3LPZA

Crystal structure of c. therm. get4
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
321
structure length
314
Chain Sequence
NKIERIIARLQRRIAEGQPEEQYEAAQETRLVAARYSKQGNWAAAVDILASVSQTLLRSGQGGSGGDLAVLLVDTFRQAGQRVDGASRGKLLGCLRLFQPGEPVRKRFVKEMIDWSKKFGDYPAGDPELHHVVGTLYVEEGEFEAAEKHLVLGTKESPEVLARMEYEWYKQDESHTAPLYCARAVLPYLLVANVRAANTAYRIFTSALVEDNKGLTVQNIGSAELRIFPSLPLLNFISMLLLSVQKGSPDLFRQLKSKYEANLNELNGIWDTALELIAEMYFGIQRPRQSNPLLDMMGSLFGGGGAALRRIDTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Get4 (YOR164C homolog)
publication title The structure of Get4 reveals an alpha-solenoid fold adapted for multiple interactions in tail-anchored protein biogenesis.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 117
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lpzA01
5BT1A 4EQFA 2QFCA 3CVLA 4RG6A 4AM9A 2PQNA 2XPIA 3CEQA 5KJKA 5ARFA 3N71A 2HO1A 4J8FA 4O6FA 4BWRA 4N2SA 4WNGA 3ASHA 4HOUA 4G26A 3TAXA 2I6HA 3UPVA 3S7DA 2KCVA 3QOUA 4CDRA 2AVPA 5HQ8A 3AS8A 2FF4A 5D0QD 2LSUA 2VGXB 3QWPA 4RG9A 1PC2A 1HH8A 4WNEA 5JJTA 1YA0A 4UI9K 1ZBPA 4HORA 2VGXA 2XCBA 5KJMA 3OXFA 3CV0A 2J9QA 4JA9A 3GZ1A 4F3VA 3MV3B 4GYOA 3LCAA 2KATA 2PL2A 5KJNA 4GYYA 4N5CA 2C0MA 3RJVA 4WNFA 2VQ2A 2XGMA 2FBNA 2LNIA 4APOA 3RO3A 2C0LA 2GW1A 3WXXA 1OUVA 4BT9A 2FEZA 4AY6A 4NQ0A 4GCOA 3EDTB 1A17A 3ASDA 1QQEA 3TGOA 2PZIA 5DIZA 4GCNA 3MV2B 4AY5A 4UI9J 3Q5MA 2YQ8A 4J0UA 4XI0A 4GA0A 5CCMA 4J8DA 1KT1A 3OXGA 3CVNA 2UWJG 3JYSA 4CGVA 3SF4A 4KXKB 1HZ4A 3TG4A 3AS4A 4G25A 5JJ6A 4BT8A 4W9RA 3VTXA 1FCHA 3U3WA 4YNDA 3FP3A 4H7XA 3IEGA 4HOTA 2VSYA 2E2EA 3KS2A 1XNFA 1HXIA 1ELRA 1E96B 2OOEA 3Q47B 4I17A 3ZN3A 4NRHB 2PQRA 4U0UA 1Y8MA 2UY1B 2YHCA 3E4BA 3S7FA 3QWWA 4WNDA 3QKYA 5EKQD 2Y4TA 3CKCA 3OXLA 4B94A 2UY1A 4HOQA 4U0ZA 5KJLA 4I2WA 4BTAA 3Q49B 2WQHA 4UI9C 2KCLA 5BNWA 2VSNA 4N2QA 2XGSA 4UQZA 3CKBA 1ZU2A 4JHRA 3TG5A 1KLXA 2HYZA 1ELWA 5CHEE 1IHGA 5G05C 4GZ5A 3HYMB 2NC9A 2ONDA 5FTPA 2XGOA 4I9EA 5M72A 4H7YA 3S7BA 3ZGQA 2XCCA 3GZ2A 2Q7FA 2IFUA 4U07A 3RIBA 3ESKA 3PDNA 4U0SA 3AS5A 3GYZA 3MA5A 3Q4AB 5FZRA 1W3BA 1TJCA 3ZFWA 4YVQC 4N3BA 4JA7A 1QZ2A 4Y6CA 3O48A 5C1DA 3ASGA 3PE3A 3Q15A 4BTBA 3LY9A 2L6JA 4AIFA 3GW4A 3MEKA 5JJ7A 3LPZA 2KC7A 2WPVA 3KD7A 1P5QA 3PE4A 3UUXA 1WAO1 4N39A 4ME2A 5G05J 3R9AB 5A7DB 4ABNA 1NZNA 5G04C 4I9CA 5ARGA 3LYAA 2LSVA 5D0OD 2BUGA 4I2ZA 2VGYA 4KYOB 4GZ3A 4G24A 3LY7A 4JL0A 2VYIA 3BEEA 3U4TA 4KBQA 3KAEA 5AYWD 3QDNA 3LY8A 3RKVA 4GA2A 1B89A 3ULQA 3RU0A 5A6CA 3FFLA 4XI9A 3RO2A 3LKUA 3K9IA 2R5SA 2HR2A 5LCWJ 2V5FA 5FZSA 2C2LA 4GA1A 5G04J 5CCLA 5FJYA 5EX3A 1KT0A 3ZHEB 3ASFA 4G1TA 5DBKA 1WM5A 4Y6WA 5HI7A 3CK9A 4N3CA 3CK8A 3ZPJA 4CGWA 3CVPA 4IN3B 3ZHEA 2DBAA 3VTYA 2IF4A 2P58C 3NF1A 2FI7A 5FZQA 2JLBA 3CK7A 3CVQA 3URZA 4LEUA 4GZ6A 5BW8C 3QWVA 1NA3A 3FWVA 4HOSA 5FT9A 4WUYA 2Y4UA 2XEVA 1IYGA 4G23A 4GYWA 3S7JA 3SZ7A 2FO7A 5EX0A 4UQXA 2KCKA 4XIFA 4J8EA 4N3AA 4YVOA 4UQYA 4A1SA 4U04A 3MKRA 4I1AA 2MHKA 5LCWC 4GPKA 1NA0A 3UQ3A 4G2VA
chains in the Genus database with same CATH superfamily
5BT1A 3PRZA 3PH0C 3FY4A 2QFCA 4AM9A 1OCRE 3DBSA 5C2YA 3FHEA 2WXGA 3L54A 5B1AE 3AG1E 3ASHA 1TNOA 2XEEA 3UM3A 3TAXA 1IQUA 2I6HA 3ZNGA 4C48B 1JCRA 3QOUA 4X8QA 3PNTB 2R59A 2AVPA 1HO8A 3AS8A 4MKTA 2CG2A 5D0QD 2LSUA 3CHOA 4MLPA 3ZYLA 1HH8A 3GZSA 4KZCA 2WXPA 1FT2A 5AARA 5FQ8A 2WMOA 1JCQA 4DX2A 3E33A 3FUFA 2Y3AA 1N4QA 3FH5A 4PS3A 2H6HA 2J9QA 1BPOA 4GZCA 4GU5A 3B7RL 4CZ2D 5EIDA 1UG3A 2KATA 4LNGA 4N5CA 4DLOA 4N5QA 4WNFA 3FH8A 2VQ2A 2XGMA 5E75A 4HRNA 4CRWA 3ONKA 2XENA 3WXXA 5ENPD 4A3TA 2F8YA 3EIJA 3CHSA 4YDEA 4BT9A 1E8WA 3JXIA 4L2YA 3ULEG 3EDTB 3PZ4A 5AQ9A 5LP0A 3ASDA 1QQEA 2LUHA 2P2CP 4GZDA 1MYOA 2LO6A 4L1BA 3MV2B 3C3OA 3TWUA 2A5EA 3ZIMA 1K1BA 1NP7A 3KEZA 3P1UA 2YQ8A 4J0UA 1INZA 4XI0A 4JVSA 5KNHD 4J8SA 1KT1A 4PDXA 2E0IA 2IY0C 4C0EA 4UUCA 1XGWA 2AXZA 3UIOC 3ZU7B 2UWJG 3T9KA 3SI5A 4HBDA 1UOHA 2Y0BG 3TG4A 3AS4A 4BT8A 2RKKA 1FCHA 1N11A 3JXJA 4YNDA 4HI9A 3IEGA 2VSYA 3KS2A 1ELRA 1E96B 5AJLA 4HLEA 3Q47B 2ZGDA 4L2LA 5ENTD 3ZN3A 2PQRA 2DZNA 4FJYA 4ANWA 4FA6A 1VDYA 3CQCB 2GRRB 2ZXWE 2Y4TA 4B94A 4TRQA 2IJGX 3PEVB 2VSXE 3DEPA 4O60A 4I2WA 1SA4A 4TV3A 2KCLA 3S2AA 5JA4D 2YINA 3EU5A 2XGSA 3CKBA 2QY7A 5KNGA 1OCOE 3DXMG 3C5RA 3J5PA 4A63B 3ZKJA 2L0IA 2AXVA 3TXNA 4ILGA 3ZYKA 4CDMA 4GZ5A 2X3MA 5ENOD 1FT1A 2GGFA 2NYJA 3PUKA 2IONA 2LAIA 3S7BA 2KXPC 3CVYA 3QC1A 1TEZA 3MYVA 3Q73A 2Q7FA 2BF0X 2BKGA 5AENA 3ESKA 3GYZA 3CHRA 3Q4AB 1QNFA 4YVQC 4DRXE 1OWMA 4Y6CA 2X6JA 3TJPA 4BTBA 3UINC 1MX4A 1UW4B 3AU5A 3LVRE 4PH4B 3L82A 1KZPA 2JABA 3LPZA 2P9PG 3UT8A 2DYRE 4AXHA 5AN8A 1TR4A 3R9AB 4ATZD 4C9BB 4ABNA 1NZNA 5G04C 1OWLA 3LYAA 4ANXA 2DIWA 2LXMA 2VGYA 4TXQA 4JHKA 3SBSA 3SD5A 4DI4A 2XRZA 3LY7A 3ENEA 5AQAA 2WXKA 4JL0A 4U95D 4LRZA 3U64A 2WXOA 4IYPA 2L6BA 1H19A 5EDSA 2PNNA 3BQOA 3SFXA 2P9NG 3LKUA 2XRYA 4DUIA 4BX8A 4UWLA 2WXRA 3MJWA 3JCKC 3MX3A 1HS6A 5CCLA 5FJYA 4DLQA 5EX3A 3UKUG 3JQ0A 3ASFA 2XZTG 3B13A 3CHQA 3PNLB 3IXEA 1RW2A 2VSOE 3V31A 5LFAA 5HI7A 3CK8A 2VGEA 4CGWA 1DNPA 1N4SA 2P9SG 4B89A 3VTYA 1N9AA 4TXPA 2P58C 1LTXA 2FI7A 3AAAC 3CVQA 4LEUA 3G2WA 2XHEA 2XPZA 4L9PA 4JHJA 3EHMA 3DSXA 3SZ7A 4BEPA 5EX0A 4UQXA 4GMJA 4ACLA 1BI7B 1UN8A 1OWOA 4YVOA 3UM0A 4U04A 4I1AA 3B7BA 1NA0A 3PUJA 3UQ3A 2DVWA 5EIBE 3BG0B 2GROB 3FUDA 1E8YA 3CEQA 3T8KA 2V5QC 2P9KG 3HHMA 1A5EA 4J8FA 4GTPA 4I6EA 2YHEA 4N2SA 3O4ZA 2WXLA 3C3QA 4HOUA 4G26A 1AWCB 1RZ4A 3FU6A 4BX9A 3UPVA 3P2BA 5HQ8A 4JPSA 2FF4A 