3LPZA

Crystal structure of c. therm. get4
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
321
structure length
314
Chain Sequence
NKIERIIARLQRRIAEGQPEEQYEAAQETRLVAARYSKQGNWAAAVDILASVSQTLLRSGQGGSGGDLAVLLVDTFRQAGQRVDGASRGKLLGCLRLFQPGEPVRKRFVKEMIDWSKKFGDYPAGDPELHHVVGTLYVEEGEFEAAEKHLVLGTKESPEVLARMEYEWYKQDESHTAPLYCARAVLPYLLVANVRAANTAYRIFTSALVEDNKGLTVQNIGSAELRIFPSLPLLNFISMLLLSVQKGSPDLFRQLKSKYEANLNELNGIWDTALELIAEMYFGIQRPRQSNPLLDMMGSLFGGGGAALRRIDTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Get4 (YOR164C homolog)
publication title The structure of Get4 reveals an alpha-solenoid fold adapted for multiple interactions in tail-anchored protein biogenesis.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Protein transport
total genus 117
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lpzA01
4N3CA 4GYYA 3WXXA 2V5FA 2L6JA 2C0MA 3ZHEA 3ASFA 2QFCA 4AM9A 4RG9A 5FJYA 5FZSA 2HYZA 1Y8MA 2UWJG 4N3BA 4WNGA 3LYAA 5AYWD 4UQYA 2OOEA 1E96B 2LSVA 5FT9A 3KAEA 4HOQA 5CCMA 4G26A 3RO2A 3LKUA 5CCLA 5G05J 4GZ5A 4N3AA 2LNIA 5A7DB 2I6HA 3ESKA 4JHRA 5KJKA 2XGOA 3QWWA 4G24A 4GCOA 3GW4A 2P58C 4G1TA 5BNWA 2FO7A 2KCVA 2VGYA 5BT1A 5DIZA 1QZ2A 4H7YA 4ME2A 2AVPA 5G05C 5C1DA 3SF4A 3OXGA 2C0LA 3QOUA 4N5CA 5DBKA 2MHKA 4CGVA 3Q49B 5D0QD 4UI9J 3URZA 4W9RA 5ARFA 2KCKA 4YVOA 4GCNA 1NA0A 1TJCA 3ZGQA 4U0ZA 1HZ4A 4BT8A 1NZNA 5A6CA 3ASDA 4AIFA 1KT0A 3CVLA 4WNDA 5G04J 3UPVA 3N71A 4UI9C 3ZHEB 4XI9A 4HOTA 2YHCA 3LCAA 4KXKB 3GYZA 3QWVA 5EKQD 2LSUA 3U3WA 4U0SA 4F3VA 5LCWJ 4I17A 4LEUA 2VQ2A 2XEVA 4CGWA 4BTBA 2VGXA 3PE3A 5G04C 3ULQA 2XGSA 4U0UA 3AS5A 3CV0A 3Q15A 4IN3B 5EX3A 4Y6WA 3IEGA 4G2VA 5LCWC 5D0OD 3SZ7A 4XI0A 2KC7A 3FP3A 3VTXA 4G25A 4XIFA 3CVPA 3S7FA 4GYWA 1IHGA 3U4TA 3CKBA 4A1SA 2KATA 3K9IA 5KJNA 3AS8A 3S7BA 2PQNA 3HYMB 4JL0A 3CVNA 4I9EA 3TGOA 3Q4AB 4N2SA 2IF4A 3UUXA 4UQZA 4HORA 2FBNA 3TG4A 2E2EA 2Q7FA 3MKRA 3MEKA 4U07A 1ZBPA 4EQFA 5HI7A 2KCLA 5HQ8A 1QQEA 3ZFWA 2Y4UA 2PL2A 3OXFA 4J8DA 2R5SA 4I1AA 3MV2B 4J8EA 3ZN3A 3CK8A 4KBQA 3E4BA 4U04A 5CHEE 3CK7A 1ELWA 2FF4A 3PE4A 5FTPA 4AY5A 1A17A 3BEEA 3CKCA 3QDNA 4YNDA 2HR2A 2DBAA 2VGXB 3OXLA 3Q47B 4WUYA 4BT9A 1W3BA 3ASGA 3AS4A 3S7JA 1IYGA 4CDRA 5KJLA 4GPKA 2PZIA 5JJTA 2IFUA 3FWVA 4I2WA 2UY1A 3KD7A 4B94A 3LY7A 2WPVA 3RU0A 3ASHA 3MV3B 3EDTB 3Q5MA 1OUVA 1KLXA 3GZ2A 3CK9A 4GZ6A 2VSYA 2J9QA 5BW8C 3VTYA 2Y4TA 4BTAA 3QKYA 3QWPA 5JJ7A 4WNEA 5EX0A 3TAXA 3ZPJA 3KS2A 3RKVA 3LY8A 4JA7A 2XCCA 1PC2A 4APOA 4J8FA 4G23A 1KT1A 4KYOB 4GA1A 2HO1A 2GW1A 3UQ3A 5FZQA 4ABNA 3FFLA 2C2LA 5KJMA 2FEZA 4GYOA 3S7DA 5M72A 4GA0A 2JLBA 3MA5A 1YA0A 3R9AB 1FCHA 1HXIA 1HH8A 1XNFA 5ARGA 4Y6CA 4HOUA 4N2QA 3LY9A 3CVQA 3GZ1A 4O6FA 1WAO1 3RIBA 4NRHB 1B89A 4NQ0A 4I9CA 2PQRA 1ELRA 2NC9A 2YQ8A 4GZ3A 2XPIA 4BWRA 4YVQC 1NA3A 4H7XA 3LPZA 2XCBA 4RG6A 5FZRA 4WNFA 2VYIA 2WQHA 4AY6A 2VSNA 2UY1B 4J0UA 3RJVA 4UI9K 5JJ6A 3CEQA 1WM5A 3O48A 1ZU2A 4I2ZA 3NF1A 2BUGA 4GA2A 4JA9A 3PDNA 2FI7A 2XGMA 4UQXA 3TG5A 1P5QA 3JYSA 4N39A 2ONDA 3RO3A 4HOSA
chains in the Genus database with same CATH superfamily
2L6JA 3DRAA 4JXTA 4CRWA 3L6AA 3ZHEA 2Y69E 1TN6A 3PZDA 1OCZE 2QFCA 1OWPA 3Q9NC 2RKKA 2J4BA 2HYZA 2P2CP 4WNGA 3GZSA 4GTPA 3D9KA 2CG3A 3D9NA 1S0PA 4CDMA 3DPYA 3CHQA 5FQ7A 2X6KA 4HOQA 4AV7A 3RO2A 2LXLA 1MX4A 5CCLA 5G05J 4ATZD 3UKRG 2A5EA 3AG4E 1NL4A 5BUZA 3EHNA 1O5MA 3QWWA 4G24A 4CT0A 4XKCA 3DWLG 4GAAA 1BI7B 3KEAA 3IHYA 5BNWA 1IQRA 4D10C 1IXVA 2F37A 5BT1A 2J07A 1QZ2A 1AWCB 1TN8A 4AEZC 4DX7D 3SF4A 3OXGA 4UUCA 1AP7A 2WQ7A 1BPOA 5BV0A 2MHKA 4KMOA 3URZA 4W9RA 2OEVA 3P1UA 3KEZA 1XGWA 3ISMC 2RFMA 1YCSB 4EBAA 1HZ4A 4BT8A 1NZNA 4N5QA 1V55E 3LDZA 5A6CA 2QZAA 1KZOA 2YHEA 4XEIG 4YDEA 1H19A 4HBDA 1IKND 2LO6A 5G04J 4FU3A 3UPVA 3N71A 1LF8A 3IKOB 3HXCA 1N0RA 4XI9A 1HG2A 3JQ0A 1HF8A 5CBNA 3CHOA 4CT4A 1YMPA 3E32A 4U0SA 4I17A 4L7TA 5KNGA 1UG3A 1K1BA 3FUEA 5E76A 1E7VA 3U66A 1Z5SC 2MYOA 4DK5A 3PE3A 3TWRA 3ZXPA 5T3RA 3FEXA 1EYHA 5CMYA 4AVXA 3AS5A 3TXMA 2P9UG 2VTBB 3SNXA 4C9BB 4Q96A 4Y6WA 5A23A 3AAAC 3CHPA 3ULYA 4BESA 4G25A 2CHXA 2OEWA 3TXNA 2A5UA 1K1AA 2KATA 3D3MA 1H2VC 2X6HA 3L13A 3TWSA 5ENSD 3TGOA 4N2SA 2F0YA 4L9PA 1TJFA 4FA6A 3TWWA 4BSXA 3AU5A 1Z3XA 2FBNA 4BETA 1WY6A 3D9HA 1TNZA 3B7UX 3OAWA 3SFYA 4G8LA 3FUDA 4EQFA 3B7TA 3PS6A 1YYHA 1QQEA 3ZFWA 1IQUA 2EIKE 2OCCE 4GZDA 3ML8A 4FHKA 1OWOA 3ZN3A 3C72A 3CR3A 5JHAA 2RFAA 3E4BA 3LVQE 4RLYA 4O1OA 2JEKA 2IO3C 4GTMA 3PE4A 1TNYA 1A17A 3MJWA 4YNDA 4I43A 5FQ6A 3PRZA 4FADA 4WUYA 4BT9A 1MX2A 1W3BA 3UIPC 2P9LG 4HRLA 3S7JA 1K3ZD 1TYQG 1FVHA 3UKUG 3NZUA 3JCKC 3ENEA 5E75A 3ASHA 3UT7A 3PZ1A 3QK0A 3ML9A 4XX5A 3Q79A 1TNBA 4JPSA 4DX5D 3WG7E 2WXFA 3V2XA 4TV3A 3PZ2A 2DCPA 3VTYA 2XRZA 1BLXB 4WNEA 5EX0A 3TAXA 3EIJA 4PDXA 5BPPA 1N95A 3FHEA 3PEUB 3E30A 4U95D 3IBEA 1PC2A 3ONLA 4Z68A 4KYOB 3T5XA 2IEJA 4WWNA 3MX3A 1SA5A 3PUKA 1TN7A 1UN9A 5FZQA 3FFLA 3FH8A 4C48B 3QC1A 4EBAG 4A1GA 4LRZA 1MJ0A 3W9FA 4ILIA 3CHRA 4HFGA 3Q78A 5LP0A 2R02A 3KSLA 1E8WA 4GB9A 2MRIA 3DSSA 2YNQA 4KZCA 4WWPA 4TRQA 4L1BA 3CVQA 4RQIA 3GZ1A 4O6FA 3ZNGA 3RIBA 4NRHB 4I6JA 2WXRA 2NC9A 3BU8A 2WQ6A 2XPIA 4YVQC 4JC8A 1H6KA 3C3RA 5JHBA 1SZAA 4DPRA 4BERA 5FZRA 4WNFA 3D9JA 4PH4B 2UY1B 4J0UA 2P9KG 5JJ6A 2R05A 3CEQA 3DBSA 2BF0X 4I2ZA 1PY1A 5EN5D 2BUGA 4GA2A 2FI7A 5KCMA 3TWXA 5B1BE 2NSZA 2XGMA 3JYSA 1JWGA 4HLLA 3B7RL 2BKKB 3RO3A 4ANUA 4BY6A 4ZHBA 3WXXA 4FC8A 3ZKJA 4GMRA 4ANXA 2ETCA 3ASFA 3QARA 3NZSA 5AJLA 5FJYA 3U64A 4X8QA 1VDYA 2UWJG 2IOSA 