3RRUA

X-ray crystal structure of the vhs domain of human tom1-like protein, northeast structural genomics consortium target hr3050e
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
DPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords TOM1L1 protein
publication title X-ray crystal structure of the VHS domain of human TOM1-like protein, Northeast Structural Genomics Consortium Target HR3050E
rcsb
source organism Homo sapiens
total genus 44
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rruA00
1INZA 3ONLA 3G2VA 4HFGA 3G2WA 2L0IA 2L0TB 3D9NA 1JWGA 5J08A 1ELKA 3ZYQA 3D9MA 1SZAA 2LO6A 1XGWA 1LF8A 1EDUA 1X5BA 2KM4A 1HG2A 2QY7A 3D9IA 4GZCA 4JXTA 1HFAA 4Q94A 3ZYMA 1HG5A 4FU3A 4AVXA 1HF8A 4FLBA 1SZ9A 4GZDA 5CMWA 3D9KA 3D9LA 3ZYKA 2DCPA 5CMYA 1H0AA 3D9JA 5LOZA 3RRUA 3ZYLA 4NACA 1VDYA 2MOWA 3G2UA 1MHQA 1DVPA 1UJKA 3ONKA 3CLJA 3G2TA 1EYHA 3D9OA 4Q96A 5LP0A 2V8SE 3LDZA 3D9PA 3G2SA 1PY1A 2DIWA 1HX8A 1JUQA 1JWFA 1UJJA 1JPLA 2BF0X
chains in the Genus database with same CATH superfamily
5HKPA 3D9HA 4AOFA 2I9CA 4BESA 4C9BB 3JYSA 1SVXA 3Q49B 4WAFA 2QYJA 3ASGA 4CT0A 5CCLA 3G2TA 2JLBA 3LYAA 3EJNA 5B1AE 4N3AA 3B7RL 3PUJA 3S7FA 3ZEFA 1IHGA 4HBDA 5BXUA 2I1JA 1WY6A 5C1DA 3CVNA 4UQZA 4ILIA 5A23A 3E37A 4BT9A 5BV1A 4TXPA 4U8VD 1UW4B 4YVQC 2GRLA 3HG0D 3KSLA 3QB2A 2E2EA 3X2QE 1TNUA 4DK5A 3HVEB 1EDUA 3SFZA 4L2YA 2V0PA 2V4HC 2OEWA 4JC8A 5BXOA 3CVXA 3ASOE 3QWPA 2WXHA 4DJAA 3QKYA 1MQSA 1Y8MA 2NXPA 2Y4TA 1N52A 3LY9A 2B0OE 3ZKJA 5DBKA 4CDRA 3ASNE 2WXRA 3ZXSA 2R5SA 2LAHA 3TWTA 3PE4A 4EZKA 2RFMA 3FWVA 5JHBA 1KLXA 3APDA 3BUAA 2IO3C 3AG3E 1HF8A 4PS8A 2R05A 4GA0A 4DRXE 3MEKA 4HOUA 4U07A 2WM9A 3EIQC 2OVBA 2XGMA 4GA1A 4KZ0A 4ATZD 3FUEA 2L6BA 5KNHD 1U3DA 4GZ5A 1OUVA 5AJDA 1E7VA 2GRRB 3GZ1A 4NQ0A 4XI0A 1W3BA 2WQ6A 4LCTA 1H19A 1FPPA 4CZ2D 2ETCA 2PQRA 4QQIA 3VTXA 2P9UG 1JCRA 1ZBPA 1N0QA 4HXIA 1H6OA 2P58C 5FTPA 5C2YA 3AAAC 3ULYA 3W9GA 3G2UA 2LXMA 2I1KA 2H6HA 4GCOA 4GPMA 4DX1A 1Z3XA 5FWQA 4O1OA 4HFGA 4ME2A 3S7DA 3RU0A 4GTVA 2EIKE 3L22A 1K8KG 1HXIA 2ZGDA 5T3RA 3T8KA 4O60A 2ILRA 4J8FA 3WXXA 3SZ7A 2XENA 2ZIRA 5ENRD 4G8KA 4ANXA 2NC9A 3V2OA 2ONDA 2LO6A 2WMOA 5LOZA 4FU3A 5CRVA 3AG4E 2QYUA 2M63A 3ZYLA 3FHEA 5KJNA 3ESLA 3L6AA 2H6GA 3CK9A 4B0ZA 5JMND 4N5QA 3DXMG 5D0OD 4EBAA 2DVWA 2BKGA 4XKBA 3G2VA 4CEMA 3R7QA 3FUKA 4Q94A 1IQUA 2XS1A 4J8YA 4UUCA 4B94A 3VLDA 3L54A 5EX3A 2H6FA 3Q4AB 4JVSA 3CHSA 4AM9A 3O4ZA 3FUMA 3QC1A 1S64A 4HRNA 3CK8A 4JB8P 4BX9A 4ILGA 3IKOB 3ZRHA 4C0EA 4HLEA 2WXQA 5G04C 3I3NA 3S7JA 2GRMA 1VDYA 1Z6TA 3DBSA 3TG4A 1O1RA 4K5BA 3S2AA 4HOSA 4XZ4A 2YHCA 2P9IG 4KYOB 3UINC 2KZTA 1MYOA 2FEZA 1RW2A 3Q9UC 3NBNB 1D9SA 3FUHA 5CMYA 3MKQA 5FQ4A 2VSNA 5JJ6A 4GMRA 2L6JA 1E8XA 3TGOA 2WQ7A 3C3RA 3GW4A 1U3CA 4UWKA 2XQ0A 4E6HA 2Q7FA 3F6QA 3GYZA 4KT6B 3T8MA 5LFAA 1Y6IA 2DBAA 2A5UA 2FF4A 5KJLA 3KEZA 4FP7A 3Q15A 3IHVA 2IF4A 3TL5A 3JXJA 5LX8A 4BEPA 2LAIA 2KC7A 4KVMA 4DX6D 3APFA 3UM1A 4EHMA 4APFA 3FTWA 1UJJA 3DWLG 1E90A 1IKND 3LCAA 2RKKA 2QY7A 3RJVA 1DCEA 4HI8A 5CMWA 4WNDA 3ULEG 1O1SA 4GYWA 5FQ7A 1O5MA 2DYSE 3FFLA 4N39A 5CCMA 5ITZF 3DPYA 5ENSD 2FO1E 2WB2A 4J0UA 1TNBA 4U7EB 3QAQA 4JL0A 3PEVB 3PZ1A 2PM7A 5KBAA 3Q47B 3NOGD 4OVVA 4UI9J 3ZUVB 4A55A 3D9OA 3LVQE 2WVIA 3TG5A 2DYRE 3L13A 1NP7A 3NAWA 3IEGA 3Q75A 2L0IA 4GA2A 3UT8A 3URZA 4KZCA 2X3MA 3C72A 3QJZA 4AY5A 3UM3A 1UJKA 4CDNA 4LEUA 2XHEA 3FU3A 4TV3A 3MKRA 4YNDA 3LEWA 1PY1A 4A1GA 4FHJA 1HO8A 3MV2B 4LSZE 1JWGA 5CECB 3I4GA 4MS6A 3ZYMA 3EU5A 5FQ8A 4GZ6A 4R7LA 3CQGB 3ZPJA 2RFAA 3CK7A 1SA4A 3IXEA 1BU9A 3ASDA 1TN8A 3CKBA 4L23A 4Z68A 5CRUA 2CFUA 4ZHBA 2X6FA 2AJAA 4UWHA 4GB9A 5JHAA 3MX3A 1BPOA 2A5EA 1A17A 5JJ7A 3QDNA 5HQ8A 3CVUA 5KJMA 1HE8A 2J8SD 2BKKB 4ACKA 1TJCA 4WNFA 5AYWD 5B3SE 1HH8A 4DX7D 1NA3A 2VGEA 4UWGA 4E85A 1HG5A 5EIBE 3SNXA 3FEYA 3TWWA 2XS8A 3HXDA 2XEEA 4MLPA 4LNGA 1DCQA 3R9AB 2KZTB 3RRNB 3V2XA 3Q79A 4BTBA 5BV0A 4XEIG 2IO2C 3EHQA 4G25A 5FJYA 1EPUA 1LF8A 2RD0A 2R02A 4U8YD 5ANLA 3LXUX 3V30A 2GGFA 1N4SA 3ASHA 1Z5SC 2X38A 3JQ0A 3HXCA 3ZXPA 3FU5A 3AJIA 4DUIA 3HXBA 1IYGA 3U9WA 3ULQA 3D3MA 3AS8A 2VSOE 1WAO1 1H2UA 1AWCB 2V8SE 2XZTG 3BEEA 3LY7A 4GPKA 2PQNA 3ZIMA 1UOHA 4TUUA 4FJZA 3IHYA 3LKUA 3MA5A 3AU5A 4U8HA 2XCBA 3DXKG 4N2QA 3EHMA 5CBNA 3FTSA 4YDYA 5D66A 3FTYA 3FTZA 1FVHA 3JCKC 3CHOA 3EIJA 3FEXA 5KNGA 4OAVB 1E7UA 3PZ3A 3RRMB 3CVVA 4ZFHA 2WXMA 3ZHEA 4EZLA 5G05J 4AIFA 2KXPC 3DSVA 1MHQA 3TJPA 2XGOA 3P2BA 2AVPA 4GTOA 5LCWJ 3U64A 2Y4UA 1OWLA 4AV7A 1OCCE 1V54E 1LD7A 3V31A 4GTSA 5CERB 4U0UA 3SY2A 4UI9K 2R17C 3PUKA 2VGYA 1HX8A 3LY8A 2Y3AA 4IRUA 4MKTA 2DWZA 3FTXA 3DSTA 3DSUA 1UG3A 1TN6A 1SW6A 3FTUA 1G3NB 2LNIA 4IYPA 3BU8A 1QQEA 3SFXA 3AG1E 5AQ9A 4JZYA 3J5QB 1N54A 1DC2A 1MX2A 3CSFA 3T9KA 1H0AA 4F6RD 3UM0A 3L16A 2HO1A 4TUMA 4G2VA 2WXLA 2IU1A 5EILA 4AEZC 3KAEA 3MCXA 3C3QA 3HXFA 4AVXA 2PL2A 4XE0A 1KPSB 3LJNA 2IONA 1H6PA 4JHJA 5EN5D 