3LPZA

Crystal structure of c. therm. get4
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
321
structure length
314
Chain Sequence
b'NKIERIIARLQRRIAEGQPEEQYEAAQETRLVAARYSKQGNWAAAVDILASVSQTLLRSGQGGSGGDLAVLLVDTFRQAGQRVDGASRGKLLGCLRLFQPGEPVRKRFVKEMIDWSKKFGDYPAGDPELHHVVGTLYVEEGEFEAAEKHLVLGTKESPEVLARMEYEWYKQDESHTAPLYCARAVLPYLLVANVRAANTAYRIFTSALVEDNKGLTVQNIGSAELRIFPSLPLLNFISMLLLSVQKGSPDLFRQLKSKYEANLNELNGIWDTALELIAEMYFGIQRPRQSNPLLDMMGSLFGGGGAALRRIDTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Get4 (YOR164C homolog)
publication title The structure of Get4 reveals an alpha-solenoid fold adapted for multiple interactions in tail-anchored protein biogenesis.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Protein transport
total genus 117
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lpzA01
2KCLA 4G26A 3RU0A 2XEVA 1PC2A 4UI9K 3LY9A 2UWJG 2J9QA 1NZNA 2VSYA 5FTPA 3FWVA 5DBKA 3MV2B 4WNEA 5FZQA 2VGXB 5KJMA 3CVQA 2Y4UA 1QZ2A 4UQXA 3VTXA 5LCWC 2LNIA 4N3BA 4GZ6A 3SF4A 3ASHA 4HOQA 4N39A 5JJ7A 2VSNA 5LCWJ 4GYWA 2FO7A 4JL0A 2YQ8A 3CEQA 1Y8MA 3UPVA 3VTYA 3PDNA 4J8DA 2WPVA 3CK8A 1ELWA 3S7JA 1QQEA 3TG5A 4HOTA 2KC7A 3ZGQA 4CGWA 4G24A 1KT0A 4AY5A 3URZA 2NC9A 3QDNA 2QFCA 4GYOA 3LKUA 5EX0A 3NF1A 1HZ4A 4J8FA 5A6CA 3JYSA 4GCOA 2OOEA 1ZU2A 1W3BA 1E96B 4GZ3A 4AY6A 4J8EA 2XGOA 5G04J 5BT1A 5BNWA 2VYIA 3QWPA 3OXLA 2MHKA 2UY1A 5CCMA 4YNDA 3ZPJA 3AS8A 3OXGA 3PE4A 3QWWA 5G05C 1ZBPA 4BT8A 1IYGA 3MA5A 4WNDA 4HORA 3K9IA 4JA9A 1NA0A 4JA7A 1XNFA 2FF4A 3SZ7A 2FEZA 3AS4A 3IEGA 5JJ6A 3R9AB 4WNFA 3ASGA 3LCAA 5BW8C 4U0ZA 2PL2A 2PQRA 4BTBA 2VQ2A 5DIZA 2VGYA 3U4TA 3ULQA 5EKQD 1WM5A 3CV0A 2IFUA 5KJNA 2C2LA 4GCNA 5KJKA 3LY8A 3FFLA 4ME2A 3RIBA 4RG6A 4I1AA 4JHRA 5ARGA 4KXKB 3KS2A 3WXXA 4AM9A 4J0UA 4H7XA 4GYYA 2UY1B 2Q7FA 2C0MA 5ARFA 3KD7A 3Q4AB 2JLBA 3RKVA 5C1DA 3QOUA 5EX3A 3HYMB 4EQFA 3N71A 2BUGA 4KBQA 3RO3A 4GA1A 3QKYA 3QWVA 4YVQC 4XI0A 1TJCA 2XGMA 3ZFWA 3Q5MA 4BT9A 4U0SA 4NRHB 4BWRA 3MEKA 4IN3B 3CKBA 4I9CA 4NQ0A 1A17A 5FJYA 4KYOB 4G1TA 3GYZA 4W9RA 2P58C 4XI9A 4RG9A 2HO1A 4U0UA 3TAXA 3S7DA 2PZIA 5CHEE 4Y6WA 3MKRA 4LEUA 5G05J 5D0QD 4H7YA 3CKCA 3GZ1A 2XPIA 4U07A 3CVNA 2IF4A 4Y6CA 4ABNA 1P5QA 2WQHA 4U04A 4BTAA 3CK9A 1HH8A 3CVPA 3UUXA 2XCBA 3E4BA 3EDTB 2LSVA 4O6FA 3O48A 3LY7A 4G2VA 5HQ8A 4APOA 4N3AA 4HOSA 4UQZA 3LYAA 2I6HA 4B94A 5FZRA 2YHCA 3ZHEA 2PQNA 1NA3A 3S7FA 1OUVA 5AYWD 3CK7A 4GPKA 3ASDA 3LPZA 1WAO1 1ELRA 4N2SA 3FP3A 4GZ5A 3MV3B 1FCHA 2XGSA 1YA0A 5FZSA 2L6JA 2R5SA 3Q49B 5FT9A 2KCVA 3S7BA 2C0LA 3ASFA 5A7DB 4CGVA 2KCKA 5CCLA 2LSUA 3Q47B 4YVOA 2AVPA 2DBAA 3ESKA 3GW4A 4UQYA 4N5CA 4N3CA 4F3VA 2FI7A 1IHGA 4G23A 2XCCA 2ONDA 4CDRA 4N2QA 3OXFA 4I17A 3Q15A 3BEEA 2HYZA 4GA0A 2V5FA 5KJLA 2KATA 2GW1A 2VGXA 5G04C 2Y4TA 3U3WA 3UQ3A 5M72A 1KT1A 3TGOA 5HI7A 3ZHEB 3PE3A 3AS5A 4WNGA 4I2ZA 4A1SA 1HXIA 4I2WA 4WUYA 5JJTA 4GA2A 2E2EA 4UI9C 1KLXA 1B89A 3CVLA 4UI9J 3ZN3A 3GZ2A 2FBNA 4G25A 4I9EA 2HR2A 3KAEA 4XIFA 4AIFA 5D0OD 3RJVA 3RO2A 3TG4A 4HOUA
chains in the Genus database with same CATH superfamily
2KCLA 3HXBA 3KEAA 2IJGX 1H2TC 5EIBE 2KZTA 1GW6A 2XEHA 3RU0A 1PC2A 4L9PA 3ENEA 2VSYA 3ZYMA 4L7TA 4C0EA 3FWVA 2V4LA 3D9IA 4WNEA 2VGXB 1QNFA 4AVXA 5KJMA 3ABKE 2Y4UA 3D9NA 4GZ6A 5JHAA 2IY0C 3L22A 3UKRG 4EBAG 3CLJA 4N39A 5ANLA 4JEHA 5JJ7A 2LO6A 4FADA 2IO2C 4GTVA 4JEUA 4KMOA 3ZIMA 4HRLA 2A4ZA 3C3QA 3PDNA 1YMPA 2ZISA 3CSFA 3JCKC 3FULA 2KC7A 3ZGQA 4TXRA 4AY5A 1KT0A 3GZSA 3CR3A 4BX8A 1PAQA 3LKUA 4ANUA 4J8FA 4EPZA 4GCOA 4JC8A 1W3BA 1Z3YA 4AY6A 4J8EA 1E8YA 2XGOA 3PZDA 4ZFHA 1PY1A 4ACLA 5G04J 4CYMD 3S2AA 3TXNA 4BESA 2MHKA 2OV8A 2UY1A 3D9HA 3UXGA 5CCMA 3IHVA 3AS8A 4URKA 4GTOA 1LD8A 3MKQB 2GGFA 3QWWA 4ANWA 4BT8A 5JA4D 3BU8A 3MA5A 1HS6A 2P9PG 1NA0A 4KZCA 1XNFA 2ILRA 4OAUC 2FF4A 4YDYA 2WXIA 4HB5A 3SZ7A 2FEZA 4FA6A 1SA5A 1Z5SC 3UIOC 5CERB 4FP7A 3LCAA 4BTBA 3I4RB 3U4TA 2AXVA 2VTBB 5J90A 1ELKA 3LJNA 2NXPA 2IFUA 1X81A 5AIJA 5KBAA 4LCTA 4GCNA 4JW1A 3RIBA 3HVEB 2EINE 5J08A 3QARA 4I1AA 4JHRA 4B8AA 3ULEG 4CCAA 1VDYA 2AJAA 4KXKB 3T9KA 2YINA 4GYYA 2WQ6A 3ZKJA 3KEZA 2RG8A 2WXQA 3LS8A 3QK0A 1TYQG 2Q7FA 2P9KG 1JPLA 2C0MA 1BLXB 5ARFA 3UI2A 2HM8A 3HXCA 4FHJA 4UUCA 4PDXA 2H6FA 3AG3E 1JCRA 3RO3A 3FUFA 4K5BA 2OCCE 4GTSA 3D9JA 1MQSA 4I43A 1IXVA 3QWVA 3I3NA 1OWLA 3E30A 3WG7E 2ETBA 3FU0A 3V2OA 4O1PA 1MYOA 3MX3A 2PNNA 1TJCA 2XGMA 3HXFA 3ZFWA 1UOHA 4BT9A 4NRHB 3UTMA 3CKBA 3PZ2A 4I9CA 1S70B 2A5EA 3L16A 1TN7A 2WXHA 1OY3D 4F6RD 4W9RA 3EHQA 3FU5A 1OCOE 3U9WA 3IV0A 3B7BA 2CHXA 2J4DA 4LEUA 3HXDA 2I2OA 3GZ1A 4MLPA 4NURA 5C2YA 4U07A 1N94A 3AG1E 4UWLA 3J5QB 2WQHA 2FULA 3DXKG 5E76A 4O6FA 2CHZA 3ZUVB 3E32A 1OCCE 4BERA 4AXHA 4TUUA 5HQ8A 3NOCD 4HOSA 4GTQA 4UQZA 2I6HA 2YHCA 5KCMA 3TWQA 5EYLA 4K5CA 2WXPA 5AYWD 3CK7A 4G8KA 4M3OA 3E33A 2GRPB 3ASDA 2CG2A 5D2MC 4TV3A 3DSTA 2R59A 2DZOA 3CHRA 3L6AA 3DSWA 3ZU7B 5E75A 1LF8A 4C9BB 2XGSA 2DZNA 4TXQA 2ETAA 4GTRA 5FZSA 2R5SA 3FTWA 5FT9A 2KCVA 2WVIA 1HG5A 5B1BE 4CGVA 1MZCA 4DI4A 2V0PA 3DSXA 3ONKA 1SZ9A 2ZGGA 4J6IA 4N5CA 3R7RA 4F3VA 1N4RA 5JHBA 2E0IA 2R2LA 2GROB 4V3IA 3PEUB 3BEEA 4ACKA 3AG4E 4LERA 3Q7FA 2GW1A 2F0YA 2VGXA 3FUIA 4DX6D 3G2UA 1TNBA 4FULA 3UQ3A 2P9IG 2IO3C 4BSXA 3ZHEB 3PE3A 1OWOA 1HXIA 1D9SA 4GA2A 3ABME 2L9BA 2E2EA 1KLXA 3CVLA 1SW6A 3ZN3A 2XS8A 1ZB1A 3C3OA 4DI3A 3FH8A 2HE0A 2WB2A 1WG0A 5AQ9A 3RJVA 3HHMA 4G26A 3HG0D 2XEVA 1KZOA 1E8XA 3EJNA 3UM1A 2UWJG 2AW6A 2J9QA 1NZNA 4K03A 3FHEA 1H6KA 3MV2B 3MKQA 