3CVNA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei glyceraldehyde-3-phosphate dehydrogenase (gapdh) pts1 peptide
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
320
structure length
300
Chain Sequence
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGEASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Peroxisome targeting signal 1 receptor
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 119
structure length 300
sequence length 320
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvnA00
3RU0A 3AS4A 3N71A 3BEEA 4UQXA 3CK9A 1IHGA 3GYZA 1Y8MA 3ZHEA 3U3WA 4N39A 3MV3B 4LEUA 4G24A 4HOUA 3NF1A 2XCBA 2ONDA 2GW1A 4HOQA 4WNDA 4RG6A 3RJVA 2C0LA 2UY1A 3ZPJA 1NZNA 4N3CA 3K9IA 2PQRA 5G04C 5KJMA 3FP3A 1NA0A 3HYMB 4XI0A 2WPVA 3UPVA 3LPZA 4HOTA 2IF4A 2C0MA 5FZSA 3RKVA 3CEQA 4N2SA 5FJYA 1HXIA 5HQ8A 3Q15A 5G04J 2MHKA 4J8FA 3QKYA 5LCWC 4GA1A 1HZ4A 3LCAA 3UQ3A 3EDTB 5BNWA 3ULQA 4YVOA 2J9QA 5AYWD 3S7DA 1XNFA 4YNDA 4H7YA 3TG5A 4ME2A 4J0UA 2VQ2A 5BT1A 4I1AA 4UI9J 5LCWJ 3S7FA 3JYSA 5KJLA 2FBNA 3CVQA 2VGXA 2FO7A 4GPKA 4I2WA 1W3BA 2R5SA 4CDRA 4GA2A 1ZU2A 2FF4A 4YVQC 2HO1A 2XGOA 4BT9A 4U0ZA 5FZRA 3LY7A 2KCLA 4WNEA 2YQ8A 3AS5A 4KXKB 3TAXA 4UI9K 5KJNA 4WUYA 4GZ6A 3MKRA 4EQFA 4U0SA 4XIFA 4G1TA 4BT8A 1YA0A 2FEZA 5JJ6A 4RG9A 3ASFA 2OOEA 1QQEA 3PE4A 3CKCA 3R9AB 3O48A 2PQNA 1NA3A 3LYAA 1ELWA 3E4BA 5D0OD 3ZHEB 4GYYA 4N5CA 4IN3B 2KCVA 2HR2A 4JHRA 4GA0A 2VGYA 4U07A 4G2VA 4I2ZA 2PZIA 4G26A 2LNIA 2Y4UA 2UY1B 4Y6WA 3LKUA 3GZ1A 5KJKA 4GYOA 5JJTA 2XGMA 4UI9C 1KT1A 2I6HA 4KBQA 3ESKA 4BWRA 2Q7FA 1P5QA 5EX3A 3ZGQA 2LSUA 3TGOA 4G23A 3OXLA 4I17A 1KT0A 5DBKA 2YHCA 3MA5A 2VSNA 3RO2A 2E2EA 1IYGA 3QWPA 2Y4TA 4O6FA 3ASGA 5FTPA 2QFCA 2KCKA 2KC7A 2LSVA 1OUVA 5EX0A 4WNFA 1ELRA 1B89A 1E96B 3KD7A 3LY9A 1ZBPA 3FFLA 1PC2A 2P58C 3CK8A 4GZ5A 4HORA 2WQHA 3WXXA 4AY5A 5EKQD 1WM5A 2C2LA 3CV0A 3GZ2A 5HI7A 5FT9A 3MEKA 2DBAA 5M72A 2BUGA 4BTBA 4N2QA 2JLBA 3Q4AB 5CCMA 5A6CA 3S7BA 3ASDA 4AIFA 2VGXB 4GCNA 5ARGA 5JJ7A 5G05C 4JA9A 3S7JA 4A1SA 3Q47B 4I9CA 3RO3A 3UUXA 4GYWA 3ZFWA 1HH8A 3IEGA 4GZ3A 1TJCA 4JL0A 2XCCA 4U0UA 4XI9A 4AM9A 2NC9A 5C1DA 3CK7A 4F3VA 5G05J 2VSYA 4GCOA 1A17A 4N3BA 3RIBA 2PL2A 2L6JA 3CKBA 5BW8C 3LY8A 4J8DA 2XEVA 3GW4A 5FZQA 3FWVA 5A7DB 2AVPA 3SZ7A 3ASHA 2FI7A 3URZA 3OXFA 3QWWA 3AS8A 3SF4A 4UQYA 4UQZA 4Y6CA 3CVPA 3QWVA 3QDNA 4HOSA 3VTXA 3CVLA 4KYOB 2V5FA 4I9EA 4W9RA 4NRHB 3QOUA 2KATA 2HYZA 4BTAA 4NQ0A 3Q49B 4H7XA 2XGSA 4J8EA 4APOA 1WAO1 2XPIA 3PE3A 3MV2B 5ARFA 3CVNA 1QZ2A 2UWJG 4B94A 5CHEE 3OXGA 3PDNA 5CCLA 4CGVA 3Q5MA 2IFUA 3KAEA 2VYIA 1FCHA 3TG4A 4U04A 3ZN3A 3U4TA 4ABNA 1KLXA 4AY6A 5D0QD 4WNGA 3VTYA 4CGWA 4N3AA 4G25A 3KS2A 4JA7A 5DIZA
chains in the Genus database with same CATH superfamily
3N71A 3CK9A 3E32A 2MOWA 4F53A 2BF0X 2V5QC 2XCBA 1KZOA 1N52A 2RKKA 2RD0A 2P9PG 4HOQA 5JHBA 4JHJA 4WNDA 1MX6A 3V30A 5ENQD 1HG2A 2P9SG 2V4LA 2WQ6A 3Q73A 5KJMA 3FP3A 3I3NA 5AARA 3HYMB 3B13A 5CBNA 3EHRA 3CR3A 2WXOA 1SW6A 2C0MA 2KM4A 3CEQA 5LFAA 5FJYA 2MRIA 5AAOA 5HQ8A 2MHKA 3QKYA 3BQOA 1HZ4A 2IONA 3R7RA 2OEVA 3UIOC 3VLFA 4R7LA 3UX4A 1X81A 4GTMA 4LNGA 3FUIA 5CRVA 1NL4A 4C0EA 3Q9UC 4M7CA 1TNZA 3AG4E 3D9LA 2VTBA 3J5PA 1V54E 3FH8A 4E6HA 3E34A 3JYSA 2ZGDA 4BSZB 3CVQA 4DX6D 1N11A 5CBOA 3AG3E 4I2WA 3KEAA 2AXZA 2X6HA 1OWLA 3ENEA 1BLXB 3BG1B 2DIWA 2EIME 3FU5A 4M3OA 4J7WA 4U0ZA 5FZRA 2JEKA 2KCLA 1TN7A 3B95A 4HFGA 3AS5A 4KXKB 3S2AA 1TN6A 4O1OA 1E8ZA 1H2UA 1UJKA 4JEUA 3TWSA 3MKRA 4EQFA 4JD2G 4XIFA 4ZFHA 4FLBA 5KBAA 4PDXA 1WY6A 2A4ZA 3ASFA 1HX8A 1SZAA 1MX2A 3T8MA 4B0ZA 3CKCA 1UG3A 1NA3A 3FH7A 3JUEA 4JEHA 5D0OD 1N94A 3ZHEB 4N5CA 4IN3B 1Z5SC 3UT8A 4ANVA 2L6BA 3UT7A 4GB9A 3HVEA 2RG8A 5ENOD 3HXBA 2FULA 2WXKA 2UY1B 3LKUA 5EILA 4GYOA 3SY2A 5EIDA 1SVXA 4KT6B 4U8VD 4J8SA 2JABA 4BWRA 2ZXWE 5EX3A 5DBKA 2YHCA 3RO2A 3QWPA 1WG0A 3AG1E 4GAAA 2KC7A 3SBTB 4NIKA 4IULA 4UWKA 1H6KA 4QQIA 5H7PA 1N0QA 4JZYA 2F8YA 3EJNA 1ZBPA 4GZ5A 1Z3YA 1IKND 5J90A 2OV8A 2WXJA 4ACKA 3WXXA 3CV0A 3MEKA 2J49A 5CMYA 4AIFA 4B89A 4WWOA 2VGXB 1OCOE 5G05C 1S70B 1L5JA 4I9CA 2PM7A 2EINE 3ZU7B 3JCKC 1NI1A 1HH8A 3L82A 1RW2A 4GZ3A 1TJCA 2V8SE 3NBNB 4L2YA 4JL0A 3QK0A 1TYQG 3CHRA 5BXUA 4U0UA 3HIZA 5KWDA 4F3VA 1AP7A 3I4GA 3L9TA 2YINA 1D8EA 5HS0A 3UMVA 2AXVA 3PS6A 3D9HA 1BD8A 2R2LA 4J8DA 2XEVA 3GW4A 3JXJA 3SD5A 4V3IA 4EPZA 1S63A 2P9IG 4LCTA 2MYOA 3SZ7A 3ASHA 3URZA 2KBXA 1FVFA 4GTQA 3Q7AA 4ACLA 5FQ8A 3ZYMA 4UQZA 2XHEA 4OYSA 1PAQA 3FTWA 2H6IA 3QWVA 3TL5A 3LDZA 2V5FA 4NRHB 2CFZA 4L7TA 4ATGA 2KATA 4MS6A 2AXUA 1BU9A 4HVBA 4O1PA 3QAQA 4EZJA 4H7XA 3I5PA 3PZ3A 4RLYA 1LD8A 1DCQA 1WAO1 2XPIA 5LOZA 3ZKJA 4GTSA 3HXFA 3LVRE 4B94A 5D66A 4OAUC 1XGWA 3D9NA 4UWFA 4G8LA 1OCZE 1OWNA 3D9IA 4BERA 2VYIA 4AP2A 1HG5A 2GGFA 3U4TA 4ABNA 1KLXA 2XEHA 4FC8A 1HU3A 2PM6A 3TWQA 2VGEA 3HG0D 4DX1A 2CHXA 5DIZA 4WAFA 1TR4A 3RRMB 1E8XA 3AS4A 3RU0A 3BEEA 4PH4B 1IHGA 3GYZA 1JCQA 1Y8MA 4FU3A 5BXOA 1HS6A 5G55A 3U3WA 4N39A 4G24A 3NF1A 2L0IA 4F1SA 4XKBA 4DX5D 3HDXA 4RG6A 3CHSA 3D9JA 4LRZA 3CVXA 2C0LA 4UWGA 3ZPJA 4LNUD 5BPPA 1Z3XA 3FTZA 3ZNGA 3FY4A 3LS8A 5T4YA 2IQCA 4L2LA 4XI0A 1TN8A 3VLEA 3UPVA 4XX5A 4HI8A 4GMRA 2IF4A 2I1KA 1N4PA 3RKVA 2EIKE 2VSOE 3QNKA 4N2SA 4L1BA 3SNXA 2WXHA 2J4BA 3FHEA 2KZTB 2XQ0A 4J8FA 3D3MA 3UINC 2GRLA 3LCAA 4TRQA 2RFAA 5C2YA 3APFA 3S7DA 4JVSA 3CVYA 3G2VA 4CCAA 3E33A 1IHBA 3G2TA 1YYHA 3RRNB 4I1OB 5IY5E 1DCEA 3TWWA 4A3TA 4GMLA 4AJWA 