3APCA 3JUIA 5AJDA 4U8HA 3DSUA 4WNEA 5KCMA 4FLBA 2ETCA 1E7VA 2DCPA 2J09A 3L13A 3OXFA 4GPMA 4DPRA 5T8IA 3T5VA 4PS7A 1U3CA 3ISMC 1ELKA 4F3VA 2WMNA 4JEUA 4GYOA 2WXNA 1FVFA 5FIOA 3CHMA 4GYYA 3EU9A 2P9LG 2EINE 3RJVA 1E90A 1IXVA 4WAFA 2AJAA 3IV0A 2L0TB 3ZXSA 4CEMA 4I6GA 3HVEB 3FTSA 4APOA 2RFMA 5HS0A 2XEHA 5G2NA 1U3DA 2H6IA 4K0RA 4XX5A 5J90A 4AY6A 2R03A 1HG2A 1G3NB 2BTDA 4RQIA 2H6GA 1S64A 4GCNA 5ANRA 4B93B 2GRQB 4AJWA 4FADA 4I1OB 4E6HA 4UWFA 5AQBA 3RRNB 3MZLB 3Q5MA 3W9GA 5FINA 5ENNA 3ABKE 2Y1LE 3BU8A 2FULA 3OXGA 4CCAA 1JUQA 4IULA 3D9IA 3NOCD 2X6HA 5BV0A 3JYSA 2AWIA 3C98A 2DWZA 2B0OE 4LCTA 1EPUA 5CEAA 4KXKB 1TNBA 2P9IG 4G25A 4EZLA 3PZ1A 3FP3A 1JPLA 4H7XA 1SW6A 4HOTA 3LJ3A 1HXIA 2GRNB 1TYQG 3T8MA 3QAQA 3E30A 2OOEA 1K3ZD 2P9UG 3V2OA 4F6RD 1EYHA 3UM1A 3UIPC 4LSZE 3FU5A 5BUZA 5EN5D 3L22A 4CT0A 4OYSA 4WNDA 3W9FA 3QKYA 3EHNA 3UM2A 5EKQD 3CKCA 2XQ0A 1MX2A 3ZRHA 3BUAA 3FTVA 3G2TA 3SFZA 5KJLA 4PS8A 5EYLA 4UI9C 4FULA 4RVBA 2VSNA 3TWVA 4Q69A 5FQ6A 3IKOB 1D8DA 3CSFA 4UQZA 2R05A 1D8EA 1JWFA 1DCEA 3D9OA 1KLXA 1X81A 4HRMB 2GRMA 3OTNA 3E32A 4EBAA 2J08A 1JCSA 1MJ0A 5CEDB 3PS6A 2NC9A 2ONDA 5FTPA 2XGOA 4I9EA 1Z3XA 3QNKA 4H7YA 3ZGQA 4ILHB 1Q2ZA 4IRUA 3Q78A 3DSTA 2IFUA 4U07A 3RIBA 3PDNA 2IO3C 1N0RA 4RSYA 2V4LA 1NI1A 3G2UA 2WXQA 2WB2A 1BU9A 4JA7A 1QZ2A 5EYPF 4M3OA 4ANVA 3ABLE 2QYJA 3DPYA 5C1DA 3DEOA 3NQPA 3TWWA 4LNBA 1TNYA 4EZJA 2L6JA 1V55E 4AIFA 4FJZA 4GMLA 4XKBA 3MEKA 2WVIA 3KD7A 3CVVA 3FTZA 3ZYMA 4TUMA 2X6IA 1WAO1 3V30A 5G05J 1OT8A 3FEYA 4DX1A 1H6OA 1LD8A 2LSVA 5AAOA 2DZOA 5D0OD 2BUGA 4I2ZA 3BG1B 4GZ3A 2CHZA 4G24A 4EECA 2QC9A 1TNZA 3NBNB 3BEEA 5A23A 1TJFA 5FQ4A 3RAUA 3PVLA 3QDNA 2L9BA 3WG7E 4E85A 4BFRA 3RKVA 2ILRA 2X6FA 1SZ9A 4A55A 3ULQA 1X5BA 2OEVA 4YDYA 3T5XA 3RO2A 4TUUA 4M7CA 2R5SA 2HR2A 2XZDG 4XEIG 3FUHA 4K5AB 5FZSA 5D2MC 2ETAA 1TN8A 4GA1A 4I1MA 4DX5D 1K1AA 3ZHEB 4DI3A 2VTBB 5ENQD 3Q75A 3AG4E 4Y6WA 2J4BA 3AU4A 3I4GA 4YDWA 3EHQA 3HRAA 1N94A 4N3CA 4WWNA 3EUVA 1OCZE 3SHFA 3ZHEA 1BD8A 1LD7A 2VTBA 2V8SE 5FZQA 2MYOA 4K5BA 3UXGA 4J7WA 2YNQA 4HOSA 2R2LA 4CYMD 4WUYA 2Y4UA 2XEVA 3B7SA 2F37A 1IYGA 1OWPA 3LDZA 2WM9A 3HIZA 2ZIRA 2KCKA 4J8EA 4A1SA 1IKND 4MS6A 2J4DA 3MKRA 5HKPA 2F8XK 4G11A 2ZISA 2EIJE 2R17C 3I3NA 2XS8A 4R7LA 4F1PA 4RG6A 1Z5SC 3JUEA 2XPIA 4FHJA 3F6QA 4OAVB 4EHMA 2HO1A 4BWRA 3IHVA 4Q94A 1H6PA 3RK6A 1SVXA 4JW1A 4RLYA 1U2VG 3E37A 3S7DA 4QQIA 4JZYA 3X2QE 4F7AA 1FPPA 1H2UA 4FU3A 5CERB 1SA5A 1BI8B 4F53A 4O1OA 2XPYA 2VGXB 4HXIA 1PC2A 4URKA 5JJTA 3DRAA 1YA0A 4UI9K 3EJNA 1HE8A 1EDUA 3V79K 2VGXA 5KJMA 3FUJA 4JA9A 2CFUA 2A5UA 4P29A 2EIME 3APFA 5E76A 4O1PA 2OVBA 3MV3B 3FEXA 4JXTA 4EPZA 2PM7A 1HU3A 4HFGA 3MKQB 4HI8A 1N95A 4AEZC 2H6FA 2R02A 4AVXA 4JD2G 2GW1A 1MZCA 3L08A 3D9JA 2QZAA 4FP7A 4DX6D 2WXIA 1H0AA 3MKQA 4NQ0A 3D9LA 3KSLA 4GCOA 3Q7FA 1L5JA 4BSZB 2CFZA 3TGOA 5IY5E 1FVHA 3SO8A 4AY5A 4MRUA 3OAWA 4G8KA 4UI9J 4ATGA 3CR3A 3FUNA 2BKKB 4HNAD 4GTOA 4LNUD 3ASNE 3FDHA 1ZB1A 3UI2A 1H2TC 3C72A 2IOLA 3SF4A 1HZ4A 5BPPA 5BXOA 5JJ6A 4W9RA 3VTXA 3UX4A 3E34A 3EHRA 3HXDA 1D9SA 1XNFA 2WXJA 2X38A 3J5QB 1QYMA 3ZUVB 3UT4A 4NRHB 2UY1B 4HB5A 3Q9UC 4AP2A 4XZ4A 4KVOA 4NURA 3PREA 3ULYA 3DSVA 3OXLA 2UY1A 4HOQA 4U0ZA 3SNXA 2GRLA 1S70B 4UWHA 4ANUA 1N0QA 3LVQE 2WQ6A 4EZKA 3RRMB 5T3RA 2B6CA 4V3IA 2IU1A 2HYZA 1ELWA 3TWXA 5AIJA 3AG2E 1IHGA 5H7PA 1QBQA 4ACKA 2CHWA 1N54A 2EQXA 3NOGD 3AG3E 4PUCA 3HVEA 1OWNA 2RD0A 4BESA 4AV7A 3B95A 4YDOA 2WXFA 4ZHBA 1DCQA 1W3BA 4U8YD 3ZFWA 1AP7A 4GTVA 2WQ7A 2WXMA 4N3BA 3C3RA 5CMWA 3O48A 3CVUA 3MGBA 3LJNA 3GW4A 2KC7A 2WPVA 3UTMA 4HS2A 3RSEG 1O5MA 1P5QA 1OY3D 3PE4A 3UUXA 4XKCA 5LOZA 5B1BE 2F0YA 5JHAA 2NXPA 2OV8A 4I9CA 3L16A 4UWGA 2PM6A 1E8ZA 3L6AA 2IO2C 3AJIA 3G2SA 1S63A 5CBOA 1HF8A 1SQMA 4JC8A 1LF8A 2VYIA 3U4TA 4KBQA 3KAEA 4LG6A 4L7TA 1H2VC 2ZGGA 3LY8A 1OXJA 3QJZA 3D9HA 4GA2A 2FO1E 1BLXB 4U63A 1B89A 4GTTA 4XE0A 3UMVA 3FFLA 4XI9A 3NAWA 4GTRA 2V5FA 2C2LA 2VJ8A 5KWDA 2MRIA 5G04J 2OCCE 4DK5A 1KT0A 3V2XA 5J08A 4G1TA 2A4ZA 3Q79A 1WM5A 4HVBA 3TWRA 1UJJA 2IEJA 3R7RA 3CK9A 2LXLA 3LS8A 3ZPJA 4K5CA 3CVPA 3L17A 4IN3B 4APFA 5T4YA 2IF4A 3NB2A 1N52A 2JLBA 3CK7A 2J07A 4OVUA 3URZA 3FTXA 3DSWA 4GZ6A 5BW8C 2KZTB 3QWVA 3HDXA 1Z6TA 3R7QA 2ZU6B 5FT9A 4JEHA 2CG3A 5BXUA 4G23A 4GYWA 4KVMA 4ILIA 2KZTA 4XIFA 4B8CB 2J49A 1YCSB 3HG0D 5D66A 2MHKA 5LCWC 1YMPA 3U66A 3CQGB 3LEWA 1KPSB 5ITZF 4EQFA 4K03A 5HRYA 1IHBA 3CLJA 3CVLA 5CECB 2PQNA 3VLFA 5KJKA 5ARFA 3N71A 4O6FA 2OVFA 2RG8A 3CHPA 4KMOA 4GAAA 5FWQA 5CRUA 3VLDA 4WNGA 1NL4A 3FUIA 2AW6A 2KCVA 1MHQA 4CDRA 1UN9A 2MOWA 3ZEFA 4JB8P 3QWPA 4RG9A 3CSTA 3FH7A 1TNUA 1ZBPA 4GTQA 3U9WA 1E8XA 3LXUX 2XCBA 5CBNA 4HORA 5ENRD 3CV0A 3ZYQA 1EF1C 1TN6A 3KEAA 1KZOA 3GZ1A 5KJNA 3LCAA 2PL2A 3SGHA 2C0MA 4I43A 4Q96A 4C0MA 2FBNA 2LNIA 3RO3A 4LUNU 2C0LA 3FU3A 3QARA 1OUVA 2LAHA 2FEZA 3TXMA 3CIAA 3IHYA 1A17A 1O1TA 3FTYA 3JQ1A 4HQDA 4WWOA 2V4HC 2PZIA 5CMYA 5DIZA 1E7UA 3UT7A 4BY6A 3ESLA 4Z68A 3ABME 3R9MA 3PZ3A 3TWTA 4KZ0A 1MX6A 2GRPB 4A1GA 4GA0A 5CCMA 3FTWA 4J8DA 3CGHA 4AOFA 3HXCA 2ETBA 1HG5A 4A3VA 3CVNA 2CHXA 3DSSA 4CGVA 5EILA 1OCCE 1WY6A 1N4PA 2IOSA 1PAQA 3FUEA 3U3WA 5KBAA 2E2EA 5LX8A 4KT6B 4NIKA 4I17A 2AXUA 4U0UA 1Y8MA 2YHCA 3E4BA 4U8VD 3CVWA 3KSQA 2V0PA 3ZVVA 3S7FA 3QWWA 4CDNA 3SQVA 3HXFA 2NSZA 3APDA 5G55A 3NZUA 4ZFHA 3FULA 4CT4A 2BEDA 1JWGA 3SY2A 3DPDA 4BTAA 3Q49B 2WQHA 5BNWA 3PEUB 4N2QA 4HLLA 4OVVA 4BETA 4DX7D 3Q7AA 1ZU2A 4JHRA 3CVXA 3TG5A 5BV1A 4J8YA 3D9MA 2KBXA 3D9PA 5CHEE 2I1KA 