3CVNA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei glyceraldehyde-3-phosphate dehydrogenase (gapdh) pts1 peptide
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
320
structure length
300
Chain Sequence
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGEASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisome targeting signal 1 receptor
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
total genus 119
structure length 300
sequence length 320
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvnA00
4WNEA 5AYWD 1WAO1 5EX0A 1QZ2A 2WQHA 4GYOA 3CKCA 4KYOB 3RU0A 3VTXA 3CV0A 2JLBA 2UWJG 1IYGA 4WNFA 5BW8C 1FCHA 5HI7A 3PDNA 4XI9A 3Q49B 3FFLA 3OXGA 1HXIA 3ZPJA 5HQ8A 4GYYA 3CVLA 3CVQA 4UI9K 2VGXA 4A1SA 4XI0A 3RJVA 5FJYA 3JYSA 4ME2A 1TJCA 3CVPA 4G23A 5G04J 1HH8A 3NF1A 5JJ7A 1ZU2A 3LKUA 4N2QA 2XPIA 1Y8MA 1IHGA 5BNWA 4U07A 4NRHB 2FEZA 1ZBPA 3E4BA 4GCNA 1KT1A 3GW4A 4WNGA 1ELWA 3MKRA 5D0OD 5KJNA 3RKVA 3QWPA 3LCAA 5JJTA 3KAEA 3TG4A 1OUVA 4CGWA 1NA3A 4N3BA 1KLXA 2KCKA 5FZRA 2LNIA 2UY1B 2HYZA 3IEGA 3GYZA 4GA2A 1W3BA 3FWVA 3CK8A 4GCOA 3ZHEA 3QWVA 4GYWA 5G05C 2LSVA 2P58C 2C0MA 3ZFWA 1ELRA 4JL0A 4I2ZA 2OOEA 1A17A 3S7FA 3ASDA 3LY8A 4AY5A 3VTYA 4EQFA 5D0QD 2XCBA 3RO2A 4UI9J 2I6HA 3GZ2A 5G05J 2E2EA 5G04C 5JJ6A 4GZ6A 3AS8A 2KCLA 3S7JA 3MA5A 2IFUA 4BWRA 3BEEA 4HOQA 3CKBA 3LY7A 2VGXB 3FP3A 3ASHA 4U0ZA 5KJKA 3OXLA 2L6JA 3S7DA 3U4TA 5BT1A 5A6CA 4BTBA 5CHEE 2XCCA 2XGOA 4BTAA 2VSYA 4U04A 4BT8A 4J8DA 2IF4A 3CVNA 2ONDA 4HOSA 4ABNA 3ASGA 3GZ1A 4G2VA 3MEKA 2XGMA 2Y4TA 3KD7A 4BT9A 4AY6A 4J8EA 4H7YA 4CGVA 4G24A 3RIBA 4JA7A 5DBKA 4W9RA 4XIFA 4G1TA 2BUGA 3ZHEB 4Y6WA 4J0UA 3ESKA 3ASFA 2GW1A 3QDNA 4I17A 5ARGA 4KXKB 1NZNA 3Q47B 3ULQA 4Y6CA 2YQ8A 3PE4A 3SF4A 5EX3A 3CK9A 3CK7A 4UI9C 3LY9A 4HORA 1B89A 1KT0A 3QWWA 3ZN3A 3HYMB 3ZGQA 5LCWJ 2WPVA 2KC7A 4UQZA 3UUXA 2FF4A 3SZ7A 3LPZA 2J9QA 4YNDA 2PL2A 3QOUA 1PC2A 5KJLA 4I1AA 2NC9A 2C0LA 2HO1A 3QKYA 3Q4AB 4F3VA 4JHRA 1NA0A 1XNFA 5CCMA 2PQRA 4I9CA 4YVOA 4U0SA 3TG5A 3AS5A 2PZIA 3O48A 4CDRA 2XEVA 5M72A 4WUYA 5A7DB 4N39A 3WXXA 3UQ3A 3EDTB 4HOTA 2Q7FA 4RG6A 2Y4UA 2VQ2A 5FZQA 4GA0A 4WNDA 5FTPA 2R5SA 4G26A 3MV2B 2C2LA 5C1DA 2KCVA 2XGSA 2KATA 2FBNA 1P5QA 4NQ0A 3N71A 2QFCA 4N2SA 2MHKA 4JA9A 1E96B 2HR2A 2VGYA 4UQYA 2FI7A 3PE3A 3Q5MA 1QQEA 3K9IA 3R9AB 3AS4A 4APOA 4HOUA 4RG9A 2LSUA 5LCWC 4GZ3A 2PQNA 3S7BA 3LYAA 3Q15A 1WM5A 3CEQA 5FT9A 4N5CA 4IN3B 4GPKA 4N3CA 5ARFA 5EKQD 2YHCA 1HZ4A 2FO7A 3U3WA 2DBAA 4UQXA 4G25A 4J8FA 3UPVA 2V5FA 3URZA 5FZSA 5CCLA 3OXFA 2VSNA 4KBQA 4U0UA 4AM9A 2UY1A 3TAXA 4I9EA 4AIFA 4LEUA 3MV3B 2AVPA 4GZ5A 3TGOA 3KS2A 4I2WA 4O6FA 4H7XA 5KJMA 5DIZA 4GA1A 4YVQC 1YA0A 3RO3A 4B94A 4N3AA 2VYIA
chains in the Genus database with same CATH superfamily
1H2UA 5CERB 3KEZA 3ZXPA 5AYWD 2XEHA 3ZYMA 4GPMA 3HG0D 2WQHA 4GYOA 4KYOB 2WXMA 5FQ6A 1QBQA 2JLBA 4FJYA 5CRVA 3ISMC 1OXJA 4N5QA 3NAWA 5BW8C 5AQAA 4XI9A 3E32A 2L6BA 4OAUC 2OEVA 1HXIA 4GYYA 5BV1A 2WXQA 2VGXA 2WXRA 5ENQD 4HI8A 1QNFA 3RJVA 5AARA 4LNGA 3B13A 5JJ7A 2VTBA 2KBXA 3APCA 4CYMD 1DNPA 4CT0A 4M7CA 5CBOA 2OEWA 5D2MC 4A3TA 1KT1A 4BFRA 4G8LA 1N4RA 3RKVA 1UJJA 3HVEB 3QWPA 3ZRHA 4RQIA 3F6QA 1XGWA 1HO8A 1NA3A 3CQCB 1SZ9A 3DSWA 4GTRA 4IRUA 2J49A 2HYZA 3CR3A 4ATGA 4CDMA 1OCRE 3CK8A 3AG4E 4GYWA 2QYJA 2ETAA 2R02A 3ASNE 3MGBA 1SQMA 1MYOA 2C0MA 1ELRA 4HI9A 1MX2A 4I2ZA 3PUJA 1BD8A 4GZCA 2P9KG 3LY8A 4CZ2D 3DSTA 4AY5A 4X8QA 2WQ7A 1D9SA 1HF8A 4CRWA 3D9OA 1Q2ZA 1INZA 3GZ2A 3BU8A 2E2EA 1HFAA 5G04C 4F7AA 1FT2A 5J08A 2YHEA 4BWRA 2WMOA 4HOQA 2ETCA 3LY7A 3AJIA 4M3OA 4U0ZA 5KJKA 2IO3C 5LP0A 3NZSA 4AJWA 1VDYA 5EYLA 2DYSE 4PS8A 2XGOA 4BTAA 3J5PA 1BU9A 5AJDA 2KZTB 4G11A 2P9PG 4HOSA 4CT4A 3CLJA 3ASGA 3W9FA 2WM9A 3EHNA 5AQ9A 3MEKA 4XKCA 3CHMA 2CG2A 4BT9A 2ZGGA 4J8EA 3DSSA 3PVLA 3D9MA 1Z5SC 1O1RA 4GB9A 4I17A 3UKUG 4JZYA 2WXHA 1OT8A 3SO8A 3LDZA 5JMND 4ZHBA 1DVPA 1LD7A 1G3NB 3CK9A 3CK7A 4UI9C 3SFXA 4YDOA 3QWWA 2A5UA 4GMJA 2XRYA 1K1AA 4BSXA 4FLHA 3TWQA 3AG1E 3UUXA 3ASOE 4OAVB 3DBSA 1S64A 2IY0C 4YNDA 5CRUA 4IYPA 4GMLA 1YCSB 3Q9NC 4HLLA 2HO1A 4ATZD 3ZKJA 4C9BB 4JHRA 1HG2A 1FPPA 3DXKG 5CCMA 4I9CA 4TXRA 3HXEA 2PZIA 3O48A 1BPOA 3C3QA 4EZKA 5AN8A 5M72A 4WUYA 5A7DB 3T9KA 1S63A 3BG0B 3UQ3A 3DPDA 1WY6A 3EDTB 3PRZA 4HOTA 3PS6A 2GRLA 4K5CA 2L9BA 3CQGB 4JEUA 1N0RA 4DX6D 4DX1A 4GTSA 2R5SA 2YINA 3HDXA 2WXFA 3MV2B 3NB2A 5C1DA 2KCVA 1MHQA 4URKA 4EBAA 1LD8A 3JXJA 5JHBA 3Q78A 5CMWA 2IU1A 5EIBE 2QFCA 4N2SA 1YYHA 2VGYA 2PM7A 3PE3A 2WXNA 3K9IA 3D3MA 3ZYKA 4APOA 3GZSA 5EDSA 4I6GA 4GMRA 1UN9A 3E37A 2B0OE 2PQNA 2X6HA 3EJNA 1EF1C 3UINC 3D9IA 2XENA 3CEQA 3V30A 4JVSA 3NBNB 5ARFA 2ZU6B 3HXDA 2IQCA 2FULA 3FU5A 3BG1B 4MLPA 4A3VA 5CECB 3PZDA 2DBAA 5EYPF 3J5QB 5AJLA 4AXHA 3IBEA 5ENPD 4PH4B 1TYQG 2VSNA 1OCCE 3QNKA 2AXVA 4U0UA 2X3MA 3TAXA 4U95D 2AW6A 4AIFA 3FUHA 2WQ6A 4HRMB 4GU5A 3TWTA 3FEXA 2GRPB 3FY4A 1OWMA 2AVPA 4GZ5A 3TGOA 3KS2A 3C5RA 3DEPA 3FUNA 2GRRB 4EPZA 1OCZE 3HXFA 4J0UA 4FA6A 4WNEA 4CEMA 1WAO1 3HXBA 1QZ2A 3CKCA 3EIJA 5BXOA 4GTPA 3RU0A 2XZDG 2WXGA 3W9GA 3G2TA 5HRYA 5ENNA 4HLEA 4WNFA 2R03A 3D9JA 4I1MA 2WMNA 5LX8A 5HI7A 4HVBA 2OVFA 5ENSD 4A55A 1MX4A 3Q49B 2GRNB 3TWVA 3SQVA 4L2YA 4BSZB 4OYSA 2VGEA 4UI9K 2FO1E 4EZJA 3CVPA 3ZW3A 3NF1A 5E76A 3CVWA 3LKUA 3ZIMA 5FWQA 3BUAA 2LXLA 1Y8MA 1IHGA 5ANRA 2JABA 3UT8A 3E4BA 3T5VA 3FHEA 4WNGA 4YDYA 2KZTA 1BI8B 1ELWA 3MKRA 4E6HA 5JJTA 5EILA 3C72A 3KAEA 1IXVA 