4FJYA 4HRNA 1QYMA 4JXTA 3IBEA 4X8QA 4JC8A 3S7FA 3TXMA 5J08A 3CVVA 2OVFA 4MBGA 5KJLA 2FBNA 2F0YA 4DX7D 3Q9NC 4J8YA 3ASNE 2XPYA 3FUKA 4CDRA 4GA2A 1ZU2A 2FF4A 4YVQC 5CEDB 3P2BA 5D2MC 2XGOA 3LY7A 4I6GA 1EDUA 1FVHA 4OAVB 3APCA 4WUYA 3PZ1A 4CT0A 2EILE 2DWZA 2WB2A 4QFVA 3TWXA 3HXEA 4DLOA 3QC1A 2ZU6B 1H0AA 2CHZA 3UT4A 4K03A 4KMOA 4BT8A 2LAIA 5CMWA 1EYHA 4RG9A 3DEOA 2OOEA 2DYRE 1LTXA 4A55A 3OAWA 4A63B 5FQ4A 3CQGB 3FEXA 3LYAA 4U8HA 3FH5A 2Y3AA 3CSFA 3CQCB 2WXIA 3G2UA 2QYUA 2XPZA 3FUNA 3ZRHA 4CRWA 4LSZE 4GA0A 2CG2A 1N54A 5AENA 2V4HC 4I2ZA 3ULEG 2KZTA 5AJDA 2XRYA 3HXDA 4KVMA 5FQ6A 3U66A 2X3MA 1TJFA 2WXLA 4U8YD 1JWFA 3FUFA 4AOFA 4FLHA 2LAHA 5KJKA 3JQ1A 5JJTA 1YMPA 2XGMA 3SGHA 2I6HA 3G2SA 1P5QA 1E8YA 4ILHB 2H6GA 2ETBA 3OXLA 2R03A 4I17A 3MCXA 4A1GA 3AU5A 2E2EA 2Y4TA 4O6FA 3ASGA 5AQAA 4U95D 2QFCA 4IRUA 4HS2A 3AJIA 2LSVA 4MKTA 4J6IA 4KZCA 1OUVA 2DZOA 4B93B 4L23A 1U3DA 2L0TB 5B1BE 3TWUA 3TWVA 4LUNU 1PC2A 4GTTA 3B7BA 2WQHA 3DEPA 3GZ2A 2XRZA 4PS3A 4D10C 3DWLG 2IJGX 5M72A 4LERA 4N2QA 4Q94A 5A6CA 3S7BA 4K5BA 5LP0A 3FUHA 4KZ0A 3C3QA 2J4DA 2P9NG 4K5CA 4MRUA 5BUZA 1N4RA 2ZGGA 2IOLA 4NACA 2DVWA 5ENPD 3D9MA 4OVVA 1E7VA 3ZFWA 3NZSA 5E75A 4EHMA 4YDYA 2WXNA 3FTSA 3DSVA 3L08A 4XEIG 4AM9A 5C1DA 2DZNA 3CK7A 2VSXE 2OCCE 5G05J 4L9PA 4PUCA 3RIBA 3NB2A 2L6JA 3CKBA 5BW8C 3LY8A 3ZIMA 4G11A 2WMOA 1N9AA 4BSXA 1ZB1A 1MYOA 5A7DB 1HF8A 5AIJA 3VLDA 2AVPA 4JPSA 4WWNA 5ENSD 3HHMA 4XKCA 3G2WA 1JPLA 5HRYA 4DX2A 3EIJA 2E0IA 3LJ3A 3E37A 3L22A 1YCSB 4HOSA 4U7EB 3VTXA 1JCSA 5KCMA 3QOUA 4GTPA 3OTNA 3NAWA 4BTAA 1VDYA 4B8CB 1IQUA 3PEUB 3AG2E 1E7UA 3PZDA 4J8EA 2H6FA 5EIBE 3PE3A 5ARFA 3C3OA 2WXPA 4I1MA 3ML8A 2EIJE 2UWJG 5CHEE 5KNHD 3FUDA 3PZ4A 4Q96A 3FU3A 1INZA 2BKKB 4LG6A 3EHNA 3TG4A 3ZN3A 4AY6A 4ANWA 4U63A 4WNGA 4HNAD 2GRPB 3KS2A 1O5MA 3QARA 4GZCA 3PUKA 4GZDA 5JMND 3ZW3A 2BTDA 4UQXA 2BEDA 5E76A 3ZHEA 2RFMA 2ZIRA 5FQ7A 2CFUA 4A3VA 1UOHA 3SFXA 2GRNB 3ZXPA 4LEUA 4FHJA 4HOUA 1MHQA 4WWPA 2ONDA 1JWGA 3Q78A 3FTYA 3ABKE 3RJVA 3B7SA 3D9KA 2DCPA 2IU1A 1KPSB 2UY1A 1NZNA 3X2QE 3K9IA 5G04C 3EIQC 1NA0A 2XS1A 5JHAA 2WXGA 1GW6A 1H6OA 4FHKA 5CEAA 2WPVA 4DI3A 1NP7A 1TNYA 3HRAA 4I6JA 1LF8A 5FZSA 3NOGD 3UM2A 1FT1A 3B7TA 2V0PA 5A23A 5LCWC 4I6EA 3FUMA 2QYJA 3UQ3A 2P2CP 1SQMA 5BNWA 3ULQA 2I9CA 4TUUA 5AYWD 1XNFA 1IQRA 4H7YA 1V55E 3NZUA 3Q75A 4YDOA 1BPOA 4J0UA 4NURA 3UKUG 5ENTD 4AV7A 5BT1A 3FDHA 4UI9J 1U3CA 3AAAC 5CECB 2VGXA 4O60A 4GPKA 1UN8A 4AVXA 3SBSA 3CHOA 3MKQB 3ZYKA 4YDWA 1S64A 2HO1A 4DK5A 4BT9A 1OCCE 4WNEA 2WXMA 2ZISA 1MQSA 3QJZA 2XS8A 2WXRA 4K0RA 4U0SA 3IXEA 5T8IA 4C9BB 2XEEA 4G1TA 4BX8A 4CEMA 5B3SE 4OVUA 3FEYA 3C5RA 1QQEA 3PE4A 3BG0B 3R9AB 5KNGA 1S0PA 2PQNA 3JXIA 3R9MA 3DSTA 3ULYA 3ISMC 2L9BA 4IYPA 5HKPA 3TWTA 2KCVA 2Y0BG 4TXQA 1U2VG 2WQ7A 3L17A 2J08A 1MJ0A 5G2NA 4G2VA 2PZIA 4BX9A 3DBSA 2LNIA 5EYPF 3KEZA 4UI9C 4KBQA 5FIOA 3ESKA 5ANLA 3T5VA 3ZGQA 1OT8A 2LSUA 5EYLA 4BESA 2F37A 1KT0A 3MA5A 3EU5A 3L13A 3PNLB 4F7AA 3FUJA 2B6CA 5FTPA 4Z68A 2B0OE 3FTVA 4EBAG 3SQVA 5EX0A 4WNFA 5CRUA 3EHQA 1ELRA 5LX8A 3KD7A 5AQBA 3SI5A 3DSSA 3U64A 3L16A 2ETAA 5AJLA 3V31A 5EKQD 2C2LA 5HI7A 2IO3C 3MYVA 5FT9A 5B1AE 2VTBB 4PS8A 4AEZC 3SFZA 2JLBA 3Q4AB 5CCMA 3ASDA 3CHQA 3J5QB 4GTOA 2WMNA 4CZ2D 5ARGA 4JA9A 3Q47B 3PEVB 3LJNA 4APFA 3RO3A 4GYWA 2LUHA 1FT2A 3WG7E 4P29A 3IEGA 1K8KG 3ESLA 2NC9A 1K1AA 3JQ0A 2HM8A 4DUIA 2VSYA 3T8KA 3NQPA 4N5QA 4N3BA 2PL2A 2IEJA 3CGHA 3FU6A 3CHMA 3ZXSA 5FZQA 3NOCD 1MZCA 4F6RD 2Y69E 1K1BA 4GTRA 4YDEA 3Q7FA 3OXFA 4HXIA 3QWWA 4EECA 3QB2A 2X6JA 3SF4A 1NFIE 3HVEB 2OVBA 4Y6CA 4PS7A 3QDNA 2R02A 4RSYA 4W9RA 4XE0A 1JUQA 1A5EA 3PNTB 2NSZA 4FULA 5CERB 2GRQB 2XZTG 3T5XA 3BUAA 2FO1E 3FU0A 3MV2B 3DSWA 3CVNA 4DLQA 3CLJA 4CGVA 4GU5A 2IFUA 2WM9A 1TNUA 3W9GA 4GPMA 1G3NB 5BV1A 4URKA 2KXPC 1FCHA 5EDSA 4U04A 3ZUVB 4UWLA 2ETCA 3VTYA 3V79K 4U96D 4N3AA 1E8WA 1TEZA 1X5BA 1OCRE 1BI7B 4KVOA 3TXNA 2IO2C 3ABLE 4F1PA 1WDYA 5ENRD 3MV3B 4JB8P 3B7RL 3RK6A 4AXHA 1UN9A 3UM3A 1FPPA 2F8XK 2GW1A 3KSQA 3MZLB 3Q79A 4JW1A 3UTMA 3EHMA 3UXGA 3F6QA 4N3CA 1UJJA 2PQRA 3RSEG 2X38A 2CHWA 3TWRA 3EUVA 5ITZF 2YNQA 3LPZA 3MX3A 2BKGA 4HOTA 4DPRA 3SFYA 3PH0C 4FJZA 4LNBA 2A5EA 3MGBA 1HXIA 2X6KA 4CDNA 3EU9A 5AQ9A 1DVPA 3Q15A 2WXFA 5G04J 4C48B 3PVLA 4GA1A 3DPYA 1SZ9A 3EDTB 1H2TC 4JHKA 4YVOA 2J9QA 2A5UA 1N0RA 2R05A 3ZYQA 4YNDA 3ABME 1E90A 3TG5A 4ME2A 4CT4A 4ANXA 5BV0A 1SA5A 4ILGA 2I2OA 4EBAA 5AN8A 3T9KA 2WXQA 2VQ2A 5JA4D 4I1AA 5LCWJ 1Y6IA 2QC9A 3UI2A 4Q69A 4BETA 2X6FA 3FTXA 2FO7A 4HRLA 3O4ZA 1W3BA 2H6HA 1EPUA 3LXUX 2R5SA 2IOSA 3B7UX 2R59A 1H2VC 2YQ8A 4RVBA 3V2OA 4HI9A 3TAXA 3FTUA 2P9KG 3IHVA 4UI9K 3JUIA 5KJNA 4GZ6A 3W9FA 2DYSE 3SO8A 4EZKA 3L54A 1TNOA 2J09A 5ENNA 4K5AB 2ILRA 1UW4B 3IHYA 1TNBA 5ANRA 1YA0A 2FEZA 2Y1LE 4HLLA 5JJ6A 4E85A 2X6IA 1OWMA 4FP7A 2LO6A 3FULA 3O48A 4UWHA 1O1TA 3SHFA 1EF1C 1ELWA 3E4BA 4B8AA 2I1JA 2J8SD 4ANUA 3C3RA 4XZ4A 4GYYA 2GRMA 2GRRB 2HR2A 1N95A 4JHRA 4C0MA 2VGYA 4U07A 3L6AA 5AQ7A 4DRXE 2GROB 3RAUA 4ILIA 4TV3A 4G26A 3ONKA 2Y4UA 4UUCA 2AWIA 3UKRG 3E30A 2OEWA 3HXCA 4Y6WA 3GZ1A 3CSTA 1KT1A 1OXJA 4FA6A 2Q7FA 1IXVA 1QBQA 2NYJA 1BI8B 3TGOA 4G23A 3RRUA 1HFAA 3LVQE 1MX4A 4GMJA 2VSNA 1IYGA 4TXPA 3UIPC 1QNFA 1RZ4A 4DI4A 2KCKA 3DPDA 2WVIA 1H6PA 3TJPA 4RQIA 3P1UA 5FWQA 3D9PA 1B89A 1E96B 3LY9A 3FFLA 2P58C 3CK8A 4G8KA 4HORA 1DNPA 4AY5A 1WM5A 1DC2A 3ZEFA 3APDA 2DBAA 4BY6A 3PREA 2AW6A 2BUGA 4BTBA 5FINA 4CYMD 1OWOA 2J07A 3DSXA 2LXLA 2NXPA 4GCNA 4ATZD 5JJ7A 3UM0A 3S7JA 4A1SA 3PZ2A 2XENA 3AU4A 2M63A 5T3RA 3UUXA 3GZSA 1O1RA 3FUEA 2QY7A 1OWPA 3BU8A 1D9SA 2AJAA 1N4QA 3DXMG 4HQDA 2LXMA 2IY0C 4I43A 3PUJA 4BEPA 2XCCA 4XI9A 4TUMA 2HE0A 4GCOA 3ZVVA 3PRZA 1A17A 3C98A 3U9WA 1JCRA 3KSLA 4CDMA 5EN5D 1H19A 1ELKA 3ONLA 2PNNA 3FWVA 3C72A 3CVWA 3ML9A 3D9OA 4BFRA 4MLPA 3DXKG 3I4RB 4HRMB 1LD7A 2FI7A 4FADA 4HLEA 2QZAA 1PY1A 3AS8A 4UQYA 1AWCB 3ASOE 2P9UG 1SA4A 3IKOB 3CVPA 1K3ZD 4DJAA 3R7QA 3CVLA 2YHEA 4KYOB 3IV0A 2R17C 4I9EA 1HE8A 1Q2ZA 1D8DA 4GTVA 3ZYLA 2HYZA 3MJWA 4NQ0A 2XZDG 3Q49B 3V2XA 1KZPA 2XGSA 4ZHBA 3MKQA 2EQXA 4APOA 1QZ2A 4EZLA 3LEWA 2VJ8A 3OXGA 4TXRA 3PDNA 1HO8A 5CCLA 3DSUA 1Z6TA 3Q5MA 2P9LG 3KAEA 4HB5A 1O1SA 1OY3D 3UM1A 3CVUA 5D0QD 2CG3A 4CGWA 4HBDA 4G25A 4JA7A 3CIAA 3DRAA 1N4SA 3CHPA
