5AAOA

Crystal structure of fluorogen-activating designed ankyrin repeat protein (darpin) dimer in complex with malachite green
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
SDLGKKLLEAARAGQDDEVRILMANGADVNAKDSRGKTPLHLAADYGYLEVAEVLLKHGADVNAHDVYGDTPLHLTATWGHLEIVEVLLKNGADANAIDFFGWTPLHLAAYFGHLEIVEVLLKYGADVNAQDKFGKTVFDISVYNGDEDLAEILQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD3210
publication title Generation of Fluorogen-Activating Designed Ankyrin Repeat Proteins (FADAs) as Versatile Sensor Tools.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 54
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5aaoA00
5CECB 5EILA 3ZUVB 4TUMA 1MJ0A 2ETAA 3DEPA 5CERB 2ZGGA 1YYHA 2FO1E 1MX4A 2KXPC 2HE0A 4K5CA 1SW6A 4HNAD 1SVXA 4J7WA 5ENQD 4O1PA 4ZHBA 1IXVA 5ITZF 5ENOD 2XEEA 4K5AB 5BXUA 2MYOA 3J5QB 2B0OE 3JXJA 5JA4D 4RLYA 3UTMA 2J8SD 1YMPA 4HBDA 4BETA 3HG0D 2Y1LE 5FIOA 2BKKB 3T9KA 4ZFHA 3AJIA 5AQ7A 4HRNA 3TWTA 1AWCB 4C48B 3TWQA 1IKND 5ENSD 4CZ2D 1IHBA 2XZTG 4LNUD 5KBAA 5KWDA 2V4HC 5AQ9A 3IXEA 5CBNA 1S70B 5HRYA 3ZKJA 2JABA 4GPMA 4DX1A 3V79K 1BLXB 1TR4A 2RFMA 3UXGA 2VGEA 1QYMA 4LG6A 2DZOA 3B95A 5AARA 3JXIA 1BU9A 2XEHA 2F37A 2QYJA 5EN5D 3EHRA 3TWRA 4ATZD 3V2OA 3NOGD 3V30A 4U8VD 3TWXA 2DWZA 1K3ZD 5EYLA 1OY3D 5ENRD 1WG0A 3Q9NC 5ENTD 3NBNB 1N0QA 4DX7D 4UUCA 5BXOA 4DUIA 3B7BA 2ETBA 4HRLA 2XZDG 5AQBA 2KBXA 1MX6A 1MYOA 1BD8A 3TWSA 4B93B 5D66A 3T8KA 3V31A 2RFAA 5ENPD 3W9GA 4BEPA 4BESA 5KNHD 2Y0BG 5AAOA 3ZNGA 1K1AA 3D9HA 5CEDB 3EU9A 3NOCD 3JUEA 3SO8A 4U95D 4G8LA 2DZNA 4BSZB 2DVWA 3HRAA 3EHQA 4G8KA 4HLLA 3TWUA 2BKGA 2P2CP 4BERA 1AP7A 2PNNA 2QC9A 4HB5A 4U8YD 1DC2A 4HRMB 1G3NB 4J8YA 5FINA 1N0RA 4A63B 4DX2A 1N11A 3ZU7B 2ETCA 5EIBE 2A5EA 2F8YA 3F6QA 1K1BA 4Z68A 4CYMD 1YCSB 4YDYA 5EIDA 1OT8A 2AJAA 4LSZE 1MX2A 5CEAA 1BI7B 3AAAC 4DX6D 3C5RA 4QFVA 4F1PA 3V2XA 4OAUC 1BI8B 1UOHA 2L6BA 4NIKA 4O1OA 1NFIE 4DRXE 4QQIA 4K5BA 5KNGA 4U96D 3UI2A 2F8XK 5JMND 4O60A 3W9FA 2ZGDA 4HQDA 3TWVA 4HI9A 5CBOA 2XENA 3DEOA 3J5PA 3TWWA 3LJNA 5EYPF 4HI8A 5AQAA 1WDYA 4OAVB 4YDWA 2V5QC 5AN8A 5HS0A 4DX5D 1DCQA 4JB8P 5HKPA 4N5QA 1D9SA 3KEAA 4GMRA 4F6RD 1A5EA 3Q9UC 2NYJA
chains in the Genus database with same CATH superfamily
3FTVA 4J7WA 2Y4TA 2CHWA 2P9SG 5ENOD 3RIBA 3UTMA 3HG0D 4DI3A 2PM6A 3MGBA 3ESKA 3TWQA 2WXLA 2X3MA 2VGXB 3PDNA 2V0PA 4I2WA 5CBNA 3SI5A 2VTBB 3FU6A 3LXUX 3U64A 4LEUA 3FH5A 4PS3A 1BU9A 3QJZA 5AYWD 5EN5D 3NOGD 4U7EB 4PH4B 4BESA 4N3AA 1TNYA 4I1MA 3ZNGA 3S7JA 3NOCD 2OV8A 3OAWA 4I6JA 4G8LA 5G04C 3L9TA 2J49A 1OCOE 5FINA 4PS8A 3ZXPA 1FT1A 5EIDA 1OT8A 3ZYLA 2EIME 3V2XA 4GCOA 3SFZA 2M63A 4X8QA 5BUZA 1HF8A 3T5XA 4E6HA 3ASFA 3UM2A 1ZBPA 2BEDA 4ZHBA 1E90A 3FP3A 4GTVA 4KZCA 1QQEA 4RLYA 4EBAG 2J4DA 4BWRA 2YHCA 1YMPA 5A23A 4HXIA 3JYSA 4UI9J 4L2YA 2P9PG 1E7VA 3LJ3A 3CHOA 3QWVA 3FTYA 3CHSA 4LNUD 3MV2B 1HG2A 3D3MA 1PC2A 1JPLA 3LVRE 3ABLE 5AENA 4KYOB 2XGMA 4FJYA 4RQIA 4UWKA 5ENTD 3E37A 3FU5A 4N2SA 4WNEA 4XX5A 5ENPD 1X81A 3FTZA 4U63A 2HYZA 4J6IA 3SO8A 3OXLA 3NAWA 2VGXA 3ZRHA 3MJWA 1TJCA 1N0RA 2WVIA 3C3OA 4G24A 2ETCA 2MHKA 2VTBA 2F8YA 2GRMA 5LOZA 4CGWA 1W3BA 2FO7A 3CVWA 2H6FA 1E8YA 3FEXA 4L23A 4HI9A 1NZNA 5EYPF 2UWJG 3HYMB 5AN8A 3R9AB 3DSXA 3Q9UC 3FTUA 3DSTA 1SVXA 2X6HA 5ENQD 3FTWA 2GW1A 1E8WA 2KM4A 1H2UA 2KC7A 4BETA 5T8IA 3URZA 2WXPA 3Q73A 2ZXWE 4KVMA 3D9JA 4F1SA 4CZ2D 3P2BA 4NQ0A 3V79K 3R7QA 5BV0A 2PQNA 5AARA 3QB2A 3P1UA 4ATZD 1HX8A 4I9EA 2IFUA 3QC1A 2AXUA 2IY0C 1QNFA 1QZ2A 3MKRA 2XZDG 2KBXA 1D8EA 1BD8A 3LPZA 4FJZA 4ATGA 4HOQA 4OVVA 2DBAA 3MA5A 4UQXA 2R03A 5CEDB 3RRMB 2AWIA 4EHMA 5G04J 4BSZB 3MX3A 3TG4A 3HRAA 1WAO1 4G8KA 2WM9A 3KSLA 3EJNA 4HVBA 1FT2A 3B7UX 1OCCE 4A63B 3RAUA 4G11A 3LCAA 3OXFA 5EIBE 3UQ3A 3I4RB 3IV0A 2RKKA 3SBTB 2NSZA 3RO3A 3KAEA 3E32A 4U04A 3DPYA 1Q2ZA 3LS8A 3PZ3A 4G25A 4GTMA 3CQGB 