3RRUA

X-ray crystal structure of the vhs domain of human tom1-like protein, northeast structural genomics consortium target hr3050e
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
b'DPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOM1L1 protein
publication title X-ray crystal structure of the VHS domain of human TOM1-like protein, Northeast Structural Genomics Consortium Target HR3050E
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 44
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rruA00
1JUQA 2KM4A 1VDYA 3D9IA 1ELKA 5CMWA 1XGWA 5J08A 4GZDA 1JWFA 3D9LA 3G2WA 1INZA 3D9KA 2MOWA 2DCPA 3ONLA 4HFGA 1JPLA 5LOZA 4Q96A 3ZYMA 4NACA 1PY1A 4Q94A 3D9MA 1HX8A 1UJJA 3ZYLA 4JXTA 2QY7A 2V8SE 2L0TB 3ZYQA 4GZCA 4FLBA 5LP0A 3D9PA 3D9JA 1HF8A 3CLJA 4FU3A 5CMYA 3G2SA 1SZ9A 1X5BA 2DIWA 1JWGA 1UJKA 3RRUA 3D9NA 1EDUA 2LO6A 3ONKA 3D9OA 4AVXA 2L0IA 1LF8A 1HG2A 3LDZA 1EYHA 3ZYKA 1DVPA 2BF0X 3G2VA 3G2TA 3G2UA 1MHQA 1HG5A 1HFAA 1SZAA 1H0AA
chains in the Genus database with same CATH superfamily
3DWLG 4CT0A 3QKYA 3ZHEA 5BXOA 2WXHA 4U63A 2F37A 3X2QE 5C1DA 3NB2A 1IHGA 3KSLA 3I5PA 1TNOA 1DC2A 4CYMD 1FVHA 5AIJA 2M63A 4CRWA 1H2VC 2Y69E 1ELKA 4GZDA 2WXKA 3QOUA 5J90A 5G04C 5E75A 2VTBB 4E6HA 3DSTA 3HXFA 4UQXA 1OUVA 5ANLA 1HF8A 2H6FA 3CKCA 4BERA 2P9UG 4G11A 3G2VA 1X81A 3CVLA 1TN6A 4RSYA 4APOA 3UXGA 3B7BA 3PEVB 4FJYA 3I4GA 3APFA 1HX8A 5G55A 4LNBA 4DLOA 4YDYA 4CCAA 4IN3B 3DSVA 4JEHA 2XS8A 5KCMA 4A1SA 5EKQD 2AWIA 3SQVA 1KT0A 1IKND 3UT8A 3JYSA 2FF4A 2B6CA 3SY2A 3MKQA 2YNQA 4OVUA 4RG9A 3TL5A 2C0MA 4GCOA 3CSFA 1HE8A 4TXRA 4V3IA 4HVBA 3MGBA 4M7CA 2I2OA 3WXXA 2P2CP 1N4SA 3D9KA 5EYPF 2DCPA 5FJYA 3ZYMA 1A5EA 2Y0BG 5B1BE 2JLBA 4G8LA 5ENRD 3NF1A 1WY6A 4U96D 4D10C 1OWOA 2XPYA 3EHRA 5J08A 1MX2A 5D0QD 4RQIA 3V2XA 3KS2A 4CDMA 2GRPB 4B89A 5C2YA 3UI2A 3CVPA 2DZOA 3DEPA 4YDEA 3GYZA 2J07A 4AY5A 4HOQA 3KEZA 3CQGB 4EZJA 1QNFA 4C0EA 3LKUA 1AP7A 4C0MA 5FT9A 2AXZA 2X6JA 4WUYA 2IONA 4EHMA 4FC8A 1E7VA 2IO2C 4GTOA 3DEOA 3L54A 3L9TA 4J7WA 2YQ8A 5AQ7A 4DX5D 3LJ3A 4AVXA 3KD7A 4DPRA 5ENNA 1VDYA 4H7YA 1H6OA 2V4LA 2J4BA 4HOUA 3OXGA 4M3OA 4OAUC 4BTAA 4CZ2D 2QYUA 1U2VG 4I9CA 4FHJA 5BXUA 2CHXA 1SVXA 3ASHA 5CHEE 1OXJA 3Q7FA 1HG5A 3HIZA 4HQDA 5AQAA 3T5VA 3AS5A 5KJMA 3NQPA 4LG6A 2OEVA 2VSXE 2WXOA 1UN8A 4JHRA 5FTPA 4ANVA 2IFUA 3ZUVB 4G1TA 4H7XA 1O1RA 2KCLA 5B1AE 2EIKE 1IXVA 2Q7FA 4UQZA 2WXRA 3E37A 3PZ2A 4GA0A 1H19A 3UIPC 4YVOA 4I6EA 5EX0A 5EN5D 3Q9NC 4O6FA 3AS8A 4XIFA 2LO6A 3NBNB 1MJ0A 1NL4A 3PS6A 2YHCA 2KXPC 3B13A 1MHQA 3TAXA 3ABME 3FWVA 4GMLA 5ENOD 4OVVA 3N71A 3IKOB 4WAFA 5AARA 4N2QA 4YNDA 3CK9A 4N3AA 3ZNGA 2KZTA 3PZ1A 4RLYA 3OXFA 5A23A 3EU5A 4GMJA 1JWFA 1KLXA 3CVWA 3PE3A 3AU4A 2H6GA 4GAAA 1NFIE 2AXUA 3ISMC 5A6CA 3FH7A 3QAQA 4ABNA 1KT1A 3C72A 1Q2ZA 2F8YA 3W9FA 3NZUA 1HU3A 4GYWA 3B7TA 4I1MA 3SBTB 4JA7A 2EINE 3LYAA 2XZTG 3CVQA 3APCA 4JC8A 4PUCA 3O4ZA 1D8DA 2VTBA 4KT6B 5KBAA 2XENA 3VLEA 2MRIA 3RRNB 3LEWA 4JL0A 3L13A 3SZ7A 5JJ6A 3CHRA 3ENEA 3TWQA 3FY4A 2WXQA 4OYSA 4NQ0A 1SA5A 1QYMA 3PDNA 1YA0A 3LY9A 2H6HA 4FJZA 4XKCA 4HRLA 4GTSA 2ETAA 2L6JA 4JD2G 4F53A 3TXNA 2VYIA 3ASDA 4TXQA 1KZOA 4LSZE 3JXIA 1BLXB 4G25A 1OCZE 1LF8A 1DVPA 2VJ8A 3ASOE 3KEAA 4WNGA 2XRYA 4LERA 2ZGDA 5G04J 4ME2A 3E33A 3HHMA 3FDHA 5CBOA 1PY1A 1PC2A 2QFCA 4GTPA 1Y6IA 3SGHA 4I17A 3EU9A 5ENSD 2XCCA 5EIDA 3OXLA 1U3CA 2VSNA 4DRXE 1MYOA 3FU5A 4ATGA 3PRZA 1TNBA 2L0TB 3Q79A 4DX6D 3LDZA 2WVIA 3ULYA 1ZBPA 3W9GA 2XGSA 3SI5A 3SFZA 5FZSA 4N5CA 1TR4A 3D9MA 4UWFA 4BSZB 3UX4A 1MQSA 4FA6A 4FADA 2AXVA 2AW6A 2WXFA 3SF4A 3UT7A 1OT8A 4GYYA 4BETA 2R17C 3CGHA 4WWOA 2FBNA 1UJJA 3SFYA 5EX3A 1LD8A 1A17A 2WXIA 4U0ZA 1Z3YA 4HFGA 3HXEA 3B7UX 5KNGA 1O1TA 4I1AA 3ZPJA 5DBKA 5G2NA 3S2AA 3DXMG 3D9OA 4GU5A 1LD7A 4U0UA 1EYHA 1Z3XA 2I1JA 5HI7A 1HFAA 3FUJA 5CMWA 1TNYA 4BTBA 5EYLA 2J09A 3CLJA 4PDXA 2J49A 2P9LG 4JHJA 2KCKA 1EPUA 2MHKA 1HO8A 3S7BA 4ZHBA 2FI7A 5ENTD 5AJLA 3D9IA 3FTVA 4F3VA 3PZDA 1TNUA 2X38A 3FUKA 3MYVA 5CEDB 3L08A 3TJPA 4U04A 2DIWA 1OWLA 2YINA 3RKVA 1V54E 3RO3A 1NZNA 4CDNA 3C3RA 4GB9A 1MZCA 2KC7A 4MKTA 3GW4A 4HS2A 3JUEA 4HOSA 3DBSA 3FUFA 4AOFA 3D9HA 3LCAA 4HRMB 5FQ8A 4J6IA 4DK5A 1QBQA 3J5QB 2XZDG 3C3QA 4KBQA 2WQ7A 1KZPA 3LXUX 2LUHA 5FZQA 3CK8A 2F0YA 1SQMA 3FUDA 3ZU7B 5LCWJ 4RG6A 1UN9A 5JHBA 2A5UA 1S0PA 3SBSA 3UM1A 1V55E 3J5PA 4BX9A 3IXEA 1JCQA 4U95D 2CG2A 2ILRA 3RAUA 2WXGA 4F7AA 4GZ6A 3EIQC 2LXMA 2UY1B 3CHPA 3MKRA 4Z68A 2WMOA 4U0SA 2NSZA 1RW2A 3EHNA 4N3BA 3RK6A 3AS4A 2FEZA 5M72A 2B0OE 2P9IG 3LY8A 4JB8P 3R9MA 3B7RL 2P58C 1N94A 3NOGD 1S70B 4U07A 3PNTB 1L5JA 3CR3A 5DIZA 2IY0C 2XGMA 4PS3A 5BW8C 2FO7A 2VQ2A 3MV2B 4DX2A 2EIME 2GW1A 3P1UA 2I9CA 3Q4AB 4B94A 4L23A 2C2LA 3FU0A 3F6QA 2BEDA 2LNIA 2KBXA 3G2TA 1FT2A 2VGYA 1INZA 2ZISA 5AAOA 2GRNB 2GGFA 3UM3A 2XHEA 1NA3A 2BKGA 3CHOA 3GZSA 3NAWA 1K1BA 2CFZA 3BG1B 4GTMA 4L9PA 2Y4UA 2RKKA 3LY7A 4W9RA 