chains in the Genus database with same CATH topology
3ZW3A 3RRMB 1E8XA 3AS4A 2BTDA 3RU0A 3N71A 3BEEA 4KVOA 4UQXA 3TXNA 4PH4B 3CK9A 1IHGA 3GYZA 1Y8MA 5E76A 4FU3A 2MOWA 1HS6A 3ZHEA 5FQ7A 4F53A 2CFUA 4A3VA 5G55A 3U3WA 2BF0X 3MV3B 4LEUA 4N39A 4FHJA 4G24A 4HOUA 3B7RL 1MHQA 2XCBA 2L0IA 3NF1A 4WWPA 3RK6A 4F1SA 4AXHA 1UN9A 1N52A 4XKBA 2RD0A 2ONDA 2GW1A 4HOQA 5JHBA 1JWGA 3HDXA 4JHJA 3MZLB 3FTYA 4WNDA 4RG6A 3RJVA 3B7SA 3CHSA 3D9KA 3D9JA 4JW1A 4LRZA 3CVXA 2C0LA 4UWGA 2DCPA 2IU1A 2UY1A 3EHMA 3ZPJA 1HG2A 1NZNA 4N3CA 1UJJA 2V4LA 3K9IA 2PQRA 5G04C 5BPPA 1Z3XA 3FTZA 2WQ6A 5KJMA 3FP3A 3EIQC 1NA0A 3I3NA 2X38A 5JHAA 3FY4A 3LS8A 3HYMB 3B13A 2CHWA 2WXGA 5T4YA 2IQCA 1GW6A 4L2LA 4FHKA 4XI0A 2WPVA 4DI3A 2YNQA 3CR3A 2WXOA 1NP7A 3VLEA 4I6JA 3LPZA 3UPVA 3MX3A 4XX5A 4HOTA 4DPRA 1LF8A 2C0MA 2IF4A 2I1KA 5FZSA 3PH0C 4FJZA 2KM4A 3RKVA 2VSOE 3CEQA 3QNKA 5LFAA 4N2SA 4L1BA 5FJYA 3MGBA 1HXIA 2X6KA 3SNXA 4CDNA 2WXHA 2J4BA 2MRIA 1DVPA 5HQ8A 3B7TA 3Q15A 2V0PA 2WXFA 2KZTB 3FHEA 2MHKA 5G04J 2XQ0A 3PVLA 4J8FA 5A23A 3D3MA 3QKYA 4I6EA 3FUMA 5LCWC 4GA1A 2GRLA 1HZ4A 3LCAA 2IONA 4TRQA 3R7RA 3UQ3A 1SZ9A 3EDTB 1SQMA 3VLFA 5BNWA 3ULQA 1H2TC 4JHKA 4YVOA 2J9QA 2I9CA 4R7LA 2A5UA 4TUUA 5C2YA 5AYWD 3APFA 3S7DA 1XNFA 4JVSA 3UX4A 3G2VA 3CVYA 1IQRA 4YNDA 3ZYQA 4H7YA 4CCAA 1E90A 3G2TA 3NZUA 3RRNB 3FUIA 3TG5A 4ME2A 4I1OB 4CT4A 1BPOA 4ANXA 5BV0A 4A3TA 4GMLA 4AJWA 4C0EA 4ILGA 4J0UA 4FJYA 2I2OA 4EBAA 4NURA 4JXTA 3IBEA 2WXQA 2VQ2A 4AV7A 3D9LA 5BT1A 3FDHA 4I1AA 2VTBA 4UI9J 4JC8A 5LCWJ 1U3CA 3FH8A 1Y6IA 3S7FA 4E6HA 3TXMA 4Q69A 5J08A 3CVVA 3JYSA 2OVFA 5KJLA 2FBNA 2X6FA 3CVQA 2VGXA 3FTXA 2FO7A 4GPKA 1UN8A 3O4ZA 4I2WA 1W3BA 4AVXA 2XPYA 3SBSA 3CHOA 2AXZA 1EPUA 2X6HA 3MKQB 1OWLA 3ENEA 3FUKA 2R5SA 3LXUX 3ZYKA 4CDRA 4GA2A 2IOSA 1ZU2A 2FF4A 3B7UX 3BG1B 4YVQC 2DIWA 2R59A 3FU5A 2HO1A 3P2BA 4DK5A 4M3OA 2XGOA 4BT9A 4U0ZA 5FZRA 1H2VC 2JEKA 3LY7A 2KCLA 4WNEA 2YQ8A 4I6GA 4RVBA 1EDUA 1FVHA 3AS5A 4HFGA 4KXKB 2WXMA 3S2AA 3APCA 1MQSA 3TAXA 3FTUA 3IHVA 4UI9K 3JUIA 3QJZA 4WUYA 4GZ6A 4CT0A 5KJNA 2WB2A 1E8ZA 1H2UA 4QFVA 4EZKA 3L54A 1UJKA 2WXRA 4JEUA 4K0RA 2J09A 3MKRA 5ENNA 4DLOA 4EQFA 4U0SA 4XIFA 4FLBA 3QC1A 2ILRA 2ZU6B 5T8IA 1H0AA 1UW4B 4C9BB 2CHZA 3IHYA 4G1TA 3UT4A 4K03A 4PDXA 4KMOA 1YA0A 2FEZA 2LAIA 5ANRA 4BT8A 4BX8A 5CMWA 4CEMA 1EYHA 1WY6A 5JJ6A 4E85A 2A4ZA 4RG9A 3ASFA 4OVUA 1HX8A 2X6IA 1SZAA 1OWMA 2OOEA 3FEYA 4FP7A 3T8MA 4B0ZA 1QQEA 2LO6A 3PE4A 3BG0B 3OAWA 3CKCA 3FULA 4A55A 1UG3A 5FQ4A 3O48A 3R9AB 1S0PA 1NA3A 2PQNA 3CQGB 3FEXA 4UWHA 3FH7A 3LYAA 4U8HA 3SHFA 3FH5A 1EF1C 1ELWA 3E4BA 4B8AA 4JEHA 2I1JA 2Y3AA 4ANUA 2L9BA 5D0OD 3CSFA 4IYPA 3CQCB 4XZ4A 3ZHEB 2WXIA 4GYYA 4N5CA 2GRMA 4IN3B 2KCVA 3G2UA 2WQ7A 2XPZA 2HR2A 3FUNA 3L17A 2J08A 3UT8A 4JHRA 3ZRHA 4ANVA 4CRWA 4GA0A 2VGYA 4C0MA 2CG2A 1N54A 4U07A 3L6AA 3UT7A 5AENA 4GB9A 5G2NA 4G2VA 3HVEA 4I2ZA 2RG8A 4ILIA 2PZIA 4BX9A 2FULA 2KZTA 4TV3A 5AJDA 3DBSA 2XRYA 2WXKA 2LNIA 3ONKA 4G26A 2Y4UA 4KVMA 2X3MA 1TJFA 2AWIA 2UY1B 2WXLA 3KEZA 3U66A 1JWFA 3FUFA 4FLHA 4AOFA 2LAHA 4Y6WA 3LKUA 3GZ1A 3CSTA 5KJKA 4GYOA 3JQ1A 5JJTA 2XGMA 4UI9C 4KT6B 3SGHA 1KT1A 2I6HA 4J8SA 4KBQA 3ESKA 4BWRA 5ANLA 4FA6A 3G2SA 2Q7FA 1P5QA 5EX3A 1E8YA 3ZGQA 3T5VA 2LSUA 3TGOA 4G23A 4ILHB 3RRUA 3OXLA 1HFAA 3LVQE 1KT0A 4I17A 5DBKA 3MCXA 2YHCA 4GMJA 3MA5A 4A1GA 3AU5A 2VSNA 3RO2A 2E2EA 1IYGA 3QWPA 3L13A 2Y4TA 3PNLB 4O6FA 4F7AA 1QNFA 3ASGA 4DI4A 4GAAA 3FUJA 5FTPA 2QFCA 2KCKA 2KC7A 4IRUA 3DPDA 4HS2A 3SBTB 2LSVA 2WVIA 3FTVA 4IULA 4J6IA 1H6KA 4KZCA 1OUVA 4MKTA 4UWKA 3TJPA 4EBAG 3P1UA 4WNFA 5EX0A 4L23A 5FWQA 3D9PA 1U3DA 2L0TB 1ELRA 1B89A 1E96B 5LX8A 3KD7A 4JZYA 3LY9A 3EJNA 3SI5A 4LUNU 1ZBPA 3U64A 3FFLA 1PC2A 2P58C 3CK8A 4GZ5A 1Z3YA 4HORA 5J90A 3L16A 2OV8A 5AJLA 2WQHA 2WXJA 4ACKA 1DNPA 3WXXA 4AY5A 5EKQD 1WM5A 2C2LA 3CV0A 3GZ2A 5HI7A 2XRZA 3MYVA 5FT9A 4PS3A 3MEKA 4D10C 3ZEFA 2IJGX 3APDA 2DBAA 2VTBB 4PS8A 4LERA 4BY6A 5M72A 3PREA 2AW6A 2BUGA 2J49A 4AEZC 5CMYA 3SFZA 4BTBA 4N2QA 2JLBA 3Q4AB 4Q94A 5CCMA 5A6CA 1OWOA 2J07A 3S7BA 3ASDA 3CHQA 5LP0A 3FUHA 4KZ0A 4AIFA 2NXPA 2WMNA 2J4DA 4B89A 4WWOA 2VGXB 4GCNA 5ARGA 4MRUA 5JJ7A 5G05C 4JA9A 3S7JA 4A1SA 5BUZA 1L5JA 3Q47B 2IOLA 4NACA 4I9CA 3AU4A 3PEVB 2M63A 3D9MA 2PM7A 4APFA 5T3RA 3RO3A 3UUXA 4GYWA 3GZSA 4OVVA 3JCKC 1E7VA 3FUEA 3ZFWA 2QY7A 1HH8A 1OWPA 3NZSA 4P29A 3IEGA 5E75A 4GZ3A 1TJCA 2V8SE 4L2YA 4JL0A 4I43A 3PUJA 3QK0A 3ESLA 2WXNA 2XCCA 3FTSA 3CHRA 4U0UA 4XI9A 3HIZA 3L08A 4AM9A 2NC9A 5C1DA 3JQ0A 2HM8A 3CK7A 4F3VA 2VSXE 5G05J 2VSYA 3I4GA 4GCOA 3ZVVA 3PRZA 2YINA 1A17A 3C98A 3NQPA 3UMVA 4N3BA 3U9WA 2AXVA 4PUCA 4CDMA 3RIBA 3PS6A 