1MX4A 1U3CA 4GTMA 4UQXA 3VTXA 2MYOA 3V31A 4HRMB 5HKPA 4N3BA 3DWLG 3ASHA 2L6BA 4P29A 4HOQA 4FC8A 5BXUA 3DXMG 2QC9A 4U8YD 2DIWA 1K1BA 1Z3XA 3UM0A 1NFIE 3UPVA 5AJDA 3VTYA 4XKCA 2WPVA 2XRZA 3S7JA 1QQEA 4GTPA 3TG5A 3PREA 3Q9UC 2X6HA 3CHQA 1L5JA 3HXEA 2J4BA 4FHKA 5EYPF 3HVEA 5KNGA 4RVBA 4HFGA 3JYSA 4KZ0A 1RZ4A 1EF1C 3NZSA 1E96B 4GZ3A 3SO8A 1K8KG 2IOSA 3SY2A 2NSZA 2V4HC 4C48B 1K3ZD 2J49A 3FUNA 1SVXA 3ZPJA 1TJFA 1K1AA 4AOFA 2XPYA 3PE4A 1BD8A 3C3RA 2P9LG 2P9UG 2RFAA 4KVMA 5G05C 3LXUX 3RRUA 1IYGA 3D9OA 4MBGA 4WNDA 3KSQA 3F6QA 1HE8A 2ETCA 2MRIA 1S64A 4I6EA 1UG3A 5CRUA 3PH0C 4EZLA 1DNPA 2J8SD 5H7PA 2WQ7A 5JJ6A 4WNFA 1H6PA 3DRAA 4LNGA 3UKUG 5DIZA 3CVXA 4HLLA 2EIKE 5EKQD 4UWHA 1U3DA 3DBSA 2Y1LE 1NI1A 2C2LA 4F1PA 3FFLA 3FTZA 5LFAA 2H6IA 1BPOA 4L1BA 4RG6A 1SA4A 3P2BA 4WWNA 3VLEA 5HRYA 3KS2A 1FT1A 4AM9A 4H7XA 3AG2E 4CT0A 4CDMA 3QNKA 2JLBA 3RKVA 1UJJA 3EIQC 5EX3A 3TWTA 3N71A 1TNYA 2BUGA 3MCXA 4GA1A 3TJPA 3QKYA 2WXKA 5ANRA 5FIOA 1EPUA 2GRMA 3UT4A 3PRZA 4MKTA 1FT2A 4LUNU 4U0SA 3UINC 3PNLB 4UWGA 2WMOA 4IN3B 3TWSA 3ZXSA 3EHNA 1A17A 1JUQA 4NIKA 5FJYA 3SD5A 5D66A 4KYOB 3C72A 1N0RA 4PUCA 4U96D 3FY4A 2P58C 1N0QA 4XI9A 4RG9A 3CVYA 1EYHA 3S7DA 5ENSD 1TNUA 5B3SE 2H6HA 3G2TA 1FVFA 5D0QD 2WXOA 3AU4A 3QB2A 4H7YA 4JHJA 3CKCA 3NQPA 3BUAA 2DVWA 2IF4A 4Y6CA 3CQGB 4BTAA 1JCQA 3PUKA 3QC1A 3E4BA 5FQ7A 3UM2A 3O48A 4G8LA 3LY7A 2DCPA 2XENA 4PH4B 4HQDA 4APOA 3KSLA 5FZRA 3ZHEA 2PQNA 3SI5A 4ATZD 5EDSA 1KPSB 4D10C 3SFXA 1WAO1 1OWNA 4N2SA 2Y0BG 4XZ4A 5T8IA 2EIME 1N9AA 4ZHBA 4A3TA 3JXIA 5CCLA 2LSUA 3Q47B 4YVOA 1N52A 4U8VD 2BKGA 3GW4A 2R03A 4N3CA 2FI7A 3Q75A 4G23A 4B0ZA 3UT8A 4CDRA 1FVHA 5EN5D 1FPPA 4OVVA 3SGHA 2R17C 3Q15A 4GA0A 1OCZE 2BEDA 1D8EA 5KJLA 4LNUD 3ZVVA 3ZEFA 5KWDA 1BI7B 1DVPA 2I9CA 1KT1A 3R9MA 2WXFA 3G2WA 4DX1A 3L13A 1S63A 3APFA 4A1SA 4RSYA 4I2WA 4WUYA 3FTVA 4A1GA 4YDOA 4CT4A 4F53A 1RW2A 4AV7A 3UMVA 3FUKA 3FTXA 1B89A 3T5VA 3T8KA 5JMND 1AP7A 3LDZA 3GZ2A 3PZ1A 1HU3A 4I9EA 4AIFA 5FQ6A 5D0OD 4HVBA 3CHOA 3D9MA 5ENPD 5B1AE 3FUEA 4XKBA 2JEKA 3V79K 4UI9K 3LY9A 3IBEA 2XZTG 3O4ZA 1DC2A 3CHPA 1IHBA 2M63A 3FEYA 3AAAC 3Q79A 4DUIA 1UN9A 5FZQA 3EU5A 3PS6A 3D9LA 3PNTB 2CFZA 4BY6A 4FLHA 4AEZC 1MX2A 1QZ2A 3LVQE 4L2LA 4DPRA 4B89A 2LNIA 5CBNA 5AQ7A 1DCEA 3APDA 2VSNA 2ZU6B 1TEZA 2J07A 4JL0A 1WY6A 4UWFA 4XEIG 1V55E 5EIDA 3HIZA 3ZXPA 2X3MA 3X2QE 4HOTA 3FUHA 4G24A 3QDNA 4GPMA 4HBDA 5EX0A 1HZ4A 4ILGA 1E90A 5G55A 5A6CA 4G11A 3U64A 1ZU2A 1TN8A 3E37A 1Y6IA 1OT8A 2GRRB 3DSVA 4YDWA 4GZDA 1HFAA 2WM9A 4MS6A 5BNWA 3L17A 5AN8A 3ZRHA 3QWPA 2WMNA 3OXLA 5LX8A 3PZ4A 5A23A 2YNQA 3OXGA 3CVVA 3L54A 2IOLA 2ZGDA 2L0IA 1ZBPA 3TWXA 4EZJA 3ABLE 4J8SA 2LXLA 4OVUA 5FWQA 3ZNGA 2IONA 4HORA 3RAUA 4JA7A 2BF0X 2LAHA 2IU1A 1S0PA 2VGEA 3SFZA 1JWGA 3EIJA 1E7UA 4U7EB 3IEGA 3ASGA 5BW8C 4U0ZA 2V8SE 2KM4A 2VQ2A 3PVLA 4GB9A 3DPDA 2VGYA 1BU9A 1WM5A 2EIJE 3ASNE 4Z68A 5KJKA 3LY8A 5KNHD 5G2NA 3W9FA 3FU6A 5ARGA 2RD0A 4GMRA 4GZCA 4DX7D 1IQUA 3L9TA 3WXXA 3BG1B 4HRNA 4B93B 1EDUA 3CSTA 3ML8A 3AU5A 3DEOA 4CDNA 3ML9A 2YHEA 5AAOA 3Q7AA 3EU9A 2LXMA 3EHRA 3D3MA 2VSOE 5C1DA 4EQFA 1H0AA 2OEVA 3TWWA 2X6JA 3FTYA 2VTBA 3EHMA 4LSZE 5FQ8A 3TL5A 1O5MA 2P9NG 3UIPC 3ASOE 4I1OB 5ENQD 4ILIA 4A63B 4DLQA 4GTTA 5T3RA 4BEPA 4BX9A 1O1SA 3Q5MA 3V30A 2CG3A 4K0RA 3C5RA 4E85A 4BETA 3FTUA 3SBSA 4OYSA 4GU5A 2GRNB 1JCSA 3JQ0A 3FU3A 4TUMA 1HF8A 2QY7A 2HO1A 1N4QA 2BKKB 2WXGA 4HI9A 1KZPA 4HI8A 5G05J 4KT6B 4O1OA 4HS2A 4XX5A 3CVNA 5CEDB 3EUVA 2XHEA 3CK9A 1HH8A 3JXJA 1N4PA 1YYHA 4F1SA 4UWKA 4DX2A 3TWUA 4B94A 3ZYQA 2OVFA 2DYSE 1NA3A 3RRNB 2F8YA 1OUVA 4FLBA 2V5QC 3ONLA 4GPKA 4Q69A 1UW4B 4A3VA 2AXUA 4U63A 1ELRA 2NYJA 1YCSB 1BI8B 3MV3B 1UN8A 2CHWA 1DCQA 3ISMC 4WWPA 3ZW3A 3SBTB 4IRUA 2LUHA 3B7UX 4J7WA 3QAQA 2C0LA 3ASFA 5A7DB 3B13A 4EECA 2AVPA 2DBAA 2XZDG 4GMLA 4AJWA 3ESKA 2BTDA 2R05A 3PEVB 4JHKA 2X6IA 4DK5A 4HNAD 4FJYA 5EILA 4EZKA 2XCCA 3OAWA 5ENRD 4GAAA 4XE0A 5CRVA 4N2QA 4I17A 1H6OA 2KATA 4DRXE 5G04C 2RFMA 3VLFA 3NBNB 3U3WA 5M72A 1OXJA 3D9PA 3G2VA 3APCA 4DX5D 3Q78A 2RKKA 4CRWA 5JJTA 3CHMA 1IKND 4F7AA 1NL4A 3MZLB 3P1UA 4EHMA 2QYJA 5IY5E 3ZYKA 1XGWA 2QYUA 4LG6A 2IEJA 2H6GA 2ZXWE 2J08A 4G25A 2MOWA 3KAEA 4XIFA 2QZAA 4IYPA 1OCRE 2F37A 2Y3AA 4I6GA 3CQCB 3TG4A 4I6JA 3MYVA 5CEAA 5FTPA 5DBKA 5BV1A 1TNZA 3CVQA 4L2YA 3CVUA 2DYRE 3RSEG 5LCWC 1TNOA 3JUEA 4R7LA 3SF4A 4ATGA 1Q2ZA 5LCWJ 3LJ3A 4GYWA 2XQ0A 2FO7A 2WXJA 3E34A 3B7RL 2YQ8A 5BXOA 3CEQA 1Y8MA 3TWVA 5BPPA 4J8DA 3CK8A 3Q9NC 4JD2G 1ELWA 5ITZF 2WXLA 1N11A 4CGWA 2LAIA 3URZA 2NC9A 4JXTA 2QFCA 4GYOA 3RRMB 4PS7A 3D9KA 3NAWA 3NF1A 3SNXA 2OOEA 4JB8P 2OVBA 4YDEA 3UX4A 5ENTD 3CGHA 1N54A 5CMWA 5BT1A 4FU3A 4AP2A 2VYIA 4JPSA 2KZTB 2KBXA 1E8WA 4YNDA 3DEPA 1UJKA 1H2UA 2GRQB 2P9SG 3L08A 3FTSA 1QYMA 5ENOD 3K9IA 3BQOA 2X6FA 4JA9A 4LNBA 4ILHB 3C98A 3LVRE 1X5BA 2ZIRA 3AS4A 4WAFA 4X8QA 3R9AB 2L0TB 2PL2A 2PQRA 5BUZA 4TXPA 4LRZA 3NB2A 3ULQA 3I4GA 3CV0A 5KJNA 3CVWA 4NACA 2PM7A 2X6KA 4ME2A 4QQIA 2Y69E 4OAVB 2A5UA 4QFVA 4K5AB 1JWFA 3NOGD 2FO1E 3SQVA 4HXIA 4J8YA 2KXPC 1N95A 1HG2A 4J0UA 1Z6TA 1WDYA 4CEMA 2UY1B 3FDHA 5AJLA 4IULA 3V2XA 2X38A 3KD7A 4M7CA 3Q4AB 4RLYA 3MGBA 3AJIA 3QOUA 1H19A 3HYMB 4KBQA 2EILE 4TRQA 4PS3A 1LD7A 3IXEA 1QBQA 1A5EA 3R7QA 1MJ0A 4BFRA 4YVQC 2XRYA 3W9GA 4HLEA 3TWRA 3MJWA 4XI0A 3ZYLA 5LOZA 1TR4A 1D8DA 2GRLA 4CZ2D 4C0MA 4BWRA 3QJZA 3MEKA 3DSUA 4NQ0A 5CBOA 3CHSA 2OEWA 3Q73A 1SQMA 4DJAA 3HDXA 4G1TA 3GYZA 3FEXA 1SZAA 4Q94A 4U0UA 4ANVA 3TAXA 3DPYA 2PZIA 