4FA6A 3UIOC 1LTXA 3ASHA 4LERA 3VLDA 4O1PA 4I6EA 1TJFA 4K5AB 3J5QB 5BW8C 4MBGA 2J07A 3ZVVA 4OVUA 2PL2A 5FIOA 2LAHA 3EIJA 3GZSA 5AQ7A 3UM1A 4HRNA 3AS8A 1WY6A 5ENSD 5D0QD 2XZTG 4AEZC 2R2LA 2FULA 3ASNE 3GZ1A 1OWOA 4U8VD 4LUNU 4GB9A 1KT0A 1GW6A 2ZU6B 5BT1A 4F7AA 2RFAA 1TYQG 5CMYA 4GPKA 4HFGA 5EX3A 2QC9A 4KMOA 3WXXA 4N2QA 4J8YA 4GA1A 4HOSA 2ZISA 4CDMA 2YQ8A 3E33A 3ULYA 2C0MA 4M3OA 1MHQA 4U96D 5JMND 3CHPA 4O60A 1UW4B 2ZGDA 4TXPA 3TWVA 4HI8A 4JL0A 2YHEA 1ZU2A 3E34A 1N9AA 3HDXA 3U9WA 5EILA 4URKA 1MZCA 4W9RA 3KS2A 3SQVA 2H6IA 5B1BE 4HNAD 2L0TB 1U3CA 4ANWA 4DLQA 3QWWA 3JXJA 4GCNA 5JA4D 3RRUA 4JW1A 3ABME 1MQSA 1KT1A 2IONA 4BX9A 2Y1LE 3AG2E 3AJIA 3Q7AA 4RG6A 5KJLA 1ZB1A 2KCLA 3OTNA 4IULA 2LNIA 3FHEA 1SQMA 2VYIA 3IXEA 4MLPA 4WNGA 3ASGA 2WXHA 2RD0A 4GZ3A 4YNDA 2C0LA 1EPUA 3Q9NC 1H6OA 3AS4A 2OVFA 3BU8A 3MKQB 1ELWA 3NF1A 1SZAA 2WQHA 4BEPA 4N5CA 4J8FA 4XI0A 1Z3XA 3SNXA 2EIJE 3MCXA 5LX8A 2KATA 3L08A 1G3NB 3ZYMA 2RG8A 2J08A 3ZIMA 4AOFA 3Q79A 2HO1A 5KNGA 2F8XK 3DSVA 4G1TA 4LRZA 4DI4A 3PNTB 1O5MA 1Y6IA 3I5PA 1WDYA 1V54E 4G26A 4A55A 3K9IA 4YDWA 1DCQA 1JCRA 2I2OA 1A5EA 3DEPA 3S7BA 2HE0A 4K5CA 3ULEG 4GTQA 4WAFA 5FZRA 3MEKA 2WPVA 3RJVA 3Q47B 4DPRA 4L7TA 5FWQA 5JJ7A 1XNFA 4FP7A 1LD7A 3ZEFA 5BPPA 3AU5A 2E0IA 4I17A 4EZLA 4GTSA 3CK9A 4K0RA 3FUKA 4U07A 1UG3A 4ILGA 5M72A 2RFMA 2CFZA 4GYOA 4LG6A 5C1DA 3D9PA 3FUIA 3CSFA 2DWZA 4RVBA 2KZTA 2VGYA 3NBNB 1H2TC 1P5QA 1MYOA 3RRNB 3QKYA 3V31A 3FDHA 4UWHA 1JWFA 4YVQC 5AAOA 2WXNA 2WMOA 4PDXA 4XE0A 4U95D 4XI9A 5AJLA 2GRRB 4BERA 2PNNA 4HRMB 3UINC 4DJAA 1N11A 3ZU7B 2HR2A 3D9LA 4YDYA 2L6JA 1YA0A 3CK7A 3QOUA 3APDA 3DWLG 4DRXE 4NACA 5CBOA 3CVYA 4CEMA 3MKQA 4FLBA 5DBKA 4LNBA 4TUMA 4C0EA 2FO1E 5B1AE 4GZDA 2OOEA 3APCA 2VQ2A 1V55E 2PQRA 3UKRG 2XGOA 5ANRA 3SD5A 2VJ8A 4XKCA 5E75A 3DSWA 4G2VA 4WWOA 5BV1A 1TN6A 3PRZA 1O1RA 5FZSA 1NI1A 3WG7E 3I4GA 5DIZA 3UPVA 1HZ4A 1RW2A 4O6FA 3ZKJA 3B95A 3CVVA 4YDOA 4CDRA 3DPDA 1K3ZD 4AJWA 3FU3A 1N4QA 1TN8A 5B3SE 1E8ZA 1O1SA 3TL5A 1MX6A 5FQ7A 2IJGX 4B93B 2R05A 2YINA 2F0YA 4ABNA 1RZ4A 3FFLA 4GMLA 2MOWA 2AXZA 2QY7A 3D9OA 3C72A 3TAXA 3AG1E 4GTOA 3DXMG 2R59A 3U66A 2OEVA 1INZA 1HH8A 5HQ8A 4UWFA 5ANLA 3TXNA 3C5RA 1JCQA 4FC8A 4OAUC 2L6BA 4NIKA 4JZYA 3HIZA 4JC8A 3Q75A 4ACKA 4HQDA 2P58C 2XRYA 4U8HA 3PEUB 3HVEB 4AXHA 3HXEA 2R5SA 3FWVA 1H6PA 1HG5A 2CFUA 4GYYA 5CRVA 3CV0A 2P9KG 2LO6A 3T5VA 3BEEA 3EDTB 4JHKA 5CRUA 2P9LG 1H6KA 3Q7FA 4Q69A 3FH7A 4CCAA 2I6HA 1HE8A 4HOUA 1HS6A 3PUKA 4ZFHA 2XHEA 3VLFA 1IKND 3PH0C 3PVLA 4EECA 2WXQA 3BUAA 1IYGA 2E2EA 5KWDA 2ILRA 2XRZA 4J8DA 1XGWA 2L0IA 5HRYA 3RSEG 4V3IA 3ESLA 1TNZA 3ZPJA 4NRHB 4ANVA 4LNGA 2J9QA 1KLXA 4AM9A 2IEJA 3EHRA 3B7TA 2QFCA 4CRWA 1SA4A 4FLHA 3CGHA 3UT4A 4NURA 5AIJA 3ML9A 3FTXA 3T8KA 1Z5SC 2BF0X 3HXFA 3CEQA 4YVOA 3C98A 3EHQA 2P2CP 3NZUA 3TG5A 4K03A 1FVHA 5FQ4A 1HU3A 4GAAA 4B94A 3F6QA 3DBSA 4CYMD 2ZIRA 4JVSA 1EYHA 4DX6D 1KZPA 1QBQA 4J8SA 3UI2A 1B89A 3W9FA 2L9BA 5AQAA 3SZ7A 2Y4UA 4G23A 4JB8P 3ZXSA 2WXOA 4JA9A 3APFA 3VLEA 5A7DB 5CECB 3CVPA 2ZGGA 3CVQA 5T3RA 5ITZF 4I9CA 3G2UA 2I1JA 4ANUA 1E96B 5JHBA 4N39A 1S63A 1UN9A 1IQUA 4I2ZA 4YDEA 3T9KA 4GZ6A 2WMNA 4L9PA 3IKOB 1NA0A 3SF4A 3ASOE 1IHBA 2V4HC 2P9IG 1BLXB 3ZYKA 3UM3A 3UXGA 4H7YA 3HVEA 1JUQA 3OXGA 4F53A 3CKBA 4Q94A 2I1KA 3QDNA 1D8DA 5LCWC 5BXOA 4C9BB 2IOLA 2LXMA 1IHGA 3DRAA 1H2VC 4BFRA 3ZFWA 4Q96A 4I43A 1K1AA 2FBNA 3SGHA 4TV3A 4KXKB 2PZIA 4EQFA 3SBSA 2WXRA 4HOTA 3BQOA 5KJKA 2EINE 3PREA 4HLEA 2BTDA 2AXVA 4A3TA 4FU3A 4OYSA 3CLJA 3TGOA 3G2VA 3FU0A 3Q5MA 3PZDA 2X6FA 4EZJA 3KEAA 4JHRA 2NYJA 3QK0A 3ZUVB 1YYHA 1MX4A 3D9IA 3JUIA 2IU1A 3PNLB 4MKTA 2H6GA 2C2LA 3KSQA 1N4PA 4CT0A 2GROB 3T8MA 4HORA 3VTXA 2GRNB 4C48B 3DSUA 3ONKA 3AG4E 4XIFA 2KZTB 4KVOA 1SZ9A 2JABA 3FY4A 1WM5A 2XQ0A 2VGEA 3B7SA 2XEHA 1HO8A 4GTRA 4RG9A 5C2YA 3TWXA 3S7DA 3DSSA 2JEKA 1EDUA 1E8XA 