5AAOA

Crystal structure of fluorogen-activating designed ankyrin repeat protein (darpin) dimer in complex with malachite green
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
SDLGKKLLEAARAGQDDEVRILMANGADVNAKDSRGKTPLHLAADYGYLEVAEVLLKHGADVNAHDVYGDTPLHLTATWGHLEIVEVLLKNGADANAIDFFGWTPLHLAAYFGHLEIVEVLLKYGADVNAQDKFGKTVFDISVYNGDEDLAEILQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of Fluorogen-Activating Designed Ankyrin Repeat Proteins (FADAs) as Versatile Sensor Tools.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
molecule keywords FAD3210
total genus 54
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5aaoA00
2XEEA 3HG0D 4Z68A 1A5EA 2P2CP 5CEDB 4BETA 3J5QB 2V4HC 5FIOA 3TWSA 3D9HA 1BI7B 1IKND 3Q9NC 4DRXE 3TWTA 3UTMA 5JA4D 3IXEA 4F6RD 5EIDA 5HKPA 3ZU7B 1K1BA 5BXUA 1AWCB 2KXPC 1MX2A 2Y0BG 4HNAD 5FINA 4U95D 2L6BA 1OY3D 2J8SD 4LNUD 1K3ZD 2DZNA 5ENTD 4DUIA 5KNHD 4GPMA 4HB5A 4JB8P 5AQ7A 4U8VD 4QFVA 3V2OA 1BU9A 1S70B 2F8XK 4J8YA 5EYLA 1MX6A 4ZHBA 3LJNA 1WDYA 2PNNA 2BKGA 3DEPA 1MJ0A 1BI8B 1SW6A 5HRYA 5AARA 2DWZA 4HRMB 1G3NB 3UXGA 5BXOA 3DEOA 1AP7A 4LSZE 4HI9A 2ETCA 2Y1LE 5KWDA 5ENQD 2VGEA 2F8YA 2NYJA 3JXIA 4G8KA 3V31A 4B93B 3TWXA 5JMND 4DX5D 2RFMA 2RFAA 4O1OA 4ATZD 4DX2A 4HI8A 4DX6D 1N0RA 5EN5D 3NBNB 4UUCA 2DVWA 4HQDA 1TR4A 1SVXA 4HLLA 4K5CA 2B0OE 2QYJA 4TUMA 3V79K 5AAOA 4YDYA 2XZDG 1UOHA 3ZNGA 4OAVB 3EHQA 2ZGGA 5CBNA 3HRAA 3ZKJA 4OAUC 4RLYA 2DZOA 4HBDA 4J7WA 3JUEA 1QYMA 3TWRA 5ENSD 3W9GA 2A5EA 4NIKA 2AJAA 5AQ9A 4ZFHA 2ZGDA 4CYMD 5ENRD 1K1AA 3Q9UC 1IXVA 4HRLA 5AQBA 1BD8A 5D66A 3SO8A 3T9KA 2XEHA 4QQIA 5EILA 5ITZF 3B95A 4GMRA 1BLXB 1MX4A 3B7BA 1YYHA 4DX7D 5KNGA 5KBAA 1N11A 3TWVA 5CECB 3AJIA 5AN8A 3ZUVB 5EIBE 1DCQA 5ENOD 4K5AB 1N0QA 3F6QA 2ETAA 4BSZB 4C48B 3T8KA 1OT8A 2F37A 3V30A 5CERB 1DC2A 1IHBA 3EHRA 2JABA 3C5RA 3V2XA 2BKKB 3NOGD 2ETBA 4U96D 4BEPA 2MYOA 3TWQA 4A63B 1WG0A 4YDWA 4BESA 4HRNA 3W9FA 2QC9A 5EYPF 4BERA 3NOCD 4O60A 4U8YD 1YCSB 4N5QA 5CBOA 3J5PA 4K5BA 5CEAA 2V5QC 2FO1E 1YMPA 3TWUA 1D9SA 4LG6A 2HE0A 2XZTG 3UI2A 5HS0A 4G8LA 5AQAA 1NFIE 3AAAC 3EU9A 4CZ2D 4F1PA 2XENA 5ENPD 3JXJA 1MYOA 2KBXA 4DX1A 3TWWA 3KEAA 4O1PA
chains in the Genus database with same CATH superfamily
5CEDB 4I43A 4G1TA 3C3RA 3D9HA 2WXIA 2XCBA 3HDXA 3JUIA 4DRXE 3I5PA 5JA4D 1NA0A 1AWCB 3SQVA 1HFAA 3DXMG 1FVHA 2MHKA 3ZFWA 5CMWA 2WXHA 3ZYMA 2XCCA 3PNLB 4FLBA 3ASOE 4NRHB 2P9SG 5KWDA 1E8WA 4G8KA 3GW4A 2R2LA 2DYSE 4B8CB 3DRAA 1GW6A 3JQ0A 4DX2A 4I9CA 1TNZA 3UQ3A 5EKQD 1SVXA 4B8AA 4GA0A 3ZNGA 5IY5E 4WWPA 4A3VA 3QOUA 3EHQA 2DZOA 4KVMA 3K9IA 3U4TA 3FUFA 4U63A 3Q4AB 2VGXB 4QQIA 4ACKA 2OEWA 2IY0C 3FULA 1X5BA 3FU5A 4E6HA 3FH7A 2F37A 3DSXA 2JABA 3C5RA 3AG4E 5BPPA 3QJZA 2MYOA 3KSQA 1E90A 2XS8A 2DIWA 4XE0A 2IEJA 3NOCD 3FU0A 3J5PA 3B7UX 4GU5A 3FUHA 3UI2A 1TNOA 3RIBA 3FTYA 1JWFA 4JPSA 1Z3YA 2P2CP 2V4HC 3HXCA 1BI7B 2L0TB 4P29A 3APCA 5BUZA 3FTSA 5BV1A 1QZ2A 3CKCA 2ZISA 1LTXA 3ZHEA 2Y4TA 3QNKA 3APDA 1OWOA 2C2LA 4JL0A 2OVBA 3DEOA 3L08A 3ML9A 4GYWA 1N4QA 4DI3A 3SFYA 2BTDA 2LUHA 2PM7A 1SZ9A 1MHQA 2GRRB 4N3BA 4RVBA 4TUMA 4BT9A 1DNPA 1UN9A 3ULQA 4APOA 2KZTB 4OAUC 2IJGX 4TV3A 5HQ8A 3Q9UC 5KCMA 5AQBA 1PY1A 2R02A 4F1SA 3P1UA 4HOSA 5KBAA 2JEKA 1ZU2A 1N54A 1N4PA 2NXPA 4EHMA 2KM4A 4BSZB 5CERB 3R7RA 3ZGQA 2E0IA 4UQZA 2LSVA 3ZYKA 4J0UA 4L7TA 3D9JA 5FQ7A 2FF4A 5CRUA 3EU9A 2KBXA 4M7CA 4J8DA 4GTQA 2WQHA 3ZW3A 3VLDA 4I6JA 3FUJA 3EJNA 3LVRE 4JEHA 2J8SD 2EIJE 4HOUA 3R9AB 3ASFA 4EZJA 1OCRE 4JHJA 4QFVA 2H6HA 2JLBA 4L1BA 5EYLA 3HVEB 4HRMB 2A5UA 1KPSB 3Q47B 3LPZA 2MRIA 3D3MA 2YHCA 3URZA 2AW6A 4GAAA 4AV7A 3MV2B 4CDMA 1JUQA 5LCWC 2GGFA 3DBSA 4EPZA 1MQSA 3B7TA 3W9GA 2FI7A 4XEIG 2EIME 1QNFA 2B6CA 5ENRD 1K1AA 5T8IA 3SO8A 4ANWA 3WXXA 1U3DA 4TRQA 3QWPA 1RZ4A 4DX7D 5ENNA 2XGOA 4V3IA 5AN8A 1N0QA 1IHBA 3LYAA 2ETBA 1ELRA 