3TG4A 4CGWA 4N3BA 4DRXE 3CHPA 2EQXA 4BX8A 1MJ0A 3GYZA 3SFZA 2J09A 2H6IA 1L5JA 4PS7A 3KEAA 1N0QA 4I6EA 1KZOA 3QWVA 1E7UA 2I9CA 3MJWA 3ZUVB 4Z68A 3PREA 5FQ8A 3UIPC 4FC8A 3DXMG 2LSVA 4ILHB 3ZFWA 4JL0A 4K5BA 4V3IA 3ONLA 3S7FA 3APFA 1UN8A 1X5BA 3ASDA 3LEWA 5HKPA 4I1OB 1SZAA 3TWUA 4TRQA 1Z3YA 4EQFA 3FEYA 4HS2A 5D0QD 1V54E 2CG3A 3UT7A 2VJ8A 1H2VC 4L23A 3TL5A 3EHMA 1U2VG 1N9AA 3UTMA 5FIOA 4GZ6A 3Q75A 2KCLA 1JPLA 2NSZA 1JCRA 2XQ0A 3FP3A 2RFAA 3OXLA 2YNQA 4KVOA 3U4TA 4WWPA 5BT1A 4Q96A 3U66A 2IONA 1UG3A 4XEIG 4BTBA 3ML8A 5CHEE 4J6IA 2VSOE 4CCAA 3FTYA 3FTZA 4HQDA 1OWOA 1TNZA 3I4RB 4U04A 3V79K 4QFVA 4J8YA 4UWLA 4G2VA 3FUDA 3QK0A 5FQ4A 2XGMA 2F0YA 2R2LA 2XHEA 4GTVA 3AAAC 3ZNGA 3PUKA 3Q73A 3MX3A 4JA7A 4XX5A 4XIFA 4G1TA 2QZAA 4Y6WA 4KVMA 1E7VA 2GW1A 2ZIRA 1NZNA 4O1OA 2DVWA 3RAUA 1FVHA 3PE4A 3SF4A 1MQSA 2IJGX 1OCOE 2LAIA 1EDUA 4BERA 5KWDA 3TJPA 1TNOA 3ULYA 4LSZE 1TN6A 3FUFA 1NFIE 3HYMB 2WVIA 4XE0A 3E34A 2KC7A 1H2TC 1TR4A 2PL2A 3QOUA 5T3RA 1PC2A 4F6RD 2NC9A 1ELKA 4FADA 1OWLA 5D66A 3LXUX 3Q4AB 1E8ZA 3APDA 4U7EB 4F3VA 3AU4A 3L17A 3UI2A 1NA0A 5ANLA 1XNFA 3PNTB 3CVVA 4U8HA 2XZTG 4PDXA 1TNUA 3AS5A 1OWNA 3L9TA 2XEVA 1JWGA 4JHJA 4APFA 4DX7D 4N39A 3WXXA 4U96D 4TUUA 2V4HC 5BPPA 2Q7FA 4ZFHA 3DRAA 2VQ2A 2HE0A 1D8EA 4GA0A 2X6KA 3HIZA 5G55A 4YDEA 2KATA 1P5QA 3FDHA 3RRMB 4JA9A 4JC8A 1E96B 2FI7A 2DWZA 1QQEA 2OCCE 3FTUA 4FHJA 3R9AB 3EU9A 3UT4A 1S0PA 4FLBA 5LCWC 4GZ3A 3SY2A 3IKOB 4R7LA 3MKQB 3LYAA 1WM5A 4N5CA 4IN3B 5T4YA 4GPKA 3PZ2A 3S2AA 3B95A 2YHCA 1HZ4A 3FULA 5J90A 2FO7A 2Y1LE 3EIQC 5JHAA 2IOSA 4G25A 4J8FA 1UJKA 2ETBA 4K03A 4RVBA 1JCQA 4L9PA 3C98A 2GRQB 4AP2A 1WDYA 4L1BA 3LVRE 5G2NA 1H19A 3NOGD 3AG2E 1SA4A 2JEKA 3I4GA 5KNHD 2QC9A 4DK5A 4GA1A 4BX9A 4A63B 4K5AB 5A23A 4N3AA 3Q9UC 2GROB 3PEUB 3UXGA 1H6OA 1E90A 4HRNA 3VTXA 2R59A 3CV0A 5KCMA 1BI7B 2L0TB 3D9NA 4OVUA 3PZ3A 3ZYLA 3PDNA 2NXPA 3Q79A 3VLDA 3FFLA 4DX5D 2BKKB 3DEOA 3JUEA 3ZPJA 1BLXB 3G2WA 3CIAA 4KZCA 3CVQA 3QC1A 4HFGA 5JA4D 4EHMA 3UMVA 4A1SA 4XI0A 4Q69A 5FJYA 1NI1A 2WXIA 4I6JA 4G23A 5G04J 1HH8A 4ACLA 4ILIA 1ZU2A 4TXPA 3FTVA 2OVBA 1KPSB 4WWOA 3CSTA 1V55E 4N2QA 2DCPA 2XPIA 1N95A 3O4ZA 3ABLE 1IHBA 3DSXA 4NRHB 3CHSA 2FEZA 1ZBPA 4B8CB 3GW4A 4DI4A 3PZ1A 4JXTA 5KJNA 3OAWA 3UX4A 3OTNA 4UWFA 3QARA 1OY3D 1OUVA 4FP7A 1KLXA 2A5EA 1E8WA 2KCKA 3HVEA 2PM6A 4FULA 4D10C 3IEGA 2F37A 4FHKA 3TWXA 2BEDA 4HB5A 4BETA 1W3BA 3G2VA 5HS0A 4HXIA 2LO6A 2P58C 2V8SE 1A17A 5H7PA 5KBAA 3JQ1A 2IOLA 3VTYA 2XCBA 2HM8A 3FU0A 2P9SG 4JD2G 4P29A 4WAFA 4G8KA 4UWGA 4UI9J 2WB2A 1E8XA 3Q7FA 5G05J 2EIJE 4F53A 3DSVA 1X81A 5JJ6A 5LFAA 4KMOA 3MZLB 4FU3A 2IFUA 3BEEA 3CKBA 2DIWA 4XKBA 1O1TA 3ASHA 1H6PA 1N4QA 3LS8A 2L6JA 3G2SA 4U8VD 2AWIA 3D9PA 1TNBA 4ANUA 3CHOA 2VSYA 2X6FA 4BT8A 2J08A 1EPUA 1UW4B 2ONDA 3PZ4A 4BESA 3LJ3A 4O60A 3T8MA 4WWNA 2MYOA 3EHQA 2PNNA 4B93B 5CBNA 1NP7A 4H7YA 3IV0A 3D9HA 2J4DA 3RIBA 2Y69E 5DBKA 2KXPC 4W9RA 2BUGA 4MBGA 3ZHEB 3ASFA 4GZDA 3QDNA 4ANVA 5ARGA 4A1GA 4KXKB 1TN7A 1AWCB 5AIJA 2P9NG 5EX3A 4LUNU 4AEZC 4GTMA 3LY9A 4JHKA 3TXMA 4RLYA 2H6FA 2H6GA 1D8DA 4UQZA 1HE8A 1GW6A 4OVVA 2FF4A 3P1UA 4L7TA 3RK6A 3SZ7A 2J9QA 3ZXSA 1K1BA 3SHFA 5KJLA 4U63A 4UWHA 3PH0C 1U3CA 2RD0A 2X6JA 2V0PA 4AV7A 3HXCA 1KZPA 4JPSA 2WXLA 3DWLG 3L54A 1TNYA 2AJAA 2PQRA 4LG6A 3QB2A 4U0SA 3TG5A 3L13A 2DZOA 3KSLA 4DX2A 2LUHA 2X38A 2XEEA 4C0EA 2RKKA 1HG5A 1LF8A 3T8KA 3E30A 3VLEA 4B8AA 2EILE 2EIME 2ZISA 3MYVA 5FZQA 4WNDA 2ILRA 4G26A 2J07A 2C2LA 2VSXE 3N71A 4LNBA 2MHKA 2HR2A 4AVXA 3B7SA 2DZNA 2GRMA 2MOWA 1N52A 4RG9A 3FUIA 1Z6TA 4AOFA 3Q15A 2A4ZA 4N3CA 3L22A 4TV3A 5CEAA 2XPYA 2NYJA 3TWWA 2R17C 3L08A 4JB8P 4PS3A 2QY7A 3RSEG 2CFUA 4MRUA 3PEVB 4XZ4A 4DLOA 4UQXA 1TEZA 3UIOC 5FZSA 5CEDB 2BF0X 5CCLA 4HBDA 4AM9A 2WXJA 4QQIA 4I9EA 2J8SD 1K8KG 3I5PA 4ANWA 4LCTA 4NACA 5KJMA 3VLFA 3CSFA 3ML9A 3V2OA 3UKRG 4DI3A 2WXPA 1K3ZD 4RSYA 3ZYQA 1HU3A 3IHVA 3JXIA 2RG8A 1RW2A 5LOZA 5EX0A 4LRZA 3NOCD 3DPYA 3V31A 2UWJG 1H0AA 3AU5A 4NURA 1IYGA 2I1JA 2R05A 1FCHA 5B1AE 2OV8A 1MZCA 3FTWA 2I2OA 3FTSA 3X2QE 3L16A 1IQRA 3OXGA 4EBAG 1O1SA 1N94A 5HQ8A 3CVLA 2EINE 4K0RA 3D9KA 3CGHA 3I3NA 1H6KA 1U3DA 3SBSA 3ULEG 3ZU7B 3JYSA 1MX6A 4ME2A 1TJCA 5BXUA 1SVXA 1N4SA 1TJFA 1WG0A 4BEPA 3EUVA 5BNWA 4U07A 5ENTD 1O5MA 4GCNA 5B3SE 3SBTB 2XPZA 3U64A 3V2XA 4F1SA 1SW6A 1LTXA 5D0OD 1N54A 4GAAA 4L2LA 3RRUA 3LCAA 4I43A 4ACKA 3ABME 4UUCA 5AQBA 3DSUA 5ITZF 4LERA 4CDNA 2XS8A 4EECA 5KNGA 5ENRD 3CHQA 2WXKA 3R7RA 3NZUA 1FT1A 5FZRA 2LNIA 2UY1B 1IKND 4GA2A 2B6CA 3T5XA 1DCQA 3FWVA 4GCOA 3ZHEA 3IXEA 2XS1A 2X6IA 4DPRA 3UM3A 5G05C 3U9WA 2GGFA 4DLQA 1A5EA 3PNLB 2ZGDA 3SI5A 3CVXA 2OOEA 3IHYA 1IQUA 4TXQA 4GTTA 3CVYA 3RO2A 1DCEA 3FU3A 1OWPA 2I6HA 3C3RA 4DUIA 5ENOD 3FH7A 3AS8A 3S7JA 3MA5A 2DYRE 3FUKA 1SA5A 4YDWA 4B89A 1AP7A 2IO2C 5AQ7A 3P2BA 2VGXB 1S70B 3QAQA 1Z3XA 1N11A 3C3OA 3S7DA 2VTBB 5A6CA 1RZ4A 1PY1A 1UOHA 2XCCA 3LJNA 4KT6B 1HS6A 1DC2A 4U8YD 3UM1A 2M63A 4BY6A 4J8DA 2IF4A 3CVNA 4FJZA 3EHRA 2F8YA 4ABNA 3GZ1A 2P9LG 3CHRA 1EYHA 3QJZA 4ANXA 2EIKE 3FH8A 5BV0A 1N4PA 1JUQA 2Y3AA 2Y4TA 3KD7A 4B0ZA 5IY5E 4AY6A 4J7WA 4GTQA 4CGVA 4G24A 1ZB1A 4IULA 5FINA 3ESKA 4TUMA 3JUIA 3Q47B 4J8SA 2IEJA 3ULQA 3FH5A 4Y6CA 3ABKE 2YQ8A 3E33A 5CMYA 2L0IA 4HORA 1B89A 1KT0A 2Y0BG 3ZN3A 4JW1A 3ZGQA 5LCWJ 2WPVA 2LXMA 1YMPA 5FQ7A 3LPZA 4MS6A 1HX8A 4C0MA 2XRZA 3AG3E 3LVQE 3G2UA 4C48B 4I1AA 2BKGA 2RFMA 2F8XK 2C0LA 3RRNB 3QKYA 2AXUA 2MRIA 3NQPA 1QYMA 5E75A 4HNAD 2I1KA 3TXNA 4YVOA 4CDRA 4NIKA 2CHXA 3L82A 3FUMA 4RG6A 3ONKA 2Y4UA 3Q7AA 3R9MA 3B7TA 3B7RL 1NL4A 2CHZA 5FTPA 1TN8A 2LAHA 4HRLA 3SFYA 5EN5D 2ZXWE 5T8IA 2P2CP 2XGSA 2FBNA 4NQ0A 3BQOA 2V5QC 4GTOA 1FVFA 3JCKC 3MCXA 4JEHA 4UQYA 3Q5MA 3FUEA 2P9UG 3UM2A 3HRAA 3TWRA 3AS4A 1Y6IA 1JWFA 2CHWA 3SGHA 3FUJA 5B1BE 2KM4A 3R7QA 4HOUA 2LSUA 1PAQA 4LNUD 5AENA 5BUZA 4Q94A 3ESLA 3S7BA 3JQ0A 3FU6A 3KSQA 5FT9A 4KZ0A 3CVUA 3B7UX 5EKQD 2WXOA 3MKQA 3SNXA 4DJAA 3U3WA 3FTXA 3UPVA 2V5FA 4E85A 3URZA 5EIDA 3WG7E 2J4BA 2QYUA 4O1PA 5C2YA 1JCSA 3EU5A 3SD5A 3OXFA 3HHMA 2V4LA 4KBQA 3D9LA 3L6AA 2UY1A 2BTDA 2AXZA 4MKTA 2CFZA 4EZLA 3UM0A 2P9IG 4LEUA 4ILGA 3MV3B 2E0IA 4PUCA 4I2WA 3ZEFA 4O6FA 4H7XA 1E8YA 4UWKA 3ZVVA 5DIZA 3TWSA 3ENEA 4F1PA 3B7BA 5AAOA 4YVQC 1YA0A 3RO3A 2H6HA 4B94A 2VYIA
