3CVNA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei glyceraldehyde-3-phosphate dehydrogenase (gapdh) pts1 peptide
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
320
structure length
300
Chain Sequence
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGEASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
molecule keywords Peroxisome targeting signal 1 receptor
total genus 119
structure length 300
sequence length 320
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvnA00
4G25A 2XPIA 3RU0A 4N3BA 4JHRA 1QZ2A 3UPVA 5EX3A 4HOSA 4EQFA 4BWRA 4I17A 3LY7A 4XI0A 5JJ7A 5G05C 5HI7A 4AM9A 2I6HA 4N3CA 4APOA 2KCVA 2YHCA 3ZHEB 2L6JA 3KAEA 2VSNA 5A6CA 3VTYA 2KATA 4GA1A 3ASDA 4WNDA 4CGVA 2XGOA 4AY5A 4JA7A 4JL0A 4H7XA 4W9RA 2VSYA 2WQHA 2PL2A 2C0MA 2E2EA 3PE4A 4N39A 4UI9J 4XIFA 3CKBA 5DBKA 5BW8C 1YA0A 2XCCA 2PQRA 3U4TA 4CDRA 3AS5A 2FI7A 4H7YA 3QWVA 4G1TA 3CV0A 3S7DA 1PC2A 4YNDA 2Y4TA 5EX0A 1WAO1 2PQNA 1KLXA 4I2ZA 3ZFWA 2Y4UA 4GZ5A 3QWWA 4RG6A 4UI9K 2UY1B 4GYWA 5LCWC 2MHKA 4B94A 2JLBA 3FP3A 3N71A 3RKVA 3HYMB 2VGYA 4UQZA 4U0UA 2FO7A 1NA3A 2FBNA 3KD7A 3ZN3A 3O48A 5CCMA 1FCHA 3SF4A 3OXFA 1Y8MA 4U07A 2IF4A 5M72A 4N2QA 4G23A 2XGMA 3S7BA 3ASHA 2UY1A 3FWVA 1QQEA 2FEZA 3S7JA 4AIFA 4CGWA 4BTAA 3QKYA 4BTBA 2QFCA 2WPVA 2YQ8A 3ZGQA 5G04C 3ULQA 1IHGA 2V5FA 4YVQC 2AVPA 3S7FA 3UUXA 4UI9C 3ASFA 3VTXA 4A1SA 4BT9A 4N5CA 4BT8A 1IYGA 2C2LA 2KCKA 2VQ2A 3TAXA 3R9AB 5KJLA 3MV3B 4O6FA 5HQ8A 2XGSA 1KT0A 4J0UA 3TG5A 5BNWA 2VGXA 2XCBA 2HYZA 5EKQD 4GCNA 4YVOA 3RIBA 3CVPA 4KBQA 4GYYA 4J8FA 5FJYA 2ONDA 4J8DA 5FZRA 5ARFA 5BT1A 2HO1A 2OOEA 3CVLA 3PDNA 5D0QD 3RO2A 3ASGA 4IN3B 1ELRA 3Q15A 3LCAA 2P58C 3PE3A 4G26A 4U0ZA 4UQYA 1W3BA 4RG9A 1HZ4A 3RJVA 3BEEA 5CCLA 4HOTA 2C0LA 3CEQA 2DBAA 4N3AA 5KJNA 2IFUA 3CK8A 5G05J 3IEGA 5DIZA 1NZNA 2KCLA 2GW1A 3K9IA 3Q47B 4ME2A 4HOUA 3FFLA 4GZ3A 3GZ2A 3Q49B 4WNGA 4Y6CA 3LY9A 4XI9A 5G04J 5C1DA 3ZHEA 3LKUA 1ZU2A 2LSVA 3SZ7A 1TJCA 3TG4A 4KXKB 3NF1A 3MEKA 4GA2A 1P5QA 4GYOA 4NQ0A 4NRHB 5CHEE 5LCWJ 3AS4A 4JA9A 4I9CA 4N2SA 5D0OD 2HR2A 3GYZA 3TGOA 3E4BA 3OXLA 4Y6WA 1NA0A 4GA0A 3LY8A 4LEUA 5FT9A 3CK9A 2Q7FA 2PZIA 3CVQA 3KS2A 3MA5A 1HH8A 5AYWD 3URZA 4GPKA 2XEVA 3LPZA 4I1AA 3UQ3A 3CK7A 3Q5MA 5FZQA 3RO3A 1ELWA 4HOQA 3GZ1A 4WUYA 4GZ6A 4WNFA 1WM5A 2BUGA 3QDNA 3LYAA 4AY6A 4U04A 3ZPJA 1E96B 2VYIA 5FZSA 4ABNA 4F3VA 3Q4AB 3WXXA 5KJMA 4I9EA 1XNFA 3MV2B 2R5SA 2VGXB 3ESKA 3GW4A 1ZBPA 3EDTB 2FF4A 2J9QA 4G2VA 4GCOA 4J8EA 4U0SA 5FTPA 5JJTA 5KJKA 4HORA 1HXIA 4G24A 3MKRA 2LNIA 3U3WA 2UWJG 3QWPA 2NC9A 3CKCA 3OXGA 3CVNA 2LSUA 1A17A 3QOUA 4KYOB 1OUVA 2KC7A 4I2WA 4UQXA 5ARGA 1B89A 4WNEA 5JJ6A 3JYSA 3AS8A 5A7DB 1KT1A
chains in the Genus database with same CATH superfamily
3G2VA 1X81A 1HO8A 1TR4A 2XQ0A 4B8CB 3ZHEB 2VSNA 4BESA 2RG8A 4ILIA 1N95A 4W9RA 1YA0A 2J8SD 4J7WA 3TWTA 4AVXA 4GTQA 3B7BA 3DEPA 2P2CP 5HS0A 5LP0A 2H6FA 4UWFA 3KD7A 2AXUA 4G23A 2AJAA 2YQ8A 4CCAA 3FEXA 2OEVA 2F8YA 3ASFA 3G2TA 4JHKA 2RKKA 2FULA 4NURA 4TRQA 1OWMA 2X6JA 2BTDA 4KBQA 5ANLA 3KEAA 3ZYKA 3ASGA 4JW1A 3FTWA 3PE3A 4LCTA 5G55A 5LFAA 3ZVVA 1Z5SC 4HB5A 3NB2A 3ZHEA 3LKUA 3ZW3A 4EZLA 1TNZA 1DVPA 3IV0A 4IYPA 4I6GA 5AJLA 2B0OE 4TUMA 3UINC 3EU9A 5CBNA 4Z68A 4G2VA 3D9MA 4HFGA 3SY2A 2RFMA 4Q96A 4NIKA 3FU6A 1YCSB 3JYSA 4WWNA 4G11A 3RIBA 4EECA 3Q78A 3RU0A 4MLPA 2FO1E 3UM2A 4BWRA 4MRUA 5JJ7A 3QNKA 5HI7A 3CQCB 4APOA 5HKPA 1IXVA 4ATGA 3KAEA 5C2YA 2YNQA 3AG2E 2BF0X 3JXJA 4F1PA 3VTYA 3I4GA 2E2EA 3EHMA 2PQNA 3FH7A 4GZ5A 4UI9K 3QWWA 5T3RA 3RKVA 1MJ0A 5KNGA 3ASHA 2NSZA 3G2UA 2WMNA 3V2OA 4L2LA 2AWIA 4EZKA 3V2XA 3L82A 2ZXWE 1TN7A 1K1AA 1EYHA 2XS1A 1JCRA 4GTOA 4J8DA 4X8QA 4LNBA 2IOSA 1O1SA 1HZ4A 4GB9A 3SBTB 4PH4B 3TGOA 3Q49B 4DI4A 3IXEA 2OCCE 3CSTA 1SA5A 4AJWA 3MGBA 2HM8A 1OWOA 1HG2A 1S63A 3PZ2A 3L9TA 5ENTD 3FUMA 4WNFA 1GW6A 3I4RB 1HG5A 3FTXA 2IY0C 2EIKE 4UQXA 3DBSA 4E6HA 5EX3A 4U95D 3SGHA 4FJYA 2C0MA 4PS8A 4UI9J 4XIFA 5DBKA 5FQ6A 5CBOA 2XCCA 3L17A 2WXRA 3ENEA 4LG6A 2HE0A 4JB8P 2H6IA 1NL4A 3NAWA 3O48A 2DYRE 3OTNA 4N2QA 1L5JA 2WM9A 4CGWA 4BTAA 3T5XA 5ANRA 1HF8A 2IQCA 2AVPA 3VTXA 3FUIA 4TXQA 1X5BA 4MBGA 3TWSA 2WXFA 1OWLA 4BSXA 3IHVA 4F7AA 4FJZA 3ESLA 1N11A 1W3BA 3RJVA 3BEEA 2XENA 3FUKA 3UT7A 4GTSA 4HOUA 3NF1A 4GA2A 4BSZB 3FEYA 5FWQA 1TNYA 4JA9A 3TWUA 2WXNA 2M63A 1K1BA 1RW2A 3ZEFA 2WQ6A 1E96B 1OWNA 4I9EA 5ARFA 3FU3A 1WDYA 5EN5D 5CMYA 4YDWA 2R02A 3TXNA 4G8LA 3DXMG 3FH8A 2J08A 1MX6A 2VJ8A 2I9CA 2J09A 3FH5A 3ASDA 1K8KG 4L2YA 3CKBA 2OVBA 1BPOA 4B94A 2NYJA 2XS8A 3J5QB 3HYMB 4FULA 4UQZA 4XKBA 1NA3A 1FT2A 1FCHA 3SF4A 4TUUA 2AXVA 4U63A 3QB2A 3RAUA 4N5CA 2KZTB 3CGHA 3CQGB 3GZSA 4HNAD 5KJLA 4UWKA 3JCKC 2OV8A 2XGSA 2XCBA 2IO2C 3FTVA 1DNPA 4IN3B 3FTYA 3FUDA 2X6KA 1QNFA 3ZXPA 5KJNA 2QY7A 1N4PA 3K9IA 2GRPB 2R59A 3SZ7A 2WXLA 4NRHB 3ZXSA 4FHKA 2PZIA 1S64A 4YDEA 4HRLA 4P29A 2GRLA 4AY6A 4R7LA 3Q4AB 2XZDG 5EIBE 4CZ2D 1UN9A 2XPZA 3QWPA 5CEAA 1A17A 5CRVA 3ULEG 1KT1A 4CT4A 1LTXA 5JHAA 1S0PA 2I6HA 4N3CA 2WQHA 3CSFA 4CDRA 3KEZA 2PQRA 1PC2A 3HVEA 2L0IA 3B95A 4GAAA 4CRWA 4BX9A 4FA6A 1INZA 4BETA 2WXPA 5CCMA 3DSVA 1KZOA 2AW6A 3R7QA 3TWQA 3JUEA 4FADA 5KWDA 1FVFA 4O6FA 3PRZA 1UJJA 3CVPA 3CVWA 1OCRE 5FJYA 1N54A 4ACLA 3CEQA 1FT1A 3ULYA 5KBAA 4ME2A 4M3OA 4Y6CA 1SA4A 2DZOA 5C1DA 1N4QA 3PNLB 5D0OD 1H6OA 1BI7B 3B7RL 1IHBA 3B7UX 3CVVA 1YYHA 4BERA 4XKCA 2XRYA 3DXKG 4KYOB 4C9BB 1N4SA 5E76A 3LY7A 4ANWA 2VTBA 3PS6A 3B7SA 2KBXA 