1YYHA 3Q9NC 5JMND 3FU0A 4GB9A 2Y69E 1DVPA 2WXHA 5G05C 4BERA 3HYMB 2I1JA 4QFVA 1K8KG 3ML9A 5M72A 3PZDA 1PY1A 2XCCA 3GZ2A 3L9TA 4B0ZA 1GW6A 4U0SA 4B8AA 3AS5A 4EBAG 4BSXA 3MA5A 5FZRA 4UWKA 1TJCA 5B3SE 1N4RA 5ANLA 2KM4A 5CRVA 5ENSD 4GMRA 2JEKA 3ASGA 3PE3A 3Q15A 3ONLA 5JHBA 3LY9A 2DYSE 4TXRA 5JJ7A 4U7EB 2HE0A 3VLEA 4U96D 2OEWA 3ZXPA 3ML8A 3D3MA 2J8SD 2M63A 4N39A 4ME2A 4WWPA 2QYUA 3HXEA 1Y6IA 5A7DB 3FUKA 2EILE 5ARGA 3D9KA 1MQSA 3I4RB 1Z3YA 4KYOB 5FQ7A 2HM8A 4G8LA 3NZSA 4FHKA 3IBEA 3SBTB 3HXBA 3SFYA 4L23A 4J6IA 4MBGA 4NACA 5AYWD 3FTUA 2RFAA 4I6JA 3QK0A 4OAUC 3RRUA 3RU0A 2XS1A 5A6CA 3PZ2A 3K9IA 4GTMA 3B7TA 1WDYA 3TWSA 5LCWJ 3TWQA 1SZAA 4FLHA 3UKRG 3G2VA 4DJAA 1IQRA 4LERA 3B7UX 2I9CA 2EIKE 5DBKA 2I2OA 3TL5A 1HFAA 3DXKG 1O1SA 2IQCA 1O1RA 3QB2A 2DBAA 1NFIE 3NF1A 4D10C 3I5PA 3FUMA 4FC8A 1NA3A 3EIQC 3FWVA 3MCXA 1WG0A 3DWLG 3ZW3A 1V54E 1TN7A 1S0PA 2X6KA 3S7JA 4HRLA 3D9NA 2FO7A 1HX8A 4N3AA 4GTSA 1UJKA 3ASOE 4UQYA 1H6KA 4F1SA 4GPKA 5AQ7A 4G2VA 1DC2A
chains in the Genus database with same CATH topology
5BT1A 4EQFA 4K03A 4R7LA 3PRZA 3CLJA 3PH0C 3FY4A 2QFCA 3BG0B 3CVLA 4RG6A 4AM9A 3FUDA 2PQNA 2XPIA 4FHJA 3VLFA 1E8YA 3CEQA 3DBSA 5ARFA 5KJKA 3HHMA 3N71A 2HO1A 4J8FA 4O6FA 5C2YA 2OVFA 3FHEA 2RG8A 4BWRA 3IHVA 3CHPA 4I6EA 2YHEA 4GAAA 4KMOA 3O4ZA 4N2SA 2WXGA 3L54A 2WXLA 5FWQA 4Q94A 3VLDA 4WNGA 3ASHA 4HOUA 3RK6A 4G26A 4JW1A 3TAXA 3FUIA 1IQUA 2I6HA 3FU6A 4BX9A 3S7DA 3UPVA 4JZYA 2AW6A 2KCVA 3QOUA 4F7AA 3PNTB 1H2UA 1MHQA 4CDRA 2R59A 2AVPA 3P2BA 5HQ8A 1HO8A 3AS8A 4JPSA 4FU3A 1UN9A 2MOWA 4MKTA 4F53A 3ZEFA 2FF4A 2CG2A 3APCA 2LSUA 5D0QD 2XPYA 3CHOA 3JUIA 4MLPA 5AJDA 2VGXB 3QWPA 4HXIA 4RG9A 3ZYLA 1PC2A 1HH8A 4U8HA 3GZSA 4KZCA 3CSTA 2WXPA 4WNEA 1YA0A 5FQ8A 4URKA 5JJTA 3FH7A 2WMOA 4UI9K 5KCMA 4FLBA 1ZBPA 1E7VA 3U9WA 3EJNA 1HE8A 1EDUA 1E8XA 3FUFA 2VGXA 2XCBA 2Y3AA 3LXUX 4HORA 2DCPA 2J09A 3FH5A 3L13A 5KJMA 3FUJA 3OXFA 4DPRA 4PS3A 3CV0A 2J9QA 5T8IA 3ZYQA 1EF1C 3T5VA 4JA9A 4PS7A 1BPOA 4GZCA 1U3CA 2CFUA 2A5UA 4P29A 3APFA 4GU5A 3B7RL 3GZ1A 5E76A 1ELKA 4F3VA 2OVBA 2WMNA 4JEUA 1UG3A 3MV3B 3FEXA 2KATA 2PL2A 1FVFA 2WXNA 3LCAA 3CHMA 4GYOA 4GYYA 4JXTA 3SGHA 4EPZA 4N5CA 2PM7A 4DLOA 2C0MA 3RJVA 1HU3A 4WNFA 3FH8A 2VQ2A 1E90A 3MKQB 4HFGA 4WAFA 4I43A 4Q96A 3IV0A 2XGMA 2L0TB 3ZXSA 4C0MA 4CEMA 2FBNA 2LNIA 4I6GA 3HVEB 3FTSA 5E75A 4AEZC 4APOA 3RO3A 4AVXA 4LUNU 2C0LA 2GW1A 3L08A 3D9JA 4CRWA 5G2NA 3ONKA 1U3DA 4FP7A 3FU3A 3WXXA 2WXIA 4A3TA 1H0AA 3CHSA 3EIJA 3QARA 1OUVA 3MKQA 4K0RA 2LAHA 1E8WA 4XX5A 4BT9A 2FEZA 4L2YA 5J90A 4AY6A 4NQ0A 3D9LA 3TXMA 4GCOA 3EDTB 1L5JA 3CIAA 3IHYA 1A17A 3FTYA 1HG2A 3JQ1A 5LP0A 3ASDA 1QQEA 4WWOA 2BTDA 2CFZA 4GZDA 3TGOA 2PZIA 5CMYA 5DIZA 1E7UA 4GCNA 5ANRA 2LO6A 3UT7A 4L1BA 4BY6A 3MV2B 1FVHA 4AJWA 4FADA 3ESLA 4I1OB 4E6HA 3ZIMA 4AY5A 4UWFA 4MRUA 3OAWA 1NP7A 3RRNB 3KEZA 3MZLB 3Q5MA 4UI9J 3P1UA 4ATGA 2YQ8A 4J0UA 3CR3A 3FUNA 4KZ0A 1INZA 4XI0A 4JVSA 4GA0A 5ENNA 4A1GA 5CCMA 3FTWA 4J8DA 1KT1A 2FULA 3CGHA 3OXGA 4J8SA 4PDXA 4AOFA 4CCAA 3FDHA 2E0IA 1JUQA 4IULA 4C0EA 1XGWA 2AXZA 1HG5A 3D9IA 4A3VA 2X6HA 3CVNA 2UWJG 5BV0A 1H2TC 3SI5A 2CHXA 3JYSA 2AWIA 3C98A 2IOLA 4CGVA 4LCTA 1EPUA 3SF4A 4KXKB 1HZ4A 3TG4A 1WY6A 5BPPA 3AS4A 2IOSA 4G25A 5JJ6A 4BT8A 4W9RA 1PAQA 3VTXA 1FCHA 4EZLA 3FUEA 3U3WA 4YNDA 3FP3A 3UX4A 1JPLA 4H7XA 3IEGA 4HOTA 2VSYA 2E2EA 3LJ3A 3KS2A 1XNFA 1HXIA 1ELRA 2WXJA 1E96B 5AJLA 3T8MA 4HLEA 2X38A 3QAQA 4KT6B 5LX8A 2OOEA 3Q47B 4I17A 4L2LA 2AXUA 3UT4A 3ZN3A 4NRHB 2PQRA 4U0UA 1Y8MA 2UY1B 1EYHA 2YHCA 3FU5A 4FJYA 4ANWA 4AP2A 3E4BA 4XZ4A 4FA6A 5BUZA 3CVWA 1VDYA 3CQCB 2V0PA 3L22A 4KVOA 3ZVVA 4CT0A 3S7FA 3QWWA 4CDNA 4OYSA 4NURA 4WNDA 3QKYA 3EHNA 3PREA 5EKQD 2Y4TA 3CKCA 3OXLA 4B94A 2XQ0A 2NSZA 3APDA 4TRQA 3ZRHA 5G55A 3FTVA 2UY1A 2IJGX 3NZUA 3G2TA 4HOQA 3PEVB 3FULA 4CT4A 2VSXE 4U0ZA 3SNXA 1JWGA 3SFZA 2GRLA 4UWHA 5KJLA 3DPDA 4I2WA 4ANUA 4PS8A 4BTAA 3Q49B 2WQHA 4TV3A 4UI9C 2KCLA 4FULA 5BNWA 4RVBA 2VSNA 3PEUB 4N2QA 4Q69A 5FQ6A 3IKOB 3S2AA 3LVQE 2YINA 3CSFA 4OVVA 2WQ6A 2XGSA 4EZKA 4UQZA 3CKBA 2QY7A 1ZU2A 4JHRA 3RRMB 3CVXA 1JWFA 3TG5A 5BV1A 3D9OA 5T3RA 4V3IA 1KLXA 2IU1A 3D9MA 2HYZA 2L0IA 3D9PA 1ELWA 5AIJA 2AXVA 5CHEE 2I1KA 3TXNA 4ILGA 2GRMA 3ZYKA 3OTNA 3FU0A 4GB9A 4EBAA 2J08A 4CDMA 1DVPA 3PS6A 1IHGA 2WXHA 5G05C 4GZ5A 2X3MA 4ACKA 2CHWA 3HYMB 2NC9A 2I1JA 4QFVA 1N54A 2EQXA 2ONDA 2GGFA 4PUCA 5FTPA 2XGOA 3ML9A 3PUKA 2IONA 4I9EA 1Z3XA 3QNKA 5M72A 4H7YA 2LAIA 3S7BA 3ZGQA 3PZDA 1PY1A 3HVEA 4ILHB 1OWNA 2RD0A 3CVYA 2XCCA 4AV7A 4IRUA 3QC1A 1TEZA 3MYVA 3GZ2A 2Q7FA 2IFUA 4U07A 4B0ZA 2BF0X 3RIBA 5AENA 3ESKA 1GW6A 3PDNA 4U0SA 4B8AA 3AS5A 2WXFA 2V4LA 3GYZA 3CHRA 4RSYA 3MA5A 3Q4AB 5FZRA 1W3BA 4BSXA 4EBAG 4UWKA 3G2UA 1TJCA 1QNFA 3ZFWA 2WXQA 2WB2A 2WQ7A 4YVQC 5ANLA 2KM4A 2WXMA 4N3BA 5KJNA 4JA7A 1OWMA 1QZ2A 5CMWA 4M3OA 4ANVA 4Y6CA 2X6JA 2JEKA 3O48A 3CVUA 5C1DA 3ASGA 3PE3A 3Q15A 3TJPA 4BTBA 3NQPA 3ONLA 3MGBA 1UW4B 5JHBA 3AU5A 3LVRE 3LY9A 4PH4B 4EZJA 2L6JA 4AIFA 4FJZA 4GMLA 4XKBA 3GW4A 3MEKA 5JJ7A 3LPZA 2WVIA 2KC7A 2WPVA 3KD7A 4HS2A 3CVVA 3VLEA 3UT8A 3FTZA 3ZYMA 1P5QA 3ML8A 2X6IA 3PE4A 3D3MA 4AXHA 3UUXA 1WAO1 4XKCA 5LOZA 2M63A 4N39A 4ME2A 5G05J 3R9AB 4WWPA 4C9BB 5JHAA 2NXPA 1Y6IA 2OV8A 5A7DB 4ABNA 1NZNA 3FUKA 4I9CA 5G04C 3L16A 4UWGA 1OWLA 3FEYA 5ARGA 3D9KA 1MQSA 3LYAA 2LSVA 2PM6A 3I4RB 4ANXA 5D0OD 1E8ZA 2DIWA 2BUGA 4I2ZA 3L6AA 2VGYA 1Z3YA 3BG1B 4KYOB 4JHKA 5FQ7A 2HM8A 3G2SA 3SBSA 4GZ3A 3SD5A 2CHZA 4DI4A 4G24A 