chains in the Genus database with same CATH topology
1H2UA 3IHVA 3KEZA 3ZW3A 4FA6A 4WNEA 4CEMA 5AYWD 3PEUB 3ZYMA 1WAO1 2RG8A 5LOZA 5EX0A 1E90A 1QZ2A 2WQHA 4GYOA 3CKCA 3EIJA 4KYOB 4LRZA 3RU0A 2WXMA 5FQ6A 3VTXA 2R59A 3CV0A 2JLBA 4FJYA 2UWJG 5KCMA 1H0AA 2WXGA 3AU5A 3G2TA 4NURA 1IYGA 5ENNA 4HLEA 4WNFA 2I1JA 3D9JA 5BW8C 2L0TB 4I1MA 2WMNA 3D9NA 5LX8A 1FCHA 5HI7A 4OVUA 2OV8A 3ZYLA 3PDNA 2NXPA 4XI9A 4HVBA 2OVFA 2I2OA 3FTWA 3FTSA 4A55A 3L16A 3VLDA 3Q49B 3FFLA 1IQRA 3OXGA 4EBAG 1HXIA 3ZPJA 5HQ8A 4GYYA 3CVLA 3G2WA 3CIAA 4L2YA 4OYSA 4KZCA 3CVQA 2WXQA 5BV1A 4K0RA 3QC1A 3D9KA 3CGHA 3I3NA 4HFGA 4UI9K 2VGXA 1H6KA 1U3DA 2WXRA 3SBSA 3UMVA 4A1SA 1QNFA 4XI0A 3RJVA 5FJYA 4Q69A 4EZJA 3JYSA 4ME2A 1TJCA 3CVPA 2WXIA 4I6JA 4G23A 5G04J 1HH8A 3B13A 3NF1A 4ILIA 5E76A 1ZU2A 2OVBA 3FTVA 3LKUA 4ACLA 3ZIMA 5JJ7A 1TJFA 4WWOA 3CSTA 5FWQA 4N2QA 2DCPA 3APCA 2XPIA 1DNPA 1Y8MA 3O4ZA 4CT0A 1IHGA 5BNWA 4U07A 5ANRA 4NRHB 3CHSA 2FEZA 1ZBPA 3UT8A 3E4BA 4A3TA 4GCNA 1KT1A 3FHEA 4B8CB 3SBTB 3GW4A 3T5VA 4WNGA 4DI4A 4BFRA 2XPZA 3U64A 4JXTA 2KZTA 1ELWA 3MKRA 4F1SA 5D0OD 5KJNA 4E6HA 3OAWA 3RKVA 1UJJA 3HVEB 1N54A 3OTNA 3QWPA 4GAAA 4L2LA 4UWFA 3RRUA 3LCAA 3QARA 5JJTA 4I43A 4ACKA 3ZRHA 4LERA 3KAEA 4CDNA 1XGWA 3TG4A 1OUVA 4CGWA 4FP7A 1HO8A 1NA3A 3CQCB 4N3BA 4EECA 1SZ9A 3CHQA 1KLXA 2WXKA 4IRUA 1E8WA 2KCKA 3HVEA 3R7RA 3CHPA 2EQXA 3NZUA 2PM6A 2J49A 5FZRA 2LNIA 2UY1B 4FULA 4BX8A 4D10C 2HYZA 3IEGA 3GYZA 4GA2A 3SFZA 2J09A 4FHKA 3T5XA 3CR3A 4ATGA 4CDMA 1W3BA 3G2VA 4HXIA 1L5JA 3FWVA 4PS7A 3CK8A 4GCOA 4I6EA 3ZHEA 3QWVA 4GYWA 1E7UA 2I9CA 2LO6A 3MJWA 3MGBA 3PREA 2X6IA 5FQ8A 4DPRA 4FC8A 5G05C 2LSVA 2P58C 3U9WA 1SQMA 2C0MA 2GGFA 1ELRA 4ILHB 3ZFWA 4DLQA 4JL0A 3PNLB 2V8SE 3SI5A 4V3IA 4I2ZA 3PUJA 3CVXA 3ONLA 2OOEA 4GZCA 1A17A 3S7FA 3APFA 1UN8A 1X5BA 3ASDA 3LEWA 3LY8A 4I1OB 1SZAA 4TRQA 3IHYA 4AY5A 3JQ1A 1IQUA 2IOLA 1Z3YA 3VTYA 2WQ7A 4EQFA 3FEYA 4HS2A 1HF8A 5D0QD 4CRWA 2CG3A 2XCBA 3UT7A 3D9OA 2HM8A 2VJ8A 3FU0A 1H2VC 4P29A 4WAFA 3CVYA 4L23A 3RO2A 4UWGA 4UI9J 3TL5A 2WB2A 3FU3A 1E8XA 1OWPA 2I6HA 1INZA 3GZ2A 3EHMA 5G05J 4F53A 2E2EA 1HFAA 5G04C 3FH7A 5JJ6A 4F7AA 4GZ6A 2VTBA 5LFAA 3AS8A 2KCLA 3S7JA 4KMOA 3MZLB 4FU3A 3MA5A 5J08A 2YHEA 2IFUA 4BWRA 3FUKA 3BEEA 1JPLA 2WMOA 2NSZA 4HOQA 4B89A 3CKBA 2DIWA 3LY7A 4XKBA 2XQ0A 3P2BA 2VGXB 3FP3A 4M3OA 3ASHA 3QAQA 1Z3XA 4U0ZA 5KJKA 3LS8A 2L6JA 3OXLA 3S7DA 3G2SA 2VTBB 2YNQA 4KVOA 3U4TA 2AWIA 4WWPA 5BT1A 5A6CA 5LP0A 4Q96A 3U66A 2IONA 3D9PA 1UG3A 3NZSA 4AJWA 4ANUA 4BTBA 3ML8A 1VDYA 1PY1A 5CHEE 4J6IA 2VSOE 4CCAA 2XCCA 3CHOA 4KT6B 4PS8A 3FTYA 3FTZA 1HS6A 2XGOA 4BTAA 2VSYA 2X6FA 1OWOA 2M63A 3I4RB 4U04A 4BT8A 2J08A 4BY6A 5AJDA 4J8DA 1EPUA 2IF4A 2KZTB 3CVNA 4FJZA 1UW4B 2ONDA 4G11A 4QFVA 4HOSA 4CT4A 3CLJA 4UWLA 3LJ3A 4ABNA 3ASGA 3GZ1A 4G2VA 3T8MA 2WM9A 3FUDA 3QK0A 3CHRA 1EYHA 3QJZA 4WWNA 5FQ4A 4ANXA 3EHNA 3FH8A 3MEKA 4XKCA 5BV0A 3CHMA 1JUQA 2CG2A 2XGMA 2Y4TA 2Y3AA 3KD7A 4B0ZA 4BT9A 4AY6A 4J8EA 2XHEA 1NP7A 4H7YA 4CGVA 3PVLA 3D9MA 3IV0A 3PUKA 4G24A 3RIBA 2J4DA 3MX3A 4JA7A 5DBKA 4XX5A 4W9RA 4XIFA 4IULA 4G1TA 2BUGA 3ZHEB 4Y6WA 3ESKA 4KVMA 3ASFA 1E7VA 2GW1A 4GZDA 4GB9A 3QDNA 4I17A 4ANVA 5ARGA 4JZYA 4A1GA 2WXHA 4KXKB 1NZNA 3JUIA 3LDZA 3Q47B 4J8SA 1FVHA 3ULQA 1DVPA 5AIJA 3FH5A 4Y6CA 2YQ8A 3PE4A 3SF4A 5EX3A 1MQSA 2IJGX 3CK9A 4LUNU 4AEZC 3CK7A 4UI9C 5CMYA 2L0IA 2LAIA 3LY9A 4HORA 1EDUA 1B89A 3TJPA 4JHKA 1KT0A 3QWWA 2A5UA 4GMJA 3FUFA 3TXMA 3ZN3A 2XRYA 4JW1A 3HYMB 2WVIA 3ZGQA 5LCWJ 4XE0A 4BSXA 4FLHA 2WPVA 2KC7A 4UQZA 1H2TC 1HE8A 3UUXA 1GW6A 4OVVA 2FF4A 5FQ7A 3P1UA 3DBSA 4L7TA 3RK6A 3SZ7A 3LPZA 4MS6A 1HX8A 4C0MA 2J9QA 2XRZA 4YNDA 3LVQE 3ZXSA 2PL2A 3QOUA 5T3RA 3SHFA 1PC2A 3G2UA 4I1AA 5KJLA 4U63A 2NC9A 4UWHA 1ELKA 3PH0C 4IYPA 1U3CA 4GMLA 2RD0A 2X6JA 2V0PA 2C0LA 3RRNB 2HO1A 3QKYA 4AV7A 4FADA 1OWLA 4JPSA 3LXUX 3Q4AB 1E8ZA 2AXUA 2WXLA 3APDA 2MRIA 4F3VA 4C9BB 3AU4A 3L17A 4JHRA 3L54A 3NQPA 1HG2A 1NA0A 5E75A 5ANLA 1XNFA 3PNTB 3CVVA 5CCMA 2PQRA 4U8HA 2I1KA 4I9CA 4PDXA 3QB2A 3TXNA 4YVOA 4U0SA 3TG5A 3L13A 3AS5A 2PZIA 3O48A 1BPOA 1OWNA 3UX4A 4CDRA 2XEVA 4EZKA 5M72A 2X38A 1JWGA 4WUYA 4JHJA 5A7DB 4APFA 4C0EA 4N39A 1HG5A 3WXXA 3BG0B 1LF8A 2CHXA 4TUUA 3UQ3A 3DPDA 1WY6A 3EDTB 3PRZA 3FUMA 3VLEA 5BPPA 4B8AA 2Q7FA 4HOTA 4RG6A 3ONKA 3PS6A 2Y4UA 2GRLA 2L9BA 3B7TA 3MYVA 3B7RL 3CQGB 2VQ2A 4JEUA 2CHZA 5FZQA 4GA0A 2X6KA 4WNDA 5FTPA 2ILRA 2R5SA 4G26A 2J07A 2YINA 2LAHA 3HDXA 2WXFA 3MV2B 3HIZA 2C2LA 5C1DA 2KCVA 1MHQA 2VSXE 5G55A 5T8IA 4URKA 2XGSA 4EBAA 2KATA 2FBNA 1P5QA 4NQ0A 5JHBA 5CMWA 2IU1A 3N71A 2QFCA 4N2SA 2MHKA 3FDHA 3RRMB 4JA9A 4JC8A 1E96B 2HR2A 