5IY5E 5AQAA 3JQ1A 4G23A 4I6JA 5J08A 4K0RA 3SGHA 2I2OA 4W9RA 5CEAA 5KWDA 4XIFA 3D9LA 5EIDA 4CDMA 3UPVA 1PC2A 4ACLA 5BNWA 4HORA 4J7WA 3KS2A 2KATA 2XCCA 1OWMA 5T8IA 3FH5A 3ML9A 2ZISA 5ENTD 2L9BA 4OYSA 1D8EA 3J5PA 3TWRA 3ZW3A 4F1PA 2VYIA 3BQOA 4GZ3A 2J49A 3L17A 3Q7FA 2CHWA 3CR3A 4BT8A 3VLFA 3UUXA 3N71A 3UXGA 3NZUA 2CG2A 4ABNA 2P9PG 3R7RA 5G2NA 3FULA 3PH0C 4DX5D 4U0SA 2DZOA 4G24A 1KT1A 3C98A 2ETBA 4U63A 3CVQA 3ONLA 3IV0A 3T5XA 2HE0A 2A4ZA 3PREA 3ZYKA 3LPZA 1MX6A 1NFIE 3PEUB 3B95A 2X6JA 2XRYA 3DSSA 4N5CA 3RKVA 3HXEA 3CIAA 2XPIA 5H7PA 5G55A 4LNUD 2MYOA 3L08A 3AG2E 4ANVA 2CG3A 4B8CB 2BTDA 4FLBA 3CKCA 1NL4A 3Q7AA 4GYYA 4HI9A 4FJYA 3TWQA 4FADA 4BTAA 2J09A 5AJLA 4EQFA 2IEJA 5FT9A 3SD5A 3CHPA 2F8YA 3DRAA 1X5BA 4I9EA 5B1BE 3PZ4A 2HYZA 4U0ZA 5AAOA 5FZRA 3CVPA 3E32A 5DIZA 3UMVA 2H6IA 3HIZA 5BW8C 3D9NA 3FY4A 3B7UX 2ETAA 3R9MA 4A63B 3Q9NC 1DNPA 4P29A 3SBTB 2J4BA 5KJKA 3K9IA 3BG1B 4NRHB 4FA6A 4K03A 5E75A 4HRLA 3U4TA 1UN8A 3JUIA 4EPZA 3D9MA 1ELRA 3EDTB 2Y0BG 4JW1A 2JEKA 1SQMA 1Z3YA 3OXLA 1N4RA 1BD8A 3L9TA 4G1TA 3U3WA 2P2CP 4AXHA 3FH8A 2C0MA 3FUNA 5EDSA 3ABKE 4I1AA 4XKCA 1NI1A 5D0QD 4Y6CA 1LTXA 4I1MA 4XI9A 4APOA 2WXKA 3UQ3A 3D9JA 4G8LA 2CHZA 1HU3A 4CRWA 5CEDB 3ZFWA 4OAUC 1BLXB 1TEZA 2FO7A 5A7DB 4HOTA 3TXNA 2E0IA 3ZN3A 2LSVA 5ENNA 1IQRA 2J9QA 4HOQA 3D9IA 3PE3A 4F7AA 3RO3A 4GMJA 1K1BA 2XEVA 4FULA 4K5CA 3LS8A 4DI4A 4O6FA 2MHKA 4AY6A 3MV3B 3E4BA 5FIOA 3VTYA 4LUNU 1TN7A 3FU0A 4JA7A 5E76A 4LG6A 2NSZA 3U66A 3CVYA 1UN9A 2DCPA 2J08A 2BUGA 3CLJA 3DPDA 1YYHA 3V79K 2WXFA 5HI7A 1JWFA 4UWFA 4FC8A 3UT7A 4RG9A 2KCLA 4YDEA 2V4LA 3FTVA 1WG0A 4O1PA 2P9LG 4M3OA 4BX8A 3UIPC 4QFVA 3UTMA 1OY3D 3HRAA 4ANWA 3OXFA 3UKRG 3ZU7B 3D9PA 4GYOA 4HB5A 3APCA 2EIME 4J6IA 5FZSA 1EF1C 1PAQA 2IQCA 2UWJG 4J8EA 3VLEA 4YVOA 2ZXWE 2B6CA 1H2TC 4F1SA 3UM2A 3S7BA 3TWXA 2KCVA 4G11A 1BI7B 4KVOA 2VSYA 1S0PA 4JPSA 4AP2A 3DEPA 4RG6A 1WM5A 1YCSB 2V5FA 3MKQB 3SQVA 5G04J 4PDXA 3RK6A 4HS2A 3ZGQA 3Q5MA 3HDXA 2GW1A 2GRPB 5BPPA 5JA4D 3HHMA 5J90A 2R03A 1AP7A 1SZAA 2KM4A 3BG0B 3W9FA 2VTBA 2R59A 2YINA 4L9PA 4TXQA 5BUZA 5ANRA 1E8YA 3CHQA 3SI5A 1K1AA 1NZNA 3B7BA 4EZJA 1D8DA 1HS6A 3I5PA 3SBSA 4OVUA 2WQHA 4DI3A 2HR2A 1ZB1A 3SFYA 3UX4A 2ZGGA 1N4PA 4N2SA 2UY1A 1N94A 4RQIA 2XGSA 2QZAA 3ABLE 5AQBA 1N95A 4JHRA 4V3IA 1OXJA 4BERA 4J8DA 4Q69A 4NURA 2AWIA 3FU6A 5FINA 4GTMA 3TWVA 1A5EA 2BEDA 5HRYA 2X6IA 4Q96A 1TNZA 4YDWA 2OEVA 3EU9A 2L0TB 4MRUA 3LJ3A 4LNBA 2IOLA 1MJ0A 3ASFA 2WXGA 5EYPF 5A6CA 4HRMB 3RIBA 5FZQA 2P9KG 3JUEA 2PZIA 4I2ZA 2WXIA 3CSTA 5M72A 3QOUA 1QBQA 4PS3A 4WWNA 3QWVA 2GRQB 1RZ4A 3B7TA 3ZVVA 3TXMA 3RO2A 1B89A 3OXGA 5EYLA 4HVBA 2X6HA 3AU4A 1OCRE 4PUCA 2MOWA 4G26A 4L1BA 3QARA 2MRIA 1IXVA 4KBQA 1TYQG 4UQXA 3FUFA 3QWWA 1INZA 4DLOA 2WXNA 3ZYQA 2EIJE 3FP3A 3SF4A 1OCOE 2IFUA 2VGXA 3CV0A 4C0MA 1FVFA 2WXPA 5AARA 2GROB 4XX5A 5CHEE 3LVRE 4LERA 3C5RA 2ZU6B 2XRZA 3ESKA 4RVBA 2LUHA 2AXUA 3O48A 4YDOA 4UI9C 1SA5A 4M7CA 3UI2A 3Q78A 3PVLA 4WWOA 4CGVA 4GTPA 4PH4B 2VSXE 4JEHA 4BETA 4BSXA 4DLQA 1YA0A 3D9KA 4FLHA 1JCSA 4TXRA 2P9NG 3TAXA 1EYHA 3WG7E 2QC9A 4BWRA 4KXKB 4B8AA 5AIJA 2QFCA 2CHXA 3FUDA 1TNYA 4IN3B 4RSYA 4PS7A 3UIOC 3PS6A 4BY6A 1SZ9A 2WXOA 4U95D 1N4QA 1OWPA 4J8SA 3I4RB 5D2MC 2PNNA 5AENA 1JCQA 1N9AA 3TWSA 1E8ZA 2VTBB 2OCCE 4MBGA 2V5QC 4AJWA 1MX4A 4GZDA 4F3VA 2FULA 3MZLB 3C3OA 1Q2ZA 1QYMA 3CVWA 1OT8A 5FQ6A 4I17A 3E34A 3CEQA 1ELKA 3NB2A 2UY1B 5EX0A 1E96B 4WUYA 4I6EA 2EILE 2F37A 3FDHA 4I1OB 3MGBA 3KSQA 2FI7A 1U2VG 2YQ8A 1H2VC 1JUQA 4TRQA 4DX2A 1P5QA 4A3TA 1X81A 2C2LA 5ARFA 3ZHEB 1KZPA 2OV8A 3ISMC 2HM8A 4URKA 2X6KA 4FHKA 3UKUG 3GZ2A 2XPZA 1N0RA 1H6KA 1KZOA 4H7YA 1TR4A 5T4YA 1MZCA 2C0LA 3RAUA 3EUVA 2FBNA 2R2LA 4A1SA 3RSEG 2Y69E 3FH7A 1BI8B 3EHNA 3PDNA 4GU5A 1OWNA 4L7TA 1JPLA 5BT1A 4EECA 1S70B 4JEUA 3UT4A 4F53A 2OOEA 2NYJA 2AXVA 3MJWA 4JXTA 4CYMD 2WXJA 3CGHA 3JXIA 3NQPA 1K3ZD 4X8QA 1DVPA 3OAWA 5LP0A 2Y1LE 3G2SA 3PRZA 2XPYA 5G05C 4JHKA 4GMLA 1XGWA 2VGXB 4NACA 5HS0A 3E30A 1L5JA 3KD7A 2VJ8A 5JJTA 2J4DA 4L2LA 5LCWC 4UWLA 3PNLB 3TWUA 4HNAD 1NA0A 4GZCA 2VQ2A 3HVEA 4ATGA 3OTNA 4GTRA 4WWPA 3E33A 5ENQD 1FT2A 3LDZA 3FUJA 4D10C 2XZDG 1KT0A 4JA9A 5EKQD 3PNTB 3NZSA 4ILHB 4HQDA 4I2WA 3G2WA 2AXZA 1HG2A 3B13A 1WDYA 4IULA 4WNGA 4GAAA 3RRUA 4CCAA 2XEHA 4B93B 4N3BA 4U04A 1TNOA 3PZ2A 2WMNA 4N3CA 4RLYA 3MYVA 4H7XA 3L82A 4I6GA 2P9SG 2CFZA 3GZSA 4Y6WA 2AW6A 2EQXA 4I43A 1E8WA 5ENOD 2GRNB 4CGWA 2IJGX 2J07A 3AS4A 2F0YA 4GCNA 5ARGA 1QNFA 1ELWA 2IY0C 4NIKA 3NF1A 3DSXA 3HYMB 3CHMA 3DEOA 4B89A 2WPVA 2KBXA 4DPRA 3IBEA 2EINE 2DZNA 2DIWA 3ENEA 2YHEA 3B7SA 4HLLA 4CT4A 2PM6A 2LSUA 3QNKA 5KCMA 2IOSA 1OWOA 1YMPA 1QZ2A 2RG8A 3EHRA 5ENPD 1O1TA 2YNQA 4U96D 3ABME 5AQ7A 3NOCD 4GTTA 4C48B 1GW6A 2LXLA 2KCKA 3FUIA 3KEAA 1V55E 1FCHA 1HFAA 4ANUA 1FT1A 3T5VA 3Q73A 4WNEA 3CHRA 3ONKA 5CBOA 1TJFA 4LRZA 1S63A 4JD2G 4I9CA 3DSWA 2F8XK 2BF0X 1OCZE 4BSZB 3CQCB 1LD8A 1XNFA 1N11A 2OVFA 2I6HA 3PZDA 5AN8A 3P1UA 3SHFA 3ML8A 3CVLA 4K5AB 3QK0A 4EBAG 3AS5A 3ZNGA 4BFRA 1ZU2A 1IHBA 3SO8A 4A3VA 4UQYA 4KMOA 4GTQA 2JABA 1HZ4A