3UTMA 3LYAA 2LSVA 2IJGX 4B89A 4BEPA 3RSEG 2WXGA 3SY2A 3ZXSA 2I1KA 4JHJA 5CCMA 4G26A 3L9TA 3I3NA 2XZDG 1V54E 1O1RA 4LG6A 4GZ5A 5A7DB 3ESKA 3G2TA 4JHRA 5KJKA 3GW4A 5HRYA 1UJKA 2FO7A 3HG0D 5DIZA 1D9SA 4QFVA 1S70B 4H7YA 4FLHA 4ME2A 2AVPA 1H2UA 2WVIA 5G05C 5KWDA 2C0LA 3FEYA 3QOUA 4GTQA 4N5CA 3I4GA 4UI9J 5LX8A 2BTDA 2XRYA 2DZOA 4RVBA 4GCNA 3P2BA 3EHQA 3PZ4A 4BSZB 3ZGQA 4A3VA 1OWNA 1G3NB 1MQSA 2XQ0A 3ASDA 4AIFA 1ZB1A 2J8SD 3DSUA 4KT6B 3EIQC 2R17C 3ZHEB 3Q73A 4DUIA 2YHCA 5FIOA 4KXKB 5AN8A 3QWVA 1EF1C 4FJZA 3U3WA 5LCWJ 2GGFA 2X6FA 2WXQA 2KZTA 4CGWA 4BTBA 5G04C 4U0UA 3FU5A 4I6EA 1X5BA 3F6QA 3Q15A 5EX3A 5HS0A 3FTZA 5FINA 3RAUA 2GRQB 2GRPB 1GW6A 5ITZF 2FULA 3SZ7A 3T9KA 2L6BA 4B8AA 1QNFA 3EUVA 4M3OA 4Q69A 4V3IA 5AIJA 2H6IA 5EILA 3CVUA 1WG0A 3K9IA 4JW1A 3ZRHA 3HIZA 5KJNA 3HYMB 3G2WA 3HVEB 3DPDA 1O1SA 4HORA 3UM3A 2EIME 3PNTB 3SI5A 1MHQA 2DZNA 3VLFA 3E37A 3MCXA 2R2LA 1SA4A 3DEOA 5HQ8A 1DCQA 4HS2A 2PM7A 2R5SA 5CEAA 3MV2B 3CK8A 3UXGA 4KBQA 3LJNA 1N0QA 2L9BA 5CHEE 5G55A 1ELWA 3FTSA 4C0EA 4AY5A 3T5VA 3QDNA 4YDOA 4EZLA 1LD7A 2L0TB 4K5BA 1BI8B 3FY4A 4ILGA 2DBAA 4AJWA 3E34A 3TWUA 3OTNA 2E0IA 2IONA 4MS6A 3LXUX 2PZIA 4J8SA 2IFUA 2CG2A 3L16A 2XHEA 3KD7A 4B94A 2V4HC 1MYOA 2AW6A 3RU0A 5KNHD 4U8YD 1E90A 3PVLA 3EDTB 1HG5A 3Q5MA 1KLXA 5FWQA 3HXEA 4A3TA 5AAOA 5BW8C 2Y4TA 2I2OA 3QKYA 2B0OE 5ENOD 4O60A 4HB5A 1U3CA 3D9IA 4LNBA 3VLEA 4E85A 2V8SE 4APOA 2R59A 2F8YA 1KT1A 5AENA 2AJAA 2HO1A 3TWVA 3BQOA 4TXPA 4AXHA 3SBSA 4A55A 4MBGA 2AXZA 4JD2G 2C2LA 5J90A 4G11A 2ZXWE 3ASNE 1H6OA 2ZU6B 5B1AE 3MA5A 2ETBA 2H6GA 4HI9A 1FCHA 4NIKA 5FQ4A 3SD5A 1HH8A 4DI4A 1DVPA 1N52A 3R9MA 2L0IA 2VJ8A 1H6PA 1EPUA 4HOUA 5D66A 3LVRE 2WMNA 1B89A 4NQ0A 1OT8A 4GZ3A 2YQ8A 4KVOA 3FH5A 1NA3A 3IXEA 2XCBA 3J5QB 3U9WA 3DSWA 2VYIA 2WQHA 3ZVVA 4AY6A 1TR4A 3CLJA 3QJZA 3FTYA 3UM2A 2RG8A 2WM9A 4CEMA 1WM5A 1QBQA 4KVMA 3PDNA 3UX4A 2XEEA 3ULEG 4EZJA 4CDNA 4GMJA 3NBNB 3RK6A 4N39A 4MRUA 2ONDA 2AXUA 3IV0A 1E8XA 4GYYA 2V5FA 2XEHA 4AM9A 4RG9A 2V0PA 1HO8A 5FZSA 4N3BA 5AYWD 2CFZA 4UQYA 3UT4A 1E96B 3L82A 5FT9A 2FO1E 5EIDA 4AP2A 4YDYA 2F8XK 3HXFA 1NP7A 3LKUA 4J7WA 2LNIA 3PUJA 4URKA 4RSYA 1HS6A 4M7CA 4GCOA 3HRAA 3FU0A 2P58C 3R7RA 3ASOE 4I1MA 2KCVA 4U96D 3ONKA 3CQCB 4PS8A 1JCRA 2OVBA 3IHVA 2XPZA 5C1DA 3FTVA 5DBKA 2R03A 4CGVA 5D0QD 3CHMA 2KM4A 5ARFA 2KCKA 4YVOA 3C98A 4OYSA 1N4PA 1U2VG 1N4RA 1NA0A 5J08A 4U0ZA 3C5RA 3EU9A 5JA4D 5AARA 2Y0BG 3G2VA 4A63B 2DWZA 4PS3A 3CVLA 4WNDA 1S64A 2QYUA 4UI9C 3ZYMA 2IY0C 1TEZA 4JHKA 1INZA 4BX9A 3UIOC 3LCAA 4GTTA 3DSTA 4OAVB 5G2NA 4NACA 1OCOE 1SW6A 4OVVA 5EKQD 4F7AA 4ATGA 4F3VA 2VQ2A 4DX2A 5ENTD 2VGXA 3FU3A 2XPYA 2XGSA 1EDUA 3B95A 3MKQA 3CV0A 4IN3B 4BX8A 1UOHA 2H6HA 2ZISA 2EINE 1N54A 4G2VA 1FPPA 5LCWC 5D0OD 2KC7A 4FHJA 4CYMD 1FVFA 3VTXA 5BV1A 4XIFA 2VSXE 1UW4B 2DVWA 3CVPA 3J5PA 2IU1A 3SFZA 3S7FA 4GYWA 5H7PA 2IQCA 1N94A 4JB8P 4UWLA 4A1SA 5ANRA 1JCSA 3NAWA 3BG1B 2NYJA 1FT1A 4JL0A 4I9EA 1DNPA 3UUXA 5IY5E 3PNLB 2OVFA 4GZCA 4UWGA 3JXJA 2KBXA 4O1PA 1SVXA 3TG4A 3V79K 3CGHA 1LTXA 2E2EA 2Q7FA 3MKRA 2IOLA 4E6HA 4EECA 3MEKA 1D8EA 3EHMA 3Q75A 5CRUA 5HI7A 3MYVA 2KCLA 2PNNA 2QC9A 3FDHA 3JXIA 3UM0A 3OXFA 2LUHA 2XS1A 4J8DA 3R7QA 4LSZE 1N9AA 3VLDA 5KBAA 3SO8A 4J8EA 1E7UA 4ZFHA 4U04A 5AQ9A 4DLQA 5CEDB 3CKCA 2J09A 2GRMA 2VGEA 3CHSA 3S2AA 3ZEFA 2HR2A 2KZTB 1K8KG 2B6CA 3FUKA 3LJ3A 4U63A 5CERB 4JZYA 3ASGA 3ESLA 3SFXA 3FULA 3C3QA 2LAHA 4K5AB 1IYGA 4CDRA 4GPKA 3DEPA 1H2TC 3C3OA 5JJTA 4KZ0A 4C0MA 3X2QE 2M63A 3LY7A 5JMND 4FJYA 3MV3B 3QB2A 3PZ3A 1OUVA 2I9CA 4R7LA 3T8KA 3UM1A 4GPMA 5CMWA 3TWQA 3FU6A 3ZPJA 3KS2A 1QYMA 3RKVA 4JA7A 2WXJA 2XCCA 4J8FA 4G23A 2WMOA 1HU3A 2WXHA 4GTRA 4GA1A 3D9OA 4TUUA 3UMVA 5KJMA 4F6RD 3FH7A 2YINA 5ANLA 4L2LA 2FEZA 3MZLB 4GYOA 4CZ2D 5ENNA 4B8CB 5M72A 2ZIRA 2JLBA 4GA0A 5D2MC 1YA0A 1LD8A 2CFUA 2X6IA 1XNFA 3JUIA 5ARGA 1KPSB 3V30A 2J08A 2XZTG 1SZ9A 3HVEA 4HLEA 1WAO1 2WXPA 1RW2A 2PQRA 1OCCE 4BWRA 5FQ8A 3I5PA 5EYPF 1OCRE 3B13A 4LNUD 2PM6A 3FTXA 5T8IA 1L5JA 2GRNB 3LPZA 3ZYQA 5EIBE 3E33A 5AQBA 2VSNA 2X38A 3LEWA 2HM8A 3QAQA 2DIWA 5ENRD 4UI9K 4K03A 3BUAA 4G8KA 5CRVA 1PAQA 3O48A 1Z3YA 1Y6IA 4HQDA 3NF1A 4JA9A 3EHRA 4DI3A 2CHWA 3APCA 4UQXA 3TG5A 1X81A 1DC2A 1P5QA 1DCEA 4FLBA 2XS8A 4N3CA 3ZU7B 2C0MA 2RD0A 2A4ZA 2WB2A 5ENQD 1N4SA 3ZIMA 3CVWA 1OXJA 5EDSA 4FULA 4F1SA 1Y8MA 3CVVA 4MKTA 2ETAA 1HX8A 2OOEA 3FUFA 4B0ZA 3CSFA 4WWOA 3KAEA 5AQ7A 5BXUA 3RRMB 3EU5A 3PREA 2J4DA 1JUQA 4PS7A 2QY7A 2GRLA 3UINC 4N3AA 3ZYKA 2I6HA 2VTBA 2XGOA 3DXMG 4Q94A 4U8HA 3NQPA 4DRXE 3HXBA 5T4YA 4G1TA 2VSOE 2VGYA 3FUHA 4IULA 4L23A 3CVYA 4HRMB 1MZCA 4GTOA 3SBTB 4FP7A 4ILHB 3Q49B 3TWTA 1N4QA 2LAIA 3B7SA 4WAFA 3HHMA 1U3DA 3D9PA 3AJIA 1S63A 3G2SA 3NOGD 2WXNA 3FTWA 4J6IA 5LOZA 4HI8A 1TJCA 1HE8A 1NFIE 3G2UA 3CSTA 4K0RA 1NI1A 3PEVB 1KT0A 1OY3D 3B7BA 4IRUA 3UT8A 3CVXA 4HOTA 5EYLA 1O1TA 3GYZA 3KSQA 4AOFA 2Y3AA 4CCAA 3NB2A 2LSUA 3O4ZA 5HKPA 1KZPA 4LERA 3I4RB 3CIAA 4LEUA 1E8ZA 2XEVA 1ELKA 4LCTA 4I6GA 2AXVA 3Q7FA 1JCQA 3ULQA 1N11A 1SQMA 1JWFA 2OV8A 4HRNA 4U8VD 1H0AA 4ANVA 2BEDA 2ILRA 3TJPA 2X6JA 1WDYA 4OAUC 4GTSA 3IEGA 1RZ4A 3FUJA 4DLOA 3FUIA 4UWHA 4XI0A 4XE0A 3FP3A 4XKBA 3ZYLA 2P9SG 2DYSE 1IHGA 4GU5A 3U4TA 5CBOA 3CKBA 4XZ4A 2I1JA 4DJAA 3D9LA 3AS8A 3UI2A 4LNGA 3S7BA 2PQNA 1IHBA 3CVNA 1A5EA 3Q4AB 4OVUA 5B3SE 2IF4A 4UQZA 3FUNA 4APFA 4UWKA 4TXQA 4U07A 2MOWA 1ZBPA 3QNKA 4TXRA 3L22A 4TUMA 1FT2A 3Q7AA 2Y4UA 3D9MA 2PL2A 3JUEA 2HE0A 4I1OB 3TL5A 2DYRE 4I1AA 5C2YA 2KXPC 