5AAOA

Crystal structure of fluorogen-activating designed ankyrin repeat protein (darpin) dimer in complex with malachite green
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
SDLGKKLLEAARAGQDDEVRILMANGADVNAKDSRGKTPLHLAADYGYLEVAEVLLKHGADVNAHDVYGDTPLHLTATWGHLEIVEVLLKNGADANAIDFFGWTPLHLAAYFGHLEIVEVLLKYGADVNAQDKFGKTVFDISVYNGDEDLAEILQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD3210
publication title Generation of Fluorogen-Activating Designed Ankyrin Repeat Proteins (FADAs) as Versatile Sensor Tools.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 54
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5aaoA00
3ZNGA 3SO8A 3B95A 5ITZF 4HRLA 1A5EA 5AQ7A 3JXJA 2KXPC 4DX7D 1DC2A 3V2XA 2B0OE 1TR4A 5ENTD 5CBNA 2ETBA 2BKGA 4ZHBA 2RFAA 3EHQA 2F8XK 1N0QA 1YMPA 2VGEA 5AQ9A 4BERA 3HG0D 3T8KA 1BU9A 1WDYA 2DZNA 4NIKA 4YDYA 2F37A 3J5PA 4HB5A 5ENSD 1S70B 3F6QA 2MYOA 2XZTG 4K5CA 4O60A 4QFVA 4BSZB 5HRYA 1OY3D 3T9KA 5EYLA 1WG0A 3D9HA 4DX6D 4HRMB 1MJ0A 4F6RD 3TWTA 1YCSB 3JUEA 2NYJA 5KWDA 5AARA 4U8VD 2QYJA 4F1PA 5HKPA 3NBNB 1SW6A 4A63B 1N11A 5ENRD 3NOCD 3ZUVB 5HS0A 1MX4A 4BETA 1K1AA 1D9SA 5CECB 3J5QB 5AAOA 4DUIA 1YYHA 2Y0BG 3W9FA 5AQAA 2V5QC 3B7BA 5JA4D 2DVWA 3DEOA 3V31A 4DRXE 4GPMA 1IXVA 3HRAA 4GMRA 1MYOA 3JXIA 3V79K 4CYMD 4Z68A 1BI7B 3AJIA 1BI8B 4YDWA 5KNGA 1N0RA 5ENQD 1G3NB 2ZGGA 4J8YA 4U8YD 2DZOA 5AQBA 3TWQA 5BXUA 4N5QA 1OT8A 1MX6A 1NFIE 4G8LA 2Y1LE 1IHBA 4U95D 4DX1A 5EIBE 1AP7A 4K5BA 1K1BA 4HNAD 4JB8P 4O1PA 4QQIA 5D66A 3TWVA 4C48B 3AAAC 4CZ2D 5EILA 2FO1E 2V4HC 5EYPF 2A5EA 1BD8A 3KEAA 4OAVB 3DEPA 5ENPD 1SVXA 4HBDA 4TUMA 3TWRA 2L6BA 1DCQA 5KNHD 1BLXB 4LG6A 3V30A 3EHRA 5CEDB 4ATZD 5FINA 3EU9A 4HI8A 4J7WA 4OAUC 1UOHA 3TWXA 4HI9A 3W9GA 3C5RA 5AN8A 2KBXA 2F8YA 3TWWA 3UXGA 4HRNA 4B93B 4O1OA 1MX2A 5KBAA 5JMND 5ENOD 4UUCA 5FIOA 2PNNA 3Q9NC 4HQDA 4LSZE 4DX2A 2QC9A 3TWSA 1IKND 5BXOA 2XEHA 4U96D 3Q9UC 4DX5D 3IXEA 3TWUA 3NOGD 2JABA 4RLYA 3ZU7B 1AWCB 2XEEA 2AJAA 2P2CP 2ZGDA 5CEAA 5CERB 4K5AB 5CBOA 4BESA 2J8SD 1QYMA 3LJNA 5EIDA 3UTMA 3V2OA 3ZKJA 2XZDG 4HLLA 2ETCA 2BKKB 5EN5D 4G8KA 4ZFHA 4LNUD 2XENA 2DWZA 1K3ZD 2ETAA 2HE0A 4BEPA 3UI2A 2RFMA
chains in the Genus database with same CATH superfamily
4TXPA 4A55A 2DCPA 3BG1B 4AOFA 3CHSA 1NP7A 5EDSA 4WNDA 3FU0A 4U63A 3CVUA 3X2QE 2VJ8A 1WDYA 3O48A 1U3CA 2RD0A 3FTUA 4HB5A 4NACA 3ZHEA 2P9PG 2J08A 4F1PA 4PUCA 3FUNA 4KYOB 4K03A 2CHZA 3C3OA 3LYAA 3BG0B 2DVWA 2H6HA 3V31A 3B7SA 4J8FA 3MKRA 5KNGA 3NF1A 4I2WA 3PUKA 4YVQC 2GROB 3D9OA 4I6EA 4HNAD 1JUQA 2V4HC 2MOWA 3AU5A 4Q96A 3V30A 4XKBA 1OCOE 4CDMA 1HG5A 4J0UA 3C98A 3PUJA 3ZXPA 2IU1A 1UN8A 2RKKA 3CVPA 5JJTA 4UUCA 2IY0C 3D9JA 4W9RA 2J4BA 5AIJA 2P2CP 3FFLA 4KZCA 1OCRE 2OVFA 4GTQA 5D0QD 3ZRHA 3RU0A 1TN6A 3JCKC 4Y6WA 1YMPA 4BERA 1WAO1 3ONLA 2F37A 3ABLE 4Q69A 2DIWA 2FO7A 3LPZA 2H6IA 5FQ8A 2Y69E 3QKYA 1OUVA 2QYJA 4BETA 3ZVVA 5KCMA 4PS3A 3B7BA 2JLBA 3KSLA 1HF8A 5EX3A 2WXQA 3T8MA 1IXVA 2XPZA 4GMRA 1MQSA 2R59A 3JXIA 2LXLA 2MHKA 3MYVA 2X3MA 3I4GA 4HXIA 1K1BA 4UQXA 5T3RA 4N39A 3TWRA 2OEWA 4ILGA 2NC9A 2V0PA 4NQ0A 4FU3A 3Q78A 5FINA 4GYWA 5J90A 3FP3A 3ASHA 3UINC 3C72A 5FZRA 4FJYA 1MX2A 4ACLA 3D9KA 3HXFA 3VTXA 2GRPB 5HQ8A 5KJKA 1HH8A 4CGVA 1H6KA 4GYYA 2CHWA 3PE3A 2J8SD 3QJZA 1N94A 3ZGQA 3GZ2A 3ASDA 4LERA 2VTBA 4HOSA 3LVQE 4N3BA 4ZFHA 4F1SA 1A17A 3AS5A 2ETAA 3ESLA 1TNYA 3Q75A 3UIPC 3L54A 3NQPA 2E2EA 1TNZA 5H7PA 2HO1A 4K5CA 4MBGA 4ANUA 1E96B 1KZPA 2MRIA 4MLPA 4TXQA 4ANWA 3RO2A 4U8VD 3R7QA 4Y6CA 4AXHA 3PE4A 1TEZA 5IY5E 1YYHA 3QWVA 1VDYA 1ELWA 2WXLA 3AU4A 3VTYA 3O4ZA 2AXUA 4DLOA 4G8LA 3SFXA 2P9LG 5DIZA 3URZA 2IOSA 5D66A 2P58C 4EBAA 5LCWC 4U0SA 1OWPA 3U66A 3QB2A 4FLBA 3FUFA 4R7LA 3FUDA 3QAQA 4B89A 4DPRA 3CK9A 2LAHA 3ABKE 4PH4B 3ZEFA 2KM4A 3Q49B 4B93B 4DJAA 2IONA 2XGOA 4U04A 2FEZA 4HQDA 3Q47B 4U7EB 1ZU2A 