3CVNA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei glyceraldehyde-3-phosphate dehydrogenase (gapdh) pts1 peptide
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
320
structure length
300
Chain Sequence
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGEASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
molecule keywords Peroxisome targeting signal 1 receptor
total genus 119
structure length 300
sequence length 320
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvnA00
4H7YA 4U0ZA 5BW8C 3KAEA 4N5CA 3RO3A 4BT8A 1Y8MA 4YVOA 2R5SA 3HYMB 3Q15A 4GYWA 3VTXA 2OOEA 3GZ2A 2HYZA 5CHEE 3UQ3A 4NRHB 1TJCA 3QKYA 1ZBPA 4EQFA 4KXKB 4H7XA 4N3CA 5FJYA 2PZIA 4N3AA 5FZRA 3RKVA 5KJMA 4G2VA 4J8EA 3TG4A 3U4TA 5FZSA 3QDNA 4YNDA 4BTAA 4Y6CA 3ZPJA 3IEGA 4N3BA 3TAXA 2XCCA 1HH8A 4JA7A 4I2WA 2XEVA 2KC7A 1QQEA 2L6JA 2IFUA 2P58C 4U04A 1IYGA 2WPVA 5LCWJ 4JA9A 1KLXA 2HR2A 1NZNA 1HXIA 1QZ2A 3QWPA 3ASGA 3S7BA 5D0QD 3JYSA 4WNFA 1IHGA 4GZ3A 4NQ0A 5EKQD 5G04J 4A1SA 3AS4A 2XGSA 3S7JA 2Y4TA 4I17A 4XIFA 3N71A 3QWVA 2JLBA 2Q7FA 2VGXB 2FEZA 2FO7A 2KCKA 4UQXA 4UI9C 3ZFWA 2C0MA 2I6HA 1KT0A 3OXGA 4U07A 5JJ6A 3CKCA 5HI7A 4CDRA 5KJLA 3MKRA 3PE4A 2WQHA 3NF1A 4I9EA 3MEKA 3TGOA 2DBAA 3FWVA 1ZU2A 3MV3B 2BUGA 3BEEA 4KBQA 1YA0A 4G23A 2UWJG 4J0UA 5C1DA 3LKUA 3U3WA 4HOTA 2FI7A 3RO2A 4XI0A 3PE3A 5BT1A 2HO1A 3Q47B 2FBNA 4I1AA 4U0SA 5M72A 5FZQA 2YHCA 4IN3B 4HOQA 4AY5A 2VYIA 5EX0A 2UY1A 3Q5MA 4G1TA 5JJ7A 2Y4UA 4RG6A 2E2EA 3GYZA 4U0UA 4WUYA 5G05J 2VSYA 3CK7A 3O48A 5ARFA 5CCLA 2VGYA 1B89A 4WNDA 2LNIA 5A6CA 3RJVA 4ABNA 2KATA 2VGXA 4GPKA 5HQ8A 1E96B 4ME2A 3VTYA 4HOSA 3QWWA 4HOUA 3RIBA 3S7DA 4BT9A 4AM9A 2PQRA 3LY9A 4HORA 3AS8A 1OUVA 2PL2A 3GZ1A 4GYOA 3ZHEB 2IF4A 3OXLA 3S7FA 4B94A 2C0LA 3MA5A 2GW1A 3CVNA 4J8DA 4KYOB 3EDTB 4GCNA 2YQ8A 3CK9A 4UQYA 4W9RA 4Y6WA 5A7DB 4J8FA 4UI9J 1WAO1 4JHRA 4O6FA 4BTBA 5KJKA 3ASDA 3CVPA 1A17A 2J9QA 3ESKA 5FT9A 3GW4A 4BWRA 3MV2B 4WNGA 2MHKA 4N2SA 2UY1B 4YVQC 5G04C 3RU0A 1FCHA 5ARGA 3Q49B 3TG5A 3ZN3A 3KD7A 3K9IA 1ELRA 3ZHEA 3LY8A 3FFLA 2XPIA 3ASHA 4G26A 3Q4AB 1XNFA 4GA2A 4GCOA 1PC2A 3ASFA 3CVQA 3PDNA 4UI9K 2FF4A 1KT1A 4GA1A 4I2ZA 4WNEA 3R9AB 1HZ4A 2AVPA 4LEUA 5AYWD 1P5QA 4AIFA 5LCWC 5BNWA 4G24A 3CVLA 3OXFA 2NC9A 3CK8A 2XGMA 1NA0A 2ONDA 3QOUA 2KCLA 4APOA 4N39A 4N2QA 4GA0A 2LSUA 3E4BA 3AS5A 3LY7A 3UPVA 4GYYA 4GZ5A 2XGOA 4JL0A 2LSVA 2VSNA 4XI9A 4GZ6A 2C2LA 2KCVA 3FP3A 3ZGQA 3URZA 4I9CA 3SF4A 4CGVA 4F3VA 3WXXA 3CEQA 3KS2A 4G25A 5EX3A 3UUXA 5DBKA 3SZ7A 5KJNA 4RG9A 1ELWA 5CCMA 5JJTA 4AY6A 2PQNA 5D0OD 5G05C 5DIZA 1W3BA 1WM5A 3LPZA 5FTPA 3CV0A 2V5FA 2QFCA 1NA3A 2VQ2A 4UQZA 3LYAA 4CGWA 3LCAA 2XCBA 3CKBA 3ULQA
chains in the Genus database with same CATH superfamily
1NFIE 2R2LA 1BI8B 2P9IG 2RG8A 3UX4A 4F1PA 4BERA 4Y6CA 2EILE 4N3BA 3RRUA 3UINC 3DSWA 5J90A 1IYGA 3PEUB 1E8ZA 3EIQC 5FQ8A 4A1SA 5JA4D 2Q7FA 4ANUA 4ILHB 2GRLA 2J4BA 3NOCD 4OVUA 2WQHA 1OY3D 4GTPA 4URKA 3ENEA 3VLDA 3TWQA 2FI7A 3MZLB 2GRQB 5BXOA 3ZXPA 4PS7A 3T9KA 5KWDA 2VGYA 4F6RD 2GGFA 2X6KA 1OUVA 4B94A 4OAUC 2X3MA 2KXPC 3NBNB 3C3QA 3PVLA 4UWFA 4UI9K 1PC2A 1SA5A 4DJAA 3ZYQA 3CVWA 3OXFA 3ASOE 2IQCA 1JCSA 3ABLE 3FH8A 1AP7A 4N39A 1H6PA 3D9KA 1Y6IA 3LVRE 1K1BA 3CIAA 3PZ2A 4I9CA 3SF4A 1UJKA 2XS8A 2PQNA 4K5CA 1WM5A 4CGWA 3FEXA 2X6JA 4TXQA 4ILIA 3L16A 4XEIG 3RKVA 2KM4A 5FZSA 5E76A 2HM8A 1H19A 3D9NA 2RFAA 5ENTD 3L54A 3D9JA 4GZCA 4FLBA 4U07A 5FQ4A 1MJ0A 3NF1A 3KSLA 1BU9A 3E30A 3FWVA 5B1BE 4B0ZA 4G23A 4G8KA 4JXTA 4K5AB 3TWXA 4L7TA 3CHSA 3CQCB 2WXLA 3ZNGA 4D10C 4WNDA 5FQ6A 3BG1B 2KATA 2ETCA 2ZISA 4TUUA 3RIBA 3LY9A 1UN9A 4ANWA 1H0AA 2C0LA 4L9PA 2BF0X 1MQSA 1OCOE 2R02A 5FT9A 4JC8A 5G04C 3ZRHA 3SGHA 3ZN3A 3K9IA 2GRMA 3ASHA 1XNFA 1G3NB 1IHBA 1MYOA 3R9AB 3TWVA 3QC1A 2PM7A 3HXBA 2HE0A 2VSXE 3E4BA 3QB2A 5EDSA 1HX8A 2IONA 2VSNA 2MYOA 4XI9A 3ZKJA 2KZTA 5G05C 1IKND 3LEWA 3LCAA 4BSZB 3ISMC 3ULQA 2AXVA 3V31A 3UI2A 4HQDA 3NQPA 2WXFA 3Q15A 4UWHA 3TWSA 2EIJE 4N3AA 2WXQA 2IJGX 2H6IA 4TV3A 4U04A 2I2OA 3CHQA 4OAVB 1DCQA 4E6HA 2WMOA 2WMNA 1Z3XA 4E85A 4RSYA 2FEZA 4UQXA 1S70B 2RKKA 3CVXA 2WXMA 4L1BA 4IYPA 1TNUA 4J0UA 3RO2A 4IRUA 2R59A 3SQVA 2EIKE 3SD5A 4G1TA 2VSYA 5KNGA 2LO6A 2YNQA 3CQGB 4A63B 1N94A 3TXNA 2GW1A 1KZOA 2X38A 4TXRA 3FUMA 3FH7A 2J9QA 3SBSA 3AJIA 4U8HA 1FCHA 2DZNA 1PY1A 4A1GA 3FFLA 2R05A 4LEUA 3HIZA 4BFRA 3CSTA 3UPVA 5LX8A 2KCVA 3EU9A 4EZLA 4UWLA 4U96D 5FTPA 1H2VC 2V5FA 2XPZA 1NA3A 3VTYA 1RZ4A 1NL4A 3RO3A 5BV1A 2KBXA 4WWOA 4NRHB 2ZU6B 2BTDA 2GRRB 3CVVA 2B0OE 4PDXA 1NZNA 3DBSA 2VJ8A 3FUNA 3QWPA 1Z6TA 3JYSA 2WXOA 4JPSA 4NQ0A 1OWPA 2JLBA 4Q69A 4UUCA 3SBTB 3ZYKA 3ZYLA 5AARA 4LCTA 4RVBA 5LP0A 5C1DA 4AP2A 3ZW3A 4C0EA 4HOQA 2PNNA 3Q5MA 4B8CB 5CERB 1E96B 4J8YA 4HOSA 2H6FA 3PUKA 4BT9A 4AM9A 5AQBA 2WQ6A 1WY6A 4GCNA 4L23A 4Y6WA 2F8XK 4CZ2D 3B7SA 1A5EA 1D8EA 3DXMG 3MV2B 3PNLB 3RU0A 3KD7A 1INZA 3Q4AB 3CVQA 5LCWC 3C98A 1NI1A 2NC9A 3FU6A 4GAAA 4JL0A 1HU3A 1FT1A 3QAQA 1N4SA 3WXXA 2WXPA 1OWNA 5KJNA 4F7AA 3LPZA 3DSSA 4BT8A 3VTXA 2PM6A 2OOEA 3TJPA 1SZ9A 3QKYA 4CRWA 3HVEA 1EF1C 4YDWA 1SW6A 3TAXA 2CG3A 2L6JA 1KLXA 5JMND 2OEWA 3Q7FA 5FQ7A 1HF8A 2JEKA 5CMWA 3NZUA 5JJ6A 1FT2A 3D9HA 3U3WA 3LKUA 1GW6A 3RK6A 5BT1A 1YYHA 3G2WA 4IN3B 1TNZA 5JJ7A 5AENA 3C3RA 3MGBA 3AS8A 3B7UX 2V5QC 4B93B 5ENRD 2V0PA 5KNHD 4GMRA 4K5BA 3PUJA 3GW4A 2UY1B 4LERA 3ZYMA 4G26A 3PDNA 5AJLA 1E8YA 2J09A 1FVFA 1P5QA 5C2YA 1H6OA 4JZYA 4G24A 2ONDA 