5AAOA

Crystal structure of fluorogen-activating designed ankyrin repeat protein (darpin) dimer in complex with malachite green
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
SDLGKKLLEAARAGQDDEVRILMANGADVNAKDSRGKTPLHLAADYGYLEVAEVLLKHGADVNAHDVYGDTPLHLTATWGHLEIVEVLLKNGADANAIDFFGWTPLHLAAYFGHLEIVEVLLKYGADVNAQDKFGKTVFDISVYNGDEDLAEILQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords FAD3210
publication title Generation of Fluorogen-Activating Designed Ankyrin Repeat Proteins (FADAs) as Versatile Sensor Tools.
pubmed doi rcsb
source organism Synthetic construct
total genus 54
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5aaoA00
4B93B 4CYMD 5KNHD 3DEPA 5HKPA 3TWXA 2HE0A 5CBNA 1UOHA 5FINA 1BU9A 1BI7B 3T9KA 4O60A 1YYHA 2XENA 4O1OA 1MX2A 3V2OA 5ENOD 4HI8A 4J8YA 1K3ZD 4QQIA 2MYOA 4C48B 2DZNA 5HRYA 2BKKB 3V79K 4YDWA 3J5PA 3NOGD 5ENTD 3JXIA 1OT8A 1SW6A 1YCSB 4JB8P 4LG6A 5FIOA 5KNGA 5CBOA 2F8YA 3TWTA 1S70B 1BD8A 4HLLA 2P2CP 4BSZB 4U96D 2QC9A 3ZKJA 4UUCA 1OY3D 2Y1LE 3DEOA 4K5AB 2DVWA 2VGEA 3EHRA 5BXUA 4BESA 2KXPC 4DX1A 4DX7D 2DZOA 4LSZE 3TWVA 3TWSA 5CEAA 1IHBA 1N11A 5EYLA 2A5EA 2KBXA 3C5RA 4QFVA 4BEPA 4J7WA 4K5CA 4TUMA 5AAOA 1YMPA 1MX6A 4HQDA 4U8VD 4F1PA 1DC2A 3D9HA 1MYOA 4U95D 5ENSD 3F6QA 2NYJA 5AQAA 1K1BA 2J8SD 1G3NB 2FO1E 2AJAA 4Z68A 2XEHA 1K1AA 3AJIA 3ZUVB 4HI9A 5AQ9A 1DCQA 5KBAA 2RFAA 4G8LA 3Q9NC 4NIKA 5ENRD 1WDYA 4RLYA 3TWUA 2QYJA 2ETAA 3V2XA 4DUIA 1IKND 3IXEA 3B7BA 3EHQA 2JABA 1BI8B 4G8KA 4U8YD 4DRXE 4ZFHA 1IXVA 5BXOA 2XZDG 3AAAC 4LNUD 3J5QB 2XEEA 5CEDB 1A5EA 2RFMA 1WG0A 3Q9UC 3ZNGA 1AWCB 5EN5D 2DWZA 5AQBA 4DX5D 2B0OE 4DX6D 4DX2A 1NFIE 2F37A 2L6BA 2Y0BG 3KEAA 4GPMA 3UTMA 4F6RD 1QYMA 3LJNA 5JA4D 5KWDA 4YDYA 4HRMB 5CERB 3B95A 2ETBA 4OAUC 1TR4A 2ETCA 1D9SA 5EIDA 5JMND 3NOCD 1SVXA 2ZGDA 5EIBE 1MX4A 1N0QA 4HBDA 1N0RA 5D66A 5EILA 4ATZD 2F8XK 2PNNA 2V5QC 3UI2A 5ENPD 3HG0D 4N5QA 3W9FA 1BLXB 1MJ0A 3JUEA 4O1PA 3SO8A 4BERA 5HS0A 3NBNB 3JXJA 4GMRA 5AN8A 3W9GA 3TWWA 3V30A 3T8KA 4K5BA 4CZ2D 4HRNA 2XZTG 4OAVB 3UXGA 2V4HC 3TWRA 2ZGGA 2BKGA 5ITZF 5EYPF 3HRAA 4HNAD 3EU9A 3TWQA 5CECB 5AARA 4A63B 4BETA 3V31A 5ENQD 4HRLA 5AQ7A 1AP7A 4ZHBA 4HB5A 3ZU7B
chains in the Genus database with same CATH superfamily
4CDMA 2HE0A 1L5JA 3D9MA 3FUMA 1JUQA 1ELKA 2WXKA 5CCMA 2KM4A 3LY8A 2DZNA 3J5PA 4HOUA 5ENTD 2VSNA 3UKRG 2R03A 1U3DA 5BXUA 3IV0A 1EF1C 3RJVA 2FF4A 1HH8A 3E37A 3U9WA 3BU8A 3C3RA 1KZOA 3FFLA 5G05C 2XGSA 4CT0A 1OWMA 3TL5A 5AQ9A 4FLHA 3S7JA 4NIKA 1WDYA 3ENEA 4M3OA 3FUIA 2J9QA 3IXEA 4U0SA 3B7BA 3EHQA 3DXKG 2R05A 4WAFA 3APFA 4NURA 3UIPC 4EZJA 2B0OE 3E30A 4JHJA 4GPMA 1TEZA 5JA4D 3OTNA 2ZGDA 1MX4A 4L2YA 3BUAA 4YVQC 1EYHA 2WMNA 2R02A 4YDEA 2YINA 4UI9K 5FWQA 1OCZE 3S2AA 4GTSA 3EU9A 5CECB 3IEGA 3FTXA 1AP7A 2CG2A 3RK6A 1E8ZA 1SA5A 3QOUA 2R5SA 3I4GA 2OVFA 3JUIA 3CK7A 2X6KA 1RZ4A 3FTZA 3QWVA 1N4PA 4N3CA 2IOSA 4ANXA 1IQRA 1TNOA 4JHRA 5HRYA 4MS6A 3SFZA 4JA7A 2P9SG 4AY6A 4JW1A 4I9CA 1PAQA 4U96D 3AG1E 1TN6A 5FQ7A 1IHBA 5BV1A 5EX0A 3G2WA 1INZA 3CVLA 2Y3AA 2AJAA 4RQIA 2FO7A 3G2VA 4KZ0A 5EX3A 2MOWA 4GA0A 3DWLG 3V2XA 5KCMA 1JCSA 3G2TA 5A6CA 1OWLA 4MLPA 1V54E 1A5EA 3U3WA 3ZNGA 4H7YA 4GB9A 4GZ5A 3UT8A 3CQCB 3ABKE 2PZIA 3NZSA 3SNXA 1JCRA 4Y6WA 1N52A 2PL2A 3ZRHA 4GMRA 5AN8A 3T5VA 1DVPA 4CGWA 4HRNA 1JCQA 3HXDA 2UY1B 2H6FA 3L9TA 3Q7AA 3TXMA 1UOHA 4C9BB 4F7AA 2C0LA 1RW2A 4O60A 4U0ZA 4O1OA 2FEZA 5ENOD 2KCVA 1JPLA 1FVFA 1H2UA 2WXMA 4GAAA 2LO6A 2DYSE 3EU5A 4UWHA 4EECA 2YHCA 4YDOA 2P2CP 3FTVA 4LNBA 3QJZA 4YVOA 4TXRA 2LAIA 3QB2A 2KBXA 4GPKA 4B8AA 2L6JA 3PEVB 4UI9C 3IKOB 2Y4TA 2X6IA 3B13A 2P9KG 3ZXPA 5LOZA 3ASOE 4XIFA 4GTTA 3TWUA 2C2LA 4APOA 2ZISA 3CVPA 4GYWA 2XZDG 3FU5A 1X81A 2XCCA 3CHQA 4GU5A 1OXJA 2CFZA 4EZLA 4JD2G 4XKCA 3FHEA 3KEAA 3P1UA 3OAWA 3RAUA 2A4ZA 4I9EA 4YDYA 3HDXA 5EIBE 3ZHEA 3ZYQA 