4Q96A 5CHEE 4Y6WA 3MKRA 2R02A 3IKOB 1IQRA 1LTXA 1V54E 3SHFA 2I1KA 2XPIA 3JUIA 5ENNA 3T5XA 1MX6A 3RK6A 3ESLA 4ABNA 1P5QA 3T8MA 3PZ3A 4U04A 2EQXA 5CMYA 3CVPA 3UUXA 2DWZA 2XCBA 3SFYA 3EDTB 2LSVA 2B6CA 3TXMA 3DSSA 4G2VA 2P2CP 4O60A 2VJ8A 1HX8A 3JQ1A 4MRUA 4U95D 4N3AA 3B7TA 5AARA 3LYAA 4L23A 1HO8A 2XPZA 3UT7A 3S7FA 5AENA 4BSZB 3FUMA 1U2VG 2XEEA 4GMJA 5CECB 2AXZA 4JVSA 3LPZA 3CIAA 3FP3A 4GZ5A 4FJZA 4E6HA 1FCHA 5FINA 1YA0A 3OTNA 5AQBA 1MHQA 3U66A 2L6JA 3Q49B 1O1RA 3S7BA 2KCKA 3UM3A 2XS1A 3FH7A 2WXRA 1INZA 1AWCB 3L82A 2IQCA 4UQYA 3I5PA 1IHGA 4DLOA 4JZYA 5AQAA 2VSXE 2ONDA 4U8HA 3PUJA 1E7VA 3OXFA 3B7SA 2HYZA 1H2VC 2V5FA 2AWIA 1G3NB 5HS0A 2Y4TA 3G2SA 3TGOA 5HI7A 1OWMA 4WWOA 3LEWA 2F8XK 3AS5A 4WNGA 2WXMA 1OWPA 4I2ZA 4I1MA 4PS8A 3B95A 1E8ZA 4APFA 3IHYA 1O1TA 3ULYA 4UI9C 1TN6A 5FQ4A 2CFUA 5LP0A 1NP7A 4A55A 2J09A 2JABA 3BG0B 4UI9J 4N5QA 3FH5A 5T4YA 2I1JA 4B8CB 4EBAA 3FUDA 4ANXA 1N4SA 2FBNA 2PM6A 2HR2A 4KVOA 4RQIA 2B0OE 3HRAA 3NZUA 3J5PA 3RO2A 5BV0A 2WXNA 3VLDA 3FUJA 4HOUA
chains in the Genus database with same CATH topology
4HVBA 2KCLA 4I6JA 3CHOA 3D9MA 2IJGX 1H2TC 3MYVA 3FUEA 4XKBA 4G26A 2KZTA 1GW6A 3RU0A 2XEVA 1PC2A 2JEKA 1E8XA 4UI9K 3LY9A 3EJNA 3ENEA 3IBEA 3O4ZA 2UWJG 2AW6A 2J9QA 1NZNA 4K03A 2VSYA 3CHPA 3FHEA 3ZYMA 4L7TA 5FTPA 4C0EA 2M63A 3FEYA 1H6KA 3FWVA 2V4LA 3D9IA 5DBKA 5BV1A 3MV2B 1UN9A 3MKQA 4WNEA 2VGXB 5FZQA 1QNFA 4AVXA 5KJMA 3CVQA 4L2YA 3CVUA 3PS6A 3D9LA 3PNTB 2CFZA 4BY6A 4FLHA 1U3CA 2Y4UA 4AEZC 1QZ2A 4UQXA 3VTXA 3LVQE 4L2LA 4DPRA 5LCWC 4B89A 2LNIA 4N3BA 3D9NA 4GZ6A 4R7LA 5JHAA 3SF4A 3ASHA 3L22A 4EBAG 4ATGA 3APDA 3CLJA 4P29A 4HOQA 4N39A 5ANLA 4FC8A 4JEHA 5JJ7A 2VSNA 5LCWJ 2ZU6B 3LJ3A 2J07A 2XQ0A 4GYWA 2FO7A 2WXJA 4JL0A 1TEZA 2LO6A 3B7RL 4FADA 1WY6A 2YQ8A 3CEQA 1Y8MA 2DIWA 4JEUA 4KMOA 3ZIMA 5BPPA 4UWFA 1Z3XA 3UPVA 5AJDA 3VTYA 2A4ZA 4XKCA 3PDNA 4J8DA 2WPVA 3CK8A 3CSFA 3HIZA 2XRZA 1ELWA 3S7JA 1QQEA 2X3MA 2WXLA 3JCKC 3TG5A 3FULA 4HOTA 2KC7A 3FUHA 3PREA 3ZGQA 2X6HA 4CGWA 2LAIA 4G24A 1KT0A 4AY5A 3CHQA 3URZA 1L5JA 2NC9A 3GZSA 2QFCA 3QDNA 4GYOA 4JXTA 3CR3A 3RRMB 4BX8A 1PAQA 4PS7A 2J4BA 3LKUA 4FHKA 3D9KA 5EX0A 4ANUA 3NF1A 1HZ4A 3HVEA 4ILGA 4J8FA 1E90A 5G55A 4EPZA 4RVBA 4G11A 3JYSA 4GCOA 4HFGA 4JC8A 4KZ0A 3SNXA 2OOEA 3U64A 1EF1C 1ZU2A 2OVBA 3UX4A 3NZSA 1W3BA 1E96B 4GZ3A 1Y6IA 1Z3YA 4AY6A 3CGHA 4J8EA 1E8YA 2XGOA 3PZDA 1N54A 1PY1A 5CMWA 4ACLA 4GZDA 2IOSA 1HFAA 5G04J 2WM9A 5BT1A 4MS6A 5BNWA 3L17A 4FU3A 4AP2A 3S2AA 2VYIA 3ZRHA 4JPSA 3TXNA 2NSZA 2WMNA 3QWPA 3OXLA 2KZTB 2J49A 2MHKA 2OV8A 1E8WA 2UY1A 3FUNA 5CCMA 5LX8A 4YNDA 5A23A 3ZPJA 3IHVA 2YNQA 1TJFA 3AS8A 4AOFA 2XPYA 3OXGA 4URKA 3CVVA 3PE4A 3L54A 1UJKA 2IOLA 1H2UA 2L0IA 3MKQB 2GGFA 3QWWA 4ANWA 4KVMA 5G05C 3LXUX 3RRUA 1ZBPA 4BT8A 4EZJA 4J8SA 4OVUA 1IYGA 5FWQA 3L08A 3FTSA 3D9OA 3MA5A 1HS6A 2IONA 4WNDA 4HORA 3K9IA 2X6FA 4JA9A 1NA0A 4JA7A 1XNFA 2ILRA 2BF0X 1HE8A 2LAHA 4KZCA 2IU1A 1S0PA 2MRIA 4I6EA 2FF4A 1UG3A 2WXIA 3PH0C 3SFZA 1JWGA 3SZ7A 4ILHB 2FEZA 3C98A 3LVRE 1DNPA 3EIJA 4EZLA 4FA6A 1E7UA 1X5BA 3AS4A 3IEGA 2WQ7A 4WAFA 5JJ6A 4FP7A 3R9AB 4WNFA 2L0TB 3ASGA 3LCAA 5BW8C 4U0ZA 2PL2A 2PQRA 4BTBA 5BUZA 2V8SE 2KM4A 2VQ2A 3I4RB 3PVLA 4LRZA 5DIZA 4GB9A 3CVXA 3DPDA 2VGYA 3U4TA 3ULQA 2AXVA 5EKQD 2VTBB 1WM5A 5J90A 1ELKA 3I4GA 3CV0A 2NXPA 4UWHA 2IFUA 1U3DA 5KJNA 3DBSA 3CVWA 4NACA 5AIJA 2PM7A 2C2LA 4LCTA 2X6KA 4GCNA 3LY8A 4JW1A 3FFLA 5KJKA 3FTZA 4ME2A 3HVEB 3RIBA 5J08A 2A5UA 3QARA 4QFVA 5LFAA 1BPOA 1JWFA 5G2NA 4L1BA 3FU6A 4RG6A 4I1AA 4JHRA 4B8AA 5ARGA 2RD0A 4HXIA 3P2BA 4WWNA 3VLEA 1VDYA 4CCAA 4GZCA 4KXKB 3KS2A 1IQUA 3WXXA 1HG2A 3BG1B 4AM9A 4J0UA 1Z6TA 1EDUA 4CEMA 3CSTA 3ML8A 3AU5A 4H7XA 2YINA 4GYYA 4CDNA 2WQ6A 3ML9A 3KEZA 2RG8A 2WXQA 5A6CA 2UY1B 3LS8A 3QK0A 2YHEA 3FDHA 5AJLA 4CT0A 2Q7FA 4IULA 1JPLA 4CDMA 2C0MA 5ARFA 2HM8A 2X38A 3KD7A 3Q4AB 4FHJA 3MGBA 3QNKA 2JLBA 3D3MA 4PDXA 2VSOE 3RKVA 5C1DA 1UJJA 3EIQC 1H0AA 1H19A 3HYMB 3N71A 3QOUA 5EX3A 2BUGA 4EQFA 4KBQA 3RO3A 3FUFA 2X6JA 3FTYA 4TRQA 3MCXA 2VTBA 4GA1A 4PS3A 3EHMA 3D9JA 3TJPA 3QKYA 1MQSA 2WXKA 5ANRA 4I43A 5FQ8A 3R7QA 1EPUA 4BFRA 3QWVA 4YVQC 3TL5A 2GRMA 3I3NA 2XRYA 4I1OB 3UT4A 4ILIA 1OWLA 3FU0A 4DLQA 4HLEA 3PRZA 3MJWA 5T3RA 4MKTA 4XI0A 3MX3A 5LOZA 3ZYLA 4BX9A 1TJCA 2XGMA 4LUNU 3ZFWA 3Q5MA 4BT9A 4U0SA 2GRLA 4C0MA 4NRHB 4BWRA 3QJZA 3PNLB 4UWGA 2WMOA 2CG3A 3MEKA 4IN3B 4K0RA 3CKBA 4I9CA 4NQ0A 3ZXSA 4E85A 3EHNA 3CHSA 3FTUA 3SBSA 1A17A 1JUQA 3L16A 4OYSA 1SQMA 4GU5A 5FJYA 3SD5A 2WXHA 4DJAA 4KYOB 3HDXA 4G1TA 3GYZA 3JQ0A 4PUCA 4W9RA 3FY4A 3FU3A 2P58C 3FEXA 3FU5A 4XI9A 3U9WA 1SZAA 4RG9A 1HF8A 2QY7A 2HO1A 3CVYA 2WXGA 1EYHA 4Q94A 4U0UA 4ANVA 3IV0A 3TAXA 3S7DA 2PZIA 2CHXA 4Q96A 5CHEE 2J4DA 4Y6WA 3G2TA 3MKRA 4LEUA 1FVFA 5G05J 5D0QD 2WXOA 3AU4A 1IQRA 3IKOB 4KT6B 3QB2A 4H7YA 2I2OA 4JHJA 3SHFA 3CKCA 3GZ1A 2I1KA 4HS2A 3NQPA 2XPIA 3JUIA 4MLPA 4NURA 4XX5A 5C2YA 4U07A 3CVNA 5ENNA 3T5XA 2IF4A 3RK6A 4UWLA 4Y6CA 3ESLA 4ABNA 1P5QA 2WQHA 3T8MA 4U04A 2FULA 2XHEA 3CQGB 2EQXA 4BTAA 5CMYA 3CK9A 1HH8A 3CVPA 3UUXA 5E76A 2XCBA 3PUKA 3QC1A 3E4BA 3EDTB 2LSVA 4O6FA 5FQ7A 2CHZA 3O48A 3LY7A 3TXMA 2DCPA 4F1SA 4G2VA 4UWKA 2VJ8A 1HX8A 4AXHA 4TUUA 4PH4B 5HQ8A 4APOA 3JQ1A 4MRUA 4N3AA 4HOSA 4UQZA 3B7TA 3LYAA 2I6HA 4B94A 4L23A 5FZRA 2YHCA 2OVFA 3ZYQA 3ZHEA 2PQNA 1HO8A 1NA3A 5KCMA 3RRNB 2XPZA 3UT7A 3S7FA 5AENA 4FLBA 1OUVA 3FUMA 3SI5A 2WXPA 5AYWD 3CK7A 4M3OA 3ONLA 4GPKA 4Q69A 3ASDA 1UW4B 4A3VA 5EDSA 2CG2A 4GMJA 4D10C 