2PL2A 1H19A 3CGHA 2L6JA 3CKBA 3FU6A 3CHMA 5BW8C 3LY8A 1ELKA 3ONLA 4J8DA 3ZIMA 2XEVA 3GW4A 4G11A 3ZXSA 2WMOA 5FZQA 3FWVA 4BSXA 3CVWA 3ML9A 5A7DB 3SD5A 3D9OA 4V3IA 1HF8A 5AIJA 4BFRA 4MLPA 3VLDA 4EPZA 3I4RB 2AVPA 4LCTA 3SZ7A 3ASHA 2FI7A 4JPSA 4FADA 3URZA 4HLEA 4WWNA 3OXFA 4HXIA 1PY1A 3HHMA 3QWWA 3G2WA 4XKCA 5FQ6A 4EECA 1FVFA 3QB2A 3AS8A 1JPLA 4ACLA 2X6JA 3SF4A 4UQYA 3EIJA 2E0IA 5FQ8A 3ZYMA 4UQZA 3IKOB 3HVEB 3LJ3A 2OVBA 4Y6CA 2XHEA 4PS7A 3CVPA 3L22A 4OYSA 1PAQA 3FTWA 3QWVA 3QDNA 4DJAA 4HOSA 3R7QA 3VTXA 3CVLA 2YHEA 4KYOB 3TL5A 3IV0A 5KCMA 3LDZA 2V5FA 2R17C 4I9EA 4RSYA 4W9RA 4XE0A 4NRHB 1HE8A 2CFZA 3QOUA 4L7TA 4ATGA 2KATA 4MS6A 2AXUA 1JUQA 3OTNA 3ZYLA 2HYZA 4BTAA 1VDYA 3MJWA 4B8CB 3PNTB 4HVBA 2NSZA 4NQ0A 1IQUA 3PEUB 3Q49B 3QAQA 4FULA 4EZJA 1E7UA 4H7XA 2XGSA 3PZDA 4J8EA 3T5XA 3I5PA 3MKQA 2EQXA 4APOA 3FU0A 1WAO1 2XPIA 3PE3A 5LOZA 3MV2B 5ARFA 3CVNA 1QZ2A 4DLQA 4EZLA 2WXPA 4I1MA 3ML8A 3LEWA 2UWJG 2VJ8A 3LVRE 5CHEE 4B94A 3OXGA 1XGWA 1HO8A 3CLJA 3D9NA 3PDNA 4UWFA 5CCLA 4CGVA 1Z6TA 3FUDA 4GU5A 3Q5MA 1OWNA 4Q96A 2IFUA 2WM9A 3FU3A 3KAEA 3D9IA 1INZA 2VYIA 3EHNA 4AP2A 5BV1A 4URKA 1FCHA 3TG4A 5EDSA 1HG5A 4U04A 3ZN3A 2GGFA 3U4TA 4ABNA 1KLXA 4UWLA 4FC8A 4AY6A 4ANWA 1HU3A 4U63A 3CVUA 2PM6A 5D0QD 4WNGA 3VTYA 2CHXA 2CG3A 4CGWA 4N3AA 4G25A 3KS2A 1E8WA 4JA7A 1TEZA 3CIAA 3QARA 5DIZA 4WAFA 4GZCA 3PUKA 4GZDA 1X5BA 3CHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RU0 A;  3AS4 A;  3N71 A;  3BEE A;  4UQX A;  3CK9 A;  1IHG A;  3GYZ A;  1Y8M A;  3ZHE A;  3U3W A;  4N39 A;  3MV3 B;  4LEU A;  4G24 A;  4HOU A;  3NF1 A;  2XCB A;  2OND A;  2GW1 A;  4HOQ A;  4WND A;  4RG6 A;  3RJV A;  2C0L A;  2UY1 A;  3ZPJ A;  1NZN A;  4N3C A;  3K9I A;  2PQR A;  5G04 C;  5KJM A;  3FP3 A;  1NA0 A;  3HYM B;  4XI0 A;  2WPV A;  3UPV A;  3LPZ A;  4HOT A;  2IF4 A;  2C0M A;  5FZS A;  3RKV A;  3CEQ A;  4N2S A;  5FJY A;  1HXI A;  5HQ8 A;  3Q15 A;  5G04 J;  2MHK A;  4J8F A;  3QKY A;  5LCW C;  4GA1 A;  1HZ4 A;  3LCA A;  3UQ3 A;  3EDT B;  5BNW A;  3ULQ A;  4YVO A;  2J9Q A;  5AYW D;  3S7D A;  1XNF A;  4YND A;  4H7Y A;  3TG5 A;  4ME2 A;  4J0U A;  2VQ2 A;  5BT1 A;  4I1A A;  4UI9 J;  5LCW J;  3S7F A;  3JYS A;  5KJL A;  2FBN A;  3CVQ A;  2VGX A;  2FO7 A;  4GPK A;  4I2W A;  1W3B A;  2R5S A;  4CDR A;  4GA2 A;  1ZU2 A;  2FF4 A;  4YVQ C;  2HO1 A;  2XGO A;  4BT9 A;  4U0Z A;  5FZR A;  3LY7 A;  2KCL A;  4WNE A;  2YQ8 A;  3AS5 A;  4KXK B;  3TAX A;  4UI9 K;  5KJN A;  4WUY A;  4GZ6 A;  3MKR A;  4EQF A;  4U0S A;  4XIF A;  4G1T A;  4BT8 A;  1YA0 A;  2FEZ A;  5JJ6 A;  4RG9 A;  3ASF A;  2OOE A;  1QQE A;  3PE4 A;  3CKC A;  3R9A B;  3O48 A;  2PQN A;  1NA3 A;  3LYA A;  1ELW A;  3E4B A;  5D0O D;  3ZHE B;  4GYY A;  4N5C A;  4IN3 B;  2KCV A;  2HR2 A;  4JHR A;  4GA0 A;  2VGY A;  4U07 A;  4G2V A;  4I2Z A;  2PZI A;  4G26 A;  2LNI A;  2Y4U A;  2UY1 B;  4Y6W A;  3LKU A;  3GZ1 A;  5KJK A;  4GYO A;  5JJT A;  2XGM A;  4UI9 C;  1KT1 A;  2I6H A;  4KBQ A;  3ESK A;  4BWR A;  2Q7F A;  1P5Q A;  5EX3 A;  3ZGQ A;  2LSU A;  3TGO A;  4G23 A;  3OXL A;  4I17 A;  1KT0 A;  5DBK A;  2YHC A;  3MA5 A;  2VSN A;  3RO2 A;  2E2E A;  1IYG A;  3QWP A;  2Y4T A;  4O6F A;  3ASG A;  5FTP A;  2QFC A;  2KCK A;  2KC7 A;  2LSV A;  1OUV A;  5EX0 A;  4WNF A;  1ELR A;  1B89 A;  1E96 B;  3KD7 A;  3LY9 A;  1ZBP A;  3FFL A;  1PC2 A;  2P58 C;  3CK8 A;  4GZ5 A;  4HOR A;  2WQH A;  3WXX A;  4AY5 A;  5EKQ D;  1WM5 A;  2C2L A;  3CV0 A;  3GZ2 A;  5HI7 A;  5FT9 A;  3MEK A;  2DBA A;  5M72 A;  2BUG A;  4BTB A;  4N2Q A;  2JLB A;  3Q4A B;  5CCM A;  5A6C A;  3S7B A;  3ASD A;  4AIF A;  2VGX B;  4GCN A;  5ARG A;  5JJ7 A;  5G05 C;  4JA9 A;  3S7J A;  4A1S A;  3Q47 B;  4I9C A;  3RO3 A;  3UUX A;  4GYW A;  3ZFW A;  1HH8 A;  3IEG A;  4GZ3 A;  1TJC A;  4JL0 A;  2XCC A;  4U0U A;  4XI9 A;  4AM9 A;  2NC9 A;  5C1D A;  3CK7 A;  4F3V A;  5G05 J;  2VSY A;  4GCO A;  1A17 A;  4N3B A;  3RIB A;  2PL2 A;  2L6J A;  3CKB A;  5BW8 C;  3LY8 A;  4J8D A;  2XEV A;  3GW4 A;  5FZQ A;  3FWV A;  5A7D B;  2AVP A;  3SZ7 A;  3ASH A;  2FI7 A;  3URZ A;  3OXF A;  3QWW A;  3AS8 A;  3SF4 A;  4UQY A;  4UQZ A;  4Y6C A;  3CVP A;  3QWV A;  3QDN A;  4HOS A;  3VTX A;  3CVL A;  4KYO B;  2V5F A;  4I9E A;  4W9R A;  4NRH B;  3QOU A;  2KAT A;  2HYZ A;  4BTA A;  4NQ0 A;  3Q49 B;  4H7X A;  2XGS A;  4J8E A;  4APO A;  1WAO 1;  2XPI A;  3PE3 A;  3MV2 B;  5ARF A;  3CVN A;  1QZ2 A;  2UWJ G;  4B94 A;  5CHE E;  3OXG A;  3PDN A;  5CCL A;  4CGV A;  3Q5M A;  2IFU A;  3KAE A;  2VYI A;  1FCH A;  3TG4 A;  4U04 A;  3ZN3 A;  3U4T A;  4ABN A;  1KLX A;  4AY6 A;  5D0Q D;  4WNG A;  3VTY A;  4CGW A;  4N3A A;  4G25 A;  3KS2 A;  4JA7 A;  5DIZ A; 
#chains in the Genus database with same CATH topology