2RD0A 1S0PA 5CBOA 4TUUA 4N3CA 3RAUA 4XKCA 4F1PA 3CVLA 4EBAA 1E7UA 4HORA 3TWSA 4JC8A 1TN7A 2QZAA 4Y6WA 2AXUA 4WUYA 3FUIA 4TXRA 3ASGA 5BV0A 2V4LA 3LDZA 2RG8A 2PL2A 4H7XA 3U9WA 4BY6A 4J8YA 1D8EA 4A1SA 4ZHBA 2WB2A 5D0OD 3ZXPA 3MKQA 2VJ8A 4CDRA 3E30A 4BX8A 5FQ6A 2VSYA 4X8QA 3DSWA 1LD8A 3MYVA 3PUJA 4GPKA 4MKTA 4AXHA 5M72A 4CRWA 3S7FA 5G55A 4HRLA 3S7JA 2I9CA 3CSFA 1YYHA 2FEZA 3ZUVB 2CG2A 4CEMA 3PZ3A 4L9PA 3ASDA 4KMOA 2BKKB 3CHSA 4D10C 1JPLA 4IRUA 5FQ4A 4BESA 4DI4A 3ISMC 3JYSA 3Q5MA 3G2VA 5B1AE 2XPIA 2CFUA 2VTBA 5ENPD 4DK5A 4O1PA 3QWWA 3SFZA 2R5SA 2F0YA 3ZPJA 3ZU7B 3HHMA 3N71A 3CHQA 5JJ6A 3NAWA 3Q49B 1K3ZD 2I1KA 5G04J 4YVQC 4GTMA 4BTBA 1HZ4A 5FTPA 3UM0A 1S70B 4UWGA 2X6KA 2F8XK 2I6HA 1SQMA 3LKUA 3IHYA 1MX6A 1HH8A 2EILE 3EUVA 1MZCA 4J8FA 1H0AA 3NZSA 2LXLA 2KC7A 2WXGA 4GA2A 1O1RA 4I2WA 2J4DA 2WXRA 1D8DA 3V79K 1TNBA 3SFXA 1N4SA 5CBNA 2WXQA 4CT0A 2WPVA 3TWRA 4NIKA 4XX5A 4GMRA 3B7BA 4GZDA 1E8XA 1N11A 2XEVA 3TWVA 2FO7A 4K5AB 2OCCE 4IYPA 3T5XA 3TG5A 3APFA 5FZQA 3AG1E 3FTXA 1YCSB 2E2EA 4AOFA 3AG2E 4GTPA 4CZ2D 3RSEG 2XENA 3JXJA 3AS4A 5DBKA 4JHRA 3AS5A 1IKND 4Y6CA 4KVOA 5BXUA 3I4RB 4IN3B 5CCLA 1HS6A 1OCZE 5E75A 4MS6A 4YVOA 5JJ7A 2OV8A 2XGMA 3FU3A 3RRUA 1BU9A 3CVUA 2XHEA 4I2ZA 4ACLA 1X81A 4LRZA 4RSYA 1WDYA 4L23A 4IULA 5C1DA 2X6FA 2F8YA 5EDSA 1V55E 3ML8A 3FU6A 1N0RA 4G23A 4UUCA 3U66A 4K5CA 2QYJA 3IKOB 2HM8A 4LNGA 4JA9A 1TN6A 3X2QE 5HI7A 3EDTB 3DPYA 5BT1A 5ITZF 3TXMA 3Q78A 4CT4A 2ZIRA 3CVWA 1HU3A 3OXLA 2LO6A 1FPPA 3AG3E 3UPVA 1DC2A 2KZTA 3DWLG 2VTBB 3EIJA 3FUMA 3PZ4A 3QAQA 3FUEA 3KAEA 3DSUA 4JD2G 2HE0A 3PUKA 1YA0A 3AAAC 3VTYA 3ONLA 3FTUA 3SY2A 4N39A 3UIOC 3R7QA 3J5QB 3S2AA 5CRVA 1OWLA 2AXVA 3OXFA 4I9EA 4CCAA 2VSNA 2WM9A 4UWLA 2CHZA 3UM2A 3RU0A 2R03A 3UMVA 4GCOA 2OVFA 1NA3A 2XS1A 1E7VA 3WG7E 1MX2A 4N2QA 4U95D 3E4BA 3RJVA 2IFUA 3Q79A 4G26A 4AY6A 3NZUA 4KXKB 4AM9A 1P5QA 5D2MC 2VYIA 3SBSA 3LS8A 3ABME 2IO3C 4FP7A 4GTVA 2DWZA 1AP7A 3ENEA 4HI9A 3JXIA 3V31A 5JMND 3SF4A 3E32A 4KBQA 1N4RA 4I6EA 4B0ZA 3L9TA 3O4ZA 2UWJG 3Q7FA 3QWVA 1H2UA 3RK6A 4ME2A 3MCXA 4ILGA 5AJDA 3RO3A 1TJCA 3C3OA 1IXVA 2PM6A 2FBNA 4YDOA 3FFLA 4JW1A 4UWFA 4C48B 3HXBA 5FWQA 4JHKA 3ESLA 2IOSA 1QBQA 4N3AA 3C72A 2AVPA 2PQRA 4U96D 3MA5A 4LERA 4O60A 5E76A 3MV3B 4R7LA 1D9SA 5EX0A 3DSSA 4AP2A 3FP3A 2WXPA 4LEUA 1WAO1 5G05C 1MYOA 3PEUB 1N9AA 4Z68A 2H6FA 3ZN3A 3AU5A 3FUNA 3L54A 2WXJA 5EIDA 3IEGA 1OCCE 3ASNE 1ZB1A 3PZDA 1VDYA 4HB5A 4RG6A 4N2SA 3IHVA 3JQ1A 5AARA 1OCOE 3ULYA 1FVFA 4B93B 3ZRHA 3QKYA 4FA6A 3BG0B 4NACA 4B89A 2B0OE 1OXJA 4A3TA 5AAOA 1V54E 3Q75A 1HE8A 4OAVB 3GZ1A 2J9QA 1O1SA 2BEDA 3ZKJA 5LX8A 2A5EA 2AJAA 5AYWD 3VLFA 3PE3A 2Y3AA 1MX4A 2CG3A 5KNGA 2IQCA 1ZBPA 4FHJA 4BSXA 1EPUA 3Q7AA 3AJIA 4F53A 4TXQA 1U2VG 4DLQA 3CVYA 4UWKA 1Q2ZA 3UT8A 2L9BA 2Q7FA 4A63B 1N94A 2QY7A 2QC9A 5B3SE 3MX3A 2V5FA 4CGWA 2IONA 5AIJA 4K0RA 4UWHA 4L2LA 3FDHA 1A5EA 4GA1A 4FC8A 1EYHA 4U8HA 4HS2A 5AENA 5FINA 5BNWA 3HXFA 5ENTD 5KJMA 4B94A 4MRUA 1K8KG 2EQXA 2P9PG 3V2OA 2HO1A 1NL4A 2C0MA 4EQFA 2KATA 3AS8A 3DEPA 5HRYA 4LSZE 3HXDA 4WAFA 2RFMA 4BT8A 4FJYA 3SGHA 1TR4A 1E8YA 5A7DB 4BTAA 1NP7A 3JCKC 1E8ZA 4U0ZA 2ZGGA 3PDNA 4GMJA 3SD5A 3TG4A 1UJJA 2GW1A 4ILHB 3HIZA 2ZGDA 4UQXA 3L82A 4GTTA 2NSZA 3FHEA 2R59A 5KJNA 2WXFA 3B95A 1PAQA 3EU5A 1WM5A 3T8MA 3NB2A 5ANLA 4PS8A 1RW2A 2EINE 3FWVA 3QK0A 5C2YA 5LFAA 2WQ7A 4L2YA 3SNXA 4UI9C 3D9IA 1HXIA 3SHFA 4BERA 1YMPA 3QC1A 3CEQA 2XZTG 5AQAA 1A17A 2R17C 3TWWA 2KCVA 2GRMA 4FULA 1HX8A 4HVBA 4ANVA 5LCWJ 1HG5A 4BFRA 3CV0A 3ZIMA 1TEZA 3Q9NC 3UTMA 5DIZA 1IYGA 5ARGA 4EECA 5KJKA 5AJLA 3HYMB 2Y0BG 1KLXA 1OY3D 3CVXA 1JCSA 4J8SA 4JB8P 4OYSA 1HO8A 3Q15A 5G04C 3HVEA 3UT4A 5BXOA 2Y4UA 3UXGA 1G3NB 4WWNA 3CHPA 3ONKA 2WXLA 1FT1A 3ESKA 2H6IA 3U64A 3ABLE 2J49A 3MKQB 3I4GA 2LSUA 3D9NA 1SA5A 2C0LA 5FZRA 5CMYA 3JUEA 5JHBA 3TL5A 3QB2A 3GZSA 1H6PA 