1HF8A 2XRZA 3LY7A 3NZSA 4EECA 4FHKA 1SQMA 4JC8A 3ENEA 3IBEA 1LF8A 2WXKA 4JL0A 2VYIA 3BEEA 3U4TA 5A23A 1TJFA 3SBTB 4KBQA 5FQ4A 3KAEA 4L23A 4L7TA 4J6IA 4LRZA 1H2VC 4NACA 2WXOA 3PVLA 4IYPA 3QDNA 3FTUA 5AYWD 1H19A 2L9BA 3U64A 4E85A 4BFRA 3LY8A 3RKVA 3QJZA 4I6JA 3QK0A 2ILRA 5EDSA 4GA2A 2X6FA 1SZ9A 4A55A 4U63A 1B89A 3RRUA 3RU0A 4XE0A 3ULQA 3UMVA 1X5BA 5A6CA 3FFLA 4XI9A 3T5XA 3RO2A 3LKUA 3K9IA 4TUUA 3B7TA 2R5SA 2XRYA 2HR2A 4BX8A 5LCWJ 4UWLA 2WXRA 3FUHA 3MJWA 2V5FA 1SZAA 3JCKC 5FZSA 4FLHA 2C2LA 3G2VA 1HS6A 3MX3A 4DJAA 2VJ8A 1IQRA 4GA1A 2MRIA 5G04J 4LERA 5CCLA 4DK5A 5FJYA 4DLQA 5EX3A 3B7UX 4I1MA 1KT0A 2I9CA 3JQ0A 3ZHEB 5J08A 3ASFA 3B13A 4DI3A 2VTBB 3CHQA 4G1TA 2A4ZA 3PNLB 5DBKA 1WM5A 2I2OA 3TL5A 1HFAA 4Y6WA 4HVBA 2VSOE 5LFAA 2J4BA 1UJJA 2IQCA 3AU4A 3I4GA 5HI7A 3R7RA 3CK9A 3LS8A 4N3CA 3CK8A 4WWNA 3ZPJA 4CGWA 1DNPA 3CVPA 3QB2A 3L17A 4IN3B 3SHFA 3ZHEA 2DBAA 4B89A 3VTYA 4APFA 5T4YA 2VTBA 2V8SE 2IF4A 2P58C 3NF1A 4D10C 2FI7A 5FZQA 1N52A 2JLBA 3CK7A 2J07A 3FUMA 3I5PA 4OVUA 3CVQA 3URZA 3FTXA 4LEUA 4GZ6A 5BW8C 4FC8A 2YNQA 2KZTB 3QWVA 1NA3A 3G2WA 3EIQC 3FWVA 4HOSA 2XHEA 3MCXA 3HDXA 1Z6TA 3R7QA 2ZU6B 5FT9A 2XPZA 3ZW3A 4JEHA 2CG3A 4WUYA 2Y4UA 2XEVA 3B7SA 1IYGA 1OWPA 4G23A 4JHJA 1S0PA 2X6KA 3EHMA 4GYWA 3S7JA 3LDZA 3SZ7A 2WM9A 4KVMA 4ILIA 3D9NA 3HIZA 2FO7A 2KZTA 5EX0A 4UQXA 4GMJA 2KCKA 4ACLA 4XIFA 4B8CB 1HX8A 1UN8A 1OWOA 2J49A 4J8EA 4N3AA 1UJKA 4YVOA 4UQYA 1H6KA 4A1SA 4U04A 4MS6A 2J4DA 3MKRA 4I1AA 2MHKA 4F1SA 4G11A 5LCWC 4GPKA 1NA0A 3PUJA 3UQ3A 4G2VA 3U66A 2R17C 3CQGB 3I3NA 3LEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT1 A;  4EQF A;  2QFC A;  3CVL A;  4RG6 A;  4AM9 A;  2PQN A;  2XPI A;  3CEQ A;  5KJK A;  5ARF A;  3N71 A;  2HO1 A;  4J8F A;  4O6F A;  4BWR A;  4N2S A;  4WNG A;  3ASH A;  4HOU A;  4G26 A;  3TAX A;  2I6H A;  3UPV A;  3S7D A;  2KCV A;  3QOU A;  4CDR A;  2AVP A;  5HQ8 A;  3AS8 A;  2FF4 A;  5D0Q D;  2LSU A;  2VGX B;  3QWP A;  4RG9 A;  1PC2 A;  1HH8 A;  4WNE A;  5JJT A;  1YA0 A;  4UI9 K;  1ZBP A;  4HOR A;  2VGX A;  2XCB A;  5KJM A;  3OXF A;  3CV0 A;  2J9Q A;  4JA9 A;  3GZ1 A;  4F3V A;  3MV3 B;  4GYO A;  3LCA A;  2KAT A;  2PL2 A;  5KJN A;  4GYY A;  4N5C A;  2C0M A;  3RJV A;  4WNF A;  2VQ2 A;  2XGM A;  2FBN A;  2LNI A;  4APO A;  3RO3 A;  2C0L A;  2GW1 A;  3WXX A;  1OUV A;  4BT9 A;  2FEZ A;  4AY6 A;  4NQ0 A;  4GCO A;  3EDT B;  1A17 A;  3ASD A;  1QQE A;  3TGO A;  2PZI A;  5DIZ A;  4GCN A;  3MV2 B;  4AY5 A;  4UI9 J;  3Q5M A;  2YQ8 A;  4J0U A;  4XI0 A;  4GA0 A;  5CCM A;  4J8D A;  1KT1 A;  3OXG A;  3CVN A;  2UWJ G;  3JYS A;  4CGV A;  3SF4 A;  4KXK B;  1HZ4 A;  3TG4 A;  3AS4 A;  4G25 A;  5JJ6 A;  4BT8 A;  4W9R A;  3VTX A;  1FCH A;  3U3W A;  4YND A;  3FP3 A;  4H7X A;  3IEG A;  4HOT A;  2VSY A;  2E2E A;  3KS2 A;  1XNF A;  1HXI A;  1ELR A;  1E96 B;  2OOE A;  3Q47 B;  4I17 A;  3ZN3 A;  4NRH B;  2PQR A;  4U0U A;  1Y8M A;  2UY1 B;  2YHC A;  3E4B A;  3S7F A;  3QWW A;  4WND A;  3QKY A;  5EKQ D;  2Y4T A;  3CKC A;  3OXL A;  4B94 A;  2UY1 A;  4HOQ A;  4U0Z A;  5KJL A;  4I2W A;  4BTA A;  3Q49 B;  2WQH A;  4UI9 C;  2KCL A;  5BNW A;  2VSN A;  4N2Q A;  2XGS A;  4UQZ A;  3CKB A;  1ZU2 A;  4JHR A;  3TG5 A;  1KLX A;  2HYZ A;  1ELW A;  5CHE E;  1IHG A;  5G05 C;  4GZ5 A;  3HYM B;  2NC9 A;  2OND A;  5FTP A;  2XGO A;  4I9E A;  5M72 A;  4H7Y A;  3S7B A;  3ZGQ A;  2XCC A;  3GZ2 A;  2Q7F A;  2IFU A;  4U07 A;  3RIB A;  3ESK A;  3PDN A;  4U0S A;  3AS5 A;  3GYZ A;  3MA5 A;  3Q4A B;  5FZR A;  1W3B A;  1TJC A;  3ZFW A;  4YVQ C;  4N3B A;  4JA7 A;  1QZ2 A;  4Y6C A;  3O48 A;  5C1D A;  3ASG A;  3PE3 A;  3Q15 A;  4BTB A;  3LY9 A;  2L6J A;  4AIF A;  3GW4 A;  3MEK A;  5JJ7 A;  3LPZ A;  2KC7 A;  2WPV A;  3KD7 A;  1P5Q A;  3PE4 A;  3UUX A;  1WAO 1;  4N39 A;  4ME2 A;  5G05 J;  3R9A B;  5A7D B;  4ABN A;  1NZN A;  5G04 C;  4I9C A;  5ARG A;  3LYA A;  2LSV A;  5D0O D;  2BUG A;  4I2Z A;  2VGY A;  4KYO B;  4GZ3 A;  4G24 A;  3LY7 A;  4JL0 A;  2VYI A;  3BEE A;  3U4T A;  4KBQ A;  3KAE A;  5AYW D;  3QDN A;  3LY8 A;  3RKV A;  4GA2 A;  1B89 A;  3ULQ A;  3RU0 A;  5A6C A;  3FFL A;  4XI9 A;  3RO2 A;  3LKU A;  3K9I A;  2R5S A;  2HR2 A;  5LCW J;  2V5F A;  5FZS A;  2C2L A;  4GA1 A;  5G04 J;  5CCL A;  5FJY A;  5EX3 A;  1KT0 A;  3ZHE B;  3ASF A;  4G1T A;  5DBK A;  1WM5 A;  4Y6W A;  5HI7 A;  3CK9 A;  4N3C A;  3CK8 A;  3ZPJ A;  4CGW A;  3CVP A;  4IN3 B;  3ZHE A;  2DBA A;  3VTY A;  2IF4 A;  2P58 C;  3NF1 A;  2FI7 A;  5FZQ A;  2JLB A;  3CK7 A;  3CVQ A;  3URZ A;  4LEU A;  4GZ6 A;  5BW8 C;  3QWV A;  1NA3 A;  3FWV A;  4HOS A;  5FT9 A;  4WUY A;  2Y4U A;  2XEV A;  1IYG A;  4G23 A;  4GYW A;  3S7J A;  3SZ7 A;  2FO7 A;  5EX0 A;  4UQX A;  2KCK A;  4XIF A;  4J8E A;  4N3A A;  4YVO A;  4UQY A;  4A1S A;  4U04 A;  3MKR A;  4I1A A;  2MHK A;  5LCW C;  4GPK A;  1NA0 A;  3UQ3 A;  4G2V A; 
#chains in the Genus database with same CATH topology