3L54A 5J90A 3PE3A 4WNDA 3LKUA 3IEGA 5D66A 3Q15A 4JXTA 2R02A 4IRUA 2OCCE 4JEUA 3EU9A 3JUEA 1TNBA 4GU5A 3CK8A 4CDNA 3D9KA 2BKGA 3KD7A 3UX4A 3PZ4A 3FUJA 4KZ0A 2LSUA 4Z68A 2HM8A 3ZHEB 3AAAC 4IN3B 1NA3A 3FEYA 1NFIE 1OCZE 3GW4A 3FUNA 5AJDA 1N95A 2XENA 3DEOA 4OAVB 5EX0A 4UI9K 3CR3A 3CVUA 5CERB 2ETAA 1TNUA 3PZ2A 1SW6A 3SFXA 3E30A 2V8SE 3CVLA 2IQCA 3EHNA 5FTPA 4WWNA 2VSNA 4RSYA 3UMVA 3DXKG 3ABKE 3ENEA 3SHFA 1TEZA 4M7CA 1LD8A 4AP2A 4Y6WA 4Y6CA 3NQPA 1QYMA 3RO2A 2WXFA 3LVQE 3V2OA 2JLBA 3IHYA 5G05C 2EIKE 5LCWJ 3CVXA 4A1GA 5AQBA 4HS2A 2KCVA 3N71A 4ACLA 3W9GA 2BUGA 4ME2A 4P29A 4WNFA 2ONDA 1O1TA 1OCRE 3ML8A 3SFYA 2DVWA 4BX8A 4B0ZA 4AY5A 1DC2A 3KEZA 4N3BA 3FUEA 4BTBA 3JQ1A 4WWPA 1YCSB 4LSZE 4EPZA 1BI7B 2FEZA 1EF1C 2XGSA 2CHXA 2J09A 4QFVA 1UOHA 3CHMA 2XS8A 4JEHA 1NP7A 3TWWA 2P9NG 3UKUG 1OWNA 1Z3YA 4KBQA 4TRQA 2WQ6A 3FULA 4BT8A 3LDZA 2UY1B 1MJ0A 5CMWA 1X5BA 1NL4A 3O48A 4JD2G 1UJJA 2MYOA 4TXRA 3ZN3A 2J8SD 3S2AA 1BPOA 2Y69E 2CHZA 4CT4A 3ZHEA 1AWCB 3IBEA 3EHMA 2EQXA 4GPMA 2KCKA 4L1BA 4MRUA 4B8AA 3CQCB 5BNWA 4DLOA 1JWGA 2AW6A 3NZSA 4KT6B 2WXMA 4E85A 4AVXA 4TXQA 1DCEA 3EIQC 4WUYA 2NXPA 3NB2A 3EU5A 3L82A 1DNPA 4GZ5A 1U2VG 2XS1A 3HXCA 4GA2A 3B7RL 4BSXA 5A6CA 3I3NA 2XPYA 2LUHA 3C3QA 3UT8A 1S0PA 4F1PA 3FUMA 1BI8B 3ASDA 4UWGA 2I9CA 3TXMA 1FVFA 3LJNA 1SA5A 1OXJA 2V5QC 5KJMA 4N5QA 1D9SA 4AY6A 1IQRA 5D0OD 1Y8MA 3JQ0A 2OEWA 4APFA 5FQ6A 2XPZA 2GGFA 2GRLA 2XCCA 3HXBA 5ARFA 3MZLB 1VDYA 3U4TA 1N4SA 2PM7A 4I1AA 4GTPA 3TWTA 5E76A 5ENNA 2X6KA 5KBAA 1S70B 4DX1A 3TJPA 2DCPA 1TR4A 3ISMC 4MS6A 4ANXA 4C0MA 1OWLA 2DZOA 1PAQA 3TWRA 3UUXA 2UY1A 2FI7A 2NC9A 5EYLA 1OY3D 1WG0A 5G05J 1N0QA 4GMJA 2WXIA 3C3RA 3L13A 3VTYA 4JHJA 1A17A 3TWUA 3HHMA 1AP7A 4TUUA 5T4YA 2Q7FA 4B89A 3CSTA 3S7FA 2WXGA 5FJYA 2IF4A 2X38A 2DYRE 1MX2A 5EKQD 4U0UA 5LFAA 2X6IA 1LF8A 3QAQA 2DIWA 4I6GA 4GMRA 4F6RD 1OUVA 1TNOA 3U3WA 2KXPC 3ZYQA 2IO2C 3D9MA 5BXUA 3LEWA 4GTTA 3LY8A 3O4ZA 4UWLA 3EUVA 5H7PA 1H19A 2B6CA 2BKKB 1N54A 4LCTA 4BTAA 5AQ9A 3GYZA 2YNQA 2F37A 4GA0A 1N94A 2XEVA 3CKCA 1KPSB 3L17A 5CCLA 4AV7A 4DUIA 2WQ7A 4HRLA 3BG0B 3TWSA 5KNHD 2LSVA 4CGVA 3D9HA 1HFAA 4DK5A 4UQZA 4HLLA 5ARGA 2P9UG 1U3DA 3R7RA 3RKVA 2WXKA 2XCBA 3ZGQA 1OWPA 1UN8A 4PS7A 2VSXE 4F3VA 3CVNA 3Q78A 3J5PA 2H6HA 5J08A 4DX5D 3X2QE 2DYSE 5IY5E 4U0SA 2VSYA 4EBAA 1IXVA 2XEEA 4PUCA 2CG2A 2B0OE 3G2WA 3UT7A 3PS6A 1FPPA 4HBDA 1ELKA 2LXLA 1JCSA 3PZ1A 3Q49B 5G55A 3UM0A 4L2LA 4GYWA 3D9NA 1L5JA 3FUDA 4D10C 5EDSA 3CHQA 2XPIA 4B8CB 4XEIG 1KZOA 1K8KG 3LY9A 3ZW3A 2EILE 2IO3C 2QYJA 3QWPA 3CIAA 5FT9A 3SY2A 3QARA 4DX7D 3Q4AB 3B7BA 2WB2A 3B13A 3G2TA 2A5UA 3PEVB 4XZ4A 4A1SA 2Y3AA 4I1OB 4FULA 4ILIA 2R17C 2LAIA 1HXIA 3AG3E 1E7UA 4J8EA 4FHJA 2DZNA 3PE4A 4JA7A 3BG1B 4APOA 5FZQA 4DX2A 2A5EA 1K1BA 4N3CA 2AJAA 4U0ZA 5JJTA 4BY6A 5KJNA 2X6JA 5HI7A 4QQIA 4K5BA 2A4ZA 3L6AA 2GRPB 1TN7A 1N52A 3L22A 1DVPA 5HS0A 5HKPA 3JCKC 2FF4A 4IYPA 4A3VA 3FTSA 3LY7A 4J0UA 3AS5A 5FQ8A 3UIPC 4FADA 3G2SA 3QNKA 5CHEE 3E4BA 3PUJA 4R7LA 3FUFA 4UI9C 4ILHB 3ONLA 4BT9A 2WXJA 5G2NA 1S64A 3ULQA 4XKBA 5LP0A 2QZAA 4H7XA 1UJKA 4UQYA 2OVBA 3L16A 3RU0A 1ELRA 1Z6TA 1FCHA 2MRIA 4EZKA 3JXIA 3CHRA 3V30A 3R9MA 3MYVA 5ENRD 3AU4A 4UUCA 2ETBA 2VSOE 3RK6A 3FH8A 1PY1A 4AIFA 2Y0BG 2QYUA 2V4LA 1N4RA 2AVPA 2J4BA 5JJ6A 4HB5A 3IHVA 4U8YD 5KCMA 3LYAA 3HXDA 1OWMA 5CEAA 3FUHA 5D2MC 3GZ2A 4O1OA 4JPSA 4GZCA 2V5FA 2IOSA 3MV3B 4FHKA 2CG3A 2GRQB 1H0AA 5CCMA 5JHAA
chains in the Genus database with same CATH topology