4IRUA 1N54A 2WXJA 2GRLA 2J8SD 4HRNA 4L7TA 3MCXA 3Q7AA 3MX3A 2PL2A 3ML8A 3S7FA 4G2VA 3PZ3A 4GTQA 2CG3A 4I9EA 2QYJA 3GZ2A 4JVSA 2KCVA 4BT9A 3GZ1A 1BI8B 5CBNA 3U66A 3CSTA 2ZIRA 1E8WA 5JMND 2R5SA 1JPLA 3DPYA 3NOCD 4Q94A 3RRMB 1UG3A 3UKUG 2QY7A 5LP0A 3L22A 3LVRE 2R02A 3ML9A 2Y4TA 3T5XA 2CHWA 1DNPA 5CRVA 5CECB 2ZXWE 4KZCA 3HVEB 2XEEA 3HDXA 2MOWA 3ABKE 2HE0A 3Q9UC 5EILA 3JQ1A 3Q78A 4NURA 1E8XA 1UW4B 3ZXPA 5KJKA 4K5AB 1N52A 4EBAG 2KM4A 4Y6WA 5JJ7A 2IEJA 3PREA 4XX5A 3TWTA 3APDA 4ATZD 2OVBA 3Q73A 3LS8A 3UM0A 3T8KA 4KYOB 3JUIA 5AENA 3TWRA 4GA2A 3LVQE 4YDOA 3FH8A 3R7RA 5CCLA 3FUIA 3AG2E 3E30A 2HYZA 4CT4A 3IHYA 3ASNE 4JXTA 2WMNA 3FTWA 4JZYA 3ASFA 2A5EA 5FIOA 3DPDA 3FTUA 1TYQG 3BEEA 2PNNA 2FO1E 4EECA 5FINA 3FULA 3QNKA 4KVMA 4CEMA 4CGVA 3ZKJA 3UMVA 4XZ4A 1MX4A 4L2YA 4BX8A 2ONDA 3V2OA 4EQFA 3TGOA 1E8YA 2DYRE 3DSUA 5HRYA 2RD0A 4A3VA 3RJVA 2R03A 3HYMB 1AWCB 3O48A 5BNWA 2DBAA 3UTMA 3FUEA 2ETCA 3QWWA 3C3OA 2XCBA 4DX7D 3JXJA 4O1PA 4GCNA 2C0LA 2J4DA 1N4RA 4HI9A 4UWKA 4GYOA 4O60A 3B7SA 1Y8MA 3AU5A 2WM9A 5FQ4A 3UUXA 2UY1A 2IQCA 5AQ9A 4GPMA 3EIJA 1N9AA 2HR2A 4MS6A 4HBDA 1N0QA 3CK7A 1D8EA 2IOSA 1S64A 1JWGA 3BG0B 1B89A 4KVOA 5CRUA 4L2LA 4UI9C 2OEWA 3Q47B 3NZSA 4GZ3A 3PE4A 3ZGQA 5EDSA 4LNUD 3ZXSA 3ZW3A 1K1AA 3PUKA 4J8EA 4FHKA 4MRUA 4K5BA 5BV1A 3D9NA 4AEZC 2L0IA 4HLLA 2JEKA 4XKBA 3FFLA 1D9SA 3MV3B 3PUJA 4J0UA 3QK0A 4E85A 2BUGA 4BSXA 3L6AA 4FLBA 3D9PA 5ANRA 1UJKA 2OVFA 4UWLA 4G24A 3TXMA 1O1SA 3FP3A 2L6BA 4FP7A 4AJWA 2RFAA 1H0AA 5HS0A 2BKKB 5AJDA 2IU1A 3PVLA 2PM7A 2R05A 3U3WA 1O5MA 2P9KG 3SO8A 5D66A 4HOTA 3SNXA 4URKA 3RU0A 1JCSA 1HXIA 2IO3C 2WB2A 1SZAA 3ZN3A 1E90A 4EBAA 3FUNA 2XGOA 5E76A 3OAWA 3L17A 3FU6A 3ZRHA 2ETBA 3FU3A 5AYWD 4N2SA 1K3ZD 3JQ0A 5ARFA 1N95A 4I43A 3IV0A 3PZ4A 4YDWA 2YHEA 4K03A 3TG5A 1TN8A 4I2ZA 3CVUA 3HVEA 3Q5MA 2DVWA 1BU9A 3S7DA 2VGXB 3QJZA 1TEZA 2GROB 5JJTA 1NI1A 3DSXA 4B8CB 3T8MA 3TWXA 1OWPA 3HG0D 1ZU2A 2X3MA 1NA0A 2X6KA 5ENQD 3ASGA 4JHKA 1G3NB 3CKBA 5CMYA 4WWNA 4K0RA 3SHFA 3UINC 5T3RA 2KATA 4XEIG 3EUVA 4TUMA 4AV7A 2QZAA 1SW6A 3TWSA 2WXLA 1RZ4A 3EDTB 3E32A 1WM5A 5ARGA 3CHQA 4U8VD 4WNDA 3L16A 4DUIA 2RG8A 4N39A 3U64A 3UQ3A 5T8IA 3DSWA 1U3DA 1P5QA 1BD8A 4LUNU 2BF0X 3Q15A 4AXHA 3CHMA 3FTZA 3RIBA 3FTSA 2E2EA 2XEHA 2HM8A 5FZRA 1NP7A 3RRUA 2P9PG 4N5QA 1N11A 3L82A 1YYHA 4TV3A 4JA9A 4HNAD 4JEUA 4QFVA 2OOEA 3VLFA 3R7QA 1ELWA 5G05C 3C5RA 4IYPA 2GRQB 2X6HA 3D9JA 1BPOA 4G8KA 3LPZA 3QB2A 2JABA 4NRHB 3PH0C 3UIOC 3IEGA 4U8HA 3ZVVA 5CEAA 2WXNA 3ZYQA 2V8SE 5FQ6A 4MLPA 4ILIA 1OCCE 2EQXA 2V4HC 4TUUA 2ZU6B 3LJNA 3BUAA 1W3BA 4XE0A 2V5QC 4EZLA 4HLEA 5ITZF 1FCHA 4I2WA 3ONLA 3TWUA 4DI3A 4EZKA 4KXKB 4R7LA 1GW6A 5LX8A 4I6GA 4TXPA 3K9IA 2A4ZA 1DCQA 3RO2A 1EF1C 4BFRA 2FULA 2E0IA 3UT4A 5KNHD 4IULA 1H6KA 1H6PA 3MEKA 4UWHA 3HXCA 4A1GA 3MJWA 4DLQA 2WPVA 3G2UA 3RSEG 3BU8A 3IBEA 2XS1A 4ILGA 4XI9A 4BWRA 5HQ8A 3P2BA 5BUZA 1DCEA 1XNFA 2LAIA 4QQIA 2BTDA 4I6JA 2LSUA 2XQ0A 3ONKA 1N0RA 3URZA 4B93B 2V5FA 3ZEFA 5FWQA 3FUHA 3QARA 4FU3A 3CIAA 2XEVA 2XPZA 3V30A 3ZIMA 3TWWA 4O1OA 1QZ2A 3QWPA 1KPSB 2IOLA 1IQUA 4AP2A 2HO1A 4ANWA 2DZNA 4UI9J 2OV8A 3WG7E 4Y6CA 2PQNA 3I3NA 4DI4A 1IYGA 3U4TA 1SZ9A 3VLDA 5KJLA 1OCRE 3FEYA 4U8YD 1HZ4A 3R9AB 3CVVA 1N4PA 2NC9A 3D3MA 5FQ7A 1LTXA 4GTTA 4DX1A 2LAHA 4HORA 2R59A 4GMRA 4DJAA 3SD5A 5LCWC 5JA4D 5A7DB 3AG3E 3HXDA 4J8FA 1HH8A 4AM9A 1Z5SC 4C9BB 3IHVA 4GA1A 2H6IA 2Y1LE 1XGWA 2P9NG 2VGXA 3TWVA 3TG4A 5CERB 1UOHA 2V0PA 3MA5A 2ZGGA 3AG4E 5JHAA 3ZHEB 4ACKA 4A55A 1OY3D 3UKRG 3T9KA 4PS8A 5B3SE 3SFXA 5KWDA 5KJNA 3KAEA 1Z6TA 1MX6A 3PNLB 4LNGA 3QC1A 3MZLB 2PM6A 2R2LA 1YMPA 4J8DA 2UWJG 4PH4B 3FHEA 4LRZA 4PS7A 3VTYA 4A3TA 1OWNA 5LFAA 4BEPA 4UI9K 4CGWA 3VTXA 3CVXA 4EPZA 3CVYA 2XRZA 1WAO1 4RVBA 3CQCB 3ABLE 2NXPA 5HKPA 3C98A 4GTRA 4F1PA 4TRQA 1FVFA 3AAAC 3FTYA 1WDYA 4HI8A 5D0OD 4ANXA 3ZYLA 2P9SG 3CV0A 3ULEG 4G23A 4JPSA 4F1SA 3EJNA 3ZFWA 2X6IA 3MKQB 1JUQA 5CCMA 2WQ6A 4LCTA 2LSVA 3UPVA 3ULQA 4L1BA 2DYSE 3BQOA 5EIBE 3HRAA 2RFMA 4HXIA 2GRRB 1HG2A 2IJGX 2VSYA 5BT1A 2VSOE 3D9LA 4WNFA 3E34A 3EHMA 1OWMA 3QDNA 2I6HA 3PEUB 1BI7B 1OCOE 3OTNA 2LXLA 2J9QA 4J8YA 4WNEA 1ZB1A 5G05J 3JCKC 2NYJA 1WG0A 1K8KG 4NIKA 1FPPA 4C48B 1ELRA 2AJAA 3CHSA 4GZCA 2CHZA 1X5BA 1IHBA 3V31A 4CDRA 4OAVB 4GTVA 4BY6A 2WXPA 1HS6A 3FTXA 3DXKG 1FT1A 4FLHA 4WWPA 4UQYA 5H7PA 4AIFA 4Q69A 4JW1A 1TJCA 2F8XK 2X6FA 4ZFHA 3ESKA 5D2MC 4ACLA 5BV0A 4UUCA 2EILE 4J8SA 1H2UA 2L9BA 4ILHB 3ESLA 4GZ5A 4HB5A 5LOZA 3CVNA 2IF4A 4F6RD 1YCSB 4ANUA 3CEQA 1QQEA 2AVPA 4YVQC 3DRAA 2EIJE 2Y3AA 3V79K 3ZYKA 4X8QA 2J08A 2QC9A 1E8ZA 3E4BA 5ENPD 4UWGA 4KZ0A 1IQRA 1S63A 5IY5E 4Q96A 1N4QA 3DSSA 3FH5A 2CFUA 4FULA 3G2SA 3Q75A 2PQRA 3FUMA 3Q49B 1EDUA 4B8AA 4G26A 2GRMA 3QWVA 4GPKA 3EHQA 3UM2A 1E96B 4N3CA 4P29A 4BT8A 3B95A 5AN8A 5AQBA 4K5CA 5T4YA 1PAQA 3U9WA 2OCCE 2PZIA 4KMOA 4MBGA 4XI0A 4APFA 4I1OB 1E7UA 1JCRA 5BPPA 1TJFA 3KSQA 2MYOA 3FEXA 1SA4A 4B0ZA 2VGEA 3G2WA 3HXBA 2WQHA 4NACA 3AG1E 2KZTB 4AY6A 1H2TC 2XPIA 3S7JA 4U7EB 4A63B 4LEUA 2WXMA 3I4RB 1TN7A 4BESA 1TNZA 2DWZA 3AJIA 2I1KA