3L08A 1EPUA 5FQ4A 2XGOA 4JEHA 4N39A 5AAOA 5J90A 3IHYA 3SD5A 3QK0A 4YNDA 2YHEA 3LJNA 1U3DA 1AP7A 3ABLE 3ASNE 3G2WA 1Y8MA 3V31A 5FQ7A 5J08A 1MZCA 2QFCA 4CDMA 2KXPC 4N5QA 3PZ1A 1O5MA 4B93B 3CHOA 2KM4A 3KSQA 2WQ7A 2VQ2A 3FU5A 2VTBB 5EILA 3TG5A 4GCNA 3UKUG 4GYYA 5FZRA 3V30A 4OVVA 1D8DA 4UQYA 5BV0A 3LCAA 3U3WA 2P9KG 1BD8A 3EHQA 5AQ7A 4ABNA 4BTBA 3LEWA 4KXKB 1U2VG 3LXUX 3W9GA 3E4BA 3D9OA 1E7VA 1JUQA 3BU8A 3LS8A 3HXCA 4KZCA 2H6HA 3DWLG 1NP7A 1UG3A 2J4BA 3ESKA 1SZ9A 4A55A 5FTPA 2UWJG 3CKCA 2LSUA 3FUJA 4EHMA 1UN8A 3NQPA 3ZRHA 5A7DB 1HU3A 2XPIA 2VSOE 4B0ZA 1BI8B 1TNOA 4L1BA 2XEHA 4UWGA 4TXPA 4CGVA 2YINA 1N94A 3Q9UC 3HVEB 2ETAA 5BW8C 3MKQB 5AQBA 4H7YA 3CV0A 1H2VC 3EIJA 4MKTA 1Q2ZA 2MHKA 3FP3A 4RLYA 2B6CA 5M72A 4XE0A 4DI3A 2CG3A 2F8XK 5JMND 2V5QC 3ZGQA 1IHGA 3UUXA 3T5VA 3JXIA 1N52A 2VGXA 3D9NA 5EIDA 4FP7A 1OWPA 5CEDB 2JABA 5AQAA 1OCZE 3CVLA 4AY5A 3FTSA 2V0PA 5CCLA 2R03A 3MKQA 2PM6A 4ATZD 3DRAA 5KJMA 1N9AA 5G04J 3T9KA 3C72A 3LY9A 2LUHA 4PUCA 2CHWA 1JCQA 2BKGA 3L22A 3PNTB 3E33A 4K5CA 3CR3A 3EUVA 1JWGA 4AXHA 4HOQA 4GZ6A 4OVUA 3Q79A 4G8KA 2QYJA 3C3OA 2Y0BG 3C3QA 2VGXB 5LCWJ 5LOZA 2WB2A 4QQIA 3ASOE 4I2WA 4JD2G 3BG1B 4KT6B 3ZUVB 2EINE 1E8YA 3JQ1A 3AG4E 4Q69A 3TL5A 1WAO1 2XHEA 2IEJA 2FO7A 2MRIA 4U07A 3S7BA 2UY1A 2P9NG 2EIME 3ZU7B 4ILHB 3NBNB 4UI9C 1O1TA 4CDNA 2V8SE 4HS2A 4J8FA 2OOEA 4G26A 3CK8A 5G05J 3Q47B 2EILE 4JHJA 1AWCB 3HDXA 2ILRA 4GYOA 3E30A 2J07A 3PUKA 3AS4A 3U64A 3CVQA 1DCEA 3NOCD 1PAQA 3C3RA 4K5AB 1EF1C 2VYIA 3DEOA 3MV2B 4U0SA 3EDTB 3D9PA 4JC8A 3LVRE 1E8WA 3OXGA 4GU5A 1OUVA 3HXBA 5ARGA 4FU3A 4Y6WA 4OAUC 3DSXA 1DC2A 4EQFA 1S70B 4I17A 4ZFHA 2YHCA 3UMVA 4H7XA 1TJFA 3ISMC 2FI7A 4DX2A 2WMOA 3CHMA 4BFRA 5ENQD 4I6JA 2H6GA 1MQSA 3L6AA 4JEUA 3RRNB 2LXLA 5B1BE 3DSUA 2XRZA 1TNBA 3EHNA 3SNXA 1QQEA 3ONKA 1TYQG 3HIZA 4ANVA 3UT4A 2IO3C 3RRUA 4O1OA 4A63B 3ULQA 2V5FA 4DLQA 3D9LA 3TAXA 2VSXE 1KT0A 4JPSA 2HYZA 1Y6IA 2F0YA 3BQOA 3Q15A 5FINA 3NZSA 3Q9NC 3HRAA 3QC1A 5EDSA 1IQRA 2WXIA 5B3SE 5BPPA 4KVOA 1SVXA 5ENOD 2GRNB 4U7EB 1KPSB 3R9MA 3OXLA 4PS3A 3U66A 3UKRG 4CEMA 3URZA 3UQ3A 3HHMA 1H2TC 5JA4D 2A5UA 1NFIE 2BUGA 3PREA 1H19A 1V55E 5AENA 4TV3A 4F3VA 3APFA 3U4TA 4J8EA 4L9PA 4DLOA 1FVHA 3SI5A 3TWXA 3E32A 2KC7A 1IKND 3AS8A 2DIWA 1SW6A 4G25A 4HBDA 3BG0B 4HOSA 2P9SG 4XI0A 2IONA 3CHPA 3HXDA 3SFXA 3ZKJA 2DYSE 1YMPA 4L7TA 1D8EA 2WXMA 2KATA 2RFAA 5FIOA 2QZAA 4C0MA 3AG3E 2OEWA 1OCOE 3RSEG 5KNHD 3CHSA 5ENPD 5LX8A 1DCQA 2PNNA 1U3CA 1H6KA 4IRUA 2XEEA 4O60A 3CVYA 4ACKA 3NZUA 4J8SA 1OT8A 4AEZC 2BKKB 3QKYA 4FC8A 5KCMA 2I1KA 4JVSA 4E85A 5AARA 2ONDA 4HXIA 4LSZE 3PDNA 1HX8A 5BT1A 4YDYA 2L0TB 4Q94A 2C0LA 4F1SA 2P9PG 2P9IG 3FDHA 2IFUA 1N4RA 4HRNA 4FLHA 5HRYA 4XI9A 3GZ2A 4HI8A 3F6QA 1H6PA 3PZ3A 3L16A 4CYMD 5AQ9A 2GRQB 2GGFA 5AYWD 3KS2A 4QFVA 4WWOA 3PH0C 5E75A 3CK7A 4GTTA 1WM5A 3QDNA 3SFYA 3LYAA 4U04A 4GMRA 5JHBA 4RVBA 2WXJA 4BY6A 3MKRA 2LNIA 3UIOC 2MYOA 3CVNA 5FQ8A 4DUIA 1BU9A 1FPPA 3SHFA 2CG2A 5G05C 3DSWA 5A6CA 3UXGA 4JL0A 2VSYA 2J4DA 3PEUB 3ML9A 3QWVA 3S7DA 4NACA 4WAFA 5ENNA 4GTMA 3FTUA 4GYWA 1BLXB 1LD7A 3N71A 4U0UA 3JUIA 4LNGA 2XGMA 2R05A 4HLLA 3AG1E 4ANXA 3PUJA 1QYMA 4U8HA 1NI1A 2C2LA 2HO1A 2GRMA 5D0QD 1ELRA 4HLEA 2P58C 3IEGA 2KCLA 2IOLA 4WNGA 3I3NA 1TJCA 3TWWA 4L23A 3DPYA 2HR2A 3DSTA 3LY8A 4LEUA 3CK9A 1QBQA 1HH8A 3HXFA 3TWRA 4I1AA 4C0EA 2X3MA 3QJZA 4A3TA 5ENRD 3ZPJA 4K5BA 3SBSA 5BXUA 2R5SA 2XZTG 3GW4A 1ZBPA 4GCOA 2FF4A 4FLBA 3ZYQA 1E8ZA 3UT8A 3WG7E 3V79K 4I1OB 5JJ6A 4DK5A 4RSYA 1QZ2A 4CT0A 3VLEA 1MYOA 4HQDA 4WNDA 5CRUA 2LAHA 2XPYA 2PL2A 4ILGA 3RK6A 3UI2A 2F37A 4JXTA 4LERA 5A23A 3LDZA 3IBEA 4URKA 4A3VA 3QAQA 3PZ4A 4ANUA 3B13A 3QARA 2DWZA 3C98A 2GRRB 3S7FA 4IULA 4A1SA 2KCKA 1G3NB 3MCXA 4U0ZA 5IY5E 1MHQA 4AP2A 2P9LG 5B1AE 4N3AA 4DX1A 1IQUA 1ZU2A 3G2SA 3UTMA 4OYSA 1PY1A 2X38A 4LUNU 4F6RD 2ZIRA 1E90A 4I6EA 3Q5MA 5FZQA 3J5PA 3GZ1A 4WUYA 2DVWA 5BV1A 5FZSA 3FUEA 3WXXA 3ABME 1JPLA 4LRZA 3EHRA 1XGWA 2CFUA 3Q75A 3FU0A 4B8AA 3RRMB 4JHRA 2L6BA 4GTVA 3UM0A 3APDA 4U8YD 3UM1A 1E8XA 3E34A 5ENSD 4F53A 4JA7A 2MOWA 4J6IA 3PZDA 1HE8A 4K03A 2CHXA 3APCA 4GPMA 2CFZA 1Z3YA 1Z6TA 2R2LA 2E0IA 2ZU6B 4FHJA 4UWLA 3LJ3A 2IF4A 3D9IA 3S7JA 5CMWA 4I43A 3IKOB 3DSSA 1Z3XA 5EYPF 3MZLB 5D66A 1UJKA 4BT8A 3R7RA 5HQ8A 1ELKA 5ITZF 3ML8A 4YVOA 1TN8A 3SQVA 2QC9A 4RG9A 3UM3A 2DBAA 2ETBA 2ZGGA 3AU4A 4AV7A 4GMJA 4BEPA 5EYLA 4MS6A 3FUFA 2V4HC 3I5PA 3VLDA 3TG4A 3MEKA 5CHEE 3Q7FA 4I9CA 4PDXA 4EPZA 1SQMA 1JWFA 2A4ZA 3MA5A 3AJIA 5T8IA 4BX8A 4EBAA 3P1UA 4DRXE 4EBAG 1XNFA 3VLFA 1H0AA 2J9QA 1HXIA 2Y1LE 2WXQA 4U96D 2JEKA 3D9KA 4B89A 2DCPA 3FY4A 2LO6A 4GTPA 3FUNA 1N0QA 2I1JA 3CLJA 4EZJA 4M7CA 2KCVA 2L6JA 5G2NA 3KSLA 5CECB 1SZAA 4WWPA 1D9SA 5T4YA 2I2OA 4XEIG 2Y4TA 5EX0A 1KLXA 4RG6A 4DX6D 2UY1B 5AJDA 2JLBA 2VGYA 4K0RA 3ZN3A 3FWVA 3S2AA 4AIFA 1A5EA 2WPVA 1ZB1A 1TN6A 5G04C 3D9HA 4YVQC 3P2BA 4BT9A 4GMLA 4GZDA 3MV3B 1K3ZD 5AN8A 5BNWA 2CHZA 3FULA 1H2UA 2IJGX 1HFAA 3OAWA 3TWVA 3ABKE 4U8VD 4XZ4A 2GW1A 1MX2A 2IU1A 2LSVA 3LVQE 3BUAA 1P5QA 3TXMA 5BUZA 1JCSA 3TJPA 3GYZA 1VDYA 2WXGA 3ZFWA 2XEVA 2X6HA 2Y69E 2GROB 1TNUA 5KJKA 4HORA 2WXOA 2X6FA 4G24A 5CERB 3W9FA 3O4ZA 3PEVB 2EQXA 1B89A 4WNEA 4DPRA 1KZPA 2J49A 3D3MA 3UPVA 4RQIA 1E7UA 4AM9A 2ZGDA 3SFZA 2A5EA 3PE4A 3UX4A 4D10C 3AS5A 4G1TA 3T8MA 5BXOA 2Y4UA 5H7PA 5LCWC 4KZ0A 2P9UG 3NOGD 1OCCE 3ZYLA 3ONLA 2FBNA 3OXFA 3CIAA 2DZNA 3CVXA 4XX5A 4V3IA 5AIJA 2AXZA 4A1GA 3SO8A 1HS6A 4ZHBA 2WXHA 4C48B 3EJNA 2NXPA 3HG0D 4UWHA 4APFA 2VGEA 2L9BA 4HVBA 3X2QE 4J8YA 4OAVB 2LXMA 2QYUA 3FUHA 5DIZA 1NZNA 3FFLA 3ZNGA 3L54A 4KMOA 4YDOA 3EU5A 1UOHA 2Q7FA 3FTZA 3UIPC 4GPKA 1OXJA 3L13A 2LAIA 3C5RA 4HI9A 3ZYMA 2OVFA 1MX4A 4HRMB 3B7TA 3CVUA 1IYGA 3E37A 4O1PA 5JJTA 3DPDA 1TEZA 2WXKA 1N0RA 4KVMA 4JZYA 3EIQC 3QOUA 3MX3A 4DX7D 4N3BA 3FHEA 3Q7AA 4GZCA 1V54E 2Y3AA 2KZTA 3T8KA 4GA1A 1O1RA 2PM7A 2X6IA 4AOFA 3JQ0A 4PS7A 3AU5A 1UW4B 4DJAA 3MJWA 4I2ZA 3AAAC 1WG0A 2BEDA 3Q73A 1WY6A 2EIJE 4I1MA 2ZISA 2FEZA 3U9WA 1RZ4A 1LF8A 4LNUD 1EDUA 3MYVA 3R9AB 3CHRA 4J0UA 5EKQD 4DX5D 4TXRA 3RO2A 4HOTA 5D2MC 2ETCA 2WVIA 4GZ3A 2V4LA 2RD0A 2R17C 4NQ0A 4N2SA 3ZIMA 3PVLA 4UUCA 1OY3D 3D9JA 1NA0A 4GA0A 5FT9A 3LPZA 3CHQA 3RO3A 1ELWA 3HXEA 4GTRA 2NC9A 1LD8A