 5BT1 A;  3PRZ A;  3PH0 C;  3FY4 A;  2QFC A;  4AM9 A;  1OCR E;  3DBS A;  5C2Y A;  3FHE A;  2WXG A;  3L54 A;  5B1A E;  3AG1 E;  3ASH A;  1TNO A;  2XEE A;  3UM3 A;  3TAX A;  1IQU A;  2I6H A;  3ZNG A;  4C48 B;  1JCR A;  3QOU A;  4X8Q A;  3PNT B;  2R59 A;  2AVP A;  1HO8 A;  3AS8 A;  4MKT A;  2CG2 A;  5D0Q D;  2LSU A;  3CHO A;  4MLP A;  3ZYL A;  1HH8 A;  3GZS A;  4KZC A;  2WXP A;  1FT2 A;  5AAR A;  5FQ8 A;  2WMO A;  1JCQ A;  4DX2 A;  3E33 A;  3FUF A;  2Y3A A;  1N4Q A;  3FH5 A;  4PS3 A;  2H6H A;  2J9Q A;  1BPO A;  4GZC A;  4GU5 A;  3B7R L;  4CZ2 D;  5EID A;  1UG3 A;  2KAT A;  4LNG A;  4N5C A;  4DLO A;  4N5Q A;  4WNF A;  3FH8 A;  2VQ2 A;  2XGM A;  5E75 A;  4HRN A;  4CRW A;  3ONK A;  2XEN A;  3WXX A;  5ENP D;  4A3T A;  2F8Y A;  3EIJ A;  3CHS A;  4YDE A;  4BT9 A;  1E8W A;  3JXI A;  4L2Y A;  3ULE G;  3EDT B;  3PZ4 A;  5AQ9 A;  5LP0 A;  3ASD A;  1QQE A;  2LUH A;  2P2C P;  4GZD A;  1MYO A;  2LO6 A;  4L1B A;  3MV2 B;  3C3O A;  3TWU A;  2A5E A;  3ZIM A;  1K1B A;  1NP7 A;  3KEZ A;  3P1U A;  2YQ8 A;  4J0U A;  1INZ A;  4XI0 A;  4JVS A;  5KNH D;  4J8S A;  1KT1 A;  4PDX A;  2E0I A;  2IY0 C;  4C0E A;  4UUC A;  1XGW A;  2AXZ A;  3UIO C;  3ZU7 B;  2UWJ G;  3T9K A;  3SI5 A;  4HBD A;  1UOH A;  2Y0B G;  3TG4 A;  3AS4 A;  4BT8 A;  2RKK A;  1FCH A;  1N11 A;  3JXJ A;  4YND A;  4HI9 A;  3IEG A;  2VSY A;  3KS2 A;  1ELR A;  1E96 B;  5AJL A;  4HLE A;  3Q47 B;  2ZGD A;  4L2L A;  5ENT D;  3ZN3 A;  2PQR A;  2DZN A;  4FJY A;  4ANW A;  4FA6 A;  1VDY A;  3CQC B;  2GRR B;  2ZXW E;  2Y4T A;  4B94 A;  4TRQ A;  2IJG X;  3PEV B;  2VSX E;  3DEP A;  4O60 A;  4I2W A;  1SA4 A;  4TV3 A;  2KCL A;  3S2A A;  5JA4 D;  2YIN A;  3EU5 A;  2XGS A;  3CKB A;  2QY7 A;  5KNG A;  1OCO E;  3DXM G;  3C5R A;  3J5P A;  4A63 B;  3ZKJ A;  2L0I A;  2AXV A;  3TXN A;  4ILG A;  3ZYK A;  4CDM A;  4GZ5 A;  2X3M A;  5ENO D;  1FT1 A;  2GGF A;  2NYJ A;  3PUK A;  2ION A;  2LAI A;  3S7B A;  2KXP C;  3CVY A;  3QC1 A;  1TEZ A;  3MYV A;  3Q73 A;  2Q7F A;  2BF0 X;  2BKG A;  5AEN A;  3ESK A;  3GYZ A;  3CHR A;  3Q4A B;  1QNF A;  4YVQ C;  4DRX E;  1OWM A;  4Y6C A;  2X6J A;  3TJP A;  4BTB A;  3UIN C;  1MX4 A;  1UW4 B;  3AU5 A;  3LVR E;  4PH4 B;  3L82 A;  1KZP A;  2JAB A;  3LPZ A;  2P9P G;  3UT8 A;  2DYR E;  4AXH A;  5AN8 A;  1TR4 A;  3R9A B;  4ATZ D;  4C9B B;  4ABN A;  1NZN A;  5G04 C;  1OWL A;  3LYA A;  4ANX A;  2DIW A;  2LXM A;  2VGY A;  4TXQ A;  4JHK A;  3SBS A;  3SD5 A;  4DI4 A;  2XRZ A;  3LY7 A;  3ENE A;  5AQA A;  2WXK A;  4JL0 A;  4U95 D;  4LRZ A;  3U64 A;  2WXO A;  4IYP A;  2L6B A;  1H19 A;  5EDS A;  2PNN A;  3BQO A;  3SFX A;  2P9N G;  3LKU A;  2XRY A;  4DUI A;  4BX8 A;  4UWL A;  2WXR A;  3MJW A;  3JCK C;  3MX3 A;  1HS6 A;  5CCL A;  5FJY A;  4DLQ A;  5EX3 A;  3UKU G;  3JQ0 A;  3ASF A;  2XZT G;  3B13 A;  3CHQ A;  3PNL B;  3IXE A;  1RW2 A;  2VSO E;  3V31 A;  5LFA A;  5HI7 A;  3CK8 A;  2VGE A;  4CGW A;  1DNP A;  1N4S A;  2P9S G;  4B89 A;  3VTY A;  1N9A A;  4TXP A;  2P58 C;  1LTX A;  2FI7 A;  3AAA C;  3CVQ A;  4LEU A;  3G2W A;  2XHE A;  2XPZ A;  4L9P A;  4JHJ A;  3EHM A;  3DSX A;  3SZ7 A;  4BEP A;  5EX0 A;  4UQX A;  4GMJ A;  4ACL A;  1BI7 B;  1UN8 A;  1OWO A;  4YVO A;  3UM0 A;  4U04 A;  4I1A A;  3B7B A;  1NA0 A;  3PUJ A;  3UQ3 A;  2DVW A;  5EIB E;  3BG0 B;  2GRO B;  3FUD A;  1E8Y A;  3CEQ A;  3T8K A;  2V5Q C;  2P9K G;  3HHM A;  1A5E A;  4J8F A;  4GTP A;  4I6E A;  2YHE A;  4N2S A;  3O4Z A;  2WXL A;  3C3Q A;  4HOU A;  4G26 A;  1AWC B;  1RZ4 A;  3FU6 A;  4BX9 A;  3UPV A;  3P2B A;  5HQ8 A;  4JPS A;  2FF4 A;  3APC A;  3JUI A;  5AJD A;  4U8H A;  3DSU A;  4WNE A;  5KCM A;  4FLB A;  2ETC A;  1E7V A;  2DCP A;  2J09 A;  3L13 A;  3OXF A;  4GPM A;  4DPR A;  5T8I A;  3T5V A;  4PS7 A;  1U3C A;  3ISM C;  1ELK A;  4F3V A;  2WMN A;  4JEU A;  4GYO A;  2WXN A;  1FVF A;  5FIO A;  3CHM A;  4GYY A;  3EU9 A;  2P9L G;  2EIN E;  3RJV A;  1E90 A;  1IXV A;  4WAF A;  2AJA A;  3IV0 A;  2L0T B;  3ZXS A;  4CEM A;  4I6G A;  3HVE B;  3FTS A;  4APO A;  2RFM A;  5HS0 A;  2XEH A;  5G2N A;  1U3D A;  2H6I A;  4K0R A;  4XX5 A;  5J90 A;  4AY6 A;  2R03 A;  1HG2 A;  1G3N B;  2BTD A;  4RQI A;  2H6G A;  1S64 A;  4GCN A;  5ANR A;  4B93 B;  2GRQ B;  4AJW A;  4FAD A;  4I1O B;  4E6H A;  4UWF A;  5AQB A;  3RRN B;  3MZL B;  3Q5M A;  3W9G A;  5FIN A;  5ENN A;  3ABK E;  2Y1L E;  3BU8 A;  2FUL A;  3OXG A;  4CCA A;  1JUQ A;  4IUL A;  3D9I A;  3NOC D;  2X6H A;  5BV0 A;  3JYS A;  2AWI A;  3C98 A;  2DWZ A;  2B0O E;  4LCT A;  1EPU A;  5CEA A;  4KXK B;  1TNB A;  2P9I G;  4G25 A;  4EZL A;  3PZ1 A;  3FP3 A;  1JPL A;  4H7X A;  1SW6 A;  4HOT A;  3LJ3 A;  1HXI A;  2GRN B;  1TYQ G;  3T8M A;  3QAQ A;  3E30 A;  2OOE A;  1K3Z D;  2P9U G;  3V2O A;  4F6R D;  1EYH A;  3UM1 A;  3UIP C;  4LSZ E;  3FU5 A;  5BUZ A;  5EN5 D;  3L22 A;  4CT0 A;  4OYS A;  4WND A;  3W9F A;  3QKY A;  3EHN A;  3UM2 A;  5EKQ D;  3CKC A;  2XQ0 A;  1MX2 A;  3ZRH A;  3BUA A;  3FTV A;  3G2T A;  3SFZ A;  5KJL A;  4PS8 A;  5EYL A;  4UI9 C;  4FUL A;  4RVB A;  2VSN A;  3TWV A;  4Q69 A;  5FQ6 A;  3IKO B;  1D8D A;  3CSF A;  4UQZ A;  2R05 A;  1D8E A;  1JWF A;  1DCE A;  3D9O A;  1KLX A;  1X81 A;  4HRM B;  2GRM A;  3OTN A;  3E32 A;  4EBA A;  2J08 A;  1JCS A;  1MJ0 A;  5CED B;  3PS6 A;  2NC9 A;  2OND A;  5FTP A;  2XGO A;  4I9E A;  1Z3X A;  3QNK A;  4H7Y A;  3ZGQ A;  4ILH B;  1Q2Z A;  4IRU A;  3Q78 A;  3DST A;  2IFU A;  4U07 A;  3RIB A;  3PDN A;  2IO3 C;  1N0R A;  4RSY A;  2V4L A;  1NI1 A;  3G2U A;  2WXQ A;  2WB2 A;  1BU9 A;  4JA7 A;  1QZ2 A;  5EYP F;  4M3O A;  4ANV A;  3ABL E;  2QYJ A;  3DPY A;  5C1D A;  3DEO A;  3NQP A;  3TWW A;  4LNB A;  1TNY A;  4EZJ A;  2L6J A;  1V55 E;  4AIF A;  4FJZ A;  4GML A;  4XKB A;  3MEK A;  2WVI A;  3KD7 A;  3CVV A;  3FTZ A;  3ZYM A;  4TUM A;  2X6I A;  1WAO 1;  3V30 A;  5G05 J;  1OT8 A;  3FEY A;  4DX1 A;  1H6O A;  1LD8 A;  2LSV A;  5AAO A;  2DZO A;  5D0O D;  2BUG A;  4I2Z A;  3BG1 B;  4GZ3 