5AAOA

Crystal structure of fluorogen-activating designed ankyrin repeat protein (darpin) dimer in complex with malachite green
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
SDLGKKLLEAARAGQDDEVRILMANGADVNAKDSRGKTPLHLAADYGYLEVAEVLLKHGADVNAHDVYGDTPLHLTATWGHLEIVEVLLKNGADANAIDFFGWTPLHLAAYFGHLEIVEVLLKYGADVNAQDKFGKTVFDISVYNGDEDLAEILQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of Fluorogen-Activating Designed Ankyrin Repeat Proteins (FADAs) as Versatile Sensor Tools.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
molecule keywords FAD3210
total genus 54
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5aaoA00
4BESA 2NYJA 2VGEA 3D9HA 1DCQA 3V2OA 5ENRD 1OY3D 3HG0D 4HRNA 3AJIA 2AJAA 4RLYA 4A63B 3JXIA 2JABA 1K1BA 4J8YA 4F1PA 1N0QA 2QC9A 1MX6A 1NFIE 5CEAA 5EIBE 1K3ZD 4CYMD 5EN5D 2XZTG 5FIOA 4UUCA 3HRAA 3Q9NC 3ZNGA 4ATZD 1AP7A 5EIDA 4HQDA 3EU9A 4G8KA 4HRMB 4DX5D 4U8VD 5HKPA 5KNHD 4QQIA 3J5PA 2RFMA 4HI8A 4LG6A 2MYOA 3ZKJA 4CZ2D 4LNUD 4BETA 3B95A 3SO8A 1YYHA 3C5RA 5BXUA 5CEDB 1BD8A 1AWCB 3NBNB 5ITZF 5KWDA 3DEOA 2KBXA 5CBNA 4DX6D 4U95D 5AN8A 2Y1LE 2DWZA 5AQAA 5CBOA 1MX2A 1TR4A 4B93B 5AQBA 3ZU7B 3EHRA 4QFVA 3KEAA 3T8KA 4GPMA 3ZUVB 2RFAA 5ENTD 1DC2A 1A5EA 1BLXB 3B7BA 2BKGA 5KBAA 1QYMA 5HS0A 1IHBA 2XEEA 4YDWA 4O1PA 4GMRA 4O60A 3T9KA 4BERA 2J8SD 3TWRA 5ENSD 1BI8B 4NIKA 3TWVA 1K1AA 4JB8P 2F8YA 1UOHA 3J5QB 3JUEA 5ENOD 3TWSA 3V2XA 3W9GA 3V79K 5CERB 3V30A 5AAOA 1BU9A 4C48B 1WDYA 4HBDA 2QYJA 4HRLA 1MJ0A 4DX7D 1BI7B 3EHQA 1N0RA 5ENQD 3Q9UC 4F6RD 2XZDG 5CECB 3TWXA 2BKKB 2V5QC 3IXEA 2FO1E 2XENA 5JMND 2F37A 3UXGA 4DUIA 2ETBA 1SVXA 2V4HC 2ZGDA 4U96D 5AQ7A 4DX2A 5JA4D 4ZHBA 4OAUC 4J7WA 4K5BA 5FINA 4G8LA 5BXOA 4N5QA 3TWQA 2ETCA 4ZFHA 3NOGD 2DZOA 1D9SA 3AAAC 2ETAA 2KXPC 3V31A 1YCSB 3TWUA 1SW6A 1MX4A 2Y0BG 3TWTA 4TUMA 4LSZE 4YDYA 3F6QA 3DEPA 1YMPA 2DVWA 4HLLA 5EYLA 2F8XK 5EYPF 4K5AB 4BSZB 3W9FA 2DZNA 5AQ9A 1OT8A 4DX1A 4BEPA 1IKND 4HI9A 4HNAD 2ZGGA 2A5EA 1MYOA 2HE0A 5D66A 4OAVB 4DRXE 3LJNA 5AARA 4O1OA 5EILA 1N11A 4K5CA 4U8YD 2P2CP 5ENPD 3NOCD 4Z68A 2PNNA 5KNGA 4HB5A 3JXJA 3UTMA 1S70B 1WG0A 5HRYA 3TWWA 2L6BA 2XEHA 3UI2A 2B0OE 1IXVA 1G3NB
chains in the Genus database with same CATH superfamily
4HRNA 4GCOA 3FUFA 3L13A 3FU6A 2CFZA 3TXMA 3G2UA 4YDOA 3LVQE 3EDTB 2EIKE 4PS3A 2P9LG 3FTVA 4HQDA 4Q94A 3B95A 1Z3YA 1UJJA 4C9BB 4I1MA 5AN8A 2L0TB 4A1GA 3EHRA 3QNKA 3JUIA 1O1RA 2WXFA 4GA2A 3ZHEB 4DK5A 3ZYQA 3CK9A 4JB8P 5FZRA 3E30A 5M72A 3E37A 3L22A 2ZXWE 3L6AA 4EZKA 3TWXA 2FO1E 5J08A 5LP0A 3MYVA 4GA0A 1KT0A 2WQ7A 3FP3A 3VLDA 3IEGA 2EQXA 3F6QA 3Q73A 2V5FA 3WG7E 3U4TA 4BSZB 4JZYA 3UIPC 3RRNB 3U64A 3DSSA 2I6HA 3HXCA 3PE4A 5E75A 4BTAA 4DRXE 3LJNA 5KJMA 2Y4UA 1BPOA 4B0ZA 1TJFA 2C0MA 5ARFA 4EZJA 2X3MA 4L2LA 4JHKA 4CT4A 2VGXB 2WMOA 1DCEA 4Y6WA 1DCQA 2LSVA 3FULA 1S63A 3PEUB 2IOSA 3JXIA 4J6IA 3QDNA 2AXZA 3OXGA 1B89A 3PEVB 1EYHA 3HRAA 5FZQA 4RVBA 2XGOA 4DJAA 3OXFA 3CHRA 1MHQA 3NZSA 2DYRE 4URKA 2VGXA 1QZ2A 3QARA 4DI4A 1NL4A 2MOWA 2JLBA 3NB2A 3PREA 2DIWA 3ABLE 2R5SA 1YA0A 1IHBA 1O1TA 2IEJA 1BI8B 2KC7A 3PUKA 4MRUA 2NC9A 4XKCA 1QNFA 5KJNA 4EQFA 2KM4A 2J9QA 4TXQA 4C48B 1XNFA 3ZYLA 4UWHA 1GW6A 3LJ3A 4APFA 4G25A 4ILIA 3OTNA 2R05A 3EUVA 1D9SA 5JJTA 5FQ6A 5EX0A 4TUMA 4YDYA 5D2MC 3U66A 5B3SE 3P1UA 3QB2A 2FO7A 2NXPA 5ANLA 1N4PA 3VTYA 4B8CB 3RKVA 3O48A 3DRAA 3FEXA 1OCCE 3AG1E 3R9MA 1E7VA 2B0OE 3CHMA 1HG2A 5A7DB 3UT4A 4JXTA 3SBTB 4I6EA 2QC9A 3PDNA 2XZTG 2IY0C 3KAEA 5D0OD 4I6JA 1TN8A 1JCQA 4LG6A 4CZ2D 2X6IA 4AP2A 4O6FA 4WWNA 1WY6A 4FA6A 2WXLA 3ZYMA 1O1SA 4YDWA 4O60A 4Q96A 3PVLA 4WNFA 2F8YA 3KD7A 3RRUA 4CRWA 1HU3A 3UT7A 5AENA 1MJ0A 3CSFA 3ASHA 2GW1A 2BTDA 2J07A 4CGVA 2KZTB 4GZ6A 4KBQA 2FI7A 5CCMA 3WXXA 2XCBA 3U9WA 4EBAG 3TWQA 1V54E 5G55A 4XI0A 5JJ7A 2FEZA 5FQ8A 3CHSA 1WM5A 4BT8A 4BTBA 3ZRHA 5CHEE 1Z5SC 