chains in the Genus database with same CATH topology
1NP7A 5G55A 2ZU6B 3IEGA 2L0IA 2XRZA 4GA2A 3L08A 3ESKA 4AOFA 4ANVA 2CG3A 2I9CA 4RVBA 3UT8A 4B8CB 3URZA 4C9BB 2BTDA 4KZCA 3JYSA 2X3MA 2AXUA 3CKCA 3Q49B 4FLBA 3QJZA 3O48A 4UI9C 4WAFA 3ASGA 4CT0A 4GYYA 4AY5A 1UJKA 5CCLA 4CDNA 3G2TA 2JLBA 4FJYA 4FADA 3LYAA 4LEUA 2XHEA 3EJNA 3PVLA 4WWOA 3FU3A 4TV3A 3MKRA 4YNDA 3LEWA 4N3AA 4CGVA 4BTAA 1PY1A 4A1GA 2J09A 5AJLA 4EQFA 3B7RL 4FHJA 5FT9A 3SD5A 1HO8A 4PH4B 3CHPA 3MV2B 3PUJA 1JWGA 3S7FA 2VSXE 4JEHA 3ZEFA 4BSXA 1IHGA 1X5BA 3I4GA 4I9EA 2I1JA 4MS6A 3ZYMA 1WY6A 2HYZA 4GZ6A 5FQ8A 4DLQA 1YA0A 4U0ZA 3D9KA 4R7LA 5FZRA 3CVNA 4UQZA 3CQGB 4FLHA 4ILIA 3CVPA 3ZPJA 5A23A 3CK7A 4BT9A 3TAXA 5BV1A 1EYHA 5DIZA 3UMVA 4BWRA 1UW4B 3ASDA 3CKBA 4KXKB 4L23A 4B8AA 5AIJA 4YVQC 2GRLA 3HIZA 2QFCA 3QB2A 2E2EA 5BW8C 2CFUA 2CHXA 3D9NA 3FY4A 3B7UX 3FUDA 4DK5A 4IN3B 4RSYA 2X6FA 4PS7A 3PS6A 3HVEB 1EDUA 3SFZA 4UWHA 4BY6A 4GB9A 5JHAA 3MX3A 4L2YA 2V0PA 1SZ9A 1BPOA 1DNPA 2WXOA 4P29A 1OWPA 3SBTB 4J8SA 1A17A 4JC8A 3I4RB 2J4BA 5KJKA 3CVXA 3K9IA 5JJ7A 3QDNA 5HQ8A 3QWPA 3CVUA 2WXHA 4DJAA 3BG1B 5AENA 3QKYA 4NRHB 5KJMA 1HE8A 4FA6A 4K03A 1MQSA 5E75A 1Y8MA 2NXPA 2Y4TA 4ACKA 3U4TA 1TJCA 1UN8A 4WNFA 5AYWD 3JUIA 1E8ZA 1HH8A 1N52A 4EPZA 3D9MA 3LY9A 1ELRA 1NA3A 2VTBB 3EDTB 4UWGA 4E85A 4JW1A 1HG5A 2JEKA 3SNXA 4AJWA 3FEYA 4GZDA 4F3VA 2FULA 1SQMA 1Z3YA 3MZLB 3OXLA 5DBKA 4CDRA 4G1TA 4MLPA 3CVWA 3U3WA 4AXHA 3R9AB 3FH8A 2KZTB 3RRNB 2C0MA 3FUNA 2WXRA 5EDSA 3ZXSA 4I1AA 5FQ6A 4XKCA 2R5SA 2LAHA 4I17A 4BTBA 3PE4A 5BV0A 3CEQA 1ELKA 4G25A 5D0QD 3FWVA 4Y6CA 5FJYA 1EPUA 4EZKA 5JHBA 2UY1B 1KLXA 1LF8A 3APDA 5EX0A 1E96B 2RD0A 4I1MA 4XI9A 4APOA 4WUYA 4I6EA 1HF8A 2WXKA 5ANLA 4PS8A 4GA0A 3LXUX 3UQ3A 3D9JA 3MEKA 4HOUA 3FDHA 2GGFA 2CHZA 1HU3A 4I1OB 4U07A 4CRWA 3MGBA 3ASHA 3ZFWA 2WM9A 2FI7A 1TEZA 2X38A 2FO7A 5A7DB 4HOTA 2YQ8A 1H2VC 3JQ0A 3TXNA 3FU5A 3EIQC 2E0IA 1JUQA 4TRQA 1P5QA 2OVBA 2C2LA 2XGMA 4GA1A 3ZN3A 4KZ0A 4A3TA 3FUEA 2LSVA 5ENNA 1U3DA 5ARFA 4GZ5A 1OUVA 5AJDA 3ZHEB 1IQRA 3U9WA 1IYGA 2J9QA 4HOQA 1E7VA 3D9IA 2OV8A 3GZ1A 3PE3A 4F7AA 3ULQA 4NQ0A 3RO3A 2HM8A 4URKA 2X6KA 3D3MA 3AS8A 2VSOE 4GMJA 4XI0A 4FHKA 1W3BA 1WAO1 2XEVA 3GZ2A 4FULA 1H2UA 2XPZA 2WQ6A 4LCTA 1H19A 2V8SE 3LS8A 1H6KA 4H7YA 4DI4A 4O6FA 2MHKA 5T4YA 4AY6A 3BEEA 3LY7A 4GPKA 2PQRA 3MV3B 3VTXA 2C0LA 2PQNA 3ZIMA 3E4BA 1ZBPA 4TUUA 4FJZA 2FBNA 4HXIA 3VTYA 3IHYA 4LUNU 4A1SA 3LKUA 3FU0A 4JA7A 5E76A 2NSZA 2P58C 5FTPA 5C2YA 3U66A 3MA5A 3CVYA 3AU5A 1UN9A 3FH7A 2DCPA 4U8HA 2XCBA 4N2QA 3EHNA 2J08A 3G2UA 2I1KA 3EHMA 2BUGA 3CLJA 3DPDA 3FTSA 4GCOA 3PDNA 4GU5A 1Z3XA 3FTYA 1OWNA 5FWQA 2WXFA 3FTZA 5HI7A 1FVHA 1JWFA 4UWFA 4FC8A 1JPLA 4L7TA 5BT1A 3UT7A 4EECA 3JCKC 3CHOA 4JEUA 3UT4A 4HFGA 4RG9A 3EIJA 2KCLA 4F53A 3FEXA 4ME2A 1E7UA 2OOEA 3RRMB 3CVVA 2AXVA 2WXMA 3MJWA 4JXTA 5G05J 2V4LA 3RU0A 3S7DA 3FTVA 3ZHEA 4EZLA 3L22A 4AIFA 2WXJA 3CGHA 3NQPA 1HXIA 4M3OA 1MHQA 5T3RA 1DVPA 4BX8A 3OAWA 2ILRA 4QFVA 3TJPA 4J8FA 3WXXA 3SZ7A 4ANWA 5LP0A 2XGOA 3OXFA 3P2BA 3D9PA 3G2SA 2AVPA 3PRZA 2XPYA 4ANXA 4GYOA 3APCA 2NC9A 4J6IA 5LCWJ 2ONDA 5FZSA 5G05C 1EF1C 4JHKA 1PAQA 4GMLA 2IQCA 2LO6A 1XGWA 2UWJG 2WMOA 4J8EA 5LOZA 3TG5A 3U64A 2Y4UA 1OWLA 4FU3A 4AV7A 3VLEA 2VGXB 4YVOA 2M63A 3ZYLA 3FHEA 4NACA 5KJNA 4U0UA 3ESLA 3L6AA 4UI9K 1H2TC 1L5JA 2R17C 3KD7A 4F1SA 3PUKA 3CK9A 4B0ZA 2VJ8A 5JJTA 2J4DA 4L2LA 2VGYA 1HX8A 3LY8A 3S7BA 2KCVA 5D0OD 4EBAA 2Y3AA 4UWLA 4G11A 5LCWC 4IRUA 4MKTA 4XKBA 4KVOA 3G2VA 3PNLB 2VSYA 1S0PA 4JPSA 4AP2A 3FTXA 4CEMA 3R7QA 4RG6A 1WM5A 1NA0A 4GZCA 3FUKA 2VQ2A 1IQUA 4Q94A 2V5FA 4B94A 3HVEA 4ATGA 3MKQB 5G04J 3OTNA 1UG3A 4PDXA 3RK6A 4WWPA 3VLDA 3L54A 4HS2A 3ZGQA 3Q5MA 5EX3A 3HDXA 2GW1A 3LDZA 3Q4AB 4JVSA 3FTUA 3CHSA 3FUJA 4D10C 2LNIA 1KT0A 3O4ZA 4JA9A 4IYPA 4AM9A 3FUMA 3QC1A 5BPPA 3HHMA 1QQEA 5J90A 5EKQD 3PNTB 3CK8A 3NZSA 4ILHB 4BX9A 4I2WA 3G2WA 4JZYA 2AXZA 4ILGA 3IKOB 1N54A 1SZAA 2KM4A 3BG0B 3ZRHA 4C0EA 4HLEA 1HG2A 3B13A 2WXQA 3CSFA 4IULA 5G04C 4WNGA 2VTBA 2R59A 3I3NA 2YINA 1H0AA 3S7JA 2GRMA 4GAAA 3RRUA 5BUZA 1VDYA 5ANRA 1Z6TA 1E8YA 3DBSA 3TG4A 3CHQA 4CCAA 3SI5A 1NZNA 4EZJA 3S2AA 4HOSA 4N3BA 4XZ4A 1HS6A 3I5PA 4U04A 3SBSA 2YHCA 3L16A 4OVUA 2HO1A 2WMNA 4KYOB 2WQHA 4N3CA 4DI3A 3MYVA 2KZTA 4G2VA 2HR2A 2WXLA 2IU1A 4H7XA 5C1DA 4AEZC 3KAEA 3MCXA 2FEZA 3UX4A 4I6GA 5CHEE 4N2SA 3FUHA 4AVXA 2CFZA 2UY1A 2PL2A 4XE0A 5CMYA 3GZSA 4Y6WA 2AW6A 2EQXA 4I43A 1E8WA 3MKQA 5FQ4A 2VSNA 2IONA 2XGSA 5JJ6A 4CGWA 2IJGX 2J07A 4JHJA 3AS4A 4GCNA 4JHRA 4V3IA 2L6JA 1E8XA 5ARGA 1QNFA 3JQ1A 1ELWA 4J8DA 4Q69A 4G23A 4I6JA 3TGOA 5J08A 2WQ7A 4NURA 4K0RA 2AWIA 2I2OA 4W9RA 3FU6A 3SGHA 3GW4A 3NF1A 3HYMB 1U3CA 4UWKA 3CHMA 2XQ0A 4XIFA 4E6HA 2Q7FA 3D9LA 4CDMA 3UPVA 4B89A 