1OWNA 3TAXA 3OAWA 4GMLA 2LNIA 3B13A 3RRNB 3C98A 3CHRA 3T8KA 3UIPC 1N52A 3LY7A 3EHRA 4ATGA 3G2UA 4Q69A 3TJPA 4GYYA 3ZYLA 1OWMA 2V5QC 4YDEA 4G8LA 5D0QD 3VLEA 4WNDA 2GRQB 2VQ2A 4DX1A 3FTWA 3BU8A 2KCLA 2L6JA 2XGSA 2VGYA 2I1JA 2P58C 2V0PA 2V8SE 3IV0A 4K03A 3GYZA 3MGBA 3UX4A 4NQ0A 2LAHA 4C9BB 4LNUD 4A1GA 3O48A 3G2SA 3EHNA 4U8VD 3KSLA 4JVSA 4M3OA 2CFZA 5CHEE 2WVIA 3PREA 4GTOA 1NI1A 2P9KG 4KYOB 1MJ0A 1BI8B 3D9OA 2VSOE 3LEWA 2VGEA 1H2TC 2RFAA 3LJ3A 3CVQA 4DX6D 5EN5D 2L0IA 4UQYA 2XZDG 5EX3A 4TXPA 3FY4A 3QDNA 4RLYA 3D9MA 4UI9J 1EF1C 3P2BA 4J6IA 4ZFHA 1KZOA 2IOLA 3T9KA 3DPDA 1INZA 4URKA 4JZYA 1KT1A 3F6QA 4PDXA 2P9UG 1BPOA 1XNFA 2KCKA 3V2XA 4KT6B 4Q94A 2X6HA 3S7DA 3L6AA 3CVVA 3PEVB 5EYPF 5BW8C 5H7PA 3CHOA 4LG6A 2H6GA 5T3RA 2FULA 3BUAA 3FH8A 1Z3XA 3FTZA 3KEAA 4DLOA 4EBAG 1LD7A 2OOEA 4U0UA 2J07A 1H2VC 3NF1A 1K1BA 4DJAA 2WXMA 4HNAD 4JXTA 3LVQE 4DUIA 4PH4B 1UN8A 2CHWA 4GPMA 5A6CA 5AQ7A 4I6GA 2DYRE 1S64A 4E85A 4GZ5A 2M63A 4EZLA 2AXZA 2Y1LE 3SI5A 3PVLA 2X6JA 3TWXA 4XI9A 2R05A 3BQOA 4HI8A 4I1OB 3CHMA 5J08A 3NQPA 1LF8A 3BG1B 4AVXA 4HXIA 3ULEG 4KZCA 2XRZA 2WMOA 1XGWA 4OVVA 1BD8A 3G2WA 5D66A 1O5MA 3D9KA 2WXOA 5EILA 1H19A 4G2VA 1HG2A 4GTSA 1DCQA 1IHGA 2P9IG 4CDNA 2CHXA 1OT8A 3KEZA 3D9PA 4YDWA 1HF8A 3E34A 1OWPA 5CEAA 3TWUA 3DSTA 3UKUG 4U04A 3KS2A 2P9LG 4BETA 3CVNA 4PS3A 5ARFA 4F7AA 4WNFA 3TWTA 5HKPA 2PZIA 3UINC 1U3CA 2J08A 1Y8MA 3CVPA 4JA7A 3CK8A 4RG9A 1E96B 2WMNA 2Y69E 3FTVA 2BKGA 4GZ6A 1SW6A 4XZ4A 4I1AA 3ZVVA 3EIQC 1B89A 4O1OA 2EIKE 2DVWA 2J09A 4LUNU 4AJWA 3LCAA 4KZ0A 2X6IA 1DVPA 3B7SA 3PZ1A 5LOZA 3SZ7A 1QYMA 5ENSD 4CYMD 1JCQA 4AEZC 4BWRA 2IO2C 5CECB 4PUCA 2YINA 4C0EA 3T5VA 4YNDA 4HRNA 1W3BA 1QQEA 4F3VA 3OTNA 2LXMA 1KT0A 3L22A 5LP0A 4U07A 2XEEA 3S7BA 4LCTA 2GRNB 4GZ3A 5B1BE 4FHKA 3IXEA 4F6RD 3G2TA 4Q96A 2KXPC 4FU3A 3MKRA 2DZNA 2UY1A 3SBTB 4W9RA 2HR2A 4I17A 1O1TA 4APFA 2XQ0A 4EZKA 1TN8A 2PNNA 2YNQA 4G11A 3ABKE 5ENQD 3E33A 4UI9K 4GCNA 3CR3A 1TNUA 3C3QA 2XPYA 4G25A 1UG3A 3TXNA 3HXEA 4HLLA 3FEYA 2WXNA 4NURA 3RRMB 5J90A 4FADA 4XKBA 3I3NA 2HYZA 2XPZA 4HBDA 4HFGA 4J7WA 3MEKA 4ANXA 1TYQG 3FUKA 3ASHA 3KD7A 2XEHA 4J8EA 2BF0X 1Z5SC 4GYOA 2ZXWE 3B7RL 3EHMA 1S63A 2AWIA 3GZ2A 3LXUX 4BX9A 3V30A 3UM3A 4MLPA 1TJFA 3NOGD 3TWQA 1WG0A 3W9FA 3CKBA 4N5QA 2FO1E 1JCRA 3CQCB 2YHEA 4FLHA 5CCMA 4OVUA 1H6OA 3HG0D 4GTRA 4LNBA 2NC9A 5FIOA 4U7EB 3DSVA 3PH0C 1N95A 3UT7A 3ZHEB 1UW4B 4DPRA 2DBAA 5FQ8A 2L6BA 4A55A 4JEUA 2XRYA 3UM1A 2J4BA 4GB9A 5KNHD 1FCHA 3DXKG 1EDUA 3OXGA 3CSTA 1PC2A 2PQNA 3D9LA 3CLJA 4XI0A 3R9MA 3PZ2A 3CGHA 3CK7A 4HLEA 1Y6IA 3IBEA 3UUXA 2NYJA 5FZSA 4DX5D 2GRPB 4I1MA 2IF4A 4HQDA 1IQRA 4ILIA 5KJLA 5G2NA 4YDYA 5T4YA 3LY8A 3UKRG 2RKKA 3HRAA 5G05J 2P9NG 5AQ9A 2QFCA 1TNYA 4WWOA 1H6KA 2I2OA 2YQ8A 4N5CA 4G24A 4O6FA 2X38A 2VSXE 3QARA 2ETAA 1OUVA 3PRZA 4FJZA 5A23A 3FEXA 4BEPA 2X3MA 4CGVA 1ELKA 4GZCA 4U8YD 3ZYQA 4AIFA 4K5BA 2WXKA 1L5JA 5ANRA 5HS0A 1NFIE 2GRLA 4C0MA 3RKVA 2ILRA 5FJYA 1FT2A 5FT9A 5JJTA 1NZNA 3ZEFA 2LAIA 4XIFA 4WNEA 4HOTA 1DCEA 3CK9A 2IU1A 3AU4A 1Z6TA 1IQUA 4PS7A 3LJNA 3MZLB 4RQIA 3ZXSA 2OEVA 4AY5A 3TGOA 1JWGA 2ETCA 2BUGA 4U0SA 3L16A 4MBGA 4ATZD 2A4ZA 3NBNB 3LY9A 3MJWA 5JHAA 3CQGB 1UOHA 3L13A 3PS6A 4ANUA 3PE4A 3L17A 4WNGA 3E37A 2UY1B 4ABNA 2ZU6B 4HOQA 2MOWA 1ELWA 1BLXB 3BEEA 1SA4A 1UJKA 1WY6A 3VTXA 2GROB 3FUDA 3Q73A 5EIBE 5ENOD 3CIAA 3PNTB 3RO2A 2WQ6A 3FH5A 3U3WA 2QYUA 2DCPA 4H7YA 1KZPA 2VGXA 1SZAA 2ONDA
chains in the Genus database with same CATH topology