2VGYA 2PM7A 1FVFA 3JCKC 3MCXA 4JEHA 4UQYA 2FI7A 4AVXA 3PE3A 3Q5MA 3FUEA 1QQEA 3FTUA 4FHJA 2WXNA 3B7SA 3K9IA 2GRMA 3AS4A 3D3MA 3R9AB 3ZYKA 3GZSA 1Y6IA 3UT4A 1JWFA 2CHWA 3SGHA 4APOA 2MOWA 3FUJA 5EDSA 1S0PA 2KM4A 3R7QA 1N52A 4HOUA 4RG9A 4I6GA 2LSUA 1PAQA 4FLBA 5LCWC 1UN9A 3FUIA 4GZ3A 5AENA 2PQNA 2X6HA 3IKOB 1Z6TA 4R7LA 3EJNA 1EF1C 5BUZA 3MKQB 4Q94A 4AOFA 3ESLA 3S7BA 3JQ0A 3LYAA 3Q15A 1WM5A 3D9IA 3FU6A 3CEQA 5FT9A 4JVSA 4KZ0A 4N5CA 4IN3B 5T4YA 3CVUA 2A4ZA 4GPKA 4N3CA 3L22A 4TV3A 5ARFA 3B7UX 2XPYA 5EKQD 2WXOA 2ZU6B 3S2AA 2R17C 3MKQA 2YHCA 1HZ4A 3SNXA 3FULA 4DJAA 5J90A 2IQCA 3L08A 2FO7A 2FULA 3FU5A 4PS3A 2QY7A 3BG1B 2CFUA 4MLPA 4A3VA 3U3WA 4MRUA 3PZDA 3EIQC 3FTXA 2DBAA 3PEVB 4XZ4A 4DLOA 4UQXA 5JHAA 1TEZA 5AJLA 2IOSA 4AXHA 3CVWA 4G25A 4J8FA 3UPVA 1UJKA 2V5FA 4E85A 3IBEA 3URZA 5FZSA 2BF0X 2J4BA 4K03A 5C2YA 4PH4B 4RVBA 3SD5A 5CCLA 3OXFA 2VSNA 3HHMA 2AXVA 2V4LA 3D9LA 3QNKA 3L6AA 2UY1A 4KBQA 2BTDA 4U0UA 4AM9A 3C98A 4N3AA 4AP2A 2AXZA 2X3MA 2WXJA 3TAXA 4I9EA 4MKTA 2CFZA 2AW6A 4AIFA 3FUHA 4L1BA 4EZLA 4GU5A 2WQ6A 4LEUA 3FEXA 3FY4A 3LVRE 4ILGA 1OWMA 2E0IA 3MV3B 5G2NA 2AVPA 3I5PA 4GZ5A 4PUCA 3KS2A 3TGOA 4I2WA 3ZEFA 4ANWA 1H19A 4LCTA 4H7XA 4NACA 3FUNA 4O6FA 5KJMA 1E8YA 4UWKA 3VLFA 3ZVVA 3CSFA 5DIZA 2JEKA 3ML9A 3ENEA 3I4GA 4DI3A 4DK5A 4EPZA 4GA1A 4BX9A 2WXPA 4RSYA 3ZYQA 4YVQC 1YA0A 3RO3A 1HU3A 5A23A 4B94A 4J0UA 2VYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNE A;  5AYW D;  1WAO 1;  5EX0 A;  1QZ2 A;  2WQH A;  4GYO A;  3CKC A;  4KYO B;  3RU0 A;  3VTX A;  3CV0 A;  2JLB A;  2UWJ G;  1IYG A;  4WNF A;  5BW8 C;  1FCH A;  5HI7 A;  3PDN A;  4XI9 A;  3Q49 B;  3FFL A;  3OXG A;  1HXI A;  3ZPJ A;  5HQ8 A;  4GYY A;  3CVL A;  3CVQ A;  4UI9 K;  2VGX A;  4A1S A;  4XI0 A;  3RJV A;  5FJY A;  3JYS A;  4ME2 A;  1TJC A;  3CVP A;  4G23 A;  5G04 J;  1HH8 A;  3NF1 A;  5JJ7 A;  1ZU2 A;  3LKU A;  4N2Q A;  2XPI A;  1Y8M A;  1IHG A;  5BNW A;  4U07 A;  4NRH B;  2FEZ A;  1ZBP A;  3E4B A;  4GCN A;  1KT1 A;  3GW4 A;  4WNG A;  1ELW A;  3MKR A;  5D0O D;  5KJN A;  3RKV A;  3QWP A;  3LCA A;  5JJT A;  3KAE A;  3TG4 A;  1OUV A;  4CGW A;  1NA3 A;  4N3B A;  1KLX A;  2KCK A;  5FZR A;  2LNI A;  2UY1 B;  2HYZ A;  3IEG A;  3GYZ A;  4GA2 A;  1W3B A;  3FWV A;  3CK8 A;  4GCO A;  3ZHE A;  3QWV A;  4GYW A;  5G05 C;  2LSV A;  2P58 C;  2C0M A;  3ZFW A;  1ELR A;  4JL0 A;  4I2Z A;  2OOE A;  1A17 A;  3S7F A;  3ASD A;  3LY8 A;  4AY5 A;  3VTY A;  4EQF A;  5D0Q D;  2XCB A;  3RO2 A;  4UI9 J;  2I6H A;  3GZ2 A;  5G05 J;  2E2E A;  5G04 C;  5JJ6 A;  4GZ6 A;  3AS8 A;  2KCL A;  3S7J A;  3MA5 A;  2IFU A;  4BWR A;  3BEE A;  4HOQ A;  3CKB A;  3LY7 A;  2VGX B;  3FP3 A;  3ASH A;  4U0Z A;  5KJK A;  3OXL A;  2L6J A;  3S7D A;  3U4T A;  5BT1 A;  5A6C A;  4BTB A;  5CHE E;  2XCC A;  2XGO A;  4BTA A;  2VSY A;  4U04 A;  4BT8 A;  4J8D A;  2IF4 A;  3CVN A;  2OND A;  4HOS A;  4ABN A;  3ASG A;  3GZ1 A;  4G2V A;  3MEK A;  2XGM A;  2Y4T A;  3KD7 A;  4BT9 A;  4AY6 A;  4J8E A;  4H7Y A;  4CGV A;  4G24 A;  3RIB A;  4JA7 A;  5DBK A;  4W9R A;  4XIF A;  4G1T A;  2BUG A;  3ZHE B;  4Y6W A;  4J0U A;  3ESK A;  3ASF A;  2GW1 A;  3QDN A;  4I17 A;  5ARG A;  4KXK B;  1NZN A;  3Q47 B;  3ULQ A;  4Y6C A;  2YQ8 A;  3PE4 A;  3SF4 A;  5EX3 A;  3CK9 A;  3CK7 A;  4UI9 C;  3LY9 A;  4HOR A;  1B89 A;  1KT0 A;  3QWW A;  3ZN3 A;  3HYM B;  3ZGQ A;  5LCW J;  2WPV A;  2KC7 A;  4UQZ A;  3UUX A;  2FF4 A;  3SZ7 A;  3LPZ A;  2J9Q A;  4YND A;  2PL2 A;  3QOU A;  1PC2 A;  5KJL A;  4I1A A;  2NC9 A;  2C0L A;  2HO1 A;  3QKY A;  3Q4A B;  4F3V A;  4JHR A;  1NA0 A;  1XNF A;  5CCM A;  2PQR A;  4I9C A;  4YVO A;  4U0S A;  3TG5 A;  3AS5 A;  2PZI A;  3O48 A;  4CDR A;  2XEV A;  5M72 A;  4WUY A;  5A7D B;  4N39 A;  3WXX A;  3UQ3 A;  3EDT B;  4HOT A;  2Q7F A;  4RG6 A;  2Y4U A;  2VQ2 A;  5FZQ A;  4GA0 A;  4WND A;  5FTP A;  2R5S A;  4G26 A;  3MV2 B;  2C2L A;  5C1D A;  2KCV A;  2XGS A;  2KAT A;  2FBN A;  1P5Q A;  4NQ0 A;  3N71 A;  2QFC A;  4N2S A;  2MHK A;  4JA9 A;  1E96 B;  2HR2 A;  2VGY A;  4UQY A;  2FI7 A;  3PE3 A;  3Q5M A;  1QQE A;  3K9I A;  3R9A B;  3AS4 A;  4APO A;  4HOU A;  4RG9 A;  2LSU A;  5LCW C;  4GZ3 A;  2PQN A;  3S7B A;  3LYA A;  3Q15 A;  1WM5 A;  3CEQ A;  5FT9 A;  4N5C A;  4IN3 B;  4GPK A;  4N3C A;  5ARF A;  5EKQ D;  2YHC A;  1HZ4 A;  2FO7 A;  3U3W A;  2DBA A;  4UQX A;  4G25 A;  4J8F A;  3UPV A;  2V5F A;  3URZ A;  5FZS A;  5CCL A;  3OXF A;  2VSN A;  4KBQ A;  4U0U A;  4AM9 A;  2UY1 A;  3TAX A;  4I9E A;  4AIF A;  4LEU A;  3MV3 B;  2AVP A;  4GZ5 A;  3TGO A;  3KS2 A;  4I2W A;  4O6F A;  4H7X A;  5KJM A;  5DIZ A;  4GA1 A;  4YVQ C;  1YA0 A;  3RO3 A;  4B94 A;  4N3A A;  2VYI A; 
#chains in the Genus database with same CATH topology