5C1DA 2FI7A 4LCTA 2XQ0A 2PQNA 3FULA 1SZAA 1LD8A 1OWOA 3CKBA 4XZ4A 4O1PA 5FQ4A 1WY6A 5JHBA 4PUCA 2VSXE 4OAVB 4EHMA 4YNDA 2IOLA 5AARA 2BTDA 4C0MA 4G2VA 1OCCE 2R2LA 3DEPA 2PQRA 3R9MA 3ULEG 3JYSA 3ASNE 1K8KG 1TN8A 2GGFA 5G04C 1MQSA 2VSOE 3QWWA 1MZCA 1SW6A 4HLLA 3ZFWA 3DEOA 1QNFA 4I2WA 1YMPA 3SD5A 1K1BA 3D9OA 2FO1E 2YHEA 4URKA 3AJIA 4L9PA 3ZUVB 1Z3YA 4AOFA 3U66A 2VGXA 4N3AA 3URZA 2VJ8A 3CHOA 1HF8A 4B94A 2WXIA 5CEDB 5A7DB 1NFIE 4A55A 1U3CA 3Q78A 3Q7FA 5IY5E 1TJFA 2OCCE 4OAUC 4U8HA 2OOEA 3CVUA 5JJ6A 3SI5A 4HBDA 2WQ6A 3Q5MA 2VQ2A 5D66A 3HG0D 3JXJA 2XPYA 3K9IA 4N3BA 2DBAA 4DPRA 3CVNA 3ASGA 2V0PA 2AVPA 3BG1B 1TNYA 3T9KA 2P9PG 4CYMD 3NF1A 1TNBA 4GTVA 3PUJA 4KBQA 1JWGA 4P29A 3HVEA 1X5BA 1XGWA 2JLBA 4H7XA 2BKKB 1TNZA 2L9BA 3RRNB 4I6JA 2PM7A 5LP0A 5CBOA 5FZSA 3ZW3A 3P2BA 1OY3D 2J08A 5D0QD 1N11A 5EYLA 3SY2A 4HLEA 3ZIMA 3EHNA 3ZHEB 2AXZA 3SFYA 4I1OB 2X6JA 5CMYA 3SFXA 5KBAA 2GRNB 2GRMA 5CCLA 2XS1A 3ULYA 4NACA 3SQVA 1TJCA 2XGOA 2DCPA 1IYGA 4HS2A 3L08A 2X6FA 4UQYA 3UT4A 1NA0A 4ATZD 3UI2A 5KJLA 3RO3A 4N5QA 1HG2A 1BLXB 5E76A 3QC1A 2FBNA 5ANRA 3AG3E 4K5BA 1OCRE 4GYOA 5ARGA 3SBSA 3L16A 4CCAA 4CT4A 1OUVA 3FUKA 3ZYLA 3UPVA 2CHZA 3CVVA 2L0TB 5HKPA 5BUZA 4U07A 4CGVA 1BPOA 3RU0A 3QARA 3Q47B 1BI7B 1YYHA 4QQIA 3Q79A 4I6GA 2AW6A 1EDUA 4TXQA 2WQ7A 1UW4B 3U4TA 2GRPB 3MYVA 3JXIA 5KNGA 1O1SA 3ASHA 4PDXA 5BNWA 3TWVA 3TWSA 3CHSA 2A5EA 2Y4UA 5LCWC 5AAOA 5G2NA 3ML8A 3DSTA 3DXMG 3PNLB 1DC2A 1DCEA 3EUVA 1IQUA 5KJKA 4Z68A 4GTOA 4PS7A 5J90A 4BT9A 4KZCA 4G23A 2AWIA 4AY5A 1O5MA 1OCOE 3DSWA 3CVQA 1KPSB 4KVMA 3CLJA 4LRZA 2V5FA 1HO8A 2E0IA 4HVBA 2F37A 3QWPA 2GW1A 3APCA 1KZPA 5JMND 2C0MA 3Q75A 3VLFA 3HVEB 3CVXA 5CMWA 2JEKA 2BUGA 3FTSA 2MHKA 4LERA 3MJWA 4DI3A 2XS8A 3W9GA 2H6GA 1Y6IA 1UN9A 2WXQA 4WWNA 1NZNA 1GW6A 3EJNA 1D8DA 1HX8A 4G24A 1LF8A 4BETA 4I43A 2WXHA 1N9AA 1W3BA 4AJWA 4LUNU 4HB5A 3IHVA 5LX8A 3JQ0A 3VLEA 4AEZC 5D0OD 2IQCA 5C2YA 3ABLE 3V2OA 4HOSA 2YQ8A 2OEVA 5KJMA 3GZ2A 2VTBA 4G25A 4FJYA 3ZYMA 3D9JA 3L22A 2GROB 3TAXA 2ZXWE 4JPSA 2DZOA 3DPYA 2CHWA 3C5RA 4JA9A 5BV0A 3FP3A 5FQ8A 5ENSD 4XI9A 5AQAA 4BX9A 4OYSA 1TNUA 4IN3B 1ELWA 3C3OA 2QYJA 1FT2A 3RRUA 3FH5A 1ELRA 3SBTB 3J5QB 4JL0A 4LEUA 4B0ZA 3Q9UC 2X3MA 1A17A 3UTMA 3BEEA 3SHFA 3NOCD 3CHRA 3UMVA 2X38A 3E34A 5BT1A 3JUEA 3HYMB 1QBQA 1SQMA 2V4LA 4BTAA 4F53A 3CVWA 3TWQA 2CG3A 1FT1A 5AQ7A 4ZHBA 2HO1A 4N2SA 3FH7A 3LS8A 4GTPA 3TG5A 4GCNA 3MX3A 2NC9A 1Z5SC 4O6FA 3V79K 3FU3A 3NAWA 4UQZA 5FIOA 3C72A 5AENA 3HXFA 1S64A 1S70B 3TGOA 5B1AE 3EHRA 3SF4A 3DSVA 4BESA 4FHJA 4J6IA 4TUMA 1MX6A 4HQDA 5CRUA 3LVRE 1LD7A 2AXUA 5FJYA 4G8LA 5FT9A 3Q9NC 5ENRD 4EBAA 1HZ4A 3UUXA 5CRVA 2IO3C 2ZU6B 1BI8B 4U8YD 1IXVA 3KD7A 3AAAC 4DLOA 1NP7A 2XEEA 1E8WA 4WUYA 5FTPA 3GYZA 3CHPA 3D9PA 5CERB 2XPZA 4ANWA 3LDZA 2XPIA 3VLDA 2IFUA 2F8XK 2V5QC 3AU5A 1N4RA 1MJ0A 3UM3A 3NBNB 4IULA 1S0PA 3PRZA 4XEIG 4UWFA 3DSSA 1KLXA 4GTMA 3QKYA 1E7UA 3FEYA 3UKUG 4ILGA 1O1TA 5G55A 3FTYA 3CK8A 3RRMB 2MYOA 4C48B 2J4BA 3MCXA 2LSVA 4JB8P 3ZXSA 2Y1LE 3KAEA 3ONKA 3MKRA 4PS8A 1H6KA 1Y8MA 4TV3A 1N4SA 3LY9A 2LUHA 5AIJA 4HI9A 1TYQG 3D9KA 4G1TA 1DCQA 3PNTB 5JHAA 3E4BA 3R9AB 1HS6A 3CVYA 1TN7A 2WXFA 3QNKA 4W9RA 2H6IA 5AJDA 3FUFA 2NXPA 1UJJA 3UQ3A 2VSYA 4ILIA 3UT7A 2DWZA 4HFGA 4JZYA 3Q49B 3LJNA 3DRAA 3O48A 5D2MC 5KWDA 2ETBA 2GRRB 4MBGA 3FH8A 3PE4A 4UQXA 3BG0B 4B89A 3PZ3A 5EILA 1H6OA 5HS0A 5BPPA 3SZ7A 3V30A 4DK5A 4GZCA 4CZ2D 2VGYA 2V4HC 3FUJA 1U2VG 5ITZF 3HRAA 3B7UX 3ZN3A 1N54A 1IHGA 4UWGA 4GMLA 3ZU7B 1WM5A 2IF4A 1NA3A 4K0RA 4WWPA 2I6HA 2R17C 4WNGA 2IO2C 3PDNA 5JJTA 1E8YA 5T3RA 3AG4E 4KMOA 3Q15A 3NOGD 1OT8A 2XEVA 4LNGA 2OVBA 4FJZA 2I1KA 3JQ1A 2OV8A 3RKVA 3N71A 3UM0A 1Q2ZA 1QZ2A 4C0EA 4A3VA 4IYPA 5EKQD 1XNFA 3VTXA 4HORA 4U95D 2NYJA 2IEJA 3O4ZA 1G3NB 2ONDA 3IHYA 3ZYKA 4EZKA 4GA1A 1Z6TA 2IONA 4ME2A 3CV0A 1WAO1 3PH0C 3AU4A 3FTUA 1VDYA 