3UIOC 4DX7D 3Q73A 3URZA 3UUXA 2J4DA 1W3BA 1Q2ZA 1Z5SC 4F53A 4N5CA 4BSXA 4DI3A 4DK5A 1S64A 3LJNA 3UQ3A 4EQFA 4J8EA 3U4TA 4HFGA 3ZPJA 3IEGA 4GTMA 4KMOA 2KC7A 3E34A 3R7RA 3KEZA 3FTXA 1IHGA 4GZDA 5T8IA 3RRNB 1SA4A 2I6HA 4EZKA 3AG4E 3APCA 4FA6A 2FULA 4I6GA 2WM9A 2EQXA 4CYMD 4U0SA 1KPSB 2DIWA 3DPYA 5ENSD 5G05J 3O48A 3DPDA 5BUZA 2F8YA 4ABNA 2VGXA 4DPRA 4J8SA 4HRLA 4KZ0A 2LXMA 2PQRA 2AXZA 3S7FA 2IY0C 3MKQA 2LAIA 5A7DB 3CVYA 1JCQA 1WAO1 3DSXA 4YDOA 4YVQC 2QC9A 3MJWA 3HXEA 1ELRA 3ZHEA 3ASFA 4FJYA 4PS8A 3FTSA 3AU4A 5D2MC 5D66A 3CK8A 4TRQA 2WXHA 3LY7A 2H6GA 3PZ4A 1S63A 3ZGQA 4F3VA 3CEQA 4LNGA 5DBKA 5D0OD 3APFA 4RLYA 3CHRA 4NURA 5AIJA 1OWOA 1TN8A 2R5SA 1KZPA 1ZBPA 2M63A 5E75A 3O4ZA 1U3CA 3D9OA 4DX1A 3LXUX 2IFUA 2NXPA 1OCRE 2GRPB 4N2QA 1E8XA 4A55A 2Y0BG 2VGXB 4XKBA 3S2AA 2H6HA 3L9TA 3TGOA 2DBAA 2I1KA 3BEEA 1BD8A 4FP7A 3CLJA 1MX6A 4U8YD 3ASNE 4DLOA 3TL5A 1HG5A 3NOGD 1LD7A 2ILRA 3W9FA 1AWCB 2ZGGA 3RSEG 1N9AA 3J5PA 2P9NG 4MLPA 2P9UG 3EHRA 4FU3A 1EDUA 1TR4A 4BX8A 3IBEA 4A3VA 3CVPA 4JHJA 3Q7AA 1TJFA 1OWMA 5B1AE 3TG5A 3Q49B 5ANLA 3EJNA 1IXVA 1V54E 3ZEFA 1SQMA 3FTUA 5BNWA 1QYMA 5EILA 2AW6A 4GZ6A 2OVFA 2QZAA 1JPLA 3QNKA 2LXLA 3AG3E 4B89A 3FDHA 4MS6A 3HVEB 2XCBA 3CGHA 2P9KG 2L6BA 2WVIA 4YVOA 3R9MA 2HYZA 5H7PA 2RFMA 4KXKB 3E32A 3QDNA 2MRIA 5FINA 4Z68A 2XRZA 4C0MA 1UJJA 4HRNA 2DZOA 3PREA 4JA9A 3EHQA 1QZ2A 2VTBA 3ZUVB 3IHYA 4XX5A 3FH5A 5KJLA 2NYJA 3D9LA 4FHKA 3G2TA 3SI5A 5EYLA 2XZTG 1MHQA 5M72A 5FZQA 4AY5A 1UOHA 4J6IA 3B7RL 2XZDG 3UMVA 2P9PG 4WAFA 4YDYA 3RJVA 1YCSB 5HQ8A 2GROB 5EYPF 1MZCA 2OV8A 3CHOA 1NP7A 2DVWA 2Y69E 4W9RA 4ZFHA 2J08A 3ESKA 2DWZA 3NB2A 4GU5A 5KCMA 3C72A 2VGEA 2FF4A 2YHEA 3CHMA 4EZJA 4AIFA 5T4YA 4GTRA 4FC8A 5LOZA 2LSUA 3Q78A 4R7LA 4GYYA 2XGOA 1O1RA 5HKPA 4HLEA 2VQ2A 3IKOB 4XZ4A 2CHZA 3HYMB 3ZXSA 4TUMA 4GTSA 1TJCA 4EBAG 2WB2A 4G2VA 5G2NA 2WXRA 1O1SA 1FPPA 4BESA 4JW1A 2WXIA 4HB5A 4APFA 4B8AA 3G2UA 4A3TA 1D8DA 4WNFA 1TNYA 5ANRA 4ILGA 3FHEA 2CHXA 1Z3YA 3UT7A 4FHJA 5CBNA 3PNTB 3PE4A 1DVPA 3HG0D 4KBQA 1YA0A 3T8MA 1TN6A 2FBNA 2RD0A 3IV0A 4O1OA 4RG6A 4M3OA 1B89A 2LNIA 4AVXA 4GPKA 4HVBA 1OCZE 4ME2A 3D9MA 2R17C 3ZHEB 1IQUA 3E33A 5AAOA 4J8DA 3FUFA 4DLQA 3I4GA 3L08A 3C3OA 1BI7B 4NIKA 4BETA 2QY7A 5ARGA 3DSVA 4PUCA 4GZ5A 4LSZE 4BY6A 1KT1A 3SFYA 2AVPA 1HE8A 3CVLA 2IOLA 3X2QE 4AJWA 3QARA 4GA0A 3DSTA 3V30A 2YINA 4O1PA 4EHMA 1ELWA 1E7VA 1JCRA 1TNOA 5JJTA 1DNPA 4PS3A 1N52A 3UIPC 3J5QB 3B13A 2CG2A 4N3CA 3SFXA 4WWNA 3ESLA 3EU5A 1E7UA 2P2CP 2JABA 4O60A 5EIDA 1TN7A 3ZVVA 5KBAA 2XEVA 3E37A 2P58C 5G04J 3ULEG 2XS1A 2XGSA 3AS4A 4HI8A 3ZFWA 1KT0A 4I9EA 3ABKE 3V79K 3MV3B 4HBDA 1O5MA 1U2VG 4NACA 4U0UA 1N54A 5ARFA 5CMYA 4WWPA 1LTXA 4JEHA 1K8KG 1XGWA 5T3RA 4ACKA 5CEAA 3UT8A 3UXGA 2VSOE 2P9LG 5A23A 5KJKA 4GTOA 4BWRA 2MHKA 1H2UA 3PS6A 2DYRE 3NAWA 3WG7E 4GB9A 1YMPA 1HZ4A 2GRNB 4JHKA 4RQIA 1HG2A 1VDYA 3TXMA 4C48B 3FULA 4G25A 1N11A 2XEHA 2EIME 3ML9A 4HRMB 1ZB1A 5CECB 3I4RB 4UWGA 2OEVA 3UM0A 4LUNU 3B7TA 3CHPA 1JUQA 3FY4A 2IEJA 2I9CA 3RRMB 5KJMA 4FULA 3JXJA 1K3ZD 4GTTA 1HH8A 2WXGA 2FO1E 1X81A 2DCPA 4PH4B 5LCWJ 3S7JA 1OT8A 2A5EA 2FO7A 4AOFA 4GMJA 4DRXE 3U66A 2V4HC 4I6JA 5AQAA 4FJZA 2YHCA 3D9IA 5EX0A 4I1OB 3FUKA 2E2EA 4WUYA 3CK7A 3EHNA 2V4LA 2ETBA 4HOUA 4GTVA 4HORA 3GZSA 4XKCA 4GYOA 4GMLA 2AWIA 2WXKA 3CK9A 3DEPA 4J8FA 4JHRA 3G2SA 3FTWA 2WXJA 3Q75A 2IOSA 4WNGA 4GTQA 2X6IA 3LY8A 2XPIA 3UM2A 4WNEA 4L2YA 5AYWD 3SFZA 2IU1A 4G8LA 3FUDA 3L17A 1LD8A 3LS8A 5DIZA 3LYAA 3DRAA 3SHFA 3D9PA 5BW8C 1PAQA 4I43A 2DYSE 3GZ2A 3IHVA 4U95D 1HS6A 2ZIRA 3CSFA 1WDYA 3MX3A 3Q79A 3NZSA 4I2WA 3HDXA 2MOWA 2WPVA 4Q94A 5D0QD 5EKQD 3D3MA 3N71A 2Y3AA 4HNAD 4FLHA 5ENQD 2C0MA 3P2BA 2IO3C 1V55E 3FU5A 1ELKA 1N0QA 2VTBB 2I1JA 3PE3A 4QFVA 2J49A 3UKUG 2P9SG 3MKQB 2ETAA 5IY5E 3BU8A 4U63A 1SVXA 3B7BA 4EPZA 5AN8A 5BXUA 2BKGA 3CVNA 3DSUA 3ASDA 2XQ0A 1EPUA 4G11A 5CEDB 4DX5D 3FTYA 5CRVA 1H2TC 5ENPD 3FUJA 3UTMA 3L6AA 3CVUA 2LSVA 2XRYA 1EYHA 2XEEA 2EINE 2C2LA 3B95A 5CRUA 2WXNA 3P1UA 1FVHA 3KS2A 5CCMA 1H6KA 3HXCA 4ACLA 4L2LA 3UM1A 1WG0A 2AXUA 1Y8MA 3FTZA 3QK0A 4DX2A 2KZTB 3L82A 5ITZF 3HRAA 1DCEA 2PZIA 2XENA 1IQRA 3CR3A 4XE0A 5J08A 4ANXA 3HHMA 2E0IA 1U3DA 5FWQA 3RAUA 4CDMA 1N0RA 1JWFA 1BLXB 4CT0A 1JWGA 3JXIA 2Y1LE 4HOTA 1N4PA 3FEYA 4I1AA 4CEMA 3T5XA 3Q9NC 1HO8A 3TWWA 2Y4UA 2WQ7A 3FUIA 3EIJA 1TNBA 5HRYA 4KZCA 3ML8A 2OCCE 3Q9UC 3S7DA 2CFUA 3GZ1A 2L0IA 3OXLA 2B6CA 2YQ8A 1D9SA 4KT6B 5EIBE 4F1SA 5EN5D 4CT4A 4GA1A 4C9BB 3UKRG 1NA0A 2BEDA 4APOA 3BG0B 3AS5A 4LRZA 3FU3A 3FP3A 3HXFA 5B3SE 5LFAA 4ATZD 3I3NA 4AY6A 2XPYA 4EBAA 3KAEA 3PEVB 4KVOA 1N4RA 2XHEA 4DI4A 4I6EA 1N4QA 4K03A 3ULYA 2ZXWE 1TYQG 3ZIMA 3KEAA 2XCCA 4JA7A 4U8VD 3C5RA 3T5VA 2NSZA 4QQIA 1HXIA 4GZ3A 2J8SD 1TEZA 2Y4TA 4I17A 2V8SE 4IULA 3OXGA 4FADA 5HI7A 3DEOA 2ZGDA 5ENOD 4ZHBA 5FIOA 2BUGA 3U64A 3W9GA 2UWJG 3JUEA 4XI0A 3PZ1A 4Q96A 5HS0A 3FU0A 3VLEA 4HLLA 1HFAA 1O1TA 3R7QA 3GYZA 5A6CA 4U7EB 4TXPA 3JUIA 4DUIA 1E8WA 4UQYA 4UI9J 2AJAA 1UG3A 2LAHA 1A17A 3EUVA 1QNFA 4OVVA 4GA2A 4OYSA 1OWLA 4I2ZA 2LUHA 3AG1E 5AQ9A 4MRUA 1OCCE 3OAWA 4CDNA 4KVMA 4HS2A 4X8QA 2A4ZA 2R03A 3MYVA 2IO2C 3FTVA 4JB8P 1RW2A 4H7YA 3TWRA 3L13A 4H7XA 1UW4B 4LNUD 1K1AA 5ENNA 4BTAA 3UT4A 3L22A 3SNXA 2F0YA 3VLFA 1QQEA 2OVBA 3ABME 1MX2A 3PH0C 1QBQA 4JD2G 2KCKA 4CDRA 4LG6A 3CKCA 3DWLG 3G2VA 3MKRA 3OTNA 3MEKA 1ZU2A 5AJDA 1X5BA 2BKKB 3I5PA 3TWUA 3LVQE 3FUEA 3ZU7B 2VYIA 2A5UA 3BQOA 2X6FA 3IXEA 3AAAC 5CCLA 3SY2A 1LF8A 4M7CA 4N5QA 3KSQA 2PL2A 4ATGA 2IF4A 4KYOB 4BX9A 3EHMA 3EDTB 4O6FA 3U9WA 1OXJA 4I1MA 3JQ0A 5CHEE 3V2XA 5FJYA 4HI9A 3TWTA 3QOUA 1MX4A 3ONKA 1BPOA 4HXIA 3DXKG 3LDZA 1DC2A 2J07A 3AG2E 3CV0A 2X6HA 3CKBA 5AQ7A 4U0ZA 3AU5A 4AV7A 1N95A 4LNBA 3JCKC 3UM3A 4GYWA 4J7WA 1E90A 4K0RA 2L0TB 3T8KA 5FZRA 3TG4A 5JHAA 2CHWA 4YNDA 3F6QA 3PRZA 1L5JA 4MKTA 2HR2A 3APDA 3S7BA 3ASGA 3BUAA 2CFZA 4XIFA 3QWVA 4JVSA 3QJZA 4CCAA 4UI9C 5G55A 3LJ3A 4GPMA 2QYJA 2HO1A 3Q47B 4V3IA 4YDEA 2UY1A 3HXDA 4UWKA 3QWWA 4AXHA 4EECA 5JHBA 1S0PA 3MA5A 4BTBA 4BEPA 2QYUA 3SO8A 5CBOA 5BV0A 3JQ1A 4GCOA 4N2SA 2L9BA 2F37A 4DX6D 2XGMA 3ONLA 4P29A 2KCLA 4JEUA 3PZDA 3V2OA 3PZ3A 3FUHA 4ANVA 4AEZC 4CGVA 1SZAA 4MBGA 3MCXA 5EX3A 3SZ7A 4RG9A 1UN8A 2QFCA 4UQZA 5BPPA