chains in the Genus database with same CATH topology
3RRMB 3G2VA 4JHRA 4CT4A 1HO8A 4EQFA 3APDA 4I17A 5JHAA 5C2YA 1S0PA 2I6HA 4N3CA 2XQ0A 2YHCA 4B8CB 3UMVA 3ZHEB 2VSNA 1E8XA 4F53A 2RG8A 4ILIA 4JA7A 4H7XA 4W9RA 2WQHA 1TJFA 3CSFA 2MOWA 4J6IA 3PZDA 4CDRA 1HE8A 1YA0A 3KEZA 2PQRA 2FI7A 4K03A 1PC2A 3HVEA 2WMOA 3CHMA 2CHXA 4BFRA 4AVXA 3APCA 2L0IA 4I6JA 2CFZA 1MQSA 3L6AA 4JEUA 3RRNB 1Z3YA 4GAAA 4CRWA 4BX9A 4FA6A 5LP0A 1INZA 4UWFA 2XRZA 1Z6TA 3KD7A 2WXPA 3EHNA 2E0IA 2ZU6B 4FHJA 4UWLA 2AXUA 3LJ3A 2IF4A 2AW6A 3SNXA 4G23A 3D9IA 3S7JA 1QQEA 3ONKA 3HIZA 5CMWA 4ANVA 4I43A 3R7QA 3IKOB 3UT4A 2YQ8A 1Z3XA 3RRUA 3FEXA 4CCAA 4FADA 3ULQA 2V5FA 3MZLB 3ASFA 3G2TA 1UJKA 1IYGA 4BT8A 1FVFA 4JHKA 4DLQA 3R7RA 3D9LA 3TAXA 2FULA 1ELKA 2VSXE 4O6FA 4NURA 4TRQA 5HQ8A 1OWMA 1KT0A 3PRZA 1UJJA 2X6JA 2HYZA 3ML8A 4JPSA 2BTDA 1Y6IA 4YVOA 3CVPA 4KBQA 3CVWA 5FJYA 5ANLA 1N54A 3ZYKA 3ASGA 4JW1A 3Q15A 3FTWA 3PE3A 4RG9A 3NZSA 4LCTA 5G55A 4ACLA 3CEQA 2DBAA 5LFAA 3ZVVA 3AU4A 4AV7A 3QC1A 4ME2A 4GMJA 4M3OA 4Y6CA 4MS6A 5EDSA 1IQRA 5C1DA 2WXIA 3FUFA 3LKUA 3ZHEA 3I5PA 3VLDA 3TG4A 5BPPA 3MEKA 4KVOA 5CHEE 3ZW3A 4EZLA 3PNLB 4I9CA 4PDXA 5D0OD 1DVPA 4EPZA 1SQMA 1JWFA 3IV0A 3OXLA 4PS3A 4IYPA 3B7RL 3U66A 2A4ZA 3MA5A 4CEMA 3URZA 3UQ3A 5T8IA 3HHMA 4BX8A 1H2TC 4I6GA 4EBAA 3P1UA 2A5UA 5AJLA 3B7UX 3CVVA 2BUGA 3PREA 1H19A 5AENA 4TV3A 4F3VA 4XKCA 3APFA 3U4TA 1XNFA 4EBAG 2XRYA 4G2VA 1H0AA 2J9QA 4J8EA 3D9MA 4HFGA 3VLFA 4DLOA 1FVHA 1HXIA 3SI5A 2WXQA 4KYOB 4Q96A 2JEKA 2KC7A 3D9KA 3FU6A 3JYSA 4WWNA 3AS8A 4G11A 2DIWA 3RIBA 4C9BB 4G25A 2DCPA 4B89A 4EECA 3FY4A 3RU0A 2LO6A 3FUNA 4MLPA 3BG0B 2I1JA 4HOSA 5E76A 3CLJA 4BWRA 4EZJA 3LY7A 4XI0A 4ANWA 2IONA 2VTBA 4MRUA 5JJ7A 3QNKA 5HI7A 3CHPA 3CQCB 3PS6A 2KCVA 4APOA 4ATGA 3B7SA 2L6JA 2YNQA 3KAEA 4L7TA 2BF0X 1EPUA 2KATA 2WXMA 3L08A 5FQ4A 5G2NA 3VTYA 2XGOA 4JEHA 3I4GA 1SZAA 2E2EA 4N39A 4WWPA 5J90A 3EHMA 3IHYA 4C0MA 5T4YA 3SD5A 2I2OA 3QK0A 4YNDA 2Y4TA 5EX0A 2YHEA 2PQNA 1KLXA 3FH7A 1U3DA 4GZ5A 3QWWA 4RG6A 4UI9K 2UY1B 3CHSA 5AJDA 5LX8A 2JLBA 5T3RA 3RKVA 1U3CA 1H6KA 2VGYA 4IRUA 4K0RA 3CVYA 3ZN3A 4ACKA 3G2WA 1Y8MA 5FQ7A 3ASHA 3FWVA 3NZUA 2NSZA 4J8SA 3G2UA 3S2AA 4AEZC 4AIFA 5J08A 3QKYA 2WMNA 2QFCA 4CDMA 2WPVA 4FC8A 4L2LA 2AWIA 4EZKA 5G04C 4YVQC 5KCMA 3P2BA 3CHOA 2I1KA 4BT9A 2KM4A 4GMLA 2WQ7A 2VQ2A 3FU5A 4GZDA 3MV3B 2VTBB 4JVSA 3TG5A 5BNWA 1EYHA 4GCNA 2CHZA 4E85A 3FULA 4GYYA 5FZRA 2ONDA 4J8DA 4OVVA 4HXIA 1H2UA 3PDNA 2IOSA 1HX8A 4UQYA 5BT1A 5BV0A 3LCAA 3U3WA 2L0TB 2IJGX 1HFAA 1HZ4A 3OAWA 4GB9A 4Q94A 2C0LA 4F1SA 3SBTB 4PH4B 3FDHA 2IFUA 4XZ4A 4FLHA 2GW1A 4XI9A 4ABNA 4BTBA 3TGOA 2IU1A 3GZ2A 3LEWA 3Q49B 4DI4A 2LSVA 3LVQE 4KXKB 1P5QA 3CSTA 3TXMA 5BUZA 4AJWA 3LXUX 3L16A 3TJPA 3GYZA 1VDYA 3E4BA 4Y6WA 3MGBA 3D9OA 2HM8A 2WXGA 2GGFA 5AYWD 1OWOA 1E7VA 3KS2A 4QFVA 4WWOA 3ZFWA 3PH0C 1HG2A 1JUQA 5E75A 2XEVA 3CK7A 2X6HA 3LS8A 3FUMA 4WNFA 1WM5A 3QDNA 3LYAA 1GW6A 4KZCA 4U04A 3I4RB 1HG5A 3FTXA 5JHBA 1NP7A 1UG3A 2J4BA 3ESKA 1SZ9A 4A55A 4RVBA 2WXJA 5KJKA 5FTPA 4HORA 2WXOA 2X6FA 4G24A 4BY6A 3MKRA 2LNIA 2UWJG 3CKCA 3O4ZA 3CVNA 2LSUA 3FUJA 2EQXA 1UN8A 3NQPA 3PEVB 4UQXA 5FQ8A 1B89A 4WNEA 3ZRHA 4DPRA 5A7DB 1HU3A 2J49A 2XPIA 3DBSA 2VSOE 4E6HA 3D3MA 5EX3A 3UPVA 3SHFA 2CG2A 4B0ZA 1E7UA 5G05C 4AM9A 4L1BA 5A6CA 4UWGA 4CGVA 2YINA 4JL0A 2VSYA 3SGHA 3SFZA 2J4DA 3HVEB 4FJYA 2C0MA 4PS8A 3PE4A 4UI9J 4XIFA 5DBKA 3PEUB 5FQ6A 5BW8C 3UX4A 2XCCA 3L17A 3MKQB 3ML9A 2WXRA 3AS5A 3ENEA 4H7YA 3QWVA 4G1TA 3CV0A 3S7DA 4NACA 1H2VC 3EIJA 4MKTA 4WAFA 5ENNA 3T8MA 2Y4UA 3FTUA 4GYWA 5LCWC 4KZ0A 2MHKA 3FP3A 3N71A 3ZYLA 4U0UA 3ONLA 2FBNA 3O48A 3JUIA 3OXFA 4D10C 5M72A 3OTNA 4XE0A 4N2QA 1L5JA 2WM9A 2XGMA 3CIAA 4DI3A 4CGWA 2CG3A 4BTAA 4ANXA 3T5XA 3CVXA 5ANRA 3PUJA 3ZGQA 4U8HA 4XX5A 1IHGA 1HF8A 2IQCA 2AVPA 4V3IA 3UUXA 3VTXA 5AIJA 3CVUA 2AXZA 3FUIA 4A1GA 3T5VA 1X5BA 2C2LA 1N52A 1HS6A 2WXFA 1OWLA 2WXHA 4BSXA 2VGXA 3D9NA 3IHVA 4F7AA 4FP7A 1OWPA 3EJNA 2NXPA 2HO1A 3CVLA 2GRMA 4FJZA 5D0QD 4AY5A 1ELRA 4HLEA 2P58C 3ESLA 3FTSA 2V0PA 1W3BA 4UWHA 3RJVA 4APFA 3BEEA 5CCLA 3FUKA 3MKQA 2L9BA 2PM6A 4HVBA 3IEGA 3FUHA 5DIZA 1NZNA 2KCLA 3UT7A 5KJMA 2IOLA 4HOUA 3FFLA 4WNGA 3I3NA 5G04J 3LY9A 1TJCA 3L54A 3NF1A 4GA2A 4L23A 4PUCA 2CHWA 4KMOA 3FEYA 5FWQA 4JA9A 2HR2A 3L22A 3PNTB 2WXNA 3LY8A 4LEUA 3CK9A 2Q7FA 2M63A 3FTZA 1HH8A 3CR3A 4GPKA 4I1AA 3L13A 4C0EA 2LAIA 1JWGA 3ZEFA 2X3MA 4HOQA 3QJZA 4A3TA 4AXHA 4GZ6A 2WQ6A 4OVUA 3ZPJA 1E96B 2OVFA 3ZYMA 1OWNA 3SBSA 4I9EA 2R5SA 2VGXB 3B7TA 3GW4A 1ZBPA 4GCOA 2FF4A 4FLBA 5ARFA 3DPDA 3FU3A 2WXKA 5LOZA 3ZYQA 5JJTA 1TEZA 2WB2A 1E8ZA 3UT8A 5CMYA 4I1OB 4I2WA 4KVMA 5JJ6A 4DK5A 