4WWPA 3Q7FA 5FTPA 3UM1A 1N11A 1E8YA 4ATGA 4CDRA 1Z6TA 1A17A 1UN8A 5KNGA 3CV0A 3UI2A 3Q47B 4L23A 1G3NB 2WXKA 3C98A 4XZ4A 3NAWA 3SF4A 4PUCA 5CEAA 2XPZA 3JCKC 1LF8A 4J8DA 3MX3A 4GTMA 2HYZA 5EIDA 3MA5A 5HKPA 4UWFA 2NSZA 3SO8A 4I17A 3NBNB 2EILE 2OV8A 2HM8A 2X6FA 4HS2A 2E2EA 3BG1B 2J8SD 3DXMG 2VSXE 1K1AA 2X38A 3FUEA 4GMJA 4KT6B 2VJ8A 2H6IA 4TRQA 1BU9A 2I1KA 2QYJA 4GZDA 1NA0A 2LXMA 2UY1A 1PC2A 2XZDG 3Q75A 2XS1A 4UI9K 2ZISA 4LNGA 3EIQC 3B7SA 4U04A 3EJNA 3TG4A 4ANVA 4FU3A 2OVBA 1UG3A 3CK8A 1Q2ZA 3UINC 1YMPA 1D8DA 3FDHA 1H6PA 4WWOA 4PDXA 3W9FA 5KJKA 3NF1A 4ILGA 5KJLA 3PUJA 1JWGA 3LDZA 4G1TA 1NA3A 2PNNA 1NI1A 1OUVA 5G05C 4UWKA 3GW4A 3TG5A 3V2OA 5IY5E 1EF1C 2P9IG 5BPPA 3E33A 5C2YA 4BT9A 3L54A 5G04J 1PY1A 2RG8A 3ZW3A 1K8KG 3ZXPA 4F1PA 3ZGQA 3RIBA 4N39A 1SZ9A 5KNHD 4F1SA 5JJ6A 2P9NG 4GZCA 3CHPA 4MBGA 1YYHA 5CEDB 2QFCA 4U95D 3G2WA 4RG6A 2UWJG 4QFVA 1HG5A 1HE8A 3L9TA 3FTWA 2XHEA 1DVPA 4JW1A 4UWLA 3C3OA 5CCLA 4U0SA 4HFGA 3BEEA 5ENNA 2VSNA 3V30A 5HQ8A 4GTSA 2QY7A 3APCA 3Q7AA 3VTXA 2ZU6B 2IOLA 2XENA 5JMND 3QWVA 3UKRG 2OVFA 2ETBA 3QC1A 4ZHBA 2CHZA 3PRZA 4ZFHA 3SFYA 2H6GA 3HVEA 3RO3A 1H2TC 1D8EA 5LOZA 4F53A 2VGYA 4BEPA 3ASGA 4A55A 5FJYA 1LD7A 1ELRA 5D66A 3DSWA 2R17C 3CVLA 1EPUA 4I1AA 4WNEA 4J8SA 3S7BA 4GPKA 4FJYA 4WNGA 4H7XA 1Z3XA 4E85A 3GYZA 2VYIA 2J09A 1JCSA 3FUJA 1HXIA 3P2BA 4DX5D 3UM2A 4U8VD 1RZ4A 3LVRE 3KSLA 3S7FA 1OCOE 5KWDA 5BUZA 3DEOA 3I5PA 3LY7A 3D9LA 4BX9A 2GRPB 5ENTD 3DSXA 3S7DA 4IULA 1LD8A 1FVHA 5ANRA 1HZ4A 4GMRA 4HOUA 2WXPA 2H6HA 2JEKA 3EHNA 5FT9A 3CVXA 2DYSE 3CVNA 2WMNA 4LCTA 2OEVA 1JUQA 1JWFA 2R02A 1FPPA 3IXEA 1HH8A 4UQZA 4ACLA 4DUIA 4EHMA 2ZGDA 2YNQA 5BXOA 4N5QA 1YCSB 2CHXA 4U0UA 4DPRA 3CIAA 3PNLB 3L08A 3EIJA 3S2AA 3T5VA 2CG2A 4F7AA 1X81A 3B7UX 3UMVA 3CQCB 2AVPA 3MGBA 4RSYA 4K5CA 3NOCD 4Q69A 4GZ5A 1DNPA 1IXVA 4U96D 3BQOA 2IFUA 5T3RA 4WNDA 4I43A 3HIZA 4XEIG 4ACKA 3JYSA 3CHQA 4G26A 2MHKA 3OAWA 2FBNA 4B8AA 4JEUA 4PS8A 3ZKJA 4L7TA 4AXHA 1TR4A 4GCNA 3Q5MA 4GZ3A 2BUGA 4OVVA 3SNXA 1A5EA 2LUHA 2KCKA 4C0EA 1H2VC 1H19A 2J49A 3U3WA 5EX3A 4XI9A 2LO6A 2OEWA 3DWLG 1FT2A 4DX7D 3HXBA 1KLXA 3ESLA 2WXIA 2PQRA 3APFA 2AWIA 2AXVA 4GAAA 3NZUA 4J7WA 4G8LA 5HI7A 3LKUA 4OYSA 1V55E 1E8XA 2IU1A 2F8XK 1NP7A 4IN3B 2P9PG 4HNAD 3MV2B 2E0IA 3PZDA 2VTBA 4UQYA 4O1OA 3FTUA 1S64A 4K0RA 1OCRE 3D9HA 1UN9A 3RO2A 4HOQA 4A1SA 4AM9A 2EIME 3ZVVA 3AJIA 3C3RA 4GYYA 4HXIA 1S0PA 2GROB 3FH5A 3S7JA 5EIBE 1NFIE 1K3ZD 2LAIA 2EIJE 3MCXA 5FQ4A 3D3MA 4HRMB 3AS8A 4BETA 3C5RA 2KBXA 3QKYA 3AG2E 4YNDA 4RG9A 2X6KA 4PH4B 5B1AE 2R59A 4DLQA 2LAHA 4XKBA 3CVYA 2BKGA 4GTOA 2XQ0A 3PS6A 4NIKA 2I1JA 3AS4A 3FU3A 3ASFA 4KVOA 4FHKA 3D9MA 3LEWA 3HXEA 2VSOE 3LYAA 3QAQA 3X2QE 2YINA 2F37A 2FULA 2PL2A 2WXOA 5JHAA 4ANWA 2ETAA 3V31A 2DVWA 4N3AA 4AOFA 2PM7A 3SFXA 1IQRA 2A5EA 4GTQA 2M63A 1E7UA 4HB5A 5KCMA 1E8ZA 5H7PA 3CVQA 3OXLA 4EPZA 4U7EB 3UPVA 4NQ0A 5AJDA 2AJAA 3CKBA 3B7RL 4J8YA 3D9IA 1MX6A 2XRZA 4YVOA 5FZSA 3FY4A 4ANUA 4G8KA 3MEKA 4AY6A 2KCLA 4CCAA 2MYOA 5BXUA 2IQCA 4OVUA 2Y69E 5CBNA 2I9CA 5AQAA 3SY2A 3CSTA 4WUYA 3KEAA 3ZUVB 3G2VA 2WXMA 2RFAA 3ZEFA 1BLXB 4YDEA 5HS0A 3FWVA 4I1OB 3NQPA 1OWLA 4A3VA 3FUNA 2P9KG 3CK7A 1E96B 4J0UA 2V5QC 4H7YA 5BV0A 2C0LA 3QJZA 3MJWA 3QWWA 4OAUC 4XX5A 4LRZA 4LERA 2B6CA 4GYWA 3K9IA 4HOTA 3NOGD 2DZOA 5FQ7A 3GZ2A 3HXFA 5EYLA 5EYPF 3Q78A 4K5AB 2DZNA 4UWGA 2X6JA 3ABKE 2GRRB 5EILA 1ZB1A 3SGHA 3FTXA 3FHEA 3FUMA 4Z68A 5A6CA 5ARGA 5AYWD 2YQ8A 4HORA 2L0IA 3IBEA 5D0QD 3EHMA 2IJGX 4APOA 1RW2A 1O5MA 4JEHA 3UKUG 3JQ1A 3ASNE 3CVPA 2RFMA 5CRVA 4CDMA 1SA5A 3CVUA 2C2LA 5DBKA 1N54A 3DSUA 4B93B 2ONDA 3ZXSA 2WVIA 4BWRA 4I9CA 3LY9A 4LEUA 1OXJA 1OWPA 4U8HA 3TWRA 4IYPA 3TWVA 2GRQB 3UM0A 3C3QA 2F0YA 1ELWA 3FEYA 4U0ZA 2P9SG 1N94A 4P29A 5C1DA 3V79K 2BF0X 3MV3B 2QYUA 4GU5A 3Q49B 3EU5A 3LS8A 4CT0A 2XGMA 1IQUA 3EHQA 1N0RA 2RD0A 4I2WA 