2XEEA 3HG0D 4Z68A 1A5EA 2P2CP 5CEDB 4BETA 3J5QB 2V4HC 5FIOA 3TWSA 3D9HA 1BI7B 1IKND 3Q9NC 4DRXE 3TWTA 3UTMA 5JA4D 3IXEA 4F6RD 5EIDA 5HKPA 3ZU7B 1K1BA 5BXUA 1AWCB 2KXPC 1MX2A 2Y0BG 4HNAD 5FINA 4U95D 2L6BA 1OY3D 2J8SD 4LNUD 1K3ZD 2DZNA 5ENTD 4DUIA 5KNHD 4GPMA 4HB5A 4JB8P 5AQ7A 4U8VD 4QFVA 3V2OA 1BU9A 1S70B 2F8XK 4J8YA 5EYLA 1MX6A 4ZHBA 3LJNA 1WDYA 2PNNA 2BKGA 3DEPA 1MJ0A 1BI8B 1SW6A 5HRYA 5AARA 2DWZA 4HRMB 1G3NB 3UXGA 5BXOA 3DEOA 1AP7A 4LSZE 4HI9A 2ETCA 2Y1LE 5KWDA 5ENQD 2VGEA 2F8YA 2NYJA 3JXIA 4G8KA 3V31A 4B93B 3TWXA 5JMND 4DX5D 2RFMA 2RFAA 4O1OA 4ATZD 4DX2A 4HI8A 4DX6D 1N0RA 5EN5D 3NBNB 4UUCA 2DVWA 4HQDA 1TR4A 1SVXA 4HLLA 4K5CA 2B0OE 2QYJA 4TUMA 3V79K 5AAOA 4YDYA 2XZDG 1UOHA 3ZNGA 4OAVB 3EHQA 2ZGGA 5CBNA 3HRAA 3ZKJA 4OAUC 4RLYA 2DZOA 4HBDA 4J7WA 3JUEA 1QYMA 3TWRA 5ENSD 3W9GA 2A5EA 4NIKA 2AJAA 5AQ9A 4ZFHA 2ZGDA 4CYMD 5ENRD 1K1AA 3Q9UC 1IXVA 4HRLA 5AQBA 1BD8A 5D66A 3SO8A 3T9KA 2XEHA 4QQIA 5EILA 5ITZF 3B95A 4GMRA 1BLXB 1MX4A 3B7BA 1YYHA 4DX7D 5KNGA 5KBAA 1N11A 3TWVA 5CECB 3AJIA 5AN8A 3ZUVB 5EIBE 1DCQA 5ENOD 4K5AB 1N0QA 3F6QA 2ETAA 4BSZB 4C48B 3T8KA 1OT8A 2F37A 3V30A 5CERB 1DC2A 1IHBA 3EHRA 2JABA 3C5RA 3V2XA 2BKKB 3NOGD 2ETBA 4U96D 4BEPA 2MYOA 3TWQA 4A63B 1WG0A 4YDWA 4BESA 4HRNA 3W9FA 2QC9A 5EYPF 4BERA 3NOCD 4O60A 4U8YD 1YCSB 4N5QA 5CBOA 3J5PA 4K5BA 5CEAA 2V5QC 2FO1E 1YMPA 3TWUA 1D9SA 4LG6A 2HE0A 2XZTG 3UI2A 5HS0A 4G8LA 5AQAA 1NFIE 3AAAC 3EU9A 4CZ2D 4F1PA 2XENA 5ENPD 3JXJA 1MYOA 2KBXA 4DX1A 3TWWA 3KEAA 4O1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEE A;  3HG0 D;  4Z68 A;  1A5E A;  2P2C P;  5CED B;  4BET A;  3J5Q B;  2V4H C;  5FIO A;  3TWS A;  3D9H A;  1BI7 B;  1IKN D;  3Q9N C;  4DRX E;  3TWT A;  3UTM A;  5JA4 D;  3IXE A;  4F6R D;  5EID A;  5HKP A;  3ZU7 B;  1K1B A;  5BXU A;  1AWC B;  2KXP C;  1MX2 A;  2Y0B G;  4HNA D;  5FIN A;  4U95 D;  2L6B A;  1OY3 D;  2J8S D;  4LNU D;  1K3Z D;  2DZN A;  5ENT D;  4DUI A;  5KNH D;  4GPM A;  4HB5 A;  4JB8 P;  5AQ7 A;  4U8V D;  4QFV A;  3V2O A;  1BU9 A;  1S70 B;  2F8X K;  4J8Y A;  5EYL A;  1MX6 A;  4ZHB A;  3LJN A;  1WDY A;  2PNN A;  2BKG A;  3DEP A;  1MJ0 A;  1BI8 B;  1SW6 A;  5HRY A;  5AAR A;  2DWZ A;  4HRM B;  1G3N B;  3UXG A;  5BXO A;  3DEO A;  1AP7 A;  4LSZ E;  4HI9 A;  2ETC A;  2Y1L E;  5KWD A;  5ENQ D;  2VGE A;  2F8Y A;  2NYJ A;  3JXI A;  4G8K A;  3V31 A;  4B93 B;  3TWX A;  5JMN D;  4DX5 D;  2RFM A;  2RFA A;  4O1O A;  4ATZ D;  4DX2 A;  4HI8 A;  4DX6 D;  1N0R A;  5EN5 D;  3NBN B;  4UUC A;  2DVW A;  4HQD A;  1TR4 A;  1SVX A;  4HLL A;  4K5C A;  2B0O E;  2QYJ A;  4TUM A;  3V79 K;  5AAO A;  4YDY A;  2XZD G;  1UOH A;  3ZNG A;  4OAV B;  3EHQ A;  2ZGG A;  5CBN A;  3HRA A;  3ZKJ A;  4OAU C;  4RLY A;  2DZO A;  4HBD A;  4J7W A;  3JUE A;  1QYM A;  3TWR A;  5ENS D;  3W9G A;  2A5E A;  4NIK A;  2AJA A;  5AQ9 A;  4ZFH A;  2ZGD A;  4CYM D;  5ENR D;  1K1A A;  3Q9U C;  1IXV A;  4HRL A;  5AQB A;  1BD8 A;  5D66 A;  3SO8 A;  3T9K A;  2XEH A;  4QQI A;  5EIL A;  5ITZ F;  3B95 A;  4GMR A;  1BLX B;  1MX4 A;  3B7B A;  1YYH A;  4DX7 D;  5KNG A;  5KBA A;  1N11 A;  3TWV A;  5CEC B;  3AJI A;  5AN8 A;  3ZUV B;  5EIB E;  1DCQ A;  5ENO D;  4K5A B;  1N0Q A;  3F6Q A;  2ETA A;  4BSZ B;  4C48 B;  3T8K A;  1OT8 A;  2F37 A;  3V30 A;  5CER B;  1DC2 A;  1IHB A;  3EHR A;  2JAB A;  3C5R A;  3V2X A;  2BKK B;  3NOG D;  2ETB A;  4U96 D;  4BEP A;  2MYO A;  3TWQ A;  4A63 B;  1WG0 A;  4YDW A;  4BES A;  4HRN A;  3W9F A;  2QC9 A;  5EYP F;  4BER A;  3NOC D;  4O60 A;  4U8Y D;  1YCS B;  4N5Q A;  5CBO A;  3J5P A;  4K5B A;  5CEA A;  2V5Q C;  2FO1 E;  1YMP A;  3TWU A;  1D9S A;  4LG6 A;  2HE0 A;  2XZT G;  3UI2 A;  5HS0 A;  4G8L A;  5AQA A;  1NFI E;  3AAA C;  3EU9 A;  4CZ2 D;  4F1P A;  2XEN A;  5ENP D;  3JXJ A;  1MYO A;  2KBX A;  4DX1 A;  3TWW A;  3KEA A;  4O1P A; 
#chains in the Genus database with same CATH topology