A;  2CHZ A;  4G24 A;  4EEC A;  2QC9 A;  1TNZ A;  3NBN B;  3BEE A;  5A23 A;  1TJF A;  5FQ4 A;  3RAU A;  3PVL A;  3QDN A;  2L9B A;  3WG7 E;  4E85 A;  4BFR A;  3RKV A;  2ILR A;  2X6F A;  1SZ9 A;  4A55 A;  3ULQ A;  1X5B A;  2OEV A;  4YDY A;  3T5X A;  3RO2 A;  4TUU A;  4M7C A;  2R5S A;  2HR2 A;  2XZD G;  4XEI G;  3FUH A;  4K5A B;  5FZS A;  5D2M C;  2ETA A;  1TN8 A;  4GA1 A;  4I1M A;  4DX5 D;  1K1A A;  3ZHE B;  4DI3 A;  2VTB B;  5ENQ D;  3Q75 A;  3AG4 E;  4Y6W A;  2J4B A;  3AU4 A;  3I4G A;  4YDW A;  3EHQ A;  3HRA A;  1N94 A;  4N3C A;  4WWN A;  3EUV A;  1OCZ E;  3SHF A;  3ZHE A;  1BD8 A;  1LD7 A;  2VTB A;  2V8S E;  5FZQ A;  2MYO A;  4K5B A;  3UXG A;  4J7W A;  2YNQ A;  4HOS A;  2R2L A;  4CYM D;  4WUY A;  2Y4U A;  2XEV A;  3B7S A;  2F37 A;  1IYG A;  1OWP A;  3LDZ A;  2WM9 A;  3HIZ A;  2ZIR A;  2KCK A;  4J8E A;  4A1S A;  1IKN D;  4MS6 A;  2J4D A;  3MKR A;  5HKP A;  2F8X K;  4G11 A;  2ZIS A;  2EIJ E;  2R17 C;  3I3N A;  2XS8 A;  4R7L A;  4F1P A;  4RG6 A;  1Z5S C;  3JUE A;  2XPI A;  4FHJ A;  3F6Q A;  4OAV B;  4EHM A;  2HO1 A;  4BWR A;  3IHV A;  4Q94 A;  1H6P A;  3RK6 A;  1SVX A;  4JW1 A;  4RLY A;  1U2V G;  3E37 A;  3S7D A;  4QQI A;  4JZY A;  3X2Q E;  4F7A A;  1FPP A;  1H2U A;  4FU3 A;  5CER B;  1SA5 A;  1BI8 B;  4F53 A;  4O1O A;  2XPY A;  2VGX B;  4HXI A;  1PC2 A;  4URK A;  5JJT A;  3DRA A;  1YA0 A;  4UI9 K;  3EJN A;  1HE8 A;  1EDU A;  3V79 K;  2VGX A;  5KJM A;  3FUJ A;  4JA9 A;  2CFU A;  2A5U A;  4P29 A;  2EIM E;  3APF A;  5E76 A;  4O1P A;  2OVB A;  3MV3 B;  3FEX A;  4JXT A;  4EPZ A;  2PM7 A;  1HU3 A;  4HFG A;  3MKQ B;  4HI8 A;  1N95 A;  4AEZ C;  2H6F A;  2R02 A;  4AVX A;  4JD2 G;  2GW1 A;  1MZC A;  3L08 A;  3D9J A;  2QZA A;  4FP7 A;  4DX6 D;  2WXI A;  1H0A A;  3MKQ A;  4NQ0 A;  3D9L A;  3KSL A;  4GCO A;  3Q7F A;  1L5J A;  4BSZ B;  2CFZ A;  3TGO A;  5IY5 E;  1FVH A;  3SO8 A;  4AY5 A;  4MRU A;  3OAW A;  4G8K A;  4UI9 J;  4ATG A;  3CR3 A;  3FUN A;  2BKK B;  4HNA D;  4GTO A;  4LNU D;  3ASN E;  3FDH A;  1ZB1 A;  3UI2 A;  1H2T C;  3C72 A;  2IOL A;  3SF4 A;  1HZ4 A;  5BPP A;  5BXO A;  5JJ6 A;  4W9R A;  3VTX A;  3UX4 A;  3E34 A;  3EHR A;  3HXD A;  1D9S A;  1XNF A;  2WXJ A;  2X38 A;  3J5Q B;  1QYM A;  3ZUV B;  3UT4 A;  4NRH B;  2UY1 B;  4HB5 A;  3Q9U C;  4AP2 A;  4XZ4 A;  4KVO A;  4NUR A;  3PRE A;  3ULY A;  3DSV A;  3OXL A;  2UY1 A;  4HOQ A;  4U0Z A;  3SNX A;  2GRL A;  1S70 B;  4UWH A;  4ANU A;  1N0Q A;  3LVQ E;  2WQ6 A;  4EZK A;  3RRM B;  5T3R A;  2B6C A;  4V3I A;  2IU1 A;  2HYZ A;  1ELW A;  3TWX A;  5AIJ A;  3AG2 E;  1IHG A;  5H7P A;  1QBQ A;  4ACK A;  2CHW A;  1N54 A;  2EQX A;  3NOG D;  3AG3 E;  4PUC A;  3HVE A;  1OWN A;  2RD0 A;  4BES A;  4AV7 A;  3B95 A;  4YDO A;  2WXF A;  4ZHB A;  1DCQ A;  1W3B A;  4U8Y D;  3ZFW A;  1AP7 A;  4GTV A;  2WQ7 A;  2WXM A;  4N3B A;  3C3R A;  5CMW A;  3O48 A;  3CVU A;  3MGB A;  3LJN A;  3GW4 A;  2KC7 A;  2WPV A;  3UTM A;  4HS2 A;  3RSE G;  1O5M A;  1P5Q A;  1OY3 D;  3PE4 A;  3UUX A;  4XKC A;  5LOZ A;  5B1B E;  2F0Y A;  5JHA A;  2NXP A;  2OV8 A;  4I9C A;  3L16 A;  4UWG A;  2PM6 A;  1E8Z A;  3L6A A;  2IO2 C;  3AJI A;  3G2S A;  1S63 A;  5CBO A;  1HF8 A;  1SQM A;  4JC8 A;  1LF8 A;  2VYI A;  3U4T A;  4KBQ A;  3KAE A;  4LG6 A;  4L7T A;  1H2V C;  2ZGG A;  3LY8 A;  1OXJ A;  3QJZ A;  3D9H A;  4GA2 A;  2FO1 E;  1BLX B;  4U63 A;  1B89 A;  4GTT A;  4XE0 A;  3UMV A;  3FFL A;  4XI9 A;  3NAW A;  4GTR A;  2V5F A;  2C2L A;  2VJ8 A;  5KWD A;  2MRI A;  5G04 J;  2OCC E;  4DK5 A;  1KT0 A;  3V2X A;  5J08 A;  4G1T A;  2A4Z A;  3Q79 A;  1WM5 A;  4HVB A;  3TWR A;  1UJJ A;  2IEJ A;  3R7R A;  3CK9 A;  2LXL A;  3LS8 A;  3ZPJ A;  4K5C A;  3CVP A;  3L17 A;  4IN3 B;  4APF A;  5T4Y A;  2IF4 A;  3NB2 A;  1N52 A;  2JLB A;  3CK7 A;  2J07 A;  4OVU A;  3URZ A;  3FTX A;  3DSW A;  4GZ6 A;  5BW8 C;  2KZT B;  3QWV A;  3HDX A;  1Z6T A;  3R7Q A;  2ZU6 B;  5FT9 A;  4JEH A;  2CG3 A;  5BXU A;  4G23 A;  4GYW A;  4KVM A;  4ILI A;  2KZT A;  4XIF A;  4B8C B;  2J49 A;  1YCS B;  3HG0 D;  5D66 A;  2MHK A;  5LCW C;  1YMP A;  3U66 A;  3CQG B;  3LEW A;  1KPS B;  5ITZ F;  4EQF A;  4K03 A;  5HRY A;  1IHB A;  3CLJ A;  3CVL A;  5CEC B;  2PQN A;  3VLF A;  5KJK A;  5ARF A;  3N71 A;  4O6F A;  2OVF A;  2RG8 A;  3CHP A;  4KMO A;  4GAA A;  5FWQ A;  5CRU A;  3VLD A;  4WNG A;  1NL4 A;  3FUI A;  2AW6 A;  2KCV A;  1MHQ A;  4CDR A;  1UN9 A;  2MOW A;  3ZEF A;  4JB8 P;  3QWP A;  4RG9 A;  3CST A;  3FH7 A;  1TNU A;  1ZBP A;  4GTQ A;  3U9W A;  1E8X A;  3LXU X;  2XCB A;  5CBN A;  4HOR A;  5ENR D;  3CV0 A;  3ZYQ A;  1EF1 C;  1TN6 A;  3KEA A;  1KZO A;  3GZ1 A;  5KJN A;  3LCA A;  2PL2 A;  3SGH A;  2C0M A;  4I43 A;  4Q96 A;  4C0M A;  2FBN A;  2LNI A;  3RO3 A;  4LUN U;  2C0L A;  3FU3 A;  3QAR A;  1OUV A;  2LAH A;  2FEZ A;  3TXM A;  3CIA A;  3IHY A;  1A17 A;  1O1T A;  3FTY A;  3JQ1 A;  4HQD A;  4WWO A;  2V4H C;  2PZI A;  5CMY A;  5DIZ A;  1E7U A;  3UT7 A;  4BY6 A;  3ESL A;  4Z68 A;  3ABM E;  3R9M A;  3PZ3 A;  3TWT A;  4KZ0 A;  1MX6 A;  2GRP B;  4A1G A;  4GA0 A;  5CCM A;  3FTW A;  4J8D A;  3CGH A;  4AOF A;  3HXC A;  2ETB A;  1HG5 A;  4A3V A;  3CVN A;  2CHX A;  3DSS A;  4CGV A;  5EIL A;  1OCC E;  1WY6 A;  1N4P A;  2IOS A;  1PAQ A;  3FUE A;  3U3W A;  5KBA A;  2E2E A;  5LX8 A;  4KT6 B;  4NIK A;  4I17 A;  2AXU A;  4U0U A;  1Y8M A;  2YHC A;  3E4B A;  4U8V D;  3CVW A;  3KSQ A;  2V0P A;  3ZVV A;  3S7F A;  3QWW A;  