3KD7A 1IHGA 4LCTA 5HI7A 3EDTB 4YDOA 4GA0A 1E8XA 3PEVB 5FZSA 4CEMA 5AENA 4HLLA 4G8KA 5LOZA 4EPZA 3D9NA 4KXKB 2VSXE 1N4QA 3B95A 5ITZF 4I1AA 2KXPC 2OVBA 4GU5A 5ENTD 3SHFA 4KZ0A 2BKGA 2YHCA 4ZHBA 4RG6A 3E30A 3PZ1A 3FH7A 5ENSD 4M3OA 2AXZA 2XCBA 5JJ7A 4N3AA 3UM3A 3ZW3A 1N95A 3UQ3A 4A63B 1N11A 3APCA 2PL2A 3SBSA 4UI9J 5AAOA 2GW1A 4V3IA 3JQ0A 4XZ4A 1ZB1A 3ZHEB 1U2VG 3SBTB 4Z68A 1E7VA 4UI9C 4U07A 2BF0X 4GMLA 3UT8A 1G3NB 3MA5A 3JUIA 5ARFA 3I3NA 4CZ2D 2PQNA 1BD8A 1MHQA 3SQVA 1E8YA 3TG5A 4UQYA 2I6HA 1E90A 4IYPA 4RVBA 3NZUA 5FIOA 3Q9NC 4LSZE 2WMNA 2L6JA 2CFUA 5LX8A 3ML8A 2ZGDA 2WQ6A 4K5AB 3QK0A 1Q2ZA 2XPIA 2XGSA 3L17A 3U64A 3CSTA 3FU3A 4UWKA 3TJPA 2L0TB 4FHJA 3CVLA 4EZKA 2WXRA 3HDXA 3VLFA 5JHAA 4HVBA 1DC2A 5CBNA 2X6JA 1OXJA 4F53A 3QARA 1BU9A 5G04J 3L13A 4JXTA 2CFZA 2XZTG 3FUIA 1EYHA 4F6RD 5CRVA 1SW6A 5ANLA 5BW8C 4BTBA 3ULEG 5CECB 1TN7A 1BPOA 4DRXE 4APOA 4WWOA 1BI7B 3RRNB 4GTVA 4N5QA 3TGOA 2DYSE 4JVSA 2OOEA 4K5BA 4CDNA 2VGYA 2UY1B 1H0AA 3P1UA 4FA6A 3CQCB 1DCQA 1H6OA 3LVRE 3FUMA 4WNEA 4GMJA 3EU9A 5AN8A 5D0OD 4O1OA 1IQUA 2V5FA 2KC7A 2AXVA 4U0UA 4BSXA 4LUNU 1FPPA 3NZSA 4LNUD 2XCCA 3ZNGA 3CHMA 3GZ1A 5AQ7A 2VTBB 1DNPA 2B0OE 3B13A 3TXNA 4F3VA 2J49A 3APFA 3ZYQA 4IN3B 2WB2A 3EHMA 1OWLA 4MS6A 5BUZA 4QFVA 1TNBA 4GA1A 4BX9A 3HXCA 4GZ6A 3T9KA 4GZCA 4PDXA 4GZDA 4DK5A 1Y6IA 1LD8A 4AEZC 1MX4A 3FTWA 4FULA 5FWQA 1WY6A 3D9MA 3AG3E 5JA4D 4CCAA 4GPKA 3HXEA 4G24A 2FI7A 4LNBA 4E6HA 3T5XA 1NA0A 1NFIE 4U95D 3PH0C 4QQIA 4DLQA 2C0MA 2RG8A 4OAVB 3DEPA 1V55E 1N52A 4KVMA 4DI3A 1TN8A 3E33A 3E34A 3CEQA 5KBAA 5KJMA 2EIJE 4XX5A 5KJLA 4LRZA 4O6FA 5BXOA 4U96D 2KATA 4A1SA 4MKTA 4DI4A 3PRZA 4PS8A 2YQ8A 5CBOA 4WWNA 2WXMA 4L23A 2XENA 3UUXA 4J8DA 2BTDA 1PAQA 4PS7A 3K9IA 3G2WA 5BT1A 2EILE 4ME2A 3APDA 5G55A 2M63A 4RG9A 4IULA 4JEHA 3DXKG 4G2VA 2DBAA 4C0EA 3ZUVB 3UT4A 3AG1E 1QNFA 2UWJG 2IF4A 4C9BB 3MCXA 3WXXA 3U3WA 2I9CA 5CHEE 1NA3A 2EINE 3G2TA 2J07A 3ISMC 3TG4A 3KAEA 3QWPA 1S63A 5BPPA 3BQOA 4JZYA 4FADA 4GTSA 5ENNA 3UM1A 3MV2B 1BLXB 2X6FA 4UI9K 4FJZA 4ATZD 4WNGA 3B7TA 3GZSA 1EF1C 2UY1A 3ZYLA 4OAUC 1Z6TA 1JCRA 3MEKA 4UQZA 5FQ7A 4ACKA 5B1BE 2VSNA 2YHEA 5B1AE 3IXEA 3QC1A 4BT9A 3FEYA 4M7CA 4YVOA 4CT0A 5CEAA 1HE8A 4UWFA 3ZKJA 3TXMA 1JCSA 4LNGA 1JWGA 4I1OB 1OWMA 3FHEA 3LY8A 3S7FA 5ARGA 3CSFA 4F7AA 5AQ9A 2VQ2A 2KCKA 4N2SA 2KCLA 4YDYA 1H6PA 2ZU6B 3MV3B 4JHJA 4O60A 4WAFA 2GRLA 4J6IA 1MJ0A 3ENEA 3AS8A 3LCAA 5HKPA 3NBNB 3BEEA 1SA4A 3CQGB 1QQEA 3LY9A 1PC2A 4NURA 4UWHA 2FULA 1N0RA 4HOQA 2ZGGA 3JQ1A 1KLXA 4LEUA 1UN9A 2FO1E 2X6IA 3CLJA 3ZFWA 4TUMA 3CKCA 2PM6A 4LG6A 1D8DA 3L22A 5CEDB 2IO3C 1TJCA 3HHMA 1PY1A 4HI9A 4XI0A 3LY7A 2KBXA 4GTOA 3CK8A 2X38A 3Q5MA 4ILHB 3OTNA 2PNNA 4DX2A 4GB9A 2GGFA 3NOGD 4L1BA 4I2ZA 4UWLA 4BESA 1UJKA 3WG7E 2XZDG 4WUYA 2YNQA 4D10C 4BSZB 5AYWD 5EYLA 1FT2A 2PM7A 3U9WA 3CKBA 1A5EA 4I9EA 3SFZA 5E75A 3EJNA 2WQHA 3Q15A 1XGWA 4G25A 3HG0D 1HS6A 5C2YA 3F6QA 4GAAA 2H6FA 3SZ7A 3SFYA 4HRMB 3TWTA 4IRUA 3KS2A 1X5BA 2ZISA 1E8ZA 3P2BA 1EPUA 2ZIRA 4B8AA 5LFAA 2Y0BG 1LD7A 2C2LA 4U0ZA 4CYMD 2EIKE 3LDZA 2AWIA 2L0IA 3DSTA 2WXKA 3HYMB 3RIBA 1DCEA 1N9AA 4JEUA 4CT4A 2VSYA 3UT7A 3AG2E 5FQ4A 4GTTA 3TWXA 4G23A 2V8SE 4FHKA 5A7DB 4XEIG 1TJFA 4GZ3A 4HORA 3VLDA 4XE0A 2GRRB 3FTVA 4L9PA 2QZAA 3TWUA 2J4DA 3FU5A 5JJ6A 3CVWA 3KSQA 2OEVA 3IKOB 3CGHA 5AJLA 4B0ZA 1SZ9A 1O1RA 2RFAA 3EHQA 4TUUA 4X8QA 2Y3AA 4C0MA 4UWGA 3UX4A 3D9HA 1YCSB 2P9NG 1H19A 2AVPA 5HS0A 4AY6A 1H2TC 3S2AA 1D9SA 1UJJA 5DBKA 3ASFA 1O1SA 1KPSB 3ML9A 5G05J 3ZYKA 4JB8P 3FH8A 3FTSA 1B89A 5G04C 2LSVA 5A6CA 4YNDA 3PEUB 2L9BA 4K0RA 3IBEA 2HR2A 2FBNA 3PZ4A 3N71A 1EDUA 3IHYA 1UG3A 3BU8A 5FZQA 3JYSA 4HI8A 3C5RA 3QDNA 1JWFA 1K8KG 1HXIA 3E4BA 3DSSA 3FUKA 1AWCB 2XEEA 3EUVA 3UPVA 1W3BA 3MJWA 3QOUA 3PVLA 2BUGA 4I43A 5E76A 2WXIA 2HE0A 3NAWA 5BNWA 2LUHA 4FC8A 1QBQA 2WQ7A 2P9KG 2AW6A 3V2XA 