5CECB 5EILA 3ZUVB 4TUMA 1MJ0A 2ETAA 3DEPA 5CERB 2ZGGA 1YYHA 2FO1E 1MX4A 2KXPC 2HE0A 4K5CA 1SW6A 4HNAD 1SVXA 4J7WA 5ENQD 4O1PA 4ZHBA 1IXVA 5ITZF 5ENOD 2XEEA 4K5AB 5BXUA 2MYOA 3J5QB 2B0OE 3JXJA 5JA4D 4RLYA 3UTMA 2J8SD 1YMPA 4HBDA 4BETA 3HG0D 2Y1LE 5FIOA 2BKKB 3T9KA 4ZFHA 3AJIA 5AQ7A 4HRNA 3TWTA 1AWCB 4C48B 3TWQA 1IKND 5ENSD 4CZ2D 1IHBA 2XZTG 4LNUD 5KBAA 5KWDA 2V4HC 5AQ9A 3IXEA 5CBNA 1S70B 5HRYA 3ZKJA 2JABA 4GPMA 4DX1A 3V79K 1BLXB 1TR4A 2RFMA 3UXGA 2VGEA 1QYMA 4LG6A 2DZOA 3B95A 5AARA 3JXIA 1BU9A 2XEHA 2F37A 2QYJA 5EN5D 3EHRA 3TWRA 4ATZD 3V2OA 3NOGD 3V30A 4U8VD 3TWXA 2DWZA 1K3ZD 5EYLA 1OY3D 5ENRD 1WG0A 3Q9NC 5ENTD 3NBNB 1N0QA 4DX7D 4UUCA 5BXOA 4DUIA 3B7BA 2ETBA 4HRLA 2XZDG 5AQBA 2KBXA 1MX6A 1MYOA 1BD8A 3TWSA 4B93B 5D66A 3T8KA 3V31A 2RFAA 5ENPD 3W9GA 4BEPA 4BESA 5KNHD 2Y0BG 5AAOA 3ZNGA 1K1AA 3D9HA 5CEDB 3EU9A 3NOCD 3JUEA 3SO8A 4U95D 4G8LA 2DZNA 4BSZB 2DVWA 3HRAA 3EHQA 4G8KA 4HLLA 3TWUA 2BKGA 2P2CP 4BERA 1AP7A 2PNNA 2QC9A 4HB5A 4U8YD 1DC2A 4HRMB 1G3NB 4J8YA 5FINA 1N0RA 4A63B 4DX2A 1N11A 3ZU7B 2ETCA 5EIBE 2A5EA 2F8YA 3F6QA 1K1BA 4Z68A 4CYMD 1YCSB 4YDYA 5EIDA 1OT8A 2AJAA 4LSZE 1MX2A 5CEAA 1BI7B 3AAAC 4DX6D 3C5RA 4QFVA 4F1PA 3V2XA 4OAUC 1BI8B 1UOHA 2L6BA 4NIKA 4O1OA 1NFIE 4DRXE 4QQIA 4K5BA 5KNGA 4U96D 3UI2A 2F8XK 5JMND 4O60A 3W9FA 2ZGDA 4HQDA 3TWVA 4HI9A 5CBOA 2XENA 3DEOA 3J5PA 3TWWA 3LJNA 5EYPF 4HI8A 5AQAA 1WDYA 4OAVB 4YDWA 2V5QC 5AN8A 5HS0A 4DX5D 1DCQA 4JB8P 5HKPA 4N5QA 1D9SA 3KEAA 4GMRA 4F6RD 1A5EA 3Q9UC 2NYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEC B;  5EIL A;  3ZUV B;  4TUM A;  1MJ0 A;  2ETA A;  3DEP A;  5CER B;  2ZGG A;  1YYH A;  2FO1 E;  1MX4 A;  2KXP C;  2HE0 A;  4K5C A;  1SW6 A;  4HNA D;  1SVX A;  4J7W A;  5ENQ D;  4O1P A;  4ZHB A;  1IXV A;  5ITZ F;  5ENO D;  2XEE A;  4K5A B;  5BXU A;  2MYO A;  3J5Q B;  2B0O E;  3JXJ A;  5JA4 D;  4RLY A;  3UTM A;  2J8S D;  1YMP A;  4HBD A;  4BET A;  3HG0 D;  2Y1L E;  5FIO A;  2BKK B;  3T9K A;  4ZFH A;  3AJI A;  5AQ7 A;  4HRN A;  3TWT A;  1AWC B;  4C48 B;  3TWQ A;  1IKN D;  5ENS D;  4CZ2 D;  1IHB A;  2XZT G;  4LNU D;  5KBA A;  5KWD A;  2V4H C;  5AQ9 A;  3IXE A;  5CBN A;  1S70 B;  5HRY A;  3ZKJ A;  2JAB A;  4GPM A;  4DX1 A;  3V79 K;  1BLX B;  1TR4 A;  2RFM A;  3UXG A;  2VGE A;  1QYM A;  4LG6 A;  2DZO A;  3B95 A;  5AAR A;  3JXI A;  1BU9 A;  2XEH A;  2F37 A;  2QYJ A;  5EN5 D;  3EHR A;  3TWR A;  4ATZ D;  3V2O A;  3NOG D;  3V30 A;  4U8V D;  3TWX A;  2DWZ A;  1K3Z D;  5EYL A;  1OY3 D;  5ENR D;  1WG0 A;  3Q9N C;  5ENT D;  3NBN B;  1N0Q A;  4DX7 D;  4UUC A;  5BXO A;  4DUI A;  3B7B A;  2ETB A;  4HRL A;  2XZD G;  5AQB A;  2KBX A;  1MX6 A;  1MYO A;  1BD8 A;  3TWS A;  4B93 B;  5D66 A;  3T8K A;  3V31 A;  2RFA A;  5ENP D;  3W9G A;  4BEP A;  4BES A;  5KNH D;  2Y0B G;  5AAO A;  3ZNG A;  1K1A A;  3D9H A;  5CED B;  3EU9 A;  3NOC D;  3JUE A;  3SO8 A;  4U95 D;  4G8L A;  2DZN A;  4BSZ B;  2DVW A;  3HRA A;  3EHQ A;  4G8K A;  4HLL A;  3TWU A;  2BKG A;  2P2C P;  4BER A;  1AP7 A;  2PNN A;  2QC9 A;  4HB5 A;  4U8Y D;  1DC2 A;  4HRM B;  1G3N B;  4J8Y A;  5FIN A;  1N0R A;  4A63 B;  4DX2 A;  1N11 A;  3ZU7 B;  2ETC A;  5EIB E;  2A5E A;  2F8Y A;  3F6Q A;  1K1B A;  4Z68 A;  4CYM D;  1YCS B;  4YDY A;  5EID A;  1OT8 A;  2AJA A;  4LSZ E;  1MX2 A;  5CEA A;  1BI7 B;  3AAA C;  4DX6 D;  3C5R A;  4QFV A;  4F1P A;  3V2X A;  4OAU C;  1BI8 B;  1UOH A;  2L6B A;  4NIK A;  4O1O A;  1NFI E;  4DRX E;  4QQI A;  4K5B A;  5KNG A;  4U96 D;  3UI2 A;  2F8X K;  5JMN D;  4O60 A;  3W9F A;  2ZGD A;  4HQD A;  3TWV A;  4HI9 A;  5CBO A;  2XEN A;  3DEO A;  3J5P A;  3TWW A;  3LJN A;  5EYP F;  4HI8 A;  5AQA A;  1WDY A;  4OAV B;  4YDW A;  2V5Q C;  5AN8 A;  5HS0 A;  4DX5 D;  1DCQ A;  4JB8 P;  5HKP A;  4N5Q A;  1D9S A;  3KEA A;  4GMR A;  4F6R D;  1A5E A;  3Q9U C;  2NYJ A; 
#chains in the Genus database with same CATH topology