3RRMB 3IHVA 3AG3E 4ANXA 4BFRA 1OWOA 2WM9A 4F3VA 5FINA 2Y3AA 3LY8A 3R7QA 2IO3C 4CEMA 3GZSA 3R9AB 3FFLA 3HHMA 3D9PA 1TNYA 2UY1B 3PZ1A 1IKND 4HI9A 3CKCA 2ZGGA 4TV3A 3UM3A 3I3NA 1HO8A 2A5UA 5B1BE 4KZ0A 3O4ZA 4LUNU 5BNWA 4U63A 3UTMA 1WG0A 4TUUA 3TWWA 2XEHA 1SQMA 3BU8A 3PH0C 5FWQA 3E32A 2P9UG 3ASOE 3RK6A 3FUKA 4M3OA 4RLYA 2XRYA 3E34A 3APDA 3EU9A 4FC8A 1ZBPA 3JQ0A 3FH7A 3DSVA 5ITZF 3D9JA 4DLOA 3CR3A 3HXDA 4GTPA 3RU0A 3FU0A 4KXKB 1QYMA 2WXNA 2KZTA 5ENSD 3HDXA 4GYOA 3FTZA 4G2VA 3HYMB 3FTYA 3KS2A 3V2XA 3CLJA 5BV1A 4CDNA 5ENQD 1SA4A 3IHYA 3AU5A 3ABME 2GRMA 2V4HC 4BY6A 2LXLA 3AAAC 3Q4AB 3AG4E 3L82A 4BX8A 4LSZE 3GZ1A 3C72A 4JHJA 4UI9C 3CQGB 3IKOB 4PS7A 5AQ9A 4AJWA 3ZYKA 2RKKA 4DX1A 1MYOA 4G24A 3DBSA 4GTRA 5J90A 4B89A 3KEZA 2XCCA 3LXUX 2XGSA 4GTVA 3HVEB 1OY3D 1SZAA 4FADA 4G11A 1MZCA 4CYMD 1JPLA 2L9BA 3ZIMA 4DI3A 3CVWA 1VDYA 4LNBA 4QQIA 2R2LA 3E4BA 2PQNA 4KYOB 3LPZA 1KZOA 3PZ3A 5AQBA 1N95A 3T8KA 1TJCA 3ULEG 3FTSA 2WXGA 3B13A 4O1PA 4FJZA 1QBQA 4I2ZA 4FP7A 5CERB 4ABNA 4R7LA 2EINE 1H0AA 3MZLB 4GB9A 4F6RD 2L6JA 1HF8A 1Y6IA 3DSTA 5LCWJ 4DX2A 4C0MA 2KXPC 1MX4A 2WXQA 4B94A 1PAQA 3MKQA 3TJPA 4YVQC 5ENPD 4N2SA 4KMOA 2L6BA 2PM6A 5AIJA 3G2TA 1W3BA 1UJKA 1WAO1 3I4RB 5EN5D 5EKQD 4EBAA 1OWMA 3Q9NC 4XE0A 2V8SE 3TL5A 2AW6A 5JHBA 4GA1A 4NRHB 4M7CA 4I6GA 3URZA 1MX2A 1FCHA 2IF4A 2WXRA 4JPSA 4AY5A 3B7BA 3UUXA 1H6KA 4V3IA 3T9KA 3UIOC 1TNOA 2VQ2A 1UOHA 2WQ6A 3AU4A 3TWSA 3CVVA 1E90A 2MRIA 3FUHA 3N71A 5E76A 4MKTA 4JVSA 3Q9UC 3T5XA 4AV7A 2BKKB 3SD5A 3D9OA 5T4YA 1TN6A 3UXGA 1SVXA 3VLFA 5AJLA 3CEQA 4K5BA 3FU5A 2ILRA 3ML9A 3LCAA 3B7TA 4TXPA 3TWTA 4HLLA 3ENEA 2LSUA 2A4ZA 3SFZA 2HE0A 4BSXA 4U8YD 3DPYA 4AIFA 4I9EA 3PZ4A 2VSYA 2CG3A 4BESA 2NYJA 2VGEA 1Y8MA 4EZLA 5ENRD 3CHOA 1H6OA 4JA9A 4K03A 3PZ2A 2GGFA 1KZPA 2ZIRA 4N5CA 5FIOA 3T8MA 1IHGA 1XGWA 3ZFWA 1N4QA 4HI8A 1TNUA 4W9RA 2QZAA 5EDSA 1KT1A 1ZU2A 3MKRA 2FF4A 5CBOA 2CFUA 4N2QA 1TN7A 1HX8A 2YHEA 2V4LA 2V0PA 4FHJA 4FLHA 2LNIA 2AXUA 3TAXA 1MQSA 2HO1A 4ILHB 5CMYA 5AAOA 2KCVA 2H6FA 4HLEA 4NACA 4NURA 1WDYA 4HBDA 3QK0A 3MKQB 3Q15A 5CECB 5CRUA 5AQ7A 3L17A 5T8IA 3ULYA 2ETCA 1U3DA 3ESKA 4D10C 1OWNA 2OCCE 1H2UA 3UX4A 4N3CA 1X5BA 3ONKA 3FUIA 3RAUA 2WXJA 4L9PA 1P5QA 3L16A 3D9NA 4IRUA 2P2CP 2XPYA 4N3BA 1FVFA 2WXHA 5CMWA 3ASDA 4AVXA 3ONLA 5A23A 1HS6A 4A63B 3KSQA 3VLEA 1TNBA 2JABA 4RQIA 1K1BA 1N0QA 4KVMA 4GMLA 4UUCA 4G23A 3ZNGA 4ATZD 1AP7A 2R03A 1U2VG 1N4RA 5G04C 4FLBA 3UT8A 4DX6D 2DWZA 1DC2A 3PE3A 5KBAA 4J8EA 2J4DA 4JHRA 4CGWA 2P58C 1U3CA 3JUEA 2IONA 4J8FA 5ENOD 4MLPA 3R7RA 3SHFA 3DPDA 4HRLA 2PZIA 1BI7B 4XIFA 2XPIA 2VTBB 1ELKA 1TEZA 3ZHEA 2WQHA 1UW4B 1TYQG 2WB2A 2J4BA 2BEDA 4UQXA 3DEPA 2OOEA 1N9AA 5DIZA 4EECA 3SI5A 3CGHA 4JC8A 3FH8A 4OAVB 4E6HA 1HFAA 1LTXA 4Y6CA 1E8WA 5BW8C 3ULQA 2DCPA 4JL0A 4HOSA 4FULA 4KZCA 4GTTA 3Q79A 3HG0D 4ME2A 3G2SA 2HR2A 2X6HA 2Q7FA 4JD2G 1OCZE 1N4SA 2XEVA 5BT1A 3TXNA 3J5PA 4L2YA 1FT1A 4LNUD 1AWCB 1BD8A 5LFAA 1N52A 3D9KA 4JA7A 2Y1LE 5G2NA 3ZU7B 3QWPA 4GPMA 4X8QA 4UI9J 2XEEA 4BERA 3SBSA 3ML8A 1QQEA 2DBAA 3J5QB 3ZN3A 3IV0A 1EDUA 4A3TA 1NZNA 3W9GA 2IO2C 3UQ3A 3RSEG 4WAFA 2I2OA 2WPVA 3BUAA 5LX8A 2Y4TA 3BG0B 3PNTB 4AEZC 5JA4D 1KPSB 3TGOA 2XS8A 1L5JA 3TWUA 1SW6A 3ZPJA 2Y0BG 3RJVA 5LCWC 2CHWA 5G05J 3DXKG 2YHCA 1INZA 2GRLA 3SZ7A 1TNZA 1OT8A 2J08A 3I4GA 3FUDA 4L1BA 4HVBA 3QOUA 5AARA 4U07A 4MS6A 3JXJA 1S70B 5HRYA 2KATA 4TXRA 3ISMC 3SQVA 1JCRA 2GRNB 1IYGA 3AS5A
chains in the Genus database with same CATH topology