3L82A 2EQXA 3CVXA 3PS6A 3T8KA 5JHBA 2HYZA 4APFA 3ESKA 4BWRA 3LEWA 3FTXA 1K1AA 5CRUA 1KT1A 1MZCA 3W9FA 5AQAA 2J09A 2XS1A 3L9TA 3HRAA 3AS4A 4JPSA 2IEJA 4TRQA 3AJIA 1BI8B 4GZ5A 4J8EA 2NXPA 2Y4TA 5AQBA 3LS8A 1P5QA 2WPVA 4JA9A 3DSWA 2LO6A 2L6BA 4EBAG 2QFCA 4HOTA 3CK7A 3LKUA 1V54E 3CVNA 2V4LA 4E85A 2EIME 3MKQA 2DYRE 3OXGA 3TWWA 3UXGA 3SD5A 4ATGA 2VGXB 4OYSA 5JMND 1XNFA 2XEHA 1HZ4A 3ZU7B 2WXPA 4GTMA 1LTXA 1QZ2A 1JCQA 3EIQC 3LJNA 4OVVA 5B3SE 4KVOA 2DWZA 2WXJA 2WXNA 3G2SA 4BEPA 4P29A 3R9AB 4HRLA 5M72A 1DVPA 2R05A 4DX7D 2ETBA 3D3MA 2VGEA 3J5PA 4AVXA 1S70B 2B6CA 4DX6D 3Q79A 3LXUX 2NYJA 5AARA 1FT1A 3ABME 3DXMG 3CV0A 3DWLG 2LSUA 4GCOA 4YDWA 3HIZA 1AP7A 1NZNA 4AJWA 1ZBPA 3UKUG 3AG4E 3OAWA 3S7BA 5EYPF 3RKVA 3CHPA 2BEDA 4URKA 2WMOA 3KEZA 2Y4UA 3RRUA 1OWOA 1OCCE 4JHRA 1RW2A 3IV0A 3I5PA 2XS8A 2QC9A 3TWSA 2R17C 3DBSA 4KMOA 3E37A 3SY2A 2A5UA 4J8SA 3C3RA 3MZLB 4EECA 4HOUA 5EN5D 3FUHA 4AIFA 3DSXA 4A1GA 4RSYA 3CHRA 2GRQB 1N4RA 3RSEG 3HXBA 3CVVA 4I17A 1HO8A 4I9CA 3PZ2A 4GCNA 3ONKA 4BX8A 5HRYA 5A23A 4CRWA 3CVQA 3DSUA 1WG0A 4KT6B 5ENRD 2ZXWE 3R9MA 4TV3A 4H7XA 3UIOC 3DEOA 2HM8A 3HVEA 4GPMA 3ULQA 1N54A 4WWPA 2R2LA 4G1TA 4J8YA 3ULYA 2DZOA 5BXUA 1Z3YA 1MX6A 4GA2A 1H2VC 4FP7A 1IHBA 2CHXA 4A3VA 4DX1A 5FTPA 3SI5A 2X6KA 2KCVA 4TXRA 5EKQD 3KEAA 3PNTB 5KNHD 5T8IA 4GTRA 4OVUA 2I2OA 3PZ3A 5BV0A 1TNOA 3CHOA 3RK6A 5KJNA 4L2YA 3TAXA 4L7TA 1FCHA 4CDRA 1INZA 3BUAA 4XIFA 2WXFA 3VLEA 3CVYA 3D9LA 3L6AA 2VGXA 1O5MA 3B7RL 1QYMA 3UTMA 5EIDA 1OWNA 4JA7A 4I6GA 1SZAA 4XKCA 3FY4A 4DUIA 2RFMA 3RAUA 3ZN3A 3UKRG 1E7UA 3Q7AA 3UM2A 3D9PA 3B7UX 1O1TA 3ASGA 4B8CB 3D9IA 1Z3XA 5LCWJ 1ELKA 3FU6A 2WM9A 2XHEA 5C1DA 4Q94A 1OY3D 5T4YA 4HS2A 3TL5A 1TYQG 2J9QA 2IJGX 3JUEA 5KWDA 3EU5A 4ABNA 2VYIA 2Q7FA 3FH5A 3J5QB 3FUJA 4G26A 2OCCE 2V5QC 2WXHA 1N4SA 1OCZE 1KZOA 1OT8A 4I1MA 2Y1LE 1SA5A 3EHNA 4I6JA 4C48B 3ZPJA 3ASNE 3E32A 4EHMA 4B94A 5ENPD 4HBDA 3NB2A 4NRHB 1H2UA 2KZTB 3DRAA 4AY5A 1LF8A 4H7YA 1KT0A 4BY6A 3Q4AB 1UOHA 4N5CA 2CG3A 2F8YA 5ANRA 1HU3A 4JHKA 2YINA 1D8EA 1HG2A 3R7RA 1IKND 1RZ4A 3MKQB 2I1JA 2CG2A 5J08A 5CERB 3L16A 3MGBA 2ETCA 5CCLA 4KBQA 4GYOA 2WXGA 4BFRA 3FUEA 1S64A 3SO8A 3RJVA 1TR4A 1Y8MA 3S7DA 2F8XK 4N3CA 2QY7A 5D2MC 3OXFA 3Q73A 2MYOA 3Q7FA 5G2NA 2XGMA 4EZJA 3ASOE 3U4TA 4MRUA 1YA0A 3ZIMA 2LNIA 2WXOA 3QWWA 3FTZA 5FQ6A 4L2LA 3G2UA 4ANVA 2OV8A 3EIJA 2A4ZA 3QNKA 1JPLA 5EIBE 4O1PA 1N4PA 5EX0A 5EILA 4AP2A 1SQMA 4ILIA 5FT9A 2IFUA 5CMYA 1SVXA 5CMWA 2GRNB 3FULA 1HX8A 3EHRA 1U3DA 2P9SG 2PQRA 4XI9A 4A3TA 4J7WA 2WVIA 2XRYA 1NL4A 3W9GA 3SGHA 3SF4A 3PNLB 4HFGA 3FEXA 3PZDA 4HRNA 4U8HA 1NI1A 2X6HA 3G2VA 4WNFA 5ENOD 3DPDA 4JW1A 3Q9UC 4DX5D 2PZIA 5CCMA 5G05C 3PDNA 2AJAA 3L08A 5BV1A 2BKKB 1IQRA 1GW6A 1S0PA 2ONDA 4JL0A 3OXLA 4EZLA 2R02A 1FVFA 3CIAA 3JXJA 3PREA 3FWVA 2XQ0A 1FVHA 1N0QA 3LJ3A 2NSZA 4BT8A 2DZNA 4NIKA 3RRMB 2IQCA 3ZXSA 4AV7A 3GW4A 2QYUA 4FLHA 1HFAA 1L5JA 3NOCD 4RQIA 3RO3A 2IO2C 2XPYA 4G11A 2P9UG 1MYOA 4GTPA 3V79K 2JEKA 5ENQD 3C3QA 3FDHA 3I4RB 4U8YD 3TWQA 1Z5SC 1UW4B 1X81A 2VSOE 3TWVA 3HVEB 4BTAA 3AAAC 3SNXA 2LXMA 3DSVA 2A5EA 3IHVA 2FF4A 4HLEA 4N2QA 1WM5A 2H6GA 5LP0A 2F0YA 3HXDA 2E0IA 4JC8A 3DPYA 2XRZA 2ILRA 3T5VA 2IOLA 5FJYA 2I1KA 4JD2G 3FTYA 3GYZA 4AM9A 4CGWA 2P9IG 3UMVA 4YDEA 2R03A 3UM0A 3CR3A 2KZTA 4ANXA 3ZYMA 5AJDA 2JABA 4RLYA 4EQFA 3CHQA 2GRMA 3IEGA 1IYGA 2C0LA 2LAIA 2XEVA 1E8WA 3V2OA 3S7JA 3MX3A 1K3ZD 1TNUA 3UI2A 1ELRA 2R5SA
chains in the Genus database with same CATH topology