 1H2U A;  5CER B;  3KEZ A;  3ZXP A;  5AYW D;  2XEH A;  3ZYM A;  4GPM A;  3HG0 D;  2WQH A;  4GYO A;  4KYO B;  2WXM A;  5FQ6 A;  1QBQ A;  2JLB A;  4FJY A;  5CRV A;  3ISM C;  1OXJ A;  4N5Q A;  3NAW A;  5BW8 C;  5AQA A;  4XI9 A;  3E32 A;  2L6B A;  4OAU C;  2OEV A;  1HXI A;  4GYY A;  5BV1 A;  2WXQ A;  2VGX A;  2WXR A;  5ENQ D;  4HI8 A;  1QNF A;  3RJV A;  5AAR A;  4LNG A;  3B13 A;  5JJ7 A;  2VTB A;  2KBX A;  3APC A;  4CYM D;  1DNP A;  4CT0 A;  4M7C A;  5CBO A;  2OEW A;  5D2M C;  4A3T A;  1KT1 A;  4BFR A;  4G8L A;  1N4R A;  3RKV A;  1UJJ A;  3HVE B;  3QWP A;  3ZRH A;  4RQI A;  3F6Q A;  1XGW A;  1HO8 A;  1NA3 A;  3CQC B;  1SZ9 A;  3DSW A;  4GTR A;  4IRU A;  2J49 A;  2HYZ A;  3CR3 A;  4ATG A;  4CDM A;  1OCR E;  3CK8 A;  3AG4 E;  4GYW A;  2QYJ A;  2ETA A;  2R02 A;  3ASN E;  3MGB A;  1SQM A;  1MYO A;  2C0M A;  1ELR A;  4HI9 A;  1MX2 A;  4I2Z A;  3PUJ A;  1BD8 A;  4GZC A;  2P9K G;  3LY8 A;  4CZ2 D;  3DST A;  4AY5 A;  4X8Q A;  2WQ7 A;  1D9S A;  1HF8 A;  4CRW A;  3D9O A;  1Q2Z A;  1INZ A;  3GZ2 A;  3BU8 A;  2E2E A;  1HFA A;  5G04 C;  4F7A A;  1FT2 A;  5J08 A;  2YHE A;  4BWR A;  2WMO A;  4HOQ A;  2ETC A;  3LY7 A;  3AJI A;  4M3O A;  4U0Z A;  5KJK A;  2IO3 C;  5LP0 A;  3NZS A;  4AJW A;  1VDY A;  5EYL A;  2DYS E;  4PS8 A;  2XGO A;  4BTA A;  3J5P A;  1BU9 A;  5AJD A;  2KZT B;  4G11 A;  2P9P G;  4HOS A;  4CT4 A;  3CLJ A;  3ASG A;  3W9F A;  2WM9 A;  3EHN A;  5AQ9 A;  3MEK A;  4XKC A;  3CHM A;  2CG2 A;  4BT9 A;  2ZGG A;  4J8E A;  3DSS A;  3PVL A;  3D9M A;  1Z5S C;  1O1R A;  4GB9 A;  4I17 A;  3UKU G;  4JZY A;  2WXH A;  1OT8 A;  3SO8 A;  3LDZ A;  5JMN D;  4ZHB A;  1DVP A;  1LD7 A;  1G3N B;  3CK9 A;  3CK7 A;  4UI9 C;  3SFX A;  4YDO A;  3QWW A;  2A5U A;  4GMJ A;  2XRY A;  1K1A A;  4BSX A;  4FLH A;  3TWQ A;  3AG1 E;  3UUX A;  3ASO E;  4OAV B;  3DBS A;  1S64 A;  2IY0 C;  4YND A;  5CRU A;  4IYP A;  4GML A;  1YCS B;  3Q9N C;  4HLL A;  2HO1 A;  4ATZ D;  3ZKJ A;  4C9B B;  4JHR A;  1HG2 A;  1FPP A;  3DXK G;  5CCM A;  4I9C A;  4TXR A;  3HXE A;  2PZI A;  3O48 A;  1BPO A;  3C3Q A;  4EZK A;  5AN8 A;  5M72 A;  4WUY A;  5A7D B;  3T9K A;  1S63 A;  3BG0 B;  3UQ3 A;  3DPD A;  1WY6 A;  3EDT B;  3PRZ A;  4HOT A;  3PS6 A;  2GRL A;  4K5C A;  2L9B A;  3CQG B;  4JEU A;  1N0R A;  4DX6 D;  4DX1 A;  4GTS A;  2R5S A;  2YIN A;  3HDX A;  2WXF A;  3MV2 B;  3NB2 A;  5C1D A;  2KCV A;  1MHQ A;  4URK A;  4EBA A;  1LD8 A;  3JXJ A;  5JHB A;  3Q78 A;  5CMW A;  2IU1 A;  5EIB E;  2QFC A;  4N2S A;  1YYH A;  2VGY A;  2PM7 A;  3PE3 A;  2WXN A;  3K9I A;  3D3M A;  3ZYK A;  4APO A;  3GZS A;  5EDS A;  4I6G A;  4GMR A;  1UN9 A;  3E37 A;  2B0O E;  2PQN A;  2X6H A;  3EJN A;  1EF1 C;  3UIN C;  3D9I A;  2XEN A;  3CEQ A;  3V30 A;  4JVS A;  3NBN B;  5ARF A;  2ZU6 B;  3HXD A;  2IQC A;  2FUL A;  3FU5 A;  3BG1 B;  4MLP A;  4A3V A;  5CEC B;  3PZD A;  2DBA A;  5EYP F;  3J5Q B;  5AJL A;  4AXH A;  3IBE A;  5ENP D;  4PH4 B;  1TYQ G;  2VSN A;  1OCC E;  3QNK A;  2AXV A;  4U0U A;  2X3M A;  3TAX A;  4U95 D;  2AW6 A;  4AIF A;  3FUH A;  2WQ6 A;  4HRM B;  4GU5 A;  3TWT A;  3FEX A;  2GRP B;  3FY4 A;  1OWM A;  2AVP A;  4GZ5 A;  3TGO A;  3KS2 A;  3C5R A;  3DEP A;  3FUN A;  2GRR B;  4EPZ A;  1OCZ E;  3HXF A;  4J0U A;  4FA6 A;  4WNE A;  4CEM A;  1WAO 1;  3HXB A;  1QZ2 A;  3CKC A;  3EIJ A;  5BXO A;  4GTP A;  3RU0 A;  2XZD G;  2WXG A;  3W9G A;  3G2T A;  5HRY A;  5ENN A;  4HLE A;  4WNF A;  2R03 A;  3D9J A;  4I1M A;  2WMN A;  5LX8 A;  5HI7 A;  4HVB A;  2OVF A;  5ENS D;  4A55 A;  1MX4 A;  3Q49 B;  2GRN B;  3TWV A;  3SQV A;  4L2Y A;  4BSZ B;  4OYS A;  2VGE A;  4UI9 K;  2FO1 E;  4EZJ A;  3CVP A;  3ZW3 A;  3NF1 A;  5E76 A;  3CVW A;  3LKU A;  3ZIM A;  5FWQ A;  3BUA A;  2LXL A;  1Y8M A;  1IHG A;  5ANR A;  2JAB A;  3UT8 A;  3E4B A;  3T5V A;  3FHE A;  4WNG A;  4YDY A;  2KZT A;  1BI8 B;  1ELW A;  3MKR A;  4E6H A;  5JJT A;  5EIL A;  3C72 A;  3KAE A;  1IXV A;  3TG4 A;  4CGW A;  4N3B A;  4DRX E;  3CHP A;  2EQX A;  4BX8 A;  1MJ0 A;  3GYZ A;  3SFZ A;  2J09 A;  2H6I A;  1L5J A;  4PS7 A;  3KEA A;  1N0Q A;  4I6E A;  1KZO A;  3QWV A;  1E7U A;  2I9C A;  3MJW A;  3ZUV B;  4Z68 A;  3PRE A;  5FQ8 A;  3UIP C;  4FC8 A;  3DXM G;  2LSV A;  4ILH B;  3ZFW A;  4JL0 A;  4K5B A;  4V3I A;  3ONL A;  3S7F A;  3APF A;  1UN8 A;  1X5B A;  3ASD A;  3LEW A;  5HKP A;  4I1O B;  1SZA A;  3TWU A;  4TRQ A;  1Z3Y A;  4EQF A;  3FEY A;  4HS2 A;  5D0Q D;  1V54 E;  2CG3 A;  3UT7 A;  2VJ8 A;  1H2V C;  4L23 A;  3TL5 A;  3EHM A;  1U2V G;  1N9A A;  3UTM A;  5FIO A;  4GZ6 A;  3Q75 A;  2KCL A;  1JPL A;  2NSZ A;  1JCR A;  2XQ0 A;  3FP3 A;  2RFA A;  3OXL A;  2YNQ A;  4KVO A;  3U4T A;  4WWP A;  5BT1 A;  4Q96 A;  3U66 A;  2ION A;  1UG3 A;  4XEI G;  4BTB A;  3ML8 A;  5CHE E;  4J6I A;  2VSO E;  4CCA A;  3FTY A;  3FTZ A;  4HQD A;  1OWO A;  1TNZ A;  3I4R B;  4U04 A;  3V79 K;  4QFV A;  4J8Y A;  4UWL A;  4G2V A;  3FUD A;  3QK0 A;  5FQ4 A;  2XGM A;  2F0Y A;  2R2L A;  2XHE A;  4GTV A;  3AAA C;  3ZNG A;  3PUK A;  3Q73 A;  3MX3 A;  4JA7 A;  4XX5 A;  4XIF A;  4G1T A;  2QZA A;  4Y6W A;  4KVM A;  1E7V A;  2GW1 A;  2ZIR A;  1NZN A;  4O1O A;  2DVW A;  3RAU A;  1FVH A;  3PE4 A;  3SF4 A;  1MQS A;  2IJG X;  1OCO E;  2LAI A;  1EDU A;  4BER A;  5KWD A;  3TJP A;  1TNO A;  3ULY A;  4LSZ E;  1TN6 A;  3FUF A;  1NFI E;  3HYM B;  2WVI A;  4XE0 A;  3E34 A;  2KC7 A;  1H2T C;  1TR4 A;  2PL2 A;  3QOU A;  5T3R A;  1PC2 A;  4F6R D;  2NC9 A;  1ELK A;  4FAD A;  1OWL A;  5D66 A;  3LXU X;  3Q4A B;  1E8Z A;  3APD A;  4U7E B;  4F3V A;  3AU4 A;  3L17 A;  3UI2 A;  1NA0 A;  5ANL A;  1XNF A;  3PNT B;  3CVV A;  4U8H A;  2XZT G;  4PDX A;  1TNU A;  3AS5 A;  1OWN A;  3L9T A;  2XEV A;  1JWG A;  4JHJ A;  4APF A;  4DX7 D;  4N39 A;  3WXX A;  4U96 D;  4TUU A;  2V4H C;  5BPP A;  2Q7F A;  4ZFH A;  3DRA A;  2VQ2 A;  2HE0 A;  1D8E A;  4GA0 A;  2X6K A;  3HIZ A;  5G55 A;  4YDE A;  2KAT A;  1P5Q A;  3FDH A;  3RRM B;  4JA9 A;  4JC8 A;  1E96 B;  2FI7 A;  2DWZ A;  1QQE A;  2OCC E;  3FTU A;  4FHJ A;  3R9A B;  3EU9 A;  3UT4 A;  1S0P A;  4FLB