2WPVA 3GYZA 1PC2A 4KT6B 3T8MA 4DPRA 2X6IA 4ACLA 4Q96A 5LFAA 5BNWA 3IBEA 4HORA 1Y6IA 2DBAA 2A5UA 2FF4A 2DIWA 5KJLA 3KS2A 3ENEA 3KEZA 2L0TB 4MRUA 3LJ3A 2KATA 2XCCA 4FP7A 3Q15A 1OWMA 2YHEA 3B7SA 5T8IA 2IOLA 3FH5A 3ASFA 3IHVA 2IF4A 4CT4A 3TL5A 3ML9A 2PM6A 5LX8A 2WXGA 2LSUA 2LAIA 3QNKA 5KCMA 2IOSA 2KC7A 1OWOA 2L9BA 4KVMA 5A6CA 3APFA 3RIBA 4OYSA 5FZQA 1QZ2A 2RG8A 3ZW3A 2PZIA 2VYIA 4GZ3A 4I2ZA 2WXIA 3CSTA 5M72A 3QOUA 2J49A 2YNQA 3FTWA 4APFA 4PS3A 3L17A 1UJJA 4WWNA 2CHWA 3CR3A 3QWVA 1GW6A 4BT8A 3VLFA 1E90A 3LCAA 3UUXA 2KCKA 3B7TA 3FUIA 3N71A 3TXMA 3ZVVA 3RO2A 2QY7A 3NZUA 1B89A 3OXGA 1FCHA 3RJVA 4HVBA 1HFAA 2CG2A 4ABNA 2X6HA 3AU4A 4ANUA 5CMWA 3R7RA 4WNDA 3T5VA 5G2NA 3FULA 3PH0C 4PUCA 4WNEA 2MOWA 4G26A 4L1BA 4U0SA 3CHRA 3ONKA 3QARA 4GYWA 2MRIA 1TJFA 5FQ7A 4G24A 4LRZA 1KT1A 4KBQA 3C98A 3FFLA 4I9CA 4UQXA 3FUFA 3QWWA 4U63A 2BF0X 3CVQA 1INZA 3ONLA 3IV0A 4N39A 4DLOA 5CCMA 2WXNA 3T5XA 3ZYQA 3CQCB 3FP3A 1XNFA 3SF4A 2WB2A 4J0UA 2OVFA 2A4ZA 3PREA 2I6HA 3QAQA 3ZYKA 3LPZA 4JL0A 2IFUA 3PZDA 3PEVB 2PM7A 3PEUB 2VGXA 2X6JA 3Q47B 2XRYA 4OVVA 4UI9J 4A55A 3P1UA 3SHFA 3CV0A 3D9OA 1FVFA 3CVLA 2WXPA 3ML8A 3QK0A 4N5CA 4C0MA 3LVQE 3RKVA 3CIAA 4EBAG 3AS5A 2WVIA 2XPIA 4BFRA 4XX5A 1ZU2A 4A3VA 4UQYA 4KMOA 4LERA 3LVRE 3L13A 1HZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1INZ A;  3ONL A;  3G2V A;  4HFG A;  3G2W A;  2L0I A;  2L0T B;  3D9N A;  1JWG A;  5J08 A;  1ELK A;  3ZYQ A;  3D9M A;  1SZA A;  2LO6 A;  1XGW A;  1LF8 A;  1EDU A;  1X5B A;  2KM4 A;  1HG2 A;  2QY7 A;  3D9I A;  4GZC A;  4JXT A;  1HFA A;  4Q94 A;  3ZYM A;  1HG5 A;  4FU3 A;  4AVX A;  1HF8 A;  4FLB A;  1SZ9 A;  4GZD A;  5CMW A;  3D9K A;  3D9L A;  3ZYK A;  2DCP A;  5CMY A;  1H0A A;  3D9J A;  5LOZ A;  3RRU A;  3ZYL A;  4NAC A;  1VDY A;  2MOW A;  3G2U A;  1MHQ A;  1DVP A;  1UJK A;  3ONK A;  3CLJ A;  3G2T A;  1EYH A;  3D9O A;  4Q96 A;  5LP0 A;  2V8S E;  3LDZ A;  3D9P A;  3G2S A;  1PY1 A;  2DIW A;  1HX8 A;  1JUQ A;  1JWF A;  1UJJ A;  1JPL A;  2BF0 X; 
#chains in the Genus database with same CATH topology
 5HKP A;  3D9H A;  4AOF A;  2I9C A;  4BES A;  4C9B B;  3JYS A;  1SVX A;  3Q49 B;  4WAF A;  2QYJ A;  3ASG A;  4CT0 A;  5CCL A;  3G2T A;  2JLB A;  3LYA A;  3EJN A;  5B1A E;  4N3A A;  3B7R L;  3PUJ A;  3S7F A;  3ZEF A;  1IHG A;  4HBD A;  5BXU A;  2I1J A;  1WY6 A;  5C1D A;  3CVN A;  4UQZ A;  4ILI A;  5A23 A;  3E37 A;  4BT9 A;  5BV1 A;  4TXP A;  4U8V D;  1UW4 B;  4YVQ C;  2GRL A;  3HG0 D;  3KSL A;  3QB2 A;  2E2E A;  3X2Q E;  1TNU A;  4DK5 A;  3HVE B;  1EDU A;  3SFZ A;  4L2Y A;  2V0P A;  2V4H C;  2OEW A;  4JC8 A;  5BXO A;  3CVX A;  3ASO E;  3QWP A;  2WXH A;  4DJA A;  3QKY A;  1MQS A;  1Y8M A;  2NXP A;  2Y4T A;  1N52 A;  3LY9 A;  2B0O E;  3ZKJ A;  5DBK A;  4CDR A;  3ASN E;  2WXR A;  3ZXS A;  2R5S A;  2LAH A;  3TWT A;  3PE4 A;  4EZK A;  2RFM A;  3FWV A;  5JHB A;  1KLX A;  3APD A;  3BUA A;  2IO3 C;  3AG3 E;  1HF8 A;  4PS8 A;  2R05 A;  4GA0 A;  4DRX E;  3MEK A;  4HOU A;  4U07 A;  2WM9 A;  3EIQ C;  2OVB A;  2XGM A;  4GA1 A;  4KZ0 A;  4ATZ D;  3FUE A;  2L6B A;  5KNH D;  1U3D A;  4GZ5 A;  1OUV A;  5AJD A;  1E7V A;  2GRR B;  3GZ1 A;  4NQ0 A;  4XI0 A;  1W3B A;  2WQ6 A;  4LCT A;  1H19 A;  1FPP A;  4CZ2 D;  2ETC A;  2PQR A;  4QQI A;  3VTX A;  2P9U G;  1JCR A;  1ZBP A;  1N0Q A;  4HXI A;  1H6O A;  2P58 C;  5FTP A;  5C2Y A;  3AAA C;  3ULY A;  3W9G A;  3G2U A;  2LXM A;  2I1K A;  2H6H A;  4GCO A;  4GPM A;  4DX1 A;  1Z3X A;  5FWQ A;  4O1O A;  4HFG A;  4ME2 A;  3S7D A;  3RU0 A;  4GTV A;  2EIK E;  3L22 A;  1K8K G;  1HXI A;  2ZGD A;  5T3R A;  3T8K A;  4O60 A;  2ILR A;  4J8F A;  3WXX A;  3SZ7 A;  2XEN A;  2ZIR A;  5ENR D;  4G8K A;  4ANX A;  2NC9 A;  3V2O A;  2OND A;  2LO6 A;  2WMO A;  5LOZ A;  4FU3 A;  5CRV A;  3AG4 E;  2QYU A;  2M63 A;  3ZYL A;  3FHE A;  5KJN A;  3ESL A;  3L6A A;  2H6G A;  3CK9 A;  4B0Z A;  5JMN D;  4N5Q A;  3DXM G;  5D0O D;  4EBA A;  2DVW A;  2BKG A;  4XKB A;  3G2V A;  4CEM A;  3R7Q A;  3FUK A;  4Q94 A;  1IQU A;  2XS1 A;  4J8Y A;  4UUC A;  4B94 A;  3VLD A;  3L54 A;  5EX3 A;  2H6F A;  3Q4A B;  4JVS A;  3CHS A;  4AM9 A;  3O4Z A;  3FUM A;  3QC1 A;  1S64 A;  4HRN A;  3CK8 A;  4JB8 P;  4BX9 A;  4ILG A;  3IKO B;  3ZRH A;  4C0E A;  4HLE A;  2WXQ A;  5G04 C;  3I3N A;  3S7J A;  2GRM A;  1VDY A;  1Z6T A;  3DBS A;  3TG4 A;  1O1R A;  4K5B A;  3S2A A;  4HOS A;  4XZ4 A;  2YHC A;  2P9I G;  4KYO B;  3UIN C;  2KZT A;  1MYO A;  2FEZ A;  1RW2 A;  3Q9U C;  3NBN B;  1D9S A;  3FUH A;  5CMY A;  3MKQ A;  5FQ4 A;  2VSN A;  5JJ6 A;  4GMR A;  2L6J A;  1E8X A;  3TGO A;  2WQ7 A;  3C3R A;  3GW4 A;  1U3C A;  4UWK A;  2XQ0 A;  4E6H A;  2Q7F A;  3F6Q A;  3GYZ A;  4KT6 B;  3T8M A;  5LFA A;  1Y6I A;  2DBA A;  2A5U A;  2FF4 A;  5KJL A;  3KEZ A;  4FP7 A;  3Q15 A;  3IHV A;  2IF4 A;  3TL5 A;  3JXJ A;  5LX8 A;  4BEP A;  2LAI A;  2KC7 A;  