4BESA 2NYJA 2VGEA 3D9HA 1DCQA 3V2OA 5ENRD 1OY3D 3HG0D 4HRNA 3AJIA 2AJAA 4RLYA 4A63B 3JXIA 2JABA 1K1BA 4J8YA 4F1PA 1N0QA 2QC9A 1MX6A 1NFIE 5CEAA 5EIBE 1K3ZD 4CYMD 5EN5D 2XZTG 5FIOA 4UUCA 3HRAA 3Q9NC 3ZNGA 4ATZD 1AP7A 5EIDA 4HQDA 3EU9A 4G8KA 4HRMB 4DX5D 4U8VD 5HKPA 5KNHD 4QQIA 3J5PA 2RFMA 4HI8A 4LG6A 2MYOA 3ZKJA 4CZ2D 4LNUD 4BETA 3B95A 3SO8A 1YYHA 3C5RA 5BXUA 5CEDB 1BD8A 1AWCB 3NBNB 5ITZF 5KWDA 3DEOA 2KBXA 5CBNA 4DX6D 4U95D 5AN8A 2Y1LE 2DWZA 5AQAA 5CBOA 1MX2A 1TR4A 4B93B 5AQBA 3ZU7B 3EHRA 4QFVA 3KEAA 3T8KA 4GPMA 3ZUVB 2RFAA 5ENTD 1DC2A 1A5EA 1BLXB 3B7BA 2BKGA 5KBAA 1QYMA 5HS0A 1IHBA 2XEEA 4YDWA 4O1PA 4GMRA 4O60A 3T9KA 4BERA 2J8SD 3TWRA 5ENSD 1BI8B 4NIKA 3TWVA 1K1AA 4JB8P 2F8YA 1UOHA 3J5QB 3JUEA 5ENOD 3TWSA 3V2XA 3W9GA 3V79K 5CERB 3V30A 5AAOA 1BU9A 4C48B 1WDYA 4HBDA 2QYJA 4HRLA 1MJ0A 4DX7D 1BI7B 3EHQA 1N0RA 5ENQD 3Q9UC 4F6RD 2XZDG 5CECB 3TWXA 2BKKB 2V5QC 3IXEA 2FO1E 2XENA 5JMND 2F37A 3UXGA 4DUIA 2ETBA 1SVXA 2V4HC 2ZGDA 4U96D 5AQ7A 4DX2A 5JA4D 4ZHBA 4OAUC 4J7WA 4K5BA 5FINA 4G8LA 5BXOA 4N5QA 3TWQA 2ETCA 4ZFHA 3NOGD 2DZOA 1D9SA 3AAAC 2ETAA 2KXPC 3V31A 1YCSB 3TWUA 1SW6A 1MX4A 2Y0BG 3TWTA 4TUMA 4LSZE 4YDYA 3F6QA 3DEPA 1YMPA 2DVWA 4HLLA 5EYLA 2F8XK 5EYPF 4K5AB 4BSZB 3W9FA 2DZNA 5AQ9A 1OT8A 4DX1A 4BEPA 1IKND 4HI9A 4HNAD 2ZGGA 2A5EA 1MYOA 2HE0A 5D66A 4OAVB 4DRXE 3LJNA 5AARA 4O1OA 5EILA 1N11A 4K5CA 4U8YD 2P2CP 5ENPD 3NOCD 4Z68A 2PNNA 5KNGA 4HB5A 3JXJA 3UTMA 1S70B 1WG0A 5HRYA 3TWWA 2L6BA 2XEHA 3UI2A 2B0OE 1IXVA 1G3NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BES A;  2NYJ A;  2VGE A;  3D9H A;  1DCQ A;  3V2O A;  5ENR D;  1OY3 D;  3HG0 D;  4HRN A;  3AJI A;  2AJA A;  4RLY A;  4A63 B;  3JXI A;  2JAB A;  1K1B A;  4J8Y A;  4F1P A;  1N0Q A;  2QC9 A;  1MX6 A;  1NFI E;  5CEA A;  5EIB E;  1K3Z D;  4CYM D;  5EN5 D;  2XZT G;  5FIO A;  4UUC A;  3HRA A;  3Q9N C;  3ZNG A;  4ATZ D;  1AP7 A;  5EID A;  4HQD A;  3EU9 A;  4G8K A;  4HRM B;  4DX5 D;  4U8V D;  5HKP A;  5KNH D;  4QQI A;  3J5P A;  2RFM A;  4HI8 A;  4LG6 A;  2MYO A;  3ZKJ A;  4CZ2 D;  4LNU D;  4BET A;  3B95 A;  3SO8 A;  1YYH A;  3C5R A;  5BXU A;  5CED B;  1BD8 A;  1AWC B;  3NBN B;  5ITZ F;  5KWD A;  3DEO A;  2KBX A;  5CBN A;  4DX6 D;  4U95 D;  5AN8 A;  2Y1L E;  2DWZ A;  5AQA A;  5CBO A;  1MX2 A;  1TR4 A;  4B93 B;  5AQB A;  3ZU7 B;  3EHR A;  4QFV A;  3KEA A;  3T8K A;  4GPM A;  3ZUV B;  2RFA A;  5ENT D;  1DC2 A;  1A5E A;  1BLX B;  3B7B A;  2BKG A;  5KBA A;  1QYM A;  5HS0 A;  1IHB A;  2XEE A;  4YDW A;  4O1P A;  4GMR A;  4O60 A;  3T9K A;  4BER A;  2J8S D;  3TWR A;  5ENS D;  1BI8 B;  4NIK A;  3TWV A;  1K1A A;  4JB8 P;  2F8Y A;  1UOH A;  3J5Q B;  3JUE A;  5ENO D;  3TWS A;  3V2X A;  3W9G A;  3V79 K;  5CER B;  3V30 A;  5AAO A;  1BU9 A;  4C48 B;  1WDY A;  4HBD A;  2QYJ A;  4HRL A;  1MJ0 A;  4DX7 D;  1BI7 B;  3EHQ A;  1N0R A;  5ENQ D;  3Q9U C;  4F6R D;  2XZD G;  5CEC B;  3TWX A;  2BKK B;  2V5Q C;  3IXE A;  2FO1 E;  2XEN A;  5JMN D;  2F37 A;  3UXG A;  4DUI A;  2ETB A;  1SVX A;  2V4H C;  2ZGD A;  4U96 D;  5AQ7 A;  4DX2 A;  5JA4 D;  4ZHB A;  4OAU C;  4J7W A;  4K5B A;  5FIN A;  4G8L A;  5BXO A;  4N5Q A;  3TWQ A;  2ETC A;  4ZFH A;  3NOG D;  2DZO A;  1D9S A;  3AAA C;  2ETA A;  2KXP C;  3V31 A;  1YCS B;  3TWU A;  1SW6 A;  1MX4 A;  2Y0B G;  3TWT A;  4TUM A;  4LSZ E;  4YDY A;  3F6Q A;  3DEP A;  1YMP A;  2DVW A;  4HLL A;  5EYL A;  2F8X K;  5EYP F;  4K5A B;  4BSZ B;  3W9F A;  2DZN A;  5AQ9 A;  1OT8 A;  4DX1 A;  4BEP A;  1IKN D;  4HI9 A;  4HNA D;  2ZGG A;  2A5E A;  1MYO A;  2HE0 A;  5D66 A;  4OAV B;  4DRX E;  3LJN A;  5AAR A;  4O1O A;  5EIL A;  1N11 A;  4K5C A;  4U8Y D;  2P2C P;  5ENP D;  3NOC D;  4Z68 A;  2PNN A;  5KNG A;  4HB5 A;  3JXJ A;  3UTM A;  1S70 B;  1WG0 A;  5HRY A;  3TWW A;  2L6B A;  2XEH A;  3UI2 A;  2B0O E;  1IXV A;  1G3N B; 
#chains in the Genus database with same CATH topology