2ZGGA 1TNUA 5CECB 3W9GA 4QQIA 2XENA 2X3MA 4DX1A 1OWLA 4PUCA 4DX6D 1BU9A 2WXLA 5BXOA 2V5QC 3CK7A 2FF4A 3APDA 5FTPA 4ANWA 3BEEA 5AQAA 4YDWA 4F1PA 1UN8A 2NXPA 2VGXB 3AG3E 3OXLA 4GMLA 3Q47B 2Y1LE 4HXIA 3HDXA 2H6FA 3MKQB 4L2YA 3AS4A 3SGHA 3L17A 4GTVA 5KJLA 1MX6A 2ZGDA 1D8DA 4LUNU 3FWVA 4I2WA 2UY1A 2WPVA 1UJJA 3AG2E 3LS8A 2EIJE 2QYJA 3FUMA 2V4LA 3FTUA 3ABKE 3CQGB 3CK9A 3GZ2A 3SHFA 4GZ6A 3Q9UC 2VSYA 3V2OA 1JPLA 4NURA 2EQXA 3APFA 2J9QA 4U7EB 4BTAA 4K5CA 3QWPA 3RRNB 5JJ7A 3T8MA 1TNOA 3LY8A 2J49A 4JVSA 4ACLA 4HVBA 1Z6TA 2LXMA 3PH0C 2AWIA 2P9PG 4MLPA 2EILE 2GW1A 1OWMA 3UQ3A 1HFAA 1E8YA 3SQVA 4ABNA 2GRRB 2P9IG 3S7DA 1BD8A 3R9AB 3L54A 2JABA 4J8YA 4P29A 3RRUA 1HXIA 3L08A 2WXIA 4Y6CA 4JEHA 5ENPD 4N2QA 3DXKG 3LY9A 4EPZA 3EJNA 2WXMA 3HXDA 5LFAA 2WXOA 3BG0B 3AG1E 4I9CA 2P9NG 1ELRA 4B93B 4H7XA 4UWFA 4RG6A 4HNAD 4JEUA 2CHZA 3ZUVB 4EZKA 3RJVA 2IO2C 3MGBA 4EHMA 4BFRA 2BKGA 3NOCD 2WXKA 1ZU2A 3ABLE 3ZW3A 3V31A 4IYPA 2GROB 3DSXA 1Q2ZA 3JQ1A 3ABME 4ACKA 3AU4A 3DSVA 5AJDA 4F53A 4HOSA
chains in the Genus database with same CATH topology
1E8XA 4N3CA 4GYYA 3WXXA 2V5FA 2L6JA 4JXTA 4FC8A 2C0MA 3L6AA 4CRWA 3ZHEA 2RD0A 2A4ZA 3PZDA 4ANXA 3ASFA 3QARA 2QFCA 2WB2A 4AM9A 4RG9A 3ZIMA 3NZSA 3CVWA 1OWPA 5AJLA 5FJYA 3U64A 5EDSA 4FULA 4F1SA 2J4BA 1HO8A 2V0PA 5FZSA 1VDYA 2HYZA 1Y8MA 2UWJG 3CVVA 2IOSA 4MKTA 3GZSA 3LYAA 4N3BA 4WNGA 5AYWD 2CFZA 3D9KA 1HX8A 4UQYA 2OOEA 3FUFA 3UT4A 1E96B 2CG3A 2LSVA 1S0PA 2IJGX 3D9NA 3CSFA 4B0ZA 4B89A 4CDMA 5FT9A 4WWOA 3KAEA 2WXGA 4AP2A 3CHQA 5FQ7A 2X6KA 4HOQA 3RRMB 3ZXSA 2I1KA 4JHJA 5CCMA 3PREA 4G26A 2J4DA 1NP7A 3I3NA 4AV7A 1JUQA 4PS7A 3RO2A 3LKUA 2QY7A 5CCLA 2GRLA 5G05J 4GZ5A 4N3AA 2LNIA 5A7DB 3ZYKA 3PUJA 2I6HA 5BUZA 4URKA 4RSYA 2VTBA 3ESKA 3G2TA 3EHNA 1HS6A 4JHRA 5KJKA 2XGOA 3QWWA 4G24A 4CT0A 4GCOA 4Q94A 3GW4A 4U8HA 3FU0A 2P58C 4XKCA 3NQPA 4GAAA 3R7RA 3IHYA 5T4YA 4I1MA 1UJKA 4G1TA 5BNWA 2VSOE 2FO7A 1IQRA 2KCVA 4D10C 2VGYA 5BT1A 3FUHA 3ONKA 4IULA 5DIZA 2J07A 3CQCB 4L23A 1QZ2A 4PS8A 4QFVA 3CVYA 4H7YA 2OVBA 4FLHA 4AEZC 4ME2A 2AVPA 3IHVA 1H2UA 2WVIA 2XPZA 5G05C 4FP7A 3SBTB 3SF4A 5C1DA 3OXGA 2C0LA 3FEYA 3QOUA 4N5CA 3FTVA 4ILHB 2WQ7A 1BPOA 5BV0A 5DBKA 3I4GA 2MHKA 4CGVA 3Q49B 5D0QD 3CHMA 4KMOA 4UI9J 3URZA 5LX8A 2KM4A 2LAIA 3B7SA 3P1UA 3KEZA 2BTDA 4W9RA 5ARFA 2KCKA 4WAFA 3HHMA 1U3DA 3D9PA 2XRYA 4RVBA 3G2SA 4YVOA 3C98A 2WXNA 4GCNA 3FTWA 4OYSA 1XGWA 3P2BA 4EBAA 4J6IA 5LOZA 1NA0A 1TJCA 3ZGQA 1HE8A 4U0ZA 5J08A 1HZ4A 4A3VA 4BT8A 1NZNA 1OWNA 3G2UA 3CSTA 3LDZA 4K0RA 5A6CA 3PEVB 3G2VA 1MQSA 2XQ0A 3ASDA 4AIFA 2YHEA 1H19A 1KT0A 4PS3A 3CVLA 2LO6A 4WNDA 5G04J 4FU3A 4KT6B 3UPVA 3EIQC 3N71A 4IRUA 4UI9C 1LF8A 3IKOB 2R17C 3ZYMA 3UT8A 1TEZA 4JHKA 3CVXA 1INZA 3ZHEB 4XI9A 4HOTA 4BX9A 2YHCA 1HG2A 3JQ0A 3LCAA 1HF8A 4KXKB 3GYZA 3CHOA 4CT4A 5G2NA 3QWVA 4AOFA 2Y3AA 4NACA 1EF1C 4FJZA 4CCAA 4OVVA 5EKQD 4F7AA 2LSUA 3O4ZA 3U3WA 4ATGA 4U0SA 4F3VA 5LCWJ 4I17A 4LERA 4L7TA 2GGFA 3I4RB 3CIAA 4LEUA 2VQ2A 1E8ZA 1UG3A 2XEVA 1ELKA 3FUEA 5E76A 1E7VA 3U66A 2X6FA 2WXQA 4LCTA 2KZTA 4I6GA 4BTBA 4DK5A 4CGWA 2AXVA 2VGXA 3PE3A 3FU3A 5G04C 2XPYA 3ULQA 2XGSA 1EDUA 1SQMA 1JWFA 3FEXA 1EYHA 2OV8A 5T3RA 4U0UA 3FU5A 1H0AA 1X5BA 3MKQA 4I6EA 5CMYA 4AVXA 3AS5A 4ANVA 3CV0A 3Q15A 3TXMA 2ILRA 3TJPA 2X6JA 4IN3B 4BX8A 5EX3A 3FTZA 2VTBB 3SNXA 4C9BB 4Q96A 4Y6WA 3IEGA 5A23A 1N54A 1GW6A 3FUJA 4DLOA 4G2VA 3FUIA 2FULA 5LCWC 5D0OD 4UWHA 3SZ7A 4XI0A 2KC7A 3CHPA 4FHJA 4XE0A 4B8AA 3FP3A 1QNFA 1FVFA 3VTXA 5BV1A 4M3OA 4G25A 4XKBA 4XIFA 2VSXE 3ZYLA 1UW4B 3CVPA 2CHXA 2IU1A 3SFZA 4Q69A 3S7FA 4V3IA 4GYWA 1IHGA 4GU5A 3U4TA 5AIJA 2IQCA 3TXNA 2A5UA 3CVUA 3CKBA 4UWLA 2KATA 2I1JA 3D3MA 3K9IA 4XZ4A 4A1SA 1H2VC 4JW1A 5ANRA 3ZRHA 4DJAA 2X6HA 3L13A 3BG1B 3D9LA 3HIZA 5KJNA 3AS8A 3S7BA 2PQNA 3HYMB 4JL0A 3CVNA 3G2WA 3HVEB 4I9EA 3TGOA 3Q4AB 4OVUA 1DNPA 4N2SA 2IF4A 3UUXA 4FA6A 1TJFA 3PNLB 4UQZA 3DPDA 2OVFA 4BSXA 3FUNA 3AU5A 1Z3XA 4GZCA 4HORA 4UWGA 2FBNA 4APFA 4UWKA 3TG4A 3CGHA 1WY6A 2E2EA 3PNTB 2Q7FA 3MKRA 2IOLA 4E6HA 3B7UX 3OAWA 3SI5A 4EECA 3MEKA 4U07A 2MOWA 3FUDA 1ZBPA 3EHMA 3QNKA 4EQFA 1MHQA 3B7TA 3PS6A 3VLFA 3MCXA 3L22A 5HI7A 3MYVA 2KCLA 5HQ8A 1QQEA 3FDHA 3ZFWA 1IQUA 2Y4UA 3D9MA 2PL2A 4HS2A 3OXFA 4J8DA 2PM7A 4GZDA 3R7QA 2R5SA 3ML8A 4I1OB 3VLDA 3TL5A 4FHKA 4I1AA 1OWOA 3MV2B 4J8EA 3ZN3A 5C2YA 3CR3A 3CK8A 1E7UA 5JHAA 4KBQA 3E4BA 3LVQE 2X3MA 4U04A 2L9BA 2JEKA 1OWLA 4PUCA 2WXLA 5CHEE 5G55A 3CK7A 1ELWA 2FF4A 3APDA 3PE4A 4DLQA 3FTSA 4C0EA 5FTPA 4ANWA 4AY5A 1A17A 3BEEA 3CKCA 3T5VA 3QDNA 2J09A 2GRMA 4EZLA 3MJWA 2L0TB 3CHSA 3S2AA 4YNDA 4I43A 3FY4A 3ZEFA 4ILGA 5FQ6A 2HR2A 2DBAA 2KZTB 1UN8A 2NXPA 3PRZA 4AJWA 2VGXB 3OXLA 4GMLA 3Q47B 3FUKA 3LJ3A 4U63A 4FADA 3OTNA 4HXIA 4WUYA 4BT9A 1W3BA 3HDXA 4JZYA 3ASGA 3MKQB 4L2YA 3ESLA 3AS4A 3FULA 3S7JA 3SGHA 2E0IA 3L17A 2IONA 4MS6A 2LAHA 1IYGA 3LXUX 4CDRA 5KJLA 4GPKA 1H2TC 2PZIA 4J8SA 1FVHA 5JJTA 4KZ0A 2CG2A 2IFUA 4C0MA 3NZUA 4LUNU 3L16A 2XHEA 3FWVA 4I2WA 2UY1A 3KD7A 3JCKC 4B94A 2M63A 3LY7A 3ENEA 2WPVA 2AW6A 5E75A 3RU0A 3ASHA 1UJJA 4FJYA 3LS8A 3MV3B 3UT7A 1E90A 3PVLA 3QB2A 3EDTB 3FUMA 1HG5A 2V4LA 3Q5MA 3QK0A 1OUVA 1KLXA 3FTUA 3ML9A 4XX5A 3CQGB 3GZ2A 3CK9A 5FWQA 3SHFA 4GZ6A 2I9CA 4JPSA 2VSYA 2WXFA 1JPLA 4R7LA 4NURA 4TV3A 2EQXA 3APFA 4A3TA 5CMWA 2DCPA 2J9QA 5BW8C 3VTYA 2Y4TA 2I2OA 3FU6A 3QKYA 4BTAA 2XRZA 3QWPA 3RRNB 5JJ7A 4WNEA 5EX0A 3TAXA 3T8MA 3ZPJA 3KS2A 3EIJA 4PDXA 5BPPA 1U3CA 3D9IA 3RKVA 3FHEA 3PEUB 3LY8A 4JA7A 2WXJA 