4KVM A;  4DX6 D;  3APF A;  3UM1 A;  4EHM A;  4APF A;  3FTW A;  1UJJ A;  3DWL G;  1E90 A;  1IKN D;  3LCA A;  2RKK A;  2QY7 A;  3RJV A;  1DCE A;  4HI8 A;  5CMW A;  4WND A;  3ULE G;  1O1S A;  4GYW A;  5FQ7 A;  1O5M A;  2DYS E;  3FFL A;  4N39 A;  5CCM A;  5ITZ F;  3DPY A;  5ENS D;  2FO1 E;  2WB2 A;  4J0U A;  1TNB A;  4U7E B;  3QAQ A;  4JL0 A;  3PEV B;  3PZ1 A;  2PM7 A;  5KBA A;  3Q47 B;  3NOG D;  4OVV A;  4UI9 J;  3ZUV B;  4A55 A;  3D9O A;  3LVQ E;  2WVI A;  3TG5 A;  2DYR E;  3L13 A;  1NP7 A;  3NAW A;  3IEG A;  3Q75 A;  2L0I A;  4GA2 A;  3UT8 A;  3URZ A;  4KZC A;  2X3M A;  3C72 A;  3QJZ A;  4AY5 A;  3UM3 A;  1UJK A;  4CDN A;  4LEU A;  2XHE A;  3FU3 A;  4TV3 A;  3MKR A;  4YND A;  3LEW A;  1PY1 A;  4A1G A;  4FHJ A;  1HO8 A;  3MV2 B;  4LSZ E;  1JWG A;  5CEC B;  3I4G A;  4MS6 A;  3ZYM A;  3EU5 A;  5FQ8 A;  4GZ6 A;  4R7L A;  3CQG B;  3ZPJ A;  2RFA A;  3CK7 A;  1SA4 A;  3IXE A;  1BU9 A;  3ASD A;  1TN8 A;  3CKB A;  4L23 A;  4Z68 A;  5CRU A;  2CFU A;  4ZHB A;  2X6F A;  2AJA A;  4UWH A;  4GB9 A;  5JHA A;  3MX3 A;  1BPO A;  2A5E A;  1A17 A;  5JJ7 A;  3QDN A;  5HQ8 A;  3CVU A;  5KJM A;  1HE8 A;  2J8S D;  2BKK B;  4ACK A;  1TJC A;  4WNF A;  5AYW D;  5B3S E;  1HH8 A;  4DX7 D;  1NA3 A;  2VGE A;  4UWG A;  4E85 A;  1HG5 A;  5EIB E;  3SNX A;  3FEY A;  3TWW A;  2XS8 A;  3HXD A;  2XEE A;  4MLP A;  4LNG A;  1DCQ A;  3R9A B;  2KZT B;  3RRN B;  3V2X A;  3Q79 A;  4BTB A;  5BV0 A;  4XEI G;  2IO2 C;  3EHQ A;  4G25 A;  5FJY A;  1EPU A;  1LF8 A;  2RD0 A;  2R02 A;  4U8Y D;  5ANL A;  3LXU X;  3V30 A;  2GGF A;  1N4S A;  3ASH A;  1Z5S C;  2X38 A;  3JQ0 A;  3HXC A;  3ZXP A;  3FU5 A;  3AJI A;  4DUI A;  3HXB A;  1IYG A;  3U9W A;  3ULQ A;  3D3M A;  3AS8 A;  2VSO E;  1WAO 1;  1H2U A;  1AWC B;  2V8S E;  2XZT G;  3BEE A;  3LY7 A;  4GPK A;  2PQN A;  3ZIM A;  1UOH A;  4TUU A;  4FJZ A;  3IHY A;  3LKU A;  3MA5 A;  3AU5 A;  4U8H A;  2XCB A;  3DXK G;  4N2Q A;  3EHM A;  5CBN A;  3FTS A;  4YDY A;  5D66 A;  3FTY A;  3FTZ A;  1FVH A;  3JCK C;  3CHO A;  3EIJ A;  3FEX A;  5KNG A;  4OAV B;  1E7U A;  3PZ3 A;  3RRM B;  3CVV A;  4ZFH A;  2WXM A;  3ZHE A;  4EZL A;  5G05 J;  4AIF A;  2KXP C;  3DSV A;  1MHQ A;  3TJP A;  2XGO A;  3P2B A;  2AVP A;  4GTO A;  5LCW J;  3U64 A;  2Y4U A;  1OWL A;  4AV7 A;  1OCC E;  1V54 E;  1LD7 A;  3V31 A;  4GTS A;  5CER B;  4U0U A;  3SY2 A;  4UI9 K;  2R17 C;  3PUK A;  2VGY A;  1HX8 A;  3LY8 A;  2Y3A A;  4IRU A;  4MKT A;  2DWZ A;  3FTX A;  3DST A;  3DSU A;  1UG3 A;  1TN6 A;  1SW6 A;  3FTU A;  1G3N B;  2LNI A;  4IYP A;  3BU8 A;  1QQE A;  3SFX A;  3AG1 E;  5AQ9 A;  4JZY A;  3J5Q B;  1N54 A;  1DC2 A;  1MX2 A;  3CSF A;  3T9K A;  1H0A A;  4F6R D;  3UM0 A;  3L16 A;  2HO1 A;  4TUM A;  4G2V A;  2WXL A;  2IU1 A;  5EIL A;  4AEZ C;  3KAE A;  3MCX A;  3C3Q A;  3HXF A;  4AVX A;  2PL2 A;  4XE0 A;  1KPS B;  3LJN A;  2ION A;  1H6P A;  4JHJ A;  5EN5 D;  5IY5 E;  5AQA A;  3JQ1 A;  4G23 A;  4I6J A;  5J08 A;  4K0R A;  3SGH A;  2I2O A;  4W9R A;  5CEA A;  5KWD A;  4XIF A;  3D9L A;  5EID A;  4CDM A;  3UPV A;  1PC2 A;  4ACL A;  5BNW A;  4HOR A;  4J7W A;  3KS2 A;  2KAT A;  2XCC A;  1OWM A;  5T8I A;  3FH5 A;  3ML9 A;  2ZIS A;  5ENT D;  2L9B A;  4OYS A;  1D8E A;  3J5P A;  3TWR A;  3ZW3 A;  4F1P A;  2VYI A;  3BQO A;  4GZ3 A;  2J49 A;  3L17 A;  3Q7F A;  2CHW A;  3CR3 A;  4BT8 A;  3VLF A;  3UUX A;  3N71 A;  3UXG A;  3NZU A;  2CG2 A;  4ABN A;  2P9P G;  3R7R A;  5G2N A;  3FUL A;  3PH0 C;  4DX5 D;  4U0S A;  2DZO A;  4G24 A;  1KT1 A;  3C98 A;  2ETB A;  4U63 A;  3CVQ A;  3ONL A;  3IV0 A;  3T5X A;  2HE0 A;  2A4Z A;  3PRE A;  3ZYK A;  3LPZ A;  1MX6 A;  1NFI E;  3PEU B;  3B95 A;  2X6J A;  2XRY A;  3DSS A;  4N5C A;  3RKV A;  3HXE A;  3CIA A;  2XPI A;  5H7P A;  5G55 A;  4LNU D;  2MYO A;  3L08 A;  3AG2 E;  4ANV A;  2CG3 A;  4B8C B;  2BTD A;  4FLB A;  3CKC A;  1NL4 A;  3Q7A A;  4GYY A;  4HI9 A;  4FJY A;  3TWQ A;  4FAD A;  4BTA A;  2J09 A;  5AJL A;  4EQF A;  2IEJ A;  5FT9 A;  3SD5 A;  3CHP A;  2F8Y A;  3DRA A;  1X5B A;  4I9E A;  5B1B E;  3PZ4 A;  2HYZ A;  4U0Z A;  5AAO A;  5FZR A;  3CVP A;  3E32 A;  5DIZ A;  3UMV A;  2H6I A;  3HIZ A;  5BW8 C;  3D9N A;  3FY4 A;  3B7U X;  2ETA A;  3R9M A;  4A63 B;  3Q9N C;  1DNP A;  4P29 A;  3SBT B;  2J4B A;  5KJK A;  3K9I A;  3BG1 B;  4NRH B;  4FA6 A;  4K03 A;  5E75 A;  4HRL A;  3U4T A;  1UN8 A;  3JUI A;  4EPZ A;  3D9M A;  1ELR A;  3EDT B;  2Y0B G;  4JW1 A;  2JEK A;  1SQM A;  1Z3Y A;  3OXL A;  1N4R A;  1BD8 A;  3L9T A;  4G1T A;  3U3W A;  2P2C P;  4AXH A;  3FH8 A;  2C0M A;  3FUN A;  5EDS A;  3ABK E;  4I1A A;  4XKC A;  1NI1 A;  5D0Q D;  4Y6C A;  1LTX A;  4I1M A;  4XI9 A;  4APO A;  2WXK A;  3UQ3 A;  3D9J A;  4G8L A;  2CHZ A;  1HU3 A;  4CRW A;  5CED B;  3ZFW A;  4OAU C;  1BLX B;  1TEZ A;  2FO7 A;  5A7D B;  4HOT A;  3TXN A;  2E0I A;  3ZN3 A;  2LSV A;  5ENN A;  