 3N71 A;  3CK9 A;  3E32 A;  2MOW A;  4F53 A;  2BF0 X;  2V5Q C;  2XCB A;  1KZO A;  1N52 A;  2RKK A;  2RD0 A;  2P9P G;  4HOQ A;  5JHB A;  4JHJ A;  4WND A;  1MX6 A;  3V30 A;  5ENQ D;  1HG2 A;  2P9S G;  2V4L A;  2WQ6 A;  3Q73 A;  5KJM A;  3FP3 A;  3I3N A;  5AAR A;  3HYM B;  3B13 A;  5CBN A;  3EHR A;  3CR3 A;  2WXO A;  1SW6 A;  2C0M A;  2KM4 A;  3CEQ A;  5LFA A;  5FJY A;  2MRI A;  5AAO A;  5HQ8 A;  2MHK A;  3QKY A;  3BQO A;  1HZ4 A;  2ION A;  3R7R A;  2OEV A;  3UIO C;  3VLF A;  4R7L A;  3UX4 A;  1X81 A;  4GTM A;  4LNG A;  3FUI A;  5CRV A;  1NL4 A;  4C0E A;  3Q9U C;  4M7C A;  1TNZ A;  3AG4 E;  3D9L A;  2VTB A;  3J5P A;  1V54 E;  3FH8 A;  4E6H A;  3E34 A;  3JYS A;  2ZGD A;  4BSZ B;  3CVQ A;  4DX6 D;  1N11 A;  5CBO A;  3AG3 E;  4I2W A;  3KEA A;  2AXZ A;  2X6H A;  1OWL A;  3ENE A;  1BLX B;  3BG1 B;  2DIW A;  2EIM E;  3FU5 A;  4M3O A;  4J7W A;  4U0Z A;  5FZR A;  2JEK A;  2KCL A;  1TN7 A;  3B95 A;  4HFG A;  3AS5 A;  4KXK B;  3S2A A;  1TN6 A;  4O1O A;  1E8Z A;  1H2U A;  1UJK A;  4JEU A;  3TWS A;  3MKR A;  4EQF A;  4JD2 G;  4XIF A;  4ZFH A;  4FLB A;  5KBA A;  4PDX A;  1WY6 A;  2A4Z A;  3ASF A;  1HX8 A;  1SZA A;  1MX2 A;  3T8M A;  4B0Z A;  3CKC A;  1UG3 A;  1NA3 A;  3FH7 A;  3JUE A;  4JEH A;  5D0O D;  1N94 A;  3ZHE B;  4N5C A;  4IN3 B;  1Z5S C;  3UT8 A;  4ANV A;  2L6B A;  3UT7 A;  4GB9 A;  3HVE A;  2RG8 A;  5ENO D;  3HXB A;  2FUL A;  2WXK A;  2UY1 B;  3LKU A;  5EIL A;  4GYO A;  3SY2 A;  5EID A;  1SVX A;  4KT6 B;  4U8V D;  4J8S A;  2JAB A;  4BWR A;  2ZXW E;  5EX3 A;  5DBK A;  2YHC A;  3RO2 A;  3QWP A;  1WG0 A;  3AG1 E;  4GAA A;  2KC7 A;  3SBT B;  4NIK A;  4IUL A;  4UWK A;  1H6K A;  4QQI A;  5H7P A;  1N0Q A;  4JZY A;  2F8Y A;  3EJN A;  1ZBP A;  4GZ5 A;  1Z3Y A;  1IKN D;  5J90 A;  2OV8 A;  2WXJ A;  4ACK A;  3WXX A;  3CV0 A;  3MEK A;  2J49 A;  5CMY A;  4AIF A;  4B89 A;  4WWO A;  2VGX B;  1OCO E;  5G05 C;  1S70 B;  1L5J A;  4I9C A;  2PM7 A;  2EIN E;  3ZU7 B;  3JCK C;  1NI1 A;  1HH8 A;  3L82 A;  1RW2 A;  4GZ3 A;  1TJC A;  2V8S E;  3NBN B;  4L2Y A;  4JL0 A;  3QK0 A;  1TYQ G;  3CHR A;  5BXU A;  4U0U A;  3HIZ A;  5KWD A;  4F3V A;  1AP7 A;  3I4G A;  3L9T A;  2YIN A;  1D8E A;  5HS0 A;  3UMV A;  2AXV A;  3PS6 A;  3D9H A;  1BD8 A;  2R2L A;  4J8D A;  2XEV A;  3GW4 A;  3JXJ A;  3SD5 A;  4V3I A;  4EPZ A;  1S63 A;  2P9I G;  4LCT A;  2MYO A;  3SZ7 A;  3ASH A;  3URZ A;  2KBX A;  1FVF A;  4GTQ A;  3Q7A A;  4ACL A;  5FQ8 A;  3ZYM A;  4UQZ A;  2XHE A;  4OYS A;  1PAQ A;  3FTW A;  2H6I A;  3QWV A;  3TL5 A;  3LDZ A;  2V5F A;  4NRH B;  2CFZ A;  4L7T A;  4ATG A;  2KAT A;  4MS6 A;  2AXU A;  1BU9 A;  4HVB A;  4O1P A;  3QAQ A;  4EZJ A;  4H7X A;  3I5P A;  3PZ3 A;  4RLY A;  1LD8 A;  1DCQ A;  1WAO 1;  2XPI A;  5LOZ A;  3ZKJ A;  4GTS A;  3HXF A;  3LVR E;  4B94 A;  5D66 A;  4OAU C;  1XGW A;  3D9N A;  4UWF A;  4G8L A;  1OCZ E;  1OWN A;  3D9I A;  4BER A;  2VYI A;  4AP2 A;  1HG5 A;  2GGF A;  3U4T A;  4ABN A;  1KLX A;  2XEH A;  4FC8 A;  1HU3 A;  2PM6 A;  3TWQ A;  2VGE A;  3HG0 D;  4DX1 A;  2CHX A;  5DIZ A;  4WAF A;  1TR4 A;  3RRM B;  1E8X A;  3AS4 A;  3RU0 A;  3BEE A;  4PH4 B;  1IHG A;  3GYZ A;  1JCQ A;  1Y8M A;  4FU3 A;  5BXO A;  1HS6 A;  5G55 A;  3U3W A;  4N39 A;  4G24 A;  3NF1 A;  2L0I A;  4F1S A;  4XKB A;  4DX5 D;  3HDX A;  4RG6 A;  3CHS A;  3D9J A;  4LRZ A;  3CVX A;  2C0L A;  4UWG A;  3ZPJ A;  4LNU D;  5BPP A;  1Z3X A;  3FTZ A;  3ZNG A;  3FY4 A;  3LS8 A;  5T4Y A;  2IQC A;  4L2L A;  4XI0 A;  1TN8 A;  3VLE A;  3UPV A;  4XX5 A;  4HI8 A;  4GMR A;  2IF4 A;  2I1K A;  1N4P A;  3RKV A;  2EIK E;  2VSO E;  3QNK A;  4N2S A;  4L1B A;  3SNX A;  2WXH A;  2J4B A;  3FHE A;  2KZT B;  2XQ0 A;  4J8F A;  3D3M A;  3UIN C;  2GRL A;  3LCA A;  4TRQ A;  2RFA A;  5C2Y A;  3APF A;  3S7D A;  4JVS A;  3CVY A;  3G2V A;  4CCA A;  3E33 A;  1IHB A;  3G2T A;  1YYH A;  3RRN B;  4I1O B;  5IY5 E;  1DCE A;  3TWW A;  4A3T A;  4GML A;  4AJW A;  4FJY A;  4HRN A;  1QYM A;  4JXT A;  3IBE A;  4X8Q A;  4JC8 A;  3S7F A;  3TXM A;  5J08 A;  3CVV A;  2OVF A;  4MBG A;  5KJL A;  2FBN A;  2F0Y A;  4DX7 D;  3Q9N C;  4J8Y A;  3ASN E;  2XPY A;  3FUK A;  4CDR A;  4GA2 A;  1ZU2 A;  2FF4 A;  4YVQ C;  5CED B;  3P2B A;  5D2M C;  2XGO A;  3LY7 A;  4I6G A;  1EDU A;  1FVH A;  4OAV B;  3APC A;  4WUY A;  3PZ1 A;  4CT0 A;  2EIL E;  2DWZ A;  2WB2 A;  4QFV A;  3TWX A;  3HXE A;  4DLO A;  3QC1 A;  2ZU6 B;  1H0A A;  2CHZ A;  3UT4 A;  4K03 A;  4KMO A;  4BT8 A;  2LAI A;  5CMW A;  1EYH A;  4RG9 A;  3DEO A;  2OOE A;  2DYR E;  1LTX A;  4A55 A;  3OAW A;  4A63 B;  5FQ4 A;  3CQG B;  3FEX A;  3LYA A;  4U8H A;  3FH5 A;  2Y3A A;  3CSF A;  3CQC B;  2WXI A;  3G2U A;  2QYU A;  2XPZ A;  3FUN A;  3ZRH A;  4CRW A;  4LSZ E;  4GA0 A;  2CG2 A;  1N54 A;  5AEN A;  2V4H C;  4I2Z A;  3ULE G;  2KZT A;  5AJD A;  2XRY A;  3HXD A;  4KVM A;  5FQ6 A;  3U66 A;  2X3M A;  1TJF A;  2WXL A;  4U8Y D;  1JWF A;  3FUF A;  4AOF A;  4FLH A;  2LAH A;  5KJK A;  3JQ1 A;  5JJT A;  1YMP A;  2XGM A;  3SGH A;  2I6H A;  3G2S A;  1P5Q A;  1E8Y A;  4ILH B;  2H6G A;  2ETB A;  3OXL A;  2R03 A;  4I17 A;  3MCX A;  4A1G A;  3AU5 A;  2E2E A;  2Y4T A;  4O6F A;  3ASG A;  5AQA A;  4U95 D;  2QFC A;  4IRU A;  4HS2 A;  3AJI A;  2LSV A;  4MKT A;  4J6I A;  4KZC A;  1OUV A;  2DZO A;  4B93 B;  4L23 A;  1U3D A;  2L0T B;  5B1B E;  3TWU A;  3TWV A;  4LUN U;  1PC2 A;  4GTT A;  3B7B A;  2WQH A;  3DEP A;  3GZ2 A;  2XRZ A;  4PS3 A;  4D10 C;  3DWL G;  2IJG X;  5M72 A;  4LER A;  4N2Q A;  4Q94 A;  5A6C A;  3S7B A;  4K5B A;  5LP0 A;  3FUH A;  4KZ0 A;  3C3Q A;  2J4D A;  2P9N G;  4K5C A;  4MRU A;  5BUZ A;  1N4R A;  2ZGG A;  2IOL A;  4NAC A;  2DVW A;  5ENP D;  3D9M A;  4OVV A;  1E7V A;  3ZFW A;  3NZS A;  5E75 A;  4EHM A;  4YDY A;  2WXN A;  3FTS A;  3DSV A;  3L08 A;  4XEI G;  4AM9 A;  5C1D A;  2DZN A;  3CK7 A;  2VSX E;  2OCC E;  5G05 J;  4L9P A;  4PUC A;  3RIB A;  3NB2 A;  2L6J A;  3CKB A;  5BW8 C;  3LY8 A;  3ZIM A;  4G11 A;  2WMO A;  1N9A A;  4BSX A;  1ZB1 A;  1MYO A;  5A7D B;  1HF8 A;  5AIJ A;  3VLD A;  2AVP A;  4JPS