2XCCA 3VLEA 4E85A 2J49A 2V8SE 4JVSA 4ACLA 3IBEA 1PC2A 2R59A 4APOA 1Z6TA 4HVBA 3ONLA 4J8FA 3PH0C 4G23A 1KT1A 2WMOA 1HU3A 4KYOB 3T5XA 5AENA 2AWIA 2WXHA 4MLPA 4GA1A 4WWNA 2HO1A 3D9OA 2GW1A 3MX3A 1OWMA 3UQ3A 1HFAA 3PUKA 1E8YA 1UN9A 5FZQA 4AXHA 3SBSA 4A55A 4ABNA 3FFLA 2AXZA 3FH8A 4TUUA 3UMVA 2C2LA 3QC1A 5J90A 4EBAG 5KJMA 4G11A 3FH7A 4LRZA 4A1GA 2YINA 5ANLA 4L2LA 2FEZA 3MZLB 4GYOA 3S7DA 5ENNA 4B8CB 4ILIA 5M72A 4GA0A 2JLBA 2ZU6B 3CHRA 3MA5A 4HFGA 1YA0A 3R9AB 3L54A 5LP0A 2CFUA 4P29A 2X6IA 3RRUA 1E8WA 1FCHA 5FQ4A 3SD5A 1HXIA 1HH8A 3L08A 4GB9A 4DI4A 1DVPA 1N52A 1XNFA 2MRIA 2WXIA 3JUIA 5ARGA 4Y6CA 4JEHA 2YNQA 2L0IA 4KZCA 2VJ8A 1EPUA 4WWPA 4HOUA 4N2QA 3LY9A 4TRQA 4L1BA 3CVQA 4EPZA 3LVRE 3GZ1A 2J08A 1SZ9A 3EJNA 2WXMA 3HVEA 1WAO1 4O6FA 4HLEA 5LFAA 2WXOA 2WXPA 3BG0B 3RIBA 2WMNA 4NRHB 1B89A 4I6JA 4NQ0A 2WXRA 2PQRA 4I9CA 1ELRA 2NC9A 2YQ8A 4GZ3A 4KVOA 2WQ6A 2XPIA 4BWRA 5FQ8A 3FH5A 3I5PA 4YVQC 3B13A 4JC8A 1NA3A 2PM6A 3FTXA 4H7XA 1H6KA 1L5JA 4UWFA 5T8IA 3LPZA 5JHBA 3ZYQA 1SZAA 2XCBA 4RG6A 4DPRA 5FZRA 4WNFA 3U9WA 2VYIA 2WQHA 3ZVVA 4AY6A 2VSNA 2X38A 3CLJA 3D9JA 3LEWA 4JEUA 4PH4B 2CHZA 2UY1B 2HM8A 3QJZA 3QAQA 2DIWA 4J0UA 3RJVA 4EZKA 3FTYA 4UI9K 4K03A 3MGBA 5JJ6A 2RG8A 2WM9A 3CEQA 4CEMA 4BFRA 2WXKA 1WM5A 1PAQA 3O48A 3DBSA 1ZU2A 2BF0X 4I2ZA 1Z3YA 3ZW3A 1Y6IA 1PY1A 3NF1A 4KVMA 4IYPA 2BUGA 4GA2A 4JA9A 3PDNA 2FI7A 5KCMA 3UX4A 4DI3A 4EZJA 4CDNA 2CHWA 2NSZA 2XGMA 3APCA 4GMJA 4UQXA 3TG5A 3JQ1A 1P5QA 3JYSA 3RK6A 1JWGA 3B7RL 4N39A 4ACKA 3AU4A 4MRUA 2ONDA 2AXUA 3RO3A 3IV0A 4ANUA 4BY6A 5AJDA 4F53A 4FLBA 4HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3C A;  4GYY A;  3WXX A;  2V5F A;  2L6J A;  2C0M A;  3ZHE A;  3ASF A;  2QFC A;  4AM9 A;  4RG9 A;  5FJY A;  5FZS A;  2HYZ A;  1Y8M A;  2UWJ G;  4N3B A;  4WNG A;  3LYA A;  5AYW D;  4UQY A;  2OOE A;  1E96 B;  2LSV A;  5FT9 A;  3KAE A;  4HOQ A;  5CCM A;  4G26 A;  3RO2 A;  3LKU A;  5CCL A;  5G05 J;  4GZ5 A;  4N3A A;  2LNI A;  5A7D B;  2I6H A;  3ESK A;  4JHR A;  5KJK A;  2XGO A;  3QWW A;  4G24 A;  4GCO A;  3GW4 A;  2P58 C;  4G1T A;  5BNW A;  2FO7 A;  2KCV A;  2VGY A;  5BT1 A;  5DIZ A;  1QZ2 A;  4H7Y A;  4ME2 A;  2AVP A;  5G05 C;  5C1D A;  3SF4 A;  3OXG A;  2C0L A;  3QOU A;  4N5C A;  5DBK A;  2MHK A;  4CGV A;  3Q49 B;  5D0Q D;  4UI9 J;  3URZ A;  4W9R A;  5ARF A;  2KCK A;  4YVO A;  4GCN A;  1NA0 A;  1TJC A;  3ZGQ A;  4U0Z A;  1HZ4 A;  4BT8 A;  1NZN A;  5A6C A;  3ASD A;  4AIF A;  1KT0 A;  3CVL A;  4WND A;  5G04 J;  3UPV A;  3N71 A;  4UI9 C;  3ZHE B;  4XI9 A;  4HOT A;  2YHC A;  3LCA A;  4KXK B;  3GYZ A;  3QWV A;  5EKQ D;  2LSU A;  3U3W A;  4U0S A;  4F3V A;  5LCW J;  4I17 A;  4LEU A;  2VQ2 A;  2XEV A;  4CGW A;  4BTB A;  2VGX A;  3PE3 A;  5G04 C;  3ULQ A;  2XGS A;  4U0U A;  3AS5 A;  3CV0 A;  3Q15 A;  4IN3 B;  5EX3 A;  4Y6W A;  3IEG A;  4G2V A;  5LCW C;  5D0O D;  3SZ7 A;  4XI0 A;  2KC7 A;  3FP3 A;  3VTX A;  4G25 A;  4XIF A;  3CVP A;  3S7F A;  4GYW A;  1IHG A;  3U4T A;  3CKB A;  4A1S A;  2KAT A;  3K9I A;  5KJN A;  3AS8 A;  3S7B A;  2PQN A;  3HYM B;  4JL0 A;  3CVN A;  4I9E A;  3TGO A;  3Q4A B;  4N2S A;  2IF4 A;  3UUX A;  4UQZ A;  4HOR A;  2FBN A;  3TG4 A;  2E2E A;  2Q7F A;  3MKR A;  3MEK A;  4U07 A;  1ZBP A;  4EQF A;  5HI7 A;  2KCL A;  5HQ8 A;  1QQE A;  3ZFW A;  2Y4U A;  2PL2 A;  3OXF A;  4J8D A;  2R5S A;  4I1A A;  3MV2 B;  4J8E A;  3ZN3 A;  3CK8 A;  4KBQ A;  3E4B A;  4U04 A;  5CHE E;  3CK7 A;  1ELW A;  2FF4 A;  3PE4 A;  5FTP A;  4AY5 A;  1A17 A;  3BEE A;  3CKC A;  3QDN A;  4YND A;  2HR2 A;  2DBA A;  2VGX B;  3OXL A;  3Q47 B;  4WUY A;  4BT9 A;  1W3B A;  3ASG A;  3AS4 A;  3S7J A;  1IYG A;  4CDR A;  5KJL A;  4GPK A;  2PZI A;  5JJT A;  2IFU A;  3FWV A;  4I2W A;  2UY1 A;  3KD7 A;  4B94 A;  3LY7 A;  2WPV A;  3RU0 A;  3ASH A;  3MV3 B;  3EDT B;  3Q5M A;  1OUV A;  1KLX A;  3GZ2 A;  3CK9 A;  4GZ6 A;  2VSY A;  2J9Q A;  5BW8 C;  3VTY A;  2Y4T A;  4BTA A;  3QKY A;  3QWP A;  5JJ7 A;  4WNE A;  5EX0 A;  3TAX A;  3ZPJ A;  3KS2 A;  3RKV A;  3LY8 A;  4JA7 A;  2XCC A;  1PC2 A;  4APO A;  4J8F A;  4G23 A;  1KT1 A;  4KYO B;  4GA1 A;  2HO1 A;  2GW1 A;  3UQ3 A;  5FZQ A;  4ABN A;  3FFL A;  2C2L A;  5KJM A;  2FEZ A;  4GYO A;  3S7D A;  5M72 A;  4GA0 A;  2JLB A;  3MA5 A;  1YA0 A;  3R9A B;  1FCH A;  1HXI A;  1HH8 A;  1XNF A;  5ARG A;  4Y6C A;  4HOU A;  4N2Q A;  3LY9 A;  3CVQ A;  3GZ1 A;  4O6F A;  1WAO 1;  3RIB A;  4NRH B;  1B89 A;  4NQ0 A;  4I9C A;  2PQR A;  1ELR A;  2NC9 A;  2YQ8 A;  4GZ3 A;  2XPI A;  4BWR A;  4YVQ C;  1NA3 A;  4H7X A;  3LPZ A;  2XCB A;  4RG6 A;  5FZR A;  4WNF A;  2VYI A;  2WQH A;  4AY6 A;  2VSN A;  2UY1 B;  4J0U A;  3RJV A;  4UI9 K;  5JJ6 A;  3CEQ A;  1WM5 A;  3O48 A;  1ZU2 A;  4I2Z A;  3NF1 A;  2BUG A;  4GA2 A;  4JA9 A;  3PDN A;  2FI7 A;  2XGM A;  4UQX A;  3TG5 A;  1P5Q A;  3JYS A;  4N39 A;  2OND A;  3RO3 A;  4HOS A; 
#chains in the Genus database with same CATH topology