A;  5LCW C;  4GZ3 A;  3SY2 A;  3IKO B;  4R7L A;  3MKQ B;  3LYA A;  1WM5 A;  4N5C A;  4IN3 B;  5T4Y A;  4GPK A;  3PZ2 A;  3S2A A;  3B95 A;  2YHC A;  1HZ4 A;  3FUL A;  5J90 A;  2FO7 A;  2Y1L E;  3EIQ C;  5JHA A;  2IOS A;  4G25 A;  4J8F A;  1UJK A;  2ETB A;  4K03 A;  4RVB A;  1JCQ A;  4L9P A;  3C98 A;  2GRQ B;  4AP2 A;  1WDY A;  4L1B A;  3LVR E;  5G2N A;  1H19 A;  3NOG D;  3AG2 E;  1SA4 A;  2JEK A;  3I4G A;  5KNH D;  2QC9 A;  4DK5 A;  4GA1 A;  4BX9 A;  4A63 B;  4K5A B;  5A23 A;  4N3A A;  3Q9U C;  2GRO B;  3PEU B;  3UXG A;  1H6O A;  1E90 A;  4HRN A;  3VTX A;  2R59 A;  3CV0 A;  5KCM A;  1BI7 B;  2L0T B;  3D9N A;  4OVU A;  3PZ3 A;  3ZYL A;  3PDN A;  2NXP A;  3Q79 A;  3VLD A;  3FFL A;  4DX5 D;  2BKK B;  3DEO A;  3JUE A;  3ZPJ A;  1BLX B;  3G2W A;  3CIA A;  4KZC A;  3CVQ A;  3QC1 A;  4HFG A;  5JA4 D;  4EHM A;  3UMV A;  4A1S A;  4XI0 A;  4Q69 A;  5FJY A;  1NI1 A;  2WXI A;  4I6J A;  4G23 A;  5G04 J;  1HH8 A;  4ACL A;  4ILI A;  1ZU2 A;  4TXP A;  3FTV A;  2OVB A;  1KPS B;  4WWO A;  3CST A;  1V55 E;  4N2Q A;  2DCP A;  2XPI A;  1N95 A;  3O4Z A;  3ABL E;  1IHB A;  3DSX A;  4NRH B;  3CHS A;  2FEZ A;  1ZBP A;  4B8C B;  3GW4 A;  4DI4 A;  3PZ1 A;  4JXT A;  5KJN A;  3OAW A;  3UX4 A;  3OTN A;  4UWF A;  3QAR A;  1OY3 D;  1OUV A;  4FP7 A;  1KLX A;  2A5E A;  1E8W A;  2KCK A;  3HVE A;  2PM6 A;  4FUL A;  4D10 C;  3IEG A;  2F37 A;  4FHK A;  3TWX A;  2BED A;  4HB5 A;  4BET A;  1W3B A;  3G2V A;  5HS0 A;  4HXI A;  2LO6 A;  2P58 C;  2V8S E;  1A17 A;  5H7P A;  5KBA A;  3JQ1 A;  2IOL A;  3VTY A;  2XCB A;  2HM8 A;  3FU0 A;  2P9S G;  4JD2 G;  4P29 A;  4WAF A;  4G8K A;  4UWG A;  4UI9 J;  2WB2 A;  1E8X A;  3Q7F A;  5G05 J;  2EIJ E;  4F53 A;  3DSV A;  1X81 A;  5JJ6 A;  5LFA A;  4KMO A;  3MZL B;  4FU3 A;  2IFU A;  3BEE A;  3CKB A;  2DIW A;  4XKB A;  1O1T A;  3ASH A;  1H6P A;  1N4Q A;  3LS8 A;  2L6J A;  3G2S A;  4U8V D;  2AWI A;  3D9P A;  1TNB A;  4ANU A;  3CHO A;  2VSY A;  2X6F A;  4BT8 A;  2J08 A;  1EPU A;  1UW4 B;  2OND A;  3PZ4 A;  4BES A;  3LJ3 A;  4O60 A;  3T8M A;  4WWN A;  2MYO A;  3EHQ A;  2PNN A;  4B93 B;  5CBN A;  1NP7 A;  4H7Y A;  3IV0 A;  3D9H A;  2J4D A;  3RIB A;  2Y69 E;  5DBK A;  2KXP C;  4W9R A;  2BUG A;  4MBG A;  3ZHE B;  3ASF A;  4GZD A;  3QDN A;  4ANV A;  5ARG A;  4A1G A;  4KXK B;  1TN7 A;  1AWC B;  5AIJ A;  2P9N G;  5EX3 A;  4LUN U;  4AEZ C;  4GTM A;  3LY9 A;  4JHK A;  3TXM A;  4RLY A;  2H6F A;  2H6G A;  1D8D A;  4UQZ A;  1HE8 A;  1GW6 A;  4OVV A;  2FF4 A;  3P1U A;  4L7T A;  3RK6 A;  3SZ7 A;  2J9Q A;  3ZXS A;  1K1B A;  3SHF A;  5KJL A;  4U63 A;  4UWH A;  3PH0 C;  1U3C A;  2RD0 A;  2X6J A;  2V0P A;  4AV7 A;  3HXC A;  1KZP A;  4JPS A;  2WXL A;  3DWL G;  3L54 A;  1TNY A;  2AJA A;  2PQR A;  4LG6 A;  3QB2 A;  4U0S A;  3TG5 A;  3L13 A;  2DZO A;  3KSL A;  4DX2 A;  2LUH A;  2X38 A;  2XEE A;  4C0E A;  2RKK A;  1HG5 A;  1LF8 A;  3T8K A;  3E30 A;  3VLE A;  4B8A A;  2EIL E;  2EIM E;  2ZIS A;  3MYV A;  5FZQ A;  4WND A;  2ILR A;  4G26 A;  2J07 A;  2C2L A;  2VSX E;  3N71 A;  4LNB A;  2MHK A;  2HR2 A;  4AVX A;  3B7S A;  2DZN A;  2GRM A;  2MOW A;  1N52 A;  4RG9 A;  3FUI A;  1Z6T A;  4AOF A;  3Q15 A;  2A4Z A;  4N3C A;  3L22 A;  4TV3 A;  5CEA A;  2XPY A;  2NYJ A;  3TWW A;  2R17 C;  3L08 A;  4JB8 P;  4PS3 A;  2QY7 A;  3RSE G;  2CFU A;  4MRU A;  3PEV B;  4XZ4 A;  4DLO A;  4UQX A;  1TEZ A;  3UIO C;  5FZS A;  5CED B;  2BF0 X;  5CCL A;  4HBD A;  4AM9 A;  2WXJ A;  4QQI A;  4I9E A;  2J8S D;  1K8K G;  3I5P A;  4ANW A;  4LCT A;  4NAC A;  5KJM A;  3VLF A;  3CSF A;  3ML9 A;  3V2O A;  3UKR G;  4DI3 A;  2WXP A;  1K3Z D;  4RSY A;  3ZYQ A;  1HU3 A;  3IHV A;  3JXI A;  2RG8 A;  1RW2 A;  5LOZ A;  5EX0 A;  4LRZ A;  3NOC D;  3DPY A;  3V31 A;  2UWJ G;  1H0A A;  3AU5 A;  4NUR A;  1IYG A;  2I1J A;  2R05 A;  1FCH A;  5B1A E;  2OV8 A;  1MZC A;  3FTW A;  2I2O A;  3FTS A;  3X2Q E;  3L16 A;  1IQR A;  3OXG A;  4EBA G;  1O1S A;  1N94 A;  5HQ8 A;  3CVL A;  2EIN E;  4K0R A;  3D9K A;  3CGH A;  3I3N A;  1H6K A;  1U3D A;  3SBS A;  3ULE G;  3ZU7 B;  3JYS A;  1MX6 A;  4ME2 A;  1TJC A;  5BXU A;  1SVX A;  1N4S A;  1TJF A;  1WG0 A;  4BEP A;  3EUV A;  5BNW A;  4U07 A;  5ENT D;  1O5M A;  4GCN A;  5B3S E;  3SBT B;  2XPZ A;  3U64 A;  3V2X A;  4F1S A;  1SW6 A;  1LTX A;  5D0O D;  1N54 A;  4GAA A;  4L2L A;  3RRU A;  3LCA A;  4I43 A;  4ACK A;  3ABM E;  4UUC A;  5AQB A;  3DSU A;  5ITZ F;  4LER A;  4CDN A;  2XS8 A;  4EEC A;  5KNG A;  5ENR D;  3CHQ A;  2WXK A;  3R7R A;  3NZU A;  1FT1 A;  5FZR A;  2LNI A;  2UY1 B;  1IKN D;  4GA2 A;  2B6C A;  3T5X A;  1DCQ A;  3FWV A;  4GCO A;  3ZHE A;  3IXE A;  2XS1 A;  2X6I A;  4DPR A;  3UM3 A;  5G05 C;  3U9W A;  2GGF A;  4DLQ A;  1A5E A;  3PNL B;  2ZGD A;  3SI5 A;  3CVX A;  2OOE A;  3IHY A;  1IQU A;  4TXQ A;  4GTT A;  3CVY A;  3RO2 A;  1DCE A;  3FU3 A;  1OWP A;  2I6H A;  3C3R A;  4DUI A;  5ENO D;  3FH7 A;  3AS8 A;  3S7J A;  3MA5 A;  2DYR E;  3FUK A;  1SA5 A;  4YDW A;  4B89 A;  1AP7 A;  2IO2 C;  5AQ7 A;  3P2B A;  2VGX B;  1S70 B;  3QAQ A;  1Z3X A;  1N11 A;  3C3O A;  3S7D A;  2VTB B;  5A6C A;  1RZ4 A;  1PY1 A;  1UOH A;  2XCC A;  3LJN A;  4KT6 B;  1HS6 A;  1DC2 A;  4U8Y D;  3UM1 A;  2M63 A;  4BY6 A;  4J8D A;  2IF4 A;  3CVN A;  4FJZ A;  3EHR A;  2F8Y A;  4ABN A;  3GZ1 A;  2P9L G;  3CHR A;  1EYH A;  3QJZ A;  4ANX A;  2EIK E;  3FH8 A;  5BV0 A;  1N4P A;  1JUQ A;  