2P9IG 5BXOA 2WXGA 4NQ0A 1E7VA 4Y6CA 4BY6A 5EN5D 2P9UG 3PZDA 3B7SA 1QYMA 2J49A 4NRHB 3QK0A 3T8MA 3D3MA 3FUNA 2A5UA 4RG6A 1JWFA 2XGMA 2HYZA 4AM9A 2QYUA 3SO8A 4N2QA 3ISMC 3TWWA 3T8KA 4UWLA 2LAHA 3VTYA 2XZTG 3UXGA 4L7TA 1V55E 4ANVA 2QZAA 4ABNA 4GYYA 3V31A 1NL4A 4N5CA 4E6HA 3E32A 3TWXA 5FZQA 5T4YA 4PH4B 3TG4A 3MEKA 3PREA 3UM2A 4L1BA 3OXLA 4FP7A 4XI0A 2LXMA 2QC9A 3MV2B 1ZBPA 2KC7A 3CSFA 2KXPC 4EQFA 2WXOA 4V3IA 3S7BA 1UJKA 2DYRE 1FPPA 2WQHA 1HG5A 2FULA 4TUUA 5G05J 2J8SD 2VGXB 3DSUA 3KSLA 3LKUA 1UN8A 3EDTB 2XEHA 3FY4A 4KXKB 5AYWD 3APDA 4WNEA 1DNPA 4I1AA 3DPDA 3IBEA 2ETAA 5B1BE 3CR3A 5BW8C 1IKND 4DRXE 2RKKA 3FWVA 5EDSA 1AWCB 3ZGQA 2QFCA 1D8EA 2LSUA 3HXBA 2WXLA 3X2QE 3ZEFA 1KT1A 2HM8A 3CIAA 2CHXA 2CFUA 4AIFA 5ENPD 3W9FA 1OWPA 3U64A 4G26A 3RSEG 4HXIA 4RSYA 4JEUA 3TWRA 4M7CA 3LVQE 4AVXA 4A63B 3ASDA 2HR2A 3AS4A 3ESLA 2Q7FA 4IRUA 5CBNA 5FINA 4JC8A 2WXPA 3LYAA 5J08A 4FA6A 1MX2A 4HI8A 2UY1A 2Y69E 5DIZA 3PVLA 4MRUA 1YCSB 3CGHA 1EPUA 4D10C 3Q73A 3TXNA 2DVWA 2VGEA 3L54A 3D9NA 4DX7D 5CEAA 2I1JA 4KVOA 4XE0A 3G2UA 4XX5A 1N4QA 3C3QA 1H2VC 4EPZA 2GRQB 1HU3A 3HHMA 4DLQA 2WM9A 1S63A 2IY0C 3KS2A 4U7EB 1HFAA 1UG3A 4ZFHA 2L0IA 4CRWA 3MA5A 5KJNA 1WG0A 5ENNA 3GZSA 4DX5D 2Y0BG 3NZUA 4Q96A 4BWRA 5M72A 1TR4A 3PZ1A 1SVXA 3WG7E 4I1MA 3AS8A 4J0UA 3G2SA 4BERA 2ILRA 3I3NA 3R7RA 4GA2A 5DBKA 2M63A 3B7TA 2EIKE 4CDRA 3L17A 4Q69A 4N39A 3NQPA 1H2TC 3C98A 4B93B 4HOQA 2J09A 4L23A 2LNIA 3CKCA 2F0YA 2QY7A 3L6AA 4J8YA 1K3ZD 1ZU2A 2MRIA 2P58C 2I9CA 3PZ2A 4F3VA 5ANLA 1NI1A 4LG6A 4A1GA 4JVSA 3PE3A 3KEZA 4UUCA 4L2LA 4LSZE 3TJPA 4F1PA 3NB2A 4UI9J 1MYOA 4GCOA 2LXLA 3F6QA 4Q94A 3RO2A 2J07A 3FU0A 4ANUA 3L82A 3I5PA 4B8CB 2RFAA 2XRZA 4BX8A 2V8SE 2KATA 4TRQA 4U63A 4DJAA 4G8KA 2E2EA 2EILE 3KSQA 4LNUD 3UM1A 3FTWA 2KCKA 4DI4A 2KCLA 4DX6D 2X6HA 4GZDA 2R59A 4GTQA 4HRMB 2OEWA 4K03A 1O1RA 2WPVA 5EIDA 4OVVA 2AXVA 3ASFA 3OXFA 2EIME 2BKGA 3FUHA 1FCHA 2ZIRA 4HRLA 4BSXA 2VTBB 3CQGB 3R7QA 3WXXA 3UIOC 2XHEA 5G04J 3T5XA 2NSZA 3CSTA 3UX4A 3S7DA 3ML9A 4A3TA 4TXPA 2WMOA 4BFRA 5B3SE 1N94A 2F8YA 3TWTA 3GW4A 4FLBA 3BQOA 2XCBA 3DBSA 4QFVA 4J7WA 5H7PA 4I17A 1H6PA 2KZTA 4BTBA 3MKQA 4G11A 4FULA 2EIJE 1ZB1A 3ESKA 3GZ1A 3EHMA 1B89A 4FU3A 3PZ4A 4F1SA 2WXRA 3PEUB 3Q4AB 2JABA 5A23A 5T8IA 2RFMA 2BF0X 5HQ8A 4GZ6A 5AQBA 4A1SA 4DX2A 2IJGX 3OXGA 5LFAA 4J8EA 4U04A 3LCAA 3EIJA 3FEXA 3RIBA 3I4RB 4AXHA 1SZ9A 3ZVVA 2YNQA 5HI7A 1KT0A 4E85A 3LPZA 4EBAG 4HNAD 3LEWA 4U0UA 5ENQD 4HOTA 1PC2A 2XRYA 4BT8A 3FUEA 3HIZA 4FADA 4OVUA 1HE8A 3E33A 3QDNA 4CDNA 2WXJA 4PS3A 1P5QA 4YDWA 3DSXA 1PY1A 1BD8A 4BSZB 2BEDA 3CEQA 4RG9A 2EINE 2P9NG 1LTXA 5FQ6A 4BEPA 3EIQC 3ZPJA 4U8VD 1Z3XA 4WNFA 3D9HA 4KYOB 2UWJG 1N95A 2WB2A 3ABME 4GTRA 2IU1A 4FHKA 1HXIA 3D9IA 5FZRA 1E90A 2WVIA 4RLYA 3LXUX 3FU6A 3B7RL 2GRLA 4J8FA 4ACKA 3AS5A 3B95A 1OWNA 2DIWA 2ETCA 1D9SA 1N0RA 4WWOA 2RG8A 5AJLA 2PNNA 3LY7A 4JEHA 2P9LG 2WXNA 4ATGA 4J8SA 4MKTA 3L13A 4CEMA 4JHKA 5ARFA 4KT6B 2KZTB 3MKQB 3JCKC 4XKBA 5CHEE 4J8DA 5KNHD 5E75A 1BU9A 1H0AA 2RD0A 2XENA 3AG2E 2VYIA 3FUDA 4I6EA 4UWKA 4R7LA 2H6HA 2B6CA 4X8QA 3ZKJA 4K5AB 3ULQA 1SA4A 4DX1A 4ACLA 5LCWJ 4K5CA 2EQXA 3FDHA 3PS6A 4RVBA 1K1AA 5JJ7A 3SGHA 2J4DA 3UINC 4WNDA 4AV7A 4DUIA 4AP2A 4FC8A 3CK9A 3S7FA 1E96B 3QAQA 3MV3B 4JXTA 3CHMA 3MZLB 1FVHA 2PM6A 2L6BA 4F6RD 4ILHB 1MHQA 4GMJA 1H19A 3ONLA 4APFA 1N0QA 3PUKA 2I2OA 3D9LA 4GZ3A 3HXEA 3LJ3A 4I2ZA 2ZGGA 1YA0A 1QQEA 1E8XA 5EYPF 3HXCA 3MGBA
chains in the Genus database with same CATH topology