3ZNGA 3SO8A 3B95A 5ITZF 4HRLA 1A5EA 5AQ7A 3JXJA 2KXPC 4DX7D 1DC2A 3V2XA 2B0OE 1TR4A 5ENTD 5CBNA 2ETBA 2BKGA 4ZHBA 2RFAA 3EHQA 2F8XK 1N0QA 1YMPA 2VGEA 5AQ9A 4BERA 3HG0D 3T8KA 1BU9A 1WDYA 2DZNA 4NIKA 4YDYA 2F37A 3J5PA 4HB5A 5ENSD 1S70B 3F6QA 2MYOA 2XZTG 4K5CA 4O60A 4QFVA 4BSZB 5HRYA 1OY3D 3T9KA 5EYLA 1WG0A 3D9HA 4DX6D 4HRMB 1MJ0A 4F6RD 3TWTA 1YCSB 3JUEA 2NYJA 5KWDA 5AARA 4U8VD 2QYJA 4F1PA 5HKPA 3NBNB 1SW6A 4A63B 1N11A 5ENRD 3NOCD 3ZUVB 5HS0A 1MX4A 4BETA 1K1AA 1D9SA 5CECB 3J5QB 5AAOA 4DUIA 1YYHA 2Y0BG 3W9FA 5AQAA 2V5QC 3B7BA 5JA4D 2DVWA 3DEOA 3V31A 4DRXE 4GPMA 1IXVA 3HRAA 4GMRA 1MYOA 3JXIA 3V79K 4CYMD 4Z68A 1BI7B 3AJIA 1BI8B 4YDWA 5KNGA 1N0RA 5ENQD 1G3NB 2ZGGA 4J8YA 4U8YD 2DZOA 5AQBA 3TWQA 5BXUA 4N5QA 1OT8A 1MX6A 1NFIE 4G8LA 2Y1LE 1IHBA 4U95D 4DX1A 5EIBE 1AP7A 4K5BA 1K1BA 4HNAD 4JB8P 4O1PA 4QQIA 5D66A 3TWVA 4C48B 3AAAC 4CZ2D 5EILA 2FO1E 2V4HC 5EYPF 2A5EA 1BD8A 3KEAA 4OAVB 3DEPA 5ENPD 1SVXA 4HBDA 4TUMA 3TWRA 2L6BA 1DCQA 5KNHD 1BLXB 4LG6A 3V30A 3EHRA 5CEDB 4ATZD 5FINA 3EU9A 4HI8A 4J7WA 4OAUC 1UOHA 3TWXA 4HI9A 3W9GA 3C5RA 5AN8A 2KBXA 2F8YA 3TWWA 3UXGA 4HRNA 4B93B 4O1OA 1MX2A 5KBAA 5JMND 5ENOD 4UUCA 5FIOA 2PNNA 3Q9NC 4HQDA 4LSZE 4DX2A 2QC9A 3TWSA 1IKND 5BXOA 2XEHA 4U96D 3Q9UC 4DX5D 3IXEA 3TWUA 3NOGD 2JABA 4RLYA 3ZU7B 1AWCB 2XEEA 2AJAA 2P2CP 2ZGDA 5CEAA 5CERB 4K5AB 5CBOA 4BESA 2J8SD 1QYMA 3LJNA 5EIDA 3UTMA 3V2OA 3ZKJA 2XZDG 4HLLA 2ETCA 2BKKB 5EN5D 4G8KA 4ZFHA 4LNUD 2XENA 2DWZA 1K3ZD 2ETAA 2HE0A 4BEPA 3UI2A 2RFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNG A;  3SO8 A;  3B95 A;  5ITZ F;  4HRL A;  1A5E A;  5AQ7 A;  3JXJ A;  2KXP C;  4DX7 D;  1DC2 A;  3V2X A;  2B0O E;  1TR4 A;  5ENT D;  5CBN A;  2ETB A;  2BKG A;  4ZHB A;  2RFA A;  3EHQ A;  2F8X K;  1N0Q A;  1YMP A;  2VGE A;  5AQ9 A;  4BER A;  3HG0 D;  3T8K A;  1BU9 A;  1WDY A;  2DZN A;  4NIK A;  4YDY A;  2F37 A;  3J5P A;  4HB5 A;  5ENS D;  1S70 B;  3F6Q A;  2MYO A;  2XZT G;  4K5C A;  4O60 A;  4QFV A;  4BSZ B;  5HRY A;  1OY3 D;  3T9K A;  5EYL A;  1WG0 A;  3D9H A;  4DX6 D;  4HRM B;  1MJ0 A;  4F6R D;  3TWT A;  1YCS B;  3JUE A;  2NYJ A;  5KWD A;  5AAR A;  4U8V D;  2QYJ A;  4F1P A;  5HKP A;  3NBN B;  1SW6 A;  4A63 B;  1N11 A;  5ENR D;  3NOC D;  3ZUV B;  5HS0 A;  1MX4 A;  4BET A;  1K1A A;  1D9S A;  5CEC B;  3J5Q B;  5AAO A;  4DUI A;  1YYH A;  2Y0B G;  3W9F A;  5AQA A;  2V5Q C;  3B7B A;  5JA4 D;  2DVW A;  3DEO A;  3V31 A;  4DRX E;  4GPM A;  1IXV A;  3HRA A;  4GMR A;  1MYO A;  3JXI A;  3V79 K;  4CYM D;  4Z68 A;  1BI7 B;  3AJI A;  1BI8 B;  4YDW A;  5KNG A;  1N0R A;  5ENQ D;  1G3N B;  2ZGG A;  4J8Y A;  4U8Y D;  2DZO A;  5AQB A;  3TWQ A;  5BXU A;  4N5Q A;  1OT8 A;  1MX6 A;  1NFI E;  4G8L A;  2Y1L E;  1IHB A;  4U95 D;  4DX1 A;  5EIB E;  1AP7 A;  4K5B A;  1K1B A;  4HNA D;  4JB8 P;  4O1P A;  4QQI A;  5D66 A;  3TWV A;  4C48 B;  3AAA C;  4CZ2 D;  5EIL A;  2FO1 E;  2V4H C;  5EYP F;  2A5E A;  1BD8 A;  3KEA A;  4OAV B;  3DEP A;  5ENP D;  1SVX A;  4HBD A;  4TUM A;  3TWR A;  2L6B A;  1DCQ A;  5KNH D;  1BLX B;  4LG6 A;  3V30 A;  3EHR A;  5CED B;  4ATZ D;  5FIN A;  3EU9 A;  4HI8 A;  4J7W A;  4OAU C;  1UOH A;  3TWX A;  4HI9 A;  3W9G A;  3C5R A;  5AN8 A;  2KBX A;  2F8Y A;  3TWW A;  3UXG A;  4HRN A;  4B93 B;  4O1O A;  1MX2 A;  5KBA A;  5JMN D;  5ENO D;  4UUC A;  5FIO A;  2PNN A;  3Q9N C;  4HQD A;  4LSZ E;  4DX2 A;  2QC9 A;  3TWS A;  1IKN D;  5BXO A;  2XEH A;  4U96 D;  3Q9U C;  4DX5 D;  3IXE A;  3TWU A;  3NOG D;  2JAB A;  4RLY A;  3ZU7 B;  1AWC B;  2XEE A;  2AJA A;  2P2C P;  2ZGD A;  5CEA A;  5CER B;  4K5A B;  5CBO A;  4BES A;  2J8S D;  1QYM A;  3LJN A;  5EID A;  3UTM A;  3V2O A;  3ZKJ A;  2XZD G;  4HLL A;  2ETC A;  2BKK B;  5EN5 D;  4G8K A;  4ZFH A;  4LNU D;  2XEN A;  2DWZ A;  1K3Z D;  2ETA A;  2HE0 A;  4BEP A;  3UI2 A;  2RFM A; 
#chains in the Genus database with same CATH topology