4JZYA 3EIQC 3QOUA 3MX3A 3TXNA 3BG1B 4RSYA 4N3BA 3FHEA 4KT6B 1QZ2A 4CT0A 3FH8A 2J08A 3VLEA 1E8YA 2VJ8A 4GZCA 2I9CA 2Y3AA 2KZTA 2J09A 3FH5A 3JQ1A 4GA1A 3ASDA 4WNDA 2X6IA 2LAHA 2PM7A 4AOFA 3JQ0A 4PS7A 4Q69A 2XPYA 3TL5A 2PL2A 3AU5A 4L2YA 3CKBA 1UW4B 4DJAA 3MJWA 4ILGA 3RK6A 2OVBA 1WAO1 5CCMA 4I2ZA 4JXTA 4LERA 1BPOA 2XHEA 4B94A 5A23A 4FULA 3HYMB 4UQZA 3LDZA 3IBEA 4XKBA 2FO7A 1NA3A 1WY6A 4URKA 2MRIA 1FCHA 3SF4A 4U07A 4I1MA 4A3VA 4TUUA 3S7BA 2AXVA 2UY1A 3QAQA 4ANUA 2FEZA 4U63A 3U9WA 3B13A 1LF8A 3QARA 3QB2A 4ILHB 3C98A 3S7FA 4A1SA 4IULA 4UI9C 1EDUA 4N5CA 2KZTB 3CGHA 3CQGB 3GZSA 2KCKA 3MYVA 5KJLA 3R9AB 3CHRA 4UWKA 3JCKC 2OV8A 2XGSA 4J0UA 4CDNA 2XCBA 5EKQD 2V8SE 3FTVA 1DNPA 4HS2A 4J8FA 3MCXA 2OOEA 3RO2A 4IN3B 4G26A 3FTYA 4U0ZA 4HOTA 3FUDA 2X6KA 1MHQA 4AP2A 1QNFA 4N3AA 5KJNA 3CK8A 5G05J 2QY7A 1IQUA 3K9IA 3Q47B 2R59A 2WVIA 4GZ3A 4JHJA 3SZ7A 1ZU2A 2V4LA 3HDXA 2WXLA 2ILRA 3G2SA 4GYOA 2RD0A 2R17C 4NQ0A 4NRHB 1PY1A 4OYSA 5LCWJ 2X38A 3ZXSA 2J07A 3PUKA 3AS4A 4N2SA 3ZIMA 4LUNU 3PVLA 4FHKA 3U64A 3D9JA 1NA0A 4GA0A 5FT9A 2PZIA 3CVQA 1E90A 4I6EA 3LPZA 3CHQA 3Q5MA 3RO3A 5FZQA 1ELWA 1PAQA 4P29A 3GZ1A 4WUYA 2GRLA 1EF1C 4AY6A 5BV1A 4R7LA 2VYIA 5FZSA 3Q4AB 3FUEA 3WXXA 3MV2B 4U0SA 3EDTB 3D9PA 4JC8A 1UN9A 2XPZA 3LVRE 1E8WA 1JPLA 3QWPA 2NC9A 1XGWA 3OXGA 4GU5A 4LRZA 1A17A 1OUVA 2CFUA 5ARGA 4FU3A 3FU0A 4B8AA 1KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G25 A;  2XPI A;  3RU0 A;  4N3B A;  4JHR A;  1QZ2 A;  3UPV A;  5EX3 A;  4HOS A;  4EQF A;  4BWR A;  4I17 A;  3LY7 A;  4XI0 A;  5JJ7 A;  5G05 C;  5HI7 A;  4AM9 A;  2I6H A;  4N3C A;  4APO A;  2KCV A;  2YHC A;  3ZHE B;  2L6J A;  3KAE A;  2VSN A;  5A6C A;  3VTY A;  2KAT A;  4GA1 A;  3ASD A;  4WND A;  4CGV A;  2XGO A;  4AY5 A;  4JA7 A;  4JL0 A;  4H7X A;  4W9R A;  2VSY A;  2WQH A;  2PL2 A;  2C0M A;  2E2E A;  3PE4 A;  4N39 A;  4UI9 J;  4XIF A;  3CKB A;  5DBK A;  5BW8 C;  1YA0 A;  2XCC A;  2PQR A;  3U4T A;  4CDR A;  3AS5 A;  2FI7 A;  4H7Y A;  3QWV A;  4G1T A;  3CV0 A;  3S7D A;  1PC2 A;  4YND A;  2Y4T A;  5EX0 A;  1WAO 1;  2PQN A;  1KLX A;  4I2Z A;  3ZFW A;  2Y4U A;  4GZ5 A;  3QWW A;  4RG6 A;  4UI9 K;  2UY1 B;  4GYW A;  5LCW C;  2MHK A;  4B94 A;  2JLB A;  3FP3 A;  3N71 A;  3RKV A;  3HYM B;  2VGY A;  4UQZ A;  4U0U A;  2FO7 A;  1NA3 A;  2FBN A;  3KD7 A;  3ZN3 A;  3O48 A;  5CCM A;  1FCH A;  3SF4 A;  3OXF A;  1Y8M A;  4U07 A;  2IF4 A;  5M72 A;  4N2Q A;  4G23 A;  2XGM A;  3S7B A;  3ASH A;  2UY1 A;  3FWV A;  1QQE A;  2FEZ A;  3S7J A;  4AIF A;  4CGW A;  4BTA A;  3QKY A;  4BTB A;  2QFC A;  2WPV A;  2YQ8 A;  3ZGQ A;  5G04 C;  3ULQ A;  1IHG A;  2V5F A;  4YVQ C;  2AVP A;  3S7F A;  3UUX A;  4UI9 C;  3ASF A;  3VTX A;  4A1S A;  4BT9 A;  4N5C A;  4BT8 A;  1IYG A;  2C2L A;  2KCK A;  2VQ2 A;  3TAX A;  3R9A B;  5KJL A;  3MV3 B;  4O6F A;  5HQ8 A;  2XGS A;  1KT0 A;  4J0U A;  3TG5 A;  5BNW A;  2VGX A;  2XCB A;  2HYZ A;  5EKQ D;  4GCN A;  4YVO A;  3RIB A;  3CVP A;  4KBQ A;  4GYY A;  4J8F A;  5FJY A;  2OND A;  4J8D A;  5FZR A;  5ARF A;  5BT1 A;  2HO1 A;  2OOE A;  3CVL A;  3PDN A;  5D0Q D;  3RO2 A;  3ASG A;  4IN3 B;  1ELR A;  3Q15 A;  3LCA A;  2P58 C;  3PE3 A;  4G26 A;  4U0Z A;  4UQY A;  1W3B A;  4RG9 A;  1HZ4 A;  3RJV A;  3BEE A;  5CCL A;  4HOT A;  2C0L A;  3CEQ A;  2DBA A;  4N3A A;  5KJN A;  2IFU A;  3CK8 A;  5G05 J;  3IEG A;  5DIZ A;  1NZN A;  2KCL A;  2GW1 A;  3K9I A;  3Q47 B;  4ME2 A;  4HOU A;  3FFL A;  4GZ3 A;  3GZ2 A;  3Q49 B;  4WNG A;  4Y6C A;  3LY9 A;  4XI9 A;  5G04 J;  5C1D A;  3ZHE A;  3LKU A;  1ZU2 A;  2LSV A;  3SZ7 A;  1TJC A;  3TG4 A;  4KXK B;  3NF1 A;  3MEK A;  4GA2 A;  1P5Q A;  4GYO A;  4NQ0 A;  4NRH B;  5CHE E;  5LCW J;  3AS4 A;  4JA9 A;  4I9C A;  4N2S A;  5D0O D;  2HR2 A;  3GYZ A;  3TGO A;  3E4B A;  3OXL A;  4Y6W A;  1NA0 A;  4GA0 A;  3LY8 A;  4LEU A;  5FT9 A;  3CK9 A;  2Q7F A;  2PZI A;  3CVQ A;  3KS2 A;  3MA5 A;  1HH8 A;  5AYW D;  3URZ A;  4GPK A;  2XEV A;  3LPZ A;  4I1A A;  3UQ3 A;  3CK7 A;  3Q5M A;  5FZQ A;  3RO3 A;  1ELW A;  4HOQ A;  3GZ1 A;  4WUY A;  4GZ6 A;  4WNF A;  1WM5 A;  2BUG A;  3QDN A;  3LYA A;  4AY6 A;  4U04 A;  3ZPJ A;  1E96 B;  2VYI A;  5FZS A;  4ABN A;  4F3V A;  3Q4A B;  3WXX A;  5KJM A;  4I9E A;  1XNF A;  3MV2 B;  2R5S A;  2VGX B;  3ESK A;  3GW4 A;  1ZBP A;  3EDT B;  2FF4 A;  2J9Q A;  4G2V A;  4GCO A;  4J8E A;  4U0S A;  5FTP A;  5JJT A;  5KJK A;  4HOR A;  1HXI A;  4G24 A;  3MKR A;  2LNI A;  3U3W A;  2UWJ G;  3QWP A;  2NC9 A;  3CKC A;  3OXG A;  3CVN A;  2LSU A;  1A17 A;  3QOU A;  4KYO B;  1OUV A;  2KC7 A;  4I2W A;  4UQX A;  5ARG A;  1B89 A;  4WNE A;  5JJ6 A;  3JYS A;  3AS8 A;  5A7D B;  1KT1 A; 
#chains in the Genus database with same CATH topology