2AXZA 4TV3A 4JVSA 2R59A 2AXUA 3LPZA 4U63A 3CHRA 1WAO1 3L6AA 1OWNA 1ELRA 4N2SA 3CIAA 3FP3A 4GZ5A 5E75A 1LF8A 4XZ4A 5T8IA 4FJZA 4E6HA 3MV3B 1UN8A 4C9BB 1FCHA 2XGSA 1YA0A 3OTNA 2CHWA 4WWPA 3ZW3A 3SBTB 5FZSA 4IRUA 1MHQA 3U66A 2L6JA 2R5SA 3FTWA 3Q49B 3B7UX 3QAQA 5FT9A 2KCVA 2WVIA 1HG5A 4A3TA 3S7BA 2C0LA 3ASFA 5A7DB 3B13A 4CGVA 2KCKA 5CCLA 2LSUA 3Q47B 4EECA 4YVOA 2AVPA 3FH7A 2DBAA 2WXRA 4DI4A 1N52A 2V0PA 4GMLA 4AJWA 1INZA 3ESKA 3ONKA 1SZ9A 2BTDA 3PEVB 4JHKA 4J6IA 2X6IA 4DK5A 3GW4A 2IQCA 4N5CA 4UQYA 3I5PA 4FJYA 4N3CA 3R7RA 2FI7A 1IHGA 4G23A 2XCCA 4DLOA 4F3VA 4JZYA 4EZKA 5JHBA 2VSXE 3OAWA 2ONDA 2E0IA 4GAAA 4U8HA 3UT8A 4B0ZA 3PUJA 1E7VA 4XE0A 4CDRA 1FVHA 4N2QA 3OXFA 4OVVA 4V3IA 3SGHA 2R17C 3PEUB 4I17A 3Q15A 3BEEA 3B7SA 2HYZA 1H2VC 4GA0A 4ACKA 2V5FA 4LERA 5KJLA 2AWIA 2KATA 2GW1A 2VGXA 5G04C 3ZVVA 3FUIA 3VLFA 3ZEFA 3G2UA 2Y4TA 4FULA 3U3WA 1DVPA 3G2SA 3UQ3A 5M72A 2I9CA 1KT1A 3TGOA 5HI7A 1OWMA 2WXFA 3G2WA 4BSXA 4WWOA 3ZHEB 3D9PA 3L13A 3LEWA 3G2VA 1OWOA 3PE3A 3AS5A 3APCA 3APFA 4WNGA 2WXMA 1OWPA 4I2ZA 4I1MA 4PS8A 4A1SA 1HXIA 4RSYA 1E8ZA 4I2WA 4WUYA 3FTVA 4CRWA 4A1GA 5JJTA 4APFA 3CHMA 3IHYA 4F7AA 4GA2A 4CT4A 4F53A 2L9BA 2E2EA 3UMVA 4AV7A 4UI9C 3FUKA 3FTXA 1KLXA 3MZLB 3P1UA 5FQ4A 2CFUA 5LP0A 1NP7A 1B89A 4A55A 3T5VA 3CVLA 2J09A 3BG0B 3ZYKA 4UI9J 3ZN3A 3FH5A 5T4YA 1XGWA 2I1JA 4B8CB 4EBAA 3LDZA 3GZ2A 3FUDA 3FH8A 4DI3A 4ANXA 2J08A 2FBNA 2PM6A 4G25A 2MOWA 1HU3A 4I9EA 2WB2A 2HR2A 3KAEA 4XIFA 4AIFA 4KVOA 5FQ6A 5D0OD 4IYPA 3NZUA 2Y3AA 3RJVA 3RO2A 2WXNA 5BV0A 4I6GA 3CQCB 3VLDA 3TG4A 3FUJA 4HOUA 3HHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCL A;  4G26 A;  3RU0 A;  2XEV A;  1PC2 A;  4UI9 K;  3LY9 A;  2UWJ G;  2J9Q A;  1NZN A;  2VSY A;  5FTP A;  3FWV A;  5DBK A;  3MV2 B;  4WNE A;  5FZQ A;  2VGX B;  5KJM A;  3CVQ A;  2Y4U A;  1QZ2 A;  4UQX A;  3VTX A;  5LCW C;  2LNI A;  4N3B A;  4GZ6 A;  3SF4 A;  3ASH A;  4HOQ A;  4N39 A;  5JJ7 A;  2VSN A;  5LCW J;  4GYW A;  2FO7 A;  4JL0 A;  2YQ8 A;  3CEQ A;  1Y8M A;  3UPV A;  3VTY A;  3PDN A;  4J8D A;  2WPV A;  3CK8 A;  1ELW A;  3S7J A;  1QQE A;  3TG5 A;  4HOT A;  2KC7 A;  3ZGQ A;  4CGW A;  4G24 A;  1KT0 A;  4AY5 A;  3URZ A;  2NC9 A;  3QDN A;  2QFC A;  4GYO A;  3LKU A;  5EX0 A;  3NF1 A;  1HZ4 A;  4J8F A;  5A6C A;  3JYS A;  4GCO A;  2OOE A;  1ZU2 A;  1W3B A;  1E96 B;  4GZ3 A;  4AY6 A;  4J8E A;  2XGO A;  5G04 J;  5BT1 A;  5BNW A;  2VYI A;  3QWP A;  3OXL A;  2MHK A;  2UY1 A;  5CCM A;  4YND A;  3ZPJ A;  3AS8 A;  3OXG A;  3PE4 A;  3QWW A;  5G05 C;  1ZBP A;  4BT8 A;  1IYG A;  3MA5 A;  4WND A;  4HOR A;  3K9I A;  4JA9 A;  1NA0 A;  4JA7 A;  1XNF A;  2FF4 A;  3SZ7 A;  2FEZ A;  3AS4 A;  3IEG A;  5JJ6 A;  3R9A B;  4WNF A;  3ASG A;  3LCA A;  5BW8 C;  4U0Z A;  2PL2 A;  2PQR A;  4BTB A;  2VQ2 A;  5DIZ A;  2VGY A;  3U4T A;  3ULQ A;  5EKQ D;  1WM5 A;  3CV0 A;  2IFU A;  5KJN A;  2C2L A;  4GCN A;  5KJK A;  3LY8 A;  3FFL A;  4ME2 A;  3RIB A;  4RG6 A;  4I1A A;  4JHR A;  5ARG A;  4KXK B;  3KS2 A;  3WXX A;  4AM9 A;  4J0U A;  4H7X A;  4GYY A;  2UY1 B;  2Q7F A;  2C0M A;  5ARF A;  3KD7 A;  3Q4A B;  2JLB A;  3RKV A;  5C1D A;  3QOU A;  5EX3 A;  3HYM B;  4EQF A;  3N71 A;  2BUG A;  4KBQ A;  3RO3 A;  4GA1 A;  3QKY A;  3QWV A;  4YVQ C;  4XI0 A;  1TJC A;  2XGM A;  3ZFW A;  3Q5M A;  4BT9 A;  4U0S A;  4NRH B;  4BWR A;  3MEK A;  4IN3 B;  3CKB A;  4I9C A;  4NQ0 A;  1A17 A;  5FJY A;  4KYO B;  4G1T A;  3GYZ A;  4W9R A;  2P58 C;  4XI9 A;  4RG9 A;  2HO1 A;  4U0U A;  3TAX A;  3S7D A;  2PZI A;  5CHE E;  4Y6W A;  3MKR A;  4LEU A;  5G05 J;  5D0Q D;  4H7Y A;  3CKC A;  3GZ1 A;  2XPI A;  4U07 A;  3CVN A;  2IF4 A;  4Y6C A;  4ABN A;  1P5Q A;  2WQH A;  4U04 A;  4BTA A;  3CK9 A;  1HH8 A;  3CVP A;  3UUX A;  2XCB A;  3E4B A;  3EDT B;  2LSV A;  4O6F A;  3O48 A;  3LY7 A;  4G2V A;  5HQ8 A;  4APO A;  4N3A A;  4HOS A;  4UQZ A;  3LYA A;  2I6H A;  4B94 A;  5FZR A;  2YHC A;  3ZHE A;  2PQN A;  1NA3 A;  3S7F A;  1OUV A;  5AYW D;  3CK7 A;  4GPK A;  3ASD A;  3LPZ A;  1WAO 1;  1ELR A;  4N2S A;  3FP3 A;  4GZ5 A;  3MV3 B;  1FCH A;  2XGS A;  1YA0 A;  5FZS A;  2L6J A;  2R5S A;  3Q49 B;  5FT9 A;  2KCV A;  3S7B A;  2C0L A;  3ASF A;  5A7D B;  4CGV A;  2KCK A;  5CCL A;  2LSU A;  3Q47 B;  4YVO A;  2AVP A;  2DBA A;  3ESK A;  3GW4 A;  4UQY A;  4N5C A;  4N3C A;  4F3V A;  2FI7 A;  1IHG A;  4G23 A;  2XCC A;  2OND A;  4CDR A;  4N2Q A;  3OXF A;  4I17 A;  3Q15 A;  3BEE A;  2HYZ A;  4GA0 A;  2V5F A;  5KJL A;  2KAT A;  2GW1 A;  2VGX A;  5G04 C;  2Y4T A;  3U3W A;  3UQ3 A;  5M72 A;  1KT1 A;  3TGO A;  5HI7 A;  3ZHE B;  3PE3 A;  3AS5 A;  4WNG A;  4I2Z A;  4A1S A;  1HXI A;  4I2W A;  4WUY A;  5JJT A;  4GA2 A;  2E2E A;  4UI9 C;  1KLX A;  1B89 A;  3CVL A;  4UI9 J;  3ZN3 A;  3GZ2 A;  2FBN A;  4G25 A;  4I9E A;  2HR2 A;  3KAE A;  4XIF A;  4AIF A;  5D0O D;  3RJV A;  3RO2 A;  3TG4 A;  4HOU A; 
#chains in the Genus database with same CATH topology