chains in the Genus database with same CATH topology
4ILGA 1U3CA 4XI9A 4BWRA 5HQ8A 2VSNA 3FULA 3P2BA 3QNKA 4KVMA 3QKYA 4CEMA 4CT0A 5BUZA 1XNFA 4CGVA 3FU5A 3ZHEA 4ATGA 2WXHA 3PRZA 2LAIA 4U63A 2BTDA 2L0TB 4I6JA 3UMVA 4XZ4A 5C1DA 4L2YA 2LSUA 4BX8A 2ONDA 2XQ0A 3ONKA 1IHGA 4EQFA 3URZA 3I5PA 3LDZA 2WVIA 3TGOA 1E8YA 1FVHA 1ZBPA 2V5FA 3ZEFA 5FWQA 5AIJA 3FUHA 3QARA 2RD0A 4A3VA 2M63A 4FU3A 3CIAA 1H2VC 4CRWA 1ELKA 2XEVA 2XPZA 2XGSA 3RJVA 4GZDA 3SI5A 3SFZA 5FZSA 4N5CA 2WXKA 3HYMB 3QOUA 3ZIMA 3O48A 5BNWA 5J90A 2DBAA 5G04C 5E75A 2VTBB 4E6HA 1QZ2A 3D9MA 3QWPA 4UWFA 2IOLA 4UQXA 1OUVA 1IQUA 5ANLA 3UX4A 1HF8A 3FUEA 3QWWA 4AP2A 3CKCA 1MQSA 2HO1A 4FADA 2AXVA 4FA6A 4ANWA 2AW6A 2WXFA 3SF4A 3UT7A 2XCBA 4GYYA 4UI9J 2R17C 3CGHA 2OV8A 4GCNA 2C0LA 4G11A 3G2VA 2J4DA 4WWOA 4Y6CA 2FBNA 2PQNA 1UJJA 5EX3A 3CVLA 3I3NA 1A17A 4RSYA 2WXIA 4DI4A 1IYGA 4APOA 4UWKA 4GYOA 4U0ZA 1Z3YA 3U4TA 3B7SA 1Y8MA 4HFGA 3PEVB 4FJYA 3I4GA 3APFA 3AU5A 2WM9A 1HX8A 3B7UX 5FQ4A 3UUXA 2UY1A 2IQCA 4I1AA 3ZPJA 5G55A 5DBKA 5G2NA 1SZ9A 3VLDA 4DLOA 5KJLA 3S2AA 3FEYA 4CCAA 3D9OA 4GU5A 4IN3B 3EIJA 4U0UA 1EYHA 4JEHA 1Z3XA 5KCMA 2I1JA 1HZ4A 5EKQD 3R9AB 4A1SA 5HI7A 3CVVA 2AWIA 1HFAA 1KT0A 2NC9A 3D3MA 3FUJA 2HR2A 5FQ7A 3UT8A 5CMWA 3JYSA 4MS6A 2LAHA 4BTBA 2FF4A 3CK7A 4HORA 2R59A 4DJAA 3MKQA 2J09A 3SD5A 2YNQA 2IOSA 4OVUA 5LCWC 5A7DB 4RG9A 3TL5A 3CLJA 4PDXA 1JWGA 2C0MA 2J49A 4GCOA 4J8FA 3CSFA 3BG0B 1HH8A 1B89A 1HE8A 4KVOA 4AM9A 4JHJA 4V3IA 2KCKA 4C9BB 1EPUA 2MHKA 1HO8A 3S7BA 4HVBA 3MGBA 3IHVA 4GA1A 4L2LA 4UI9C 2I2OA 2FI7A 3Q47B 3WXXA 3NZSA 4GZ3A 5AJLA 3D9IA 3PE4A 3ZGQA 5EDSA 1XGWA 2VGXA 3FTVA 4F3VA 3ZXSA 3ZW3A 3D9KA 2DCPA 5FJYA 3PUKA 3PZDA 3ZYMA 2X38A 3FUKA 3MYVA 3TG4A 3L08A 3TJPA 2JLBA 3NF1A 4FHKA 4J8EA 4U04A 2DIWA 4MRUA 5BV1A 1OWLA 2YINA 2V0PA 3D9NA 4AEZC 3RKVA 3MA5A 3RO3A 1WY6A 2L0IA 5JHAA 2JEKA 4XKBA 3FFLA 1NZNA 3ZHEB 4ACKA 4D10C 4CDNA 3MV3B 1OWOA 4A55A 2XPYA 3PUJA 4GB9A 4J0UA 5J08A 2KC7A 4MKTA 5D0QD 4PS8A 3GW4A 3KS2A 3QK0A 4HS2A 4B89A 4CDMA 4HOSA 3DBSA 5C2YA 4E85A 2BUGA 4BSXA 3FUFA 3L6AA 4FLBA 4AOFA 3D9PA 5KJNA 3CVPA 3KAEA 5ANRA 3LCAA 1Z6TA 1UJKA 5FQ8A 4J6IA 4DK5A 2OVFA 3GYZA 2J07A 4AY5A 4HOQA 3PNLB 4UWLA 4G24A 3TXMA 3KEZA 3CQGB 3FP3A 3QC1A 4EZJA 1QNFA 3MZLB 2PM6A 4C0EA 4KBQA 3LKUA 4FP7A 2WQ7A 4AJWA 1H0AA 4J8DA 2UWJG 3LXUX 4PH4B 3FHEA 4C0MA 5FT9A 2AXZA 2X6JA 4LRZA 4PS7A 2IONA 4WUYA 5AJDA 5FZQA 3CK8A 3VTYA 4A3TA 1SQMA 1OWNA 3FUDA 5LCWJ 5LFAA 4FC8A 2IU1A 1E7VA 3PVLA 2PM7A 4RG6A 3U3WA 4UI9K 4CGWA 3VTXA 1UN9A 3L54A 5JHBA 2A5UA 4HOTA 1S0PA 2YQ8A 3CVXA 3SBSA 4EPZA 3SNXA 3LJ3A 4BX9A 4URKA 4AVXA 3RU0A 3CVYA 2XRZA 1WAO1 2CG2A 2ILRA 3KD7A 4RVBA 3CQCB 1HXIA 4DPRA 4EECA 2NXPA 2WXGA 4F7AA 4GZ6A 5ENNA 2WB2A 3C98A 1VDYA 4H7YA 1SZAA 3ZN3A 1E90A 2V4LA 3EIQC 4TRQA 2J4BA 2UY1B 4EBAA 1FVFA 3FUNA 4HOUA 3CHPA 3OXGA 2XGOA 3FTYA 4M3OA 5E76A 4BTAA 3MKRA 3OAWA 2WMOA 5D0OD 4ANXA 4U0SA 3L17A 3ZYLA 2NSZA 3FU6A 3ZRHA 3EHNA 4N3BA 3RK6A 3AS4A 4I9CA 4FHJA 2FEZA 3FU3A 3CV0A 5M72A 5AYWD 4N2SA 4G23A 4JPSA 2CHXA 4F1SA 3ASHA 3EJNA 3JQ0A 3LY8A 5ARFA 5CHEE 3ZFWA 2X6IA 3B7RL 1HG5A 2P58C 4I43A 3IV0A 3MKQB 1JUQA 5CCMA 2WQ6A 3HIZA 4LCTA 4U07A 2LSVA 3AS5A 5KJMA 3PNTB 2YHEA 3ULQA 4L1BA 3T5VA 3UPVA 1L5JA 3NQPA 3CR3A 5DIZA 2VSXE 2WXOA 2XGMA 4K03A 3TG5A 4PS3A 5BW8C 2FO7A 1UN8A 2VQ2A 4JHRA 3MV2B 5FTPA 2GW1A 3P1UA 4I2ZA 2I9CA 3HVEA 3Q5MA 4ANVA 2IFUA 3CVUA 3Q4AB 4HXIA 4B94A 4L23A 3S7DA 4G1TA 2C2LA 2VGXB 4H7XA 2KCLA 1HG2A 3FU0A 2IJGX 2LNIA 3G2TA 3QJZA 1TEZA 2VSYA 5JJTA 2Q7FA 5BT1A 4UQZA 2WXRA 2VSOE 4B8CB 3T8MA 3D9LA 2VGYA 4WNFA 1OWPA 4GA0A 1INZA 1ZU2A 3EHMA 2X3MA 1NA0A 1OWMA 2X6KA 1H19A 3ASGA 2GGFA 3QDNA 4YVOA 4JHKA 2XHEA 2I6HA 3CKBA 4I6EA 5CMYA 5EX0A 4WWNA 4O6FA 3PEUB 1NA3A 4K0RA 3SHFA 3AS8A 5T3RA 3CHOA 2KATA 2LO6A 3GZSA 3OTNA 4XIFA 3PS6A 2YHCA 2CFZA 2J9QA 4AV7A 3B13A 1MHQA 3BG1B 4WNEA 3TAXA 5G05J 3JCKC 2Y4UA 3LY7A 4W9RA 2WXLA 4IRUA 3EDTB 1N54A 3FWVA 2WXJA 4GMLA 1WM5A 5ARGA 3CHQA 1ELRA 4OVVA 4WNDA 3CHSA 3N71A 3L16A 3IKOB 2GRLA 4WAFA 4GZCA 4N2QA 2CHZA 2RG8A 4N39A 4YNDA 1X5BA 3U64A 3UQ3A 3CK9A 5T8IA 4N3AA 4CDRA 2KZTA 1U3DA 1P5QA 4L7TA 4BY6A 4LUNU 2WXPA 1HS6A 2BF0X 3FTXA 4FLHA 3MCXA 3OXFA 3Q15A 4WWPA 5A23A 4UQYA 4AXHA 4AIFA 4Q69A 4JW1A 3CHMA 3MX3A 4GMJA 1TJCA 1JWFA 1KLXA 3FTZA 3RIBA 2X6FA 3CVWA 2PL2A 3ML8A 3PE3A 3AU4A 3S7FA 3FTSA 4GAAA 2E2EA 3ESKA 4G2VA 2HM8A 2CG3A 2AXUA 5FZRA 4I9EA 4ACLA 1NP7A 3GZ2A 5BV0A 3RRUA 4JVSA 2KCVA 4BT9A 5A6CA 3GZ1A 3FH7A 3QAQA 4ABNA 3U66A 1KT1A 4TV3A 4JA9A 3CSTA 4JEUA 4J8SA 4QFVA 2OOEA 3VLFA 1H2UA 2L9BA 1E8WA 4ILHB 3ESLA 4GZ5A 3R7QA 3NZUA 1HU3A 4GYWA 3B7TA 1ELWA 4I1MA 2R5SA 5G05C 5LOZA 3SBTB 3CVNA 2IF4A 1JPLA 4JA7A 4Q94A 4ANUA 3LYAA 1UG3A 3RRMB 4IYPA 3CVQA 2QY7A 