4B93B 4CYMD 5KNHD 3DEPA 5HKPA 3TWXA 2HE0A 5CBNA 1UOHA 5FINA 1BU9A 1BI7B 3T9KA 4O60A 1YYHA 2XENA 4O1OA 1MX2A 3V2OA 5ENOD 4HI8A 4J8YA 1K3ZD 4QQIA 2MYOA 4C48B 2DZNA 5HRYA 2BKKB 3V79K 4YDWA 3J5PA 3NOGD 5ENTD 3JXIA 1OT8A 1SW6A 1YCSB 4JB8P 4LG6A 5FIOA 5KNGA 5CBOA 2F8YA 3TWTA 1S70B 1BD8A 4HLLA 2P2CP 4BSZB 4U96D 2QC9A 3ZKJA 4UUCA 1OY3D 2Y1LE 3DEOA 4K5AB 2DVWA 2VGEA 3EHRA 5BXUA 4BESA 2KXPC 4DX1A 4DX7D 2DZOA 4LSZE 3TWVA 3TWSA 5CEAA 1IHBA 1N11A 5EYLA 2A5EA 2KBXA 3C5RA 4QFVA 4BEPA 4J7WA 4K5CA 4TUMA 5AAOA 1YMPA 1MX6A 4HQDA 4U8VD 4F1PA 1DC2A 3D9HA 1MYOA 4U95D 5ENSD 3F6QA 2NYJA 5AQAA 1K1BA 2J8SD 1G3NB 2FO1E 2AJAA 4Z68A 2XEHA 1K1AA 3AJIA 3ZUVB 4HI9A 5AQ9A 1DCQA 5KBAA 2RFAA 4G8LA 3Q9NC 4NIKA 5ENRD 1WDYA 4RLYA 3TWUA 2QYJA 2ETAA 3V2XA 4DUIA 1IKND 3IXEA 3B7BA 3EHQA 2JABA 1BI8B 4G8KA 4U8YD 4DRXE 4ZFHA 1IXVA 5BXOA 2XZDG 3AAAC 4LNUD 3J5QB 2XEEA 5CEDB 1A5EA 2RFMA 1WG0A 3Q9UC 3ZNGA 1AWCB 5EN5D 2DWZA 5AQBA 4DX5D 2B0OE 4DX6D 4DX2A 1NFIE 2F37A 2L6BA 2Y0BG 3KEAA 4GPMA 3UTMA 4F6RD 1QYMA 3LJNA 5JA4D 5KWDA 4YDYA 4HRMB 5CERB 3B95A 2ETBA 4OAUC 1TR4A 2ETCA 1D9SA 5EIDA 5JMND 3NOCD 1SVXA 2ZGDA 5EIBE 1MX4A 1N0QA 4HBDA 1N0RA 5D66A 5EILA 4ATZD 2F8XK 2PNNA 2V5QC 3UI2A 5ENPD 3HG0D 4N5QA 3W9FA 1BLXB 1MJ0A 3JUEA 4O1PA 3SO8A 4BERA 5HS0A 3NBNB 3JXJA 4GMRA 5AN8A 3W9GA 3TWWA 3V30A 3T8KA 4K5BA 4CZ2D 4HRNA 2XZTG 4OAVB 3UXGA 2V4HC 3TWRA 2ZGGA 2BKGA 5ITZF 5EYPF 3HRAA 4HNAD 3EU9A 3TWQA 5CECB 5AARA 4A63B 4BETA 3V31A 5ENQD 4HRLA 5AQ7A 1AP7A 4ZHBA 4HB5A 3ZU7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B93 B;  4CYM D;  5KNH D;  3DEP A;  5HKP A;  3TWX A;  2HE0 A;  5CBN A;  1UOH A;  5FIN A;  1BU9 A;  1BI7 B;  3T9K A;  4O60 A;  1YYH A;  2XEN A;  4O1O A;  1MX2 A;  3V2O A;  5ENO D;  4HI8 A;  4J8Y A;  1K3Z D;  4QQI A;  2MYO A;  4C48 B;  2DZN A;  5HRY A;  2BKK B;  3V79 K;  4YDW A;  3J5P A;  3NOG D;  5ENT D;  3JXI A;  1OT8 A;  1SW6 A;  1YCS B;  4JB8 P;  4LG6 A;  5FIO A;  5KNG A;  5CBO A;  2F8Y A;  3TWT A;  1S70 B;  1BD8 A;  4HLL A;  2P2C P;  4BSZ B;  4U96 D;  2QC9 A;  3ZKJ A;  4UUC A;  1OY3 D;  2Y1L E;  3DEO A;  4K5A B;  2DVW A;  2VGE A;  3EHR A;  5BXU A;  4BES A;  2KXP C;  4DX1 A;  4DX7 D;  2DZO A;  4LSZ E;  3TWV A;  3TWS A;  5CEA A;  1IHB A;  1N11 A;  5EYL A;  2A5E A;  2KBX A;  3C5R A;  4QFV A;  4BEP A;  4J7W A;  4K5C A;  4TUM A;  5AAO A;  1YMP A;  1MX6 A;  4HQD A;  4U8V D;  4F1P A;  1DC2 A;  3D9H A;  1MYO A;  4U95 D;  5ENS D;  3F6Q A;  2NYJ A;  5AQA A;  1K1B A;  2J8S D;  1G3N B;  2FO1 E;  2AJA A;  4Z68 A;  2XEH A;  1K1A A;  3AJI A;  3ZUV B;  4HI9 A;  5AQ9 A;  1DCQ A;  5KBA A;  2RFA A;  4G8L A;  3Q9N C;  4NIK A;  5ENR D;  1WDY A;  4RLY A;  3TWU A;  2QYJ A;  2ETA A;  3V2X A;  4DUI A;  1IKN D;  3IXE A;  3B7B A;  3EHQ A;  2JAB A;  1BI8 B;  4G8K A;  4U8Y D;  4DRX E;  4ZFH A;  1IXV A;  5BXO A;  2XZD G;  3AAA C;  4LNU D;  3J5Q B;  2XEE A;  5CED B;  1A5E A;  2RFM A;  1WG0 A;  3Q9U C;  3ZNG A;  1AWC B;  5EN5 D;  2DWZ A;  5AQB A;  4DX5 D;  2B0O E;  4DX6 D;  4DX2 A;  1NFI E;  2F37 A;  2L6B A;  2Y0B G;  3KEA A;  4GPM A;  3UTM A;  4F6R D;  1QYM A;  3LJN A;  5JA4 D;  5KWD A;  4YDY A;  4HRM B;  5CER B;  3B95 A;  2ETB A;  4OAU C;  1TR4 A;  2ETC A;  1D9S A;  5EID A;  5JMN D;  3NOC D;  1SVX A;  2ZGD A;  5EIB E;  1MX4 A;  1N0Q A;  4HBD A;  1N0R A;  5D66 A;  5EIL A;  4ATZ D;  2F8X K;  2PNN A;  2V5Q C;  3UI2 A;  5ENP D;  3HG0 D;  4N5Q A;  3W9F A;  1BLX B;  1MJ0 A;  3JUE A;  4O1P A;  3SO8 A;  4BER A;  5HS0 A;  3NBN B;  3JXJ A;  4GMR A;  5AN8 A;  3W9G A;  3TWW A;  3V30 A;  3T8K A;  4K5B A;  4CZ2 D;  4HRN A;  2XZT G;  4OAV B;  3UXG A;  2V4H C;  3TWR A;  2ZGG A;  2BKG A;  5ITZ F;  5EYP F;  3HRA A;  4HNA D;  3EU9 A;  3TWQ A;  5CEC B;  5AAR A;  4A63 B;  4BET A;  3V31 A;  5ENQ D;  4HRL A;  5AQ7 A;  1AP7 A;  4ZHB A;  4HB5 A;  3ZU7 B; 
#chains in the Genus database with same CATH topology