 4HRN A;  4GCO A;  3FUF A;  3L13 A;  3FU6 A;  2CFZ A;  3TXM A;  3G2U A;  4YDO A;  3LVQ E;  3EDT B;  2EIK E;  4PS3 A;  2P9L G;  3FTV A;  4HQD A;  4Q94 A;  3B95 A;  1Z3Y A;  1UJJ A;  4C9B B;  4I1M A;  5AN8 A;  2L0T B;  4A1G A;  3EHR A;  3QNK A;  3JUI A;  1O1R A;  2WXF A;  4GA2 A;  3ZHE B;  4DK5 A;  3ZYQ A;  3CK9 A;  4JB8 P;  5FZR A;  3E30 A;  5M72 A;  3E37 A;  3L22 A;  2ZXW E;  3L6A A;  4EZK A;  3TWX A;  2FO1 E;  5J08 A;  5LP0 A;  3MYV A;  4GA0 A;  1KT0 A;  2WQ7 A;  3FP3 A;  3VLD A;  3IEG A;  2EQX A;  3F6Q A;  3Q73 A;  2V5F A;  3WG7 E;  3U4T A;  4BSZ B;  4JZY A;  3UIP C;  3RRN B;  3U64 A;  3DSS A;  2I6H A;  3HXC A;  3PE4 A;  5E75 A;  4BTA A;  4DRX E;  3LJN A;  5KJM A;  2Y4U A;  1BPO A;  4B0Z A;  1TJF A;  2C0M A;  5ARF A;  4EZJ A;  2X3M A;  4L2L A;  4JHK A;  4CT4 A;  2VGX B;  2WMO A;  1DCE A;  4Y6W A;  1DCQ A;  2LSV A;  3FUL A;  1S63 A;  3PEU B;  2IOS A;  3JXI A;  4J6I A;  3QDN A;  2AXZ A;  3OXG A;  1B89 A;  3PEV B;  1EYH A;  3HRA A;  5FZQ A;  4RVB A;  2XGO A;  4DJA A;  3OXF A;  3CHR A;  1MHQ A;  3NZS A;  2DYR E;  4URK A;  2VGX A;  1QZ2 A;  3QAR A;  4DI4 A;  1NL4 A;  2MOW A;  2JLB A;  3NB2 A;  3PRE A;  2DIW A;  3ABL E;  2R5S A;  1YA0 A;  1IHB A;  1O1T A;  2IEJ A;  1BI8 B;  2KC7 A;  3PUK A;  4MRU A;  2NC9 A;  4XKC A;  1QNF A;  5KJN A;  4EQF A;  2KM4 A;  2J9Q A;  4TXQ A;  4C48 B;  1XNF A;  3ZYL A;  4UWH A;  1GW6 A;  3LJ3 A;  4APF A;  4G25 A;  4ILI A;  3OTN A;  2R05 A;  3EUV A;  1D9S A;  5JJT A;  5FQ6 A;  5EX0 A;  4TUM A;  4YDY A;  5D2M C;  3U66 A;  5B3S E;  3P1U A;  3QB2 A;  2FO7 A;  2NXP A;  5ANL A;  1N4P A;  3VTY A;  4B8C B;  3RKV A;  3O48 A;  3DRA A;  3FEX A;  1OCC E;  3AG1 E;  3R9M A;  1E7V A;  2B0O E;  3CHM A;  1HG2 A;  5A7D B;  3UT4 A;  4JXT A;  3SBT B;  4I6E A;  2QC9 A;  3PDN A;  2XZT G;  2IY0 C;  3KAE A;  5D0O D;  4I6J A;  1TN8 A;  1JCQ A;  4LG6 A;  4CZ2 D;  2X6I A;  4AP2 A;  4O6F A;  4WWN A;  1WY6 A;  4FA6 A;  2WXL A;  3ZYM A;  1O1S A;  4YDW A;  4O60 A;  4Q96 A;  3PVL A;  4WNF A;  2F8Y A;  3KD7 A;  3RRU A;  4CRW A;  1HU3 A;  3UT7 A;  5AEN A;  1MJ0 A;  3CSF A;  3ASH A;  2GW1 A;  2BTD A;  2J07 A;  4CGV A;  2KZT B;  4GZ6 A;  4KBQ A;  2FI7 A;  5CCM A;  3WXX A;  2XCB A;  3U9W A;  4EBA G;  3TWQ A;  1V54 E;  5G55 A;  4XI0 A;  5JJ7 A;  2FEZ A;  5FQ8 A;  3CHS A;  1WM5 A;  4BT8 A;  4BTB A;  3ZRH A;  5CHE E;  1Z5S C;  4WWP A;  3Q7F A;  5FTP A;  3UM1 A;  1N11 A;  1E8Y A;  4ATG A;  4CDR A;  1Z6T A;  1A17 A;  1UN8 A;  5KNG A;  3CV0 A;  3UI2 A;  3Q47 B;  4L23 A;  1G3N B;  2WXK A;  3C98 A;  4XZ4 A;  3NAW A;  3SF4 A;  4PUC A;  5CEA A;  2XPZ A;  3JCK C;  1LF8 A;  4J8D A;  3MX3 A;  4GTM A;  2HYZ A;  5EID A;  3MA5 A;  5HKP A;  4UWF A;  2NSZ A;  3SO8 A;  4I17 A;  3NBN B;  2EIL E;  2OV8 A;  2HM8 A;  2X6F A;  4HS2 A;  2E2E A;  3BG1 B;  2J8S D;  3DXM G;  2VSX E;  1K1A A;  2X38 A;  3FUE A;  4GMJ A;  4KT6 B;  2VJ8 A;  2H6I A;  4TRQ A;  1BU9 A;  2I1K A;  2QYJ A;  4GZD A;  1NA0 A;  2LXM A;  2UY1 A;  1PC2 A;  2XZD G;  3Q75 A;  2XS1 A;  4UI9 K;  2ZIS A;  4LNG A;  3EIQ C;  3B7S A;  4U04 A;  3EJN A;  3TG4 A;  4ANV A;  4FU3 A;  2OVB A;  1UG3 A;  3CK8 A;  1Q2Z A;  3UIN C;  1YMP A;  1D8D A;  3FDH A;  1H6P A;  4WWO A;  4PDX A;  3W9F A;  5KJK A;  3NF1 A;  4ILG A;  5KJL A;  3PUJ A;  1JWG A;  3LDZ A;  4G1T A;  1NA3 A;  2PNN A;  1NI1 A;  1OUV A;  5G05 C;  4UWK A;  3GW4 A;  3TG5 A;  3V2O A;  5IY5 E;  1EF1 C;  2P9I G;  5BPP A;  3E33 A;  5C2Y A;  4BT9 A;  3L54 A;  5G04 J;  1PY1 A;  2RG8 A;  3ZW3 A;  1K8K G;  3ZXP A;  4F1P A;  3ZGQ A;  3RIB A;  4N39 A;  1SZ9 A;  5KNH D;  4F1S A;  5JJ6 A;  2P9N G;  4GZC A;  3CHP A;  4MBG A;  1YYH A;  5CED B;  2QFC A;  4U95 D;  3G2W A;  4RG6 A;  2UWJ G;  4QFV A;  1HG5 A;  1HE8 A;  3L9T A;  3FTW A;  2XHE A;  1DVP A;  4JW1 A;  4UWL A;  3C3O A;  5CCL A;  4U0S A;  4HFG A;  3BEE A;  5ENN A;  2VSN A;  3V30 A;  5HQ8 A;  4GTS A;  2QY7 A;  3APC A;  3Q7A A;  3VTX A;  2ZU6 B;  2IOL A;  2XEN A;  5JMN D;  3QWV A;  3UKR G;  2OVF A;  2ETB A;  3QC1 A;  4ZHB A;  2CHZ A;  3PRZ A;  4ZFH A;  3SFY A;  2H6G A;  3HVE A;  3RO3 A;  1H2T C;  1D8E A;  5LOZ A;  4F53 