 5CED B;  4I43 A;  4G1T A;  3C3R A;  3D9H A;  2WXI A;  2XCB A;  3HDX A;  3JUI A;  4DRX E;  3I5P A;  5JA4 D;  1NA0 A;  1AWC B;  3SQV A;  1HFA A;  3DXM G;  1FVH A;  2MHK A;  3ZFW A;  5CMW A;  2WXH A;  3ZYM A;  2XCC A;  3PNL B;  4FLB A;  3ASO E;  4NRH B;  2P9S G;  5KWD A;  1E8W A;  4G8K A;  3GW4 A;  2R2L A;  2DYS E;  4B8C B;  3DRA A;  1GW6 A;  3JQ0 A;  4DX2 A;  4I9C A;  1TNZ A;  3UQ3 A;  5EKQ D;  1SVX A;  4B8A A;  4GA0 A;  3ZNG A;  5IY5 E;  4WWP A;  4A3V A;  3QOU A;  3EHQ A;  2DZO A;  4KVM A;  3K9I A;  3U4T A;  3FUF A;  4U63 A;  3Q4A B;  2VGX B;  4QQI A;  4ACK A;  2OEW A;  2IY0 C;  3FUL A;  1X5B A;  3FU5 A;  4E6H A;  3FH7 A;  2F37 A;  3DSX A;  2JAB A;  3C5R A;  3AG4 E;  5BPP A;  3QJZ A;  2MYO A;  3KSQ A;  1E90 A;  2XS8 A;  2DIW A;  4XE0 A;  2IEJ A;  3NOC D;  3FU0 A;  3J5P A;  3B7U X;  4GU5 A;  3FUH A;  3UI2 A;  1TNO A;  3RIB A;  3FTY A;  1JWF A;  4JPS A;  1Z3Y A;  2P2C P;  2V4H C;  3HXC A;  1BI7 B;  2L0T B;  4P29 A;  3APC A;  5BUZ A;  3FTS A;  5BV1 A;  1QZ2 A;  3CKC A;  2ZIS A;  1LTX A;  3ZHE A;  2Y4T A;  3QNK A;  3APD A;  1OWO A;  2C2L A;  4JL0 A;  2OVB A;  3DEO A;  3L08 A;  3ML9 A;  4GYW A;  1N4Q A;  4DI3 A;  3SFY A;  2BTD A;  2LUH A;  2PM7 A;  1SZ9 A;  1MHQ A;  2GRR B;  4N3B A;  4RVB A;  4TUM A;  4BT9 A;  1DNP A;  1UN9 A;  3ULQ A;  4APO A;  2KZT B;  4OAU C;  2IJG X;  4TV3 A;  5HQ8 A;  3Q9U C;  5KCM A;  5AQB A;  1PY1 A;  2R02 A;  4F1S A;  3P1U A;  4HOS A;  5KBA A;  2JEK A;  1ZU2 A;  1N54 A;  1N4P A;  2NXP A;  4EHM A;  2KM4 A;  4BSZ B;  5CER B;  3R7R A;  3ZGQ A;  2E0I A;  4UQZ A;  2LSV A;  3ZYK A;  4J0U A;  4L7T A;  3D9J A;  5FQ7 A;  2FF4 A;  5CRU A;  3EU9 A;  2KBX A;  4M7C A;  4J8D A;  4GTQ A;  2WQH A;  3ZW3 A;  3VLD A;  4I6J A;  3FUJ A;  3EJN A;  3LVR E;  4JEH A;  2J8S D;  2EIJ E;  4HOU A;  3R9A B;  3ASF A;  4EZJ A;  1OCR E;  4JHJ A;  4QFV A;  2H6H A;  2JLB A;  4L1B A;  5EYL A;  3HVE B;  4HRM B;  2A5U A;  1KPS B;  3Q47 B;  3LPZ A;  2MRI A;  3D3M A;  2YHC A;  3URZ A;  2AW6 A;  4GAA A;  4AV7 A;  3MV2 B;  4CDM A;  1JUQ A;  5LCW C;  2GGF A;  3DBS A;  4EPZ A;  1MQS A;  3B7T A;  3W9G A;  2FI7 A;  4XEI G;  2EIM E;  1QNF A;  2B6C A;  5ENR D;  1K1A A;  5T8I A;  3SO8 A;  4ANW A;  3WXX A;  1U3D A;  4TRQ A;  3QWP A;  1RZ4 A;  4DX7 D;  5ENN A;  2XGO A;  4V3I A;  5AN8 A;  1N0Q A;  1IHB A;  3LYA A;  2ETB A;  1ELR A;  2RD0 A;  1S0P A;  5CBO A;  4TUU A;  4N3C A;  3RAU A;  4XKC A;  4F1P A;  3CVL A;  4EBA A;  1E7U A;  4HOR A;  3TWS A;  4JC8 A;  1TN7 A;  2QZA A;  4Y6W A;  2AXU A;  4WUY A;  3FUI A;  4TXR A;  3ASG A;  5BV0 A;  2V4L A;  3LDZ A;  2RG8 A;  2PL2 A;  4H7X A;  3U9W A;  4BY6 A;  4J8Y A;  1D8E A;  4A1S A;  4ZHB A;  2WB2 A;  5D0O D;  3ZXP A;  3MKQ A;  2VJ8 A;  4CDR A;  3E30 A;  4BX8 A;  5FQ6 A;  2VSY A;  4X8Q A;  3DSW A;  1LD8 A;  3MYV A;  3PUJ A;  4GPK A;  4MKT A;  4AXH A;  5M72 A;  4CRW A;  3S7F A;  5G55 A;  4HRL A;  3S7J A;  2I9C A;  3CSF A;  1YYH A;  2FEZ A;  3ZUV B;  2CG2 A;  4CEM A;  3PZ3 A;  4L9P A;  3ASD A;  4KMO A;  2BKK B;  3CHS A;  4D10 C;  1JPL A;  4IRU A;  5FQ4 A;  4BES A;  4DI4 A;  3ISM C;  3JYS A;  3Q5M A;  3G2V A;  5B1A E;  2XPI A;  2CFU A;  2VTB A;  5ENP D;  4DK5 A;  4O1P A;  3QWW A;  3SFZ A;  2R5S A;  2F0Y A;  3ZPJ A;  3ZU7 B;  3HHM A;  3N71 A;  3CHQ A;  5JJ6 A;  3NAW A;  3Q49 B;  1K3Z D;  2I1K A;  5G04 J;  4YVQ C;  4GTM A;  4BTB A;  1HZ4 A;  5FTP A;  3UM0 A;  1S70 B;  4UWG A;  2X6K A;  2F8X K;  2I6H A;  1SQM A;  3LKU A;  3IHY A;  1MX6 A;  1HH8 A;  2EIL E;  3EUV A;  1MZC A;  4J8F A;  1H0A A;  3NZS A;  2LXL A;  2KC7 A;  2WXG A;  4GA2 A;  1O1R A;  4I2W A;  2J4D A;  2WXR A;  1D8D A;  3V79 K;  1TNB A;  3SFX A;  1N4S A;  5CBN A;  2WXQ A;  4CT0 A;  2WPV A;  3TWR A;  4NIK A;  4XX5 A;  4GMR A;  3B7B A;  4GZD A;  1E8X A;  1N11 A;  2XEV A;  3TWV A;  2FO7 A;  4K5A B;  2OCC E;  4IYP A;  3T5X A;  3TG5 A;  3APF A;  5FZQ A;  3AG1 E;  3FTX A;  1YCS B;  2E2E A;  4AOF A;  3AG2 E;  4GTP A;  4CZ2 D;  3RSE G;  2XEN A;  3JXJ A;  3AS4 A;  5DBK A;  4JHR A;  3AS5 A;  1IKN D;  4Y6C A;  4KVO A;  5BXU A;  3I4R B;  4IN3 B;  5CCL A;  1HS6 A;  1OCZ E;  5E75 