 4TXP A;  4A55 A;  2DCP A;  3BG1 B;  4AOF A;  3CHS A;  1NP7 A;  5EDS A;  4WND A;  3FU0 A;  4U63 A;  3CVU A;  3X2Q E;  2VJ8 A;  1WDY A;  3O48 A;  1U3C A;  2RD0 A;  3FTU A;  4HB5 A;  4NAC A;  3ZHE A;  2P9P G;  2J08 A;  4F1P A;  4PUC A;  3FUN A;  4KYO B;  4K03 A;  2CHZ A;  3C3O A;  3LYA A;  3BG0 B;  2DVW A;  2H6H A;  3V31 A;  3B7S A;  4J8F A;  3MKR A;  5KNG A;  3NF1 A;  4I2W A;  3PUK A;  4YVQ C;  2GRO B;  3D9O A;  4I6E A;  4HNA D;  1JUQ A;  2V4H C;  2MOW A;  3AU5 A;  4Q96 A;  3V30 A;  4XKB A;  1OCO E;  4CDM A;  1HG5 A;  4J0U A;  3C98 A;  3PUJ A;  3ZXP A;  2IU1 A;  1UN8 A;  2RKK A;  3CVP A;  5JJT A;  4UUC A;  2IY0 C;  3D9J A;  4W9R A;  2J4B A;  5AIJ A;  2P2C P;  3FFL A;  4KZC A;  1OCR E;  2OVF A;  4GTQ A;  5D0Q D;  3ZRH A;  3RU0 A;  1TN6 A;  3JCK C;  4Y6W A;  1YMP A;  4BER A;  1WAO 1;  3ONL A;  2F37 A;  3ABL E;  4Q69 A;  2DIW A;  2FO7 A;  3LPZ A;  2H6I A;  5FQ8 A;  2Y69 E;  3QKY A;  1OUV A;  2QYJ A;  4BET A;  3ZVV A;  5KCM A;  4PS3 A;  3B7B A;  2JLB A;  3KSL A;  1HF8 A;  5EX3 A;  2WXQ A;  3T8M A;  1IXV A;  2XPZ A;  4GMR A;  1MQS A;  2R59 A;  3JXI A;  2LXL A;  2MHK A;  3MYV A;  2X3M A;  3I4G A;  4HXI A;  1K1B A;  4UQX A;  5T3R A;  4N39 A;  3TWR A;  2OEW A;  4ILG A;  2NC9 A;  2V0P A;  4NQ0 A;  4FU3 A;  3Q78 A;  5FIN A;  4GYW A;  5J90 A;  3FP3 A;  3ASH A;  3UIN C;  3C72 A;  5FZR A;  4FJY A;  1MX2 A;  4ACL A;  3D9K A;  3HXF A;  3VTX A;  2GRP B;  5HQ8 A;  5KJK A;  1HH8 A;  4CGV A;  1H6K A;  4GYY A;  2CHW A;  3PE3 A;  2J8S D;  3QJZ A;  1N94 A;  3ZGQ A;  3GZ2 A;  3ASD A;  4LER A;  2VTB A;  4HOS A;  3LVQ E;  4N3B A;  4ZFH A;  4F1S A;  1A17 A;  3AS5 A;  2ETA A;  3ESL A;  1TNY A;  3Q75 A;  3UIP C;  3L54 A;  3NQP A;  2E2E A;  1TNZ A;  5H7P A;  2HO1 A;  4K5C A;  4MBG A;  4ANU A;  1E96 B;  1KZP A;  2MRI A;  4MLP A;  4TXQ A;  4ANW A;  3RO2 A;  4U8V D;  3R7Q A;  4Y6C A;  4AXH A;  3PE4 A;  1TEZ A;  5IY5 E;  1YYH A;  3QWV A;  1VDY A;  1ELW A;  2WXL A;  3AU4 A;  3VTY A;  3O4Z A;  2AXU A;  4DLO A;  4G8L A;  3SFX A;  2P9L G;  5DIZ A;  3URZ A;  2IOS A;  5D66 A;  2P58 C;  4EBA A;  5LCW C;  4U0S A;  1OWP A;  3U66 A;  3QB2 A;  4FLB A;  3FUF A;  4R7L A;  3FUD A;  3QAQ A;  4B89 A;  4DPR A;  3CK9 A;  2LAH A;  3ABK E;  4PH4 B;  3ZEF A;  2KM4 A;  3Q49 B;  4B93 B;  4DJA A;  2ION A;  2XGO A;  4U04 A;  2FEZ A;  4HQD A;  3Q47 B;  4U7E B;  1ZU2 A;  3KD7 A;  1IHG A;  4LCT A;  5HI7 A;  3EDT B;  4YDO A;  4GA0 A;  1E8X A;  3PEV B;  5FZS A;  4CEM A;  5AEN A;  4HLL A;  4G8K A;  5LOZ A;  4EPZ A;  3D9N A;  4KXK B;  2VSX E;  1N4Q A;  3B95 A;  5ITZ F;  4I1A A;  2KXP C;  2OVB A;  4GU5 A;  5ENT D;  3SHF A;  4KZ0 A;  2BKG A;  2YHC A;  4ZHB A;  4RG6 A;  3E30 A;  3PZ1 A;  3FH7 A;  5ENS D;  4M3O A;  2AXZ A;  2XCB A;  5JJ7 A;  4N3A A;  3UM3 A;  3ZW3 A;  1N95 A;  3UQ3 A;  4A63 B;  1N11 A;  3APC A;  2PL2 A;  3SBS A;  4UI9 J;  5AAO A;  2GW1 A;  4V3I A;  3JQ0 A;  4XZ4 A;  1ZB1 A;  3ZHE B;  1U2V G;  3SBT B;  4Z68 A;  1E7V A;  4UI9 C;  4U07 A;  2BF0 X;  4GML A;  3UT8 A;  1G3N B;  3MA5 A;  3JUI A;  5ARF A;  3I3N A;  4CZ2 D;  2PQN A;  1BD8 A;  1MHQ A;  3SQV A;  1E8Y A;  3TG5 A;  4UQY A;  2I6H A;  1E90 A;  4IYP A;  4RVB A;  3NZU A;  5FIO A;  3Q9N C;  4LSZ E;  2WMN A;  2L6J A;  2CFU A;  5LX8 A;  3ML8 A;  2ZGD A;  2WQ6 A;  4K5A B;  3QK0 A;  1Q2Z A;  2XPI A;  2XGS A;  3L17 A;  3U64 A;  3CST A;  3FU3 A;  4UWK A;  3TJP A;  2L0T B;  4FHJ A;  3CVL A;  4EZK A;  2WXR A;  3HDX A;  3VLF A;  5JHA A;  4HVB A;  1DC2 A;  5CBN A;  2X6J A;  1OXJ A;  4F53 A;  3QAR A;  1BU9 A;  5G04 J;  3L13 A;  4JXT A;  2CFZ A;  2XZT G;  3FUI A;  1EYH A;  4F6R D;  5CRV A;  1SW6 A;  5ANL A;  5BW8 C;  4BTB A;  3ULE G;  5CEC B;  1TN7 A;  1BPO A;  4DRX E;  4APO A;  4WWO A;  1BI7 B;  3RRN B;  4GTV A;  4N5Q A;  3TGO A;  2DYS E;  4JVS A;  2OOE A;  4K5B A;  4CDN A;  2VGY A;  2UY1 B;  1H0A A;  3P1U A;  4FA6 A;  3CQC B;  1DCQ A;  1H6O A;  3LVR E;  3FUM A;  4WNE A;  4GMJ A;  3EU9 A;  5AN8 A;  5D0O D;  4O1O A;  1IQU A;  2V5F A;  2KC7 A;  2AXV A;  4U0U A;  4BSX A;  4LUN U;  1FPP A;  3NZS A;  4LNU D;  2XCC A;  3ZNG A;  3CHM A;  3GZ1 A;  5AQ7 A;  2VTB B;  1DNP A;  2B0O E;  3B13 A;  3TXN A;  4F3V A;  2J49 A;  3APF A;  3ZYQ A;  4IN3 B;  2WB2 A;  3EHM A;  1OWL A;  4MS6 A;  5BUZ A;  4QFV A;  1TNB A;  4GA1 A;  4BX9 A;  3HXC A;  4GZ6 A;  3T9K A;  4GZC A;  4PDX A;  4GZD A;  4DK5 A;  1Y6I A;  1LD8 A;  4AEZ C;  1MX4 A;  3FTW A;  4FUL A;  5FWQ A;  1WY6 A;  3D9M A;  3AG3 E;  5JA4 D;  4CCA A;  4GPK A;  3HXE A;  4G24 A;  2FI7 A;  4LNB A;  4E6H A;  3T5X A;  1NA0 A;  1NFI E;  4U95 D;  3PH0 C;  4QQI A;  4DLQ A;  2C0M A;  2RG8 A;  4OAV B;  3DEP A;  1V55 E;  1N52 A;  4KVM A;  4DI3 A;  1TN8 A;  3E33 A;  3E34 A;  3CEQ A;  5KBA A;  5KJM A;  2EIJ E;  4XX5 A;  5KJL A;  4LRZ A;  4O6F A;  5BXO A;  4U96 D;  2KAT A;  4A1S A;  4MKT A;  4DI4 A;  3PRZ A;  4PS8 A;  2YQ8 A;  5CBO A;  4WWN A;  2WXM A;  4L23 A;  2XEN A;  3UUX A;  4J8D A;  2BTD A;  1PAQ A;  4PS7 A;  3K9I A;  3G2W A;  5BT1 A;  2EIL E;  4ME2 A;  3APD A;  5G55 A;  2M63 A;  4RG9 A;  4IUL A;  4JEH A;  3DXK G;  4G2V A;  2DBA A;  4C0E A;  3ZUV B;  3UT4 A;  3AG1 E;  1QNF A;  2UWJ G;  2IF4 A;  4C9B B;  3MCX A;  3WXX A;  3U3W A;  2I9C A;  5CHE E;  1NA3 A;  2EIN E;  3G2T A;  2J07 A;  3ISM C;  3TG4 A;  3KAE A;  3QWP A;  1S63 A;  5BPP A;  3BQO A;  4JZY A;  4FAD A;  4GTS A;  5ENN A;  3UM1 A;  3MV2 B;  1BLX B;  2X6F A;  4UI9 K;  4FJZ A;  4ATZ D;  4WNG A;  3B7T A;  3GZS A;  1EF1 C;  2UY1 A;  3ZYL A;  4OAU C;  1Z6T A;  1JCR A;  3MEK A;  4UQZ A;  5FQ7 A;  4ACK A;  5B1B E;  2VSN A;  2YHE A;  5B1A E;  3IXE A;  3QC1 A;  4BT9 A;  3FEY A;  4M7C A;  4YVO A;  4CT0 A;  5CEA A;  1HE8 A;  4UWF A;  3ZKJ A;  3TXM A;  1JCS A;  4LNG A;  1JWG A;  4I1O B;  1OWM A;  3FHE A;  3LY8 A;  3S7F A;  5ARG A;  3CSF A;  4F7A A;  5AQ9 A;  2VQ2 A;  2KCK A;  4N2S A;  2KCL A;  4YDY A;  1H6P A;  2ZU6 B;  3MV3 B;  4JHJ A;  4O60 A;  4WAF A;  2GRL A;  4J6I A;  1MJ0 A;  3ENE A;  3AS8 A;  3LCA A;  5HKP A;  3NBN B;  3BEE A;  1SA4 A;  3CQG B;  1QQE A;  3LY9 A;  1PC2 A;  4NUR A;  4UWH A;  2FUL A;  1N0R A;  4HOQ A;  2ZGG A;  3JQ1 A;  1KLX A;  4LEU A;  1UN9 A;  2FO1 E;  2X6I A;  3CLJ A;  3ZFW A;  4TUM A;  3CKC A;  2PM6 A;  4LG6 A;  1D8D A;  3L22 A;  5CED B;  2IO3 C;  1TJC A;  3HHM A;  1PY1 A;  4HI9 A;  4XI0 A;  3LY7 A;  2KBX A;  4GTO A;  3CK8 A;  2X38 A;  3Q5M A;  4ILH B;  3OTN A;  2PNN A;  4DX2 A;  4GB9 A;  2GGF A;  3NOG D;  4L1B A;  4I2Z A;  4UWL A;  4BES A;  1UJK A;  3WG7 E;  2XZD G;  4WUY A;  2YNQ A;  4D10 C;  4BSZ B;  5AYW D;  5EYL A;  1FT2 A;  2PM7 A;  3U9W A;  3CKB A;  1A5E A;  4I9E A;  3SFZ A;  5E75 A;  3EJN A;  2WQH A;  3Q15 A;  1XGW A;  4G25 A;  3HG0 D;  1HS6 A;  5C2Y A;  3F6Q A;  4GAA A;  2H6F A;  3SZ7 A;  3SFY A;  4HRM B;  3TWT A;  4IRU A;  3KS2 A;  1X5B A;  2ZIS A;  1E8Z A;  3P2B A;  1EPU A;  2ZIR A;  4B8A A;  5LFA A;  2Y0B G;  1LD7 A;  2C2L A;  4U0Z A;  4CYM D;  2EIK E;  3LDZ A;  2AWI A;  2L0I A;  3DST A;  2WXK A;  3HYM B;  3RIB A;  1DCE A;  1N9A A;  4JEU A;  4CT4 A;  2VSY A;  3UT7 A;  3AG2 E;  5FQ4 A;  4GTT A;  3TWX A;  4G23 A;  2V8S E;  4FHK A;  5A7D B;  4XEI G;  1TJF A;  4GZ3 A;  4HOR A;  3VLD A;  4XE0 A;  2GRR B;  3FTV A;  4L9P A;  2QZA A;  3TWU A;  2J4D A;  3FU5 A;  5JJ6 A;  3CVW A;  3KSQ A;  2OEV A;  3IKO B;  3CGH A;  5AJL A;  4B0Z A;  1SZ9 A;  1O1R A;  2RFA A;  3EHQ A;  4TUU A;  4X8Q A;  2Y3A A;  4C0M A;  4UWG A;  3UX4 A;  3D9H A;  1YCS B;  2P9N G;  1H19 A;  2AVP A;  5HS0 A;  4AY6 A;  1H2T C;  3S2A A;  1D9S A;  1UJJ A;  5DBK A;  3ASF A;  1O1S A;  1KPS B;  3ML9 A;  5G05 J;  3ZYK A;  4JB8 P;  3FH8 A;  3FTS A;  1B89 A;  5G04 C;  2LSV A;  5A6C A;  4YND A;  3PEU B;  2L9B A;  4K0R A;  3IBE A;  2HR2 A;  2FBN A;  3PZ4 A;  3N71 A;  1EDU A;  3IHY A;  1UG3 A;  3BU8 A;  5FZQ A;  3JYS A;  4HI8 A;  3C5R A;  3QDN A;  1JWF A;  1K8K G;  1HXI A;  3E4B A;  3DSS A;  3FUK A;  1AWC B;  2XEE A;  3EUV A;  3UPV A;  1W3B