chains in the Genus database with same CATH topology
4BT8A 2AXUA 1Y8MA 2CHZA 3HYMB 3ZXSA 3FTZA 3QK0A 2PM6A 2OOEA 2RG8A 3TJPA 2KZTB 3UX4A 3VTXA 1SZ9A 1TJCA 3QKYA 4EBAG 4CRWA 2PZIA 2WB2A 4G2VA 5G2NA 2WXRA 3HVEA 4Y6CA 1EF1C 1IQRA 4N3BA 3TAXA 4JW1A 2WXIA 3RRUA 2CG3A 2L6JA 3CR3A 5J90A 4APFA 1IYGA 3PEUB 4B8AA 1KLXA 3G2UA 1E8ZA 3EIQC 4XE0A 4A3TA 5J08A 5FQ7A 1HF8A 4ANXA 3HHMA 4WNFA 5FQ8A 4A1SA 2E0IA 1U3DA 2JEKA 5ANRA 4ILGA 3FHEA 5CMWA 2Q7FA 3NZUA 4ANUA 2CHXA 1Z3YA 3UT7A 4FHJA 4ILHB 5FWQA 4CDMA 5JJ6A 2GRLA 2J4BA 3PNTB 3PE4A 2WQHA 4OVUA 1DVPA 1JWFA 4KBQA 4URKA 3U3WA 1YA0A 3ENEA 3T8MA 3VLDA 1JWGA 3LKUA 4CT0A 1GW6A 4HOTA 2FI7A 3MZLB 3RK6A 3FEYA 5BT1A 2FBNA 3G2WA 2RD0A 4I1AA 4CEMA 3T5XA 4IN3B 1HO8A 4PS7A 3IV0A 5JJ7A 2Y4UA 2WQ7A 4RG6A 5AENA 4M3OA 3FUIA 1B89A 2VGYA 3EIJA 2LNIA 4AVXA 4GPKA 4KZCA 4HVBA 3ML8A 4ME2A 3S7DA 2GGFA 3D9MA 3MGBA 2X6KA 2CFUA 3AS8A 1OUVA 2R17C 3B7UX 3GZ1A 3ZHEB 1IQUA 2L0IA 3OXLA 4B94A 2X3MA 4J8DA 3FUFA 4DLQA 3I4GA 2YQ8A 3L08A 2V0PA 3PUJA 3GW4A 4KT6B 4F1SA 2UY1B 2QY7A 3PVLA 4LERA 4UWFA 5ARGA 3ZYMA 4CT4A 4PUCA 4GZ5A 4G26A 4BY6A 4UI9K 1PC2A 3PDNA 5AJLA 1KT1A 4GA1A 4C9BB 1E8YA 2AVPA 2J09A 1FVFA 1P5QA 4DJAA 5C2YA 3ZYQA 3CVWA 1HE8A 4JZYA 4G24A 3CVLA 3OXFA 2IOLA 2IQCA 1NA0A 2ONDA 4APOA 4AJWA 3FH8A 3QARA 3BG0B 4N39A 3D9KA 4GA0A 3AS5A 1Y6IA 3LVRE 4LRZA 3CIAA 3FU3A 3FP3A 3URZA 5LFAA 4I9CA 3SF4A 2YINA 3UUXA 1UJKA 1E7VA 1ELWA 2J4DA 3I3NA 5JJTA 2PQNA 1DNPA 4AY6A 1W3BA 1WM5A 2XPYA 4CGWA 4EBAA 3FEXA 2X6JA 1N52A 4PS3A 4F53A 4ILIA 3KAEA 4N5CA 3B13A 3PEVB 4KVOA 3L16A 4BSXA 4DI3A 4DK5A 2CG2A 2XHEA 3UQ3A 4EQFA 4DI4A 4I6EA 4N3CA 4WWNA 3RKVA 2KM4A 4J8EA 3ESLA 3U4TA 1E7UA 4K03A 5E76A 5FZSA 2HM8A 4HFGA 3ZPJA 3IEGA 3ZIMA 4KMOA 2XCCA 3ZVVA 4JA7A 2XEVA 2KC7A 2P58C 2NSZA 1H19A 3D9NA 3KEZA 3R7RA 3T5VA 1HXIA 3FTXA 3L54A 3D9JA 1IHGA 4GZ3A 5G04J 4GZCA 3AS4A 2XGSA 1TEZA 2Y4TA 4GZDA 4I17A 5T8IA 2V8SE 3RRNB 4FLBA 4IULA 3ZFWA 2I6HA 1KT0A 3OXGA 4U07A 4FADA 5FQ4A 5HI7A 4EZKA 4I9EA 3APCA 3NF1A 4FA6A 4B0ZA 3FWVA 3MV3B 2BUGA 3U64A 4G23A 2UWJG 4JXTA 2FULA 4I6GA 4XI0A 2WM9A 4L7TA 4Q96A 3VLEA 2EQXA 3FU0A 4U0SA 1HFAA 3CHSA 3CQCB 2DIWA 2WXLA 4NACA 4D10C 3R7QA 3GYZA 4U0UA 5G05J 3O48A 1N54A 5ARFA 3DPDA 4WNDA 5FQ6A 5BUZA 3BG1B 5CMYA 5A6CA 4ABNA 4WWPA 2KATA 2VGXA 4DPRA 4J8SA 4JEHA 4KZ0A 1XGWA 4TUUA 3RIBA 2PQRA 5T3RA 3LY9A 4ACKA 3JUIA 1UN9A 2AXZA 3UT8A 4ANWA 1H0AA 2VSOE 2C0LA 3S7FA 1E8WA 3MKQA 5A23A 2LAIA 5A7DB 2BF0X 4UQYA 3CVYA 1MQSA 4UI9J 1WAO1 5KJKA 1UG3A 2LAHA 1A17A 5FT9A 1QNFA 4JC8A 4BWRA 2MHKA 1H2UA 4YVQC 3PS6A 5G04C 3ZRHA 3MJWA 3SGHA 3ZN3A 3K9IA 1ELRA 4OVVA 3ZHEA 2GRMA 4GA2A 3ASHA 4OYSA 1OWLA 1XNFA 4GB9A 3ASFA 4FJYA 4PS8A 3FTSA 3AU4A 4I2ZA 3R9AB 1HZ4A 3QC1A 4JHKA 2PM7A 2VSXE 3CK8A 4MRUA 4TRQA 2WXHA 1HG2A 1VDYA 3LY7A 3E4BA 3OAWA 3TXMA 3QB2A 4CDNA 1HX8A 2IONA 4KVMA 5EDSA 2VSNA 3FULA 4HS2A 4XI9A 3ZGQA 4F3VA 3CEQA 2A4ZA 4G25A 2KZTA 3MYVA 3ML9A 5DBKA 5G05C 5D0OD 3FTVA 3APFA 3I4RB 4UWGA 3LEWA 3CHRA 3LCAA 3ULQA 4LUNU 4NURA 2AXVA 5AIJA 4H7YA 1OWOA 3B7TA 3CHPA 1JUQA 2R5SA 3FY4A 3NQPA 2WXFA 3Q15A 4UWHA 2I9CA 3L13A 3RRMB 1ZBPA 2M63A 4H7XA 5E75A 4N3AA 1UW4B 3O4ZA 5KJMA 1U3CA 3D9OA 4FULA 5ENNA 2WXQA 4BTAA 3UT4A 3LXUX 3L22A 2IJGX 3SNXA 4TV3A 1HH8A 3VLFA 1QQEA 4U04A 2IFUA 2I2OA 2NXPA 2WXGA 3CHQA 2DCPA 4PH4B 5LCWJ 2OVBA 4E6HA 4N2QA 2WMOA 1E8XA 2WMNA 3S7JA 4A55A 1Z3XA 3PH0C 4E85A 2VGXB 4RSYA 2FEZA 2FO7A 2KCKA 4UQXA 4XKBA 3S2AA 4AOFA 4GMJA 3CKCA 4CDRA 3G2VA 3TGOA 3MKRA 3OTNA 3U66A 3MEKA 3CVXA 2DBAA 2WXMA 4L1BA 1ZU2A 2I1KA 3BEEA 4IYPA 5AJDA 4J0UA 4FP7A 3CLJA 1X5BA 3I5PA 3RO2A 3LVQE 4I6JA 2R59A 4IRUA 4FJZA 2YHCA 3D9IA 3FUEA 2VYIA 5EX0A 2A5UA 4G1TA 4I1OB 3SD5A 4DLOA 3FUKA 2X6FA 2E2EA 3TL5A 4WUYA 1HG5A 2VSYA 3CK7A 5CCLA 3EHNA 2V4LA 2ILRA 2LO6A 2YNQA 3CQGB 4HOUA 1LF8A 4MLPA 4HORA 3GZSA 4XKCA 2PL2A 4ATGA 4GYOA 2IF4A 4GMLA 3TXNA 2AWIA 2GW1A 4FU3A 4KYOB 4BX9A 3EHMA 3EDTB 2WXKA 1EDUA 2X38A 3CK9A 4BX8A 3IBEA 4J8FA 3FUMA 4JHRA 4O6FA 3FH7A 3CVPA 4JHJA 4A3VA 2J9QA 3U9WA 3G2SA 3SBSA 3FTWA 1TJFA 2WXJA 1OWMA 4U8HA 2IOSA 4I1MA 4WNGA 3TG5A 1FCHA 3Q49B 2X6IA 5ANLA 1PY1A 4A1GA 3JQ0A 3EJNA 3LY8A 3FFLA 2XPIA 5CHEE 5FJYA 3ZEFA 1SQMA 4WNEA 4L2YA 4LEUA 5AYWD 3FTUA 3SFZA 2IU1A 5BNWA 3HIZA 3QOUA 4BFRA 3FUDA 2AW6A 3CSTA 3L17A 3ONKA 3UPVA 5LX8A 1BPOA 4GZ6A 2OVFA 2KCVA 1JPLA 4HXIA 4EZLA 3QNKA 3LDZA 2J07A 3LS8A 4UWLA 4B89A 5DIZA 5FTPA 1H2VC 3CV0A 2V5FA 3FDHA 2XPZA 1NA3A 2X6HA 3LYAA 4MS6A 3HVEB 2XCBA 3CKBA 3CGHA 3VTYA 4U0ZA 3D9PA 5BW8C 3RO3A 3SHFA 2WVIA 5BV1A 3AU5A 4YVOA 4AV7A 1PAQA 3JCKC 4I43A 4GYWA 3GZ2A 3IHVA 2HYZA 1E90A 4K0RA 4NRHB 4WWOA 2ZU6B 2L0TB 2BTDA 4KXKB 