 2KCL A;  3HXB A;  3KEA A;  2IJG X;  1H2T C;  5EIB E;  2KZT A;  1GW6 A;  2XEH A;  3RU0 A;  1PC2 A;  4L9P A;  3ENE A;  2VSY A;  3ZYM A;  4L7T A;  4C0E A;  3FWV A;  2V4L A;  3D9I A;  4WNE A;  2VGX B;  1QNF A;  4AVX A;  5KJM A;  3ABK E;  2Y4U A;  3D9N A;  4GZ6 A;  5JHA A;  2IY0 C;  3L22 A;  3UKR G;  4EBA G;  3CLJ A;  4N39 A;  5ANL A;  4JEH A;  5JJ7 A;  2LO6 A;  4FAD A;  2IO2 C;  4GTV A;  4JEU A;  4KMO A;  3ZIM A;  4HRL A;  2A4Z A;  3C3Q A;  3PDN A;  1YMP A;  2ZIS A;  3CSF A;  3JCK C;  3FUL A;  2KC7 A;  3ZGQ A;  4TXR A;  4AY5 A;  1KT0 A;  3GZS A;  3CR3 A;  4BX8 A;  1PAQ A;  3LKU A;  4ANU A;  4J8F A;  4EPZ A;  4GCO A;  4JC8 A;  1W3B A;  1Z3Y A;  4AY6 A;  4J8E A;  1E8Y A;  2XGO A;  3PZD A;  4ZFH A;  1PY1 A;  4ACL A;  5G04 J;  4CYM D;  3S2A A;  3TXN A;  4BES A;  2MHK A;  2OV8 A;  2UY1 A;  3D9H A;  3UXG A;  5CCM A;  3IHV A;  3AS8 A;  4URK A;  4GTO A;  1LD8 A;  3MKQ B;  2GGF A;  3QWW A;  4ANW A;  4BT8 A;  5JA4 D;  3BU8 A;  3MA5 A;  1HS6 A;  2P9P G;  1NA0 A;  4KZC A;  1XNF A;  2ILR A;  4OAU C;  2FF4 A;  4YDY A;  2WXI A;  4HB5 A;  3SZ7 A;  2FEZ A;  4FA6 A;  1SA5 A;  1Z5S C;  3UIO C;  5CER B;  4FP7 A;  3LCA A;  4BTB A;  3I4R B;  3U4T A;  2AXV A;  2VTB B;  5J90 A;  1ELK A;  3LJN A;  2NXP A;  2IFU A;  1X81 A;  5AIJ A;  5KBA A;  4LCT A;  4GCN A;  4JW1 A;  3RIB A;  3HVE B;  2EIN E;  5J08 A;  3QAR A;  4I1A A;  4JHR A;  4B8A A;  3ULE G;  4CCA A;  1VDY A;  2AJA A;  4KXK B;  3T9K A;  2YIN A;  4GYY A;  2WQ6 A;  3ZKJ A;  3KEZ A;  2RG8 A;  2WXQ A;  3LS8 A;  3QK0 A;  1TYQ G;  2Q7F A;  2P9K G;  1JPL A;  2C0M A;  1BLX B;  5ARF A;  3UI2 A;  2HM8 A;  3HXC A;  4FHJ A;  4UUC A;  4PDX A;  2H6F A;  3AG3 E;  1JCR A;  3RO3 A;  3FUF A;  4K5B A;  2OCC E;  4GTS A;  3D9J A;  1MQS A;  4I43 A;  1IXV A;  3QWV A;  3I3N A;  1OWL A;  3E30 A;  3WG7 E;  2ETB A;  3FU0 A;  3V2O A;  4O1P A;  1MYO A;  3MX3 A;  2PNN A;  1TJC A;  2XGM A;  3HXF A;  3ZFW A;  1UOH A;  4BT9 A;  4NRH B;  3UTM A;  3CKB A;  3PZ2 A;  4I9C A;  1S70 B;  2A5E A;  3L16 A;  1TN7 A;  2WXH A;  1OY3 D;  4F6R D;  4W9R A;  3EHQ A;  3FU5 A;  1OCO E;  3U9W A;  3IV0 A;  3B7B A;  2CHX A;  2J4D A;  4LEU A;  3HXD A;  2I2O A;  3GZ1 A;  4MLP A;  4NUR A;  5C2Y A;  4U07 A;  1N94 A;  3AG1 E;  4UWL A;  3J5Q B;  2WQH A;  2FUL A;  3DXK G;  5E76 A;  4O6F A;  2CHZ A;  3ZUV B;  3E32 A;  1OCC E;  4BER A;  4AXH A;  4TUU A;  5HQ8 A;  3NOC D;  4HOS A;  4GTQ A;  4UQZ A;  2I6H A;  2YHC A;  5KCM A;  3TWQ A;  5EYL A;  4K5C A;  2WXP A;  5AYW D;  3CK7 A;  4G8K A;  4M3O A;  3E33 A;  2GRP B;  3ASD A;  2CG2 A;  5D2M C;  4TV3 A;  3DST A;  2R59 A;  2DZO A;  3CHR A;  3L6A A;  3DSW A;  3ZU7 B;  5E75 A;  1LF8 A;  4C9B B;  2XGS A;  2DZN A;  4TXQ A;  2ETA A;  4GTR A;  5FZS A;  2R5S A;  3FTW A;  5FT9 A;  2KCV A;  2WVI A;  1HG5 A;  5B1B E;  4CGV A;  1MZC A;  4DI4 A;  2V0P A;  3DSX A;  3ONK A;  1SZ9 A;  2ZGG A;  4J6I A;  4N5C A;  3R7R A;  4F3V A;  1N4R A;  5JHB A;  2E0I A;  2R2L A;  2GRO B;  4V3I A;  3PEU B;  3BEE A;  4ACK A;  3AG4 E;  4LER A;  3Q7F A;  2GW1 A;  2F0Y A;  2VGX A;  3FUI A;  4DX6 D;  3G2U A;  1TNB A;  4FUL A;  3UQ3 A;  2P9I G;  2IO3 C;  4BSX A;  3ZHE B;  3PE3 A;  1OWO A;  1HXI A;  1D9S A;  4GA2 A;  3ABM E;  2L9B A;  2E2E A;  1KLX A;  3CVL A;  1SW6 A;  3ZN3 A;  2XS8 A;  1ZB1 A;  3C3O A;  4DI3 A;  3FH8 A;  2HE0 A;  2WB2 A;  1WG0 A;  5AQ9 A;  3RJV A;  3HHM A;  4G26 A;  3HG0 D;  2XEV A;  1KZO A;  1E8X A;  3EJN A;  3UM1 A;  2UWJ G;  2AW6 A;  2J9Q A;  1NZN A;  4K03 A;  3FHE A;  1H6K A;  3MV2 B;  3MKQ A;  1MX4 A;  1U3C A;  4GTM A;  4UQX A;  3VTX A;  2MYO A;  3V31 A;  4HRM B;  5HKP A;  4N3B A;  3DWL G;  3ASH A;  2L6B A;  4P29 A;  4HOQ A;  4FC8 A;  5BXU A;  3DXM G;  2QC9 A;  4U8Y D;  2DIW A;  1K1B A;  1Z3X A;  3UM0 A;  1NFI E;  3UPV A;  5AJD A;  3VTY A;  4XKC A;  2WPV A;  2XRZ A;  3S7J A;  1QQE A;  4GTP A;  3TG5 A;  3PRE A;  3Q9U C;  2X6H A;  3CHQ A;  1L5J A;  3HXE A;  2J4B A;  4FHK A;  5EYP F;  3HVE A;  5KNG A;  4RVB A;  4HFG A;  3JYS A;  4KZ0 A;  1RZ4 A;  1EF1 C;  3NZS A;  1E96 B;  4GZ3 A;  3SO8 A;  1K8K G;  2IOS A;  3SY2 A;  2NSZ A;  2V4H C;  4C48 B;  1K3Z D;  2J49 A;  3FUN A;  1SVX A;  3ZPJ A;  1TJF A;  1K1A A;  4AOF A;  2XPY A;  3PE4 A;  1BD8 A;  3C3R A;  2P9L G;  2P9U G;  2RFA A;  4KVM A;  5G05 C;  3LXU X;  3RRU A;  1IYG A;  3D9O A;  4MBG A;  4WND A;  3KSQ A;  3F6Q A;  1HE8 A;  2ETC A;  2MRI A;  1S64 A;  4I6E A;  1UG3 A;  5CRU A;  3PH0 C;  4EZL A;  1DNP A;  2J8S D;  5H7P A;  2WQ7 A;  5JJ6 A;  4WNF A;  1H6P A;  3DRA A;  4LNG A;  3UKU G;  5DIZ A;  3CVX A;  4HLL A;  2EIK E;  5EKQ D;  4UWH A;  1U3D A;  3DBS A;  2Y1L E;  1NI1 A;  2C2L A;  4F1P A;  3FFL A;  3FTZ A;  5LFA A;  2H6I A;  1BPO A;  4L1B A;  4RG6 A;  1SA4 A;  3P2B A;  4WWN A;  3VLE A;  5HRY A;  3KS2 A;  1FT1 A;  4AM9 A;  4H7X A;  3AG2 E;  4CT0 A;  4CDM A;  3QNK A;  2JLB A;  3RKV A;  1UJJ A;  3EIQ C;  5EX3 A;  3TWT A;  3N71 A;  1TNY A;  2BUG A;  3MCX A;  4GA1 A;  3TJP A;  3QKY A;  2WXK A;  5ANR A;  5FIO A;  1EPU A;  2GRM A;  3UT4 A;  3PRZ A;  4MKT A;  1FT2 A;  4LUN U;  4U0S A;  3UIN C;  3PNL B;  4UWG A;  2WMO A;  4IN3 B;  3TWS A;  3ZXS A;  3EHN A;  1A17 A;  1JUQ A;  4NIK A;  5FJY A;  3SD5 A;  5D66 A;  4KYO B;  3C72 A;  1N0R A;  4PUC A;  4U96 D;  3FY4 A;  2P58 C;  1N0Q A;  4XI9 A;  4RG9 A;  3CVY A;  1EYH A;  3S7D A;  5ENS D;  1TNU A;  5B3S E;  2H6H A;  3G2T A;  1FVF A;  5D0Q D;  2WXO A;  3AU4 A;  3QB2 A;  4H7Y A;  4JHJ A;  3CKC A;  3NQP A;  3BUA A;  2DVW A;  2IF4 A;  4Y6C A;  3CQG B;  4BTA A;  1JCQ A;  3PUK A;  3QC1 A;  3E4B A;  5FQ7 A;  3UM2 A;  3O48 A;  4G8L A;  3LY7 A;  2DCP A;  2XEN A;  4PH4 B;  4HQD A;  4APO A;  3KSL A;  5FZR A;  3ZHE A;  2PQN A;  3SI5 A;  4ATZ D;  5EDS A;  1KPS B;  4D10 C;  3SFX A;  1WAO 1;  1OWN A;  4N2S A;  2Y0B G;  4XZ4 A;  5T8I A;  2EIM E;  1N9A A;  4ZHB A;  4A3T A;  3JXI A;  5CCL A;  2LSU A;  3Q47 B;  4YVO A;  1N52 A;  4U8V D;  2BKG A;  3GW4 A;  2R03 