 3FTV A;  4J7W A;  2Y4T A;  2CHW A;  2P9S G;  5ENO D;  3RIB A;  3UTM A;  3HG0 D;  4DI3 A;  2PM6 A;  3MGB A;  3ESK A;  3TWQ A;  2WXL A;  2X3M A;  2VGX B;  3PDN A;  2V0P A;  4I2W A;  5CBN A;  3SI5 A;  2VTB B;  3FU6 A;  3LXU X;  3U64 A;  4LEU A;  3FH5 A;  4PS3 A;  1BU9 A;  3QJZ A;  5AYW D;  5EN5 D;  3NOG D;  4U7E B;  4PH4 B;  4BES A;  4N3A A;  1TNY A;  4I1M A;  3ZNG A;  3S7J A;  3NOC D;  2OV8 A;  3OAW A;  4I6J A;  4G8L A;  5G04 C;  3L9T A;  2J49 A;  1OCO E;  5FIN A;  4PS8 A;  3ZXP A;  1FT1 A;  5EID A;  1OT8 A;  3ZYL A;  2EIM E;  3V2X A;  4GCO A;  3SFZ A;  2M63 A;  4X8Q A;  5BUZ A;  1HF8 A;  3T5X A;  4E6H A;  3ASF A;  3UM2 A;  1ZBP A;  2BED A;  4ZHB A;  1E90 A;  3FP3 A;  4GTV A;  4KZC A;  1QQE A;  4RLY A;  4EBA G;  2J4D A;  4BWR A;  2YHC A;  1YMP A;  5A23 A;  4HXI A;  3JYS A;  4UI9 J;  4L2Y A;  2P9P G;  1E7V A;  3LJ3 A;  3CHO A;  3QWV A;  3FTY A;  3CHS A;  4LNU D;  3MV2 B;  1HG2 A;  3D3M A;  1PC2 A;  1JPL A;  3LVR E;  3ABL E;  5AEN A;  4KYO B;  2XGM A;  4FJY A;  4RQI A;  4UWK A;  5ENT D;  3E37 A;  3FU5 A;  4N2S A;  4WNE A;  4XX5 A;  5ENP D;  1X81 A;  3FTZ A;  4U63 A;  2HYZ A;  4J6I A;  3SO8 A;  3OXL A;  3NAW A;  2VGX A;  3ZRH A;  3MJW A;  1TJC A;  1N0R A;  2WVI A;  3C3O A;  4G24 A;  2ETC A;  2MHK A;  2VTB A;  2F8Y A;  2GRM A;  5LOZ A;  4CGW A;  1W3B A;  2FO7 A;  3CVW A;  2H6F A;  1E8Y A;  3FEX A;  4L23 A;  4HI9 A;  1NZN A;  5EYP F;  2UWJ G;  3HYM B;  5AN8 A;  3R9A B;  3DSX A;  3Q9U C;  3FTU A;  3DST A;  1SVX A;  2X6H A;  5ENQ D;  3FTW A;  2GW1 A;  1E8W A;  2KM4 A;  1H2U A;  2KC7 A;  4BET A;  5T8I A;  3URZ A;  2WXP A;  3Q73 A;  2ZXW E;  4KVM A;  3D9J A;  4F1S A;  4CZ2 D;  3P2B A;  4NQ0 A;  3V79 K;  3R7Q A;  5BV0 A;  2PQN A;  5AAR A;  3QB2 A;  3P1U A;  4ATZ D;  1HX8 A;  4I9E A;  2IFU A;  3QC1 A;  2AXU A;  2IY0 C;  1QNF A;  1QZ2 A;  3MKR A;  2XZD G;  2KBX A;  1D8E A;  1BD8 A;  3LPZ A;  4FJZ A;  4ATG A;  4HOQ A;  4OVV A;  2DBA A;  3MA5 A;  4UQX A;  2R03 A;  5CED B;  3RRM B;  2AWI A;  4EHM A;  5G04 J;  4BSZ B;  3MX3 A;  3TG4 A;  3HRA A;  1WAO 1;  4G8K A;  2WM9 A;  3KSL A;  3EJN A;  4HVB A;  1FT2 A;  3B7U X;  1OCC E;  4A63 B;  3RAU A;  4G11 A;  3LCA A;  3OXF A;  5EIB E;  3UQ3 A;  3I4R B;  3IV0 A;  2RKK A;  3SBT B;  2NSZ A;  3RO3 A;  3KAE A;  3E32 A;  4U04 A;  3DPY A;  1Q2Z A;  3LS8 A;  3PZ3 A;  4G25 A;  4GTM A;  3CQG B;  4FA6 A;  3UIO C;  1LTX A;  3ASH A;  4LER A;  3VLD A;  4O1P A;  4I6E A;  1TJF A;  4K5A B;  3J5Q B;  5BW8 C;  4MBG A;  2J07 A;  3ZVV A;  4OVU A;  2PL2 A;  5FIO A;  2LAH A;  3EIJ A;  3GZS A;  5AQ7 A;  3UM1 A;  4HRN A;  3AS8 A;  1WY6 A;  5ENS D;  5D0Q D;  2XZT G;  4AEZ C;  2R2L A;  2FUL A;  3ASN E;  3GZ1 A;  1OWO A;  4U8V D;  4LUN U;  4GB9 A;  1KT0 A;  1GW6 A;  2ZU6 B;  5BT1 A;  4F7A A;  2RFA A;  1TYQ G;  5CMY A;  4GPK A;  4HFG A;  5EX3 A;  2QC9 A;  4KMO A;  3WXX A;  4N2Q A;  4J8Y A;  4GA1 A;  4HOS A;  2ZIS A;  4CDM A;  2YQ8 A;  3E33 A;  3ULY A;  2C0M A;  4M3O A;  1MHQ A;  4U96 D;  5JMN D;  3CHP A;  4O60 A;  1UW4 B;  2ZGD A;  4TXP A;  3TWV A;  4HI8 A;  4JL0 A;  2YHE A;  1ZU2 A;  3E34 A;  1N9A A;  3HDX A;  3U9W A;  5EIL A;  4URK A;  1MZC A;  4W9R A;  3KS2 A;  3SQV A;  2H6I A;  5B1B E;  4HNA D;  2L0T B;  1U3C A;  4ANW A;  4DLQ A;  3QWW A;  3JXJ A;  4GCN A;  5JA4 D;  3RRU A;  4JW1 A;  3ABM E;  1MQS A;  1KT1 A;  2ION A;  4BX9 A;  2Y1L E;  3AG2 E;  3AJI A;  3Q7A A;  4RG6 A;  5KJL A;  1ZB1 A;  2KCL A;  3OTN A;  4IUL A;  2LNI A;  3FHE A;  1SQM A;  2VYI A;  3IXE A;  4MLP A;  4WNG A;  3ASG A;  2WXH A;  2RD0 A;  4GZ3 A;  4YND A;  2C0L A;  1EPU A;  3Q9N C;  1H6O A;  3AS4 A;  2OVF A;  3BU8 A;  3MKQ B;  1ELW A;  3NF1 A;  1SZA A;  2WQH A;  4BEP A;  4N5C A;  4J8F A;  4XI0 A;  1Z3X A;  3SNX A;  2EIJ E;  3MCX A;  5LX8 A;  2KAT A;  3L08 A;  1G3N B;  3ZYM A;  2RG8 A;  2J08 A;  3ZIM A;  4AOF A;  3Q79 A;  2HO1 A;  5KNG A;  2F8X K;  3DSV A;  4G1T A;  4LRZ A;  4DI4 A;  3PNT B;  1O5M A;  1Y6I A;  3I5P A;  1WDY A;  1V54 E;  4G26 A;  4A55 A;  3K9I A;  4YDW A;  1DCQ A;  1JCR A;  2I2O A;  1A5E A;  3DEP A;  3S7B A;  2HE0 A;  4K5C A;  3ULE G;  4GTQ A;  4WAF A;  