3APCA 5LP0A 2X6HA 3L22A 3CEQA 1QQEA 3LVRE 3D9JA 4JC8A 4PUCA 2AVPA 3ML9A 2Y4TA 1BPOA 4YVQC 3O4ZA 2VTBA 3T5XA 4KT6B 3LPZA 2CHWA 2Y3AA 3QB2A 3ZYKA 1DNPA 2J08A 1E8ZA 3VLEA 3E4BA 2MRIA 4KZCA 4NRHB 3PH0C 4UWGA 3LEWA 3RRNB 3IEGA 4JL0A 4KZ0A 1IQRA 3L13A 4U8HA 3HVEB 3SZ7A 3HDXA 2MOWA 4Q96A 5JJ6A 3ZVVA 2WXNA 3CHRA 3ZYQA 2V8SE 3ENEA 3FY4A 4ILIA 4MLPA 5FQ6A 3FH5A 2CFUA 2WXQA 4FULA 3JQ1A 2EQXA 3G2SA 4OYSA 4NQ0A 4TUUA 2PQRA 3FUMA 3PDNA 3Q49B 1EDUA 1YA0A 4B8AA 3LY9A 4NURA 2ZU6B 4G26A 1E8XA 2GRMA 4FJZA 4XKCA 1UW4B 1W3BA 5KJKA 4XE0A 3QWVA 4EBAG 1N52A 4GPKA 2KM4A 4Y6WA 1E96B 4N3CA 4P29A 4BT8A 4EZLA 5JJ7A 2L6JA 3PREA 4HLEA 4XX5A 4F53A 1FCHA 4I2WA 3ONLA 5T4YA 1PAQA 3U9WA 3TXNA 3APDA 4DI3A 4EZKA 4KXKB 2VYIA 4R7LA 2OVBA 3ASDA 2PZIA 3LS8A 4KMOA 4XI0A 4APFA 1GW6A 4I1OB 1E7UA 5LX8A 4G25A 4KYOB 3JUIA 5BPPA 1LF8A 1TJFA 5AENA 1DVPA 4I6GA 2VJ8A 3FEXA 4WNGA 3K9IA 2XRYA 4LERA 2A4ZA 4GA2A 3LVQE 4B0ZA 3FH8A 3R7RA 5G04J 3G2WA 4ME2A 3RO2A 1EF1C 3HHMA 5CCLA 3FUIA 2HYZA 2WQHA 3FDHA 4CT4A 4NACA 1PY1A 4BFRA 2FULA 2KZTB 3IHYA 4AY6A 4JXTA 2E0IA 1H2TC 2XPIA 2WMNA 3UT4A 3S7JA 1PC2A 2QFCA 4IULA 3FTWA 4LEUA 2WXMA 4JZYA 1H6KA 3I4RB 1Y6IA 3SGHA 3MEKA 3ASFA 4I17A 4UWHA 4A1GA 3DPDA 3FTUA 3MJWA 4DLQA 2XCCA 3BEEA 2WPVA 3G2UA 3OXLA 3IBEA 2I1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUQ A;  2KM4 A;  1VDY A;  3D9I A;  1ELK A;  5CMW A;  1XGW A;  5J08 A;  4GZD A;  1JWF A;  3D9L A;  3G2W A;  1INZ A;  3D9K A;  2MOW A;  2DCP A;  3ONL A;  4HFG A;  1JPL A;  5LOZ A;  4Q96 A;  3ZYM A;  4NAC A;  1PY1 A;  4Q94 A;  3D9M A;  1HX8 A;  1UJJ A;  3ZYL A;  4JXT A;  2QY7 A;  2V8S E;  2L0T B;  3ZYQ A;  4GZC A;  4FLB A;  5LP0 A;  3D9P A;  3D9J A;  1HF8 A;  3CLJ A;  4FU3 A;  5CMY A;  3G2S A;  1SZ9 A;  1X5B A;  2DIW A;  1JWG A;  1UJK A;  3RRU A;  3D9N A;  1EDU A;  2LO6 A;  3ONK A;  3D9O A;  4AVX A;  2L0I A;  1LF8 A;  1HG2 A;  3LDZ A;  1EYH A;  3ZYK A;  1DVP A;  2BF0 X;  3G2V A;  3G2T A;  3G2U A;  1MHQ A;  1HG5 A;  1HFA A;  1SZA A;  1H0A A; 
#chains in the Genus database with same CATH topology
 3DWL G;  4CT0 A;  3QKY A;  3ZHE A;  5BXO A;  2WXH A;  4U63 A;  2F37 A;  3X2Q E;  5C1D A;  3NB2 A;  1IHG A;  3KSL A;  3I5P A;  1TNO A;  1DC2 A;  4CYM D;  1FVH A;  5AIJ A;  2M63 A;  4CRW A;  1H2V C;  2Y69 E;  1ELK A;  4GZD A;  2WXK A;  3QOU A;  5J90 A;  5G04 C;  5E75 A;  2VTB B;  4E6H A;  3DST A;  3HXF A;  4UQX A;  1OUV A;  5ANL A;  1HF8 A;  2H6F A;  3CKC A;  4BER A;  2P9U G;  4G11 A;  3G2V A;  1X81 A;  3CVL A;  1TN6 A;  4RSY A;  4APO A;  3UXG A;  3B7B A;  3PEV B;  4FJY A;  3I4G A;  3APF A;  1HX8 A;  5G55 A;  4LNB A;  4DLO A;  4YDY A;  4CCA A;  4IN3 B;  3DSV A;  4JEH A;  2XS8 A;  5KCM A;  4A1S A;  5EKQ D;  2AWI A;  3SQV A;  1KT0 A;  1IKN D;  3UT8 A;  3JYS A;  2FF4 A;  2B6C A;  3SY2 A;  3MKQ A;  2YNQ A;  4OVU A;  4RG9 A;  3TL5 A;  2C0M A;  4GCO A;  3CSF A;  1HE8 A;  4TXR A;  4V3I A;  4HVB A;  3MGB A;  4M7C A;  2I2O A;  3WXX A;  2P2C P;  1N4S A;  3D9K A;  5EYP F;  2DCP A;  5FJY A;  3ZYM A;  1A5E A;  2Y0B G;  5B1B E;  2JLB A;  4G8L A;  5ENR D;  3NF1 A;  1WY6 A;  4U96 D;  4D10 C;  1OWO A;  2XPY A;  3EHR A;  5J08 A;  1MX2 A;  5D0Q D;  4RQI A;  3V2X A;  3KS2 A;  4CDM A;  2GRP B;  4B89 A;  5C2Y A;  3UI2 A;  3CVP A;  2DZO A;  3DEP A;  4YDE A;  3GYZ A;  2J07 A;  4AY5 A;  4HOQ A;  3KEZ A;  3CQG B;  4EZJ A;  1QNF A;  4C0E A;  3LKU A;  1AP7 A;  4C0M A;  5FT9 A;  2AXZ A;  2X6J A;  4WUY A;  2ION A;  4EHM A;  4FC8 A;  1E7V A;  2IO2 C;  4GTO A;  3DEO A;  3L54 A;  3L9T A;  4J7W A;  2YQ8 A;  5AQ7 A;  4DX5 D;  3LJ3 A;  4AVX A;  3KD7 A;  4DPR A;  5ENN A;  1VDY A;  4H7Y A;  1H6O A;  2V4L A;  2J4B A;  4HOU A;  3OXG A;  4M3O A;  4OAU C;  4BTA A;  4CZ2 D;  2QYU A;  1U2V G;  4I9C A;  4FHJ A;  5BXU A;  2CHX A;  1SVX A;  3ASH A;  5CHE E;  1OXJ A;  3Q7F A;  1HG5 A;  3HIZ A;  4HQD A;  5AQA A;  3T5V A;  3AS5 A;  5KJM A;  3NQP A;  4LG6 A;  2OEV A;  2VSX E;  2WXO A;  1UN8 A;  4JHR A;  5FTP A;  4ANV A;  2IFU A;  3ZUV B;  4G1T A;  4H7X A;  1O1R A;  2KCL A;  5B1A E;  2EIK E;  1IXV A;  2Q7F A;  4UQZ A;  2WXR A;  3E37 A;  3PZ2 A;  4GA0 A;  1H19 A;  3UIP C;  4YVO A;  4I6E A;  5EX0 A;  5EN5 D;  3Q9N C;  4O6F A;  3AS8 A;  4XIF A;  2LO6 A;  3NBN B;  1MJ0 A;  1NL4 A;  3PS6 A;  2YHC A;  2KXP C;  3B13 A;  1MHQ A;  3TAX A;  3ABM E;  3FWV A;  4GML A;  5ENO D;  4OVV A;  3N71 A;  3IKO B;  4WAF A;  5AAR A;  4N2Q A;  4YND A;  3CK9 A;  4N3A A;  3ZNG A;  2KZT A;  3PZ1 A;  4RLY A;  3OXF A;  5A23 A;  3EU5 A;  4GMJ A;  1JWF A;  1KLX A;  3CVW A;  3PE3 A;  3AU4 A;  2H6G A;  4GAA A;  1NFI E;  2AXU A;  3ISM C;  5A6C A;  3FH7 A;  3QAQ A;  4ABN A;  1KT1 A;  3C72 A;  1Q2Z A;  2F8Y A;  3W9F A;  3NZU A;  1HU3 A;  4GYW A;  3B7T A;  4I1M A;  3SBT B;  4JA7 A;  2EIN E;  3LYA A;  2XZT G;  3CVQ A;  3APC A;  4JC8 A;  4PUC A;  3O4Z A;  1D8D A;  2VTB A;  4KT6 