2Y3A A;  2Y4T A;  3KD7 A;  4B0Z A;  5IY5 E;  4AY6 A;  4J7W A;  4GTQ A;  4CGV A;  4G24 A;  1ZB1 A;  4IUL A;  5FIN A;  3ESK A;  4TUM A;  3JUI A;  3Q47 B;  4J8S A;  2IEJ A;  3ULQ A;  3FH5 A;  4Y6C A;  3ABK E;  2YQ8 A;  3E33 A;  5CMY A;  2L0I A;  4HOR A;  1B89 A;  1KT0 A;  2Y0B G;  3ZN3 A;  4JW1 A;  3ZGQ A;  5LCW J;  2WPV A;  2LXM A;  1YMP A;  5FQ7 A;  3LPZ A;  4MS6 A;  1HX8 A;  4C0M A;  2XRZ A;  3AG3 E;  3LVQ E;  3G2U A;  4C48 B;  4I1A A;  2BKG A;  2RFM A;  2F8X K;  2C0L A;  3RRN B;  3QKY A;  2AXU A;  2MRI A;  3NQP A;  1QYM A;  5E75 A;  4HNA D;  2I1K A;  3TXN A;  4YVO A;  4CDR A;  4NIK A;  2CHX A;  3L82 A;  3FUM A;  4RG6 A;  3ONK A;  2Y4U A;  3Q7A A;  3R9M A;  3B7T A;  3B7R L;  1NL4 A;  2CHZ A;  5FTP A;  1TN8 A;  2LAH A;  4HRL A;  3SFY A;  5EN5 D;  2ZXW E;  5T8I A;  2P2C P;  2XGS A;  2FBN A;  4NQ0 A;  3BQO A;  2V5Q C;  4GTO A;  1FVF A;  3JCK C;  3MCX A;  4JEH A;  4UQY A;  3Q5M A;  3FUE A;  2P9U G;  3UM2 A;  3HRA A;  3TWR A;  3AS4 A;  1Y6I A;  1JWF A;  2CHW A;  3SGH A;  3FUJ A;  5B1B E;  2KM4 A;  3R7Q A;  4HOU A;  2LSU A;  1PAQ A;  4LNU D;  5AEN A;  5BUZ A;  4Q94 A;  3ESL A;  3S7B A;  3JQ0 A;  3FU6 A;  3KSQ A;  5FT9 A;  4KZ0 A;  3CVU A;  3B7U X;  5EKQ D;  2WXO A;  3MKQ A;  3SNX A;  4DJA A;  3U3W A;  3FTX A;  3UPV A;  2V5F A;  4E85 A;  3URZ A;  5EID A;  3WG7 E;  2J4B A;  2QYU A;  4O1P A;  5C2Y A;  1JCS A;  3EU5 A;  3SD5 A;  3OXF A;  3HHM A;  2V4L A;  4KBQ A;  3D9L A;  3L6A A;  2UY1 A;  2BTD A;  2AXZ A;  4MKT A;  2CFZ A;  4EZL A;  3UM0 A;  2P9I G;  4LEU A;  4ILG A;  3MV3 B;  2E0I A;  4PUC A;  4I2W A;  3ZEF A;  4O6F A;  4H7X A;  1E8Y A;  4UWK A;  3ZVV A;  5DIZ A;  3TWS A;  3ENE A;  4F1P A;  3B7B A;  5AAO A;  4YVQ C;  1YA0 A;  3RO3 A;  2H6H A;  4B94 A;  2VYI A; 
#chains in the Genus database with same CATH homology
 1H2U A;  3IHV A;  3KEZ A;  3ZW3 A;  4FA6 A;  4WNE A;  4CEM A;  5AYW D;  3PEU B;  3ZYM A;  1WAO 1;  2RG8 A;  5LOZ A;  5EX0 A;  1E90 A;  1QZ2 A;  2WQH A;  4GYO A;  3CKC A;  3EIJ A;  4KYO B;  4LRZ A;  3RU0 A;  2WXM A;  5FQ6 A;  3VTX A;  2R59 A;  3CV0 A;  2JLB A;  4FJY A;  2UWJ G;  5KCM A;  1H0A A;  2WXG A;  3AU5 A;  3G2T A;  4NUR A;  1IYG A;  5ENN A;  4HLE A;  4WNF A;  2I1J A;  3D9J A;  5BW8 C;  2L0T B;  4I1M A;  2WMN A;  3D9N A;  5LX8 A;  1FCH A;  5HI7 A;  4OVU A;  2OV8 A;  3ZYL A;  3PDN A;  2NXP A;  4XI9 A;  4HVB A;  2OVF A;  2I2O A;  3FTW A;  3FTS A;  4A55 A;  3L16 A;  3VLD A;  3Q49 B;  3FFL A;  1IQR A;  3OXG A;  4EBA G;  1HXI A;  3ZPJ A;  5HQ8 A;  4GYY A;  3CVL A;  3G2W A;  3CIA A;  4L2Y A;  4OYS A;  4KZC A;  3CVQ A;  2WXQ A;  5BV1 A;  4K0R A;  3QC1 A;  3D9K A;  3CGH A;  3I3N A;  4HFG A;  4UI9 K;  2VGX A;  1H6K A;  1U3D A;  2WXR A;  3SBS A;  3UMV A;  4A1S A;  1QNF A;  4XI0 A;  3RJV A;  5FJY A;  4Q69 A;  4EZJ A;  3JYS A;  4ME2 A;  1TJC A;  3CVP A;  2WXI A;  4I6J A;  4G23 A;  5G04 J;  1HH8 A;  3B13 A;  3NF1 A;  4ILI A;  5E76 A;  1ZU2 A;  2OVB A;  3FTV A;  3LKU A;  4ACL A;  3ZIM A;  5JJ7 A;  1TJF A;  4WWO A;  3CST A;  5FWQ A;  4N2Q A;  2DCP A;  3APC A;  2XPI A;  1DNP A;  1Y8M A;  3O4Z A;  4CT0 A;  1IHG A;  5BNW A;  4U07 A;  5ANR A;  4NRH B;  3CHS A;  2FEZ A;  1ZBP A;  3UT8 A;  3E4B A;  4A3T A;  4GCN A;  1KT1 A;  3FHE A;  4B8C B;  3SBT B;  3GW4 A;  3T5V A;  4WNG A;  4DI4 A;  4BFR A;  2XPZ A;  3U64 A;  4JXT A;  2KZT A;  1ELW A;  3MKR A;  4F1S A;  5D0O D;  5KJN A;  4E6H A;  3OAW A;  3RKV A;  1UJJ A;  3HVE B;  1N54 A;  3OTN A;  3QWP A;  4GAA A;  4L2L A;  4UWF A;  3RRU A;  3LCA A;  3QAR A;  5JJT A;  4I43 A;  4ACK A;  3ZRH A;  4LER A;  3KAE A;  4CDN A;  1XGW A;  3TG4 A;  1OUV A;  4CGW A;  4FP7 A;  1HO8 A;  1NA3 A;  3CQC B;  4N3B A;  4EEC A;  1SZ9 A;  3CHQ A;  1KLX A;  2WXK A;  4IRU A;  1E8W A;  2KCK A;  3HVE A;  3R7R A;  3CHP A;  2EQX A;  3NZU A;  2PM6 A;  2J49 A;  5FZR A;  2LNI A;  2UY1 B;  4FUL A;  4BX8 A;  4D10 C;  2HYZ A;  3IEG A;  3GYZ A;  4GA2 A;  3SFZ A;  2J09 A;  4FHK A;  3T5X A;  3CR3 A;  4ATG A;  4CDM A;  1W3B A;  3G2V A;  4HXI A;  1L5J A;  3FWV A;  4PS7 A;  3CK8 A;  4GCO A;  4I6E A;  3ZHE A;  3QWV A;  4GYW A;  1E7U A;  2I9C A;  2LO6 A;  3MJW A;  3MGB A;  3PRE A;  2X6I A;  5FQ8 A;  4DPR A;  4FC8 A;  5G05 C;  2LSV A;  2P58 C;  3U9W A;  1SQM A;  2C0M A;  2GGF A;  1ELR A;  4ILH B;  3ZFW A;  4DLQ A;  4JL0 A;  3PNL B;  2V8S E;  3SI5 A;  4V3I A;  4I2Z A;  3PUJ A;  3CVX A;  3ONL A;  2OOE A;  4GZC A;  1A17 A;  3S7F A;  3APF A;  1UN8 A;  1X5B A;  3ASD A;  3LEW A;  3LY8 A;  4I1O B;  1SZA A;  4TRQ A;  3IHY A;  4AY5 A;  3JQ1 A;  1IQU A;  2IOL A;  1Z3Y A;  3VTY A;  2WQ7 A;  4EQF A;  3FEY A;  4HS2 A;  1HF8 A;  5D0Q D;  4CRW A;  2CG3 A;  2XCB A;  3UT7 A;  3D9O A;  2HM8 A;  2VJ8 A;  3FU0 A;  1H2V C;  4P29 A;  4WAF A;  3CVY A;  4L23 A;  3RO2 A;  4UWG A;  4UI9 J;  3TL5 A;  2WB2 A;  3FU3 A;  1E8X A;  1OWP A;  2I6H A;  1INZ A;  3GZ2 A;  3EHM A;  5G05 J;  4F53 A;  2E2E A;  1HFA A;  5G04 C;  3FH7 A;  5JJ6 A;  4F7A A;  4GZ6 A;  2VTB A;  5LFA A;  3AS8 A;  2KCL A;  3S7J A;  4KMO A;  3MZL B;  4FU3 A;  3MA5 A;  5J08 A;  2YHE A;  2IFU A;  4BWR A;  3FUK A;  3BEE A;  1JPL A;  2WMO A;  2NSZ A;  4HOQ A;  4B89 A;  3CKB A;  2DIW A;  3LY7 A;  4XKB A;  2XQ0 A;  3P2B A;  2VGX B;  3FP3 A;  4M3O A;  3ASH A;  3QAQ A;  1Z3X A;  4U0Z A;  5KJK A;  3LS8 A;  2L6J A;  3OXL A;  3S7D A;  3G2S A;  2VTB B;  2YNQ A;  4KVO A;  3U4T A;  2AWI A;  4WWP