4CDN A;  3SQV A;  3HXF A;  2NSZ A;  3APD A;  5G55 A;  3NZU A;  4ZFH A;  3FUL A;  4CT4 A;  2BED A;  1JWG A;  3SY2 A;  3DPD A;  4BTA A;  3Q49 B;  2WQH A;  5BNW A;  3PEU B;  4N2Q A;  4HLL A;  4OVV A;  4BET A;  4DX7 D;  3Q7A A;  1ZU2 A;  4JHR A;  3CVX A;  3TG5 A;  5BV1 A;  4J8Y A;  3D9M A;  2KBX A;  3D9P A;  5CHE E;  2I1K A;  1YYH A;  3Q9N C;  5JMN D;  3FU0 A;  4GB9 A;  2Y69 E;  1DVP A;  2WXH A;  5G05 C;  4BER A;  3HYM B;  2I1J A;  4QFV A;  1K8K G;  3ML9 A;  5M72 A;  3PZD A;  1PY1 A;  2XCC A;  3GZ2 A;  3L9T A;  4B0Z A;  1GW6 A;  4U0S A;  4B8A A;  3AS5 A;  4EBA G;  4BSX A;  3MA5 A;  5FZR A;  4UWK A;  1TJC A;  5B3S E;  1N4R A;  5ANL A;  2KM4 A;  5CRV A;  5ENS D;  4GMR A;  2JEK A;  3ASG A;  3PE3 A;  3Q15 A;  3ONL A;  5JHB A;  3LY9 A;  2DYS E;  4TXR A;  5JJ7 A;  4U7E B;  2HE0 A;  3VLE A;  4U96 D;  2OEW A;  3ZXP A;  3ML8 A;  3D3M A;  2J8S D;  2M63 A;  4N39 A;  4ME2 A;  4WWP A;  2QYU A;  3HXE A;  1Y6I A;  5A7D B;  3FUK A;  2EIL E;  5ARG A;  3D9K A;  1MQS A;  3I4R B;  1Z3Y A;  4KYO B;  5FQ7 A;  2HM8 A;  4G8L A;  3NZS A;  4FHK A;  3IBE A;  3SBT B;  3HXB A;  3SFY A;  4L23 A;  4J6I A;  4MBG A;  4NAC A;  5AYW D;  3FTU A;  2RFA A;  4I6J A;  3QK0 A;  4OAU C;  3RRU A;  3RU0 A;  2XS1 A;  5A6C A;  3PZ2 A;  3K9I A;  4GTM A;  3B7T A;  1WDY A;  3TWS A;  5LCW J;  3TWQ A;  1SZA A;  4FLH A;  3UKR G;  3G2V A;  4DJA A;  1IQR A;  4LER A;  3B7U X;  2I9C A;  2EIK E;  5DBK A;  2I2O A;  3TL5 A;  1HFA A;  3DXK G;  1O1S A;  2IQC A;  1O1R A;  3QB2 A;  2DBA A;  1NFI E;  3NF1 A;  4D10 C;  3I5P A;  3FUM A;  4FC8 A;  1NA3 A;  3EIQ C;  3FWV A;  3MCX A;  1WG0 A;  3DWL G;  3ZW3 A;  1V54 E;  1TN7 A;  1S0P A;  2X6K A;  3S7J A;  4HRL A;  3D9N A;  2FO7 A;  1HX8 A;  4N3A A;  4GTS A;  1UJK A;  3ASO E;  4UQY A;  1H6K A;  4F1S A;  4GPK A;  5AQ7 A;  4G2V A;  1DC2 A; 
#chains in the Genus database with same CATH homology
 5BT1 A;  4EQF A;  4K03 A;  4R7L A;  3PRZ A;  3CLJ A;  3PH0 C;  3FY4 A;  2QFC A;  3BG0 B;  3CVL A;  4RG6 A;  4AM9 A;  3FUD A;  2PQN A;  2XPI A;  4FHJ A;  3VLF A;  1E8Y A;  3CEQ A;  3DBS A;  5ARF A;  5KJK A;  3HHM A;  3N71 A;  2HO1 A;  4J8F A;  4O6F A;  5C2Y A;  2OVF A;  3FHE A;  2RG8 A;  4BWR A;  3IHV A;  3CHP A;  4I6E A;  2YHE A;  4GAA A;  4KMO A;  3O4Z A;  4N2S A;  2WXG A;  3L54 A;  2WXL A;  5FWQ A;  4Q94 A;  3VLD A;  4WNG A;  3ASH A;  4HOU A;  3RK6 A;  4G26 A;  4JW1 A;  3TAX A;  3FUI A;  1IQU A;  2I6H A;  3FU6 A;  4BX9 A;  3S7D A;  3UPV A;  4JZY A;  2AW6 A;  2KCV A;  3QOU A;  4F7A A;  3PNT B;  1H2U A;  1MHQ A;  4CDR A;  2R59 A;  2AVP A;  3P2B A;  5HQ8 A;  1HO8 A;  3AS8 A;  4JPS A;  4FU3 A;  1UN9 A;  2MOW A;  4MKT A;  4F53 A;  3ZEF A;  2FF4 A;  2CG2 A;  3APC A;  2LSU A;  5D0Q D;  2XPY A;  3CHO A;  3JUI A;  4MLP A;  5AJD A;  2VGX B;  3QWP A;  4HXI A;  4RG9 A;  3ZYL A;  1PC2 A;  1HH8 A;  4U8H A;  3GZS A;  4KZC A;  3CST A;  2WXP A;  4WNE A;  1YA0 A;  5FQ8 A;  4URK A;  5JJT A;  3FH7 A;  2WMO A;  4UI9 K;  5KCM A;  4FLB A;  1ZBP A;  1E7V A;  3U9W A;  3EJN A;  1HE8 A;  1EDU A;  1E8X A;  3FUF A;  2VGX A;  2XCB A;  2Y3A A;  3LXU X;  4HOR A;  2DCP A;  2J09 A;  3FH5 A;  3L13 A;  5KJM A;  3FUJ A;  3OXF A;  4DPR A;  4PS3 A;  3CV0 A;  2J9Q A;  5T8I A;  3ZYQ A;  1EF1 C;  3T5V A;  4JA9 A;  4PS7 A;  1BPO A;  4GZC A;  1U3C A;  2CFU A;  2A5U A;  4P29 A;  3APF A;  4GU5 A;  3B7R L;  3GZ1 A;  5E76 A;  1ELK A;  4F3V A;  2OVB A;  2WMN A;  4JEU A;  1UG3 A;  3MV3 B;  3FEX A;  2KAT A;  2PL2 A;  1FVF A;  2WXN A;  3LCA A;  3CHM A;  4GYO A;  4GYY A;  4JXT A;  3SGH A;  4EPZ A;  4N5C A;  2PM7 A;  4DLO A;  2C0M A;  3RJV A;  1HU3 A;  4WNF A;  3FH8 A;  2VQ2 A;  1E90 A;  3MKQ B;  4HFG A;  4WAF A;  4I43 A;  4Q96 A;  3IV0 A;  2XGM A;  2L0T B;  3ZXS A;  4C0M A;  4CEM A;  2FBN A;  2LNI A;  4I6G A;  3HVE B;  3FTS A;  5E75 A;  4AEZ C;  4APO A;  3RO3 A;  4AVX A;  4LUN U;  2C0L A;  2GW1 A;  3L08 A;  3D9J A;  4CRW A;  5G2N A;  3ONK A;  1U3D A;  4FP7 A;  3FU3 A;  3WXX A;  2WXI A;  4A3T A;  1H0A A;  3CHS A;  3EIJ A;  3QAR A;  1OUV A;  3MKQ A;  4K0R A;  2LAH A;  1E8W A;  4XX5 A;  4BT9 A;  2FEZ A;  4L2Y A;  5J90 A;  4AY6 A;  4NQ0 A;  3D9L A;  3TXM A;  4GCO A;  3EDT B;  1L5J A;  3CIA A;  3IHY A;  1A17 A;  3FTY A;  1HG2 A;  3JQ1 A;  5LP0 A;  3ASD A;  1QQE A;  4WWO A;  2BTD A;  2CFZ A;  4GZD A;  3TGO A;  2PZI A;  5CMY A;  5DIZ A;  1E7U A;  4GCN A;  5ANR A;  2LO6 A;  3UT7 A;  4L1B A;  4BY6 A;  3MV2 B;  1FVH A;  4AJW A;  4FAD A;  3ESL A;  4I1O B;  4E6H A;  3ZIM A;  4AY5 A;  4UWF A;  4MRU A;  3OAW A;  1NP7 A;  3RRN B;  3KEZ A;  3MZL B;  3Q5M A;  4UI9 J;  3P1U A;  4ATG A;  2YQ8 A;  4J0U A;  3CR3 A;  3FUN A;  4KZ0 A;  1INZ A;  4XI0 A;  4JVS A;  4GA0 A;  5ENN A;  4A1G A;  5CCM A;  3FTW A;  4J8D A;  1KT1 A;  2FUL A;  3CGH A;  3OXG A;  4J8S A;  4PDX A;  4AOF A;  4CCA A;  3FDH A;  2E0I A;  1JUQ A;  4IUL A;  4C0E A;  1XGW A;  2AXZ A;  1HG5 A;  3D9I A;  4A3V A;  2X6H A;  3CVN A;  2UWJ G;  5BV0 A;  1H2T C;  3SI5 A;  2CHX A;  3JYS A;  2AWI A;  3C98 A;  2IOL A;  4CGV A;  4LCT A;  1EPU A;  3SF4 A;  4KXK B;  1HZ4 A;  3TG4 A;  1WY6 A;  5BPP A;  3AS4 A;  2IOS A;  4G25 A;  5JJ6 A;  4BT8 A;  4W9R A;  1PAQ A;  3VTX A;  1FCH A;  4EZL A;  3FUE A;  3U3W A;  4YND A;  3FP3 A;  3UX4 A;  1JPL A;  4H7X A;  3IEG A;  4HOT A;  2VSY A;  2E2E A;  3LJ3 A;  3KS2 A;  1XNF A;  1HXI A;  1ELR A;  2WXJ A;  1E96 B;  5AJL A;  3T8M A;  4HLE A;  2X38 A;  3QAQ A;  