A;  2VGY A;  4BEP A;  3ASG A;  4A55 A;  5FJY A;  1LD7 A;  1ELR A;  5D66 A;  3DSW A;  2R17 C;  3CVL A;  1EPU A;  4I1A A;  4WNE A;  4J8S A;  3S7B A;  4GPK A;  4FJY A;  4WNG A;  4H7X A;  1Z3X A;  4E85 A;  3GYZ A;  2VYI A;  2J09 A;  1JCS A;  3FUJ A;  1HXI A;  3P2B A;  4DX5 D;  3UM2 A;  4U8V D;  1RZ4 A;  3LVR E;  3KSL A;  3S7F A;  1OCO E;  5KWD A;  5BUZ A;  3DEO A;  3I5P A;  3LY7 A;  3D9L A;  4BX9 A;  2GRP B;  5ENT D;  3DSX A;  3S7D A;  4IUL A;  1LD8 A;  1FVH A;  5ANR A;  1HZ4 A;  4GMR A;  4HOU A;  2WXP A;  2H6H A;  2JEK A;  3EHN A;  5FT9 A;  3CVX A;  2DYS E;  3CVN A;  2WMN A;  4LCT A;  2OEV A;  1JUQ A;  1JWF A;  2R02 A;  1FPP A;  3IXE A;  1HH8 A;  4UQZ A;  4ACL A;  4DUI A;  4EHM A;  2ZGD A;  2YNQ A;  5BXO A;  4N5Q A;  1YCS B;  2CHX A;  4U0U A;  4DPR A;  3CIA A;  3PNL B;  3L08 A;  3EIJ A;  3S2A A;  3T5V A;  2CG2 A;  4F7A A;  1X81 A;  3B7U X;  3UMV A;  3CQC B;  2AVP A;  3MGB A;  4RSY A;  4K5C A;  3NOC D;  4Q69 A;  4GZ5 A;  1DNP A;  1IXV A;  4U96 D;  3BQO A;  2IFU A;  5T3R A;  4WND A;  4I43 A;  3HIZ A;  4XEI G;  4ACK A;  3JYS A;  3CHQ A;  4G26 A;  2MHK A;  3OAW A;  2FBN A;  4B8A A;  4JEU A;  4PS8 A;  3ZKJ A;  4L7T A;  4AXH A;  1TR4 A;  4GCN A;  3Q5M A;  4GZ3 A;  2BUG A;  4OVV A;  3SNX A;  1A5E A;  2LUH A;  2KCK A;  4C0E A;  1H2V C;  1H19 A;  2J49 A;  3U3W A;  5EX3 A;  4XI9 A;  2LO6 A;  2OEW A;  3DWL G;  1FT2 A;  4DX7 D;  3HXB A;  1KLX A;  3ESL A;  2WXI A;  2PQR A;  3APF A;  2AWI A;  2AXV A;  4GAA A;  3NZU A;  4J7W A;  4G8L A;  5HI7 A;  3LKU A;  4OYS A;  1V55 E;  1E8X A;  2IU1 A;  2F8X K;  1NP7 A;  4IN3 B;  2P9P G;  4HNA D;  3MV2 B;  2E0I A;  3PZD A;  2VTB A;  4UQY A;  4O1O A;  3FTU A;  1S64 A;  4K0R A;  1OCR E;  3D9H A;  1UN9 A;  3RO2 A;  4HOQ A;  4A1S A;  4AM9 A;  2EIM E;  3ZVV A;  3AJI A;  3C3R A;  4GYY A;  4HXI A;  1S0P A;  2GRO B;  3FH5 A;  3S7J A;  5EIB E;  1NFI E;  1K3Z D;  2LAI A;  2EIJ E;  3MCX A;  5FQ4 A;  3D3M A;  4HRM B;  3AS8 A;  4BET A;  3C5R A;  2KBX A;  3QKY A;  3AG2 E;  4YND A;  4RG9 A;  2X6K A;  4PH4 B;  5B1A E;  2R59 A;  4DLQ A;  2LAH A;  4XKB A;  3CVY A;  2BKG A;  4GTO A;  2XQ0 A;  3PS6 A;  4NIK A;  2I1J A;  3AS4 A;  3FU3 A;  3ASF A;  4KVO A;  4FHK A;  3D9M A;  3LEW A;  3HXE A;  2VSO E;  3LYA A;  3QAQ A;  3X2Q E;  2YIN A;  2F37 A;  2FUL A;  2PL2 A;  2WXO A;  5JHA A;  4ANW A;  2ETA A;  3V31 A;  2DVW A;  4N3A A;  4AOF A;  2PM7 A;  3SFX A;  1IQR A;  2A5E A;  4GTQ A;  2M63 A;  1E7U A;  4HB5 A;  5KCM A;  1E8Z A;  5H7P A;  3CVQ A;  3OXL A;  4EPZ A;  4U7E B;  3UPV A;  4NQ0 A;  5AJD A;  2AJA A;  3CKB A;  3B7R L;  4J8Y A;  3D9I A;  1MX6 A;  2XRZ A;  4YVO A;  5FZS A;  3FY4 A;  4ANU A;  4G8K A;  3MEK A;  4AY6 A;  2KCL A;  4CCA A;  2MYO A;  5BXU A;  2IQC A;  4OVU A;  2Y69 E;  5CBN A;  2I9C A;  5AQA A;  3SY2 A;  3CST A;  4WUY A;  3KEA A;  3ZUV B;  3G2V A;  2WXM A;  2RFA A;  3ZEF A;  1BLX B;  4YDE A;  5HS0 A;  3FWV A;  4I1O B;  3NQP A;  1OWL A;  4A3V A;  3FUN A;  2P9K G;  3CK7 A;  1E96 B;  4J0U A;  2V5Q C;  4H7Y A;  5BV0 A;  2C0L A;  3QJZ A;  3MJW A;  3QWW A;  4OAU C;  4XX5 A;  4LRZ A;  4LER A;  2B6C A;  4GYW A;  3K9I A;  4HOT A;  3NOG D;  2DZO A;  5FQ7 A;  3GZ2 A;  3HXF A;  5EYL A;  5EYP F;  3Q78 A;  4K5A B;  2DZN A;  4UWG A;  2X6J A;  3ABK E;  2GRR B;  5EIL A;  1ZB1 A;  3SGH A;  3FTX A;  3FHE A;  3FUM A;  4Z68 A;  5A6C A;  5ARG A;  5AYW D;  2YQ8 A;  4HOR A;  2L0I A;  3IBE A;  5D0Q D;  3EHM A;  2IJG X;  4APO A;  1RW2 A;  1O5M A;  4JEH A;  3UKU G;  3JQ1 A;  3ASN E;  3CVP A;  2RFM A;  5CRV A;  4CDM A;  1SA5 A;  3CVU A;  2C2L A;  5DBK A;  1N54 A;  3DSU A;  4B93 B;  2OND A;  3ZXS A;  2WVI A;  4BWR A;  4I9C A;  3LY9 A;  4LEU A;  1OXJ A;  1OWP A;  4U8H A;  3TWR A;  4IYP A;  3TWV A;  2GRQ B;  3UM0 A;  3C3Q A;  2F0Y A;  1ELW A;  3FEY A;  4U0Z A;  2P9S G;  1N94 