A;  5BT1 A;  5A6C A;  5LP0 A;  4Q96 A;  3U66 A;  2ION A;  3D9P A;  1UG3 A;  3NZS A;  4AJW A;  4ANU A;  4BTB A;  3ML8 A;  1VDY A;  1PY1 A;  5CHE E;  4J6I A;  2VSO E;  4CCA A;  2XCC A;  3CHO A;  4KT6 B;  4PS8 A;  3FTY A;  3FTZ A;  1HS6 A;  2XGO A;  4BTA A;  2VSY A;  2X6F A;  1OWO A;  2M63 A;  3I4R B;  4U04 A;  4BT8 A;  2J08 A;  4BY6 A;  5AJD A;  4J8D A;  1EPU A;  2IF4 A;  2KZT B;  3CVN A;  4FJZ A;  1UW4 B;  2OND A;  4G11 A;  4QFV A;  4HOS A;  4CT4 A;  3CLJ A;  4UWL A;  3LJ3 A;  4ABN A;  3ASG A;  3GZ1 A;  4G2V A;  3T8M A;  2WM9 A;  3FUD A;  3QK0 A;  3CHR A;  1EYH A;  3QJZ A;  4WWN A;  5FQ4 A;  4ANX A;  3EHN A;  3FH8 A;  3MEK A;  4XKC A;  5BV0 A;  3CHM A;  1JUQ A;  2CG2 A;  2XGM A;  2Y4T A;  2Y3A A;  3KD7 A;  4B0Z A;  4BT9 A;  4AY6 A;  4J8E A;  2XHE A;  1NP7 A;  4H7Y A;  4CGV A;  3PVL A;  3D9M A;  3IV0 A;  3PUK A;  4G24 A;  3RIB A;  2J4D A;  3MX3 A;  4JA7 A;  5DBK A;  4XX5 A;  4W9R A;  4XIF A;  4IUL A;  4G1T A;  2BUG A;  3ZHE B;  4Y6W A;  3ESK A;  4KVM A;  3ASF A;  1E7V A;  2GW1 A;  4GZD A;  4GB9 A;  3QDN A;  4I17 A;  4ANV A;  5ARG A;  4JZY A;  4A1G A;  2WXH A;  4KXK B;  1NZN A;  3JUI A;  3LDZ A;  3Q47 B;  4J8S A;  1FVH A;  3ULQ A;  1DVP A;  5AIJ A;  3FH5 A;  4Y6C A;  2YQ8 A;  3PE4 A;  3SF4 A;  5EX3 A;  1MQS A;  2IJG X;  3CK9 A;  4LUN U;  4AEZ C;  3CK7 A;  4UI9 C;  5CMY A;  2L0I A;  2LAI A;  3LY9 A;  4HOR A;  1EDU A;  1B89 A;  3TJP A;  4JHK A;  1KT0 A;  3QWW A;  2A5U A;  4GMJ A;  3FUF A;  3TXM A;  3ZN3 A;  2XRY A;  4JW1 A;  3HYM B;  2WVI A;  3ZGQ A;  5LCW J;  4XE0 A;  4BSX A;  4FLH A;  2WPV A;  2KC7 A;  4UQZ A;  1H2T C;  1HE8 A;  3UUX A;  1GW6 A;  4OVV A;  2FF4 A;  5FQ7 A;  3P1U A;  3DBS A;  4L7T A;  3RK6 A;  3SZ7 A;  3LPZ A;  4MS6 A;  1HX8 A;  4C0M A;  2J9Q A;  2XRZ A;  4YND A;  3LVQ E;  3ZXS A;  2PL2 A;  3QOU A;  5T3R A;  3SHF A;  1PC2 A;  3G2U A;  4I1A A;  5KJL A;  4U63 A;  2NC9 A;  4UWH A;  1ELK A;  3PH0 C;  4IYP A;  1U3C A;  4GML A;  2RD0 A;  2X6J A;  2V0P A;  2C0L A;  3RRN B;  2HO1 A;  3QKY A;  4AV7 A;  4FAD A;  1OWL A;  4JPS A;  3LXU X;  3Q4A B;  1E8Z A;  2AXU A;  2WXL A;  3APD A;  2MRI A;  4F3V A;  4C9B B;  3AU4 A;  3L17 A;  4JHR A;  3L54 A;  3NQP A;  1HG2 A;  1NA0 A;  5E75 A;  5ANL A;  1XNF A;  3PNT B;  3CVV A;  5CCM A;  2PQR A;  4U8H A;  2I1K A;  4I9C A;  4PDX A;  3QB2 A;  3TXN A;  4YVO A;  4U0S A;  3TG5 A;  3L13 A;  3AS5 A;  2PZI A;  3O48 A;  1BPO A;  1OWN A;  3UX4 A;  4CDR A;  2XEV A;  4EZK A;  5M72 A;  2X38 A;  1JWG A;  4WUY A;  4JHJ A;  5A7D B;  4APF A;  4C0E A;  4N39 A;  1HG5 A;  3WXX A;  3BG0 B;  1LF8 A;  2CHX A;  4TUU A;  3UQ3 A;  3DPD A;  1WY6 A;  3EDT B;  3PRZ A;  3FUM A;  3VLE A;  5BPP A;  4B8A A;  2Q7F A;  4HOT A;  4RG6 A;  3ONK A;  3PS6 A;  2Y4U A;  2GRL A;  2L9B A;  3B7T A;  3MYV A;  3B7R L;  3CQG B;  2VQ2 A;  4JEU A;  2CHZ A;  5FZQ A;  4GA0 A;  2X6K A;  4WND A;  5FTP A;  2ILR A;  2R5S A;  4G26 A;  2J07 A;  2YIN A;  2LAH A;  3HDX A;  2WXF A;  3MV2 B;  3HIZ A;  2C2L A;  5C1D A;  2KCV A;  1MHQ A;  2VSX E;  5G55 A;  5T8I A;  4URK A;  2XGS A;  4EBA A;  2KAT A;  2FBN A;  1P5Q A;  4NQ0 A;  5JHB A;  5CMW A;  2IU1 A;  3N71 A;  2QFC A;  4N2S A;  2MHK A;  3FDH A;  3RRM B;  4JA9 A;  4JC8 A;  1E96 B;  2HR2 A;  2VGY A;  2PM7 A;  1FVF A;  3JCK C;  3MCX A;  4JEH A;  4UQY A;  2FI7 A;  4AVX A;  3PE3 A;  3Q5M A;  3FUE A;  1QQE A;  3FTU A;  4FHJ A;  2WXN A;  3B7S A;  3K9I A;  2GRM A;  3AS4 A;  3D3M A;  3R9A B;  3ZYK A;  3GZS A;  1Y6I A;  3UT4 A;  1JWF A;  2CHW A;  3SGH A;  4APO A;  2MOW A;  3FUJ A;  5EDS A;  1S0P A;  2KM4 A;  3R7Q A;  1N52 A;  4HOU A;  4RG9 A;  4I6G A;  2LSU A;  1PAQ A;  4FLB A;  5LCW C;  1UN9 A;  3FUI A;  4GZ3 A;  5AEN A;  2PQN A;  2X6H A;  3IKO B;  1Z6T A;  4R7L A;  3EJN A;  1EF1 C;  5BUZ A;  3MKQ B;  4Q94 A;  4AOF A;  3ESL A;  3S7B A;  3JQ0 A;  3LYA A;  3Q15 A;  1WM5 A;  3D9I A;  3FU6 A;  3CEQ A;  5FT9 A;  4JVS A;  4KZ0 A;  4N5C A;  4IN3 B;  5T4Y A;  3CVU A;  2A4Z A;  4GPK A;  4N3C A;  3L22 A;  4TV3 A;  5ARF A;  3B7U X;  2XPY A;  5EKQ D;  2WXO A;  2ZU6 B;  3S2A A;  2R17 C;  3MKQ A;  2YHC A;  1HZ4 A;  3SNX A;  3FUL A;  4DJA A;  5J90 A;  2IQC A;  3L08 A;  2FO7 A;  2FUL A;  3FU5 A;  4PS3 A;  2QY7 A;  3BG1 B;  2CFU A;  4MLP A;  4A3V A;  3U3W A;  4MRU A;  3PZD A;  3EIQ C;  3FTX A;  2DBA A;  3PEV B;  4XZ4 A;  4DLO A;  4UQX A;  5JHA A;  1TEZ A;  5AJL A;  2IOS A;  4AXH A;  3CVW A;  4G25 A;  4J8F A;  3UPV A;  1UJK A;  2V5F A;  4E85 A;  3IBE A;  3URZ A;  5FZS A;  2BF0 X;  2J4B A;  4K03 A;  5C2Y A;  4PH4 B;  4RVB A;  3SD5 A;  5CCL A;  3OXF A;  2VSN A;  3HHM A;  2AXV A;  2V4L A;  3D9L A;  3QNK A;  3L6A A;  2UY1 A;  4KBQ A;  2BTD A;  4U0U A;  4AM9 A;  3C98 A;  4N3A A;  4AP2 A;  2AXZ A;  2X3M A;  2WXJ A;  3TAX A;  4I9E A;  4MKT A;  2CFZ A;  2AW6 A;  4AIF A;  3FUH A;  4L1B A;  4EZL A;  4GU5 A;  2WQ6 A;  4LEU A;  3FEX A;  3FY4 A;  3LVR E;  4ILG A;  1OWM A;  2E0I A;  3MV3 B;  5G2N A;  2AVP A;  3I5P A;  4GZ5 A;  4PUC A;  3KS2 A;  3TGO A;  4I2W A;  3ZEF A;  4ANW A;  1H19 A;  4LCT A;  4H7X A;  4NAC A;  3FUN A;  4O6F A;  5KJM A;  1E8Y A;  4UWK A;  3VLF A;  3ZVV A;  3CSF A;  5DIZ A;  2JEK A;  3ML9 A;  3ENE A;  3I4G A;  4DI3 A;  4DK5 A;  4EPZ A;  4GA1 A;  4BX9 A;  2WXP A;  4RSY A;  3ZYQ A;  4YVQ C;  1YA0 A;  3RO3 A;  1HU3 A;  5A23 A;  4B94 A;  4J0U A;  2VYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...