 2L6J A;  3DRA A;  4JXT A;  4CRW A;  3L6A A;  3ZHE A;  2Y69 E;  1TN6 A;  3PZD A;  1OCZ E;  2QFC A;  1OWP A;  3Q9N C;  2RKK A;  2J4B A;  2HYZ A;  2P2C P;  4WNG A;  3GZS A;  4GTP A;  3D9K A;  2CG3 A;  3D9N A;  1S0P A;  4CDM A;  3DPY A;  3CHQ A;  5FQ7 A;  2X6K A;  4HOQ A;  4AV7 A;  3RO2 A;  2LXL A;  1MX4 A;  5CCL A;  5G05 J;  4ATZ D;  3UKR G;  2A5E A;  3AG4 E;  1NL4 A;  5BUZ A;  3EHN A;  1O5M A;  3QWW A;  4G24 A;  4CT0 A;  4XKC A;  3DWL G;  4GAA A;  1BI7 B;  3KEA A;  3IHY A;  5BNW A;  1IQR A;  4D10 C;  1IXV A;  2F37 A;  5BT1 A;  2J07 A;  1QZ2 A;  1AWC B;  1TN8 A;  4AEZ C;  4DX7 D;  3SF4 A;  3OXG A;  4UUC A;  1AP7 A;  2WQ7 A;  1BPO A;  5BV0 A;  2MHK A;  4KMO A;  3URZ A;  4W9R A;  2OEV A;  3P1U A;  3KEZ A;  1XGW A;  3ISM C;  2RFM A;  1YCS B;  4EBA A;  1HZ4 A;  4BT8 A;  1NZN A;  4N5Q A;  1V55 E;  3LDZ A;  5A6C A;  2QZA A;  1KZO A;  2YHE A;  4XEI G;  4YDE A;  1H19 A;  4HBD A;  1IKN D;  2LO6 A;  5G04 J;  4FU3 A;  3UPV A;  3N71 A;  1LF8 A;  3IKO B;  3HXC A;  1N0R A;  4XI9 A;  1HG2 A;  3JQ0 A;  1HF8 A;  5CBN A;  3CHO A;  4CT4 A;  1YMP A;  3E32 A;  4U0S A;  4I17 A;  4L7T A;  5KNG A;  1UG3 A;  1K1B A;  3FUE A;  5E76 A;  1E7V A;  3U66 A;  1Z5S C;  2MYO A;  4DK5 A;  3PE3 A;  3TWR A;  3ZXP A;  5T3R A;  3FEX A;  1EYH A;  5CMY A;  4AVX A;  3AS5 A;  3TXM A;  2P9U G;  2VTB B;  3SNX A;  4C9B B;  4Q96 A;  4Y6W A;  5A23 A;  3AAA C;  3CHP A;  3ULY A;  4BES A;  4G25 A;  2CHX A;  2OEW A;  3TXN A;  2A5U A;  1K1A A;  2KAT A;  3D3M A;  1H2V C;  2X6H A;  3L13 A;  3TWS A;  5ENS D;  3TGO A;  4N2S A;  2F0Y A;  4L9P A;  1TJF A;  4FA6 A;  3TWW A;  4BSX A;  3AU5 A;  1Z3X A;  2FBN A;  4BET A;  1WY6 A;  3D9H A;  1TNZ A;  3B7U X;  3OAW A;  3SFY A;  4G8L A;  3FUD A;  4EQF A;  3B7T A;  3PS6 A;  1YYH A;  1QQE A;  3ZFW A;  1IQU A;  2EIK E;  2OCC E;  4GZD A;  3ML8 A;  4FHK A;  1OWO A;  3ZN3 A;  3C72 A;  3CR3 A;  5JHA A;  2RFA A;  3E4B A;  3LVQ E;  4RLY A;  4O1O A;  2JEK A;  2IO3 C;  4GTM A;  3PE4 A;  1TNY A;  1A17 A;  3MJW A;  4YND A;  4I43 A;  5FQ6 A;  3PRZ A;  4FAD A;  4WUY A;  4BT9 A;  1MX2 A;  1W3B A;  3UIP C;  2P9L G;  4HRL A;  3S7J A;  1K3Z D;  1TYQ G;  1FVH A;  3UKU G;  3NZU A;  3JCK C;  3ENE A;  5E75 A;  3ASH A;  3UT7 A;  3PZ1 A;  3QK0 A;  3ML9 A;  4XX5 A;  3Q79 A;  1TNB A;  4JPS A;  4DX5 D;  3WG7 E;  2WXF A;  3V2X A;  4TV3 A;  3PZ2 A;  2DCP A;  3VTY A;  2XRZ A;  1BLX B;  4WNE A;  5EX0 A;  3TAX A;  3EIJ A;  4PDX A;  5BPP A;  1N95 A;  3FHE A;  3PEU B;  3E30 A;  4U95 D;  3IBE A;  1PC2 A;  3ONL A;  4Z68 A;  4KYO B;  3T5X A;  2IEJ A;  4WWN A;  3MX3 A;  1SA5 A;  3PUK A;  1TN7 A;  1UN9 A;  5FZQ A;  3FFL A;  3FH8 A;  4C48 B;  3QC1 A;  4EBA G;  4A1G A;  4LRZ A;  1MJ0 A;  3W9F A;  4ILI A;  3CHR A;  4HFG A;  3Q78 A;  5LP0 A;  2R02 A;  3KSL A;  1E8W A;  4GB9 A;  2MRI A;  3DSS A;  2YNQ A;  4KZC A;  4WWP A;  4TRQ A;  4L1B A;  3CVQ A;  4RQI A;  3GZ1 A;  4O6F A;  3ZNG A;  3RIB A;  4NRH B;  4I6J A;  2WXR A;  2NC9 A;  3BU8 A;  2WQ6 A;  2XPI A;  4YVQ C;  4JC8 A;  1H6K A;  3C3R A;  5JHB A;  1SZA A;  4DPR A;  4BER A;  5FZR A;  4WNF A;  3D9J A;  4PH4 B;  2UY1 B;  4J0U A;  2P9K G;  5JJ6 A;  2R05 A;  3CEQ A;  3DBS A;  2BF0 X;  4I2Z A;  1PY1 A;  5EN5 D;  2BUG A;  4GA2 A;  2FI7 A;  5KCM A;  3TWX A;  5B1B E;  2NSZ A;  2XGM A;  3JYS A;  1JWG A;  4HLL A;  3B7R L;  2BKK B;  3RO3 A;  4ANU A;  4BY6 A;  4ZHB A;  3WXX A;  4FC8 A;  3ZKJ A;  4GMR A;  4ANX A;  2ETC A;  3ASF A;  3QAR A;  3NZS A;  5AJL A;  5FJY A;  3U64 A;  4X8Q A;  1VDY A;  2UWJ G;  2IOS A;  3UTM A;  3LYA A;  2LSV A;  2IJG X;  4B89 A;  4BEP A;  3RSE G;  2WXG A;  3SY2 A;  3ZXS A;  2I1K A;  4JHJ A;  5CCM A;  4G26 A;  3L9T A;  3I3N A;  2XZD G;  1V54 E;  1O1R A;  4LG6 A;  4GZ5 A;  5A7D B;  3ESK A;  3G2T A;  4JHR A;  5KJK A;  3GW4 A;  5HRY A;  1UJK A;  2FO7 A;  3HG0 D;  5DIZ A;  1D9S A;  4QFV A;  1S70 B;  4H7Y A;  4FLH A;  4ME2 A;  2AVP A;  1H2U A;  2WVI A;  5G05 C;  5KWD A;  2C0L A;  3FEY A;  3QOU A;  4GTQ A;  4N5C A;  3I4G A;  4UI9 J;  5LX8 A;  2BTD A;  2XRY A;  2DZO A;  4RVB A;  4GCN A;  3P2B A;  3EHQ A;  3PZ4 A;  4BSZ B;  3ZGQ A;  4A3V A;  1OWN A;  1G3N B;  1MQS A;  2XQ0 A;  3ASD A;  4AIF A;  1ZB1 A;  2J8S D;  3DSU A;  4KT6 B;  3EIQ C;  2R17 C;  3ZHE B;  3Q73 A;  4DUI A;  2YHC A;  5FIO A;  4KXK B;  5AN8 A;  3QWV A;  1EF1 C;  4FJZ A;  3U3W A;  5LCW J;  2GGF A;  2X6F A;  2WXQ A;  2KZT A;  4CGW A;  4BTB A;  5G04 C;  4U0U A;  3FU5 A;  4I6E A;  1X5B A;  3F6Q A;  3Q15 A;  5EX3 A;  5HS0 A;  3FTZ A;  5FIN A;  3RAU A;  2GRQ B;  2GRP B;  1GW6 A;  5ITZ F;  2FUL A;  3SZ7 A;  3T9K A;  2L6B A;  4B8A A;  1QNF A;  3EUV A;  4M3O A;  4Q69 A;  4V3I A;  5AIJ A;  2H6I A;  5EIL A;  3CVU A;  1WG0 A;  3K9I A;  4JW1 A;  3ZRH A;  3HIZ A;  5KJN A;  3HYM B;  3G2W A;  3HVE B;  3DPD A;  1O1S A;  4HOR A;  3UM3 A;  2EIM E;  3PNT B;  3SI5 A;  1MHQ A;  2DZN A;  3VLF A;  3E37 A;  3MCX A;  2R2L A;  1SA4 A;  3DEO A;  5HQ8 A;  1DCQ A;  4HS2 A;  2PM7 A;  2R5S A;  5CEA A;  3MV2 B;  3CK8 A;  3UXG A;  4KBQ A;  3LJN A;  1N0Q A;  2L9B A;  5CHE E;  5G55 A;  1ELW A;  3FTS A;  4C0E A;  4AY5 A;  3T5V A;  3QDN A;  4YDO A;  4EZL A;  1LD7 A;  2L0T B;  4K5B A;  1BI8 B;  3FY4 A;  4ILG A;  2DBA A;  4AJW A;  3E34 A;  3TWU A;  3OTN A;  2E0I A;  2ION A;  4MS6 A;  3LXU X;  2PZI A;  4J8S A;  2IFU A;  2CG2 A;  3L16 A;  2XHE A;  3KD7 A;  4B94 A;  2V4H C;  1MYO A;  2AW6 A;  3RU0 A;  5KNH D;  4U8Y D;  1E90 A;  3PVL A;  3EDT B;  1HG5 A;  3Q5M A;  1KLX A;  5FWQ A;  3HXE A;  4A3T A;  5AAO A;  5BW8 C;  2Y4T A;  2I2O A;  3QKY A;  2B0O E;  5ENO D;  4O60 A;  4HB5 A;  1U3C A;  3D9I A;  4LNB A;  3VLE A;  4E85 A;  2V8S E;  4APO A;  2R59 A;  2F8Y A;  1KT1 A;  5AEN A;  2AJA A;  2HO1 A;  3TWV A;  3BQO A;  4TXP A;  4AXH A;  3SBS A;  4A55 A;  4MBG A;  2AXZ A;  4JD2 G;  2C2L A;  5J90 A;  4G11 A;  2ZXW E;  3ASN E;  1H6O A;  2ZU6 B;  5B1A E;  3MA5 A;  2ETB A;  2H6G A;  4HI9 A;  1FCH A;  4NIK A;  5FQ4 