A;  4WWN A;  5ENS D;  3HHM A;  4XKC A;  3G2W A;  1JPL A;  5HRY A;  4DX2 A;  3EIJ A;  2E0I A;  3LJ3 A;  3E37 A;  3L22 A;  1YCS B;  4HOS A;  4U7E B;  3VTX A;  1JCS A;  5KCM A;  3QOU A;  4GTP A;  3OTN A;  3NAW A;  4BTA A;  1VDY A;  4B8C B;  1IQU A;  3PEU B;  3AG2 E;  1E7U A;  3PZD A;  4J8E A;  2H6F A;  5EIB E;  3PE3 A;  5ARF A;  3C3O A;  2WXP A;  4I1M A;  3ML8 A;  2EIJ E;  2UWJ G;  5CHE E;  5KNH D;  3FUD A;  3PZ4 A;  4Q96 A;  3FU3 A;  1INZ A;  2BKK B;  4LG6 A;  3EHN A;  3TG4 A;  3ZN3 A;  4AY6 A;  4ANW A;  4U63 A;  4WNG A;  4HNA D;  2GRP B;  3KS2 A;  1O5M A;  3QAR A;  4GZC A;  3PUK A;  4GZD A;  5JMN D;  3ZW3 A;  2BTD A;  4UQX A;  2BED A;  5E76 A;  3ZHE A;  2RFM A;  2ZIR A;  5FQ7 A;  2CFU A;  4A3V A;  1UOH A;  3SFX A;  2GRN B;  3ZXP A;  4LEU A;  4FHJ A;  4HOU A;  1MHQ A;  4WWP A;  2OND A;  1JWG A;  3Q78 A;  3FTY A;  3ABK E;  3RJV A;  3B7S A;  3D9K A;  2DCP A;  2IU1 A;  1KPS B;  2UY1 A;  1NZN A;  3X2Q E;  3K9I A;  5G04 C;  3EIQ C;  1NA0 A;  2XS1 A;  5JHA A;  2WXG A;  1GW6 A;  1H6O A;  4FHK A;  5CEA A;  2WPV A;  4DI3 A;  1NP7 A;  1TNY A;  3HRA A;  4I6J A;  1LF8 A;  5FZS A;  3NOG D;  3UM2 A;  1FT1 A;  3B7T A;  2V0P A;  5A23 A;  5LCW C;  4I6E A;  3FUM A;  2QYJ A;  3UQ3 A;  2P2C P;  1SQM A;  5BNW A;  3ULQ A;  2I9C A;  4TUU A;  5AYW D;  1XNF A;  1IQR A;  4H7Y A;  1V55 E;  3NZU A;  3Q75 A;  4YDO A;  1BPO A;  4J0U A;  4NUR A;  3UKU G;  5ENT D;  4AV7 A;  5BT1 A;  3FDH A;  4UI9 J;  1U3C A;  3AAA C;  5CEC B;  2VGX A;  4O60 A;  4GPK A;  1UN8 A;  4AVX A;  3SBS A;  3CHO A;  3MKQ B;  3ZYK A;  4YDW A;  1S64 A;  2HO1 A;  4DK5 A;  4BT9 A;  1OCC E;  4WNE A;  2WXM A;  2ZIS A;  1MQS A;  3QJZ A;  2XS8 A;  2WXR A;  4K0R A;  4U0S A;  3IXE A;  5T8I A;  4C9B B;  2XEE A;  4G1T A;  4BX8 A;  4CEM A;  5B3S E;  4OVU A;  3FEY A;  3C5R A;  1QQE A;  3PE4 A;  3BG0 B;  3R9A B;  5KNG A;  1S0P A;  2PQN A;  3JXI A;  3R9M A;  3DST A;  3ULY A;  3ISM C;  2L9B A;  4IYP A;  5HKP A;  3TWT A;  2KCV A;  2Y0B G;  4TXQ A;  1U2V G;  2WQ7 A;  3L17 A;  2J08 A;  1MJ0 A;  5G2N A;  4G2V A;  2PZI A;  4BX9 A;  3DBS A;  2LNI A;  5EYP F;  3KEZ A;  4UI9 C;  4KBQ A;  5FIO A;  3ESK A;  5ANL A;  3T5V A;  3ZGQ A;  1OT8 A;  2LSU A;  5EYL A;  4BES A;  2F37 A;  1KT0 A;  3MA5 A;  3EU5 A;  3L13 A;  3PNL B;  4F7A A;  3FUJ A;  2B6C A;  5FTP A;  4Z68 A;  2B0O E;  3FTV A;  4EBA G;  3SQV A;  5EX0 A;  4WNF A;  5CRU A;  3EHQ A;  1ELR A;  5LX8 A;  3KD7 A;  5AQB A;  3SI5 A;  3DSS A;  3U64 A;  3L16 A;  2ETA A;  5AJL A;  3V31 A;  5EKQ D;  2C2L A;  5HI7 A;  2IO3 C;  3MYV A;  5FT9 A;  5B1A E;  2VTB B;  4PS8 A;  4AEZ C;  3SFZ A;  2JLB A;  3Q4A B;  5CCM A;  3ASD A;  3CHQ A;  3J5Q B;  4GTO A;  2WMN A;  4CZ2 D;  5ARG A;  4JA9 A;  3Q47 B;  3PEV B;  3LJN A;  4APF A;  3RO3 A;  4GYW A;  2LUH A;  1FT2 A;  3WG7 E;  4P29 A;  3IEG A;  1K8K G;  3ESL A;  2NC9 A;  1K1A A;  3JQ0 A;  2HM8 A;  4DUI A;  2VSY A;  3T8K A;  3NQP A;  4N5Q A;  4N3B A;  2PL2 A;  2IEJ A;  3CGH A;  3FU6 A;  3CHM A;  3ZXS A;  5FZQ A;  3NOC D;  1MZC A;  4F6R D;  2Y69 E;  1K1B A;  4GTR A;  4YDE A;  3Q7F A;  3OXF A;  4HXI A;  3QWW A;  4EEC A;  3QB2 A;  2X6J A;  3SF4 A;  1NFI E;  3HVE B;  2OVB A;  4Y6C A;  4PS7 A;  3QDN A;  2R02 A;  4RSY A;  4W9R A;  4XE0 A;  1JUQ A;  1A5E A;  3PNT B;  2NSZ A;  4FUL A;  5CER B;  2GRQ B;  2XZT G;  3T5X A;  3BUA A;  2FO1 E;  3FU0 A;  3MV2 B;  3DSW A;  3CVN A;  4DLQ A;  3CLJ A;  4CGV A;  4GU5 A;  2IFU A;  2WM9 A;  1TNU A;  3W9G A;  4GPM A;  1G3N B;  5BV1 A;  4URK A;  2KXP C;  1FCH A;  5EDS A;  4U04 A;  3ZUV B;  4UWL A;  2ETC A;  3VTY A;  3V79 K;  4U96 D;  4N3A A;  1E8W A;  1TEZ A;  1X5B A;  1OCR E;  1BI7 B;  4KVO A;  3TXN A;  2IO2 C;  3ABL E;  4F1P A;  1WDY A;  5ENR D;  3MV3 B;  4JB8 P;  3B7R L;  3RK6 A;  4AXH A;  1UN9 A;  3UM3 A;  1FPP A;  2F8X K;  2GW1 A;  3KSQ A;  3MZL B;  3Q79 A;  4JW1 A;  3UTM A;  3EHM A;  3UXG A;  3F6Q A;  4N3C A;  1UJJ A;  2PQR A;  3RSE G;  2X38 A;  2CHW A;  3TWR A;  3EUV A;  5ITZ F;  2YNQ A;  3LPZ A;  3MX3 A;  2BKG A;  4HOT A;  4DPR A;  3SFY A;  3PH0 C;  4FJZ A;  4LNB A;  2A5E A;  3MGB A;  1HXI A;  2X6K A;  4CDN A;  3EU9 A;  5AQ9 A;  1DVP A;  3Q15 A;  2WXF A;  5G04 J;  4C48 B;  3PVL A;  4GA1 A;  3DPY A;  1SZ9 A;  3EDT B;  1H2T C;  4JHK A;  4YVO A;  2J9Q A;  2A5U A;  1N0R A;  2R05 A;  3ZYQ A;  4YND A;  3ABM E;  1E90 A;  3TG5 A;  4ME2 A;  4CT4 A;  4ANX A;  5BV0 A;  1SA5 A;  4ILG A;  2I2O A;  4EBA A;  5AN8 A;  3T9K A;  2WXQ A;  2VQ2 A;  5JA4 D;  4I1A A;  5LCW J;  1Y6I A;  2QC9 A;  3UI2 A;  4Q69 A;  4BET A;  2X6F A;  3FTX A;  2FO7 A;  4HRL A;  3O4Z A;  1W3B A;  2H6H A;  1EPU A;  3LXU X;  2R5S A;  2IOS A;  3B7U X;  2R59 A;  1H2V C;  2YQ8 A;  4RVB A;  3V2O A;  4HI9 A;  3TAX A;  3FTU A;  2P9K G;  3IHV A;  4UI9 K;  3JUI A;  5KJN A;  4GZ6 A;  3W9F A;  2DYS E;  3SO8 A;  4EZK A;  3L54 A;  1TNO A;  2J09 A;  5ENN A;  4K5A B;  2ILR A;  1UW4 B;  3IHY A;  1TNB A;  5ANR A;  1YA0 A;  2FEZ A;  2Y1L E;  4HLL A;  5JJ6 A;  4E85 A;  2X6I A;  1OWM A;  4FP7 A;  2LO6 A;  3FUL A;  3O48 A;  4UWH A;  1O1T A;  3SHF A;  1EF1 C;  1ELW A;  3E4B A;  4B8A A;  2I1J A;  2J8S D;  4ANU A;  3C3R A;  4XZ4 A;  4GYY A;  2GRM A;  2GRR B;  2HR2 A;  1N95 A;  4JHR A;  4C0M A;  2VGY A;  4U07 A;  3L6A A;  5AQ7 A;  4DRX E;  2GRO B;  3RAU A;  4ILI A;  4TV3 A;  4G26 A;  3ONK A;  2Y4U A;  4UUC A;  2AWI A;  3UKR G;  3E30 A;  2OEW A;  