A;  3MJW A;  3QOU A;  3PVL A;  2BUG A;  4I43 A;  5E76 A;  2WXI A;  2HE0 A;  3NAW A;  5BNW A;  2LUH A;  4FC8 A;  1QBQ A;  2WQ7 A;  2P9K G;  2AW6 A;  3V2X A;  3L82 A;  2EQX A;  3CVX A;  3PS6 A;  3T8K A;  5JHB A;  2HYZ A;  4APF A;  3ESK A;  4BWR A;  3LEW A;  3FTX A;  1K1A A;  5CRU A;  1KT1 A;  1MZC A;  3W9F A;  5AQA A;  2J09 A;  2XS1 A;  3L9T A;  3HRA A;  3AS4 A;  4JPS A;  2IEJ A;  4TRQ A;  3AJI A;  1BI8 B;  4GZ5 A;  4J8E A;  2NXP A;  2Y4T A;  5AQB A;  3LS8 A;  1P5Q A;  2WPV A;  4JA9 A;  3DSW A;  2LO6 A;  2L6B A;  4EBA G;  2QFC A;  4HOT A;  3CK7 A;  3LKU A;  1V54 E;  3CVN A;  2V4L A;  4E85 A;  2EIM E;  3MKQ A;  2DYR E;  3OXG A;  3TWW A;  3UXG A;  3SD5 A;  4ATG A;  2VGX B;  4OYS A;  5JMN D;  1XNF A;  2XEH A;  1HZ4 A;  3ZU7 B;  2WXP A;  4GTM A;  1LTX A;  1QZ2 A;  1JCQ A;  3EIQ C;  3LJN A;  4OVV A;  5B3S E;  4KVO A;  2DWZ A;  2WXJ A;  2WXN A;  3G2S A;  4BEP A;  4P29 A;  3R9A B;  4HRL A;  5M72 A;  1DVP A;  2R05 A;  4DX7 D;  2ETB A;  3D3M A;  2VGE A;  3J5P A;  4AVX A;  1S70 B;  2B6C A;  4DX6 D;  3Q79 A;  3LXU X;  2NYJ A;  5AAR A;  1FT1 A;  3ABM E;  3DXM G;  3CV0 A;  3DWL G;  2LSU A;  4GCO A;  4YDW A;  3HIZ A;  1AP7 A;  1NZN A;  4AJW A;  1ZBP A;  3UKU G;  3AG4 E;  3OAW A;  3S7B A;  5EYP F;  3RKV A;  3CHP A;  2BED A;  4URK A;  2WMO A;  3KEZ A;  2Y4U A;  3RRU A;  1OWO A;  1OCC E;  4JHR A;  1RW2 A;  3IV0 A;  3I5P A;  2XS8 A;  2QC9 A;  3TWS A;  2R17 C;  3DBS A;  4KMO A;  3E37 A;  3SY2 A;  2A5U A;  4J8S A;  3C3R A;  3MZL B;  4EEC A;  4HOU A;  5EN5 D;  3FUH A;  4AIF A;  3DSX A;  4A1G A;  4RSY A;  3CHR A;  2GRQ B;  1N4R A;  3RSE G;  3HXB A;  3CVV A;  4I17 A;  1HO8 A;  4I9C A;  3PZ2 A;  4GCN A;  3ONK A;  4BX8 A;  5HRY A;  5A23 A;  4CRW A;  3CVQ A;  3DSU A;  1WG0 A;  4KT6 B;  5ENR D;  2ZXW E;  3R9M A;  4TV3 A;  4H7X A;  3UIO C;  3DEO A;  2HM8 A;  3HVE A;  4GPM A;  3ULQ A;  1N54 A;  4WWP A;  2R2L A;  4G1T A;  4J8Y A;  3ULY A;  2DZO A;  5BXU A;  1Z3Y A;  1MX6 A;  4GA2 A;  1H2V C;  4FP7 A;  1IHB A;  2CHX A;  4A3V A;  4DX1 A;  5FTP A;  3SI5 A;  2X6K A;  2KCV A;  4TXR A;  5EKQ D;  3KEA A;  3PNT B;  5KNH D;  5T8I A;  4GTR A;  4OVU A;  2I2O A;  3PZ3 A;  5BV0 A;  1TNO A;  3CHO A;  3RK6 A;  5KJN A;  4L2Y A;  3TAX A;  4L7T A;  1FCH A;  4CDR A;  1INZ A;  3BUA A;  4XIF A;  2WXF A;  3VLE A;  3CVY A;  3D9L A;  3L6A A;  2VGX A;  1O5M A;  3B7R L;  1QYM A;  3UTM A;  5EID A;  1OWN A;  4JA7 A;  4I6G A;  1SZA A;  4XKC A;  3FY4 A;  4DUI A;  2RFM A;  3RAU A;  3ZN3 A;  3UKR G;  1E7U A;  3Q7A A;  3UM2 A;  3D9P A;  3B7U X;  1O1T A;  3ASG A;  4B8C B;  3D9I A;  1Z3X A;  5LCW J;  1ELK A;  3FU6 A;  2WM9 A;  2XHE A;  5C1D A;  4Q94 A;  1OY3 D;  5T4Y A;  4HS2 A;  3TL5 A;  1TYQ G;  2J9Q A;  2IJG X;  3JUE A;  5KWD A;  3EU5 A;  4ABN A;  2VYI A;  2Q7F A;  3FH5 A;  3J5Q B;  3FUJ A;  4G26 A;  2OCC E;  2V5Q C;  2WXH A;  1N4S A;  1OCZ E;  1KZO A;  1OT8 A;  4I1M A;  2Y1L E;  1SA5 A;  3EHN A;  4I6J A;  4C48 B;  3ZPJ A;  3ASN E;  3E32 A;  4EHM A;  4B94 A;  5ENP D;  4HBD A;  3NB2 A;  4NRH B;  1H2U A;  2KZT B;  3DRA A;  4AY5 A;  1LF8 A;  4H7Y A;  1KT0 A;  4BY6 A;  3Q4A B;  1UOH A;  4N5C A;  2CG3 A;  2F8Y A;  5ANR A;  1HU3 A;  4JHK A;  2YIN A;  1D8E A;  1HG2 A;  3R7R A;  1IKN D;  1RZ4 A;  3MKQ B;  2I1J A;  2CG2 A;  5J08 A;  5CER B;  3L16 A;  3MGB A;  2ETC A;  5CCL A;  4KBQ A;  4GYO A;  2WXG A;  4BFR A;  3FUE A;  1S64 A;  3SO8 A;  3RJV A;  1TR4 A;  1Y8M A;  3S7D A;  2F8X K;  4N3C A;  2QY7 A;  5D2M C;  3OXF A;  3Q73 A;  2MYO A;  3Q7F A;  5G2N A;  2XGM A;  4EZJ A;  3ASO E;  3U4T A;  4MRU A;  1YA0 A;  3ZIM A;  2LNI A;  2WXO A;  3QWW A;  3FTZ A;  5FQ6 A;  4L2L A;  3G2U A;  4ANV A;  2OV8 A;  3EIJ A;  2A4Z A;  3QNK A;  1JPL A;  5EIB E;  4O1P A;  1N4P A;  5EX0 A;  5EIL A;  4AP2 A;  1SQM A;  4ILI A;  5FT9 A;  2IFU A;  5CMY