4KT6 B;  5LX8 A;  2OOE A;  3Q47 B;  4I17 A;  4L2L A;  2AXU A;  3UT4 A;  3ZN3 A;  4NRH B;  2PQR A;  4U0U A;  1Y8M A;  2UY1 B;  1EYH A;  2YHC A;  3FU5 A;  4FJY A;  4ANW A;  4AP2 A;  3E4B A;  4XZ4 A;  4FA6 A;  5BUZ A;  3CVW A;  1VDY A;  3CQC B;  2V0P A;  3L22 A;  4KVO A;  3ZVV A;  4CT0 A;  3S7F A;  3QWW A;  4CDN A;  4OYS A;  4NUR A;  4WND A;  3QKY A;  3EHN A;  3PRE A;  5EKQ D;  2Y4T A;  3CKC A;  3OXL A;  4B94 A;  2XQ0 A;  2NSZ A;  3APD A;  4TRQ A;  3ZRH A;  5G55 A;  3FTV A;  2UY1 A;  2IJG X;  3NZU A;  3G2T A;  4HOQ A;  3PEV B;  3FUL A;  4CT4 A;  2VSX E;  4U0Z A;  3SNX A;  1JWG A;  3SFZ A;  2GRL A;  4UWH A;  5KJL A;  3DPD A;  4I2W A;  4ANU A;  4PS8 A;  4BTA A;  3Q49 B;  2WQH A;  4TV3 A;  4UI9 C;  2KCL A;  4FUL A;  5BNW A;  4RVB A;  2VSN A;  3PEU B;  4N2Q A;  4Q69 A;  5FQ6 A;  3IKO B;  3S2A A;  3LVQ E;  2YIN A;  3CSF A;  4OVV A;  2WQ6 A;  2XGS A;  4EZK A;  4UQZ A;  3CKB A;  2QY7 A;  1ZU2 A;  4JHR A;  3RRM B;  3CVX A;  1JWF A;  3TG5 A;  5BV1 A;  3D9O A;  5T3R A;  4V3I A;  1KLX A;  2IU1 A;  3D9M A;  2HYZ A;  2L0I A;  3D9P A;  1ELW A;  5AIJ A;  2AXV A;  5CHE E;  2I1K A;  3TXN A;  4ILG A;  2GRM A;  3ZYK A;  3OTN A;  3FU0 A;  4GB9 A;  4EBA A;  2J08 A;  4CDM A;  1DVP A;  3PS6 A;  1IHG A;  2WXH A;  5G05 C;  4GZ5 A;  2X3M A;  4ACK A;  2CHW A;  3HYM B;  2NC9 A;  2I1J A;  4QFV A;  1N54 A;  2EQX A;  2OND A;  2GGF A;  4PUC A;  5FTP A;  2XGO A;  3ML9 A;  3PUK A;  2ION A;  4I9E A;  1Z3X A;  3QNK A;  5M72 A;  4H7Y A;  2LAI A;  3S7B A;  3ZGQ A;  3PZD A;  1PY1 A;  3HVE A;  4ILH B;  1OWN A;  2RD0 A;  3CVY A;  2XCC A;  4AV7 A;  4IRU A;  3QC1 A;  1TEZ A;  3MYV A;  3GZ2 A;  2Q7F A;  2IFU A;  4U07 A;  4B0Z A;  2BF0 X;  3RIB A;  5AEN A;  3ESK A;  1GW6 A;  3PDN A;  4U0S A;  4B8A A;  3AS5 A;  2WXF A;  2V4L A;  3GYZ A;  3CHR A;  4RSY A;  3MA5 A;  3Q4A B;  5FZR A;  1W3B A;  4BSX A;  4EBA G;  4UWK A;  3G2U A;  1TJC A;  1QNF A;  3ZFW A;  2WXQ A;  2WB2 A;  2WQ7 A;  4YVQ C;  5ANL A;  2KM4 A;  2WXM A;  4N3B A;  5KJN A;  4JA7 A;  1OWM A;  1QZ2 A;  5CMW A;  4M3O A;  4ANV A;  4Y6C A;  2X6J A;  2JEK A;  3O48 A;  3CVU A;  5C1D A;  3ASG A;  3PE3 A;  3Q15 A;  3TJP A;  4BTB A;  3NQP A;  3ONL A;  3MGB A;  1UW4 B;  5JHB A;  3AU5 A;  3LVR E;  3LY9 A;  4PH4 B;  4EZJ A;  2L6J A;  4AIF A;  4FJZ A;  4GML A;  4XKB A;  3GW4 A;  3MEK A;  5JJ7 A;  3LPZ A;  2WVI A;  2KC7 A;  2WPV A;  3KD7 A;  4HS2 A;  3CVV A;  3VLE A;  3UT8 A;  3FTZ A;  3ZYM A;  1P5Q A;  3ML8 A;  2X6I A;  3PE4 A;  3D3M A;  4AXH A;  3UUX A;  1WAO 1;  4XKC A;  5LOZ A;  2M63 A;  4N39 A;  4ME2 A;  5G05 J;  3R9A B;  4WWP A;  4C9B B;  5JHA A;  2NXP A;  1Y6I A;  2OV8 A;  5A7D B;  4ABN A;  1NZN A;  3FUK A;  4I9C A;  5G04 C;  3L16 A;  4UWG A;  1OWL A;  3FEY A;  5ARG A;  3D9K A;  1MQS A;  3LYA A;  2LSV A;  2PM6 A;  3I4R B;  4ANX A;  5D0O D;  1E8Z A;  2DIW A;  2BUG A;  4I2Z A;  3L6A A;  2VGY A;  1Z3Y A;  3BG1 B;  4KYO B;  4JHK A;  5FQ7 A;  2HM8 A;  3G2S A;  3SBS A;  4GZ3 A;  3SD5 A;  2CHZ A;  4DI4 A;  4G24 A;  1HF8 A;  2XRZ A;  3LY7 A;  3NZS A;  4EEC A;  4FHK A;  1SQM A;  4JC8 A;  3ENE A;  3IBE A;  1LF8 A;  2WXK A;  4JL0 A;  2VYI A;  3BEE A;  3U4T A;  5A23 A;  1TJF A;  3SBT B;  4KBQ A;  5FQ4 A;  3KAE A;  4L23 A;  4L7T A;  4J6I A;  4LRZ A;  1H2V C;  4NAC A;  2WXO A;  3PVL A;  4IYP A;  3QDN A;  3FTU A;  5AYW D;  1H19 A;  2L9B A;  3U64 A;  4E85 A;  4BFR A;  3LY8 A;  3RKV A;  3QJZ A;  4I6J A;  3QK0 A;  2ILR A;  5EDS A;  4GA2 A;  2X6F A;  1SZ9 A;  4A55 A;  4U63 A;  1B89 A;  3RRU A;  3RU0 A;  4XE0 A;  3ULQ A;  3UMV A;  1X5B A;  5A6C A;  3FFL A;  4XI9 A;  3T5X A;  3RO2 A;  3LKU A;  3K9I A;  4TUU A;  3B7T A;  2R5S A;  2XRY A;  2HR2 A;  4BX8 A;  5LCW J;  4UWL A;  2WXR A;  3FUH A;  3MJW A;  2V5F A;  1SZA A;  3JCK C;  5FZS A;  4FLH A;  2C2L A;  3G2V A;  1HS6 A;  3MX3 A;  4DJA A;  2VJ8 A;  1IQR A;  4GA1 A;  2MRI A;  5G04 J;  4LER A;  5CCL A;  4DK5 A;  5FJY A;  4DLQ A;  5EX3 A;  3B7U X;  4I1M A;  1KT0 A;  2I9C A;  3JQ0 A;  3ZHE B;  5J08 A;  3ASF A;  3B13 A;  4DI3 A;  2VTB B;  3CHQ A;  4G1T A;  2A4Z A;  3PNL B;  5DBK A;  1WM5 A;  2I2O A;  3TL5 A;  1HFA A;  4Y6W A;  4HVB A;  2VSO E;  5LFA A;  2J4B A;  1UJJ A;  2IQC A;  3AU4 A;  3I4G A;  5HI7 A;  3R7R A;  3CK9 A;  3LS8 A;  4N3C A;  3CK8 A;  4WWN A;  3ZPJ A;  4CGW A;  1DNP A;  3CVP A;  3QB2 A;  3L17 A;  4IN3 B;  3SHF A;  3ZHE A;  2DBA A;  4B89 A;  3VTY A;  4APF A;  5T4Y A;  2VTB A;  2V8S E;  2IF4 A;  2P58 C;  3NF1 A;  4D10 C;  2FI7 A;  5FZQ A;  1N52 A;  2JLB A;  3CK7 A;  2J07 A;  3FUM A;  3I5P A;  4OVU A;  3CVQ A;  3URZ A;  3FTX A;  4LEU A;  4GZ6 A;  5BW8 C;  4FC8 A;  2YNQ A;  2KZT B;  3QWV A;  1NA3 A;  3G2W A;  3EIQ C;  3FWV A;  4HOS A;  2XHE A;  3MCX A;  3HDX A;  1Z6T A;  3R7Q A;  2ZU6 B;  5FT9 A;  2XPZ A;  3ZW3 A;  4JEH A;  2CG3 A;  4WUY A;  2Y4U A;  2XEV A;  3B7S A;  1IYG A;  1OWP A;  4G23 A;  4JHJ A;  1S0P A;  2X6K A;  3EHM A;  4GYW A;  3S7J A;  3LDZ A;  3SZ7 A;  2WM9 A;  4KVM A;  4ILI A;  3D9N A;  3HIZ A;  2FO7 A;  2KZT A;  5EX0 A;  4UQX A;  4GMJ A;  2KCK A;  4ACL A;  4XIF A;  4B8C B;  1HX8 A;  1UN8 A;  1OWO A;  2J49 A;  4J8E A;  4N3A A;  1UJK A;  4YVO A;  4UQY A;  1H6K A;  4A1S A;  4U04 A;  4MS6 A;  2J4D A;  3MKR A;  4I1A A;  2MHK A;  4F1S A;  4G11 A;  5LCW C;  4GPK A;  1NA0 A;  3PUJ A;  3UQ3 A;  4G2V A;  3U66 A;  2R17 C;  3CQG B;  3I3N A;  3LEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...