 3G2V A;  1X81 A;  1HO8 A;  1TR4 A;  2XQ0 A;  4B8C B;  3ZHE B;  2VSN A;  4BES A;  2RG8 A;  4ILI A;  1N95 A;  4W9R A;  1YA0 A;  2J8S D;  4J7W A;  3TWT A;  4AVX A;  4GTQ A;  3B7B A;  3DEP A;  2P2C P;  5HS0 A;  5LP0 A;  2H6F A;  4UWF A;  3KD7 A;  2AXU A;  4G23 A;  2AJA A;  2YQ8 A;  4CCA A;  3FEX A;  2OEV A;  2F8Y A;  3ASF A;  3G2T A;  4JHK A;  2RKK A;  2FUL A;  4NUR A;  4TRQ A;  1OWM A;  2X6J A;  2BTD A;  4KBQ A;  5ANL A;  3KEA A;  3ZYK A;  3ASG A;  4JW1 A;  3FTW A;  3PE3 A;  4LCT A;  5G55 A;  5LFA A;  3ZVV A;  1Z5S C;  4HB5 A;  3NB2 A;  3ZHE A;  3LKU A;  3ZW3 A;  4EZL A;  1TNZ A;  1DVP A;  3IV0 A;  4IYP A;  4I6G A;  5AJL A;  2B0O E;  4TUM A;  3UIN C;  3EU9 A;  5CBN A;  4Z68 A;  4G2V A;  3D9M A;  4HFG A;  3SY2 A;  2RFM A;  4Q96 A;  4NIK A;  3FU6 A;  1YCS B;  3JYS A;  4WWN A;  4G11 A;  3RIB A;  4EEC A;  3Q78 A;  3RU0 A;  4MLP A;  2FO1 E;  3UM2 A;  4BWR A;  4MRU A;  5JJ7 A;  3QNK A;  5HI7 A;  3CQC B;  4APO A;  5HKP A;  1IXV A;  4ATG A;  3KAE A;  5C2Y A;  2YNQ A;  3AG2 E;  2BF0 X;  3JXJ A;  4F1P A;  3VTY A;  3I4G A;  2E2E A;  3EHM A;  2PQN A;  3FH7 A;  4GZ5 A;  4UI9 K;  3QWW A;  5T3R A;  3RKV A;  1MJ0 A;  5KNG A;  3ASH A;  2NSZ A;  3G2U A;  2WMN A;  3V2O A;  4L2L A;  2AWI A;  4EZK A;  3V2X A;  3L82 A;  2ZXW E;  1TN7 A;  1K1A A;  1EYH A;  2XS1 A;  1JCR A;  4GTO A;  4J8D A;  4X8Q A;  4LNB A;  2IOS A;  1O1S A;  1HZ4 A;  4GB9 A;  3SBT B;  4PH4 B;  3TGO A;  3Q49 B;  4DI4 A;  3IXE A;  2OCC E;  3CST A;  1SA5 A;  4AJW A;  3MGB A;  2HM8 A;  1OWO A;  1HG2 A;  1S63 A;  3PZ2 A;  3L9T A;  5ENT D;  3FUM A;  4WNF A;  1GW6 A;  3I4R B;  1HG5 A;  3FTX A;  2IY0 C;  2EIK E;  4UQX A;  3DBS A;  4E6H A;  5EX3 A;  4U95 D;  3SGH A;  4FJY A;  2C0M A;  4PS8 A;  4UI9 J;  4XIF A;  5DBK A;  5FQ6 A;  5CBO A;  2XCC A;  3L17 A;  2WXR A;  3ENE A;  4LG6 A;  2HE0 A;  4JB8 P;  2H6I A;  1NL4 A;  3NAW A;  3O48 A;  2DYR E;  3OTN A;  4N2Q A;  1L5J A;  2WM9 A;  4CGW A;  4BTA A;  3T5X A;  5ANR A;  1HF8 A;  2IQC A;  2AVP A;  3VTX A;  3FUI A;  4TXQ A;  1X5B A;  4MBG A;  3TWS A;  2WXF A;  1OWL A;  4BSX A;  3IHV A;  4F7A A;  4FJZ A;  3ESL A;  1N11 A;  1W3B A;  3RJV A;  3BEE A;  2XEN A;  3FUK A;  3UT7 A;  4GTS A;  4HOU A;  3NF1 A;  4GA2 A;  4BSZ B;  3FEY A;  5FWQ A;  1TNY A;  4JA9 A;  3TWU A;  2WXN A;  2M63 A;  1K1B A;  1RW2 A;  3ZEF A;  2WQ6 A;  1E96 B;  1OWN A;  4I9E A;  5ARF A;  3FU3 A;  1WDY A;  5EN5 D;  5CMY A;  4YDW A;  2R02 A;  3TXN A;  4G8L A;  3DXM G;  3FH8 A;  2J08 A;  1MX6 A;  2VJ8 A;  2I9C A;  2J09 A;  3FH5 A;  3ASD A;  1K8K G;  4L2Y A;  3CKB A;  2OVB A;  1BPO A;  4B94 A;  2NYJ A;  2XS8 A;  3J5Q B;  3HYM B;  4FUL A;  4UQZ A;  4XKB A;  1NA3 A;  1FT2 A;  1FCH A;  3SF4 A;  4TUU A;  2AXV A;  4U63 A;  3QB2 A;  3RAU A;  4N5C A;  2KZT B;  3CGH A;  3CQG B;  3GZS A;  4HNA D;  5KJL A;  4UWK A;  3JCK C;  2OV8 A;  2XGS A;  2XCB A;  2IO2 C;  3FTV A;  1DNP A;  4IN3 B;  3FTY A;  3FUD A;  2X6K A;  1QNF A;  3ZXP A;  5KJN A;  2QY7 A;  1N4P A;  3K9I A;  2GRP B;  2R59 A;  3SZ7 A;  2WXL A;  4NRH B;  3ZXS A;  4FHK A;  2PZI A;  1S64 A;  4YDE A;  4HRL A;  4P29 A;  2GRL A;  4AY6 A;  4R7L A;  3Q4A B;  2XZD G;  5EIB E;  4CZ2 D;  1UN9 A;  2XPZ A;  3QWP A;  5CEA A;  1A17 A;  5CRV A;  3ULE G;  1KT1 A;  4CT4 A;  1LTX A;  5JHA A;  1S0P A;  2I6H A;  4N3C A;  2WQH A;  3CSF A;  4CDR A;  3KEZ A;  2PQR A;  1PC2 A;  3HVE A;  2L0I A;  3B95 A;  4GAA A;  4CRW A;  4BX9 A;  4FA6 A;  1INZ A;  4BET A;  2WXP A;  5CCM A;  3DSV A;  1KZO A;  2AW6 A;  3R7Q A;  3TWQ A;  3JUE A;  4FAD A;  5KWD A;  1FVF A;  4O6F A;  3PRZ A;  1UJJ A;  3CVP A;  3CVW A;  1OCR E;  5FJY A;  1N54 A;  4ACL A;  3CEQ A;  1FT1 A;  3ULY A;  5KBA A;  4ME2 A;  4M3O A;  4Y6C A;  1SA4 A;  2DZO A;  5C1D A;  1N4Q A;  3PNL B;  5D0O D;  1H6O A;  1BI7 B;  3B7R L;  1IHB A;  3B7U X;  3CVV A;  1YYH A;  4BER A;  4XKC A;  2XRY A;  3DXK G;  4KYO B;  4C9B B;  1N4S A;  5E76 A;  3LY7 A;  4ANW A;  2VTB A;  3PS6 A;  3B7S A;  2KBX A;  3L08 A;  1EPU A;  5FQ4 A;  2XGO A;  4JEH A;  4N39 A;  5AAO A;  5J90 A;  3IHY A;  3SD5 A;  3QK0 A;  4YND A;  2YHE A;  3LJN A;  1U3D A;  1AP7 A;  3ABL E;  3ASN E;  3G2W A;  1Y8M A;  3V31 A;  5FQ7 A;  5J08 A;  1MZC A;  2QFC A;  4CDM A;  2KXP C;  4N5Q A;  3PZ1 A;  1O5M A;  4B93 B;  3CHO A;  2KM4 A;  3KSQ A;  2WQ7 A;  2VQ2 A;  3FU5 A;  2VTB B;  5EIL A;  3TG5 A;  4GCN A;  3UKU G;  4GYY A;  5FZR A;  3V30 A;  4OVV A;  1D8D A;  4UQY A;  5BV0 A;  3LCA A;  3U3W A;  2P9K G;  1BD8 A;  3EHQ A;  5AQ7 A;  4ABN A;  4BTB A;  3LEW A;  4KXK B;  1U2V G;  3LXU X;  3W9G A;  3E4B A;  3D9O A;  1E7V A;  1JUQ A;  3BU8 A;  3LS8 A;  3HXC A;  4KZC A;  2H6H A;  3DWL G;  1NP7 A;  1UG3 A;  2J4B A;  3ESK A;  1SZ9 A;  4A55 A;  5FTP A;  2UWJ G;  3CKC A;  2LSU A;  3FUJ A;  4EHM A;  1UN8 A;  3NQP A;  3ZRH A;  5A7D B;  1HU3 A;  2XPI A;  2VSO E;  4B0Z A;  1BI8 B;  1TNO A;  4L1B A;  2XEH A;  4UWG A;  4TXP A;  4CGV A;  2YIN A;  1N94 A;  3Q9U C;  3HVE B;  2ETA A;  5BW8 C;  3MKQ B;  5AQB A;  4H7Y A;  3CV0 A;  1H2V C;  3EIJ A;  4MKT A;  1Q2Z A;  2MHK A;  3FP3 A;  4RLY A;  2B6C A;  5M72 A;  4XE0 A;  4DI3 A;  2CG3 A;  2F8X K;  5JMN D;  2V5Q C;  3ZGQ A;  1IHG A;  3UUX A;  3T5V A;  3JXI A;  1N52 A;  2VGX A;  3D9N A;  5EID A;  4FP7 A;  1OWP A;  5CED B;  2JAB A;  5AQA A;  1OCZ E;  3CVL A;  4AY5 A;  3FTS A;  2V0P A;  5CCL A;  2R03 A;  3MKQ A;  2PM6 A;  4ATZ D;  3DRA A;  5KJM A;  1N9A A;  5G04 J;  3T9K A;  3C72 A;  3LY9 A;  2LUH A;  4PUC A;  2CHW A;  1JCQ A;  2BKG A;  3L22 A;  3PNT B;  3E33 A;  4K5C A;  3CR3 A;  3EUV A;  1JWG A;  4AXH A;  4HOQ A;  4GZ6 A;  4OVU A;  3Q79 A;  4G8K A;  2QYJ A;  3C3O A;  2Y0B G;  3C3Q A;  2VGX B;  5LCW J;  5LOZ A;  2WB2 A;  4QQI A;  3ASO E;  4I2W A;  4JD2 G;  3BG1 B;  4KT6 B;  3ZUV B;  2EIN E;  1E8Y A;  3JQ1 A;  3AG4 E;  4Q69 A;  3TL5 A;  1WAO 1;  2XHE A;  2IEJ A;  2FO7 A;  2MRI A;  4U07 A;  3S7B A;  2UY1 A;  2P9N G;  2EIM E;  3ZU7 B;  4ILH B;  3NBN B;  4UI9 C;  1O1T A;  4CDN A;  2V8S E;  4HS2 A;  4J8F A;  2OOE A;  4G26 A;  3CK8 A;  5G05 J;  3Q47 B;  2EIL E;  4JHJ A;  1AWC B;  3HDX A;  2ILR A;  4GYO A;  3E30 A;  2J07 A;  3PUK A;  3AS4 A;  3U64 A;  3CVQ A;  1DCE A;  3NOC D;  1PAQ A;  3C3R A;  4K5A B;  1EF1 C;  2VYI A;  3DEO A;  3MV2 B;  4U0S A;  3EDT B;  3D9P A;  4JC8 A;  3LVR E;  1E8W A;  3OXG A;  4GU5 A;  1OUV A;  3HXB A;  5ARG A;  4FU3 A;  4Y6W A;  4OAU C;  3DSX A;  1DC2 A;  4EQF A;  1S70 B;  4I17 A;  4ZFH A;  2YHC A;  3UMV A;  4H7X A;  1TJF A;  3ISM C;  2FI7 A;  4DX2 A;  2WMO A;  3CHM A;  4BFR A;  5ENQ D;  4I6J A;  2H6G A;  1MQS A;  3L6A A;  4JEU A;  3RRN B;  2LXL A;  5B1B E;  3DSU A;  2XRZ A;  1TNB A;  3EHN A;  3SNX A;  1QQE A;  3ONK A;  1TYQ G;  3HIZ A;  4ANV A;  3UT4 A;  2IO3 C;  3RRU A;  4O1O A;  4A63 B;  3ULQ A;  2V5F A;  4DLQ A;  3D9L A;  3TAX A;  2VSX E;  1KT0 A;  4JPS A;  2HYZ A;  1Y6I A;  2F0Y A;  3BQO A;  3Q15 A;  5FIN A;  3NZS A;  3Q9N C;  3HRA A;  3QC1 A;  5EDS A;  1IQR A;  2WXI A;  5B3S E;  5BPP A;  4KVO A;  1SVX A;  5ENO D;  2GRN B;  4U7E B;  1KPS B;  3R9M A;  3OXL A;  4PS3 A;  3U66 A;  3UKR G;  4CEM A;  3URZ A;  3UQ3 A;  3HHM A;  1H2T C;  5JA4 D;  2A5U A;  1NFI E;  2BUG A;  3PRE A;  1H19 A;  1V55 E;  5AEN A;  4TV3 A;  4F3V A;  3APF A;  3U4T A;  4J8E A;  4L9P A;  4DLO A;  1FVH A;  3SI5 A;  3TWX A;  3E32 A;  2KC7 A;  1IKN D;  3AS8 A;  2DIW A;  1SW6 A;  4G25 A;  4HBD A;  3BG0 B;  4HOS A;  2P9S G;  4XI0 A;  2ION A;  3CHP A;  3HXD A;  3SFX A;  3ZKJ A;  2DYS E;  1YMP A;  4L7T A;  1D8E A;  2WXM A;  2KAT A;  2RFA A;  5FIO A;  2QZA A;  4C0M A;  3AG3 E;  2OEW A;  1OCO E;  3RSE G;  5KNH D;  3CHS A;  5ENP D;  5LX8 A;  1DCQ A;  2PNN A;  1U3C A;  1H6K A;  4IRU A;  2XEE A;  4O60 A;  3CVY A;  4ACK A;  3NZU A;  4J8S A;  1OT8 A;  4AEZ C;  2BKK B;  3QKY A;  4FC8 A;  5KCM A;  2I1K A;  4JVS A;  4E85 A;  5AAR A;  2OND A;  4HXI A;  4LSZ E;  3PDN A;  1HX8 A;  5BT1 A;  4YDY A;  2L0T B;  4Q94 A;  2C0L A;  4F1S A;  2P9P G;  2P9I G;  3FDH A;  2IFU A;  1N4R A;  4HRN A;  4FLH A;  5HRY A;  4XI9 A;  3GZ2 A;  4HI8 A;  3F6Q A;  1H6P A;  3PZ3 A;  3L16 A;  4CYM D;  5AQ9 A;  2GRQ B;  2GGF A;  5AYW D;  3KS2 A;  4QFV A;  4WWO A;  3PH0 C;  5E75 A;  3CK7 A;  4GTT A;  1WM5 A;  3QDN A;  3SFY A;  3LYA A;  4U04 A;  4GMR A;  5JHB A;  4RVB A;  2WXJ A;  4BY6 A;  3MKR A;  2LNI A;  3UIO C;  2MYO A;  3CVN A;  5FQ8 A;  4DUI A;  1BU9 A;  1FPP A;  3SHF A;  2CG2 A;  5G05 C;  3DSW A;  5A6C A;  3UXG A;  4JL0 A;  2VSY A;  2J4D A;  3PEU B;  3ML9 A;  3QWV A;  3S7D A;  4NAC A;  4WAF A;  5ENN A;  4GTM A;  3FTU A;  4GYW A;  1BLX B;  1LD7 A;  3N71 A;  4U0U A;  3JUI A;  4LNG A;  2XGM A;  2R05 A;  4HLL A;  3AG1 E;  4ANX A;  3PUJ A;  1QYM A;  4U8H A;  1NI1 A;  2C2L A;  2HO1 A;  2GRM A;  5D0Q D;  1ELR A;  4HLE A;  2P58 C;  3IEG A;  2KCL A;  2IOL A;  4WNG A;  3I3N A;  1TJC A;  3TWW A;  4L23 A;  3DPY A;  2HR2 A;  3DST A;  3LY8 A;  4LEU A;  3CK9 A;  1QBQ A;  1HH8 A;  3HXF A;  3TWR A;  4I1A A;  4C0E A;  2X3M A;  3QJZ A;  4A3T A;  5ENR D;  3ZPJ A;  4K5B A;  3SBS A;  5BXU A;  2R5S A;  2XZT G;  3GW4 A;  1ZBP A;  4GCO A;  2FF4 A;  4FLB A;  3ZYQ A;  1E8Z A;  3UT8 A;  3WG7 E;  3V79 K;  4I1O B;  5JJ6 A;  4DK5 A;  4RSY A;  1QZ2 A;  4CT0 A;  3VLE A;  1MYO A;  4HQD A;  4WND A;  5CRU A;  2LAH A;  2XPY A;  2PL2 A;  4ILG A;  3RK6 A;  3UI2 A;  2F37 A;  4JXT A;  4LER A;  5A23 A;  3LDZ A;  3IBE A;  4URK A;  4A3V A;  3QAQ A;  3PZ4 A;  4ANU A;  3B13 A;  3QAR A;  2DWZ A;  3C98 A;  2GRR B;  3S7F A;  4IUL A;  4A1S A;  2KCK A;  1G3N B;  3MCX A;  4U0Z A;  5IY5 E;  1MHQ A;  4AP2 A;  2P9L G;  5B1A E;  4N3A A;  4DX1 A;  1IQU A;  1ZU2 A;  3G2S A;  3UTM A;  4OYS A;  1PY1 A;  2X38 A;  4LUN U;  4F6R D;  2ZIR A;  1E90 A;  4I6E A;  3Q5M A;  5FZQ A;  3J5P A;  3GZ1 A;  4WUY A;  2DVW A;  5BV1 A;  5FZS A;  3FUE A;  3WXX A;  3ABM E;  1JPL A;  4LRZ A;  3EHR A;  1XGW A;  2CFU A;  3Q75 A;  3FU0 A;  4B8A A;  3RRM B;  4JHR A;  2L6B A;  4GTV A;  3UM0 A;  3APD A;  4U8Y D;  3UM1 A;  1E8X A;  3E34 A;  5ENS D;  4F53 A;  4JA7 A;  2MOW A;  4J6I A;  3PZD A;  1HE8 A;  4K03 A;  2CHX A;  3APC A;  4GPM A;  2CFZ A;  1Z3Y A;  1Z6T A;  2R2L A;  2E0I A;  2ZU6 B;  4FHJ A;  4UWL A;  3LJ3 A;  2IF4 A;  3D9I A;  3S7J A;  5CMW A;  4I43 A;  3IKO B;  3DSS A;  1Z3X A;  5EYP F;  3MZL B;  5D66 A;  1UJK A;  4BT8 A;  3R7R A;  5HQ8 A;  1ELK A;  5ITZ F;  3ML8 A;  4YVO A;  1TN8 A;  3SQV A;  2QC9 A;  4RG9 A;  3UM3 A;  2DBA A;  2ETB A;  2ZGG A;  3AU4 A;  4AV7 A;  4GMJ A;  4BEP A;  5EYL A;  4MS6 A;  3FUF A;  2V4H C;  3I5P A;  3VLD A;  3TG4 A;  3MEK A;  5CHE E;  3Q7F A;  4I9C A;  4PDX A;  4EPZ A;  1SQM A;  1JWF A;  2A4Z A;  3MA5 A;  3AJI A;  5T8I A;  4BX8 A;  4EBA A;  3P1U A;  4DRX E;  4EBA G;  1XNF A;  3VLF A;  1H0A A;  2J9Q A;  1HXI A;  2Y1L E;  2WXQ A;  4U96 D;  2JEK A;  3D9K A;  4B89 A;  2DCP A;  3FY4 A;  2LO6 A;  4GTP A;  3FUN A;  1N0Q A;  2I1J A;  3CLJ A;  4EZJ A;  4M7C A;  2KCV A;  2L6J A;  5G2N A;  3KSL A;  5CEC B;  1SZA A;  4WWP A;  1D9S A;  5T4Y A;  2I2O A;  4XEI G;  2Y4T A;  5EX0 A;  1KLX A;  4RG6 A;  4DX6 D;  2UY1 B;  5AJD A;  2JLB A;  2VGY A;  4K0R A;  3ZN3 A;  3FWV A;  3S2A A;  4AIF A;  1A5E A;  2WPV A;  1ZB1 A;  1TN6 A;  5G04 C;  3D9H A;  4YVQ C;  3P2B A;  4BT9 A;  4GML A;  4GZD A;  3MV3 B;  1K3Z D;  5AN8 A;  5BNW A;  2CHZ A;  3FUL A;  1H2U A;  2IJG X;  1HFA A;  3OAW A;  3TWV A;  3ABK E;  4U8V D;  4XZ4 A;  2GW1 A;  1MX2 A;  2IU1 A;  2LSV A;  3LVQ E;  3BUA A;  1P5Q A;  3TXM A;  