5FZR A;  3MEK A;  2WPV A;  3RJV A;  3Q47 B;  4DPR A;  4L7T A;  5FWQ A;  5JJ7 A;  1XNF A;  4FP7 A;  1LD7 A;  3ZEF A;  5BPP A;  3AU5 A;  2E0I A;  4I17 A;  4EZL A;  4GTS A;  3CK9 A;  4K0R A;  3FUK A;  4U07 A;  1UG3 A;  4ILG A;  5M72 A;  2RFM A;  2CFZ A;  4GYO A;  4LG6 A;  5C1D A;  3D9P A;  3FUI A;  3CSF A;  2DWZ A;  4RVB A;  2KZT A;  2VGY A;  3NBN B;  1H2T C;  1P5Q A;  1MYO A;  3RRN B;  3QKY A;  3V31 A;  3FDH A;  4UWH A;  1JWF A;  4YVQ C;  5AAO A;  2WXN A;  2WMO A;  4PDX A;  4XE0 A;  4U95 D;  4XI9 A;  5AJL A;  2GRR B;  4BER A;  2PNN A;  4HRM B;  3UIN C;  4DJA A;  1N11 A;  3ZU7 B;  2HR2 A;  3D9L A;  4YDY A;  2L6J A;  1YA0 A;  3CK7 A;  3QOU A;  3APD A;  3DWL G;  4DRX E;  4NAC A;  5CBO A;  3CVY A;  4CEM A;  3MKQ A;  4FLB A;  5DBK A;  4LNB A;  4TUM A;  4C0E A;  2FO1 E;  5B1A E;  4GZD A;  2OOE A;  3APC A;  2VQ2 A;  1V55 E;  2PQR A;  3UKR G;  2XGO A;  5ANR A;  3SD5 A;  2VJ8 A;  4XKC A;  5E75 A;  3DSW A;  4G2V A;  4WWO A;  5BV1 A;  1TN6 A;  3PRZ A;  1O1R A;  5FZS A;  1NI1 A;  3WG7 E;  3I4G A;  5DIZ A;  3UPV A;  1HZ4 A;  1RW2 A;  4O6F A;  3ZKJ A;  3B95 A;  3CVV A;  4YDO A;  4CDR A;  3DPD A;  1K3Z D;  4AJW A;  3FU3 A;  1N4Q A;  1TN8 A;  5B3S E;  1E8Z A;  1O1S A;  3TL5 A;  1MX6 A;  5FQ7 A;  2IJG X;  4B93 B;  2R05 A;  2YIN A;  2F0Y A;  4ABN A;  1RZ4 A;  3FFL A;  4GML A;  2MOW A;  2AXZ A;  2QY7 A;  3D9O A;  3C72 A;  3TAX A;  3AG1 E;  4GTO A;  3DXM G;  2R59 A;  3U66 A;  2OEV A;  1INZ A;  1HH8 A;  5HQ8 A;  4UWF A;  5ANL A;  3TXN A;  3C5R A;  1JCQ A;  4FC8 A;  4OAU C;  2L6B A;  4NIK A;  4JZY A;  3HIZ A;  4JC8 A;  3Q75 A;  4ACK A;  4HQD A;  2P58 C;  2XRY A;  4U8H A;  3PEU B;  3HVE B;  4AXH A;  3HXE A;  2R5S A;  3FWV A;  1H6P A;  1HG5 A;  2CFU A;  4GYY A;  5CRV A;  3CV0 A;  2P9K G;  2LO6 A;  3T5V A;  3BEE A;  3EDT B;  4JHK A;  5CRU A;  2P9L G;  1H6K A;  3Q7F A;  4Q69 A;  3FH7 A;  4CCA A;  2I6H A;  1HE8 A;  4HOU A;  1HS6 A;  3PUK A;  4ZFH A;  2XHE A;  3VLF A;  1IKN D;  3PH0 C;  3PVL A;  4EEC A;  2WXQ A;  3BUA A;  1IYG A;  2E2E A;  5KWD A;  2ILR A;  2XRZ A;  4J8D A;  1XGW A;  2L0I A;  5HRY A;  3RSE G;  4V3I A;  3ESL A;  1TNZ A;  3ZPJ A;  4NRH B;  4ANV A;  4LNG A;  2J9Q A;  1KLX A;  4AM9 A;  2IEJ A;  3EHR A;  3B7T A;  2QFC A;  4CRW A;  1SA4 A;  4FLH A;  3CGH A;  3UT4 A;  4NUR A;  5AIJ A;  3ML9 A;  3FTX A;  3T8K A;  1Z5S C;  2BF0 X;  3HXF A;  3CEQ A;  4YVO A;  3C98 A;  3EHQ A;  2P2C P;  3NZU A;  3TG5 A;  4K03 A;  1FVH A;  5FQ4 A;  1HU3 A;  4GAA A;  4B94 A;  3F6Q A;  3DBS A;  4CYM D;  2ZIR A;  4JVS A;  1EYH A;  4DX6 D;  1KZP A;  1QBQ A;  4J8S A;  3UI2 A;  1B89 A;  3W9F A;  2L9B A;  5AQA A;  3SZ7 A;  2Y4U A;  4G23 A;  4JB8 P;  3ZXS A;  2WXO A;  4JA9 A;  3APF A;  3VLE A;  5A7D B;  5CEC B;  3CVP A;  2ZGG A;  3CVQ A;  5T3R A;  5ITZ F;  4I9C A;  3G2U A;  2I1J A;  4ANU A;  1E96 B;  5JHB A;  4N39 A;  1S63 A;  1UN9 A;  1IQU A;  4I2Z A;  4YDE A;  3T9K A;  4GZ6 A;  2WMN A;  4L9P A;  3IKO B;  1NA0 A;  3SF4 A;  3ASO E;  1IHB A;  2V4H C;  2P9I G;  1BLX B;  3ZYK A;  3UM3 A;  3UXG A;  4H7Y A;  3HVE A;  1JUQ A;  3OXG A;  4F53 A;  3CKB A;  4Q94 A;  2I1K A;  3QDN A;  1D8D A;  5LCW C;  5BXO A;  4C9B B;  2IOL A;  2LXM A;  1IHG A;  3DRA A;  1H2V C;  4BFR A;  3ZFW A;  4Q96 A;  4I43 A;  1K1A A;  2FBN A;  3SGH A;  4TV3 A;  4KXK B;  2PZI A;  4EQF A;  3SBS A;  2WXR A;  4HOT A;  3BQO A;  5KJK A;  2EIN E;  3PRE A;  4HLE A;  2BTD A;  2AXV A;  4A3T A;  4FU3 A;  4OYS A;  3CLJ A;  3TGO A;  3G2V A;  3FU0 A;  3Q5M A;  3PZD A;  2X6F A;  4EZJ A;  3KEA A;  4JHR A;  2NYJ A;  3QK0 A;  3ZUV B;  1YYH A;  1MX4 A;  3D9I A;  3JUI A;  2IU1 A;  3PNL B;  4MKT A;  2H6G A;  2C2L A;  3KSQ A;  1N4P A;  4CT0 A;  2GRO B;  3T8M A;  4HOR A;  3VTX A;  2GRN B;  4C48 B;  3DSU A;  3ONK A;  3AG4 E;  4XIF A;  2KZT B;  4KVO A;  1SZ9 