 4CDM A;  2HE0 A;  1L5J A;  3D9M A;  3FUM A;  1JUQ A;  1ELK A;  2WXK A;  5CCM A;  2KM4 A;  3LY8 A;  2DZN A;  3J5P A;  4HOU A;  5ENT D;  2VSN A;  3UKR G;  2R03 A;  1U3D A;  5BXU A;  3IV0 A;  1EF1 C;  3RJV A;  2FF4 A;  1HH8 A;  3E37 A;  3U9W A;  3BU8 A;  3C3R A;  1KZO A;  3FFL A;  5G05 C;  2XGS A;  4CT0 A;  1OWM A;  3TL5 A;  5AQ9 A;  4FLH A;  3S7J A;  4NIK A;  1WDY A;  3ENE A;  4M3O A;  3FUI A;  2J9Q A;  3IXE A;  4U0S A;  3B7B A;  3EHQ A;  3DXK G;  2R05 A;  4WAF A;  3APF A;  4NUR A;  3UIP C;  4EZJ A;  2B0O E;  3E30 A;  4JHJ A;  4GPM A;  1TEZ A;  5JA4 D;  3OTN A;  2ZGD A;  1MX4 A;  4L2Y A;  3BUA A;  4YVQ C;  1EYH A;  2WMN A;  2R02 A;  4YDE A;  2YIN A;  4UI9 K;  5FWQ A;  1OCZ E;  3S2A A;  4GTS A;  3EU9 A;  5CEC B;  3IEG A;  3FTX A;  1AP7 A;  2CG2 A;  3RK6 A;  1E8Z A;  1SA5 A;  3QOU A;  2R5S A;  3I4G A;  2OVF A;  3JUI A;  3CK7 A;  2X6K A;  1RZ4 A;  3FTZ A;  3QWV A;  1N4P A;  4N3C A;  2IOS A;  4ANX A;  1IQR A;  1TNO A;  4JHR A;  5HRY A;  4MS6 A;  3SFZ A;  4JA7 A;  2P9S G;  4AY6 A;  4JW1 A;  4I9C A;  1PAQ A;  4U96 D;  3AG1 E;  1TN6 A;  5FQ7 A;  1IHB A;  5BV1 A;  5EX0 A;  3G2W A;  1INZ A;  3CVL A;  2Y3A A;  2AJA A;  4RQI A;  2FO7 A;  3G2V A;  4KZ0 A;  5EX3 A;  2MOW A;  4GA0 A;  3DWL G;  3V2X A;  5KCM A;  1JCS A;  3G2T A;  5A6C A;  1OWL A;  4MLP A;  1V54 E;  1A5E A;  3U3W A;  3ZNG A;  4H7Y A;  4GB9 A;  4GZ5 A;  3UT8 A;  3CQC B;  3ABK E;  2PZI A;  3NZS A;  3SNX A;  1JCR A;  4Y6W A;  1N52 A;  2PL2 A;  3ZRH A;  4GMR A;  5AN8 A;  3T5V A;  1DVP A;  4CGW A;  4HRN A;  1JCQ A;  3HXD A;  2UY1 B;  2H6F A;  3L9T A;  3Q7A A;  3TXM A;  1UOH A;  4C9B B;  4F7A A;  2C0L A;  1RW2 A;  4O60 A;  4U0Z A;  4O1O A;  2FEZ A;  5ENO D;  2KCV A;  1JPL A;  1FVF A;  1H2U A;  2WXM A;  4GAA A;  2LO6 A;  2DYS E;  3EU5 A;  4UWH A;  4EEC A;  2YHC A;  4YDO A;  2P2C P;  3FTV A;  4LNB A;  3QJZ A;  4YVO A;  4TXR A;  2LAI A;  3QB2 A;  2KBX A;  4GPK A;  4B8A A;  2L6J A;  3PEV B;  4UI9 C;  3IKO B;  2Y4T A;  2X6I A;  3B13 A;  2P9K G;  3ZXP A;  5LOZ A;  3ASO E;  4XIF A;  4GTT A;  3TWU A;  2C2L A;  4APO A;  2ZIS A;  3CVP A;  4GYW A;  2XZD G;  3FU5 A;  1X81 A;  2XCC A;  3CHQ A;  4GU5 A;  1OXJ A;  2CFZ A;  4EZL A;  4JD2 G;  4XKC A;  3FHE A;  3KEA A;  3P1U A;  3OAW A;  3RAU A;  2A4Z A;  4I9E A;  4YDY A;  3HDX A;  5EIB E;  3ZHE A;  3ZYQ A;  5C1D A;  2FI7 A;  4LCT A;  2XQ0 A;  2PQN A;  3FUL A;  1SZA A;  1LD8 A;  1OWO A;  3CKB A;  4XZ4 A;  4O1P A;  5FQ4 A;  1WY6 A;  5JHB A;  4PUC A;  2VSX E;  4OAV B;  4EHM A;  4YND A;  2IOL A;  5AAR A;  2BTD A;  4C0M A;  4G2V A;  1OCC E;  2R2L A;  3DEP A;  2PQR A;  3R9M A;  3ULE G;  3JYS A;  3ASN E;  1K8K G;  1TN8 A;  2GGF A;  5G04 C;  1MQS A;  2VSO E;  3QWW A;  1MZC A;  1SW6 A;  4HLL A;  3ZFW A;  3DEO A;  1QNF A;  4I2W A;  1YMP A;  3SD5 A;  1K1B A;  3D9O A;  2FO1 E;  2YHE A;  4URK A;  3AJI A;  4L9P A;  3ZUV B;  1Z3Y A;  4AOF A;  3U66 A;  2VGX A;  4N3A A;  3URZ A;  2VJ8 A;  3CHO A;  1HF8 A;  4B94 A;  2WXI A;  5CED B;  5A7D B;  1NFI E;  4A55 A;  1U3C A;  3Q78 A;  3Q7F A;  5IY5 E;  1TJF A;  2OCC E;  4OAU C;  4U8H A;  2OOE A;  3CVU A;  5JJ6 A;  3SI5 A;  4HBD A;  2WQ6 A;  3Q5M A;  2VQ2 A;  5D66 A;  3HG0 D;  3JXJ A;  2XPY A;  3K9I A;  4N3B A;  2DBA A;  4DPR A;  3CVN A;  3ASG A;  2V0P A;  2AVP A;  3BG1 B;  1TNY A;  3T9K A;  2P9P G;  4CYM D;  3NF1 A;  1TNB A;  4GTV A;  3PUJ A;  4KBQ A;  1JWG A;  4P29 A;  3HVE A;  1X5B A;  1XGW A;  2JLB A;  4H7X A;  2BKK B;  1TNZ A;  2L9B A;  3RRN B;  4I6J A;  2PM7 A;  5LP0 A;  5CBO A;  5FZS A;  3ZW3 A;  3P2B A;  1OY3 D;  2J08 A;  5D0Q D;  1N11 A;  5EYL A;  3SY2 A;  4HLE A;  3ZIM A;  3EHN A;  3ZHE B;  2AXZ A;  3SFY A;  4I1O B;  2X6J A;  5CMY A;  3SFX A;  5KBA A;  2GRN B;  2GRM A;  5CCL A;  2XS1 A;  3ULY A;  4NAC A;  3SQV A;  1TJC A;  2XGO A;  2DCP A;  1IYG A;  4HS2 A;  3L08 A;  2X6F A;  4UQY A;  3UT4 A;  1NA0 A;  4ATZ D;  3UI2 A;  5KJL A;  3RO3 A;  4N5Q A;  1HG2 A;  1BLX B;  5E76 A;  3QC1 A;  2FBN A;  5ANR A;  3AG3 E;  4K5B A;  1OCR E;  4GYO A;  5ARG A;  3SBS A;  3L16 A;  4CCA A;  4CT4 A;  1OUV A;  3FUK A;  3ZYL A;  3UPV A;  