1HS6A 5FZRA 3CSFA 3TG4A 5JHAA 2CHWA 3QDNA 4YNDA 3S7BA 2MRIA 3MX3A 3CVVA 2XRZA 4C0MA 1UJJA 3NZSA 4I2WA 3HDXA 1L5JA 2MOWA 3PRZA 3PREA 2WPVA 4JA9A 4MKTA 4PDXA 2HR2A 1NZNA 4Q94A 3APDA 1QZ2A 3DBSA 2VJ8A 2VTBA 3FUNA 3ASGA 1Z6TA 3QWPA 3JYSA 5D0QD 2WXOA 4JPSA 4NQ0A 5EKQD 3D3MA 2CFZA 1OWPA 4XIFA 3N71A 3QWVA 2JLBA 4Q69A 3IHYA 2Y3AA 4XX5A 4JVSA 4FLHA 3SBTB 3FH5A 3QJZA 3ZYKA 3ZYLA 4UI9C 4CCAA 5G55A 2C0MA 4LCTA 3LJ3A 4RVBA 5KJLA 3P2BA 3D9LA 4FHKA 5LP0A 3FU5A 1ELKA 3G2TA 5C1DA 2VTBB 2I1JA 3SI5A 3PE3A 4AP2A 2HO1A 3Q47B 1MHQA 3ZW3A 4C0EA 4V3IA 5FZQA 4QFVA 5M72A 4HOQA 2J49A 4AY5A 2UY1A 3Q5MA 3B7RL 4J6IA 3MKQB 4U63A 4B8CB 3UMVA 4WAFA 3RJVA 5HQ8A 1E96B 4UWKA 4HOSA 3PUKA 4EPZA 3QWWA 4BT9A 4AM9A 4AXHA 4EECA 2OV8A 2WQ6A 3CHOA 5JHBA 1S0PA 3MA5A 3CVNA 1WY6A 1NP7A 4GCNA 4L23A 4Y6WA 4W9RA 4BTBA 3ASDA 2XQ0A 2J08A 3ESKA 1EPUA 3B7SA 3MV2B 4G11A 3PNLB 4GU5A 5KCMA 3RU0A 5BV0A 3KD7A 3FTYA 1INZA 3JQ1A 3Q4AB 4GCOA 3CVQA 5LCWC 3C98A 4N2SA 2FF4A 2YHEA 3CHMA 4EZJA 1H2TC 2L9BA 4AIFA 3FUJA 5T4YA 3L6AA 2NC9A 2XGMA 3ONLA 4P29A 2KCLA 3FU6A 4JEUA 3PZDA 4FC8A 5LOZA 2LSUA 4R7LA 4GYYA 4GAAA 2XGOA 1HU3A 2LSVA 2XRYA 1EYHA 3FUHA 4JL0A 3CVUA 2C2LA 4ANVA 2WXNA 3P1UA 1FVHA 4AEZC 3QAQA 4CGVA 3WXXA 1SZAA 1OWNA 2WXPA 3KS2A 3MCXA 5EX3A 3SZ7A 5KJNA 4RG9A 5CCMA 4F7AA 4HLEA 3LPZA 1H6KA 4ACLA 1UN8A 2QFCA 2VQ2A 4UQZA 4L2LA 3IKOB 4XZ4A 5BPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H7Y A;  4U0Z A;  5BW8 C;  3KAE A;  4N5C A;  3RO3 A;  4BT8 A;  1Y8M A;  4YVO A;  2R5S A;  3HYM B;  3Q15 A;  4GYW A;  3VTX A;  2OOE A;  3GZ2 A;  2HYZ A;  5CHE E;  3UQ3 A;  4NRH B;  1TJC A;  3QKY A;  1ZBP A;  4EQF A;  4KXK B;  4H7X A;  4N3C A;  5FJY A;  2PZI A;  4N3A A;  5FZR A;  3RKV A;  5KJM A;  4G2V A;  4J8E A;  3TG4 A;  3U4T A;  5FZS A;  3QDN A;  4YND A;  4BTA A;  4Y6C A;  3ZPJ A;  3IEG A;  4N3B A;  3TAX A;  2XCC A;  1HH8 A;  4JA7 A;  4I2W A;  2XEV A;  2KC7 A;  1QQE A;  2L6J A;  2IFU A;  2P58 C;  4U04 A;  1IYG A;  2WPV A;  5LCW J;  4JA9 A;  1KLX A;  2HR2 A;  1NZN A;  1HXI A;  1QZ2 A;  3QWP A;  3ASG A;  3S7B A;  5D0Q D;  3JYS A;  4WNF A;  1IHG A;  4GZ3 A;  4NQ0 A;  5EKQ D;  5G04 J;  4A1S A;  3AS4 A;  2XGS A;  3S7J A;  2Y4T A;  4I17 A;  4XIF A;  3N71 A;  3QWV A;  2JLB A;  2Q7F A;  2VGX B;  2FEZ A;  2FO7 A;  2KCK A;  4UQX A;  4UI9 C;  3ZFW A;  2C0M A;  2I6H A;  1KT0 A;  3OXG A;  4U07 A;  5JJ6 A;  3CKC A;  5HI7 A;  4CDR A;  5KJL A;  3MKR A;  3PE4 A;  2WQH A;  3NF1 A;  4I9E A;  3MEK A;  3TGO A;  2DBA A;  3FWV A;  1ZU2 A;  3MV3 B;  2BUG A;  3BEE A;  4KBQ A;  1YA0 A;  4G23 A;  2UWJ G;  4J0U A;  5C1D A;  3LKU A;  3U3W A;  4HOT A;  2FI7 A;  3RO2 A;  4XI0 A;  3PE3 A;  5BT1 A;  2HO1 A;  3Q47 B;  2FBN A;  4I1A A;  4U0S A;  5M72 A;  5FZQ A;  2YHC A;  4IN3 B;  4HOQ A;  4AY5 A;  2VYI A;  5EX0 A;  2UY1 A;  3Q5M A;  4G1T A;  5JJ7 A;  2Y4U A;  4RG6 A;  2E2E A;  3GYZ A;  4U0U A;  4WUY A;  5G05 J;  2VSY A;  3CK7 A;  3O48 A;  5ARF A;  5CCL A;  2VGY A;  1B89 A;  4WND A;  2LNI A;  5A6C A;  3RJV A;  4ABN A;  2KAT A;  2VGX A;  4GPK A;  5HQ8 A;  1E96 B;  4ME2 A;  3VTY A;  4HOS A;  3QWW A;  4HOU A;  3RIB A;  3S7D A;  4BT9 A;  4AM9 A;  2PQR A;  3LY9 A;  4HOR A;  3AS8 A;  1OUV A;  2PL2 A;  3GZ1 A;  4GYO A;  3ZHE B;  2IF4 A;  3OXL A;  3S7F A;  4B94 A;  2C0L A;  3MA5 A;  2GW1 A;  3CVN A;  4J8D A;  4KYO B;  3EDT B;  4GCN A;  2YQ8 A;  3CK9 A;  4UQY A;  4W9R A;  4Y6W A;  5A7D B;  4J8F A;  4UI9 J;  1WAO 1;  4JHR A;  4O6F A;  4BTB A;  5KJK A;  3ASD A;  3CVP A;  1A17 A;  2J9Q A;  3ESK A;  5FT9 A;  3GW4 A;  4BWR A;  3MV2 B;  4WNG A;  2MHK A;  4N2S A;  2UY1 B;  4YVQ C;  5G04 C;  3RU0 A;  1FCH A;  5ARG A;  3Q49 B;  3TG5 A;  3ZN3 A;  3KD7 A;  3K9I A;  1ELR A;  3ZHE A;  3LY8 A;  3FFL A;  2XPI A;  3ASH A;  4G26 A;  3Q4A B;  1XNF A;  4GA2 A;  4GCO A;  1PC2 A;  3ASF A;  3CVQ A;  3PDN A;  4UI9 K;  2FF4 A;  1KT1 A;  4GA1 A;  4I2Z A;  4WNE A;  3R9A B;  1HZ4 A;  2AVP A;  4LEU A;  5AYW D;  1P5Q A;  4AIF A;  5LCW C;  5BNW A;  4G24 A;  3CVL A;  3OXF A;  2NC9 A;  3CK8 A;  2XGM A;  1NA0 A;  2OND A;  3QOU A;  2KCL A;  4APO A;  4N39 A;  4N2Q A;  4GA0 A;  2LSU A;  3E4B A;  3AS5 A;  3LY7 A;  3UPV A;  4GYY A;  4GZ5 A;  2XGO A;  4JL0 A;  2LSV A;  2VSN A;  4XI9 A;  4GZ6 A;  2C2L A;  2KCV A;  3FP3 A;  3ZGQ A;  3URZ A;  4I9C A;  3SF4 A;  4CGV A;  4F3V A;  3WXX A;  3CEQ A;  3KS2 A;  4G25 A;  5EX3 A;  3UUX A;  5DBK A;  3SZ7 A;  5KJN A;  4RG9 A;  1ELW A;  5CCM A;  5JJT A;  4AY6 A;  2PQN A;  5D0O D;  5G05 C;  5DIZ A;  1W3B A;  1WM5 A;  3LPZ A;  5FTP A;  3CV0 A;  2V5F A;  2QFC A;  1NA3 A;  2VQ2 A;  4UQZ A;  3LYA A;  4CGW A;  3LCA A;  2XCB A;  3CKB A;  3ULQ A; 
#chains in the Genus database with same CATH topology