3HXC A;  4Y6W A;  3GZ1 A;  3CST A;  1KT1 A;  1OXJ A;  4FA6 A;  2Q7F A;  1IXV A;  1QBQ A;  2NYJ A;  1BI8 B;  3TGO A;  4G23 A;  3RRU A;  1HFA A;  3LVQ E;  1MX4 A;  4GMJ A;  2VSN A;  1IYG A;  4TXP A;  3UIP C;  1QNF A;  1RZ4 A;  4DI4 A;  2KCK A;  3DPD A;  2WVI A;  1H6P A;  3TJP A;  4RQI A;  3P1U A;  5FWQ A;  3D9P A;  1B89 A;  1E96 B;  3LY9 A;  3FFL A;  2P58 C;  3CK8 A;  4G8K A;  4HOR A;  1DNP A;  4AY5 A;  1WM5 A;  1DC2 A;  3ZEF A;  3APD A;  2DBA A;  4BY6 A;  3PRE A;  2AW6 A;  2BUG A;  4BTB A;  5FIN A;  4CYM D;  1OWO A;  2J07 A;  3DSX A;  2LXL A;  2NXP A;  4GCN A;  4ATZ D;  5JJ7 A;  3UM0 A;  3S7J A;  4A1S A;  3PZ2 A;  2XEN A;  3AU4 A;  2M63 A;  5T3R A;  3UUX A;  3GZS A;  1O1R A;  3FUE A;  2QY7 A;  1OWP A;  3BU8 A;  1D9S A;  2AJA A;  1N4Q A;  3DXM G;  4HQD A;  2LXM A;  2IY0 C;  4I43 A;  3PUJ A;  4BEP A;  2XCC A;  4XI9 A;  4TUM A;  2HE0 A;  4GCO A;  3ZVV A;  3PRZ A;  1A17 A;  3C98 A;  3U9W A;  1JCR A;  3KSL A;  4CDM A;  5EN5 D;  1H19 A;  1ELK A;  3ONL A;  2PNN A;  3FWV A;  3C72 A;  3CVW A;  3ML9 A;  3D9O A;  4BFR A;  4MLP A;  3DXK G;  3I4R B;  4HRM B;  1LD7 A;  2FI7 A;  4FAD A;  4HLE A;  2QZA A;  1PY1 A;  3AS8 A;  4UQY A;  1AWC B;  3ASO E;  2P9U G;  1SA4 A;  3IKO B;  3CVP A;  1K3Z D;  4DJA A;  3R7Q A;  3CVL A;  2YHE A;  4KYO B;  3IV0 A;  2R17 C;  4I9E A;  1HE8 A;  1Q2Z A;  1D8D A;  4GTV A;  3ZYL A;  2HYZ A;  3MJW A;  4NQ0 A;  2XZD G;  3Q49 B;  3V2X A;  1KZP A;  2XGS A;  4ZHB A;  3MKQ A;  2EQX A;  4APO A;  1QZ2 A;  4EZL A;  3LEW A;  2VJ8 A;  3OXG A;  4TXR A;  3PDN A;  1HO8 A;  5CCL A;  3DSU A;  1Z6T A;  3Q5M A;  2P9L G;  3KAE A;  4HB5 A;  1O1S A;  1OY3 D;  3UM1 A;  3CVU A;  5D0Q D;  2CG3 A;  4CGW A;  4HBD A;  4G25 A;  4JA7 A;  3CIA A;  3DRA A;  1N4S A;  3CHP A; 
#chains in the Genus database with same CATH homology
 3ZW3 A;  3RRM B;  1E8X A;  3AS4 A;  2BTD A;  3RU0 A;  3N71 A;  3BEE A;  4KVO A;  4UQX A;  3TXN A;  4PH4 B;  3CK9 A;  1IHG A;  3GYZ A;  1Y8M A;  5E76 A;  4FU3 A;  2MOW A;  1HS6 A;  3ZHE A;  5FQ7 A;  4F53 A;  2CFU A;  4A3V A;  5G55 A;  3U3W A;  2BF0 X;  3MV3 B;  4LEU A;  4N39 A;  4FHJ A;  4G24 A;  4HOU A;  3B7R L;  1MHQ A;  2XCB A;  2L0I A;  3NF1 A;  4WWP A;  3RK6 A;  4F1S A;  4AXH A;  1UN9 A;  1N52 A;  4XKB A;  2RD0 A;  2OND A;  2GW1 A;  4HOQ A;  5JHB A;  1JWG A;  3HDX A;  4JHJ A;  3MZL B;  3FTY A;  4WND A;  4RG6 A;  3RJV A;  3B7S A;  3CHS A;  3D9K A;  3D9J A;  4JW1 A;  4LRZ A;  3CVX A;  2C0L A;  4UWG A;  2DCP A;  2IU1 A;  2UY1 A;  3EHM A;  3ZPJ A;  1HG2 A;  1NZN A;  4N3C A;  1UJJ A;  2V4L A;  3K9I A;  2PQR A;  5G04 C;  5BPP A;  1Z3X A;  3FTZ A;  2WQ6 A;  5KJM A;  3FP3 A;  3EIQ C;  1NA0 A;  3I3N A;  2X38 A;  5JHA A;  3FY4 A;  3LS8 A;  3HYM B;  3B13 A;  2CHW A;  2WXG A;  5T4Y A;  2IQC A;  1GW6 A;  4L2L A;  4FHK A;  4XI0 A;  2WPV A;  4DI3 A;  2YNQ A;  3CR3 A;  2WXO A;  1NP7 A;  3VLE A;  4I6J A;  3LPZ A;  3UPV A;  3MX3 A;  4XX5 A;  4HOT A;  4DPR A;  1LF8 A;  2C0M A;  2IF4 A;  2I1K A;  5FZS A;  3PH0 C;  4FJZ A;  2KM4 A;  3RKV A;  2VSO E;  3CEQ A;  3QNK A;  5LFA A;  4N2S A;  4L1B A;  5FJY A;  3MGB A;  1HXI A;  2X6K A;  3SNX A;  4CDN A;  2WXH A;  2J4B A;  2MRI A;  1DVP A;  5HQ8 A;  3B7T A;  3Q15 A;  2V0P A;  2WXF A;  2KZT B;  3FHE A;  2MHK A;  5G04 J;  2XQ0 A;  3PVL A;  4J8F A;  5A23 A;  3D3M A;  3QKY A;  4I6E A;  3FUM A;  5LCW C;  4GA1 A;  2GRL A;  1HZ4 A;  3LCA A;  2ION A;  4TRQ A;  3R7R A;  3UQ3 A;  1SZ9 A;  3EDT B;  1SQM A;  3VLF A;  5BNW A;  3ULQ A;  1H2T C;  4JHK A;  4YVO A;  2J9Q A;  2I9C A;  4R7L A;  2A5U A;  4TUU A;  5C2Y A;  5AYW D;  3APF A;  3S7D A;  1XNF A;  4JVS A;  3UX4 A;  3G2V A;  3CVY A;  1IQR A;  4YND A;  3ZYQ A;  4H7Y A;  4CCA A;  1E90 A;  3G2T A;  3NZU A;  3RRN B;  3FUI A;  3TG5 A;  4ME2 A;  4I1O B;  4CT4 A;  1BPO A;  4ANX A;  5BV0 A;  4A3T A;  4GML A;  4AJW A;  4C0E A;  4ILG A;  4J0U A;  4FJY A;  2I2O A;  4EBA A;  4NUR A;  4JXT A;  3IBE A;  2WXQ A;  2VQ2 A;  4AV7 A;  3D9L A;  5BT1 A;  3FDH A;  4I1A A;  2VTB A;  4UI9 J;  4JC8 A;  5LCW J;  1U3C A;  3FH8 A;  1Y6I A;  3S7F A;  4E6H A;  3TXM A;  4Q69 A;  5J08 A;  3CVV A;  3JYS A;  2OVF A;  5KJL A;  2FBN A;  2X6F A;  3CVQ A;  2VGX A;  3FTX A;  2FO7 A;  4GPK A;  1UN8 A;  3O4Z A;  4I2W A;  1W3B A;  4AVX A;  2XPY A;  3SBS A;  3CHO A;  2AXZ A;  1EPU A;  2X6H A;  3MKQ B;  1OWL A;  3ENE A;  3FUK A;  2R5S A;  3LXU X;  3ZYK A;  4CDR A;  4GA2 A;  2IOS A;  1ZU2 A;  2FF4 A;  3B7U X;  3BG1 B;  4YVQ C;  2DIW A;  2R59 A;  3FU5 A;  2HO1 A;  3P2B A;  4DK5 A;  4M3O A;  2XGO A;  4BT9 A;  4U0Z A;  5FZR A;  1H2V C;  2JEK A;  3LY7 A;  2KCL A;  4WNE A;  2YQ8 A;  4I6G A;  4RVB A;  1EDU A;  1FVH A;  3AS5 A;  4HFG A;  4KXK B;  2WXM A;  3S2A A;  3APC A;  1MQS A;  3TAX A;  3FTU A;  3IHV A;  4UI9 K;  3JUI A;  3QJZ A;  4WUY A;  4GZ6 A;  4CT0 A;  5KJN A;  2WB2 A;  1E8Z A;  1H2U A;  4QFV A;  4EZK A;  3L54 A;  1UJK A;  2WXR A;  4JEU A;  4K0R A;  2J09 A;  3MKR A;  5ENN A;  4DLO A;  4EQF A;  4U0S A;  4XIF A;  4FLB A;  3QC1 A;  2ILR A;  2ZU6 B;  5T8I A;  1H0A A;  1UW4 B;  4C9B B;  2CHZ A;  3IHY A;  4G1T A;  3UT4 A;  4K03 A;  4PDX A;  4KMO A;  1YA0 A;  2FEZ A;  2LAI A;  5ANR A;  4BT8 A;  4BX8 A;  5CMW A;  4CEM A;  1EYH A;  1WY6 A;  5JJ6 A;  4E85 A;  2A4Z A;  4RG9 A;  3ASF A;  4OVU A;  1HX8 A;  2X6I A;  1SZA A;  1OWM A;  2OOE A;  3FEY A;  4FP7 A;  3T8M A;  4B0Z A;  1QQE A;  2LO6 A;  