A;  4N3C A;  2FI7 A;  3Q75 A;  4G23 A;  4B0Z A;  3UT8 A;  4CDR A;  1FVH A;  5EN5 D;  1FPP A;  4OVV A;  3SGH A;  2R17 C;  3Q15 A;  4GA0 A;  1OCZ E;  2BED A;  1D8E A;  5KJL A;  4LNU D;  3ZVV A;  3ZEF A;  5KWD A;  1BI7 B;  1DVP A;  2I9C A;  1KT1 A;  3R9M A;  2WXF A;  3G2W A;  4DX1 A;  3L13 A;  1S63 A;  3APF A;  4A1S A;  4RSY A;  4I2W A;  4WUY A;  3FTV A;  4A1G A;  4YDO A;  4CT4 A;  4F53 A;  1RW2 A;  4AV7 A;  3UMV A;  3FUK A;  3FTX A;  1B89 A;  3T5V A;  3T8K A;  5JMN D;  1AP7 A;  3LDZ A;  3GZ2 A;  3PZ1 A;  1HU3 A;  4I9E A;  4AIF A;  5FQ6 A;  5D0O D;  4HVB A;  3CHO A;  3D9M A;  5ENP D;  5B1A E;  3FUE A;  4XKB A;  2JEK A;  3V79 K;  4UI9 K;  3LY9 A;  3IBE A;  2XZT G;  3O4Z A;  1DC2 A;  3CHP A;  1IHB A;  2M63 A;  3FEY A;  3AAA C;  3Q79 A;  4DUI A;  1UN9 A;  5FZQ A;  3EU5 A;  3PS6 A;  3D9L A;  3PNT B;  2CFZ A;  4BY6 A;  4FLH A;  4AEZ C;  1MX2 A;  1QZ2 A;  3LVQ E;  4L2L A;  4DPR A;  4B89 A;  2LNI A;  5CBN A;  5AQ7 A;  1DCE A;  3APD A;  2VSN A;  2ZU6 B;  1TEZ A;  2J07 A;  4JL0 A;  1WY6 A;  4UWF A;  4XEI G;  1V55 E;  5EID A;  3HIZ A;  3ZXP A;  2X3M A;  3X2Q E;  4HOT A;  3FUH A;  4G24 A;  3QDN A;  4GPM A;  4HBD A;  5EX0 A;  1HZ4 A;  4ILG A;  1E90 A;  5G55 A;  5A6C A;  4G11 A;  3U64 A;  1ZU2 A;  1TN8 A;  3E37 A;  1Y6I A;  1OT8 A;  2GRR B;  3DSV A;  4YDW A;  4GZD A;  1HFA A;  2WM9 A;  4MS6 A;  5BNW A;  3L17 A;  5AN8 A;  3ZRH A;  3QWP A;  2WMN A;  3OXL A;  5LX8 A;  3PZ4 A;  5A23 A;  2YNQ A;  3OXG A;  3CVV A;  3L54 A;  2IOL A;  2ZGD A;  2L0I A;  1ZBP A;  3TWX A;  4EZJ A;  3ABL E;  4J8S A;  2LXL A;  4OVU A;  5FWQ A;  3ZNG A;  2ION A;  4HOR A;  3RAU A;  4JA7 A;  2BF0 X;  2LAH A;  2IU1 A;  1S0P A;  2VGE A;  3SFZ A;  1JWG A;  3EIJ A;  1E7U A;  4U7E B;  3IEG A;  3ASG A;  5BW8 C;  4U0Z A;  2V8S E;  2KM4 A;  2VQ2 A;  3PVL A;  4GB9 A;  3DPD A;  2VGY A;  1BU9 A;  1WM5 A;  2EIJ E;  3ASN E;  4Z68 A;  5KJK A;  3LY8 A;  5KNH D;  5G2N A;  3W9F A;  3FU6 A;  5ARG A;  2RD0 A;  4GMR A;  4GZC A;  4DX7 D;  1IQU A;  3L9T A;  3WXX A;  3BG1 B;  4HRN A;  4B93 B;  1EDU A;  3CST A;  3ML8 A;  3AU5 A;  3DEO A;  4CDN A;  3ML9 A;  2YHE A;  5AAO A;  3Q7A A;  3EU9 A;  2LXM A;  3EHR A;  3D3M A;  2VSO E;  5C1D A;  4EQF A;  1H0A A;  2OEV A;  3TWW A;  2X6J A;  3FTY A;  2VTB A;  3EHM A;  4LSZ E;  5FQ8 A;  3TL5 A;  1O5M A;  2P9N G;  3UIP C;  3ASO E;  4I1O B;  5ENQ D;  4ILI A;  4A63 B;  4DLQ A;  4GTT A;  5T3R A;  4BEP A;  4BX9 A;  1O1S A;  3Q5M A;  3V30 A;  2CG3 A;  4K0R A;  3C5R A;  4E85 A;  4BET A;  3FTU A;  3SBS A;  4OYS A;  4GU5 A;  2GRN B;  1JCS A;  3JQ0 A;  3FU3 A;  4TUM A;  1HF8 A;  2QY7 A;  2HO1 A;  1N4Q A;  2BKK B;  2WXG A;  4HI9 A;  1KZP A;  4HI8 A;  5G05 J;  4KT6 B;  4O1O A;  4HS2 A;  4XX5 A;  3CVN A;  5CED B;  3EUV A;  2XHE A;  3CK9 A;  1HH8 A;  3JXJ A;  1N4P A;  1YYH A;  4F1S A;  4UWK A;  4DX2 A;  3TWU A;  4B94 A;  3ZYQ A;  2OVF A;  2DYS E;  1NA3 A;  3RRN B;  2F8Y A;  1OUV A;  4FLB A;  2V5Q C;  3ONL A;  4GPK A;  4Q69 A;  1UW4 B;  4A3V A;  2AXU A;  4U63 A;  1ELR A;  2NYJ A;  1YCS B;  1BI8 B;  3MV3 B;  1UN8 A;  2CHW A;  1DCQ A;  3ISM C;  4WWP A;  3ZW3 A;  3SBT B;  4IRU A;  2LUH A;  3B7U X;  4J7W A;  3QAQ A;  2C0L A;  3ASF A;  5A7D B;  3B13 A;  4EEC A;  2AVP A;  2DBA A;  2XZD G;  4GML A;  4AJW A;  3ESK A;  2BTD A;  2R05 A;  3PEV B;  4JHK A;  2X6I A;  4DK5 A;  4HNA D;  4FJY A;  5EIL A;  4EZK A;  2XCC A;  3OAW A;  5ENR D;  4GAA A;  4XE0 A;  5CRV A;  4N2Q A;  4I17 A;  1H6O A;  2KAT A;  4DRX E;  5G04 C;  2RFM A;  3VLF A;  3NBN B;  3U3W A;  5M72 A;  1OXJ A;  3D9P A;  3G2V A;  3APC A;  4DX5 D;  3Q78 A;  2RKK A;  4CRW A;  5JJT A;  3CHM A;  1IKN D;  4F7A A;  1NL4 A;  3MZL B;  3P1U A;  4EHM A;  2QYJ A;  5IY5 E;  3ZYK A;  1XGW A;  2QYU A;  4LG6 A;  2IEJ A;  2H6G A;  2ZXW E;  2J08 A;  4G25 A;  2MOW A;  3KAE A;  4XIF A;  2QZA A;  4IYP A;  1OCR E;  2F37 A;  2Y3A A;  4I6G A;  3CQC B;  3TG4 A;  4I6J A;  3MYV A;  5CEA A;  5FTP A;  5DBK A;  5BV1 A;  1TNZ A;  3CVQ A;  4L2Y A;  3CVU A;  2DYR E;  3RSE G;  5LCW C;  1TNO A;  3JUE A;  4R7L A;  3SF4 A;  4ATG A;  1Q2Z A;  5LCW J;  3LJ3 A;  4GYW A;  2XQ0 A;  2FO7 A;  2WXJ A;  3E34 A;  3B7R L;  2YQ8 A;  5BXO A;  3CEQ A;  1Y8M A;  3TWV A;  5BPP A;  4J8D A;  3CK8 A;  3Q9N C;  4JD2 G;  1ELW A;  5ITZ F;  2WXL A;  1N11 A;  4CGW A;  2LAI A;  3URZ A;  2NC9 A;  4JXT A;  2QFC A;  4GYO A;  3RRM B;  4PS7 A;  3D9K A;  3NAW A;  3NF1 A;  3SNX A;  2OOE A;  4JB8 P;  2OVB A;  4YDE A;  3UX4 A;  5ENT D;  3CGH A;  1N54 A;  5CMW A;  5BT1 A;  4FU3 A;  4AP2 A;  2VYI A;  4JPS A;  2KZT B;  2KBX A;  1E8W A;  4YND A;  3DEP A;  1UJK A;  1H2U A;  2GRQ B;  2P9S G;  3L08 A;  3FTS A;  1QYM A;  5ENO D;  3K9I A;  3BQO A;  2X6F A;  4JA9 A;  4LNB A;  4ILH B;  3C98 A;  3LVR E;  1X5B A;  2ZIR A;  3AS4 A;  4WAF A;  4X8Q A;  3R9A B;  2L0T B;  2PL2 A;  2PQR A;  5BUZ A;  4TXP A;  4LRZ A;  3NB2 A;  3ULQ A;  3I4G A;  3CV0 A;  5KJN A;  3CVW A;  4NAC A;  2PM7 A;  2X6K A;  4ME2 A;  4QQI A;  2Y69 E;  4OAV B;  2A5U A;  4QFV A;  4K5A B;  1JWF A;  3NOG D;  2FO1 E;  3SQV A;  4HXI A;  4J8Y A;  2KXP C;  1N95 A;  1HG2 A;  4J0U A;  1Z6T A;  1WDY A;  4CEM A;  2UY1 B;  3FDH A;  5AJL A;  4IUL A;  3V2X A;  2X38 A;  3KD7 A;  4M7C A;  3Q4A B;  4RLY A;  3MGB A;  3AJI A;  3QOU A;  1H19 A;  3HYM B;  4KBQ A;  2EIL E;  4TRQ A;  4PS3 A;  1LD7 A;  3IXE A;  1QBQ A;  1A5E A;  3R7Q A;  1MJ0 A;  4BFR A;  4YVQ C;  2XRY A;  3W9G A;  