A;  4MS6 A;  4YVO A;  5JJ7 A;  2OV8 A;  2XGM A;  3FU3 A;  3RRU A;  1BU9 A;  3CVU A;  2XHE A;  4I2Z A;  4ACL A;  1X81 A;  4LRZ A;  4RSY A;  1WDY A;  4L23 A;  4IUL A;  5C1D A;  2X6F A;  2F8Y A;  5EDS A;  1V55 E;  3ML8 A;  3FU6 A;  1N0R A;  4G23 A;  4UUC A;  3U66 A;  4K5C A;  2QYJ A;  3IKO B;  2HM8 A;  4LNG A;  4JA9 A;  1TN6 A;  3X2Q E;  5HI7 A;  3EDT B;  3DPY A;  5BT1 A;  5ITZ F;  3TXM A;  3Q78 A;  4CT4 A;  2ZIR A;  3CVW A;  1HU3 A;  3OXL A;  2LO6 A;  1FPP A;  3AG3 E;  3UPV A;  1DC2 A;  2KZT A;  3DWL G;  2VTB B;  3EIJ A;  3FUM A;  3PZ4 A;  3QAQ A;  3FUE A;  3KAE A;  3DSU A;  4JD2 G;  2HE0 A;  3PUK A;  1YA0 A;  3AAA C;  3VTY A;  3ONL A;  3FTU A;  3SY2 A;  4N39 A;  3UIO C;  3R7Q A;  3J5Q B;  3S2A A;  5CRV A;  1OWL A;  2AXV A;  3OXF A;  4I9E A;  4CCA A;  2VSN A;  2WM9 A;  4UWL A;  2CHZ A;  3UM2 A;  3RU0 A;  2R03 A;  3UMV A;  4GCO A;  2OVF A;  1NA3 A;  2XS1 A;  1E7V A;  3WG7 E;  1MX2 A;  4N2Q A;  4U95 D;  3E4B A;  3RJV A;  2IFU A;  3Q79 A;  4G26 A;  4AY6 A;  3NZU A;  4KXK B;  4AM9 A;  1P5Q A;  5D2M C;  2VYI A;  3SBS A;  3LS8 A;  3ABM E;  2IO3 C;  4FP7 A;  4GTV A;  2DWZ A;  1AP7 A;  3ENE A;  4HI9 A;  3JXI A;  3V31 A;  5JMN D;  3SF4 A;  3E32 A;  4KBQ A;  1N4R A;  4I6E A;  4B0Z A;  3L9T A;  3O4Z A;  2UWJ G;  3Q7F A;  3QWV A;  1H2U A;  3RK6 A;  4ME2 A;  3MCX A;  4ILG A;  5AJD A;  3RO3 A;  1TJC A;  3C3O A;  1IXV A;  2PM6 A;  2FBN A;  4YDO A;  3FFL A;  4JW1 A;  4UWF A;  4C48 B;  3HXB A;  5FWQ A;  4JHK A;  3ESL A;  2IOS A;  1QBQ A;  4N3A A;  3C72 A;  2AVP A;  2PQR A;  4U96 D;  3MA5 A;  4LER A;  4O60 A;  5E76 A;  3MV3 B;  4R7L A;  1D9S A;  5EX0 A;  3DSS A;  4AP2 A;  3FP3 A;  2WXP A;  4LEU A;  1WAO 1;  5G05 C;  1MYO A;  3PEU B;  1N9A A;  4Z68 A;  2H6F A;  3ZN3 A;  3AU5 A;  3FUN A;  3L54 A;  2WXJ A;  5EID A;  3IEG A;  1OCC E;  3ASN E;  1ZB1 A;  3PZD A;  1VDY A;  4HB5 A;  4RG6 A;  4N2S A;  3IHV A;  3JQ1 A;  5AAR A;  1OCO E;  3ULY A;  1FVF A;  4B93 B;  3ZRH A;  3QKY A;  4FA6 A;  3BG0 B;  4NAC A;  4B89 A;  2B0O E;  1OXJ A;  4A3T A;  5AAO A;  1V54 E;  3Q75 A;  1HE8 A;  4OAV B;  3GZ1 A;  2J9Q A;  1O1S A;  2BED A;  3ZKJ A;  5LX8 A;  2A5E A;  2AJA A;  5AYW D;  3VLF A;  3PE3 A;  2Y3A A;  1MX4 A;  2CG3 A;  5KNG A;  2IQC A;  1ZBP A;  4FHJ A;  4BSX A;  1EPU A;  3Q7A A;  3AJI A;  4F53 A;  4TXQ A;  1U2V G;  4DLQ A;  3CVY A;  4UWK A;  1Q2Z A;  3UT8 A;  2L9B A;  2Q7F A;  4A63 B;  1N94 A;  2QY7 A;  2QC9 A;  5B3S E;  3MX3 A;  2V5F A;  4CGW A;  2ION A;  5AIJ A;  4K0R A;  4UWH A;  4L2L A;  3FDH A;  1A5E A;  4GA1 A;  4FC8 A;  1EYH A;  4U8H A;  4HS2 A;  5AEN A;  5FIN A;  5BNW A;  3HXF A;  5ENT D;  5KJM A;  4B94 A;  4MRU A;  1K8K G;  2EQX A;  2P9P G;  3V2O A;  2HO1 A;  1NL4 A;  2C0M A;  4EQF A;  2KAT A;  3AS8 A;  3DEP A;  5HRY A;  4LSZ E;  3HXD A;  4WAF A;  2RFM A;  4BT8 A;  4FJY A;  3SGH A;  1TR4 A;  1E8Y A;  5A7D B;  4BTA A;  1NP7 A;  3JCK C;  1E8Z A;  4U0Z A;  2ZGG A;  3PDN A;  4GMJ A;  3SD5 A;  3TG4 A;  1UJJ A;  2GW1 A;  4ILH B;  3HIZ A;  2ZGD A;  4UQX A;  3L82 A;  4GTT A;  2NSZ A;  3FHE A;  2R59 A;  5KJN A;  2WXF A;  3B95 A;  1PAQ A;  3EU5 A;  1WM5 A;  3T8M A;  3NB2 A;  5ANL A;  4PS8 A;  1RW2 A;  2EIN E;  3FWV A;  3QK0 A;  5C2Y A;  5LFA A;  2WQ7 A;  4L2Y A;  3SNX A;  4UI9 C;  3D9I A;  1HXI A;  3SHF A;  4BER A;  1YMP A;  3QC1 A;  3CEQ A;  2XZT G;  5AQA A;  1A17 A;  2R17 C;  3TWW A;  2KCV A;  2GRM A;  4FUL A;  1HX8 A;  4HVB A;  4ANV A;  5LCW J;  1HG5 A;  4BFR A;  3CV0 A;  3ZIM A;  1TEZ A;  3Q9N C;  3UTM A;  5DIZ A;  1IYG A;  5ARG A;  4EEC A;  5KJK A;  5AJL A;  3HYM B;  2Y0B G;  1KLX A;  1OY3 D;  3CVX A;  1JCS A;  4J8S A;  4JB8 P;  4OYS A;  1HO8 A;  3Q15 A;  5G04 C;  3HVE A;  3UT4 A;  5BXO A;  2Y4U A;  3UXG A;  1G3N B;  4WWN A;  3CHP A;  3ONK A;  2WXL A;  1FT1 A;  3ESK A;  2H6I A;  3U64 