1IQR A;  2J9Q A;  4HOQ A;  3D9I A;  3PE3 A;  4F7A A;  3RO3 A;  4GMJ A;  1K1B A;  2XEV A;  4FUL A;  4K5C A;  3LS8 A;  4DI4 A;  4O6F A;  2MHK A;  4AY6 A;  3MV3 B;  3E4B A;  5FIO A;  3VTY A;  4LUN U;  1TN7 A;  3FU0 A;  4JA7 A;  5E76 A;  4LG6 A;  2NSZ A;  3U66 A;  3CVY A;  1UN9 A;  2DCP A;  2J08 A;  2BUG A;  3CLJ A;  3DPD A;  1YYH A;  3V79 K;  2WXF A;  5HI7 A;  1JWF A;  4UWF A;  4FC8 A;  3UT7 A;  4RG9 A;  2KCL A;  4YDE A;  2V4L A;  3FTV A;  1WG0 A;  4O1P A;  2P9L G;  4M3O A;  4BX8 A;  3UIP C;  4QFV A;  3UTM A;  1OY3 D;  3HRA A;  4ANW A;  3OXF A;  3UKR G;  3ZU7 B;  3D9P A;  4GYO A;  4HB5 A;  3APC A;  2EIM E;  4J6I A;  5FZS A;  1EF1 C;  1PAQ A;  2IQC A;  2UWJ G;  4J8E A;  3VLE A;  4YVO A;  2ZXW E;  2B6C A;  1H2T C;  4F1S A;  3UM2 A;  3S7B A;  3TWX A;  2KCV A;  4G11 A;  1BI7 B;  4KVO A;  2VSY A;  1S0P A;  4JPS A;  4AP2 A;  3DEP A;  4RG6 A;  1WM5 A;  1YCS B;  2V5F A;  3MKQ B;  3SQV A;  5G04 J;  4PDX A;  3RK6 A;  4HS2 A;  3ZGQ A;  3Q5M A;  3HDX A;  2GW1 A;  2GRP B;  5BPP A;  5JA4 D;  3HHM A;  5J90 A;  2R03 A;  1AP7 A;  1SZA A;  2KM4 A;  3BG0 B;  3W9F A;  2VTB A;  2R59 A;  2YIN A;  4L9P A;  4TXQ A;  5BUZ A;  5ANR A;  1E8Y A;  3CHQ A;  3SI5 A;  1K1A A;  1NZN A;  3B7B A;  4EZJ A;  1D8D A;  1HS6 A;  3I5P A;  3SBS A;  4OVU A;  2WQH A;  4DI3 A;  2HR2 A;  1ZB1 A;  3SFY A;  3UX4 A;  2ZGG A;  1N4P A;  4N2S A;  2UY1 A;  1N94 A;  4RQI A;  2XGS A;  2QZA A;  3ABL E;  5AQB A;  1N95 A;  4JHR A;  4V3I A;  1OXJ A;  4BER A;  4J8D A;  4Q69 A;  4NUR A;  2AWI A;  3FU6 A;  5FIN A;  4GTM A;  3TWV A;  1A5E A;  2BED A;  5HRY A;  2X6I A;  4Q96 A;  1TNZ A;  4YDW A;  2OEV A;  3EU9 A;  2L0T B;  4MRU A;  3LJ3 A;  4LNB A;  2IOL A;  1MJ0 A;  3ASF A;  2WXG A;  5EYP F;  5A6C A;  4HRM B;  3RIB A;  5FZQ A;  2P9K G;  3JUE A;  2PZI A;  4I2Z A;  2WXI A;  3CST A;  5M72 A;  3QOU A;  1QBQ A;  4PS3 A;  4WWN A;  3QWV A;  2GRQ B;  1RZ4 A;  3B7T A;  3ZVV A;  3TXM A;  3RO2 A;  1B89 A;  3OXG A;  5EYL A;  4HVB A;  2X6H A;  3AU4 A;  1OCR E;  4PUC A;  2MOW A;  4G26 A;  4L1B A;  3QAR A;  2MRI A;  1IXV A;  4KBQ A;  1TYQ G;  4UQX A;  3FUF A;  3QWW A;  1INZ A;  4DLO A;  2WXN A;  3ZYQ A;  2EIJ E;  3FP3 A;  3SF4 A;  1OCO E;  2IFU A;  2VGX A;  3CV0 A;  4C0M A;  1FVF A;  2WXP A;  5AAR A;  2GRO B;  4XX5 A;  5CHE E;  3LVR E;  4LER A;  3C5R A;  2ZU6 B;  2XRZ A;  3ESK A;  4RVB A;  2LUH A;  2AXU A;  3O48 A;  4YDO A;  4UI9 C;  1SA5 A;  4M7C A;  3UI2 A;  3Q78 A;  3PVL A;  4WWO A;  4CGV A;  4GTP A;  4PH4 B;  2VSX E;  4JEH A;  4BET A;  4BSX A;  4DLQ A;  1YA0 A;  3D9K A;  4FLH A;  1JCS A;  4TXR A;  2P9N G;  3TAX A;  1EYH A;  3WG7 E;  2QC9 A;  4BWR A;  4KXK B;  4B8A A;  5AIJ A;  2QFC A;  2CHX A;  3FUD A;  1TNY A;  4IN3 B;  4RSY A;  4PS7 A;  3UIO C;  3PS6 A;  4BY6 A;  1SZ9 A;  2WXO A;  4U95 D;  1N4Q A;  1OWP A;  4J8S A;  3I4R B;  5D2M C;  2PNN A;  5AEN A;  1JCQ A;  1N9A A;  3TWS A;  1E8Z A;  2VTB B;  2OCC E;  4MBG A;  2V5Q C;  4AJW A;  1MX4 A;  4GZD A;  4F3V A;  2FUL A;  3MZL B;  3C3O A;  1Q2Z A;  1QYM A;  3CVW A;  1OT8 A;  5FQ6 A;  4I17 A;  3E34 A;  3CEQ A;  1ELK A;  3NB2 A;  2UY1 B;  5EX0 A;  1E96 B;  4WUY A;  4I6E A;  2EIL E;  2F37 A;  3FDH A;  4I1O B;  3MGB A;  3KSQ A;  2FI7 A;  1U2V G;  2YQ8 A;  1H2V C;  1JUQ A;  4TRQ A;  4DX2 A;  1P5Q A;  4A3T A;  1X81 A;  2C2L A;  5ARF A;  3ZHE B;  1KZP A;  2OV8 A;  3ISM C;  2HM8 A;  4URK A;  2X6K A;  4FHK A;  3UKU G;  3GZ2 A;  2XPZ A;  1N0R A;  1H6K A;  1KZO A;  4H7Y A;  1TR4 A;  5T4Y A;  1MZC A;  2C0L A;  3RAU A;  3EUV A;  2FBN A;  2R2L A;  4A1S A;  3RSE G;  2Y69 E;  3FH7 A;  1BI8 B;  3EHN A;  3PDN A;  4GU5 A;  1OWN A;  4L7T A;  1JPL A;  5BT1 A;  4EEC A;  1S70 B;  4JEU A;  3UT4 A;  4F53 A;  2OOE A;  2NYJ A;  2AXV A;  3MJW A;  4JXT A;  4CYM D;  2WXJ A;  3CGH A;  3JXI A;  3NQP A;  1K3Z D;  4X8Q A;  1DVP A;  3OAW A;  5LP0 A;  2Y1L E;  3G2S A;  3PRZ A;  2XPY A;  5G05 C;  4JHK A;  4GML A;  1XGW A;  2VGX B;  4NAC A;  5HS0 A;  3E30 A;  1L5J A;  3KD7 A;  2VJ8 A;  5JJT A;  2J4D A;  4L2L A;  5LCW C;  4UWL A;  3PNL B;  3TWU A;  4HNA D;  1NA0 A;  4GZC A;  2VQ2 A;  3HVE A;  4ATG A;  3OTN A;  4GTR A;  4WWP A;  3E33 A;  5ENQ D;  1FT2 A;  3LDZ A;  3FUJ A;  4D10 C;  2XZD G;  1KT0 A;  4JA9 A;  5EKQ D;  3PNT B;  3NZS A;  4ILH B;  4HQD A;  4I2W A;  3G2W A;  2AXZ A;  1HG2 A;  3B13 A;  1WDY A;  4IUL A;  4WNG A;  4GAA A;  3RRU A;  4CCA A;  2XEH A;  4B93 B;  4N3B A;  4U04 A;  1TNO A;  3PZ2 A;  2WMN A;  4N3C A;  4RLY A;  3MYV A;  4H7X A;  3L82 A;  4I6G A;  2P9S G;  2CFZ A;  3GZS A;  4Y6W A;  2AW6 A;  2EQX A;  4I43 A;  1E8W A;  5ENO D;  2GRN B;  4CGW A;  2IJG X;  2J07 A;  3AS4 A;  2F0Y A;  4GCN A;  5ARG A;  1QNF A;  1ELW A;  2IY0 C;  4NIK A;  3NF1 A;  3DSX A;  3HYM B;  3CHM A;  3DEO A;  4B89 A;  2WPV A;  2KBX A;  4DPR A;  3IBE A;  2EIN E;  2DZN A;  2DIW A;  3ENE A;  2YHE A;  3B7S A;  4HLL A;  4CT4 A;  2PM6 A;  2LSU A;  3QNK A;  5KCM A;  2IOS A;  1OWO A;  1YMP A;  1QZ2 A;  2RG8 A;  3EHR A;  5ENP D;  1O1T A;  2YNQ A;  4U96 D;  3ABM E;  5AQ7 A;  3NOC D;  4GTT A;  4C48 B;  1GW6 A;  2LXL A;  2KCK A;  3FUI A;  3KEA A;  1V55 E;  1FCH A;  1HFA A;  4ANU A;  1FT1 A;  3T5V A;  3Q73 A;  4WNE A;  3CHR A;  3ONK A;  5CBO A;  1TJF A;  4LRZ A;  1S63 A;  4JD2 G;  4I9C A;  3DSW A;  2F8X K;  2BF0 X;  1OCZ E;  4BSZ B;  3CQC B;  1LD8 A;  1XNF A;  1N11 A;  2OVF A;  2I6H A;  3PZD A;  5AN8 A;  3P1U A;  3SHF A;  3ML8 A;  3CVL A;  4K5A B;  3QK0 A;  4EBA G;  3AS5 A;  3ZNG A;  4BFR A;  1ZU2 A;  1IHB A;  3SO8 A;  4A3V A;  4UQY A;  4KMO A;  4GTQ A;  2JAB A;  1HZ4 A; 