A;  4P29 A;  5C1D A;  3V79 K;  2BF0 X;  3MV3 B;  2QYU A;  4GU5 A;  3Q49 B;  3EU5 A;  3LS8 A;  4CT0 A;  2XGM A;  1IQU A;  3EHQ A;  1N0R A;  2RD0 A;  4I2W A;  3RRM B;  3IHV A;  3AG3 E;  4ANX A;  4BFR A;  1OWO A;  2WM9 A;  4F3V A;  5FIN A;  2Y3A A;  3LY8 A;  3R7Q A;  2IO3 C;  4CEM A;  3GZS A;  3R9A B;  3FFL A;  3HHM A;  3D9P A;  1TNY A;  2UY1 B;  3PZ1 A;  1IKN D;  4HI9 A;  3CKC A;  2ZGG A;  4TV3 A;  3UM3 A;  3I3N A;  1HO8 A;  2A5U A;  5B1B E;  4KZ0 A;  3O4Z A;  4LUN U;  5BNW A;  4U63 A;  3UTM A;  1WG0 A;  4TUU A;  3TWW A;  2XEH A;  1SQM A;  3BU8 A;  3PH0 C;  5FWQ A;  3E32 A;  2P9U G;  3ASO E;  3RK6 A;  3FUK A;  4M3O A;  4RLY A;  2XRY A;  3E34 A;  3APD A;  3EU9 A;  4FC8 A;  1ZBP A;  3JQ0 A;  3FH7 A;  3DSV A;  5ITZ F;  3D9J A;  4DLO A;  3CR3 A;  3HXD A;  4GTP A;  3RU0 A;  3FU0 A;  4KXK B;  1QYM A;  2WXN A;  2KZT A;  5ENS D;  3HDX A;  4GYO A;  3FTZ A;  4G2V A;  3HYM B;  3FTY A;  3KS2 A;  3V2X A;  3CLJ A;  5BV1 A;  4CDN A;  5ENQ D;  1SA4 A;  3IHY A;  3AU5 A;  3ABM E;  2GRM A;  2V4H C;  4BY6 A;  2LXL A;  3AAA C;  3Q4A B;  3AG4 E;  3L82 A;  4BX8 A;  4LSZ E;  3GZ1 A;  3C72 A;  4JHJ A;  4UI9 C;  3CQG B;  3IKO B;  4PS7 A;  5AQ9 A;  4AJW A;  3ZYK A;  2RKK A;  4DX1 A;  1MYO A;  4G24 A;  3DBS A;  4GTR A;  5J90 A;  4B89 A;  3KEZ A;  2XCC A;  3LXU X;  2XGS A;  4GTV A;  3HVE B;  1OY3 D;  1SZA A;  4FAD A;  4G11 A;  1MZC A;  4CYM D;  1JPL A;  2L9B A;  3ZIM A;  4DI3 A;  3CVW A;  1VDY A;  4LNB A;  4QQI A;  2R2L A;  3E4B A;  2PQN A;  4KYO B;  3LPZ A;  1KZO A;  3PZ3 A;  5AQB A;  1N95 A;  3T8K A;  1TJC A;  3ULE G;  3FTS A;  2WXG A;  3B13 A;  4O1P A;  4FJZ A;  1QBQ A;  4I2Z A;  4FP7 A;  5CER B;  4ABN A;  4R7L A;  2EIN E;  1H0A A;  3MZL B;  4GB9 A;  4F6R D;  2L6J A;  1HF8 A;  1Y6I A;  3DST A;  5LCW J;  4DX2 A;  4C0M A;  2KXP C;  1MX4 A;  2WXQ A;  4B94 A;  1PAQ A;  3MKQ A;  3TJP A;  4YVQ C;  5ENP D;  4N2S A;  4KMO A;  2L6B A;  2PM6 A;  5AIJ A;  3G2T A;  1W3B A;  1UJK A;  1WAO 1;  3I4R B;  5EN5 D;  5EKQ D;  4EBA A;  1OWM A;  3Q9N C;  4XE0 A;  2V8S E;  3TL5 A;  2AW6 A;  5JHB A;  4GA1 A;  4NRH B;  4M7C A;  4I6G A;  3URZ A;  1MX2 A;  1FCH A;  2IF4 A;  2WXR A;  4JPS A;  4AY5 A;  3B7B A;  3UUX A;  1H6K A;  4V3I A;  3T9K A;  3UIO C;  1TNO A;  2VQ2 A;  1UOH A;  2WQ6 A;  3AU4 A;  3TWS A;  3CVV A;  1E90 A;  2MRI A;  3FUH A;  3N71 A;  5E76 A;  4MKT A;  4JVS A;  3Q9U C;  3T5X A;  4AV7 A;  2BKK B;  3SD5 A;  3D9O A;  5T4Y A;  1TN6 A;  3UXG A;  1SVX A;  3VLF A;  5AJL A;  3CEQ A;  4K5B A;  3FU5 A;  2ILR A;  3ML9 A;  3LCA A;  3B7T A;  4TXP A;  3TWT A;  4HLL A;  3ENE A;  2LSU A;  2A4Z A;  3SFZ A;  2HE0 A;  4BSX A;  4U8Y D;  3DPY A;  4AIF A;  4I9E A;  3PZ4 A;  2VSY A;  2CG3 A;  4BES A;  2NYJ A;  2VGE A;  1Y8M A;  4EZL A;  5ENR D;  3CHO A;  1H6O A;  4JA9 A;  4K03 A;  3PZ2 A;  2GGF A;  1KZP A;  2ZIR A;  4N5C A;  5FIO A;  3T8M A;  1IHG A;  1XGW A;  3ZFW A;  1N4Q A;  4HI8 A;  1TNU A;  4W9R A;  2QZA A;  5EDS A;  1KT1 A;  1ZU2 A;  3MKR A;  2FF4 A;  5CBO A;  2CFU A;  4N2Q A;  1TN7 A;  1HX8 A;  2YHE A;  2V4L A;  2V0P A;  4FHJ A;  4FLH A;  2LNI A;  2AXU A;  3TAX A;  1MQS A;  2HO1 A;  4ILH B;  5CMY A;  5AAO A;  2KCV A;  2H6F A;  4HLE A;  4NAC A;  4NUR A;  1WDY A;  4HBD A;  3QK0 A;  3MKQ B;  3Q15 A;  5CEC B;  5CRU A;  5AQ7 A;  3L17 A;  5T8I A;  3ULY A;  2ETC A;  1U3D A;  3ESK A;  4D10 C;  1OWN A;  2OCC E;  1H2U A;  3UX4 A;  4N3C A;  1X5B A;  3ONK A;  3FUI A;  3RAU A;  2WXJ A;  4L9P A;  1P5Q A;  3L16 A;  3D9N A;  4IRU A;  2P2C P;  2XPY A;  4N3B A;  1FVF A;  2WXH A;  5CMW A;  3ASD A;  4AVX A;  3ONL A;  5A23 A;  1HS6 A;  4A63 B;  3KSQ A;  3VLE A;  1TNB A;  2JAB A;  4RQI A;  1K1B A;  1N0Q A;  4KVM A;  4GML A;  4UUC A;  4G23 A;  3ZNG A;  4ATZ D;  1AP7 A;  2R03 A;  1U2V G;  1N4R A;  5G04 C;  4FLB A;  3UT8 A;  4DX6 