A;  2JAB A;  3FY4 A;  1WM5 A;  2XQ0 A;  2VGE A;  3B7S A;  2XEH A;  1HO8 A;  4GTR A;  4RG9 A;  5C2Y A;  3TWX A;  3S7D A;  3DSS A;  2JEK A;  1EDU A;  1E8X A;  3L54 A;  5J90 A;  3PE3 A;  4WND A;  3LKU A;  3IEG A;  5D66 A;  3Q15 A;  4JXT A;  2R02 A;  4IRU A;  2OCC E;  4JEU A;  3EU9 A;  3JUE A;  1TNB A;  4GU5 A;  3CK8 A;  4CDN A;  3D9K A;  2BKG A;  3KD7 A;  3UX4 A;  3PZ4 A;  3FUJ A;  4KZ0 A;  2LSU A;  4Z68 A;  2HM8 A;  3ZHE B;  3AAA C;  4IN3 B;  1NA3 A;  3FEY A;  1NFI E;  1OCZ E;  3GW4 A;  3FUN A;  5AJD A;  1N95 A;  2XEN A;  3DEO A;  4OAV B;  5EX0 A;  4UI9 K;  3CR3 A;  3CVU A;  5CER B;  2ETA A;  1TNU A;  3PZ2 A;  1SW6 A;  3SFX A;  3E30 A;  2V8S E;  3CVL A;  2IQC A;  3EHN A;  5FTP A;  4WWN A;  2VSN A;  4RSY A;  3UMV A;  3DXK G;  3ABK E;  3ENE A;  3SHF A;  1TEZ A;  4M7C A;  1LD8 A;  4AP2 A;  4Y6W A;  4Y6C A;  3NQP A;  1QYM A;  3RO2 A;  2WXF A;  3LVQ E;  3V2O A;  2JLB A;  3IHY A;  5G05 C;  2EIK E;  5LCW J;  3CVX A;  4A1G A;  5AQB A;  4HS2 A;  2KCV A;  3N71 A;  4ACL A;  3W9G A;  2BUG A;  4ME2 A;  4P29 A;  4WNF A;  2OND A;  1O1T A;  1OCR E;  3ML8 A;  3SFY A;  2DVW A;  4BX8 A;  4B0Z A;  4AY5 A;  1DC2 A;  3KEZ A;  4N3B A;  3FUE A;  4BTB A;  3JQ1 A;  4WWP A;  1YCS B;  4LSZ E;  4EPZ A;  1BI7 B;  2FEZ A;  1EF1 C;  2XGS A;  2CHX A;  2J09 A;  4QFV A;  1UOH A;  3CHM A;  2XS8 A;  4JEH A;  1NP7 A;  3TWW A;  2P9N G;  3UKU G;  1OWN A;  1Z3Y A;  4KBQ A;  4TRQ A;  2WQ6 A;  3FUL A;  4BT8 A;  3LDZ A;  2UY1 B;  1MJ0 A;  5CMW A;  1X5B A;  1NL4 A;  3O48 A;  4JD2 G;  1UJJ A;  2MYO A;  4TXR A;  3ZN3 A;  2J8S D;  3S2A A;  1BPO A;  2Y69 E;  2CHZ A;  4CT4 A;  3ZHE A;  1AWC B;  3IBE A;  3EHM A;  2EQX A;  4GPM A;  2KCK A;  4L1B A;  4MRU A;  4B8A A;  3CQC B;  5BNW A;  4DLO A;  1JWG A;  2AW6 A;  3NZS A;  4KT6 B;  2WXM A;  4E85 A;  4AVX A;  4TXQ A;  1DCE A;  3EIQ C;  4WUY A;  2NXP A;  3NB2 A;  3EU5 A;  3L82 A;  1DNP A;  4GZ5 A;  1U2V G;  2XS1 A;  3HXC A;  4GA2 A;  3B7R L;  4BSX A;  5A6C A;  3I3N A;  2XPY A;  2LUH A;  3C3Q A;  3UT8 A;  1S0P A;  4F1P A;  3FUM A;  1BI8 B;  3ASD A;  4UWG A;  2I9C A;  3TXM A;  1FVF A;  3LJN A;  1SA5 A;  1OXJ A;  2V5Q C;  5KJM A;  4N5Q A;  1D9S A;  4AY6 A;  1IQR A;  5D0O D;  1Y8M A;  3JQ0 A;  2OEW A;  4APF A;  5FQ6 A;  2XPZ A;  2GGF A;  2GRL A;  2XCC A;  3HXB A;  5ARF A;  3MZL B;  1VDY A;  3U4T A;  1N4S A;  2PM7 A;  4I1A A;  4GTP A;  3TWT A;  5E76 A;  5ENN A;  2X6K A;  5KBA A;  1S70 B;  4DX1 A;  3TJP A;  2DCP A;  1TR4 A;  3ISM C;  4MS6 A;  4ANX A;  4C0M A;  1OWL A;  2DZO A;  1PAQ A;  3TWR A;  3UUX A;  2UY1 A;  2FI7 A;  2NC9 A;  5EYL A;  1OY3 D;  1WG0 A;  5G05 J;  1N0Q A;  4GMJ A;  2WXI A;  3C3R A;  3L13 A;  3VTY A;  4JHJ A;  1A17 A;  3TWU A;  3HHM A;  1AP7 A;  4TUU A;  5T4Y A;  2Q7F A;  4B89 A;  3CST A;  3S7F A;  2WXG A;  5FJY A;  2IF4 A;  2X38 A;  2DYR E;  1MX2 A;  5EKQ D;  4U0U A;  5LFA A;  2X6I A;  1LF8 A;  3QAQ A;  2DIW A;  4I6G A;  4GMR A;  4F6R D;  1OUV A;  1TNO A;  3U3W A;  2KXP C;  3ZYQ A;  2IO2 C;  3D9M A;  5BXU A;  3LEW A;  4GTT A;  3LY8 A;  3O4Z A;  4UWL A;  3EUV A;  5H7P A;  1H19 A;  2B6C A;  2BKK B;  1N54 A;  4LCT A;  4BTA A;  5AQ9 A;  3GYZ A;  2YNQ A;  2F37 A;  4GA0 A;  1N94 A;  2XEV A;  3CKC A;  1KPS B;  3L17 A;  5CCL A;  4AV7 A;  4DUI A;  2WQ7 A;  4HRL A;  3BG0 B;  3TWS A;  5KNH D;  2LSV A;  4CGV A;  3D9H A;  1HFA A;  4DK5 A;  4UQZ A;  4HLL A;  5ARG A;  2P9U G;  1U3D A;  3R7R A;  3RKV A;  2WXK A;  2XCB A;  3ZGQ A;  1OWP A;  1UN8 A;  4PS7 A;  2VSX E;  4F3V A;  3CVN A;  3Q78 A;  3J5P A;  2H6H A;  5J08 A;  4DX5 D;  3X2Q E;  2DYS E;  5IY5 E;  4U0S A;  2VSY A;  4EBA A;  1IXV A;  2XEE A;  4PUC A;  2CG2 A;  2B0O E;  3G2W A;  3UT7 A;  3PS6 A;  1FPP A;  4HBD A;  1ELK A;  2LXL A;  1JCS A;  3PZ1 A;  3Q49 B;  5G55 A;  3UM0 A;  4L2L A;  4GYW A;  3D9N A;  1L5J