A;  1SVX A;  5CMW A;  2GRN B;  3FUL A;  1HX8 A;  3EHR A;  1U3D A;  2P9S G;  2PQR A;  4XI9 A;  4A3T A;  4J7W A;  2WVI A;  2XRY A;  1NL4 A;  3W9G A;  3SGH A;  3SF4 A;  3PNL B;  4HFG A;  3FEX A;  3PZD A;  4HRN A;  4U8H A;  1NI1 A;  2X6H A;  3G2V A;  4WNF A;  5ENO D;  3DPD A;  4JW1 A;  3Q9U C;  4DX5 D;  2PZI A;  5CCM A;  5G05 C;  3PDN A;  2AJA A;  3L08 A;  5BV1 A;  2BKK B;  1IQR A;  1GW6 A;  1S0P A;  2OND A;  4JL0 A;  3OXL A;  4EZL A;  2R02 A;  1FVF A;  3CIA A;  3JXJ A;  3PRE A;  3FWV A;  2XQ0 A;  1FVH A;  1N0Q A;  3LJ3 A;  2NSZ A;  4BT8 A;  2DZN A;  4NIK A;  3RRM B;  2IQC A;  3ZXS A;  4AV7 A;  3GW4 A;  2QYU A;  4FLH A;  1HFA A;  1L5J A;  3NOC D;  4RQI A;  3RO3 A;  2IO2 C;  2XPY A;  4G11 A;  2P9U G;  1MYO A;  4GTP A;  3V79 K;  2JEK A;  5ENQ D;  3C3Q A;  3FDH A;  3I4R B;  4U8Y D;  3TWQ A;  1Z5S C;  1UW4 B;  1X81 A;  2VSO E;  3TWV A;  3HVE B;  4BTA A;  3AAA C;  3SNX A;  2LXM A;  3DSV A;  2A5E A;  3IHV A;  2FF4 A;  4HLE A;  4N2Q A;  1WM5 A;  2H6G A;  5LP0 A;  2F0Y A;  3HXD A;  2E0I A;  4JC8 A;  3DPY A;  2XRZ A;  2ILR A;  3T5V A;  2IOL A;  5FJY A;  2I1K A;  4JD2 G;  3FTY A;  3GYZ A;  4AM9 A;  4CGW A;  2P9I G;  3UMV A;  4YDE A;  2R03 A;  3UM0 A;  3CR3 A;  2KZT A;  4ANX A;  3ZYM A;  5AJD A;  2JAB A;  4RLY A;  4EQF A;  3CHQ A;  2GRM A;  3IEG A;  1IYG A;  2C0L A;  2LAI A;  2XEV A;  1E8W A;  3V2O A;  3S7J A;  3MX3 A;  1K3Z D;  1TNU A;  3UI2 A;  1ELR A;  2R5S A; 
#chains in the Genus database with same CATH homology
 3ZNG A;  3SO8 A;  3B95 A;  5ITZ F;  4HRL A;  1A5E A;  5AQ7 A;  3JXJ A;  2KXP C;  4DX7 D;  1DC2 A;  3V2X A;  2B0O E;  1TR4 A;  5ENT D;  5CBN A;  2ETB A;  2BKG A;  4ZHB A;  2RFA A;  3EHQ A;  2F8X K;  1N0Q A;  1YMP A;  2VGE A;  5AQ9 A;  4BER A;  3HG0 D;  3T8K A;  1BU9 A;  1WDY A;  2DZN A;  4NIK A;  4YDY A;  2F37 A;  3J5P A;  4HB5 A;  5ENS D;  1S70 B;  3F6Q A;  2MYO A;  2XZT G;  4K5C A;  4O60 A;  4QFV A;  4BSZ B;  5HRY A;  1OY3 D;  3T9K A;  5EYL A;  1WG0 A;  3D9H A;  4DX6 D;  4HRM B;  1MJ0 A;  4F6R D;  3TWT A;  1YCS B;  3JUE A;  2NYJ A;  5KWD A;  5AAR A;  4U8V D;  2QYJ A;  4F1P A;  5HKP A;  3NBN B;  1SW6 A;  4A63 B;  1N11 A;  5ENR D;  3NOC D;  3ZUV B;  5HS0 A;  1MX4 A;  4BET A;  1K1A A;  1D9S A;  5CEC B;  3J5Q B;  5AAO A;  4DUI A;  1YYH A;  2Y0B G;  3W9F A;  5AQA A;  2V5Q C;  3B7B A;  5JA4 D;  2DVW A;  3DEO A;  3V31 A;  4DRX E;  4GPM A;  1IXV A;  3HRA A;  4GMR A;  1MYO A;  3JXI A;  3V79 K;  4CYM D;  4Z68 A;  1BI7 B;  3AJI A;  1BI8 B;  4YDW A;  5KNG A;  1N0R A;  5ENQ D;  1G3N B;  2ZGG A;  4J8Y A;  4U8Y D;  2DZO A;  5AQB A;  3TWQ A;  5BXU A;  4N5Q A;  1OT8 A;  1MX6 A;  1NFI E;  4G8L A;  2Y1L E;  1IHB A;  4U95 D;  4DX1 A;  5EIB E;  1AP7 A;  4K5B A;  1K1B A;  4HNA D;  4JB8 P;  4O1P A;  4QQI A;  5D66 A;  3TWV A;  4C48 B;  3AAA C;  4CZ2 D;  5EIL A;  2FO1 E;  2V4H C;  5EYP F;  2A5E A;  1BD8 A;  3KEA A;  4OAV B;  3DEP A;  5ENP D;  1SVX A;  4HBD A;  4TUM A;  3TWR A;  2L6B A;  1DCQ A;  5KNH D;  1BLX B;  4LG6 A;  3V30 A;  3EHR A;  5CED B;  4ATZ D;  5FIN A;  3EU9 A;  4HI8 A;  4J7W A;  4OAU C;  1UOH A;  3TWX A;  4HI9 A;  3W9G A;  3C5R A;  5AN8 A;  2KBX A;  2F8Y A;  3TWW A;  3UXG A;  4HRN A;  4B93 B;  4O1O A;  1MX2 A;  5KBA A;  5JMN D;  5ENO D;  4UUC A;  5FIO A;  2PNN A;  3Q9N C;  4HQD A;  4LSZ E;  4DX2 A;  2QC9 A;  3TWS A;  1IKN D;  5BXO A;  2XEH A;  4U96 D;  3Q9U C;  4DX5 D;  3IXE A;  3TWU A;  3NOG D;  2JAB A;  4RLY A;  3ZU7 B;  1AWC B;  2XEE A;  2AJA A;  2P2C P;  2ZGD A;  5CEA A;  5CER B;  4K5A B;  5CBO A;  4BES A;  2J8S D;  1QYM A;  3LJN A;  5EID A;  3UTM A;  3V2O A;  3ZKJ A;  2XZD G;  4HLL A;  2ETC A;  2BKK B;  5EN5 D;  4G8K A;  4ZFH A;  4LNU D;  2XEN A;  2DWZ A;  1K3Z D;  2ETA A;  2HE0 A;  4BEP A;  3UI2 A;  2RFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...