D;  2DWZ A;  1DC2 A;  3PE3 A;  5KBA A;  4J8E A;  2J4D A;  4JHR A;  4CGW A;  2P58 C;  1U3C A;  3JUE A;  2ION A;  4J8F A;  5ENO D;  4MLP A;  3R7R A;  3SHF A;  3DPD A;  4HRL A;  2PZI A;  1BI7 B;  4XIF A;  2XPI A;  2VTB B;  1ELK A;  1TEZ A;  3ZHE A;  2WQH A;  1UW4 B;  1TYQ G;  2WB2 A;  2J4B A;  2BED A;  4UQX A;  3DEP A;  2OOE A;  1N9A A;  5DIZ A;  4EEC A;  3SI5 A;  3CGH A;  4JC8 A;  3FH8 A;  4OAV B;  4E6H A;  1HFA A;  1LTX A;  4Y6C A;  1E8W A;  5BW8 C;  3ULQ A;  2DCP A;  4JL0 A;  4HOS A;  4FUL A;  4KZC A;  4GTT A;  3Q79 A;  3HG0 D;  4ME2 A;  3G2S A;  2HR2 A;  2X6H A;  2Q7F A;  4JD2 G;  1OCZ E;  1N4S A;  2XEV A;  5BT1 A;  3TXN A;  3J5P A;  4L2Y A;  1FT1 A;  4LNU D;  1AWC B;  1BD8 A;  5LFA A;  1N52 A;  3D9K A;  4JA7 A;  2Y1L E;  5G2N A;  3ZU7 B;  3QWP A;  4GPM A;  4X8Q A;  4UI9 J;  2XEE A;  4BER A;  3SBS A;  3ML8 A;  1QQE A;  2DBA A;  3J5Q B;  3ZN3 A;  3IV0 A;  1EDU A;  4A3T A;  1NZN A;  3W9G A;  2IO2 C;  3UQ3 A;  3RSE G;  4WAF A;  2I2O A;  2WPV A;  3BUA A;  5LX8 A;  2Y4T A;  3BG0 B;  3PNT B;  4AEZ C;  5JA4 D;  1KPS B;  3TGO A;  2XS8 A;  1L5J A;  3TWU A;  1SW6 A;  3ZPJ A;  2Y0B G;  3RJV A;  5LCW C;  2CHW A;  5G05 J;  3DXK G;  2YHC A;  1INZ A;  2GRL A;  3SZ7 A;  1TNZ A;  1OT8 A;  2J08 A;  3I4G A;  3FUD A;  4L1B A;  4HVB A;  3QOU A;  5AAR A;  4U07 A;  4MS6 A;  3JXJ A;  1S70 B;  5HRY A;  2KAT A;  4TXR A;  3ISM C;  3SQV A;  1JCR A;  2GRN B;  1IYG A;  3AS5 A; 
#chains in the Genus database with same CATH homology
 4BES A;  2NYJ A;  2VGE A;  3D9H A;  1DCQ A;  3V2O A;  5ENR D;  1OY3 D;  3HG0 D;  4HRN A;  3AJI A;  2AJA A;  4RLY A;  4A63 B;  3JXI A;  2JAB A;  1K1B A;  4J8Y A;  4F1P A;  1N0Q A;  2QC9 A;  1MX6 A;  1NFI E;  5CEA A;  5EIB E;  1K3Z D;  4CYM D;  5EN5 D;  2XZT G;  5FIO A;  4UUC A;  3HRA A;  3Q9N C;  3ZNG A;  4ATZ D;  1AP7 A;  5EID A;  4HQD A;  3EU9 A;  4G8K A;  4HRM B;  4DX5 D;  4U8V D;  5HKP A;  5KNH D;  4QQI A;  3J5P A;  2RFM A;  4HI8 A;  4LG6 A;  2MYO A;  3ZKJ A;  4CZ2 D;  4LNU D;  4BET A;  3B95 A;  3SO8 A;  1YYH A;  3C5R A;  5BXU A;  5CED B;  1BD8 A;  1AWC B;  3NBN B;  5ITZ F;  5KWD A;  3DEO A;  2KBX A;  5CBN A;  4DX6 D;  4U95 D;  5AN8 A;  2Y1L E;  2DWZ A;  5AQA A;  5CBO A;  1MX2 A;  1TR4 A;  4B93 B;  5AQB A;  3ZU7 B;  3EHR A;  4QFV A;  3KEA A;  3T8K A;  4GPM A;  3ZUV B;  2RFA A;  5ENT D;  1DC2 A;  1A5E A;  1BLX B;  3B7B A;  2BKG A;  5KBA A;  1QYM A;  5HS0 A;  1IHB A;  2XEE A;  4YDW A;  4O1P A;  4GMR A;  4O60 A;  3T9K A;  4BER A;  2J8S D;  3TWR A;  5ENS D;  1BI8 B;  4NIK A;  3TWV A;  1K1A A;  4JB8 P;  2F8Y A;  1UOH A;  3J5Q B;  3JUE A;  5ENO D;  3TWS A;  3V2X A;  3W9G A;  3V79 K;  5CER B;  3V30 A;  5AAO A;  1BU9 A;  4C48 B;  1WDY A;  4HBD A;  2QYJ A;  4HRL A;  1MJ0 A;  4DX7 D;  1BI7 B;  3EHQ A;  1N0R A;  5ENQ D;  3Q9U C;  4F6R D;  2XZD G;  5CEC B;  3TWX A;  2BKK B;  2V5Q C;  3IXE A;  2FO1 E;  2XEN A;  5JMN D;  2F37 A;  3UXG A;  4DUI A;  2ETB A;  1SVX A;  2V4H C;  2ZGD A;  4U96 D;  5AQ7 A;  4DX2 A;  5JA4 D;  4ZHB A;  4OAU C;  4J7W A;  4K5B A;  5FIN A;  4G8L A;  5BXO A;  4N5Q A;  3TWQ A;  2ETC A;  4ZFH A;  3NOG D;  2DZO A;  1D9S A;  3AAA C;  2ETA A;  2KXP C;  3V31 A;  1YCS B;  3TWU A;  1SW6 A;  1MX4 A;  2Y0B G;  3TWT A;  4TUM A;  4LSZ E;  4YDY A;  3F6Q A;  3DEP A;  1YMP A;  2DVW A;  4HLL A;  5EYL A;  2F8X K;  5EYP F;  4K5A B;  4BSZ B;  3W9F A;  2DZN A;  5AQ9 A;  1OT8 A;  4DX1 A;  4BEP A;  1IKN D;  4HI9 A;  4HNA D;  2ZGG A;  2A5E A;  1MYO A;  2HE0 A;  5D66 A;  4OAV B;  4DRX E;  3LJN A;  5AAR A;  4O1O A;  5EIL A;  1N11 A;  4K5C A;  4U8Y D;  2P2C P;  5ENP D;  3NOC D;  4Z68 A;  2PNN A;  5KNG A;  4HB5 A;  3JXJ A;  3UTM A;  1S70 B;  1WG0 A;  5HRY A;  3TWW A;  2L6B A;  2XEH A;  3UI2 A;  2B0O E;  1IXV A;  1G3N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...