 1NFI E;  2R2L A;  1BI8 B;  2P9I G;  2RG8 A;  3UX4 A;  4F1P A;  4BER A;  4Y6C A;  2EIL E;  4N3B A;  3RRU A;  3UIN C;  3DSW A;  5J90 A;  1IYG A;  3PEU B;  1E8Z A;  3EIQ C;  5FQ8 A;  4A1S A;  5JA4 D;  2Q7F A;  4ANU A;  4ILH B;  2GRL A;  2J4B A;  3NOC D;  4OVU A;  2WQH A;  1OY3 D;  4GTP A;  4URK A;  3ENE A;  3VLD A;  3TWQ A;  2FI7 A;  3MZL B;  2GRQ B;  5BXO A;  3ZXP A;  4PS7 A;  3T9K A;  5KWD A;  2VGY A;  4F6R D;  2GGF A;  2X6K A;  1OUV A;  4B94 A;  4OAU C;  2X3M A;  2KXP C;  3NBN B;  3C3Q A;  3PVL A;  4UWF A;  4UI9 K;  1PC2 A;  1SA5 A;  4DJA A;  3ZYQ A;  3CVW A;  3OXF A;  3ASO E;  2IQC A;  1JCS A;  3ABL E;  3FH8 A;  1AP7 A;  4N39 A;  1H6P A;  3D9K A;  1Y6I A;  3LVR E;  1K1B A;  3CIA A;  3PZ2 A;  4I9C A;  3SF4 A;  1UJK A;  2XS8 A;  2PQN A;  4K5C A;  1WM5 A;  4CGW A;  3FEX A;  2X6J A;  4TXQ A;  4ILI A;  3L16 A;  4XEI G;  3RKV A;  2KM4 A;  5FZS A;  5E76 A;  2HM8 A;  1H19 A;  3D9N A;  2RFA A;  5ENT D;  3L54 A;  3D9J A;  4GZC A;  4FLB A;  4U07 A;  5FQ4 A;  1MJ0 A;  3NF1 A;  3KSL A;  1BU9 A;  3E30 A;  3FWV A;  5B1B E;  4B0Z A;  4G23 A;  4G8K A;  4JXT A;  4K5A B;  3TWX A;  4L7T A;  3CHS A;  3CQC B;  2WXL A;  3ZNG A;  4D10 C;  4WND A;  5FQ6 A;  3BG1 B;  2KAT A;  2ETC A;  2ZIS A;  4TUU A;  3RIB A;  3LY9 A;  1UN9 A;  4ANW A;  1H0A A;  2C0L A;  4L9P A;  2BF0 X;  1MQS A;  1OCO E;  2R02 A;  5FT9 A;  4JC8 A;  5G04 C;  3ZRH A;  3SGH A;  3ZN3 A;  3K9I A;  2GRM A;  3ASH A;  1XNF A;  1G3N B;  1IHB A;  1MYO A;  3R9A B;  3TWV A;  3QC1 A;  2PM7 A;  3HXB A;  2HE0 A;  2VSX E;  3E4B A;  3QB2 A;  5EDS A;  1HX8 A;  2ION A;  2VSN A;  2MYO A;  4XI9 A;  3ZKJ A;  2KZT A;  5G05 C;  1IKN D;  3LEW A;  3LCA A;  4BSZ B;  3ISM C;  3ULQ A;  2AXV A;  3V31 A;  3UI2 A;  4HQD A;  3NQP A;  2WXF A;  3Q15 A;  4UWH A;  3TWS A;  2EIJ E;  4N3A A;  2WXQ A;  2IJG X;  2H6I A;  4TV3 A;  4U04 A;  2I2O A;  3CHQ A;  4OAV B;  1DCQ A;  4E6H A;  2WMO A;  2WMN A;  1Z3X A;  4E85 A;  4RSY A;  2FEZ A;  4UQX A;  1S70 B;  2RKK A;  3CVX A;  2WXM A;  4L1B A;  4IYP A;  1TNU A;  4J0U A;  3RO2 A;  4IRU A;  2R59 A;  3SQV A;  2EIK E;  3SD5 A;  4G1T A;  2VSY A;  5KNG A;  2LO6 A;  2YNQ A;  3CQG B;  4A63 B;  1N94 A;  3TXN A;  2GW1 A;  1KZO A;  2X38 A;  4TXR A;  3FUM A;  3FH7 A;  2J9Q A;  3SBS A;  3AJI A;  4U8H A;  1FCH A;  2DZN A;  1PY1 A;  4A1G A;  3FFL A;  2R05 A;  4LEU A;  3HIZ A;  4BFR A;  3CST A;  3UPV A;  5LX8 A;  2KCV A;  3EU9 A;  4EZL A;  4UWL A;  4U96 D;  5FTP A;  1H2V C;  2V5F A;  2XPZ A;  1NA3 A;  3VTY A;  1RZ4 A;  1NL4 A;  3RO3 A;  5BV1 A;  2KBX A;  4WWO A;  4NRH B;  2ZU6 B;  2BTD A;  2GRR B;  3CVV A;  2B0O E;  4PDX A;  1NZN A;  3DBS A;  2VJ8 A;  3FUN A;  3QWP A;  1Z6T A;  3JYS A;  2WXO A;  4JPS A;  4NQ0 A;  1OWP A;  2JLB A;  4Q69 A;  4UUC A;  3SBT B;  3ZYK A;  3ZYL A;  5AAR A;  4LCT A;  4RVB A;  5LP0 A;  5C1D A;  4AP2 A;  3ZW3 A;  4C0E A;  4HOQ A;  2PNN A;  3Q5M A;  4B8C B;  5CER B;  1E96 B;  4J8Y A;  4HOS A;  2H6F A;  3PUK A;  4BT9 A;  4AM9 A;  5AQB A;  2WQ6 A;  1WY6 A;  4GCN A;  4L23 A;  4Y6W A;  2F8X K;  4CZ2 D;  3B7S A;  1A5E A;  1D8E A;  3DXM G;  3MV2 B;  3PNL B;  3RU0 A;  3KD7 A;  1INZ A;  3Q4A B;  3CVQ A;  5LCW C;  3C98 A;  1NI1 A;  2NC9 A;  3FU6 A;  4GAA A;  4JL0 A;  1HU3 A;  1FT1 A;  3QAQ A;  1N4S A;  3WXX A;  2WXP A;  1OWN A;  5KJN A;  4F7A A;  3LPZ A;  3DSS A;  4BT8 A;  3VTX A;  2PM6 A;  2OOE A;  3TJP A;  1SZ9 A;  3QKY A;  4CRW A;  3HVE A;  1EF1 C;  4YDW A;  1SW6 A;  3TAX A;  2CG3 A;  2L6J A;  1KLX A;  5JMN D;  2OEW A;  3Q7F A;  5FQ7 A;  1HF8 A;  2JEK A;  5CMW A;  3NZU A;  5JJ6 A;  1FT2 A;  3D9H A;  3U3W A;  3LKU A;  1GW6 A;  3RK6 A;  5BT1 A;  1YYH A;  3G2W A;  4IN3 B;  1TNZ A;  5JJ7 A;  5AEN A;  3C3R A;  3MGB A;  3AS8 A;  3B7U X;  2V5Q C;  4B93 B;  5ENR D;  2V0P A;  5KNH D;  4GMR A;  4K5B A;  3PUJ A;  3GW4 A;  2UY1 B;  4LER A;  3ZYM A;  4G26 A;  3PDN A;  5AJL A;  1E8Y A;  2J09 A;  1FVF A;  1P5Q A;  5C2Y A;  1H6O A;  4JZY A;  4G24 A;  2OND A;  3UIO C;  4DX7 D;  3Q73 A;  3URZ A;  3UUX A;  2J4D A;  1W3B A;  1Q2Z A;  1Z5S C;  4F53 A;  4N5C A;  4BSX A;  4DI3 A;  4DK5 A;  1S64 A;  3LJN A;  3UQ3 A;  4EQF A;  4J8E A;  3U4T A;  4HFG A;  3ZPJ A;  3IEG A;  4GTM A;  4KMO A;  2KC7 A;  3E34 A;  3R7R A;  3KEZ A;  3FTX A;  1IHG A;  4GZD A;  5T8I A;  3RRN B;  1SA4 A;  2I6H A;  4EZK A;  3AG4 E;  3APC A;  4FA6 A;  2FUL A;  4I6G A;  2WM9 A;  2EQX A;  4CYM D;  4U0S A;  1KPS B;  2DIW A;  3DPY A;  5ENS D;  5G05 J;  3O48 A;  3DPD A;  5BUZ A;  2F8Y A;  4ABN A;  2VGX A;  4DPR A;  4J8S A;  4HRL A;  4KZ0 A;  2LXM A;  2PQR A;  2AXZ A;  3S7F A;  2IY0 C;  3MKQ A;  2LAI A;  5A7D B;  3CVY A;  1JCQ A;  1WAO 1;  3DSX A;  4YDO A;  4YVQ C;  2QC9 A;  3MJW A;  3HXE A;  1ELR A;  3ZHE A;  3ASF A;  4FJY A;  4PS8 A;  3FTS A;  3AU4 A;  5D2M C;  5D66 A;  3CK8 A;  4TRQ A;  2WXH A;  3LY7 A;  2H6G A;  3PZ4 A;  1S63 A;  3ZGQ A;  4F3V A;  3CEQ A;  4LNG A;  5DBK A;  5D0O D;  3APF A;  4RLY A;  3CHR A;  4NUR A;  5AIJ A;  1OWO A;  1TN8 A;  2R5S A;  1KZP A;  1ZBP A;  2M63 A;  5E75 A;  3O4Z A;  1U3C A;  3D9O A;  4DX1 A;  3LXU X;  2IFU A;  2NXP A;  1OCR E;  2GRP B;  4N2Q A;  1E8X A;  4A55 A;  2Y0B G;  2VGX B;  4XKB A;  3S2A A;  2H6H A;  3L9T A;  3TGO A;  2DBA A;  2I1K A;  3BEE A;  1BD8 A;  4FP7 A;  3CLJ A;  1MX6 A;  4U8Y D;  3ASN E;  4DLO A;  3TL5 A;  1HG5 A;  3NOG D;  1LD7 A;  2ILR A;  3W9F A;  1AWC B;  2ZGG A;  3RSE G;  1N9A A;  3J5P A;  2P9N G;  4MLP A;  2P9U G;  3EHR A;  4FU3 A;  1EDU A;  1TR4 A;  4BX8 A;  3IBE A;  4A3V A;  3CVP A;  4JHJ A;  3Q7A A;  1TJF A;  1OWM A;  5B1A E;  3TG5 A;  3Q49 B;  5ANL A;  3EJN A;  1IXV A;  1V54 E;  3ZEF A;  1SQM A;  3FTU A;  5BNW A;  1QYM A;  5EIL A;  2AW6 A;  4GZ6 A;  2OVF A;  2QZA A;  1JPL A;  3QNK A;  2LXL A;  3AG3 E;  4B89 A;  3FDH A;  4MS6 A;  3HVE B;  2XCB A;  3CGH A;  2P9K G;  2L6B A;  2WVI A;  4YVO A;  3R9M A;  2HYZ A;  5H7P A;  2RFM A;  4KXK B;  3E32 A;  3QDN A;  2MRI A;  5FIN A;  4Z68 A;  2XRZ A;  4C0M A;  1UJJ A;  4HRN A;  2DZO A;  3PRE A;  4JA9 A;  3EHQ A;  1QZ2 A;  2VTB A;  3ZUV B;  3IHY