B;  5KBA A;  2XEN A;  3VLE A;  2MRI A;  3RRN B;  3LEW A;  4JL0 A;  3L13 A;  3SZ7 A;  5JJ6 A;  3CHR A;  3ENE A;  3TWQ A;  3FY4 A;  2WXQ A;  4OYS A;  4NQ0 A;  1SA5 A;  1QYM A;  3PDN A;  1YA0 A;  3LY9 A;  2H6H A;  4FJZ A;  4XKC A;  4HRL A;  4GTS A;  2ETA A;  2L6J A;  4JD2 G;  4F53 A;  3TXN A;  2VYI A;  3ASD A;  4TXQ A;  1KZO A;  4LSZ E;  3JXI A;  1BLX B;  4G25 A;  1OCZ E;  1LF8 A;  1DVP A;  2VJ8 A;  3ASO E;  3KEA A;  4WNG A;  2XRY A;  4LER A;  2ZGD A;  5G04 J;  4ME2 A;  3E33 A;  3HHM A;  3FDH A;  5CBO A;  1PY1 A;  1PC2 A;  2QFC A;  4GTP A;  1Y6I A;  3SGH A;  4I17 A;  3EU9 A;  5ENS D;  2XCC A;  5EID A;  3OXL A;  1U3C A;  2VSN A;  4DRX E;  1MYO A;  3FU5 A;  4ATG A;  3PRZ A;  1TNB A;  2L0T B;  3Q79 A;  4DX6 D;  3LDZ A;  2WVI A;  3ULY A;  1ZBP A;  3W9G A;  2XGS A;  3SI5 A;  3SFZ A;  5FZS A;  4N5C A;  1TR4 A;  3D9M A;  4UWF A;  4BSZ B;  3UX4 A;  1MQS A;  4FA6 A;  4FAD A;  2AXV A;  2AW6 A;  2WXF A;  3SF4 A;  3UT7 A;  1OT8 A;  4GYY A;  4BET A;  2R17 C;  3CGH A;  4WWO A;  2FBN A;  1UJJ A;  3SFY A;  5EX3 A;  1LD8 A;  1A17 A;  2WXI A;  4U0Z A;  1Z3Y A;  4HFG A;  3HXE A;  3B7U X;  5KNG A;  1O1T A;  4I1A A;  3ZPJ A;  5DBK A;  5G2N A;  3S2A A;  3DXM G;  3D9O A;  4GU5 A;  1LD7 A;  4U0U A;  1EYH A;  1Z3X A;  2I1J A;  5HI7 A;  1HFA A;  3FUJ A;  5CMW A;  1TNY A;  4BTB A;  5EYL A;  2J09 A;  3CLJ A;  4PDX A;  2J49 A;  2P9L G;  4JHJ A;  2KCK A;  1EPU A;  2MHK A;  1HO8 A;  3S7B A;  4ZHB A;  2FI7 A;  5ENT D;  5AJL A;  3D9I A;  3FTV A;  4F3V A;  3PZD A;  1TNU A;  2X38 A;  3FUK A;  3MYV A;  5CED B;  3L08 A;  3TJP A;  4U04 A;  2DIW A;  1OWL A;  2YIN A;  3RKV A;  1V54 E;  3RO3 A;  1NZN A;  4CDN A;  3C3R A;  4GB9 A;  1MZC A;  2KC7 A;  4MKT A;  3GW4 A;  4HS2 A;  3JUE A;  4HOS A;  3DBS A;  3FUF A;  4AOF A;  3D9H A;  3LCA A;  4HRM B;  5FQ8 A;  4J6I A;  4DK5 A;  1QBQ A;  3J5Q B;  2XZD G;  3C3Q A;  4KBQ A;  2WQ7 A;  1KZP A;  3LXU X;  2LUH A;  5FZQ A;  3CK8 A;  2F0Y A;  1SQM A;  3FUD A;  3ZU7 B;  5LCW J;  4RG6 A;  1UN9 A;  5JHB A;  2A5U A;  1S0P A;  3SBS A;  3UM1 A;  1V55 E;  3J5P A;  4BX9 A;  3IXE A;  1JCQ A;  4U95 D;  2CG2 A;  2ILR A;  3RAU A;  2WXG A;  4F7A A;  4GZ6 A;  3EIQ C;  2LXM A;  2UY1 B;  3CHP A;  3MKR A;  4Z68 A;  2WMO A;  4U0S A;  2NSZ A;  1RW2 A;  3EHN A;  4N3B A;  3RK6 A;  3AS4 A;  2FEZ A;  5M72 A;  2B0O E;  2P9I G;  3LY8 A;  4JB8 P;  3R9M A;  3B7R L;  2P58 C;  1N94 A;  3NOG D;  1S70 B;  4U07 A;  3PNT B;  1L5J A;  3CR3 A;  5DIZ A;  2IY0 C;  2XGM A;  4PS3 A;  5BW8 C;  2FO7 A;  2VQ2 A;  3MV2 B;  4DX2 A;  2EIM E;  2GW1 A;  3P1U A;  2I9C A;  3Q4A B;  4B94 A;  4L23 A;  2C2L A;  3FU0 A;  3F6Q A;  2BED A;  2LNI A;  2KBX A;  3G2T A;  1FT2 A;  2VGY A;  1INZ A;  2ZIS A;  5AAO A;  2GRN B;  2GGF A;  3UM3 A;  2XHE A;  1NA3 A;  2BKG A;  3CHO A;  3GZS A;  3NAW A;  1K1B A;  2CFZ A;  3BG1 B;  4GTM A;  4L9P A;  2Y4U A;  2RKK A;  3LY7 A;  4W9R A;  4IRU A;  1N54 A;  2WXJ A;  2GRL A;  2J8S D;  4HRN A;  4L7T A;  3MCX A;  3Q7A A;  3MX3 A;  2PL2 A;  3ML8 A;  3S7F A;  4G2V A;  3PZ3 A;  4GTQ A;  2CG3 A;  4I9E A;  2QYJ A;  3GZ2 A;  4JVS A;  2KCV A;  4BT9 A;  3GZ1 A;  1BI8 B;  5CBN A;  3U66 A;  3CST A;  2ZIR A;  1E8W A;  5JMN D;  2R5S A;  1JPL A;  3DPY A;  3NOC D;  4Q94 A;  3RRM B;  1UG3 A;  3UKU G;  2QY7 A;  5LP0 A;  3L22 A;  3LVR E;  2R02 A;  3ML9 A;  2Y4T A;  3T5X A;  2CHW A;  1DNP A;  5CRV A;  5CEC B;  2ZXW E;  4KZC A;  3HVE B;  2XEE A;  3HDX A;  2MOW A;  3ABK E;  2HE0 A;  3Q9U C;  5EIL A;  3JQ1 A;  3Q78 A;  4NUR A;  1E8X A;  1UW4 B;  3ZXP A;  5KJK A;  4K5A B;  1N52 A;  4EBA G;  2KM4 A;  4Y6W A;  5JJ7 A;  2IEJ A;  3PRE A;  4XX5 A;  3TWT A;  3APD A;  4ATZ D;  2OVB A;  3Q73 A;  3LS8 A;  3UM0 A;  3T8K A;  4KYO B;  3JUI A;  5AEN A;  3TWR A;  4GA2 A;  3LVQ E;  4YDO A;  3FH8 A;  3R7R A;  5CCL A;  3FUI A;  3AG2 E;  3E30 A;  2HYZ A;  4CT4 A;  3IHY A;  3ASN E;  4JXT A;  2WMN A;  3FTW A;  4JZY A;  3ASF A;  2A5E A;  5FIO A;  3DPD A;  3FTU A;  1TYQ G;  3BEE A;  2PNN A;  2FO1 E;  4EEC A;  5FIN A;  3FUL A;  3QNK A;  4KVM A;  4CEM A;  4CGV A;  3ZKJ A;  3UMV A;  4XZ4 A;  1MX4 A;  4L2Y A;  4BX8 A;  2OND A;  3V2O A;  4EQF A;  3TGO A;  1E8Y A;  2DYR E;  3DSU A;  5HRY A;  2RD0 A;  4A3V A;  3RJV A;  2R03 A;  3HYM B;  1AWC B;  3O48 A;  5BNW A;  2DBA A;  3UTM A;  3FUE A;  2ETC A;  3QWW A;  3C3O A;  2XCB A;  4DX7 D;  3JXJ A;  4O1P A;  4GCN A;  2C0L A;  2J4D A;  1N4R A;  4HI9 A;  4UWK A;  4GYO A;  4O60 A;  3B7S A;  1Y8M A;  3AU5 A;  2WM9 A;  5FQ4 A;  3UUX A;  2UY1 A;  2IQC A;  5AQ9 A;  4GPM A;  3EIJ A;  1N9A A;  2HR2 A;  4MS6 A;  4HBD A;  1N0Q A;  3CK7 A;  1D8E A;  2IOS A;  1S64 A;  1JWG A;  3BG0 B;  1B89 A;  4KVO A;  5CRU A;  4L2L A;  4UI9 C;  2OEW A;  3Q47 B;  3NZS A;  4GZ3 A;  3PE4 A;  3ZGQ A;  5EDS A;  4LNU D;  3ZXS A;  3ZW3 A;  1K1A A;  3PUK A;  4J8E A;  4FHK A;  4MRU A;  4K5B