#chains in the Genus database with same CATH homology
 1NP7 A;  5G55 A;  2ZU6 B;  3IEG A;  2L0I A;  2XRZ A;  4GA2 A;  3L08 A;  3ESK A;  4AOF A;  4ANV A;  2CG3 A;  2I9C A;  4RVB A;  3UT8 A;  4B8C B;  3URZ A;  4C9B B;  2BTD A;  4KZC A;  3JYS A;  2X3M A;  2AXU A;  3CKC A;  3Q49 B;  4FLB A;  3QJZ A;  3O48 A;  4UI9 C;  4WAF A;  3ASG A;  4CT0 A;  4GYY A;  4AY5 A;  1UJK A;  5CCL A;  4CDN A;  3G2T A;  2JLB A;  4FJY A;  4FAD A;  3LYA A;  4LEU A;  2XHE A;  3EJN A;  3PVL A;  4WWO A;  3FU3 A;  4TV3 A;  3MKR A;  4YND A;  3LEW A;  4N3A A;  4CGV A;  4BTA A;  1PY1 A;  4A1G A;  2J09 A;  5AJL A;  4EQF A;  3B7R L;  4FHJ A;  5FT9 A;  3SD5 A;  1HO8 A;  4PH4 B;  3CHP A;  3MV2 B;  3PUJ A;  1JWG A;  3S7F A;  2VSX E;  4JEH A;  3ZEF A;  4BSX A;  1IHG A;  1X5B A;  3I4G A;  4I9E A;  2I1J A;  4MS6 A;  3ZYM A;  1WY6 A;  2HYZ A;  4GZ6 A;  5FQ8 A;  4DLQ A;  1YA0 A;  4U0Z A;  3D9K A;  4R7L A;  5FZR A;  3CVN A;  4UQZ A;  3CQG B;  4FLH A;  4ILI A;  3CVP A;  3ZPJ A;  5A23 A;  3CK7 A;  4BT9 A;  3TAX A;  5BV1 A;  1EYH A;  5DIZ A;  3UMV A;  4BWR A;  1UW4 B;  3ASD A;  3CKB A;  4KXK B;  4L23 A;  4B8A A;  5AIJ A;  4YVQ C;  2GRL A;  3HIZ A;  2QFC A;  3QB2 A;  2E2E A;  5BW8 C;  2CFU A;  2CHX A;  3D9N A;  3FY4 A;  3B7U X;  3FUD A;  4DK5 A;  4IN3 B;  4RSY A;  2X6F A;  4PS7 A;  3PS6 A;  3HVE B;  1EDU A;  3SFZ A;  4UWH A;  4BY6 A;  4GB9 A;  5JHA A;  3MX3 A;  4L2Y A;  2V0P A;  1SZ9 A;  1BPO A;  1DNP A;  2WXO A;  4P29 A;  1OWP A;  3SBT B;  4J8S A;  1A17 A;  4JC8 A;  3I4R B;  2J4B A;  5KJK A;  3CVX A;  3K9I A;  5JJ7 A;  3QDN A;  5HQ8 A;  3QWP A;  3CVU A;  2WXH A;  4DJA A;  3BG1 B;  5AEN A;  3QKY A;  4NRH B;  5KJM A;  1HE8 A;  4FA6 A;  4K03 A;  1MQS A;  5E75 A;  1Y8M A;  2NXP A;  2Y4T A;  4ACK A;  3U4T A;  1TJC A;  1UN8 A;  4WNF A;  5AYW D;  3JUI A;  1E8Z A;  1HH8 A;  1N52 A;  4EPZ A;  3D9M A;  3LY9 A;  1ELR A;  1NA3 A;  2VTB B;  3EDT B;  4UWG A;  4E85 A;  4JW1 A;  1HG5 A;  2JEK A;  3SNX A;  4AJW A;  3FEY A;  4GZD A;  4F3V A;  2FUL A;  1SQM A;  1Z3Y A;  3MZL B;  3OXL A;  5DBK A;  4CDR A;  4G1T A;  4MLP A;  3CVW A;  3U3W A;  4AXH A;  3R9A B;  3FH8 A;  2KZT B;  3RRN B;  2C0M A;  3FUN A;  2WXR A;  5EDS A;  3ZXS A;  4I1A A;  5FQ6 A;  4XKC A;  2R5S A;  2LAH A;  4I17 A;  4BTB A;  3PE4 A;  5BV0 A;  3CEQ A;  1ELK A;  4G25 A;  5D0Q D;  3FWV A;  4Y6C A;  5FJY A;  1EPU A;  4EZK A;  5JHB A;  2UY1 B;  1KLX A;  1LF8 A;  3APD A;  5EX0 A;  1E96 B;  2RD0 A;  4I1M A;  4XI9 A;  4APO A;  4WUY A;  4I6E A;  1HF8 A;  2WXK A;  5ANL A;  4PS8 A;  4GA0 A;  3LXU X;  3UQ3 A;  3D9J A;  3MEK A;  4HOU A;  3FDH A;  2GGF A;  2CHZ A;  1HU3 A;  4I1O B;  4U07 A;  4CRW A;  3MGB A;  3ASH A;  3ZFW A;  2WM9 A;  2FI7 A;  1TEZ A;  2X38 A;  2FO7 A;  5A7D B;  4HOT A;  2YQ8 A;  1H2V C;  3JQ0 A;  3TXN A;  3FU5 A;  3EIQ C;  2E0I A;  1JUQ A;  4TRQ A;  1P5Q A;  2OVB A;  2C2L A;  2XGM A;  4GA1 A;  3ZN3 A;  4KZ0 A;  4A3T A;  3FUE A;  2LSV A;  5ENN A;  1U3D A;  5ARF A;  4GZ5 A;  1OUV A;  5AJD A;  3ZHE B;  1IQR A;  3U9W A;  1IYG A;  2J9Q A;  4HOQ A;  1E7V A;  3D9I A;  2OV8 A;  3GZ1 A;  3PE3 A;  4F7A A;  3ULQ A;  4NQ0 A;  3RO3 A;  2HM8 A;  4URK A;  2X6K A;  3D3M A;  3AS8 A;  2VSO E;  4GMJ A;  4XI0 A;  4FHK A;  1W3B A;  1WAO 1;  2XEV A;  3GZ2 A;  4FUL A;  1H2U A;  2XPZ A;  2WQ6 A;  4LCT A;  1H19 A;  2V8S E;  3LS8 A;  1H6K A;  4H7Y A;  4DI4 A;  4O6F A;  2MHK A;  5T4Y A;  4AY6 A;  3BEE A;  3LY7 A;  4GPK A;  2PQR A;  3MV3 B;  3VTX A;  2C0L A;  2PQN A;  3ZIM A;  3E4B A;  1ZBP A;  4TUU A;  4FJZ A;  2FBN A;  4HXI A;  3VTY A;  3IHY A;  4LUN U;  4A1S A;  3LKU A;  3FU0 A;  4JA7 A;  5E76 A;  2NSZ A;  2P58 C;  5FTP A;  5C2Y A;  3U66 A;  3MA5 A;  3CVY A;  3AU5 A;  1UN9 A;  3FH7 A;  2DCP A;  4U8H A;  2XCB A;  4N2Q A;  3EHN A;  2J08 A;  3G2U A;  2I1K A;  3EHM A;  2BUG A;  3CLJ A;  3DPD A;  3FTS A;  4GCO A;  3PDN A;  4GU5 A;  1Z3X A;  3FTY A;  1OWN A;  5FWQ A;  2WXF A;  3FTZ A;  5HI7 A;  1FVH A;  1JWF A;  4UWF A;  4FC8 A;  1JPL A;  4L7T A;  5BT1 A;  3UT7 A;  4EEC A;  3JCK C;  3CHO A;  4JEU A;  3UT4 A;  4HFG A;  4RG9 A;  3EIJ A;  2KCL A;  4F53 A;  3FEX A;  4ME2 A;  1E7U