A;  3ABL E;  2J49 A;  3MKQ B;  3I4G A;  2LSU A;  3D9N A;  1SA5 A;  2C0L A;  5FZR A;  5CMY A;  3JUE A;  5JHB A;  3TL5 A;  3QB2 A;  3GZS A;  1H6P A;  1OWN A;  3TAX A;  3OAW A;  4GML A;  2LNI A;  3B13 A;  3RRN B;  3C98 A;  3CHR A;  3T8K A;  3UIP C;  1N52 A;  3LY7 A;  3EHR A;  4ATG A;  3G2U A;  4Q69 A;  3TJP A;  4GYY A;  3ZYL A;  1OWM A;  2V5Q C;  4YDE A;  4G8L A;  5D0Q D;  3VLE A;  4WND A;  2GRQ B;  2VQ2 A;  4DX1 A;  3FTW A;  3BU8 A;  2KCL A;  2L6J A;  2XGS A;  2VGY A;  2I1J A;  2P58 C;  2V0P A;  2V8S E;  3IV0 A;  4K03 A;  3GYZ A;  3MGB A;  3UX4 A;  4NQ0 A;  2LAH A;  4C9B B;  4LNU D;  4A1G A;  3O48 A;  3G2S A;  3EHN A;  4U8V D;  3KSL A;  4JVS A;  4M3O A;  2CFZ A;  5CHE E;  2WVI A;  3PRE A;  4GTO A;  1NI1 A;  2P9K G;  4KYO B;  1MJ0 A;  1BI8 B;  3D9O A;  2VSO E;  3LEW A;  2VGE A;  1H2T C;  2RFA A;  3LJ3 A;  3CVQ A;  4DX6 D;  5EN5 D;  2L0I A;  4UQY A;  2XZD G;  5EX3 A;  4TXP A;  3FY4 A;  3QDN A;  4RLY A;  3D9M A;  4UI9 J;  1EF1 C;  3P2B A;  4J6I A;  4ZFH A;  1KZO A;  2IOL A;  3T9K A;  3DPD A;  1INZ A;  4URK A;  4JZY A;  1KT1 A;  3F6Q A;  4PDX A;  2P9U G;  1BPO A;  1XNF A;  2KCK A;  3V2X A;  4KT6 B;  4Q94 A;  2X6H A;  3S7D A;  3L6A A;  3CVV A;  3PEV B;  5EYP F;  5BW8 C;  5H7P A;  3CHO A;  4LG6 A;  2H6G A;  5T3R A;  2FUL A;  3BUA A;  3FH8 A;  1Z3X A;  3FTZ A;  3KEA A;  4DLO A;  4EBA G;  1LD7 A;  2OOE A;  4U0U A;  2J07 A;  1H2V C;  3NF1 A;  1K1B A;  4DJA A;  2WXM A;  4HNA D;  4JXT A;  3LVQ E;  4DUI A;  4PH4 B;  1UN8 A;  2CHW A;  4GPM A;  5A6C A;  5AQ7 A;  4I6G A;  2DYR E;  1S64 A;  4E85 A;  4GZ5 A;  2M63 A;  4EZL A;  2AXZ A;  2Y1L E;  3SI5 A;  3PVL A;  2X6J A;  3TWX A;  4XI9 A;  2R05 A;  3BQO A;  4HI8 A;  4I1O B;  3CHM A;  5J08 A;  3NQP A;  1LF8 A;  3BG1 B;  4AVX A;  4HXI A;  3ULE G;  4KZC A;  2XRZ A;  2WMO A;  1XGW A;  4OVV A;  1BD8 A;  3G2W A;  5D66 A;  1O5M A;  3D9K A;  2WXO A;  5EIL A;  1H19 A;  4G2V A;  1HG2 A;  4GTS A;  1DCQ A;  1IHG A;  2P9I G;  4CDN A;  2CHX A;  1OT8 A;  3KEZ A;  3D9P A;  4YDW A;  1HF8 A;  3E34 A;  1OWP A;  5CEA A;  3TWU A;  3DST A;  3UKU G;  4U04 A;  3KS2 A;  2P9L G;  4BET A;  3CVN A;  4PS3 A;  5ARF A;  4F7A A;  4WNF A;  3TWT A;  5HKP A;  2PZI A;  3UIN C;  1U3C A;  2J08 A;  1Y8M A;  3CVP A;  4JA7 A;  3CK8 A;  4RG9 A;  1E96 B;  2WMN A;  2Y69 E;  3FTV A;  2BKG A;  4GZ6 A;  1SW6 A;  4XZ4 A;  4I1A A;  3ZVV A;  3EIQ C;  1B89 A;  4O1O A;  2EIK E;  2DVW A;  2J09 A;  4LUN U;  4AJW A;  3LCA A;  4KZ0 A;  2X6I A;  1DVP A;  3B7S A;  3PZ1 A;  5LOZ A;  3SZ7 A;  1QYM A;  5ENS D;  4CYM D;  1JCQ A;  4AEZ C;  4BWR A;  2IO2 C;  5CEC B;  4PUC A;  2YIN A;  4C0E A;  3T5V A;  4YND A;  4HRN A;  1W3B A;  1QQE A;  4F3V A;  3OTN A;  2LXM A;  1KT0 A;  3L22 A;  5LP0 A;  4U07 A;  2XEE A;  3S7B A;  4LCT A;  2GRN B;  4GZ3 A;  5B1B E;  4FHK A;  3IXE A;  4F6R D;  3G2T A;  4Q96 A;  2KXP C;  4FU3 A;  3MKR A;  2DZN A;  2UY1 A;  3SBT B;  4W9R A;  2HR2 A;  4I17 A;  1O1T A;  4APF A;  2XQ0 A;  4EZK A;  1TN8 A;  2PNN A;  2YNQ A;  4G11 A;  3ABK E;  5ENQ D;  3E33 A;  4UI9 K;  4GCN A;  3CR3 A;  1TNU A;  3C3Q A;  2XPY A;  4G25 A;  1UG3 A;  3TXN A;  3HXE A;  4HLL A;  3FEY A;  2WXN A;  4NUR A;  3RRM B;  5J90 A;  4FAD A;  4XKB A;  3I3N A;  2HYZ A;  2XPZ A;  4HBD A;  4HFG A;  4J7W A;  3MEK A;  4ANX A;  1TYQ G;  3FUK A;  3ASH A;  3KD7 A;  2XEH A;  4J8E A;  2BF0 X;  1Z5S C;  4GYO A;  2ZXW E;  3B7R L;  3EHM A;  1S63 A;  2AWI A;  3GZ2 A;  3LXU X;  4BX9 A;  3V30 A;  3UM3 A;  4MLP A;  1TJF A;  3NOG D;  3TWQ A;  1WG0 A;  3W9F A;  3CKB A;  4N5Q A;  2FO1 E;  1JCR A;  3CQC B;  2YHE A;  4FLH A;  5CCM A;  4OVU A;  1H6O A;  3HG0 D;  4GTR A;  4LNB A;  2NC9 A;  5FIO A;  4U7E B;  3DSV A;  3PH0 C;  1N95 A;  3UT7 A;  3ZHE B;  1UW4 B;  4DPR A;  2DBA A;  5FQ8 A;  2L6B A;  4A55 A;  4JEU A;  2XRY A;  3UM1 