2CHZ A;  3CVV A;  2L0T B;  5HKP A;  5BUZ A;  4U07 A;  4CGV A;  1BPO A;  3RU0 A;  3QAR A;  3Q47 B;  1BI7 B;  1YYH A;  4QQI A;  3Q79 A;  4I6G A;  2AW6 A;  1EDU A;  4TXQ A;  2WQ7 A;  1UW4 B;  3U4T A;  2GRP B;  3MYV A;  3JXI A;  5KNG A;  1O1S A;  3ASH A;  4PDX A;  5BNW A;  3TWV A;  3TWS A;  3CHS A;  2A5E A;  2Y4U A;  5LCW C;  5AAO A;  5G2N A;  3ML8 A;  3DST A;  3DXM G;  3PNL B;  1DC2 A;  1DCE A;  3EUV A;  1IQU A;  5KJK A;  4Z68 A;  4GTO A;  4PS7 A;  5J90 A;  4BT9 A;  4KZC A;  4G23 A;  2AWI A;  4AY5 A;  1O5M A;  1OCO E;  3DSW A;  3CVQ A;  1KPS B;  4KVM A;  3CLJ A;  4LRZ A;  2V5F A;  1HO8 A;  2E0I A;  4HVB A;  2F37 A;  3QWP A;  2GW1 A;  3APC A;  1KZP A;  5JMN D;  2C0M A;  3Q75 A;  3VLF A;  3HVE B;  3CVX A;  5CMW A;  2JEK A;  2BUG A;  3FTS A;  2MHK A;  4LER A;  3MJW A;  4DI3 A;  2XS8 A;  3W9G A;  2H6G A;  1Y6I A;  1UN9 A;  2WXQ A;  4WWN A;  1NZN A;  1GW6 A;  3EJN A;  1D8D A;  1HX8 A;  4G24 A;  1LF8 A;  4BET A;  4I43 A;  2WXH A;  1N9A A;  1W3B A;  4AJW A;  4LUN U;  4HB5 A;  3IHV A;  5LX8 A;  3JQ0 A;  3VLE A;  4AEZ C;  5D0O D;  2IQC A;  5C2Y A;  3ABL E;  3V2O A;  4HOS A;  2YQ8 A;  2OEV A;  5KJM A;  3GZ2 A;  2VTB A;  4G25 A;  4FJY A;  3ZYM A;  3D9J A;  3L22 A;  2GRO B;  3TAX A;  2ZXW E;  4JPS A;  2DZO A;  3DPY A;  2CHW A;  3C5R A;  4JA9 A;  5BV0 A;  3FP3 A;  5FQ8 A;  5ENS D;  4XI9 A;  5AQA A;  4BX9 A;  4OYS A;  1TNU A;  4IN3 B;  1ELW A;  3C3O A;  2QYJ A;  1FT2 A;  3RRU A;  3FH5 A;  1ELR A;  3SBT B;  3J5Q B;  4JL0 A;  4LEU A;  4B0Z A;  3Q9U C;  2X3M A;  1A17 A;  3UTM A;  3BEE A;  3SHF A;  3NOC D;  3CHR A;  3UMV A;  2X38 A;  3E34 A;  5BT1 A;  3JUE A;  3HYM B;  1QBQ A;  1SQM A;  2V4L A;  4BTA A;  4F53 A;  3CVW A;  3TWQ A;  2CG3 A;  1FT1 A;  5AQ7 A;  4ZHB A;  2HO1 A;  4N2S A;  3FH7 A;  3LS8 A;  4GTP A;  3TG5 A;  4GCN A;  3MX3 A;  2NC9 A;  1Z5S C;  4O6F A;  3V79 K;  3FU3 A;  3NAW A;  4UQZ A;  5FIO A;  3C72 A;  5AEN A;  3HXF A;  1S64 A;  1S70 B;  3TGO A;  5B1A E;  3EHR A;  3SF4 A;  3DSV A;  4BES A;  4FHJ A;  4J6I A;  4TUM A;  1MX6 A;  4HQD A;  5CRU A;  3LVR E;  1LD7 A;  2AXU A;  5FJY A;  4G8L A;  5FT9 A;  3Q9N C;  5ENR D;  4EBA A;  1HZ4 A;  3UUX A;  5CRV A;  2IO3 C;  2ZU6 B;  1BI8 B;  4U8Y D;  1IXV A;  3KD7 A;  3AAA C;  4DLO A;  1NP7 A;  2XEE A;  1E8W A;  4WUY A;  5FTP A;  3GYZ A;  3CHP A;  3D9P A;  5CER B;  2XPZ A;  4ANW A;  3LDZ A;  2XPI A;  3VLD A;  2IFU A;  2F8X K;  2V5Q C;  3AU5 A;  1N4R A;  1MJ0 A;  3UM3 A;  3NBN B;  4IUL A;  1S0P A;  3PRZ A;  4XEI G;  4UWF A;  3DSS A;  1KLX A;  4GTM A;  3QKY A;  1E7U A;  3FEY A;  3UKU G;  4ILG A;  1O1T A;  5G55 A;  3FTY A;  3CK8 A;  3RRM B;  2MYO A;  4C48 B;  2J4B A;  3MCX A;  2LSV A;  4JB8 P;  3ZXS A;  2Y1L E;  3KAE A;  3ONK A;  3MKR A;  4PS8 A;  1H6K A;  1Y8M A;  4TV3 A;  1N4S A;  3LY9 A;  2LUH A;  5AIJ A;  4HI9 A;  1TYQ G;  3D9K A;  4G1T A;  1DCQ A;  3PNT B;  5JHA A;  3E4B A;  3R9A B;  1HS6 A;  3CVY A;  1TN7 A;  2WXF A;  3QNK A;  4W9R A;  2H6I A;  5AJD A;  3FUF A;  2NXP A;  1UJJ A;  3UQ3 A;  2VSY A;  4ILI A;  3UT7 A;  2DWZ A;  4HFG A;  4JZY A;  3Q49 B;  3LJN A;  3DRA A;  3O48 A;  5D2M C;  5KWD A;  2ETB A;  2GRR B;  4MBG A;  3FH8 A;  3PE4 A;  4UQX A;  3BG0 B;  4B89 A;  3PZ3 A;  5EIL A;  1H6O A;  5HS0 A;  5BPP A;  3SZ7 A;  3V30 A;  4DK5 A;  4GZC A;  4CZ2 D;  2VGY A;  2V4H C;  3FUJ A;  1U2V G;  5ITZ F;  3HRA A;  3B7U X;  3ZN3 A;  1N54 A;  1IHG A;  4UWG A;  4GML A;  3ZU7 B;  1WM5 A;  2IF4 A;  1NA3 A;  4K0R A;  4WWP A;  2I6H A;  2R17 C;  4WNG A;  2IO2 C;  3PDN A;  5JJT A;  1E8Y A;  5T3R A;  3AG4 E;  4KMO A;  3Q15 A;  3NOG D;  1OT8 A;  2XEV A;  4LNG A;  2OVB A;  4FJZ A;  2I1K A;  3JQ1 A;  2OV8 A;  3RKV A;  3N71 A;  3UM0 A;  1Q2Z A;  1QZ2 A;  4C0E A;  4A3V A;  4IYP A;  5EKQ D;  1XNF A;  3VTX A;  4HOR A;  4U95 D;  2NYJ A;  2IEJ A;  