4HLE A;  3TWR A;  3MJW A;  4XI0 A;  3ZYL A;  5LOZ A;  1TR4 A;  1D8D A;  2GRL A;  4CZ2 D;  4C0M A;  4BWR A;  3QJZ A;  3MEK A;  3DSU A;  4NQ0 A;  5CBO A;  3CHS A;  2OEW A;  3Q73 A;  1SQM A;  4DJA A;  3HDX A;  4G1T A;  3GYZ A;  3FEX A;  1SZA A;  4Q94 A;  4U0U A;  4ANV A;  3TAX A;  3DPY A;  2PZI A;  4Q96 A;  5CHE E;  4Y6W A;  3MKR A;  2R02 A;  3IKO B;  1IQR A;  1LTX A;  1V54 E;  3SHF A;  2I1K A;  2XPI A;  3JUI A;  5ENN A;  3T5X A;  1MX6 A;  3RK6 A;  3ESL A;  4ABN A;  1P5Q A;  3T8M A;  3PZ3 A;  4U04 A;  2EQX A;  5CMY A;  3CVP A;  3UUX A;  2DWZ A;  2XCB A;  3SFY A;  3EDT B;  2LSV A;  2B6C A;  3TXM A;  3DSS A;  4G2V A;  2P2C P;  4O60 A;  2VJ8 A;  1HX8 A;  3JQ1 A;  4MRU A;  4U95 D;  4N3A A;  3B7T A;  5AAR A;  3LYA A;  4L23 A;  1HO8 A;  2XPZ A;  3UT7 A;  3S7F A;  5AEN A;  4BSZ B;  3FUM A;  1U2V G;  2XEE A;  4GMJ A;  5CEC B;  2AXZ A;  4JVS A;  3LPZ A;  3CIA A;  3FP3 A;  4GZ5 A;  4FJZ A;  4E6H A;  1FCH A;  5FIN A;  1YA0 A;  3OTN A;  5AQB A;  1MHQ A;  3U66 A;  2L6J A;  3Q49 B;  1O1R A;  3S7B A;  2KCK A;  3UM3 A;  2XS1 A;  3FH7 A;  2WXR A;  1INZ A;  1AWC B;  3L82 A;  2IQC A;  4UQY A;  3I5P A;  1IHG A;  4DLO A;  4JZY A;  5AQA A;  2VSX E;  2OND A;  4U8H A;  3PUJ A;  1E7V A;  3OXF A;  3B7S A;  2HYZ A;  1H2V C;  2V5F A;  2AWI A;  1G3N B;  5HS0 A;  2Y4T A;  3G2S A;  3TGO A;  5HI7 A;  1OWM A;  4WWO A;  3LEW A;  2F8X K;  3AS5 A;  4WNG A;  2WXM A;  1OWP A;  4I2Z A;  4I1M A;  4PS8 A;  3B95 A;  1E8Z A;  4APF A;  3IHY A;  1O1T A;  3ULY A;  4UI9 C;  1TN6 A;  5FQ4 A;  2CFU A;  5LP0 A;  1NP7 A;  4A55 A;  2J09 A;  2JAB A;  3BG0 B;  4UI9 J;  4N5Q A;  3FH5 A;  5T4Y A;  2I1J A;  4B8C B;  4EBA A;  3FUD A;  4ANX A;  1N4S A;  2FBN A;  2PM6 A;  2HR2 A;  4KVO A;  4RQI A;  2B0O E;  3HRA A;  3NZU A;  3J5P A;  3RO2 A;  5BV0 A;  2WXN A;  3VLD A;  3FUJ A;  4HOU A; 
#chains in the Genus database with same CATH homology
 4HVB A;  2KCL A;  4I6J A;  3CHO A;  3D9M A;  2IJG X;  1H2T C;  3MYV A;  3FUE A;  4XKB A;  4G26 A;  2KZT A;  1GW6 A;  3RU0 A;  2XEV A;  1PC2 A;  2JEK A;  1E8X A;  4UI9 K;  3LY9 A;  3EJN A;  3ENE A;  3IBE A;  3O4Z A;  2UWJ G;  2AW6 A;  2J9Q A;  1NZN A;  4K03 A;  2VSY A;  3CHP A;  3FHE A;  3ZYM A;  4L7T A;  5FTP A;  4C0E A;  2M63 A;  3FEY A;  1H6K A;  3FWV A;  2V4L A;  3D9I A;  5DBK A;  5BV1 A;  3MV2 B;  1UN9 A;  3MKQ A;  4WNE A;  2VGX B;  5FZQ A;  1QNF A;  4AVX A;  5KJM A;  3CVQ A;  4L2Y A;  3CVU A;  3PS6 A;  3D9L A;  3PNT B;  2CFZ A;  4BY6 A;  4FLH A;  1U3C A;  2Y4U A;  4AEZ C;  1QZ2 A;  4UQX A;  3VTX A;  3LVQ E;  4L2L A;  4DPR A;  5LCW C;  4B89 A;  2LNI A;  4N3B A;  3D9N A;  4GZ6 A;  4R7L A;  5JHA A;  3SF4 A;  3ASH A;  3L22 A;  4EBA G;  4ATG A;  3APD A;  3CLJ A;  4P29 A;  4HOQ A;  4N39 A;  5ANL A;  4FC8 A;  4JEH A;  5JJ7 A;  2VSN A;  5LCW J;  2ZU6 B;  3LJ3 A;  2J07 A;  2XQ0 A;  4GYW A;  2FO7 A;  2WXJ A;  4JL0 A;  1TEZ A;  2LO6 A;  3B7R L;  4FAD A;  1WY6 A;  2YQ8 A;  3CEQ A;  1Y8M A;  2DIW A;  4JEU A;  4KMO A;  3ZIM A;  5BPP A;  4UWF A;  1Z3X A;  3UPV A;  5AJD A;  3VTY A;  2A4Z A;  4XKC A;  3PDN A;  4J8D A;  2WPV A;  3CK8 A;  3CSF A;  3HIZ A;  2XRZ A;  1ELW A;  3S7J A;  1QQE A;  2X3M A;  2WXL A;  3JCK C;  3TG5 A;  3FUL A;  4HOT A;  2KC7 A;  3FUH A;  3PRE A;  3ZGQ A;  2X6H A;  4CGW A;  2LAI A;  4G24 A;  1KT0 A;  4AY5 A;  3CHQ A;  3URZ A;  1L5J A;  2NC9 A;  3GZS A;  2QFC A;  3QDN A;  4GYO A;  4JXT A;  3CR3 A;  3RRM B;  4BX8 A;  1PAQ A;  4PS7 A;  2J4B A;  3LKU A;  4FHK A;  3D9K A;  5EX0 A;  4ANU A;  3NF1 A;  1HZ4 A;  3HVE A;  4ILG A;  4J8F A;  1E90 A;  5G55 A;  4EPZ A;  4RVB A;  4G11 A;  3JYS A;  4GCO A;  4HFG A;  4JC8 A;  4KZ0 A;  3SNX A;  2OOE A;  3U64 A;  1EF1 C;  1ZU2 A;  2OVB A;  3UX4 A;  3NZS A;  1W3B A;  1E96 B;  4GZ3 A;  1Y6I A;  1Z3Y A;  4AY6 A;  3CGH A;  4J8E A;  1E8Y A;  2XGO A;  3PZD A;  1N54 A;  1PY1 A;  5CMW A;  4ACL A;  4GZD A;  2IOS A;  1HFA A;  5G04 J;  2WM9 A;  5BT1 A;  4MS6 A;  5BNW A;  3L17 A;  4FU3 A;  4AP2 A;  3S2A A;  2VYI A;  3ZRH A;  4JPS A;  3TXN A;  2NSZ A;  2WMN A;  3QWP A;  3OXL A;  2KZT B;  2J49 A;  2MHK A;  2OV8 A;  1E8W A;  2UY1 A;  3FUN A;  5CCM A;  5LX8 A;  4YND A;  5A23 A;  3ZPJ A;  3IHV A;  2YNQ A;  1TJF A;  3AS8 A;  4AOF A;  2XPY A;  3OXG A;  4URK A;  3CVV A;  3PE4 A;  3L54 A;  1UJK A;  2IOL A;  1H2U A;  2L0I A;  3MKQ B;  2GGF A;  3QWW A;  4ANW A;  4KVM A;  5G05 C;  3LXU X;  3RRU A;  1ZBP A;  4BT8 A;  4EZJ A;  4J8S A;  4OVU A;  1IYG A;  5FWQ A;  3L08 A;  3FTS A;  3D9O A;  3MA5 A;  1HS6 A;  2ION A;  4WND A;  4HOR A;  3K9I A;  2X6F A;  4JA9 A;  1NA0 A;  4JA7 A;  1XNF A;  2ILR A;  2BF0 X;  1HE8 A;  2LAH A;  4KZC A;  2IU1 A;  1S0P A;  2MRI A;  4I6E A;  2FF4 A;  1UG3 A;  2WXI A;  3PH0 C;  3SFZ A;  1JWG A;  3SZ7 A;  4ILH B;  2FEZ A;  3C98 A;  3LVR E;  1DNP A;  3EIJ A;  4EZL A;  4FA6 A;  1E7U A;  1X5B A;  3AS4 A;  3IEG A;  2WQ7 A;  4WAF A;  5JJ6 A;  4FP7 A;  3R9A B;  4WNF A;  2L0T B;  3ASG A;  3LCA A;  5BW8 C;  4U0Z A;  2PL2 A;  2PQR A;  4BTB A;  5BUZ A;  2V8S E;  2KM4 A;  2VQ2 A;  3I4R B;  3PVL A;  4LRZ A;  5DIZ A;  4GB9 A;  3CVX A;  3DPD A;  2VGY A;  3U4T A;  3ULQ A;  2AXV A;  5EKQ D;  2VTB B;  1WM5 A;  5J90 A;  1ELK A;  3I4G A;  3CV0 A;  2NXP A;  4UWH A;  2IFU A;  1U3D A;  5KJN A;  3DBS A;  3CVW A;  4NAC A;  5AIJ A;  2PM7 A;  2C2L A;  4LCT A;  2X6K A;  4GCN A;  3LY8 A;  4JW1 A;  3FFL A;  5KJK A;  3FTZ A;  4ME2 A;  3HVE B;  3RIB A;  5J08 A;  