3PE4 A;  3BG0 B;  3OAW A;  3CKC A;  3FUL A;  4A55 A;  1UG3 A;  5FQ4 A;  3O48 A;  3R9A B;  1S0P A;  1NA3 A;  2PQN A;  3CQG B;  3FEX A;  4UWH A;  3FH7 A;  3LYA A;  4U8H A;  3SHF A;  3FH5 A;  1EF1 C;  1ELW A;  3E4B A;  4B8A A;  4JEH A;  2I1J A;  2Y3A A;  4ANU A;  2L9B A;  5D0O D;  3CSF A;  4IYP A;  3CQC B;  4XZ4 A;  3ZHE B;  2WXI A;  4GYY A;  4N5C A;  2GRM A;  4IN3 B;  2KCV A;  3G2U A;  2WQ7 A;  2XPZ A;  2HR2 A;  3FUN A;  3L17 A;  2J08 A;  3UT8 A;  4JHR A;  3ZRH A;  4ANV A;  4CRW A;  4GA0 A;  2VGY A;  4C0M A;  2CG2 A;  1N54 A;  4U07 A;  3L6A A;  3UT7 A;  5AEN A;  4GB9 A;  5G2N A;  4G2V A;  3HVE A;  4I2Z A;  2RG8 A;  4ILI A;  2PZI A;  4BX9 A;  2FUL A;  2KZT A;  4TV3 A;  5AJD A;  3DBS A;  2XRY A;  2WXK A;  2LNI A;  3ONK A;  4G26 A;  2Y4U A;  4KVM A;  2X3M A;  1TJF A;  2AWI A;  2UY1 B;  2WXL A;  3KEZ A;  3U66 A;  1JWF A;  3FUF A;  4FLH A;  4AOF A;  2LAH A;  4Y6W A;  3LKU A;  3GZ1 A;  3CST A;  5KJK A;  4GYO A;  3JQ1 A;  5JJT A;  2XGM A;  4UI9 C;  4KT6 B;  3SGH A;  1KT1 A;  2I6H A;  4J8S A;  4KBQ A;  3ESK A;  4BWR A;  5ANL A;  4FA6 A;  3G2S A;  2Q7F A;  1P5Q A;  5EX3 A;  1E8Y A;  3ZGQ A;  3T5V A;  2LSU A;  3TGO A;  4G23 A;  4ILH B;  3RRU A;  3OXL A;  1HFA A;  3LVQ E;  1KT0 A;  4I17 A;  5DBK A;  3MCX A;  2YHC A;  4GMJ A;  3MA5 A;  4A1G A;  3AU5 A;  2VSN A;  3RO2 A;  2E2E A;  1IYG A;  3QWP A;  3L13 A;  2Y4T A;  3PNL B;  4O6F A;  4F7A A;  1QNF A;  3ASG A;  4DI4 A;  4GAA A;  3FUJ A;  5FTP A;  2QFC A;  2KCK A;  2KC7 A;  4IRU A;  3DPD A;  4HS2 A;  3SBT B;  2LSV A;  2WVI A;  3FTV A;  4IUL A;  4J6I A;  1H6K A;  4KZC A;  1OUV A;  4MKT A;  4UWK A;  3TJP A;  4EBA G;  3P1U A;  4WNF A;  5EX0 A;  4L23 A;  5FWQ A;  3D9P A;  1U3D A;  2L0T B;  1ELR A;  1B89 A;  1E96 B;  5LX8 A;  3KD7 A;  4JZY A;  3LY9 A;  3EJN A;  3SI5 A;  4LUN U;  1ZBP A;  3U64 A;  3FFL A;  1PC2 A;  2P58 C;  3CK8 A;  4GZ5 A;  1Z3Y A;  4HOR A;  5J90 A;  3L16 A;  2OV8 A;  5AJL A;  2WQH A;  2WXJ A;  4ACK A;  1DNP A;  3WXX A;  4AY5 A;  5EKQ D;  1WM5 A;  2C2L A;  3CV0 A;  3GZ2 A;  5HI7 A;  2XRZ A;  3MYV A;  5FT9 A;  4PS3 A;  3MEK A;  4D10 C;  3ZEF A;  2IJG X;  3APD A;  2DBA A;  2VTB B;  4PS8 A;  4LER A;  4BY6 A;  5M72 A;  3PRE A;  2AW6 A;  2BUG A;  2J49 A;  4AEZ C;  5CMY A;  3SFZ A;  4BTB A;  4N2Q A;  2JLB A;  3Q4A B;  4Q94 A;  5CCM A;  5A6C A;  1OWO A;  2J07 A;  3S7B A;  3ASD A;  3CHQ A;  5LP0 A;  3FUH A;  4KZ0 A;  4AIF A;  2NXP A;  2WMN A;  2J4D A;  4B89 A;  4WWO A;  2VGX B;  4GCN A;  5ARG A;  4MRU A;  5JJ7 A;  5G05 C;  4JA9 A;  3S7J A;  4A1S A;  5BUZ A;  1L5J A;  3Q47 B;  2IOL A;  4NAC A;  4I9C A;  3AU4 A;  3PEV B;  2M63 A;  3D9M A;  2PM7 A;  4APF A;  5T3R A;  3RO3 A;  3UUX A;  4GYW A;  3GZS A;  4OVV A;  3JCK C;  1E7V A;  3FUE A;  3ZFW A;  2QY7 A;  1HH8 A;  1OWP A;  3NZS A;  4P29 A;  3IEG A;  5E75 A;  4GZ3 A;  1TJC A;  2V8S E;  4L2Y A;  4JL0 A;  4I43 A;  3PUJ A;  3QK0 A;  3ESL A;  2WXN A;  2XCC A;  3FTS A;  3CHR A;  4U0U A;  4XI9 A;  3HIZ A;  3L08 A;  4AM9 A;  2NC9 A;  5C1D A;  3JQ0 A;  2HM8 A;  3CK7 A;  4F3V A;  2VSX E;  5G05 J;  2VSY A;  3I4G A;  4GCO A;  3ZVV A;  3PRZ A;  2YIN A;  1A17 A;  3C98 A;  3NQP A;  3UMV A;  4N3B A;  3U9W A;  2AXV A;  4PUC A;  4CDM A;  3RIB A;  3PS6 A;  2PL2 A;  1H19 A;  3CGH A;  2L6J A;  3CKB A;  3FU6 A;  3CHM A;  5BW8 C;  3LY8 A;  1ELK A;  3ONL A;  4J8D A;  3ZIM A;  2XEV A;  3GW4 A;  4G11 A;  3ZXS A;  2WMO A;  5FZQ A;  3FWV A;  4BSX A;  3CVW A;  3ML9 A;  5A7D B;  3SD5 A;  3D9O A;  4V3I A;  1HF8 A;  5AIJ A;  4BFR A;  4MLP A;  3VLD A;  4EPZ A;  3I4R B;  2AVP A;  4LCT A;  3SZ7 A;  3ASH A;  2FI7 A;  4JPS A;  4FAD A;  3URZ A;  4HLE A;  4WWN A;  3OXF A;  4HXI A;  1PY1 A;  3HHM A;  3QWW A;  3G2W A;  4XKC A;  5FQ6 A;  4EEC A;  1FVF A;  3QB2 A;  3AS8 A;  1JPL A;  4ACL A;  2X6J A;  3SF4 A;  4UQY A;  3EIJ A;  2E0I A;  5FQ8 A;  3ZYM A;  4UQZ A;  3IKO B;  3HVE B;  3LJ3 A;  2OVB A;  4Y6C A;  2XHE A;  4PS7 A;  3CVP A;  3L22 A;  4OYS A;  1PAQ A;  3FTW A;  3QWV A;  3QDN A;  4DJA A;  4HOS A;  3R7Q A;  3VTX A;  3CVL A;  2YHE A;  4KYO B;  3TL5 A;  3IV0 A;  5KCM A;  3LDZ A;  2V5F A;  2R17 C;  4I9E A;  4RSY A;  4W9R A;  4XE0 A;  4NRH B;  1HE8 A;  2CFZ A;  3QOU A;  4L7T A;  4ATG A;  2KAT A;  4MS6 A;  2AXU A;  1JUQ A;  3OTN A;  3ZYL A;  2HYZ A;  4BTA A;  1VDY A;  3MJW A;  4B8C B;  3PNT B;  4HVB A;  2NSZ A;  4NQ0 A;  1IQU A;  3PEU B;  3Q49 B;  3QAQ A;  4FUL A;  4EZJ A;  1E7U A;  4H7X A;  2XGS A;  3PZD A;  4J8E A;  3T5X A;  3I5P A;  3MKQ A;  2EQX A;  4APO A;  3FU0 A;  1WAO 1;  2XPI A;  3PE3 A;  5LOZ A;  3MV2 B;  5ARF A;  3CVN A;  1QZ2 A;  4DLQ A;  4EZL A;  2WXP A;  4I1M A;  3ML8 A;  3LEW A;  2UWJ G;  2VJ8 A;  3LVR E;  5CHE E;  4B94 A;  3OXG A;  1XGW A;  1HO8 A;  3CLJ A;  3D9N A;  3PDN A;  4UWF A;  5CCL A;  4CGV A;  1Z6T A;  3FUD A;  4GU5 A;  3Q5M A;  1OWN A;  4Q96 A;  2IFU A;  2WM9 A;  3FU3 A;  3KAE A;  3D9I A;  1INZ A;  2VYI A;  3EHN A;  4AP2 A;  5BV1 A;  4URK A;  1FCH A;  3TG4 A;  5EDS A;  1HG5 A;  4U04 A;  3ZN3 A;  2GGF A;  3U4T A;  4ABN A;  1KLX A;  4UWL A;  4FC8 A;  4AY6 A;  4ANW A;  1HU3 A;  4U63 A;  3CVU A;  2PM6 A;  5D0Q D;  4WNG A;  3VTY A;  2CHX A;  2CG3 A;  4CGW A;  4N3A A;  4G25 A;  3KS2 A;  1E8W A;  4JA7 A;  1TEZ A;  3CIA A;  3QAR A;  5DIZ A;  4WAF A;  4GZC A;  3PUK A;  4GZD A;  1X5B A;  3CHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...