5BUZ A;  1JCS A;  3TJP A;  3GYZ A;  1VDY A;  2WXG A;  3ZFW A;  2XEV A;  2X6H A;  2Y69 E;  2GRO B;  1TNU A;  5KJK A;  4HOR A;  2WXO A;  2X6F A;  4G24 A;  5CER B;  3W9F A;  3O4Z A;  3PEV B;  2EQX A;  1B89 A;  4WNE A;  4DPR A;  1KZP A;  2J49 A;  3D3M A;  3UPV A;  4RQI A;  1E7U A;  4AM9 A;  2ZGD A;  3SFZ A;  2A5E A;  3PE4 A;  3UX4 A;  4D10 C;  3AS5 A;  4G1T A;  3T8M A;  5BXO A;  2Y4U A;  5H7P A;  5LCW C;  4KZ0 A;  2P9U G;  3NOG D;  1OCC E;  3ZYL A;  3ONL A;  2FBN A;  3OXF A;  3CIA A;  2DZN A;  3CVX A;  4XX5 A;  4V3I A;  5AIJ A;  2AXZ A;  4A1G A;  3SO8 A;  1HS6 A;  4ZHB A;  2WXH A;  4C48 B;  3EJN A;  2NXP A;  3HG0 D;  4UWH A;  4APF A;  2VGE A;  2L9B A;  4HVB A;  3X2Q E;  4J8Y A;  4OAV B;  2LXM A;  2QYU A;  3FUH A;  5DIZ A;  1NZN A;  3FFL A;  3ZNG A;  3L54 A;  4KMO A;  4YDO A;  3EU5 A;  1UOH A;  2Q7F A;  3FTZ A;  3UIP C;  4GPK A;  1OXJ A;  3L13 A;  2LAI A;  3C5R A;  4HI9 A;  3ZYM A;  2OVF A;  1MX4 A;  4HRM B;  3B7T A;  3CVU A;  1IYG A;  3E37 A;  4O1P A;  5JJT A;  3DPD A;  1TEZ A;  2WXK A;  1N0R A;  4KVM A;  4JZY A;  3EIQ C;  3QOU A;  3MX3 A;  4DX7 D;  4N3B A;  3FHE A;  3Q7A A;  4GZC A;  1V54 E;  2Y3A A;  2KZT A;  3T8K A;  4GA1 A;  1O1R A;  2PM7 A;  2X6I A;  4AOF A;  3JQ0 A;  4PS7 A;  3AU5 A;  1UW4 B;  4DJA A;  3MJW A;  4I2Z A;  3AAA C;  1WG0 A;  2BED A;  3Q73 A;  1WY6 A;  2EIJ E;  4I1M A;  2ZIS A;  2FEZ A;  3U9W A;  1RZ4 A;  1LF8 A;  4LNU D;  1EDU A;  3MYV A;  3R9A B;  3CHR A;  4J0U A;  5EKQ D;  4DX5 D;  4TXR A;  3RO2 A;  4HOT A;  5D2M C;  2ETC A;  2WVI A;  4GZ3 A;  2V4L A;  2RD0 A;  2R17 C;  4NQ0 A;  4N2S A;  3ZIM A;  3PVL A;  4UUC A;  1OY3 D;  3D9J A;  1NA0 A;  4GA0 A;  5FT9 A;  3LPZ A;  3CHQ A;  3RO3 A;  1ELW A;  3HXE A;  4GTR A;  2NC9 A;  1LD8 A; 
#chains in the Genus database with same CATH homology
 3RRM B;  3G2V A;  4JHR A;  4CT4 A;  1HO8 A;  4EQF A;  3APD A;  4I17 A;  5JHA A;  5C2Y A;  1S0P A;  2I6H A;  4N3C A;  2XQ0 A;  2YHC A;  4B8C B;  3UMV A;  3ZHE B;  2VSN A;  1E8X A;  4F53 A;  2RG8 A;  4ILI A;  4JA7 A;  4H7X A;  4W9R A;  2WQH A;  1TJF A;  3CSF A;  2MOW A;  4J6I A;  3PZD A;  4CDR A;  1HE8 A;  1YA0 A;  3KEZ A;  2PQR A;  2FI7 A;  4K03 A;  1PC2 A;  3HVE A;  2WMO A;  3CHM A;  2CHX A;  4BFR A;  4AVX A;  3APC A;  2L0I A;  4I6J A;  2CFZ A;  1MQS A;  3L6A A;  4JEU A;  3RRN B;  1Z3Y A;  4GAA A;  4CRW A;  4BX9 A;  4FA6 A;  5LP0 A;  1INZ A;  4UWF A;  2XRZ A;  1Z6T A;  3KD7 A;  2WXP A;  3EHN A;  2E0I A;  2ZU6 B;  4FHJ A;  4UWL A;  2AXU A;  3LJ3 A;  2IF4 A;  2AW6 A;  3SNX A;  4G23 A;  3D9I A;  3S7J A;  1QQE A;  3ONK A;  3HIZ A;  5CMW A;  4ANV A;  4I43 A;  3R7Q A;  3IKO B;  3UT4 A;  2YQ8 A;  1Z3X A;  3RRU A;  3FEX A;  4CCA A;  4FAD A;  3ULQ A;  2V5F A;  3MZL B;  3ASF A;  3G2T A;  1UJK A;  1IYG A;  4BT8 A;  1FVF A;  4JHK A;  4DLQ A;  3R7R A;  3D9L A;  3TAX A;  2FUL A;  1ELK A;  2VSX E;  4O6F A;  4NUR A;  4TRQ A;  5HQ8 A;  1OWM A;  1KT0 A;  3PRZ A;  1UJJ A;  2X6J A;  2HYZ A;  3ML8 A;  4JPS A;  2BTD A;  1Y6I A;  4YVO A;  3CVP A;  4KBQ A;  3CVW A;  5FJY A;  5ANL A;  1N54 A;  3ZYK A;  3ASG A;  4JW1 A;  3Q15 A;  3FTW A;  3PE3 A;  4RG9 A;  3NZS A;  4LCT A;  5G55 A;  4ACL A;  3CEQ A;  2DBA A;  5LFA A;  3ZVV A;  3AU4 A;  4AV7 A;  3QC1 A;  4ME2 A;  4GMJ A;  4M3O A;  4Y6C A;  4MS6 A;  5EDS A;  1IQR A;  5C1D A;  2WXI A;  3FUF A;  3LKU A;  3ZHE A;  3I5P A;  3VLD A;  3TG4 A;  5BPP A;  3MEK A;  4KVO A;  5CHE E;  3ZW3 A;  4EZL A;  3PNL B;  4I9C A;  4PDX A;  5D0O D;  1DVP A;  4EPZ A;  1SQM A;  1JWF A;  3IV0 A;  3OXL A;  4PS3 A;  4IYP A;  3B7R L;  3U66 A;  2A4Z A;  3MA5 A;  4CEM A;  3URZ A;  3UQ3 A;  5T8I A;  3HHM A;  4BX8 A;  1H2T C;  4I6G A;  4EBA A;  3P1U A;  2A5U A;  5AJL A;  3B7U X;  3CVV A;  2BUG A;  3PRE A;  1H19 A;  5AEN A;  4TV3 A;  4F3V A;  4XKC A;  3APF A;  3U4T A;  1XNF A;  4EBA G;  2XRY A;  4G2V A;  1H0A A;  2J9Q A;  4J8E A;  3D9M A;  4HFG A;  3VLF A;  4DLO A;  1FVH A;  1HXI A;  3SI5 A;  2WXQ A;  4KYO B;  4Q96 A;  2JEK A;  2KC7 A;  3D9K A;  3FU6 A;  3JYS A;  4WWN A;  3AS8 A;  4G11 A;  2DIW A;  3RIB A;  4C9B B;  4G25 A;  2DCP A;  4B89 A;  4EEC A;  3FY4 A;  3RU0 A;  2LO6 A;  3FUN A;  4MLP A;  3BG0 B;  2I1J A;  4HOS A;  5E76 A;  3CLJ A;  4BWR A;  4EZJ A;  3LY7 A;  4XI0 A;  4ANW A;  2ION A;  2VTB A;  4MRU A;  5JJ7 A;  3QNK A;  5HI7 A;  3CHP A;  3CQC B;  3PS6 A;  2KCV A;  4APO A;  4ATG A;  3B7S A;  2L6J A;  2YNQ A;  3KAE A;  4L7T A;  2BF0 X;  1EPU A;  2KAT A;  2WXM A;  3L08 A;  5FQ4 A;  5G2N A;  3VTY A;  2XGO A;  4JEH A;  3I4G A;  1SZA A;  2E2E A;  4N39 A;  4WWP A;  5J90 A;  3EHM A;  3IHY A;  4C0M A;  5T4Y A;  3SD5 A;  2I2O A;  3QK0 A;  4YND A;  2Y4T A;  5EX0 A;  2YHE A;  2PQN A;  1KLX A;  3FH7 A;  1U3D A;  4GZ5 A;  3QWW A;  4RG6 A;  4UI9 K;  2UY1 B;  3CHS A;  5AJD A;  5LX8 A;  2JLB A;  5T3R A;  3RKV A;  1U3C A;  1H6K A;  2VGY A;  4IRU A;  4K0R A;  3CVY A;  3ZN3 A;  4ACK A;  3G2W A;  1Y8M A;  5FQ7 A;  3ASH A;  3FWV A;  3NZU A;  2NSZ A;  4J8S A;  3G2U A;  3S2A A;  4AEZ C;  4AIF A;  5J08 A;  3QKY A;  2WMN A;  2QFC A;  4CDM A;  2WPV A;  4FC8 A;  4L2L A;  2AWI A;  4EZK A;  5G04 C;  4YVQ C;  5KCM A;  3P2B A;  3CHO A;  2I1K A;  4BT9 A;  2KM4 A;  4GML A;  2WQ7 A;  2VQ2 A;  3FU5 A;  4GZD A;  3MV3 B;  2VTB B;  4JVS A;  3TG5 A;  5BNW A;  1EYH A;  4GCN A;  2CHZ A;  4E85 A;  3FUL A;  4GYY A;  5FZR A;  2OND A;  4J8D A;  4OVV A;  