A;  5BV1 A;  3D9N A;  4AEZ C;  2L0I A;  4HLL A;  2JEK A;  4XKB A;  3FFL A;  1D9S A;  3MV3 B;  3PUJ A;  4J0U A;  3QK0 A;  4E85 A;  2BUG A;  4BSX A;  3L6A A;  4FLB A;  3D9P A;  5ANR A;  1UJK A;  2OVF A;  4UWL A;  4G24 A;  3TXM A;  1O1S A;  3FP3 A;  2L6B A;  4FP7 A;  4AJW A;  2RFA A;  1H0A A;  5HS0 A;  2BKK B;  5AJD A;  2IU1 A;  3PVL A;  2PM7 A;  2R05 A;  3U3W A;  1O5M A;  2P9K G;  3SO8 A;  5D66 A;  4HOT A;  3SNX A;  4URK A;  3RU0 A;  1JCS A;  1HXI A;  2IO3 C;  2WB2 A;  1SZA A;  3ZN3 A;  1E90 A;  4EBA A;  3FUN A;  2XGO A;  5E76 A;  3OAW A;  3L17 A;  3FU6 A;  3ZRH A;  2ETB A;  3FU3 A;  5AYW D;  4N2S A;  1K3Z D;  3JQ0 A;  5ARF A;  1N95 A;  4I43 A;  3IV0 A;  3PZ4 A;  4YDW A;  2YHE A;  4K03 A;  3TG5 A;  1TN8 A;  4I2Z A;  3CVU A;  3HVE A;  3Q5M A;  2DVW A;  1BU9 A;  3S7D A;  2VGX B;  3QJZ A;  1TEZ A;  2GRO B;  5JJT A;  1NI1 A;  3DSX A;  4B8C B;  3T8M A;  3TWX A;  1OWP A;  3HG0 D;  1ZU2 A;  2X3M A;  1NA0 A;  2X6K A;  5ENQ D;  3ASG A;  4JHK A;  1G3N B;  3CKB A;  5CMY A;  4WWN A;  4K0R A;  3SHF A;  3UIN C;  5T3R A;  2KAT A;  4XEI G;  3EUV A;  4TUM A;  4AV7 A;  2QZA A;  1SW6 A;  3TWS A;  2WXL A;  1RZ4 A;  3EDT B;  3E32 A;  1WM5 A;  5ARG A;  3CHQ A;  4U8V D;  4WND A;  3L16 A;  4DUI A;  2RG8 A;  4N39 A;  3U64 A;  3UQ3 A;  5T8I A;  3DSW A;  1U3D A;  1P5Q A;  1BD8 A;  4LUN U;  2BF0 X;  3Q15 A;  4AXH A;  3CHM A;  3FTZ A;  3RIB A;  3FTS A;  2E2E A;  2XEH A;  2HM8 A;  5FZR A;  1NP7 A;  3RRU A;  2P9P G;  4N5Q A;  1N11 A;  3L82 A;  1YYH A;  4TV3 A;  4JA9 A;  4HNA D;  4JEU A;  4QFV A;  2OOE A;  3VLF A;  3R7Q A;  1ELW A;  5G05 C;  3C5R A;  4IYP A;  2GRQ B;  2X6H A;  3D9J A;  1BPO A;  4G8K A;  3LPZ A;  3QB2 A;  2JAB A;  4NRH B;  3PH0 C;  3UIO C;  3IEG A;  4U8H A;  3ZVV A;  5CEA A;  2WXN A;  3ZYQ A;  2V8S E;  5FQ6 A;  4MLP A;  4ILI A;  1OCC E;  2EQX A;  2V4H C;  4TUU A;  2ZU6 B;  3LJN A;  3BUA A;  1W3B A;  4XE0 A;  2V5Q C;  4EZL A;  4HLE A;  5ITZ F;  1FCH A;  4I2W A;  3ONL A;  3TWU A;  4DI3 A;  4EZK A;  4KXK B;  4R7L A;  1GW6 A;  5LX8 A;  4I6G A;  4TXP A;  3K9I A;  2A4Z A;  1DCQ A;  3RO2 A;  1EF1 C;  4BFR A;  2FUL A;  2E0I A;  3UT4 A;  5KNH D;  4IUL A;  1H6K A;  1H6P A;  3MEK A;  4UWH A;  3HXC A;  4A1G A;  3MJW A;  4DLQ A;  2WPV A;  3G2U A;  3RSE G;  3BU8 A;  3IBE A;  2XS1 A;  4ILG A;  4XI9 A;  4BWR A;  5HQ8 A;  3P2B A;  5BUZ A;  1DCE A;  1XNF A;  2LAI A;  4QQI A;  2BTD A;  4I6J A;  2LSU A;  2XQ0 A;  3ONK A;  1N0R A;  3URZ A;  4B93 B;  2V5F A;  3ZEF A;  5FWQ A;  3FUH A;  3QAR A;  4FU3 A;  3CIA A;  2XEV A;  2XPZ A;  3V30 A;  3ZIM A;  3TWW A;  4O1O A;  1QZ2 A;  3QWP A;  1KPS B;  2IOL A;  1IQU A;  4AP2 A;  2HO1 A;  4ANW A;  2DZN A;  4UI9 J;  2OV8 A;  3WG7 E;  4Y6C A;  2PQN A;  3I3N A;  4DI4 A;  1IYG A;  3U4T A;  1SZ9 A;  3VLD A;  5KJL A;  1OCR E;  3FEY A;  4U8Y D;  1HZ4 A;  3R9A B;  3CVV A;  1N4P A;  2NC9 A;  3D3M A;  5FQ7 A;  1LTX A;  4GTT A;  4DX1 A;  2LAH A;  4HOR A;  2R59 A;  4GMR A;  4DJA A;  3SD5 A;  5LCW C;  5JA4 D;  5A7D B;  3AG3 E;  3HXD A;  4J8F A;  1HH8 A;  4AM9 A;  1Z5S C;  4C9B B;  3IHV A;  4GA1 A;  2H6I A;  2Y1L E;  1XGW A;  2P9N G;  2VGX A;  3TWV A;  3TG4 A;  5CER B;  1UOH A;  2V0P A;  3MA5 A;  2ZGG A;  3AG4 E;  5JHA A;  3ZHE B;  4ACK A;  4A55 A;  1OY3 D;  3UKR G;  3T9K A;  4PS8 A;  5B3S E;  3SFX A;  5KWD A;  5KJN A;  3KAE A;  1Z6T A;  1MX6 A;  3PNL B;  4LNG A;  3QC1 A;  3MZL B;  2PM6 A;  2R2L A;  1YMP A;  4J8D A;  2UWJ G;  4PH4 B;  3FHE A;  4LRZ A;  4PS7 A;  3VTY A;  4A3T A;  1OWN A;  5LFA A;  4BEP A;  4UI9 K;  4CGW A;  3VTX A;  3CVX A;  4EPZ A;  3CVY A;  2XRZ A;  1WAO 1;  4RVB A;  3CQC B;  3ABL E;  2NXP A;  5HKP A;  3C98 A;  4GTR A;  4F1P A;  4TRQ A;  1FVF A;  3AAA C;  3FTY A;  1WDY A;  4HI8 A;  5D0O D;  4ANX A;  3ZYL A;  2P9S G;  3CV0 A;  3ULE G;  4G23 A;  4JPS A;  4F1S A;  3EJN A;  3ZFW A;  2X6I A;  3MKQ B;  1JUQ A;  5CCM A;  2WQ6 A;  4LCT A;  2LSV A;  3UPV A;  3ULQ A;  4L1B A;  2DYS E;  3BQO A;  5EIB E;  3HRA A;  2RFM A;  4HXI A;  2GRR B;  1HG2 A;  2IJG X;  2VSY A;  5BT1 A;  2VSO E;  3D9L A;  4WNF A;  3E34 A;  3EHM A;  1OWM A;  3QDN A;  2I6H A;  3PEU B;  1BI7 B;  1OCO E;  3OTN A;  2LXL A;  2J9Q A;  4J8Y A;  4WNE A;  1ZB1 A;  5G05 J;  3JCK C;  2NYJ A;  1WG0 A;  1K8K G;  4NIK A;  1FPP A;  4C48 B;  1ELR A;  2AJA A;  3CHS A;  4GZC A;  2CHZ A;  1X5B A;  1IHB A;  3V31 A;  4CDR A;  4OAV B;  4GTV A;  4BY6 A;  2WXP A;  1HS6 A;  3FTX A;  3DXK G;  1FT1 A;  4FLH A;  4WWP A;  4UQY A;  5H7P A;  4AIF A;  4Q69 A;  4JW1 A;  1TJC A;  2F8X K;  2X6F A;  4ZFH A;  3ESK A;  5D2M C;  4ACL A;  5BV0 A;  4UUC A;  2EIL E;  4J8S A;  1H2U A;  2L9B A;  4ILH B;  3ESL A;  4GZ5 A;  4HB5 A;  5LOZ A;  3CVN A;  2IF4 A;  4F6R D;  1YCS B;  4ANU A;  3CEQ A;  1QQE A;  2AVP A;  4YVQ C;  3DRA A;  2EIJ E;  2Y3A A;  3V79 K;  3ZYK A;  4X8Q A;  2J08 A;  2QC9 A;  1E8Z A;  3E4B A;  5ENP D;  4UWG A;  4KZ0 A;  1IQR A;  1S63 A;  5IY5 E;  4Q96 A;  1N4Q A;  3DSS A;  3FH5 A;  2CFU A;  4FUL A;  3G2S A;  3Q75 A;  2PQR A;  3FUM A;  3Q49 B;  1EDU A;  4B8A A;  4G26 A;  2GRM A;  3QWV A;  4GPK A;  3EHQ A;  3UM2 A;  1E96 B;  4N3C A;  4P29 A;  4BT8 A;  3B95 A;  5AN8 A;  5AQB A;  4K5C A;  5T4Y A;  1PAQ A;  3U9W A;  2OCC E;  2PZI A;  4KMO A;  4MBG A;  4XI0 A;  4APF A;  4I1O B;  1E7U A;  1JCR A;  5BPP A;  1TJF A;  3KSQ A;  2MYO A;  3FEX A;  1SA4 A;  4B0Z A;  2VGE A;  3G2W A;  3HXB A;  2WQH A;  4NAC A;  3AG1 E;  2KZT B;  4AY6 A;  1H2T C;  2XPI A;  3S7J A;  4U7E B;  4A63 B;  4LEU A;  2WXM A;  3I4R B;  1TN7 A;  4BES A;  1TNZ A;  2DWZ A;  3AJI A;  2I1K A; 