2A5U A;  3QAR A;  4QFV A;  5LFA A;  1BPO A;  1JWF A;  5G2N A;  4L1B A;  3FU6 A;  4RG6 A;  4I1A A;  4JHR A;  4B8A A;  5ARG A;  2RD0 A;  4HXI A;  3P2B A;  4WWN A;  3VLE A;  1VDY A;  4CCA A;  4GZC A;  4KXK B;  3KS2 A;  1IQU A;  3WXX A;  1HG2 A;  3BG1 B;  4AM9 A;  4J0U A;  1Z6T A;  1EDU A;  4CEM A;  3CST A;  3ML8 A;  3AU5 A;  4H7X A;  2YIN A;  4GYY A;  4CDN A;  2WQ6 A;  3ML9 A;  3KEZ A;  2RG8 A;  2WXQ A;  5A6C A;  2UY1 B;  3LS8 A;  3QK0 A;  2YHE A;  3FDH A;  5AJL A;  4CT0 A;  2Q7F A;  4IUL A;  1JPL A;  4CDM A;  2C0M A;  5ARF A;  2HM8 A;  2X38 A;  3KD7 A;  3Q4A B;  4FHJ A;  3MGB A;  3QNK A;  2JLB A;  3D3M A;  4PDX A;  2VSO E;  3RKV A;  5C1D A;  1UJJ A;  3EIQ C;  1H0A A;  1H19 A;  3HYM B;  3N71 A;  3QOU A;  5EX3 A;  2BUG A;  4EQF A;  4KBQ A;  3RO3 A;  3FUF A;  2X6J A;  3FTY A;  4TRQ A;  3MCX A;  2VTB A;  4GA1 A;  4PS3 A;  3EHM A;  3D9J A;  3TJP A;  3QKY A;  1MQS A;  2WXK A;  5ANR A;  4I43 A;  5FQ8 A;  3R7Q A;  1EPU A;  4BFR A;  3QWV A;  4YVQ C;  3TL5 A;  2GRM A;  3I3N A;  2XRY A;  4I1O B;  3UT4 A;  4ILI A;  1OWL A;  3FU0 A;  4DLQ A;  4HLE A;  3PRZ A;  3MJW A;  5T3R A;  4MKT A;  4XI0 A;  3MX3 A;  5LOZ A;  3ZYL A;  4BX9 A;  1TJC A;  2XGM A;  4LUN U;  3ZFW A;  3Q5M A;  4BT9 A;  4U0S A;  2GRL A;  4C0M A;  4NRH B;  4BWR A;  3QJZ A;  3PNL B;  4UWG A;  2WMO A;  2CG3 A;  3MEK A;  4IN3 B;  4K0R A;  3CKB A;  4I9C A;  4NQ0 A;  3ZXS A;  4E85 A;  3EHN A;  3CHS A;  3FTU A;  3SBS A;  1A17 A;  1JUQ A;  3L16 A;  4OYS A;  1SQM A;  4GU5 A;  5FJY A;  3SD5 A;  2WXH A;  4DJA A;  4KYO B;  3HDX A;  4G1T A;  3GYZ A;  3JQ0 A;  4PUC A;  4W9R A;  3FY4 A;  3FU3 A;  2P58 C;  3FEX A;  3FU5 A;  4XI9 A;  3U9W A;  1SZA A;  4RG9 A;  1HF8 A;  2QY7 A;  2HO1 A;  3CVY A;  2WXG A;  1EYH A;  4Q94 A;  4U0U A;  4ANV A;  3IV0 A;  3TAX A;  3S7D A;  2PZI A;  2CHX A;  4Q96 A;  5CHE E;  2J4D A;  4Y6W A;  3G2T A;  3MKR A;  4LEU A;  1FVF A;  5G05 J;  5D0Q D;  2WXO A;  3AU4 A;  1IQR A;  3IKO B;  4KT6 B;  3QB2 A;  4H7Y A;  2I2O A;  4JHJ A;  3SHF A;  3CKC A;  3GZ1 A;  2I1K A;  4HS2 A;  3NQP A;  2XPI A;  3JUI A;  4MLP A;  4NUR A;  4XX5 A;  5C2Y A;  4U07 A;  3CVN A;  5ENN A;  3T5X A;  2IF4 A;  3RK6 A;  4UWL A;  4Y6C A;  3ESL A;  4ABN A;  1P5Q A;  2WQH A;  3T8M A;  4U04 A;  2FUL A;  2XHE A;  3CQG B;  2EQX A;  4BTA A;  5CMY A;  3CK9 A;  1HH8 A;  3CVP A;  3UUX A;  5E76 A;  2XCB A;  3PUK A;  3QC1 A;  3E4B A;  3EDT B;  2LSV A;  4O6F A;  5FQ7 A;  2CHZ A;  3O48 A;  3LY7 A;  3TXM A;  2DCP A;  4F1S A;  4G2V A;  4UWK A;  2VJ8 A;  1HX8 A;  4AXH A;  4TUU A;  4PH4 B;  5HQ8 A;  4APO A;  3JQ1 A;  4MRU A;  4N3A A;  4HOS A;  4UQZ A;  3B7T A;  3LYA A;  2I6H A;  4B94 A;  4L23 A;  5FZR A;  2YHC A;  2OVF A;  3ZYQ A;  3ZHE A;  2PQN A;  1HO8 A;  1NA3 A;  5KCM A;  3RRN B;  2XPZ A;  3UT7 A;  3S7F A;  5AEN A;  4FLB A;  1OUV A;  3FUM A;  3SI5 A;  2WXP A;  5AYW D;  3CK7 A;  4M3O A;  3ONL A;  4GPK A;  4Q69 A;  3ASD A;  1UW4 B;  4A3V A;  5EDS A;  2CG2 A;  4GMJ A;  4D10 C;  2AXZ A;  4TV3 A;  4JVS A;  2R59 A;  2AXU A;  3LPZ A;  4U63 A;  3CHR A;  1WAO 1;  3L6A A;  1OWN A;  1ELR A;  4N2S A;  3CIA A;  3FP3 A;  4GZ5 A;  5E75 A;  1LF8 A;  4XZ4 A;  5T8I A;  4FJZ A;  4E6H A;  3MV3 B;  1UN8 A;  4C9B B;  1FCH A;  2XGS A;  1YA0 A;  3OTN A;  2CHW A;  4WWP A;  3ZW3 A;  3SBT B;  5FZS A;  4IRU A;  1MHQ A;  3U66 A;  2L6J A;  2R5S A;  3FTW A;  3Q49 B;  3B7U X;  3QAQ A;  5FT9 A;  2KCV A;  2WVI A;  1HG5 A;  4A3T A;  3S7B A;  2C0L A;  3ASF A;  5A7D B;  3B13 A;  4CGV A;  2KCK A;  5CCL A;  2LSU A;  3Q47 B;  4EEC A;  4YVO A;  2AVP A;  3FH7 A;  2DBA A;  2WXR A;  4DI4 A;  1N52 A;  2V0P A;  4GML A;  4AJW A;  1INZ A;  3ESK A;  3ONK A;  1SZ9 A;  2BTD A;  3PEV B;  4JHK A;  4J6I A;  2X6I A;  4DK5 A;  3GW4 A;  2IQC A;  4N5C A;  4UQY A;  3I5P A;  4FJY A;  4N3C A;  3R7R A;  2FI7 A;  1IHG A;  4G23 A;  2XCC A;  4DLO A;  4F3V A;  4JZY A;  4EZK A;  5JHB A;  2VSX E;  3OAW A;  2OND A;  2E0I A;  4GAA A;  4U8H A;  3UT8 A;  4B0Z A;  3PUJ A;  1E7V A;  4XE0 A;  4CDR A;  1FVH A;  4N2Q A;  3OXF A;  4OVV A;  4V3I A;  3SGH A;  2R17 C;  3PEU B;  4I17 A;  3Q15 A;  3BEE A;  3B7S A;  2HYZ A;  1H2V C;  4GA0 A;  4ACK A;  2V5F A;  4LER A;  5KJL A;  2AWI A;  2KAT A;  2GW1 A;  2VGX A;  5G04 C;  3ZVV A;  3FUI A;  3VLF A;  3ZEF A;  3G2U A;  2Y4T A;  4FUL A;  3U3W A;  1DVP A;  3G2S A;  3UQ3 A;  5M72 A;  2I9C A;  1KT1 A;  3TGO A;  5HI7 A;  1OWM A;  2WXF A;  3G2W A;  4BSX A;  4WWO A;  3ZHE B;  3D9P A;  3L13 A;  3LEW A;  3G2V A;  1OWO A;  3PE3 A;  3AS5 A;  3APC A;  3APF A;  4WNG A;  2WXM A;  1OWP A;  4I2Z A;  4I1M A;  4PS8 A;  4A1S A;  1HXI A;  4RSY A;  1E8Z A;  4I2W A;  4WUY A;  3FTV A;  4CRW A;  4A1G A;  5JJT A;  4APF A;  3CHM A;  3IHY A;  4F7A A;  4GA2 A;  4CT4 A;  4F53 A;  2L9B A;  2E2E A;  3UMV A;  4AV7 A;  4UI9 C;  3FUK A;  3FTX A;  1KLX A;  3MZL B;  3P1U A;  5FQ4 A;  2CFU A;  5LP0 A;  1NP7 A;  1B89 A;  4A55 A;  3T5V A;  3CVL A;  2J09 A;  3BG0 B;  3ZYK A;  4UI9 J;  3ZN3 A;  3FH5 A;  5T4Y A;  1XGW A;  2I1J A;  4B8C B;  4EBA A;  3LDZ A;  3GZ2 A;  3FUD A;  3FH8 A;  4DI3 A;  4ANX A;  2J08 A;  2FBN A;  2PM6 A;  4G25 A;  2MOW A;  1HU3 A;  4I9E A;  2WB2 A;  2HR2 A;  3KAE A;  4XIF A;  4AIF A;  4KVO A;  5FQ6 A;  5D0O D;  4IYP A;  3NZU A;  2Y3A A;  3RJV A;  3RO2 A;  2WXN A;  5BV0 A;  4I6G A;  3CQC B;  3VLD A;  3TG4 A;  3FUJ A;  4HOU A;  3HHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...