A;  4XX5 A;  3FH5 A;  5KJL A;  2NYJ A;  3D9L A;  4FHK A;  3G2T A;  3SI5 A;  5EYL A;  2XZT G;  1MHQ A;  5M72 A;  5FZQ A;  4AY5 A;  1UOH A;  4J6I A;  3B7R L;  2XZD G;  3UMV A;  2P9P G;  4WAF A;  4YDY A;  3RJV A;  1YCS B;  5HQ8 A;  2GRO B;  5EYP F;  1MZC A;  2OV8 A;  3CHO A;  1NP7 A;  2DVW A;  2Y69 E;  4W9R A;  4ZFH A;  2J08 A;  3ESK A;  2DWZ A;  3NB2 A;  4GU5 A;  5KCM A;  3C72 A;  2VGE A;  2FF4 A;  2YHE A;  3CHM A;  4EZJ A;  4AIF A;  5T4Y A;  4GTR A;  4FC8 A;  5LOZ A;  2LSU A;  3Q78 A;  4R7L A;  4GYY A;  2XGO A;  1O1R A;  5HKP A;  4HLE A;  2VQ2 A;  3IKO B;  4XZ4 A;  2CHZ A;  3HYM B;  3ZXS A;  4TUM A;  4GTS A;  1TJC A;  4EBA G;  2WB2 A;  4G2V A;  5G2N A;  2WXR A;  1O1S A;  1FPP A;  4BES A;  4JW1 A;  2WXI A;  4HB5 A;  4APF A;  4B8A A;  3G2U A;  4A3T A;  1D8D A;  4WNF A;  1TNY A;  5ANR A;  4ILG A;  3FHE A;  2CHX A;  1Z3Y A;  3UT7 A;  4FHJ A;  5CBN A;  3PNT B;  3PE4 A;  1DVP A;  3HG0 D;  4KBQ A;  1YA0 A;  3T8M A;  1TN6 A;  2FBN A;  2RD0 A;  3IV0 A;  4O1O A;  4RG6 A;  4M3O A;  1B89 A;  2LNI A;  4AVX A;  4GPK A;  4HVB A;  1OCZ E;  4ME2 A;  3D9M A;  2R17 C;  3ZHE B;  1IQU A;  3E33 A;  5AAO A;  4J8D A;  3FUF A;  4DLQ A;  3I4G A;  3L08 A;  3C3O A;  1BI7 B;  4NIK A;  4BET A;  2QY7 A;  5ARG A;  3DSV A;  4PUC A;  4GZ5 A;  4LSZ E;  4BY6 A;  1KT1 A;  3SFY A;  2AVP A;  1HE8 A;  3CVL A;  2IOL A;  3X2Q E;  4AJW A;  3QAR A;  4GA0 A;  3DST A;  3V30 A;  2YIN A;  4O1P A;  4EHM A;  1ELW A;  1E7V A;  1JCR A;  1TNO A;  5JJT A;  1DNP A;  4PS3 A;  1N52 A;  3UIP C;  3J5Q B;  3B13 A;  2CG2 A;  4N3C A;  3SFX A;  4WWN A;  3ESL A;  3EU5 A;  1E7U A;  2P2C P;  2JAB A;  4O60 A;  5EID A;  1TN7 A;  3ZVV A;  5KBA A;  2XEV A;  3E37 A;  2P58 C;  5G04 J;  3ULE G;  2XS1 A;  2XGS A;  3AS4 A;  4HI8 A;  3ZFW A;  1KT0 A;  4I9E A;  3ABK E;  3V79 K;  3MV3 B;  4HBD A;  1O5M A;  1U2V G;  4NAC A;  4U0U A;  1N54 A;  5ARF A;  5CMY A;  4WWP A;  1LTX A;  4JEH A;  1K8K G;  1XGW A;  5T3R A;  4ACK A;  5CEA A;  3UT8 A;  3UXG A;  2VSO E;  2P9L G;  5A23 A;  5KJK A;  4GTO A;  4BWR A;  2MHK A;  1H2U A;  3PS6 A;  2DYR E;  3NAW A;  3WG7 E;  4GB9 A;  1YMP A;  1HZ4 A;  2GRN B;  4JHK A;  4RQI A;  1HG2 A;  1VDY A;  3TXM A;  4C48 B;  3FUL A;  4G25 A;  1N11 A;  2XEH A;  2EIM E;  3ML9 A;  4HRM B;  1ZB1 A;  5CEC B;  3I4R B;  4UWG A;  2OEV A;  3UM0 A;  4LUN U;  3B7T A;  3CHP A;  1JUQ A;  3FY4 A;  2IEJ A;  2I9C A;  3RRM B;  5KJM A;  4FUL A;  3JXJ A;  1K3Z D;  4GTT A;  1HH8 A;  2WXG A;  2FO1 E;  1X81 A;  2DCP A;  4PH4 B;  5LCW J;  3S7J A;  1OT8 A;  2A5E A;  2FO7 A;  4AOF A;  4GMJ A;  4DRX E;  3U66 A;  2V4H C;  4I6J A;  5AQA A;  4FJZ A;  2YHC A;  3D9I A;  5EX0 A;  4I1O B;  3FUK A;  2E2E A;  4WUY A;  3CK7 A;  3EHN A;  2V4L A;  2ETB A;  4HOU A;  4GTV A;  4HOR A;  3GZS A;  4XKC A;  4GYO A;  4GML A;  2AWI A;  2WXK A;  3CK9 A;  3DEP A;  4J8F A;  4JHR A;  3G2S A;  3FTW A;  2WXJ A;  3Q75 A;  2IOS A;  4WNG A;  4GTQ A;  2X6I A;  3LY8 A;  2XPI A;  3UM2 A;  4WNE A;  4L2Y A;  5AYW D;  3SFZ A;  2IU1 A;  4G8L A;  3FUD A;  3L17 A;  1LD8 A;  3LS8 A;  5DIZ A;  3LYA A;  3DRA A;  3SHF A;  3D9P A;  5BW8 C;  1PAQ A;  4I43 A;  2DYS E;  3GZ2 A;  3IHV A;  4U95 D;  1HS6 A;  2ZIR A;  3CSF A;  1WDY A;  3MX3 A;  3Q79 A;  3NZS A;  4I2W A;  3HDX A;  2MOW A;  2WPV A;  4Q94 A;  5D0Q D;  5EKQ D;  3D3M A;  3N71 A;  2Y3A A;  4HNA D;  4FLH A;  5ENQ D;  2C0M A;  3P2B A;  2IO3 C;  1V55 E;  3FU5 A;  1ELK A;  1N0Q A;  2VTB B;  2I1J A;  3PE3 A;  4QFV A;  2J49 A;  3UKU G;  2P9S G;  3MKQ B;  2ETA A;  5IY5 E;  3BU8 A;  4U63 A;  1SVX A;  3B7B A;  4EPZ A;  5AN8 A;  5BXU A;  2BKG A;  3CVN A;  3DSU A;  3ASD A;  2XQ0 A;  1EPU A;  4G11 A;  5CED B;  4DX5 D;  3FTY A;  5CRV A;  1H2T C;  5ENP D;  3FUJ A;  3UTM A;  3L6A A;  3CVU A;  2LSV A;  2XRY A;  1EYH A;  2XEE A;  2EIN E;  2C2L A;  3B95 A;  5CRU A;  2WXN A;  3P1U A;  1FVH A;  3KS2 A;  5CCM A;  1H6K A;  3HXC A;  4ACL A;  4L2L A;  3UM1 A;  1WG0 A;  2AXU A;  1Y8M A;  3FTZ A;  3QK0 A;  4DX2 A;  2KZT B;  3L82 A;  5ITZ F;  3HRA A;  1DCE A;  2PZI A;  2XEN A;  1IQR A;  3CR3 A;  4XE0 A;  5J08 A;  4ANX A;  3HHM A;  2E0I A;  1U3D A;  5FWQ A;  3RAU A;  4CDM A;  1N0R A;  1JWF A;  1BLX B;  4CT0 A;  1JWG A;  3JXI A;  2Y1L E;  4HOT A;  1N4P A;  3FEY A;  4I1A A;  4CEM A;  3T5X A;  3Q9N C;  1HO8 A;  3TWW A;  2Y4U A;  2WQ7 A;  3FUI A;  3EIJ A;  1TNB A;  5HRY A;  4KZC A;  3ML8 A;  2OCC E;  3Q9U C;  3S7D A;  2CFU A;  3GZ1 A;  2L0I A;  3OXL A;  2B6C A;  2YQ8 A;  1D9S A;  4KT6 B;  5EIB E;  4F1S A;  5EN5 D;  4CT4 A;  4GA1 A;  4C9B B;  3UKR G;  1NA0 A;  2BED A;  4APO A;  3BG0 B;  3AS5 A;  4LRZ A;  3FU3 A;  3FP3 A;  3HXF A;  5B3S E;  5LFA A;  4ATZ D;  3I3N A;  4AY6 A;  2XPY A;  4EBA A;  3KAE A;  3PEV B;  4KVO A;  1N4R A;  2XHE A;  4DI4 A;  4I6E A;  1N4Q A;  4K03 A;  3ULY A;  2ZXW E;  1TYQ G;  3ZIM A;  3KEA A;  2XCC A;  4JA7 A;  4U8V D;  3C5R A;  3T5V A;  2NSZ A;  4QQI A;  1HXI A;  4GZ3 A;  2J8S D;  1TEZ A;  2Y4T A;  4I17 A;  2V8S E;  4IUL A;  3OXG A;  4FAD A;  5HI7 A;  3DEO A;  2ZGD A;  5ENO D;  4ZHB A;  5FIO A;  2BUG A;  3U64 A;  3W9G A;  2UWJ G;  3JUE A;  4XI0 A;  3PZ1 A;  4Q96 A;  5HS0 A;  3FU0 A;  3VLE A;  4HLL A;  1HFA A;  1O1T A;  3R7Q A;  3GYZ A;  5A6C A;  4U7E B;  4TXP A;  3JUI A;  4DUI A;  1E8W A;  4UQY A;  4UI9 J;  2AJA A;  1UG3 A;  2LAH A;  1A17 A;  3EUV A;  1QNF A;  4OVV A;  4GA2 A;  4OYS A;  