3O4Z A;  1G3N B;  2OND A;  3IHY A;  3ZYK A;  4EZK A;  4GA1 A;  1Z6T A;  2ION A;  4ME2 A;  3CV0 A;  1WAO 1;  3PH0 C;  3AU4 A;  3FTU A;  1VDY A;  2P9I G;  5BXO A;  2WXG A;  4NQ0 A;  1E7V A;  4Y6C A;  4BY6 A;  5EN5 D;  2P9U G;  3PZD A;  3B7S A;  1QYM A;  2J49 A;  4NRH B;  3QK0 A;  3T8M A;  3D3M A;  3FUN A;  2A5U A;  4RG6 A;  1JWF A;  2XGM A;  2HYZ A;  4AM9 A;  2QYU A;  3SO8 A;  4N2Q A;  3ISM C;  3TWW A;  3T8K A;  4UWL A;  2LAH A;  3VTY A;  2XZT G;  3UXG A;  4L7T A;  1V55 E;  4ANV A;  2QZA A;  4ABN A;  4GYY A;  3V31 A;  1NL4 A;  4N5C A;  4E6H A;  3E32 A;  3TWX A;  5FZQ A;  5T4Y A;  4PH4 B;  3TG4 A;  3MEK A;  3PRE A;  3UM2 A;  4L1B A;  3OXL A;  4FP7 A;  4XI0 A;  2LXM A;  2QC9 A;  3MV2 B;  1ZBP A;  2KC7 A;  3CSF A;  2KXP C;  4EQF A;  2WXO A;  4V3I A;  3S7B A;  1UJK A;  2DYR E;  1FPP A;  2WQH A;  1HG5 A;  2FUL A;  4TUU A;  5G05 J;  2J8S D;  2VGX B;  3DSU A;  3KSL A;  3LKU A;  1UN8 A;  3EDT B;  2XEH A;  3FY4 A;  4KXK B;  5AYW D;  3APD A;  4WNE A;  1DNP A;  4I1A A;  3DPD A;  3IBE A;  2ETA A;  5B1B E;  3CR3 A;  5BW8 C;  1IKN D;  4DRX E;  2RKK A;  3FWV A;  5EDS A;  1AWC B;  3ZGQ A;  2QFC A;  1D8E A;  2LSU A;  3HXB A;  2WXL A;  3X2Q E;  3ZEF A;  1KT1 A;  2HM8 A;  3CIA A;  2CHX A;  2CFU A;  4AIF A;  5ENP D;  3W9F A;  1OWP A;  3U64 A;  4G26 A;  3RSE G;  4HXI A;  4RSY A;  4JEU A;  3TWR A;  4M7C A;  3LVQ E;  4AVX A;  4A63 B;  3ASD A;  2HR2 A;  3AS4 A;  3ESL A;  2Q7F A;  4IRU A;  5CBN A;  5FIN A;  4JC8 A;  2WXP A;  3LYA A;  5J08 A;  4FA6 A;  1MX2 A;  4HI8 A;  2UY1 A;  2Y69 E;  5DIZ A;  3PVL A;  4MRU A;  1YCS B;  3CGH A;  1EPU A;  4D10 C;  3Q73 A;  3TXN A;  2DVW A;  2VGE A;  3L54 A;  3D9N A;  4DX7 D;  5CEA A;  2I1J A;  4KVO A;  4XE0 A;  3G2U A;  4XX5 A;  1N4Q A;  3C3Q A;  1H2V C;  4EPZ A;  2GRQ B;  1HU3 A;  3HHM A;  4DLQ A;  2WM9 A;  1S63 A;  2IY0 C;  3KS2 A;  4U7E B;  1HFA A;  1UG3 A;  4ZFH A;  2L0I A;  4CRW A;  3MA5 A;  5KJN A;  1WG0 A;  5ENN A;  3GZS A;  4DX5 D;  2Y0B G;  3NZU A;  4Q96 A;  4BWR A;  5M72 A;  1TR4 A;  3PZ1 A;  1SVX A;  3WG7 E;  4I1M A;  3AS8 A;  4J0U A;  3G2S A;  4BER A;  2ILR A;  3I3N A;  3R7R A;  4GA2 A;  5DBK A;  2M63 A;  3B7T A;  2EIK E;  4CDR A;  3L17 A;  4Q69 A;  4N39 A;  3NQP A;  1H2T C;  3C98 A;  4B93 B;  4HOQ A;  2J09 A;  4L23 A;  2LNI A;  3CKC A;  2F0Y A;  2QY7 A;  3L6A A;  4J8Y A;  1K3Z D;  1ZU2 A;  2MRI A;  2P58 C;  2I9C A;  3PZ2 A;  4F3V A;  5ANL A;  1NI1 A;  4LG6 A;  4A1G A;  4JVS A;  3PE3 A;  3KEZ A;  4UUC A;  4L2L A;  4LSZ E;  3TJP A;  4F1P A;  3NB2 A;  4UI9 J;  1MYO A;  4GCO A;  2LXL A;  3F6Q A;  4Q94 A;  3RO2 A;  2J07 A;  3FU0 A;  4ANU A;  3L82 A;  3I5P A;  4B8C B;  2RFA A;  2XRZ A;  4BX8 A;  2V8S E;  2KAT A;  4TRQ A;  4U63 A;  4DJA A;  4G8K A;  2E2E A;  2EIL E;  3KSQ A;  4LNU D;  3UM1 A;  3FTW A;  2KCK A;  4DI4 A;  2KCL A;  4DX6 D;  2X6H A;  4GZD A;  2R59 A;  4GTQ A;  4HRM B;  2OEW A;  4K03 A;  1O1R A;  2WPV A;  5EID A;  4OVV A;  2AXV A;  3ASF A;  3OXF A;  2EIM E;  2BKG A;  3FUH A;  1FCH A;  2ZIR A;  4HRL A;  4BSX A;  2VTB B;  3CQG B;  3R7Q A;  3WXX A;  3UIO C;  2XHE A;  5G04 J;  3T5X A;  2NSZ A;  3CST A;  3UX4 A;  3S7D A;  3ML9 A;  4A3T A;  4TXP A;  2WMO A;  4BFR A;  5B3S E;  1N94 A;  2F8Y A;  3TWT A;  3GW4 A;  4FLB A;  3BQO A;  2XCB A;  3DBS A;  4QFV A;  4J7W A;  5H7P A;  4I17 A;  1H6P A;  2KZT A;  4BTB A;  3MKQ A;  4G11 A;  4FUL A;  2EIJ E;  1ZB1 A;  3ESK A;  3GZ1 A;  3EHM A;  1B89 A;  4FU3 A;  3PZ4 A;  4F1S A;  2WXR A;  3PEU B;  3Q4A B;  2JAB A;  5A23 A;  5T8I A;  2RFM A;  2BF0 X;  5HQ8 A;  4GZ6 A;  5AQB A;  4A1S A;  4DX2 A;  2IJG X;  3OXG A;  5LFA A;  4J8E A;  4U04 A;  3LCA A;  3EIJ A;  3FEX A;  3RIB A;  3I4R B;  4AXH A;  1SZ9 A;  3ZVV A;  2YNQ A;  5HI7 A;  1KT0 A;  4E85 A;  3LPZ A;  4EBA G;  4HNA D;  3LEW A;  4U0U A;  5ENQ D;  4HOT