A;  2OOE A;  3RRM B;  3CVV A;  2AXV A;  2WXM A;  3MJW A;  4JXT A;  5G05 J;  2V4L A;  3RU0 A;  3S7D A;  3FTV A;  3ZHE A;  4EZL A;  3L22 A;  4AIF A;  2WXJ A;  3CGH A;  3NQP A;  1HXI A;  4M3O A;  1MHQ A;  5T3R A;  1DVP A;  4BX8 A;  3OAW A;  2ILR A;  4QFV A;  3TJP A;  4J8F A;  3WXX A;  3SZ7 A;  4ANW A;  5LP0 A;  2XGO A;  3OXF A;  3P2B A;  3D9P A;  3G2S A;  2AVP A;  3PRZ A;  2XPY A;  4ANX A;  4GYO A;  3APC A;  2NC9 A;  4J6I A;  5LCW J;  2OND A;  5FZS A;  5G05 C;  1EF1 C;  4JHK A;  1PAQ A;  4GML A;  2IQC A;  2LO6 A;  1XGW A;  2UWJ G;  2WMO A;  4J8E A;  5LOZ A;  3TG5 A;  3U64 A;  2Y4U A;  1OWL A;  4FU3 A;  4AV7 A;  3VLE A;  2VGX B;  4YVO A;  2M63 A;  3ZYL A;  3FHE A;  4NAC A;  5KJN A;  4U0U A;  3ESL A;  3L6A A;  4UI9 K;  1H2T C;  1L5J A;  2R17 C;  3KD7 A;  4F1S A;  3PUK A;  3CK9 A;  4B0Z A;  2VJ8 A;  5JJT A;  2J4D A;  4L2L A;  2VGY A;  1HX8 A;  3LY8 A;  3S7B A;  2KCV A;  5D0O D;  4EBA A;  2Y3A A;  4UWL A;  4G11 A;  5LCW C;  4IRU A;  4MKT A;  4XKB A;  4KVO A;  3G2V A;  3PNL B;  2VSY A;  1S0P A;  4JPS A;  4AP2 A;  3FTX A;  4CEM A;  3R7Q A;  4RG6 A;  1WM5 A;  1NA0 A;  4GZC A;  3FUK A;  2VQ2 A;  1IQU A;  4Q94 A;  2V5F A;  4B94 A;  3HVE A;  4ATG A;  3MKQ B;  5G04 J;  3OTN A;  1UG3 A;  4PDX A;  3RK6 A;  4WWP A;  3VLD A;  3L54 A;  4HS2 A;  3ZGQ A;  3Q5M A;  5EX3 A;  3HDX A;  2GW1 A;  3LDZ A;  3Q4A B;  4JVS A;  3FTU A;  3CHS A;  3FUJ A;  4D10 C;  2LNI A;  1KT0 A;  3O4Z A;  4JA9 A;  4IYP A;  4AM9 A;  3FUM A;  3QC1 A;  5BPP A;  3HHM A;  1QQE A;  5J90 A;  5EKQ D;  3PNT B;  3CK8 A;  3NZS A;  4ILH B;  4BX9 A;  4I2W A;  3G2W A;  4JZY A;  2AXZ A;  4ILG A;  3IKO B;  1N54 A;  1SZA A;  2KM4 A;  3BG0 B;  3ZRH A;  4C0E A;  4HLE A;  1HG2 A;  3B13 A;  2WXQ A;  3CSF A;  4IUL A;  5G04 C;  4WNG A;  2VTB A;  2R59 A;  3I3N A;  2YIN A;  1H0A A;  3S7J A;  2GRM A;  4GAA A;  3RRU A;  5BUZ A;  1VDY A;  5ANR A;  1Z6T A;  1E8Y A;  3DBS A;  3TG4 A;  3CHQ A;  4CCA A;  3SI5 A;  1NZN A;  4EZJ A;  3S2A A;  4HOS A;  4N3B A;  4XZ4 A;  1HS6 A;  3I5P A;  4U04 A;  3SBS A;  2YHC A;  3L16 A;  4OVU A;  2HO1 A;  2WMN A;  4KYO B;  2WQH A;  4N3C A;  4DI3 A;  3MYV A;  2KZT A;  4G2V A;  2HR2 A;  2WXL A;  2IU1 A;  4H7X A;  5C1D A;  4AEZ C;  3KAE A;  3MCX A;  2FEZ A;  3UX4 A;  4I6G A;  5CHE E;  4N2S A;  3FUH A;  4AVX A;  2CFZ A;  2UY1 A;  2PL2 A;  4XE0 A;  5CMY A;  3GZS A;  4Y6W A;  2AW6 A;  2EQX A;  4I43 A;  1E8W A;  3MKQ A;  5FQ4 A;  2VSN A;  2ION A;  2XGS A;  5JJ6 A;  4CGW A;  2IJG X;  2J07 A;  4JHJ A;  3AS4 A;  4GCN A;  4JHR A;  4V3I A;  2L6J A;  1E8X A;  5ARG A;  1QNF A;  3JQ1 A;  1ELW A;  4J8D A;  4Q69 A;  4G23 A;  4I6J A;  3TGO A;  5J08 A;  2WQ7 A;  4NUR A;  4K0R A;  2AWI A;  2I2O A;  4W9R A;  3FU6 A;  3SGH A;  3GW4 A;  3NF1 A;  3HYM B;  1U3C A;  4UWK A;  3CHM A;  2XQ0 A;  4XIF A;  4E6H A;  2Q7F A;  3D9L A;  4CDM A;  3UPV A;  4B89 A;  2WPV A;  3GYZ A;  1PC2 A;  4KT6 B;  3T8M A;  4DPR A;  2X6I A;  4ACL A;  4Q96 A;  5LFA A;  5BNW A;  3IBE A;  4HOR A;  1Y6I A;  2DBA A;  2A5U A;  2FF4 A;  2DIW A;  5KJL A;  3KS2 A;  3ENE A;  3KEZ A;  2L0T B;  4MRU A;  3LJ3 A;  2KAT A;  2XCC A;  4FP7 A;  3Q15 A;  1OWM A;  2YHE A;  3B7S A;  5T8I A;  2IOL A;  3FH5 A;  3ASF A;  3IHV A;  2IF4 A;  4CT4 A;  3TL5 A;  3ML9 A;  2PM6 A;  5LX8 A;  2WXG A;  2LSU A;  2LAI A;  3QNK A;  5KCM A;  2IOS A;  2KC7 A;  1OWO A;  2L9B A;  4KVM A;  5A6C A;  3APF A;  3RIB A;  4OYS A;  5FZQ A;  1QZ2 A;  2RG8 A;  3ZW3 A;  2PZI A;  2VYI A;  4GZ3 A;  4I2Z A;  2WXI A;  3CST A;  5M72 A;  3QOU A;  2J49 A;  2YNQ A;  3FTW A;  4APF A;  4PS3 A;  3L17 A;  1UJJ A;  4WWN A;  2CHW A;  3CR3 A;  3QWV A;  1GW6 A;  4BT8 A;  3VLF A;  1E90 A;  3LCA A;  3UUX A;  2KCK A;  3B7T A;  3FUI A;  3N71 A;  3TXM A;  3ZVV A;  3RO2 A;  2QY7 A;  3NZU A;  1B89 A;  3OXG A;  1FCH A;  3RJV A;  4HVB A;  1HFA A;  2CG2 A;  4ABN A;  2X6H A;  3AU4 A;  4ANU A;  5CMW A;  3R7R A;  4WND A;  3T5V A;  5G2N A;  3FUL A;  3PH0 C;  4PUC A;  4WNE A;  2MOW A;  4G26 A;  4L1B A;  4U0S A;  3CHR A;  3ONK A;  3QAR A;  4GYW A;  2MRI A;  1TJF A;  5FQ7 A;  4G24 A;  4LRZ A;  1KT1 A;  4KBQ A;  3C98 A;  3FFL A;  4I9C A;  4UQX A;  3FUF A;  3QWW A;  4U63 A;  2BF0 X;  3CVQ A;  1INZ A;  3ONL A;  3IV0 A;  4N39 A;  4DLO A;  5CCM A;  2WXN A;  3T5X A;  3ZYQ A;  3CQC B;  3FP3 A;  1XNF A;  3SF4 A;  2WB2 A;  4J0U A;  2OVF A;  2A4Z A;  3PRE A;  2I6H A;  3QAQ A;  3ZYK A;  3LPZ A;  4JL0 A;  2IFU A;  3PZD A;  3PEV B;  2PM7 A;  3PEU B;  2VGX A;  2X6J A;  3Q47 B;  2XRY A;  4OVV A;  4UI9 J;  4A55 A;  3P1U A;  3SHF A;  3CV0 A;  3D9O A;  1FVF A;  3CVL A;  2WXP A;  3ML8 A;  3QK0 A;  4N5C A;  4C0M A;  3LVQ E;  3RKV A;  3CIA A;  4EBA G;  3AS5 A;  2WVI A;  2XPI A;  4BFR A;  4XX5 A;  1ZU2 A;  4A3V A;  4UQY A;  4KMO A;  4LER A;  3LVR E;  3L13 A;  1HZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...