A;  3SD5 A;  1HH8 A;  4DI4 A;  1DVP A;  1N52 A;  3R9M A;  2L0I A;  2VJ8 A;  1H6P A;  1EPU A;  4HOU A;  5D66 A;  3LVR E;  2WMN A;  1B89 A;  4NQ0 A;  1OT8 A;  4GZ3 A;  2YQ8 A;  4KVO A;  3FH5 A;  1NA3 A;  3IXE A;  2XCB A;  3J5Q B;  3U9W A;  3DSW A;  2VYI A;  2WQH A;  3ZVV A;  4AY6 A;  1TR4 A;  3CLJ A;  3QJZ A;  3FTY A;  3UM2 A;  2RG8 A;  2WM9 A;  4CEM A;  1WM5 A;  1QBQ A;  4KVM A;  3PDN A;  3UX4 A;  2XEE A;  3ULE G;  4EZJ A;  4CDN A;  4GMJ A;  3NBN B;  3RK6 A;  4N39 A;  4MRU A;  2OND A;  2AXU A;  3IV0 A;  1E8X A;  4GYY A;  2V5F A;  2XEH A;  4AM9 A;  4RG9 A;  2V0P A;  1HO8 A;  5FZS A;  4N3B A;  5AYW D;  2CFZ A;  4UQY A;  3UT4 A;  1E96 B;  3L82 A;  5FT9 A;  2FO1 E;  5EID A;  4AP2 A;  4YDY A;  2F8X K;  3HXF A;  1NP7 A;  3LKU A;  4J7W A;  2LNI A;  3PUJ A;  4URK A;  4RSY A;  1HS6 A;  4M7C A;  4GCO A;  3HRA A;  3FU0 A;  2P58 C;  3R7R A;  3ASO E;  4I1M A;  2KCV A;  4U96 D;  3ONK A;  3CQC B;  4PS8 A;  1JCR A;  2OVB A;  3IHV A;  2XPZ A;  5C1D A;  3FTV A;  5DBK A;  2R03 A;  4CGV A;  5D0Q D;  3CHM A;  2KM4 A;  5ARF A;  2KCK A;  4YVO A;  3C98 A;  4OYS A;  1N4P A;  1U2V G;  1N4R A;  1NA0 A;  5J08 A;  4U0Z A;  3C5R A;  3EU9 A;  5JA4 D;  5AAR A;  2Y0B G;  3G2V A;  4A63 B;  2DWZ A;  4PS3 A;  3CVL A;  4WND A;  1S64 A;  2QYU A;  4UI9 C;  3ZYM A;  2IY0 C;  1TEZ A;  4JHK A;  1INZ A;  4BX9 A;  3UIO C;  3LCA A;  4GTT A;  3DST A;  4OAV B;  5G2N A;  4NAC A;  1OCO E;  1SW6 A;  4OVV A;  5EKQ D;  4F7A A;  4ATG A;  4F3V A;  2VQ2 A;  4DX2 A;  5ENT D;  2VGX A;  3FU3 A;  2XPY A;  2XGS A;  1EDU A;  3B95 A;  3MKQ A;  3CV0 A;  4IN3 B;  4BX8 A;  1UOH A;  2H6H A;  2ZIS A;  2EIN E;  1N54 A;  4G2V A;  1FPP A;  5LCW C;  5D0O D;  2KC7 A;  4FHJ A;  4CYM D;  1FVF A;  3VTX A;  5BV1 A;  4XIF A;  2VSX E;  1UW4 B;  2DVW A;  3CVP A;  3J5P A;  2IU1 A;  3SFZ A;  3S7F A;  4GYW A;  5H7P A;  2IQC A;  1N94 A;  4JB8 P;  4UWL A;  4A1S A;  5ANR A;  1JCS A;  3NAW A;  3BG1 B;  2NYJ A;  1FT1 A;  4JL0 A;  4I9E A;  1DNP A;  3UUX A;  5IY5 E;  3PNL B;  2OVF A;  4GZC A;  4UWG A;  3JXJ A;  2KBX A;  4O1P A;  1SVX A;  3TG4 A;  3V79 K;  3CGH A;  1LTX A;  2E2E A;  2Q7F A;  3MKR A;  2IOL A;  4E6H A;  4EEC A;  3MEK A;  1D8E A;  3EHM A;  3Q75 A;  5CRU A;  5HI7 A;  3MYV A;  2KCL A;  2PNN A;  2QC9 A;  3FDH A;  3JXI A;  3UM0 A;  3OXF A;  2LUH A;  2XS1 A;  4J8D A;  3R7Q A;  4LSZ E;  1N9A A;  3VLD A;  5KBA A;  3SO8 A;  4J8E A;  1E7U A;  4ZFH A;  4U04 A;  5AQ9 A;  4DLQ A;  5CED B;  3CKC A;  2J09 A;  2GRM A;  2VGE A;  3CHS A;  3S2A A;  3ZEF A;  2HR2 A;  2KZT B;  1K8K G;  2B6C A;  3FUK A;  3LJ3 A;  4U63 A;  5CER B;  4JZY A;  3ASG A;  3ESL A;  3SFX A;  3FUL A;  3C3Q A;  2LAH A;  4K5A B;  1IYG A;  4CDR A;  4GPK A;  3DEP A;  1H2T C;  3C3O A;  5JJT A;  4KZ0 A;  4C0M A;  3X2Q E;  2M63 A;  3LY7 A;  5JMN D;  4FJY A;  3MV3 B;  3QB2 A;  3PZ3 A;  1OUV A;  2I9C A;  4R7L A;  3T8K A;  3UM1 A;  4GPM A;  5CMW A;  3TWQ A;  3FU6 A;  3ZPJ A;  3KS2 A;  1QYM A;  3RKV A;  4JA7 A;  2WXJ A;  2XCC A;  4J8F A;  4G23 A;  2WMO A;  1HU3 A;  2WXH A;  4GTR A;  4GA1 A;  3D9O A;  4TUU A;  3UMV A;  5KJM A;  4F6R D;  3FH7 A;  2YIN A;  5ANL A;  4L2L A;  2FEZ A;  3MZL B;  4GYO A;  4CZ2 D;  5ENN A;  4B8C B;  5M72 A;  2ZIR A;  2JLB A;  4GA0 A;  5D2M C;  1YA0 A;  1LD8 A;  2CFU A;  2X6I A;  1XNF A;  3JUI A;  5ARG A;  1KPS B;  3V30 A;  2J08 A;  2XZT G;  1SZ9 A;  3HVE A;  4HLE A;  1WAO 1;  2WXP A;  1RW2 A;  2PQR A;  1OCC E;  4BWR A;  5FQ8 A;  3I5P A;  5EYP F;  1OCR E;  3B13 A;  4LNU D;  2PM6 A;  3FTX A;  5T8I A;  1L5J A;  2GRN B;  3LPZ A;  3ZYQ A;  5EIB E;  3E33 A;  5AQB A;  2VSN A;  2X38 A;  3LEW A;  2HM8 A;  3QAQ A;  2DIW A;  5ENR D;  4UI9 K;  4K03 A;  3BUA A;  4G8K A;  5CRV A;  1PAQ A;  3O48 A;  1Z3Y A;  1Y6I A;  4HQD A;  3NF1 A;  4JA9 A;  3EHR A;  4DI3 A;  2CHW A;  3APC A;  4UQX A;  3TG5 A;  1X81 A;  1DC2 A;  1P5Q A;  1DCE A;  4FLB A;  2XS8 A;  4N3C A;  3ZU7 B;  2C0M A;  2RD0 A;  2A4Z A;  2WB2 A;  5ENQ D;  1N4S A;  3ZIM A;  3CVW A;  1OXJ A;  5EDS A;  4FUL A;  4F1S A;  1Y8M A;  3CVV A;  4MKT A;  2ETA A;  1HX8 A;  2OOE A;  3FUF A;  4B0Z A;  3CSF A;  4WWO A;  3KAE A;  5AQ7 A;  5BXU A;  3RRM B;  3EU5 A;  3PRE A;  2J4D A;  1JUQ A;  4PS7 A;  2QY7 A;  2GRL A;  3UIN C;  4N3A A;  3ZYK A;  2I6H A;  2VTB A;  2XGO A;  3DXM G;  4Q94 A;  4U8H A;  3NQP A;  4DRX E;  3HXB A;  5T4Y A;  4G1T A;  2VSO E;  2VGY A;  3FUH A;  4IUL A;  4L23 A;  3CVY A;  4HRM B;  1MZC A;  4GTO A;  3SBT B;  4FP7 A;  4ILH B;  3Q49 B;  3TWT A;  1N4Q A;  2LAI A;  3B7S A;  4WAF A;  3HHM A;  1U3D A;  3D9P A;  3AJI A;  1S63 A;  3G2S A;  3NOG D;  2WXN A;  3FTW A;  4J6I A;  5LOZ A;  4HI8 A;  1TJC A;  1HE8 A;  1NFI E;  3G2U A;  3CST A;  4K0R A;  1NI1 A;  3PEV B;  1KT0 A;  1OY3 D;  3B7B A;  4IRU A;  3UT8 A;  3CVX A;  4HOT A;  5EYL A;  1O1T A;  3GYZ A;  3KSQ A;  4AOF A;  2Y3A A;  4CCA A;  3NB2 A;  2LSU A;  3O4Z A;  5HKP A;  1KZP A;  4LER A;  3I4R B;  3CIA A;  4LEU A;  1E8Z A;  2XEV A;  1ELK A;  4LCT A;  4I6G A;  2AXV A;  3Q7F A;  1JCQ A;  3ULQ A;  1N11 A;  1SQM A;  1JWF A;  2OV8 A;  4HRN A;  4U8V D;  1H0A A;  4ANV A;  2BED A;  2ILR A;  3TJP A;  2X6J A;  1WDY A;  4OAU C;  4GTS A;  3IEG A;  1RZ4 A;  3FUJ A;  4DLO A;  3FUI A;  4UWH A;  4XI0 A;  4XE0 A;  3FP3 A;  4XKB A;  3ZYL A;  2P9S G;  2DYS E;  1IHG A;  4GU5 A;  3U4T A;  5CBO A;  3CKB A;  4XZ4 A;  2I1J A;  4DJA A;  3D9L A;  3AS8 A;  3UI2 A;  4LNG A;  3S7B A;  