1OWL A;  4I2Z A;  2LUH A;  3AG1 E;  5AQ9 A;  4MRU A;  1OCC E;  3OAW A;  4CDN A;  4KVM A;  4HS2 A;  4X8Q A;  2A4Z A;  2R03 A;  3MYV A;  2IO2 C;  3FTV A;  4JB8 P;  1RW2 A;  4H7Y A;  3TWR A;  3L13 A;  4H7X A;  1UW4 B;  4LNU D;  1K1A A;  5ENN A;  4BTA A;  3UT4 A;  3L22 A;  3SNX A;  2F0Y A;  3VLF A;  1QQE A;  2OVB A;  3ABM E;  1MX2 A;  3PH0 C;  1QBQ A;  4JD2 G;  2KCK A;  4CDR A;  4LG6 A;  3CKC A;  3DWL G;  3G2V A;  3MKR A;  3OTN A;  3MEK A;  1ZU2 A;  5AJD A;  1X5B A;  2BKK B;  3I5P A;  3TWU A;  3LVQ E;  3FUE A;  3ZU7 B;  2VYI A;  2A5U A;  3BQO A;  2X6F A;  3IXE A;  3AAA C;  5CCL A;  3SY2 A;  1LF8 A;  4M7C A;  4N5Q A;  3KSQ A;  2PL2 A;  4ATG A;  2IF4 A;  4KYO B;  4BX9 A;  3EHM A;  3EDT B;  4O6F A;  3U9W A;  1OXJ A;  4I1M A;  3JQ0 A;  5CHE E;  3V2X A;  5FJY A;  4HI9 A;  3TWT A;  3QOU A;  1MX4 A;  3ONK A;  1BPO A;  4HXI A;  3DXK G;  3LDZ A;  1DC2 A;  2J07 A;  3AG2 E;  3CV0 A;  2X6H A;  3CKB A;  5AQ7 A;  4U0Z A;  3AU5 A;  4AV7 A;  1N95 A;  4LNB A;  3JCK C;  3UM3 A;  4GYW A;  4J7W A;  1E90 A;  4K0R A;  2L0T B;  3T8K A;  5FZR A;  3TG4 A;  5JHA A;  2CHW A;  4YND A;  3F6Q A;  3PRZ A;  1L5J A;  4MKT A;  2HR2 A;  3APD A;  3S7B A;  3ASG A;  3BUA A;  2CFZ A;  4XIF A;  3QWV A;  4JVS A;  3QJZ A;  4CCA A;  4UI9 C;  5G55 A;  3LJ3 A;  4GPM A;  2QYJ A;  2HO1 A;  3Q47 B;  4V3I A;  4YDE A;  2UY1 A;  3HXD A;  4UWK A;  3QWW A;  4AXH A;  4EEC A;  5JHB A;  1S0P A;  3MA5 A;  4BTB A;  4BEP A;  2QYU A;  3SO8 A;  5CBO A;  5BV0 A;  3JQ1 A;  4GCO A;  4N2S A;  2L9B A;  2F37 A;  4DX6 D;  2XGM A;  3ONL A;  4P29 A;  2KCL A;  4JEU A;  3PZD A;  3V2O A;  3PZ3 A;  3FUH A;  4ANV A;  4AEZ C;  4CGV A;  1SZA A;  4MBG A;  3MCX A;  5EX3 A;  3SZ7 A;  4RG9 A;  1UN8 A;  2QFC A;  4UQZ A;  5BPP A; 
#chains in the Genus database with same CATH homology
 4BT8 A;  2AXU A;  1Y8M A;  2CHZ A;  3HYM B;  3ZXS A;  3FTZ A;  3QK0 A;  2PM6 A;  2OOE A;  2RG8 A;  3TJP A;  2KZT B;  3UX4 A;  3VTX A;  1SZ9 A;  1TJC A;  3QKY A;  4EBA G;  4CRW A;  2PZI A;  2WB2 A;  4G2V A;  5G2N A;  2WXR A;  3HVE A;  4Y6C A;  1EF1 C;  1IQR A;  4N3B A;  3TAX A;  4JW1 A;  2WXI A;  3RRU A;  2CG3 A;  2L6J A;  3CR3 A;  5J90 A;  4APF A;  1IYG A;  3PEU B;  4B8A A;  1KLX A;  3G2U A;  1E8Z A;  3EIQ C;  4XE0 A;  4A3T A;  5J08 A;  5FQ7 A;  1HF8 A;  4ANX A;  3HHM A;  4WNF A;  5FQ8 A;  4A1S A;  2E0I A;  1U3D A;  2JEK A;  5ANR A;  4ILG A;  3FHE A;  5CMW A;  2Q7F A;  3NZU A;  4ANU A;  2CHX A;  1Z3Y A;  3UT7 A;  4FHJ A;  4ILH B;  5FWQ A;  4CDM A;  5JJ6 A;  2GRL A;  2J4B A;  3PNT B;  3PE4 A;  2WQH A;  4OVU A;  1DVP A;  1JWF A;  4KBQ A;  4URK A;  3U3W A;  1YA0 A;  3ENE A;  3T8M A;  3VLD A;  1JWG A;  3LKU A;  4CT0 A;  1GW6 A;  4HOT A;  2FI7 A;  3MZL B;  3RK6 A;  3FEY A;  5BT1 A;  2FBN A;  3G2W A;  2RD0 A;  4I1A A;  4CEM A;  3T5X A;  4IN3 B;  1HO8 A;  4PS7 A;  3IV0 A;  5JJ7 A;  2Y4U A;  2WQ7 A;  4RG6 A;  5AEN A;  4M3O A;  3FUI A;  1B89 A;  2VGY A;  3EIJ A;  2LNI A;  4AVX A;  4GPK A;  4KZC A;  4HVB A;  3ML8 A;  4ME2 A;  3S7D A;  2GGF A;  3D9M A;  3MGB A;  2X6K A;  2CFU A;  3AS8 A;  1OUV A;  2R17 C;  3B7U X;  3GZ1 A;  3ZHE B;  1IQU A;  2L0I A;  3OXL A;  4B94 A;  2X3M A;  4J8D A;  3FUF A;  4DLQ A;  3I4G A;  2YQ8 A;  3L08 A;  2V0P A;  3PUJ A;  3GW4 A;  4KT6 B;  4F1S A;  2UY1 B;  2QY7 A;  3PVL A;  4LER A;  4UWF A;  5ARG A;  3ZYM A;  4CT4 A;  4PUC A;  4GZ5 A;  4G26 A;  4BY6 A;  4UI9 K;  1PC2 A;  3PDN A;  5AJL A;  1KT1 A;  4GA1 A;  4C9B B;  1E8Y A;  2AVP A;  2J09 A;  1FVF A;  1P5Q A;  4DJA A;  5C2Y A;  3ZYQ A;  3CVW A;  1HE8 A;  4JZY A;  4G24 A;  3CVL A;  3OXF A;  2IOL A;  2IQC A;  1NA0 A;  2OND A;  4APO A;  4AJW A;  3FH8 A;  3QAR A;  3BG0 B;  4N39 A;  3D9K A;  4GA0 A;  3AS5 A;  1Y6I A;  3LVR E;  4LRZ A;  3CIA A;  3FU3 A;  3FP3 A;  3URZ A;  5LFA A;  4I9C A;  3SF4 A;  2YIN A;  3UUX A;  1UJK A;  1E7V A;  1ELW A;  2J4D A;  3I3N A;  5JJT A;  2PQN A;  1DNP A;  4AY6 A;  1W3B A;  1WM5 A;  2XPY A;  4CGW A;  4EBA A;  3FEX A;  2X6J A;  1N52 A;  4PS3 A;  4F53 A;  4ILI A;  3KAE A;  4N5C A;  3B13 A;  3PEV B;  4KVO A;  3L16 A;  4BSX A;  4DI3 A;  4DK5 A;  2CG2 A;  2XHE A;  3UQ3 A;  4EQF A;  4DI4 A;  4I6E A;  4N3C A;  4WWN A;  3RKV A;  2KM4 A;  4J8E A;  3ESL A;  3U4T A;  1E7U A;  4K03 A;  5E76 A;  5FZS A;  2HM8 A;  4HFG A;  3ZPJ A;  3IEG A;  3ZIM A;  4KMO A;  2XCC A;  3ZVV A;  4JA7 A;  2XEV A;  2KC7 A;  2P58 C;  2NSZ A;  1H19 A;  3D9N A;  3KEZ A;  3R7R A;  3T5V A;  1HXI A;  3FTX A;  3L54 A;  3D9J A;  1IHG A;  4GZ3 A;  5G04 J;  4GZC A;  3AS4 A;  2XGS A;  1TEZ A;  2Y4T A;  4GZD A;  4I17 A;  5T8I A;  2V8S E;  3RRN B;  4FLB A;  4IUL A;  3ZFW A;  2I6H A;  1KT0 A;  3OXG A;  4U07 A;  4FAD A;  5FQ4 A;  5HI7 A;  4EZK A;  4I9E A;  3APC A;  3NF1 A;  4FA6 A;  4B0Z A;  3FWV A;  3MV3 B;  2BUG A;  3U64 A;  4G23 A;  2UWJ G;  4JXT A;  2FUL A;  4I6G A;  4XI0 A;  2WM9 A;  4L7T A;  4Q96 A;  3VLE A;  2EQX A;  3FU0 A;  4U0S A;  1HFA A;  3CHS A;  3CQC B;  2DIW A;  2WXL A;  4NAC A;  4D10 C;  3R7Q A;  3GYZ A;  4U0U A;  5G05 J;  3O48 A;  1N54 A;  5ARF A;  3DPD A;  4WND A;  5FQ6 A;  5BUZ A;  3BG1 B;  5CMY A;  5A6C A;  4ABN A;  4WWP A;  2KAT A;  2VGX A;  4DPR A;  4J8S A;  4JEH A;  4KZ0 A;  1XGW A;  4TUU A;  3RIB A;  2PQR A;  5T3R A;  3LY9 A;  4ACK A;  3JUI A;  1UN9 A;  2AXZ A;  3UT8 A;  4ANW A;  1H0A A;  2VSO E;  2C0L A;  3S7F A;  1E8W A;  3MKQ A;  5A23 A;  