A;  2J4B A;  4GB9 A;  5KNH D;  1FCH A;  3DXK G;  1EDU A;  3OXG A;  3CST A;  1PC2 A;  2PQN A;  3D9L A;  3CLJ A;  4XI0 A;  3R9M A;  3PZ2 A;  3CGH A;  3CK7 A;  4HLE A;  1Y6I A;  3IBE A;  3UUX A;  2NYJ A;  5FZS A;  4DX5 D;  2GRP B;  4I1M A;  2IF4 A;  4HQD A;  1IQR A;  4ILI A;  5KJL A;  5G2N A;  4YDY A;  5T4Y A;  3LY8 A;  3UKR G;  2RKK A;  3HRA A;  5G05 J;  2P9N G;  5AQ9 A;  2QFC A;  1TNY A;  4WWO A;  1H6K A;  2I2O A;  2YQ8 A;  4N5C A;  4G24 A;  4O6F A;  2X38 A;  2VSX E;  3QAR A;  2ETA A;  1OUV A;  3PRZ A;  4FJZ A;  5A23 A;  3FEX A;  4BEP A;  2X3M A;  4CGV A;  1ELK A;  4GZC A;  4U8Y D;  3ZYQ A;  4AIF A;  4K5B A;  2WXK A;  1L5J A;  5ANR A;  5HS0 A;  1NFI E;  2GRL A;  4C0M A;  3RKV A;  2ILR A;  5FJY A;  1FT2 A;  5FT9 A;  5JJT A;  1NZN A;  3ZEF A;  2LAI A;  4XIF A;  4WNE A;  4HOT A;  1DCE A;  3CK9 A;  2IU1 A;  3AU4 A;  1Z6T A;  1IQU A;  4PS7 A;  3LJN A;  3MZL B;  4RQI A;  3ZXS A;  2OEV A;  4AY5 A;  3TGO A;  1JWG A;  2ETC A;  2BUG A;  4U0S A;  3L16 A;  4MBG A;  4ATZ D;  2A4Z A;  3NBN B;  3LY9 A;  3MJW A;  5JHA A;  3CQG B;  1UOH A;  3L13 A;  3PS6 A;  4ANU A;  3PE4 A;  3L17 A;  4WNG A;  3E37 A;  2UY1 B;  4ABN A;  2ZU6 B;  4HOQ A;  2MOW A;  1ELW A;  1BLX B;  3BEE A;  1SA4 A;  1UJK A;  1WY6 A;  3VTX A;  2GRO B;  3FUD A;  3Q73 A;  5EIB E;  5ENO D;  3CIA A;  3PNT B;  3RO2 A;  2WQ6 A;  3FH5 A;  3U3W A;  2QYU A;  2DCP A;  4H7Y A;  1KZP A;  2VGX A;  1SZA A;  2OND A; 
#chains in the Genus database with same CATH homology
 2XEE A;  3HG0 D;  4Z68 A;  1A5E A;  2P2C P;  5CED B;  4BET A;  3J5Q B;  2V4H C;  5FIO A;  3TWS A;  3D9H A;  1BI7 B;  1IKN D;  3Q9N C;  4DRX E;  3TWT A;  3UTM A;  5JA4 D;  3IXE A;  4F6R D;  5EID A;  5HKP A;  3ZU7 B;  1K1B A;  5BXU A;  1AWC B;  2KXP C;  1MX2 A;  2Y0B G;  4HNA D;  5FIN A;  4U95 D;  2L6B A;  1OY3 D;  2J8S D;  4LNU D;  1K3Z D;  2DZN A;  5ENT D;  4DUI A;  5KNH D;  4GPM A;  4HB5 A;  4JB8 P;  5AQ7 A;  4U8V D;  4QFV A;  3V2O A;  1BU9 A;  1S70 B;  2F8X K;  4J8Y A;  5EYL A;  1MX6 A;  4ZHB A;  3LJN A;  1WDY A;  2PNN A;  2BKG A;  3DEP A;  1MJ0 A;  1BI8 B;  1SW6 A;  5HRY A;  5AAR A;  2DWZ A;  4HRM B;  1G3N B;  3UXG A;  5BXO A;  3DEO A;  1AP7 A;  4LSZ E;  4HI9 A;  2ETC A;  2Y1L E;  5KWD A;  5ENQ D;  2VGE A;  2F8Y A;  2NYJ A;  3JXI A;  4G8K A;  3V31 A;  4B93 B;  3TWX A;  5JMN D;  4DX5 D;  2RFM A;  2RFA A;  4O1O A;  4ATZ D;  4DX2 A;  4HI8 A;  4DX6 D;  1N0R A;  5EN5 D;  3NBN B;  4UUC A;  2DVW A;  4HQD A;  1TR4 A;  1SVX A;  4HLL A;  4K5C A;  2B0O E;  2QYJ A;  4TUM A;  3V79 K;  5AAO A;  4YDY A;  2XZD G;  1UOH A;  3ZNG A;  4OAV B;  3EHQ A;  2ZGG A;  5CBN A;  3HRA A;  3ZKJ A;  4OAU C;  4RLY A;  2DZO A;  4HBD A;  4J7W A;  3JUE A;  1QYM A;  3TWR A;  5ENS D;  3W9G A;  2A5E A;  4NIK A;  2AJA A;  5AQ9 A;  4ZFH A;  2ZGD A;  4CYM D;  5ENR D;  1K1A A;  3Q9U C;  1IXV A;  4HRL A;  5AQB A;  1BD8 A;  5D66 A;  3SO8 A;  3T9K A;  2XEH A;  4QQI A;  5EIL A;  5ITZ F;  3B95 A;  4GMR A;  1BLX B;  1MX4 A;  3B7B A;  1YYH A;  4DX7 D;  5KNG A;  5KBA A;  1N11 A;  3TWV A;  5CEC B;  3AJI A;  5AN8 A;  3ZUV B;  5EIB E;  1DCQ A;  5ENO D;  4K5A B;  1N0Q A;  3F6Q A;  2ETA A;  4BSZ B;  4C48 B;  3T8K A;  1OT8 A;  2F37 A;  3V30 A;  5CER B;  1DC2 A;  1IHB A;  3EHR A;  2JAB A;  3C5R A;  3V2X A;  2BKK B;  3NOG D;  2ETB A;  4U96 D;  4BEP A;  2MYO A;  3TWQ A;  4A63 B;  1WG0 A;  4YDW A;  4BES A;  4HRN A;  3W9F A;  2QC9 A;  5EYP F;  4BER A;  3NOC D;  4O60 A;  4U8Y D;  1YCS B;  4N5Q A;  5CBO A;  3J5P A;  4K5B A;  5CEA A;  2V5Q C;  2FO1 E;  1YMP A;  3TWU A;  1D9S A;  4LG6 A;  2HE0 A;  2XZT G;  3UI2 A;  5HS0 A;  4G8L A;  5AQA A;  1NFI E;  3AAA C;  3EU9 A;  4CZ2 D;  4F1P A;  2XEN A;  5ENP D;  3JXJ A;  1MYO A;  2KBX A;  4DX1 A;  3TWW A;  3KEA A;  4O1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...