2PQN A;  1IHB A;  3CVN A;  1A5E A;  3Q4A B;  4OVU A;  5B3S E;  2IF4 A;  4UQZ A;  3FUN A;  4APF A;  4UWK A;  4TXQ A;  4U07 A;  2MOW A;  1ZBP A;  3QNK A;  4TXR A;  3L22 A;  4TUM A;  1FT2 A;  3Q7A A;  2Y4U A;  3D9M A;  2PL2 A;  3JUE A;  2HE0 A;  4I1O B;  3TL5 A;  2DYR E;  4I1A A;  5C2Y A;  2KXP C;  2ZGG A;  1TNU A;  5CEC B;  3W9G A;  4QQI A;  2XEN A;  2X3M A;  4DX1 A;  1OWL A;  4PUC A;  4DX6 D;  1BU9 A;  2WXL A;  5BXO A;  2V5Q C;  3CK7 A;  2FF4 A;  3APD A;  5FTP A;  4ANW A;  3BEE A;  5AQA A;  4YDW A;  4F1P A;  1UN8 A;  2NXP A;  2VGX B;  3AG3 E;  3OXL A;  4GML A;  3Q47 B;  2Y1L E;  4HXI A;  3HDX A;  2H6F A;  3MKQ B;  4L2Y A;  3AS4 A;  3SGH A;  3L17 A;  4GTV A;  5KJL A;  1MX6 A;  2ZGD A;  1D8D A;  4LUN U;  3FWV A;  4I2W A;  2UY1 A;  2WPV A;  1UJJ A;  3AG2 E;  3LS8 A;  2EIJ E;  2QYJ A;  3FUM A;  2V4L A;  3FTU A;  3ABK E;  3CQG B;  3CK9 A;  3GZ2 A;  3SHF A;  4GZ6 A;  3Q9U C;  2VSY A;  3V2O A;  1JPL A;  4NUR A;  2EQX A;  3APF A;  2J9Q A;  4U7E B;  4BTA A;  4K5C A;  3QWP A;  3RRN B;  5JJ7 A;  3T8M A;  1TNO A;  3LY8 A;  2J49 A;  4JVS A;  4ACL A;  4HVB A;  1Z6T A;  2LXM A;  3PH0 C;  2AWI A;  2P9P G;  4MLP A;  2EIL E;  2GW1 A;  1OWM A;  3UQ3 A;  1HFA A;  1E8Y A;  3SQV A;  4ABN A;  2GRR B;  2P9I G;  3S7D A;  1BD8 A;  3R9A B;  3L54 A;  2JAB A;  4J8Y A;  4P29 A;  3RRU A;  1HXI A;  3L08 A;  2WXI A;  4Y6C A;  4JEH A;  5ENP D;  4N2Q A;  3DXK G;  3LY9 A;  4EPZ A;  3EJN A;  2WXM A;  3HXD A;  5LFA A;  2WXO A;  3BG0 B;  3AG1 E;  4I9C A;  2P9N G;  1ELR A;  4B93 B;  4H7X A;  4UWF A;  4RG6 A;  4HNA D;  4JEU A;  2CHZ A;  3ZUV B;  4EZK A;  3RJV A;  2IO2 C;  3MGB A;  4EHM A;  4BFR A;  2BKG A;  3NOC D;  2WXK A;  1ZU2 A;  3ABL E;  3ZW3 A;  3V31 A;  4IYP A;  2GRO B;  3DSX A;  1Q2Z A;  3JQ1 A;  3ABM E;  4ACK A;  3AU4 A;  3DSV A;  5AJD A;  4F53 A;  4HOS A; 
#chains in the Genus database with same CATH homology
 1E8X A;  4N3C A;  4GYY A;  3WXX A;  2V5F A;  2L6J A;  4JXT A;  4FC8 A;  2C0M A;  3L6A A;  4CRW A;  3ZHE A;  2RD0 A;  2A4Z A;  3PZD A;  4ANX A;  3ASF A;  3QAR A;  2QFC A;  2WB2 A;  4AM9 A;  4RG9 A;  3ZIM A;  3NZS A;  3CVW A;  1OWP A;  5AJL A;  5FJY A;  3U64 A;  5EDS A;  4FUL A;  4F1S A;  2J4B A;  1HO8 A;  2V0P A;  5FZS A;  1VDY A;  2HYZ A;  1Y8M A;  2UWJ G;  3CVV A;  2IOS A;  4MKT A;  3GZS A;  3LYA A;  4N3B A;  4WNG A;  5AYW D;  2CFZ A;  3D9K A;  1HX8 A;  4UQY A;  2OOE A;  3FUF A;  3UT4 A;  1E96 B;  2CG3 A;  2LSV A;  1S0P A;  2IJG X;  3D9N A;  3CSF A;  4B0Z A;  4B89 A;  4CDM A;  5FT9 A;  4WWO A;  3KAE A;  2WXG A;  4AP2 A;  3CHQ A;  5FQ7 A;  2X6K A;  4HOQ A;  3RRM B;  3ZXS A;  2I1K A;  4JHJ A;  5CCM A;  3PRE A;  4G26 A;  2J4D A;  1NP7 A;  3I3N A;  4AV7 A;  1JUQ A;  4PS7 A;  3RO2 A;  3LKU A;  2QY7 A;  5CCL A;  2GRL A;  5G05 J;  4GZ5 A;  4N3A A;  2LNI A;  5A7D B;  3ZYK A;  3PUJ A;  2I6H A;  5BUZ A;  4URK A;  4RSY A;  2VTB A;  3ESK A;  3G2T A;  3EHN A;  1HS6 A;  4JHR A;  5KJK A;  2XGO A;  3QWW A;  4G24 A;  4CT0 A;  4GCO A;  4Q94 A;  3GW4 A;  4U8H A;  3FU0 A;  2P58 C;  4XKC A;  3NQP A;  4GAA A;  3R7R A;  3IHY A;  5T4Y A;  4I1M A;  1UJK A;  4G1T A;  5BNW A;  2VSO E;  2FO7 A;  1IQR A;  2KCV A;  4D10 C;  2VGY A;  5BT1 A;  3FUH A;  3ONK A;  4IUL A;  5DIZ A;  2J07 A;  3CQC B;  4L23 A;  1QZ2 A;  4PS8 A;  4QFV A;  3CVY A;  4H7Y A;  2OVB A;  4FLH A;  4AEZ C;  4ME2 A;  2AVP A;  3IHV A;  1H2U A;  2WVI A;  2XPZ A;  5G05 C;  4FP7 A;  3SBT B;  3SF4 A;  5C1D A;  3OXG A;  2C0L A;  3FEY A;  3QOU A;  4N5C A;  3FTV A;  4ILH B;  2WQ7 A;  1BPO A;  5BV0 A;  5DBK A;  3I4G A;  2MHK A;  4CGV A;  3Q49 B;  5D0Q D;  3CHM A;  4KMO A;  4UI9 J;  3URZ A;  5LX8 A;  2KM4 A;  2LAI A;  3B7S A;  3P1U A;  3KEZ A;  2BTD A;  4W9R A;  5ARF A;  2KCK A;  4WAF A;  3HHM A;  1U3D A;  3D9P A;  2XRY A;  4RVB A;  3G2S A;  4YVO A;  3C98 A;  2WXN A;  4GCN A;  3FTW A;  4OYS A;  1XGW A;  3P2B A;  4EBA A;  4J6I A;  5LOZ A;  1NA0 A;  1TJC A;  3ZGQ A;  1HE8 A;  4U0Z A;  5J08 A;  1HZ4 A;  4A3V A;  4BT8 A;  1NZN A;  1OWN A;  3G2U A;  3CST A;  3LDZ A;  4K0R A;  5A6C A;  3PEV B;  3G2V A;  1MQS A;  2XQ0 A;  3ASD A;  4AIF A;  2YHE A;  1H19 A;  1KT0 A;  4PS3 A;  3CVL A;  2LO6 A;  4WND A;  5G04 J;  4FU3 A;  4KT6 B;  3UPV A;  3EIQ C;  3N71 A;  4IRU A;  4UI9 C;  1LF8 A;  3IKO B;  2R17 C;  3ZYM A;  3UT8 A;  1TEZ A;  4JHK A;  3CVX A;  1INZ A;  3ZHE B;  4XI9 A;  4HOT A;  4BX9 A;  2YHC A;  1HG2 A;  3JQ0 A;  3LCA A;  1HF8 A;  4KXK B;  3GYZ A;  3CHO A;  4CT4 A;  5G2N A;  3QWV A;  4AOF A;  2Y3A A;  4NAC A;  1EF1 C;  4FJZ A;  4CCA A;  4OVV A;  5EKQ D;  4F7A A;  2LSU A;  3O4Z A;  3U3W A;  4ATG A;  4U0S A;  4F3V A;  5LCW J;  4I17 A;  4LER A;  4L7T A;  2GGF A;  3I4R B;  3CIA A;  4LEU A;  2VQ2 A;  1E8Z A;  1UG3 A;  2XEV A;  1ELK A;  3FUE A;  5E76 A;  1E7V A;  3U66 A;  2X6F A;  2WXQ A;  4LCT A;  2KZT A;  4I6G A;  4BTB A;  4DK5 A;  4CGW A;  2AXV A;  2VGX A;  3PE3 A;  3FU3 A;  5G04 C;  2XPY A;  3ULQ A;  2XGS A;  1EDU A;  1SQM A;  1JWF A;  3FEX A;  1EYH A;  2OV8 A;  5T3R A;  4U0U A;  3FU5 A;  1H0A A;  1X5B A;  3MKQ A;  4I6E A;  5CMY A;  4AVX A;  3AS5 A;  4ANV A;  3CV0 A;  3Q15 A;  3TXM A;  2ILR A;  3TJP A;  2X6J A;  4IN3 B;  4BX8 A;  5EX3 A;  3FTZ A;  2VTB B;  3SNX A;  4C9B B;  4Q96 A;  4Y6W A;  3IEG A;  5A23 A;  1N54 A;  1GW6 A;  3FUJ A;  4DLO A;  4G2V A;  3FUI A;  2FUL A;  5LCW C;  5D0O D;  4UWH A;  3SZ7 A;  4XI0 A;  2KC7 A;  3CHP A;  4FHJ A;  4XE0 