2LAI A;  5A7D B;  2BF0 X;  4UQY A;  3CVY A;  1MQS A;  4UI9 J;  1WAO 1;  5KJK A;  1UG3 A;  2LAH A;  1A17 A;  5FT9 A;  1QNF A;  4JC8 A;  4BWR A;  2MHK A;  1H2U A;  4YVQ C;  3PS6 A;  5G04 C;  3ZRH A;  3MJW A;  3SGH A;  3ZN3 A;  3K9I A;  1ELR A;  4OVV A;  3ZHE A;  2GRM A;  4GA2 A;  3ASH A;  4OYS A;  1OWL A;  1XNF A;  4GB9 A;  3ASF A;  4FJY A;  4PS8 A;  3FTS A;  3AU4 A;  4I2Z A;  3R9A B;  1HZ4 A;  3QC1 A;  4JHK A;  2PM7 A;  2VSX E;  3CK8 A;  4MRU A;  4TRQ A;  2WXH A;  1HG2 A;  1VDY A;  3LY7 A;  3E4B A;  3OAW A;  3TXM A;  3QB2 A;  4CDN A;  1HX8 A;  2ION A;  4KVM A;  5EDS A;  2VSN A;  3FUL A;  4HS2 A;  4XI9 A;  3ZGQ A;  4F3V A;  3CEQ A;  2A4Z A;  4G25 A;  2KZT A;  3MYV A;  3ML9 A;  5DBK A;  5G05 C;  5D0O D;  3FTV A;  3APF A;  3I4R B;  4UWG A;  3LEW A;  3CHR A;  3LCA A;  3ULQ A;  4LUN U;  4NUR A;  2AXV A;  5AIJ A;  4H7Y A;  1OWO A;  3B7T A;  3CHP A;  1JUQ A;  2R5S A;  3FY4 A;  3NQP A;  2WXF A;  3Q15 A;  4UWH A;  2I9C A;  3L13 A;  3RRM B;  1ZBP A;  2M63 A;  4H7X A;  5E75 A;  4N3A A;  1UW4 B;  3O4Z A;  5KJM A;  1U3C A;  3D9O A;  4FUL A;  5ENN A;  2WXQ A;  4BTA A;  3UT4 A;  3LXU X;  3L22 A;  2IJG X;  3SNX A;  4TV3 A;  1HH8 A;  3VLF A;  1QQE A;  4U04 A;  2IFU A;  2I2O A;  2NXP A;  2WXG A;  3CHQ A;  2DCP A;  4PH4 B;  5LCW J;  2OVB A;  4E6H A;  4N2Q A;  2WMO A;  1E8X A;  2WMN A;  3S7J A;  4A55 A;  1Z3X A;  3PH0 C;  4E85 A;  2VGX B;  4RSY A;  2FEZ A;  2FO7 A;  2KCK A;  4UQX A;  4XKB A;  3S2A A;  4AOF A;  4GMJ A;  3CKC A;  4CDR A;  3G2V A;  3TGO A;  3MKR A;  3OTN A;  3U66 A;  3MEK A;  3CVX A;  2DBA A;  2WXM A;  4L1B A;  1ZU2 A;  2I1K A;  3BEE A;  4IYP A;  5AJD A;  4J0U A;  4FP7 A;  3CLJ A;  1X5B A;  3I5P A;  3RO2 A;  3LVQ E;  4I6J A;  2R59 A;  4IRU A;  4FJZ A;  2YHC A;  3D9I A;  3FUE A;  2VYI A;  5EX0 A;  2A5U A;  4G1T A;  4I1O B;  3SD5 A;  4DLO A;  3FUK A;  2X6F A;  2E2E A;  3TL5 A;  4WUY A;  1HG5 A;  2VSY A;  3CK7 A;  5CCL A;  3EHN A;  2V4L A;  2ILR A;  2LO6 A;  2YNQ A;  3CQG B;  4HOU A;  1LF8 A;  4MLP A;  4HOR A;  3GZS A;  4XKC A;  2PL2 A;  4ATG A;  4GYO A;  2IF4 A;  4GML A;  3TXN A;  2AWI A;  2GW1 A;  4FU3 A;  4KYO B;  4BX9 A;  3EHM A;  3EDT B;  2WXK A;  1EDU A;  2X38 A;  3CK9 A;  4BX8 A;  3IBE A;  4J8F A;  3FUM A;  4JHR A;  4O6F A;  3FH7 A;  3CVP A;  4JHJ A;  4A3V A;  2J9Q A;  3U9W A;  3G2S A;  3SBS A;  3FTW A;  1TJF A;  2WXJ A;  1OWM A;  4U8H A;  2IOS A;  4I1M A;  4WNG A;  3TG5 A;  1FCH A;  3Q49 B;  2X6I A;  5ANL A;  1PY1 A;  4A1G A;  3JQ0 A;  3EJN A;  3LY8 A;  3FFL A;  2XPI A;  5CHE E;  5FJY A;  3ZEF A;  1SQM A;  4WNE A;  4L2Y A;  4LEU A;  5AYW D;  3FTU A;  3SFZ A;  2IU1 A;  5BNW A;  3HIZ A;  3QOU A;  4BFR A;  3FUD A;  2AW6 A;  3CST A;  3L17 A;  3ONK A;  3UPV A;  5LX8 A;  1BPO A;  4GZ6 A;  2OVF A;  2KCV A;  1JPL A;  4HXI A;  4EZL A;  3QNK A;  3LDZ A;  2J07 A;  3LS8 A;  4UWL A;  4B89 A;  5DIZ A;  5FTP A;  1H2V C;  3CV0 A;  2V5F A;  3FDH A;  2XPZ A;  1NA3 A;  2X6H A;  3LYA A;  4MS6 A;  3HVE B;  2XCB A;  3CKB A;  3CGH A;  3VTY A;  4U0Z A;  3D9P A;  5BW8 C;  3RO3 A;  3SHF A;  2WVI A;  5BV1 A;  3AU5 A;  4YVO A;  4AV7 A;  1PAQ A;  3JCK C;  4I43 A;  4GYW A;  3GZ2 A;  3IHV A;  2HYZ A;  1E90 A;  4K0R A;  4NRH B;  4WWO A;  2ZU6 B;  2L0T B;  2BTD A;  4KXK B;  1HS6 A;  5FZR A;  3CSF A;  3TG4 A;  5JHA A;  2CHW A;  3QDN A;  4YND A;  3S7B A;  2MRI A;  3MX3 A;  3CVV A;  2XRZ A;  4C0M A;  1UJJ A;  3NZS A;  4I2W A;  3HDX A;  1L5J A;  2MOW A;  3PRZ A;  3PRE A;  2WPV A;  4JA9 A;  4MKT A;  4PDX A;  2HR2 A;  1NZN A;  4Q94 A;  3APD A;  1QZ2 A;  3DBS A;  2VJ8 A;  2VTB A;  3FUN A;  3ASG A;  1Z6T A;  3QWP A;  3JYS A;  5D0Q D;  2WXO A;  4JPS A;  4NQ0 A;  5EKQ D;  3D3M A;  2CFZ A;  1OWP A;  4XIF A;  3N71 A;  3QWV A;  2JLB A;  4Q69 A;  3IHY A;  2Y3A A;  4XX5 A;  4JVS A;  4FLH A;  3SBT B;  3FH5 A;  3QJZ A;  3ZYK A;  3ZYL A;  4UI9 C;  4CCA A;  5G55 A;  2C0M A;  4LCT A;  3LJ3 A;  4RVB A;  5KJL A;  3P2B A;  3D9L A;  4FHK A;  5LP0 A;  3FU5 A;  1ELK A;  3G2T A;  5C1D A;  2VTB B;  2I1J A;  3SI5 A;  3PE3 A;  4AP2 A;  2HO1 A;  3Q47 B;  1MHQ A;  3ZW3 A;  4C0E A;  4V3I A;  5FZQ A;  4QFV A;  5M72 A;  4HOQ A;  2J49 A;  4AY5 A;  2UY1 A;  3Q5M A;  3B7R L;  4J6I A;  3MKQ B;  4U63 A;  4B8C B;  3UMV A;  4WAF A;  3RJV A;  5HQ8 A;  1E96 B;  4UWK A;  4HOS A;  3PUK A;  4EPZ A;  3QWW A;  4BT9 A;  4AM9 A;  4AXH A;  4EEC A;  2OV8 A;  2WQ6 A;  3CHO A;  5JHB A;  1S0P A;  3MA5 A;  3CVN A;  1WY6 A;  1NP7 A;  4GCN A;  4L23 A;  4Y6W A;  4W9R A;  4BTB A;  3ASD A;  2XQ0 A;  2J08 A;  3ESK A;  1EPU A;  3B7S A;  3MV2 B;  4G11 A;  3PNL B;  4GU5 A;  5KCM A;  3RU0 A;  5BV0 A;  3KD7 A;  3FTY A;  1INZ A;  3JQ1 A;  3Q4A B;  4GCO A;  3CVQ A;  5LCW C;  3C98 A;  4N2S A;  2FF4 A;  2YHE A;  3CHM A;  4EZJ A;  1H2T C;  2L9B A;  4AIF A;  3FUJ A;  5T4Y A;  3L6A A;  2NC9 A;  2XGM A;  3ONL A;  4P29 A;  2KCL A;  3FU6 A;  4JEU A;  3PZD A;  4FC8 A;  5LOZ A;  2LSU A;  4R7L A;  4GYY A;  4GAA A;  2XGO A;  1HU3 A;  2LSV A;  2XRY A;  1EYH A;  3FUH A;  4JL0 A;  3CVU A;  2C2L A;  4ANV A;  2WXN A;  3P1U A;  1FVH A;  4AEZ C;  3QAQ A;  4CGV A;  3WXX A;  1SZA A;  1OWN A;  2WXP A;  3KS2 A;  3MCX A;  5EX3 A;  3SZ7 A;  5KJN A;  4RG9 A;  5CCM A;  4F7A A;  4HLE A;  3LPZ A;  1H6K A;  4ACL A;  1UN8 A;  2QFC A;  2VQ2 A;  4UQZ A;  4L2L A;  3IKO B;  4XZ4 A;  5BPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...