#chains in the Genus database with same CATH homology
 4ILG A;  1U3C A;  4XI9 A;  4BWR A;  5HQ8 A;  2VSN A;  3FUL A;  3P2B A;  3QNK A;  4KVM A;  3QKY A;  4CEM A;  4CT0 A;  5BUZ A;  1XNF A;  4CGV A;  3FU5 A;  3ZHE A;  4ATG A;  2WXH A;  3PRZ A;  2LAI A;  4U63 A;  2BTD A;  2L0T B;  4I6J A;  3UMV A;  4XZ4 A;  5C1D A;  4L2Y A;  2LSU A;  4BX8 A;  2OND A;  2XQ0 A;  3ONK A;  1IHG A;  4EQF A;  3URZ A;  3I5P A;  3LDZ A;  2WVI A;  3TGO A;  1E8Y A;  1FVH A;  1ZBP A;  2V5F A;  3ZEF A;  5FWQ A;  5AIJ A;  3FUH A;  3QAR A;  2RD0 A;  4A3V A;  2M63 A;  4FU3 A;  3CIA A;  1H2V C;  4CRW A;  1ELK A;  2XEV A;  2XPZ A;  2XGS A;  3RJV A;  4GZD A;  3SI5 A;  3SFZ A;  5FZS A;  4N5C A;  2WXK A;  3HYM B;  3QOU A;  3ZIM A;  3O48 A;  5BNW A;  5J90 A;  2DBA A;  5G04 C;  5E75 A;  2VTB B;  4E6H A;  1QZ2 A;  3D9M A;  3QWP A;  4UWF A;  2IOL A;  4UQX A;  1OUV A;  1IQU A;  5ANL A;  3UX4 A;  1HF8 A;  3FUE A;  3QWW A;  4AP2 A;  3CKC A;  1MQS A;  2HO1 A;  4FAD A;  2AXV A;  4FA6 A;  4ANW A;  2AW6 A;  2WXF A;  3SF4 A;  3UT7 A;  2XCB A;  4GYY A;  4UI9 J;  2R17 C;  3CGH A;  2OV8 A;  4GCN A;  2C0L A;  4G11 A;  3G2V A;  2J4D A;  4WWO A;  4Y6C A;  2FBN A;  2PQN A;  1UJJ A;  5EX3 A;  3CVL A;  3I3N A;  1A17 A;  4RSY A;  2WXI A;  4DI4 A;  1IYG A;  4APO A;  4UWK A;  4GYO A;  4U0Z A;  1Z3Y A;  3U4T A;  3B7S A;  1Y8M A;  4HFG A;  3PEV B;  4FJY A;  3I4G A;  3APF A;  3AU5 A;  2WM9 A;  1HX8 A;  3B7U X;  5FQ4 A;  3UUX A;  2UY1 A;  2IQC A;  4I1A A;  3ZPJ A;  5G55 A;  5DBK A;  5G2N A;  1SZ9 A;  3VLD A;  4DLO A;  5KJL A;  3S2A A;  3FEY A;  4CCA A;  3D9O A;  4GU5 A;  4IN3 B;  3EIJ A;  4U0U A;  1EYH A;  4JEH A;  1Z3X A;  5KCM A;  2I1J A;  1HZ4 A;  5EKQ D;  3R9A B;  4A1S A;  5HI7 A;  3CVV A;  2AWI A;  1HFA A;  1KT0 A;  2NC9 A;  3D3M A;  3FUJ A;  2HR2 A;  5FQ7 A;  3UT8 A;  5CMW A;  3JYS A;  4MS6 A;  2LAH A;  4BTB A;  2FF4 A;  3CK7 A;  4HOR A;  2R59 A;  4DJA A;  3MKQ A;  2J09 A;  3SD5 A;  2YNQ A;  2IOS A;  4OVU A;  5LCW C;  5A7D B;  4RG9 A;  3TL5 A;  3CLJ A;  4PDX A;  1JWG A;  2C0M A;  2J49 A;  4GCO A;  4J8F A;  3CSF A;  3BG0 B;  1HH8 A;  1B89 A;  1HE8 A;  4KVO A;  4AM9 A;  4JHJ A;  4V3I A;  2KCK A;  4C9B B;  1EPU A;  2MHK A;  1HO8 A;  3S7B A;  4HVB A;  3MGB A;  3IHV A;  4GA1 A;  4L2L A;  4UI9 C;  2I2O A;  2FI7 A;  3Q47 B;  3WXX A;  3NZS A;  4GZ3 A;  5AJL A;  3D9I A;  3PE4 A;  3ZGQ A;  5EDS A;  1XGW A;  2VGX A;  3FTV A;  4F3V A;  3ZXS A;  3ZW3 A;  3D9K A;  2DCP A;  5FJY A;  3PUK A;  3PZD A;  3ZYM A;  2X38 A;  3FUK A;  3MYV A;  3TG4 A;  3L08 A;  3TJP A;  2JLB A;  3NF1 A;  4FHK A;  4J8E A;  4U04 A;  2DIW A;  4MRU A;  5BV1 A;  1OWL A;  2YIN A;  2V0P A;  3D9N A;  4AEZ C;  3RKV A;  3MA5 A;  3RO3 A;  1WY6 A;  2L0I A;  5JHA A;  2JEK A;  4XKB A;  3FFL A;  1NZN A;  3ZHE B;  4ACK A;  4D10 C;  4CDN A;  3MV3 B;  1OWO A;  4A55 A;  2XPY A;  3PUJ A;  4GB9 A;  4J0U A;  5J08 A;  2KC7 A;  4MKT A;  5D0Q D;  4PS8 A;  3GW4 A;  3KS2 A;  3QK0 A;  4HS2 A;  4B89 A;  4CDM A;  4HOS A;  3DBS A;  5C2Y A;  4E85 A;  2BUG A;  4BSX A;  3FUF A;  3L6A A;  4FLB A;  4AOF A;  3D9P A;  5KJN A;  3CVP A;  3KAE A;  5ANR A;  3LCA A;  1Z6T A;  1UJK A;  5FQ8 A;  4J6I A;  4DK5 A;  2OVF A;  3GYZ A;  2J07 A;  4AY5 A;  4HOQ A;  3PNL B;  4UWL A;  4G24 A;  3TXM A;  3KEZ A;  3CQG B;  3FP3 A;  3QC1 A;  4EZJ A;  1QNF A;  3MZL B;  2PM6 A;  4C0E A;  4KBQ A;  3LKU A;  4FP7 A;  2WQ7 A;  4AJW A;  1H0A A;  4J8D A;  2UWJ G;  3LXU X;  4PH4 B;  3FHE A;  4C0M A;  5FT9 A;  2AXZ A;  2X6J A;  4LRZ A;  4PS7 A;  2ION A;  4WUY A;  5AJD A;  5FZQ A;  3CK8 A;  3VTY A;  4A3T A;  1SQM A;  1OWN A;  3FUD A;  5LCW J;  5LFA A;  4FC8 A;  2IU1 A;  1E7V A;  3PVL A;  2PM7 A;  4RG6 A;  3U3W A;  4UI9 K;  4CGW A;  3VTX A;  1UN9 A;  3L54 A;  5JHB A;  2A5U A;  4HOT A;  1S0P A;  2YQ8 A;  3CVX A;  3SBS A;  4EPZ A;  3SNX A;  3LJ3 A;  4BX9 A;  4URK A;  4AVX A;  3RU0 A;  3CVY A;  2XRZ A;  1WAO 1;  2CG2 A;  2ILR A;  3KD7 A;  4RVB A;  3CQC B;  1HXI A;  4DPR A;  4EEC A;  2NXP A;  2WXG A;  4F7A A;  4GZ6 A;  5ENN A;  2WB2 A;  3C98 A;  1VDY A;  4H7Y A;  1SZA A;  3ZN3 A;  1E90 A;  2V4L A;  3EIQ C;  4TRQ A;  2J4B