4HXI A;  1H2U A;  3PDN A;  2IOS A;  1HX8 A;  4UQY A;  5BT1 A;  5BV0 A;  3LCA A;  3U3W A;  2L0T B;  2IJG X;  1HFA A;  1HZ4 A;  3OAW A;  4GB9 A;  4Q94 A;  2C0L A;  4F1S A;  3SBT B;  4PH4 B;  3FDH A;  2IFU A;  4XZ4 A;  4FLH A;  2GW1 A;  4XI9 A;  4ABN A;  4BTB A;  3TGO A;  2IU1 A;  3GZ2 A;  3LEW A;  3Q49 B;  4DI4 A;  2LSV A;  3LVQ E;  4KXK B;  1P5Q A;  3CST A;  3TXM A;  5BUZ A;  4AJW A;  3LXU X;  3L16 A;  3TJP A;  3GYZ A;  1VDY A;  3E4B A;  4Y6W A;  3MGB A;  3D9O A;  2HM8 A;  2WXG A;  2GGF A;  5AYW D;  1OWO A;  1E7V A;  3KS2 A;  4QFV A;  4WWO A;  3ZFW A;  3PH0 C;  1HG2 A;  1JUQ A;  5E75 A;  2XEV A;  3CK7 A;  2X6H A;  3LS8 A;  3FUM A;  4WNF A;  1WM5 A;  3QDN A;  3LYA A;  1GW6 A;  4KZC A;  4U04 A;  3I4R B;  1HG5 A;  3FTX A;  5JHB A;  1NP7 A;  1UG3 A;  2J4B A;  3ESK A;  1SZ9 A;  4A55 A;  4RVB A;  2WXJ A;  5KJK A;  5FTP A;  4HOR A;  2WXO A;  2X6F A;  4G24 A;  4BY6 A;  3MKR A;  2LNI A;  2UWJ G;  3CKC A;  3O4Z A;  3CVN A;  2LSU A;  3FUJ A;  2EQX A;  1UN8 A;  3NQP A;  3PEV B;  4UQX A;  5FQ8 A;  1B89 A;  4WNE A;  3ZRH A;  4DPR A;  5A7D B;  1HU3 A;  2J49 A;  2XPI A;  3DBS A;  2VSO E;  4E6H A;  3D3M A;  5EX3 A;  3UPV A;  3SHF A;  2CG2 A;  4B0Z A;  1E7U A;  5G05 C;  4AM9 A;  4L1B A;  5A6C A;  4UWG A;  4CGV A;  2YIN A;  4JL0 A;  2VSY A;  3SGH A;  3SFZ A;  2J4D A;  3HVE B;  4FJY A;  2C0M A;  4PS8 A;  3PE4 A;  4UI9 J;  4XIF A;  5DBK A;  3PEU B;  5FQ6 A;  5BW8 C;  3UX4 A;  2XCC A;  3L17 A;  3MKQ B;  3ML9 A;  2WXR A;  3AS5 A;  3ENE A;  4H7Y A;  3QWV A;  4G1T A;  3CV0 A;  3S7D A;  4NAC A;  1H2V C;  3EIJ A;  4MKT A;  4WAF A;  5ENN A;  3T8M A;  2Y4U A;  3FTU A;  4GYW A;  5LCW C;  4KZ0 A;  2MHK A;  3FP3 A;  3N71 A;  3ZYL A;  4U0U A;  3ONL A;  2FBN A;  3O48 A;  3JUI A;  3OXF A;  4D10 C;  5M72 A;  3OTN A;  4XE0 A;  4N2Q A;  1L5J A;  2WM9 A;  2XGM A;  3CIA A;  4DI3 A;  4CGW A;  2CG3 A;  4BTA A;  4ANX A;  3T5X A;  3CVX A;  5ANR A;  3PUJ A;  3ZGQ A;  4U8H A;  4XX5 A;  1IHG A;  1HF8 A;  2IQC A;  2AVP A;  4V3I A;  3UUX A;  3VTX A;  5AIJ A;  3CVU A;  2AXZ A;  3FUI A;  4A1G A;  3T5V A;  1X5B A;  2C2L A;  1N52 A;  1HS6 A;  2WXF A;  1OWL A;  2WXH A;  4BSX A;  2VGX A;  3D9N A;  3IHV A;  4F7A A;  4FP7 A;  1OWP A;  3EJN A;  2NXP A;  2HO1 A;  3CVL A;  2GRM A;  4FJZ A;  5D0Q D;  4AY5 A;  1ELR A;  4HLE A;  2P58 C;  3ESL A;  3FTS A;  2V0P A;  1W3B A;  4UWH A;  3RJV A;  4APF A;  3BEE A;  5CCL A;  3FUK A;  3MKQ A;  2L9B A;  2PM6 A;  4HVB A;  3IEG A;  3FUH A;  5DIZ A;  1NZN A;  2KCL A;  3UT7 A;  5KJM A;  2IOL A;  4HOU A;  3FFL A;  4WNG A;  3I3N A;  5G04 J;  3LY9 A;  1TJC A;  3L54 A;  3NF1 A;  4GA2 A;  4L23 A;  4PUC A;  2CHW A;  4KMO A;  3FEY A;  5FWQ A;  4JA9 A;  2HR2 A;  3L22 A;  3PNT B;  2WXN A;  3LY8 A;  4LEU A;  3CK9 A;  2Q7F A;  2M63 A;  3FTZ A;  1HH8 A;  3CR3 A;  4GPK A;  4I1A A;  3L13 A;  4C0E A;  2LAI A;  1JWG A;  3ZEF A;  2X3M A;  4HOQ A;  3QJZ A;  4A3T A;  4AXH A;  4GZ6 A;  2WQ6 A;  4OVU A;  3ZPJ A;  1E96 B;  2OVF A;  3ZYM A;  1OWN A;  3SBS A;  4I9E A;  2R5S A;  2VGX B;  3B7T A;  3GW4 A;  1ZBP A;  4GCO A;  2FF4 A;  4FLB A;  5ARF A;  3DPD A;  3FU3 A;  2WXK A;  5LOZ A;  3ZYQ A;  5JJT A;  1TEZ A;  2WB2 A;  1E8Z A;  3UT8 A;  5CMY A;  4I1O B;  4I2W A;  4KVM A;  5JJ6 A;  4DK5 A;  4JZY A;  3EIQ C;  3QOU A;  3MX3 A;  3TXN A;  3BG1 B;  4RSY A;  4N3B A;  3FHE A;  4KT6 B;  1QZ2 A;  4CT0 A;  3FH8 A;  2J08 A;  3VLE A;  1E8Y A;  2VJ8 A;  4GZC A;  2I9C A;  2Y3A A;  2KZT A;  2J09 A;  3FH5 A;  3JQ1 A;  4GA1 A;  3ASD A;  4WND A;  2X6I A;  2LAH A;  2PM7 A;  4AOF A;  3JQ0 A;  4PS7 A;  4Q69 A;  2XPY A;  3TL5 A;  2PL2 A;  3AU5 A;  4L2Y A;  3CKB A;  1UW4 B;  4DJA A;  3MJW A;  4ILG A;  3RK6 A;  2OVB A;  1WAO 1;  5CCM A;  4I2Z A;  4JXT A;  4LER A;  1BPO A;  2XHE A;  4B94 A;  5A23 A;  4FUL A;  3HYM B;  4UQZ A;  3LDZ A;  3IBE A;  4XKB A;  2FO7 A;  1NA3 A;  1WY6 A;  4URK A;  2MRI A;  1FCH A;  3SF4 A;  4U07 A;  4I1M A;  4A3V A;  4TUU A;  3S7B A;  2AXV A;  2UY1 A;  3QAQ A;  4ANU A;  2FEZ A;  4U63 A;  3U9W A;  3B13 A;  1LF8 A;  3QAR A;  3QB2 A;  4ILH B;  3C98 A;  3S7F A;  4A1S A;  4IUL A;  4UI9 C;  1EDU A;  4N5C A;  2KZT B;  3CGH A;  3CQG B;  3GZS A;  2KCK A;  3MYV A;  5KJL A;  3R9A B;  3CHR A;  4UWK A;  3JCK C;  2OV8 A;  2XGS A;  4J0U A;  4CDN A;  2XCB A;  5EKQ D;  2V8S E;  3FTV A;  1DNP A;  4HS2 A;  4J8F A;  3MCX A;  2OOE A;  3RO2 A;  4IN3 B;  4G26 A;  3FTY A;  4U0Z A;  4HOT A;  3FUD A;  2X6K A;  1MHQ A;  4AP2 A;  1QNF A;  4N3A A;  5KJN A;  3CK8 A;  5G05 J;  2QY7 A;  1IQU A;  3K9I A;  3Q47 B;  2R59 A;  2WVI A;  4GZ3 A;  4JHJ A;  3SZ7 A;  1ZU2 A;  2V4L A;  3HDX A;  2WXL A;  2ILR A;  3G2S A;  4GYO A;  2RD0 A;  2R17 C;  4NQ0 A;  4NRH B;  1PY1 A;  4OYS A;  5LCW J;  2X38 A;  3ZXS A;  2J07 A;  3PUK A;  3AS4 A;  4N2S A;  3ZIM A;  4LUN U;  3PVL A;  4FHK A;  3U64 A;  3D9J A;  1NA0 A;  4GA0 A;  5FT9 A;  2PZI A;  3CVQ A;  1E90 A;  4I6E A;  3LPZ A;  3CHQ A;  3Q5M A;  3RO3 A;  5FZQ A;  1ELW A;  1PAQ A;  4P29 A;  3GZ1 A;  4WUY A;  2GRL A;  1EF1 C;  4AY6 A;  5BV1 A;  4R7L A;  2VYI A;  5FZS A;  3Q4A B;  3FUE A;  3WXX A;  3MV2 B;  4U0S A;  3EDT B;  3D9P A;  4JC8 A;  1UN9 A;  2XPZ A;  3LVR E;  1E8W A;  1JPL A;  3QWP A;  2NC9 A;  1XGW A;  3OXG A;  4GU5 A;  4LRZ A;  1A17 A;  1OUV A;  2CFU A;  5ARG A;  4FU3 A;  3FU0 A;  4B8A A;  1KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...