A;  4B8A A;  3FP3 A;  1QNF A;  1FVF A;  3VTX A;  5BV1 A;  4M3O A;  4G25 A;  4XKB A;  4XIF A;  2VSX E;  3ZYL A;  1UW4 B;  3CVP A;  2CHX A;  2IU1 A;  3SFZ A;  4Q69 A;  3S7F A;  4V3I A;  4GYW A;  1IHG A;  4GU5 A;  3U4T A;  5AIJ A;  2IQC A;  3TXN A;  2A5U A;  3CVU A;  3CKB A;  4UWL A;  2KAT A;  2I1J A;  3D3M A;  3K9I A;  4XZ4 A;  4A1S A;  1H2V C;  4JW1 A;  5ANR A;  3ZRH A;  4DJA A;  2X6H A;  3L13 A;  3BG1 B;  3D9L A;  3HIZ A;  5KJN A;  3AS8 A;  3S7B A;  2PQN A;  3HYM B;  4JL0 A;  3CVN A;  3G2W A;  3HVE B;  4I9E A;  3TGO A;  3Q4A B;  4OVU A;  1DNP A;  4N2S A;  2IF4 A;  3UUX A;  4FA6 A;  1TJF A;  3PNL B;  4UQZ A;  3DPD A;  2OVF A;  4BSX A;  3FUN A;  3AU5 A;  1Z3X A;  4GZC A;  4HOR A;  4UWG A;  2FBN A;  4APF A;  4UWK A;  3TG4 A;  3CGH A;  1WY6 A;  2E2E A;  3PNT B;  2Q7F A;  3MKR A;  2IOL A;  4E6H A;  3B7U X;  3OAW A;  3SI5 A;  4EEC A;  3MEK A;  4U07 A;  2MOW A;  3FUD A;  1ZBP A;  3EHM A;  3QNK A;  4EQF A;  1MHQ A;  3B7T A;  3PS6 A;  3VLF A;  3MCX A;  3L22 A;  5HI7 A;  3MYV A;  2KCL A;  5HQ8 A;  1QQE A;  3FDH A;  3ZFW A;  1IQU A;  2Y4U A;  3D9M A;  2PL2 A;  4HS2 A;  3OXF A;  4J8D A;  2PM7 A;  4GZD A;  3R7Q A;  2R5S A;  3ML8 A;  4I1O B;  3VLD A;  3TL5 A;  4FHK A;  4I1A A;  1OWO A;  3MV2 B;  4J8E A;  3ZN3 A;  5C2Y A;  3CR3 A;  3CK8 A;  1E7U A;  5JHA A;  4KBQ A;  3E4B A;  3LVQ E;  2X3M A;  4U04 A;  2L9B A;  2JEK A;  1OWL A;  4PUC A;  2WXL A;  5CHE E;  5G55 A;  3CK7 A;  1ELW A;  2FF4 A;  3APD A;  3PE4 A;  4DLQ A;  3FTS A;  4C0E A;  5FTP A;  4ANW A;  4AY5 A;  1A17 A;  3BEE A;  3CKC A;  3T5V A;  3QDN A;  2J09 A;  2GRM A;  4EZL A;  3MJW A;  2L0T B;  3CHS A;  3S2A A;  4YND A;  4I43 A;  3FY4 A;  3ZEF A;  4ILG A;  5FQ6 A;  2HR2 A;  2DBA A;  2KZT B;  1UN8 A;  2NXP A;  3PRZ A;  4AJW A;  2VGX B;  3OXL A;  4GML A;  3Q47 B;  3FUK A;  3LJ3 A;  4U63 A;  4FAD A;  3OTN A;  4HXI A;  4WUY A;  4BT9 A;  1W3B A;  3HDX A;  4JZY A;  3ASG A;  3MKQ B;  4L2Y A;  3ESL A;  3AS4 A;  3FUL A;  3S7J A;  3SGH A;  2E0I A;  3L17 A;  2ION A;  4MS6 A;  2LAH A;  1IYG A;  3LXU X;  4CDR A;  5KJL A;  4GPK A;  1H2T C;  2PZI A;  4J8S A;  1FVH A;  5JJT A;  4KZ0 A;  2CG2 A;  2IFU A;  4C0M A;  3NZU A;  4LUN U;  3L16 A;  2XHE A;  3FWV A;  4I2W A;  2UY1 A;  3KD7 A;  3JCK C;  4B94 A;  2M63 A;  3LY7 A;  3ENE A;  2WPV A;  2AW6 A;  5E75 A;  3RU0 A;  3ASH A;  1UJJ A;  4FJY A;  3LS8 A;  3MV3 B;  3UT7 A;  1E90 A;  3PVL A;  3QB2 A;  3EDT B;  3FUM A;  1HG5 A;  2V4L A;  3Q5M A;  3QK0 A;  1OUV A;  1KLX A;  3FTU A;  3ML9 A;  4XX5 A;  3CQG B;  3GZ2 A;  3CK9 A;  5FWQ A;  3SHF A;  4GZ6 A;  2I9C A;  4JPS A;  2VSY A;  2WXF A;  1JPL A;  4R7L A;  4NUR A;  4TV3 A;  2EQX A;  3APF A;  4A3T A;  5CMW A;  2DCP A;  2J9Q A;  5BW8 C;  3VTY A;  2Y4T A;  2I2O A;  3FU6 A;  3QKY A;  4BTA A;  2XRZ A;  3QWP A;  3RRN B;  5JJ7 A;  4WNE A;  5EX0 A;  3TAX A;  3T8M A;  3ZPJ A;  3KS2 A;  3EIJ A;  4PDX A;  5BPP A;  1U3C A;  3D9I A;  3RKV A;  3FHE A;  3PEU B;  3LY8 A;  4JA7 A;  2WXJ A;  2XCC A;  3VLE A;  4E85 A;  2J49 A;  2V8S E;  4JVS A;  4ACL A;  3IBE A;  1PC2 A;  2R59 A;  4APO A;  1Z6T A;  4HVB A;  3ONL A;  4J8F A;  3PH0 C;  4G23 A;  1KT1 A;  2WMO A;  1HU3 A;  4KYO B;  3T5X A;  5AEN A;  2AWI A;  2WXH A;  4MLP A;  4GA1 A;  4WWN A;  2HO1 A;  3D9O A;  2GW1 A;  3MX3 A;  1OWM A;  3UQ3 A;  1HFA A;  3PUK A;  1E8Y A;  1UN9 A;  5FZQ A;  4AXH A;  3SBS A;  4A55 A;  4ABN A;  3FFL A;  2AXZ A;  3FH8 A;  4TUU A;  3UMV A;  2C2L A;  3QC1 A;  5J90 A;  4EBA G;  5KJM A;  4G11 A;  3FH7 A;  4LRZ A;  4A1G A;  2YIN A;  5ANL A;  4L2L A;  2FEZ A;  3MZL B;  4GYO A;  3S7D A;  5ENN A;  4B8C B;  4ILI A;  5M72 A;  4GA0 A;  2JLB A;  2ZU6 B;  3CHR A;  3MA5 A;  4HFG A;  1YA0 A;  3R9A B;  3L54 A;  5LP0 A;  2CFU A;  4P29 A;  2X6I A;  3RRU A;  1E8W A;  1FCH A;  5FQ4 A;  3SD5 A;  1HXI A;  1HH8 A;  3L08 A;  4GB9 A;  4DI4 A;  1DVP A;  1N52 A;  1XNF A;  2MRI A;  2WXI A;  3JUI A;  5ARG A;  4Y6C A;  4JEH A;  2YNQ A;  2L0I A;  4KZC A;  2VJ8 A;  1EPU A;  4WWP A;  4HOU A;  4N2Q A;  3LY9 A;  4TRQ A;  4L1B A;  3CVQ A;  4EPZ A;  3LVR E;  3GZ1 A;  2J08 A;  1SZ9 A;  3EJN A;  2WXM A;  3HVE A;  1WAO 1;  4O6F A;  4HLE A;  5LFA A;  2WXO A;  2WXP A;  3BG0 B;  3RIB A;  2WMN A;  4NRH B;  1B89 A;  4I6J A;  4NQ0 A;  2WXR A;  2PQR A;  4I9C A;  1ELR A;  2NC9 A;  2YQ8 A;  4GZ3 A;  4KVO A;  2WQ6 A;  2XPI A;  4BWR A;  5FQ8 A;  3FH5 A;  3I5P A;  4YVQ C;  3B13 A;  4JC8 A;  1NA3 A;  2PM6 A;  3FTX A;  4H7X A;  1H6K A;  1L5J A;  4UWF A;  5T8I A;  3LPZ A;  5JHB A;  3ZYQ A;  1SZA A;  2XCB A;  4RG6 A;  4DPR A;  5FZR A;  4WNF A;  3U9W A;  2VYI A;  2WQH A;  3ZVV A;  4AY6 A;  2VSN A;  2X38 A;  3CLJ A;  3D9J A;  3LEW A;  4JEU A;  4PH4 B;  2CHZ A;  2UY1 B;  2HM8 A;  3QJZ A;  3QAQ A;  2DIW A;  4J0U A;  3RJV A;  4EZK A;  3FTY A;  4UI9 K;  4K03 A;  3MGB A;  5JJ6 A;  2RG8 A;  2WM9 A;  3CEQ A;  4CEM A;  4BFR A;  2WXK A;  1WM5 A;  1PAQ A;  3O48 A;  3DBS A;  1ZU2 A;  2BF0 X;  4I2Z A;  1Z3Y A;  3ZW3 A;  1Y6I A;  1PY1 A;  3NF1 A;  4KVM A;  4IYP A;  2BUG A;  4GA2 A;  4JA9 A;  3PDN A;  2FI7 A;  5KCM A;  3UX4 A;  4DI3 A;  4EZJ A;  4CDN A;  2CHW A;  2NSZ A;  2XGM A;  3APC A;  4GMJ A;  4UQX A;  3TG5 A;  3JQ1 A;  1P5Q A;  3JYS A;  3RK6 A;  1JWG A;  3B7R L;  4N39 A;  4ACK A;  3AU4 A;  4MRU A;  2OND A;  2AXU A;  3RO3 A;  3IV0 A;  4ANU A;  4BY6 A;  5AJD A;  4F53 A;  4FLB A;  4HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...