A;  1PC2 A;  2XRY A;  4BT8 A;  3FUE A;  3HIZ A;  4FAD A;  4OVU A;  1HE8 A;  3E33 A;  3QDN A;  4CDN A;  2WXJ A;  4PS3 A;  1P5Q A;  4YDW A;  3DSX A;  1PY1 A;  1BD8 A;  4BSZ B;  2BED A;  3CEQ A;  4RG9 A;  2EIN E;  2P9N G;  1LTX A;  5FQ6 A;  4BEP A;  3EIQ C;  3ZPJ A;  4U8V D;  1Z3X A;  4WNF A;  3D9H A;  4KYO B;  2UWJ G;  1N95 A;  2WB2 A;  3ABM E;  4GTR A;  2IU1 A;  4FHK A;  1HXI A;  3D9I A;  5FZR A;  1E90 A;  2WVI A;  4RLY A;  3LXU X;  3FU6 A;  3B7R L;  2GRL A;  4J8F A;  4ACK A;  3AS5 A;  3B95 A;  1OWN A;  2DIW A;  2ETC A;  1D9S A;  1N0R A;  4WWO A;  2RG8 A;  5AJL A;  2PNN A;  3LY7 A;  4JEH A;  2P9L G;  2WXN A;  4ATG A;  4J8S A;  4MKT A;  3L13 A;  4CEM A;  4JHK A;  5ARF A;  4KT6 B;  2KZT B;  3MKQ B;  3JCK C;  4XKB A;  5CHE E;  4J8D A;  5KNH D;  5E75 A;  1BU9 A;  1H0A A;  2RD0 A;  2XEN A;  3AG2 E;  2VYI A;  3FUD A;  4I6E A;  4UWK A;  4R7L A;  2H6H A;  2B6C A;  4X8Q A;  3ZKJ A;  4K5A B;  3ULQ A;  1SA4 A;  4DX1 A;  4ACL A;  5LCW J;  4K5C A;  2EQX A;  3FDH A;  3PS6 A;  4RVB A;  1K1A A;  5JJ7 A;  3SGH A;  2J4D A;  3UIN C;  4WND A;  4AV7 A;  4DUI A;  4AP2 A;  4FC8 A;  3CK9 A;  3S7F A;  1E96 B;  3QAQ A;  3MV3 B;  4JXT A;  3CHM A;  3MZL B;  1FVH A;  2PM6 A;  2L6B A;  4F6R D;  4ILH B;  1MHQ A;  4GMJ A;  1H19 A;  3ONL A;  4APF A;  1N0Q A;  3PUK A;  2I2O A;  3D9L A;  4GZ3 A;  3HXE A;  3LJ3 A;  4I2Z A;  2ZGG A;  1YA0 A;  1QQE A;  1E8X A;  5EYP F;  3HXC A;  3MGB A; 
#chains in the Genus database with same CATH homology
 4B93 B;  4CYM D;  5KNH D;  3DEP A;  5HKP A;  3TWX A;  2HE0 A;  5CBN A;  1UOH A;  5FIN A;  1BU9 A;  1BI7 B;  3T9K A;  4O60 A;  1YYH A;  2XEN A;  4O1O A;  1MX2 A;  3V2O A;  5ENO D;  4HI8 A;  4J8Y A;  1K3Z D;  4QQI A;  2MYO A;  4C48 B;  2DZN A;  5HRY A;  2BKK B;  3V79 K;  4YDW A;  3J5P A;  3NOG D;  5ENT D;  3JXI A;  1OT8 A;  1SW6 A;  1YCS B;  4JB8 P;  4LG6 A;  5FIO A;  5KNG A;  5CBO A;  2F8Y A;  3TWT A;  1S70 B;  1BD8 A;  4HLL A;  2P2C P;  4BSZ B;  4U96 D;  2QC9 A;  3ZKJ A;  4UUC A;  1OY3 D;  2Y1L E;  3DEO A;  4K5A B;  2DVW A;  2VGE A;  3EHR A;  5BXU A;  4BES A;  2KXP C;  4DX1 A;  4DX7 D;  2DZO A;  4LSZ E;  3TWV A;  3TWS A;  5CEA A;  1IHB A;  1N11 A;  5EYL A;  2A5E A;  2KBX A;  3C5R A;  4QFV A;  4BEP A;  4J7W A;  4K5C A;  4TUM A;  5AAO A;  1YMP A;  1MX6 A;  4HQD A;  4U8V D;  4F1P A;  1DC2 A;  3D9H A;  1MYO A;  4U95 D;  5ENS D;  3F6Q A;  2NYJ A;  5AQA A;  1K1B A;  2J8S D;  1G3N B;  2FO1 E;  2AJA A;  4Z68 A;  2XEH A;  1K1A A;  3AJI A;  3ZUV B;  4HI9 A;  5AQ9 A;  1DCQ A;  5KBA A;  2RFA A;  4G8L A;  3Q9N C;  4NIK A;  5ENR D;  1WDY A;  4RLY A;  3TWU A;  2QYJ A;  2ETA A;  3V2X A;  4DUI A;  1IKN D;  3IXE A;  3B7B A;  3EHQ A;  2JAB A;  1BI8 B;  4G8K A;  4U8Y D;  4DRX E;  4ZFH A;  1IXV A;  5BXO A;  2XZD G;  3AAA C;  4LNU D;  3J5Q B;  2XEE A;  5CED B;  1A5E A;  2RFM A;  1WG0 A;  3Q9U C;  3ZNG A;  1AWC B;  5EN5 D;  2DWZ A;  5AQB A;  4DX5 D;  2B0O E;  4DX6 D;  4DX2 A;  1NFI E;  2F37 A;  2L6B A;  2Y0B G;  3KEA A;  4GPM A;  3UTM A;  4F6R D;  1QYM A;  3LJN A;  5JA4 D;  5KWD A;  4YDY A;  4HRM B;  5CER B;  3B95 A;  2ETB A;  4OAU C;  1TR4 A;  2ETC A;  1D9S A;  5EID A;  5JMN D;  3NOC D;  1SVX A;  2ZGD A;  5EIB E;  1MX4 A;  1N0Q A;  4HBD A;  1N0R A;  5D66 A;  5EIL A;  4ATZ D;  2F8X K;  2PNN A;  2V5Q C;  3UI2 A;  5ENP D;  3HG0 D;  4N5Q A;  3W9F A;  1BLX B;  1MJ0 A;  3JUE A;  4O1P A;  3SO8 A;  4BER A;  5HS0 A;  3NBN B;  3JXJ A;  4GMR A;  5AN8 A;  3W9G A;  3TWW A;  3V30 A;  3T8K A;  4K5B A;  4CZ2 D;  4HRN A;  2XZT G;  4OAV B;  3UXG A;  2V4H C;  3TWR A;  2ZGG A;  2BKG A;  5ITZ F;  5EYP F;  3HRA A;  4HNA D;  3EU9 A;  3TWQ A;  5CEC B;  5AAR A;  4A63 B;  4BET A;  3V31 A;  5ENQ D;  4HRL A;  5AQ7 A;  1AP7 A;  4ZHB A;  4HB5 A;  3ZU7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...