A;  2UY1 B;  4EBA A;  1FVF A;  3FUN A;  4HOU A;  3CHP A;  3OXG A;  2XGO A;  3FTY A;  4M3O A;  5E76 A;  4BTA A;  3MKR A;  3OAW A;  2WMO A;  5D0O D;  4ANX A;  4U0S A;  3L17 A;  3ZYL A;  2NSZ A;  3FU6 A;  3ZRH A;  3EHN A;  4N3B A;  3RK6 A;  3AS4 A;  4I9C A;  4FHJ A;  2FEZ A;  3FU3 A;  3CV0 A;  5M72 A;  5AYW D;  4N2S A;  4G23 A;  4JPS A;  2CHX A;  4F1S A;  3ASH A;  3EJN A;  3JQ0 A;  3LY8 A;  5ARF A;  5CHE E;  3ZFW A;  2X6I A;  3B7R L;  1HG5 A;  2P58 C;  4I43 A;  3IV0 A;  3MKQ B;  1JUQ A;  5CCM A;  2WQ6 A;  3HIZ A;  4LCT A;  4U07 A;  2LSV A;  3AS5 A;  5KJM A;  3PNT B;  2YHE A;  3ULQ A;  4L1B A;  3T5V A;  3UPV A;  1L5J A;  3NQP A;  3CR3 A;  5DIZ A;  2VSX E;  2WXO A;  2XGM A;  4K03 A;  3TG5 A;  4PS3 A;  5BW8 C;  2FO7 A;  1UN8 A;  2VQ2 A;  4JHR A;  3MV2 B;  5FTP A;  2GW1 A;  3P1U A;  4I2Z A;  2I9C A;  3HVE A;  3Q5M A;  4ANV A;  2IFU A;  3CVU A;  3Q4A B;  4HXI A;  4B94 A;  4L23 A;  3S7D A;  4G1T A;  2C2L A;  2VGX B;  4H7X A;  2KCL A;  1HG2 A;  3FU0 A;  2IJG X;  2LNI A;  3G2T A;  3QJZ A;  1TEZ A;  2VSY A;  5JJT A;  2Q7F A;  5BT1 A;  4UQZ A;  2WXR A;  2VSO E;  4B8C B;  3T8M A;  3D9L A;  2VGY A;  4WNF A;  1OWP A;  4GA0 A;  1INZ A;  1ZU2 A;  3EHM A;  2X3M A;  1NA0 A;  1OWM A;  2X6K A;  1H19 A;  3ASG A;  2GGF A;  3QDN A;  4YVO A;  4JHK A;  2XHE A;  2I6H A;  3CKB A;  4I6E A;  5CMY A;  5EX0 A;  4WWN A;  4O6F A;  3PEU B;  1NA3 A;  4K0R A;  3SHF A;  3AS8 A;  5T3R A;  3CHO A;  2KAT A;  2LO6 A;  3GZS A;  3OTN A;  4XIF A;  3PS6 A;  2YHC A;  2CFZ A;  2J9Q A;  4AV7 A;  3B13 A;  1MHQ A;  3BG1 B;  4WNE A;  3TAX A;  5G05 J;  3JCK C;  2Y4U A;  3LY7 A;  4W9R A;  2WXL A;  4IRU A;  3EDT B;  1N54 A;  3FWV A;  2WXJ A;  4GML A;  1WM5 A;  5ARG A;  3CHQ A;  1ELR A;  4OVV A;  4WND A;  3CHS A;  3N71 A;  3L16 A;  3IKO B;  2GRL A;  4WAF A;  4GZC A;  4N2Q A;  2CHZ A;  2RG8 A;  4N39 A;  4YND A;  1X5B A;  3U64 A;  3UQ3 A;  3CK9 A;  5T8I A;  4N3A A;  4CDR A;  2KZT A;  1U3D A;  1P5Q A;  4L7T A;  4BY6 A;  4LUN U;  2WXP A;  1HS6 A;  2BF0 X;  3FTX A;  4FLH A;  3MCX A;  3OXF A;  3Q15 A;  4WWP A;  5A23 A;  4UQY A;  4AXH A;  4AIF A;  4Q69 A;  4JW1 A;  3CHM A;  3MX3 A;  4GMJ A;  1TJC A;  1JWF A;  1KLX A;  3FTZ A;  3RIB A;  2X6F A;  3CVW A;  2PL2 A;  3ML8 A;  3PE3 A;  3AU4 A;  3S7F A;  3FTS A;  4GAA A;  2E2E A;  3ESK A;  4G2V A;  2HM8 A;  2CG3 A;  2AXU A;  5FZR A;  4I9E A;  4ACL A;  1NP7 A;  3GZ2 A;  5BV0 A;  3RRU A;  4JVS A;  2KCV A;  4BT9 A;  5A6C A;  3GZ1 A;  3FH7 A;  3QAQ A;  4ABN A;  3U66 A;  1KT1 A;  4TV3 A;  4JA9 A;  3CST A;  4JEU A;  4J8S A;  4QFV A;  2OOE A;  3VLF A;  1H2U A;  2L9B A;  1E8W A;  4ILH B;  3ESL A;  4GZ5 A;  3R7Q A;  3NZU A;  1HU3 A;  4GYW A;  3B7T A;  1ELW A;  4I1M A;  2R5S A;  5G05 C;  5LOZ A;  3SBT B;  3CVN A;  2IF4 A;  1JPL A;  4JA7 A;  4Q94 A;  4ANU A;  3LYA A;  1UG3 A;  3RRM B;  4IYP A;  3CVQ A;  2QY7 A;  3APC A;  5LP0 A;  2X6H A;  3L22 A;  3CEQ A;  1QQE A;  3LVR E;  3D9J A;  4JC8 A;  4PUC A;  2AVP A;  3ML9 A;  2Y4T A;  1BPO A;  4YVQ C;  3O4Z A;  2VTB A;  3T5X A;  4KT6 B;  3LPZ A;  2CHW A;  2Y3A A;  3QB2 A;  3ZYK A;  1DNP A;  2J08 A;  1E8Z A;  3VLE A;  3E4B A;  2MRI A;  4KZC A;  4NRH B;  3PH0 C;  4UWG A;  3LEW A;  3RRN B;  3IEG A;  4JL0 A;  4KZ0 A;  1IQR A;  3L13 A;  4U8H A;  3HVE B;  3SZ7 A;  3HDX A;  2MOW A;  4Q96 A;  5JJ6 A;  3ZVV A;  2WXN A;  3CHR A;  3ZYQ A;  2V8S E;  3ENE A;  3FY4 A;  4ILI A;  4MLP A;  5FQ6 A;  3FH5 A;  2CFU A;  2WXQ A;  4FUL A;  3JQ1 A;  2EQX A;  3G2S A;  4OYS A;  4NQ0 A;  4TUU A;  2PQR A;  3FUM A;  3PDN A;  3Q49 B;  1EDU A;  1YA0 A;  4B8A A;  3LY9 A;  4NUR A;  2ZU6 B;  4G26 A;  1E8X A;  2GRM A;  4FJZ A;  4XKC A;  1UW4 B;  1W3B A;  5KJK A;  4XE0 A;  3QWV A;  4EBA G;  1N52 A;  4GPK A;  2KM4 A;  4Y6W A;  1E96 B;  4N3C A;  4P29 A;  4BT8 A;  4EZL A;  5JJ7 A;  2L6J A;  3PRE A;  4HLE A;  4XX5 A;  4F53 A;  1FCH A;  4I2W A;  3ONL A;  5T4Y A;  1PAQ A;  3U9W A;  3TXN A;  3APD A;  4DI3 A;  4EZK A;  4KXK B;  2VYI A;  4R7L A;  2OVB A;  3ASD A;  2PZI A;  3LS8 A;  4KMO A;  4XI0 A;  4APF A;  1GW6 A;  4I1O B;  1E7U A;  5LX8 A;  4G25 A;  4KYO B;  3JUI A;  5BPP A;  1LF8 A;  1TJF A;  5AEN A;  1DVP A;  4I6G A;  2VJ8 A;  3FEX A;  4WNG A;  3K9I A;  2XRY A;  4LER A;  2A4Z A;  4GA2 A;  3LVQ E;  4B0Z A;  3FH8 A;  3R7R A;  5G04 J;  3G2W A;  4ME2 A;  3RO2 A;  1EF1 C;  3HHM A;  5CCL A;  3FUI A;  2HYZ A;  2WQH A;  3FDH A;  4CT4 A;  4NAC A;  1PY1 A;  4BFR A;  2FUL A;  2KZT B;  3IHY A;  4AY6 A;  4JXT A;  2E0I A;  1H2T C;  2XPI A;  2WMN A;  3UT4 A;  3S7J A;  1PC2 A;  2QFC A;  4IUL A;  3FTW A;  4LEU A;  2WXM A;  4JZY A;  1H6K A;  3I4R B;  1Y6I A;  3SGH A;  3MEK A;  3ASF A;  4I17 A;  4UWH A;  4A1G A;  3DPD A;  3FTU A;  3MJW A;  4DLQ A;  2XCC A;  3BEE A;  2WPV A;  3G2U A;  3OXL A;  3IBE A;  2I1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...