A;  3FUD A;  4D10 C;  5EDS A;  3CHQ A;  2XPI A;  4B8C B;  4XEI G;  1KZO A;  1K8K G;  3LY9 A;  3ZW3 A;  2EIL E;  2IO3 C;  2QYJ A;  3QWP A;  3CIA A;  5FT9 A;  3SY2 A;  3QAR A;  4DX7 D;  3Q4A B;  3B7B A;  2WB2 A;  3B13 A;  3G2T A;  2A5U A;  3PEV B;  4XZ4 A;  4A1S A;  2Y3A A;  4I1O B;  4FUL A;  4ILI A;  2R17 C;  2LAI A;  1HXI A;  3AG3 E;  1E7U A;  4J8E A;  4FHJ A;  2DZN A;  3PE4 A;  4JA7 A;  3BG1 B;  4APO A;  5FZQ A;  4DX2 A;  2A5E A;  1K1B A;  4N3C A;  2AJA A;  4U0Z A;  5JJT A;  4BY6 A;  5KJN A;  2X6J A;  5HI7 A;  4QQI A;  4K5B A;  2A4Z A;  3L6A A;  2GRP B;  1TN7 A;  1N52 A;  3L22 A;  1DVP A;  5HS0 A;  5HKP A;  3JCK C;  2FF4 A;  4IYP A;  4A3V A;  3FTS A;  3LY7 A;  4J0U A;  3AS5 A;  5FQ8 A;  3UIP C;  4FAD A;  3G2S A;  3QNK A;  5CHE E;  3E4B A;  3PUJ A;  4R7L A;  3FUF A;  4UI9 C;  4ILH B;  3ONL A;  4BT9 A;  2WXJ A;  5G2N A;  1S64 A;  3ULQ A;  4XKB A;  5LP0 A;  2QZA A;  4H7X A;  1UJK A;  4UQY A;  2OVB A;  3L16 A;  3RU0 A;  1ELR A;  1Z6T A;  1FCH A;  2MRI A;  4EZK A;  3JXI A;  3CHR A;  3V30 A;  3R9M A;  3MYV A;  5ENR D;  3AU4 A;  4UUC A;  2ETB A;  2VSO E;  3RK6 A;  3FH8 A;  1PY1 A;  4AIF A;  2Y0B G;  2QYU A;  2V4L A;  1N4R A;  2AVP A;  2J4B A;  5JJ6 A;  4HB5 A;  3IHV A;  4U8Y D;  5KCM A;  3LYA A;  3HXD A;  1OWM A;  5CEA A;  3FUH A;  5D2M C;  3GZ2 A;  4O1O A;  4JPS A;  4GZC A;  2V5F A;  2IOS A;  3MV3 B;  4FHK A;  2CG3 A;  2GRQ B;  1H0A A;  5CCM A;  5JHA A; 
#chains in the Genus database with same CATH homology
 5CEC B;  5EIL A;  3ZUV B;  4TUM A;  1MJ0 A;  2ETA A;  3DEP A;  5CER B;  2ZGG A;  1YYH A;  2FO1 E;  1MX4 A;  2KXP C;  2HE0 A;  4K5C A;  1SW6 A;  4HNA D;  1SVX A;  4J7W A;  5ENQ D;  4O1P A;  4ZHB A;  1IXV A;  5ITZ F;  5ENO D;  2XEE A;  4K5A B;  5BXU A;  2MYO A;  3J5Q B;  2B0O E;  3JXJ A;  5JA4 D;  4RLY A;  3UTM A;  2J8S D;  1YMP A;  4HBD A;  4BET A;  3HG0 D;  2Y1L E;  5FIO A;  2BKK B;  3T9K A;  4ZFH A;  3AJI A;  5AQ7 A;  4HRN A;  3TWT A;  1AWC B;  4C48 B;  3TWQ A;  1IKN D;  5ENS D;  4CZ2 D;  1IHB A;  2XZT G;  4LNU D;  5KBA A;  5KWD A;  2V4H C;  5AQ9 A;  3IXE A;  5CBN A;  1S70 B;  5HRY A;  3ZKJ A;  2JAB A;  4GPM A;  4DX1 A;  3V79 K;  1BLX B;  1TR4 A;  2RFM A;  3UXG A;  2VGE A;  1QYM A;  4LG6 A;  2DZO A;  3B95 A;  5AAR A;  3JXI A;  1BU9 A;  2XEH A;  2F37 A;  2QYJ A;  5EN5 D;  3EHR A;  3TWR A;  4ATZ D;  3V2O A;  3NOG D;  3V30 A;  4U8V D;  3TWX A;  2DWZ A;  1K3Z D;  5EYL A;  1OY3 D;  5ENR D;  1WG0 A;  3Q9N C;  5ENT D;  3NBN B;  1N0Q A;  4DX7 D;  4UUC A;  5BXO A;  4DUI A;  3B7B A;  2ETB A;  4HRL A;  2XZD G;  5AQB A;  2KBX A;  1MX6 A;  1MYO A;  1BD8 A;  3TWS A;  4B93 B;  5D66 A;  3T8K A;  3V31 A;  2RFA A;  5ENP D;  3W9G A;  4BEP A;  4BES A;  5KNH D;  2Y0B G;  5AAO A;  3ZNG A;  1K1A A;  3D9H A;  5CED B;  3EU9 A;  3NOC D;  3JUE A;  3SO8 A;  4U95 D;  4G8L A;  2DZN A;  4BSZ B;  2DVW A;  3HRA A;  3EHQ A;  4G8K A;  4HLL A;  3TWU A;  2BKG A;  2P2C P;  4BER A;  1AP7 A;  2PNN A;  2QC9 A;  4HB5 A;  4U8Y D;  1DC2 A;  4HRM B;  1G3N B;  4J8Y A;  5FIN A;  1N0R A;  4A63 B;  4DX2 A;  1N11 A;  3ZU7 B;  2ETC A;  5EIB E;  2A5E A;  2F8Y A;  3F6Q A;  1K1B A;  4Z68 A;  4CYM D;  1YCS B;  4YDY A;  5EID A;  1OT8 A;  2AJA A;  4LSZ E;  1MX2 A;  5CEA A;  1BI7 B;  3AAA C;  4DX6 D;  3C5R A;  4QFV A;  4F1P A;  3V2X A;  4OAU C;  1BI8 B;  1UOH A;  2L6B A;  4NIK A;  4O1O A;  1NFI E;  4DRX E;  4QQI A;  4K5B A;  5KNG A;  4U96 D;  3UI2 A;  2F8X K;  5JMN D;  4O60 A;  3W9F A;  2ZGD A;  4HQD A;  3TWV A;  4HI9 A;  5CBO A;  2XEN A;  3DEO A;  3J5P A;  3TWW A;  3LJN A;  5EYP F;  4HI8 A;  5AQA A;  1WDY A;  4OAV B;  4YDW A;  2V5Q C;  5AN8 A;  5HS0 A;  4DX5 D;  1DCQ A;  4JB8 P;  5HKP A;  4N5Q A;  1D9S A;  3KEA A;  4GMR A;  4F6R D;  1A5E A;  3Q9U C;  2NYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...