3RRUA

X-ray crystal structure of the vhs domain of human tom1-like protein, northeast structural genomics consortium target hr3050e
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
DPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOM1L1 protein
publication title X-ray crystal structure of the VHS domain of human TOM1-like protein, Northeast Structural Genomics Consortium Target HR3050E
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 44
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rruA00
1HX8A 3ONKA 2L0TB 4Q94A 3G2SA 2V8SE 1HG2A 4FLBA 1UJJA 3ZYKA 1PY1A 2LO6A 1XGWA 3RRUA 1INZA 3LDZA 3G2TA 3D9PA 2DIWA 4NACA 4GZDA 5J08A 5LOZA 1SZAA 1HG5A 1EDUA 1UJKA 3CLJA 4AVXA 4GZCA 1JWGA 2QY7A 4JXTA 3ONLA 1JUQA 3D9JA 4FU3A 1ELKA 3G2UA 3D9OA 1EYHA 1SZ9A 1MHQA 1LF8A 4HFGA 1JPLA 3D9IA 1HF8A 2L0IA 2MOWA 1VDYA 3D9MA 3ZYQA 2KM4A 3D9LA 4Q96A 3ZYLA 1H0AA 1JWFA 3ZYMA 3G2VA 3D9KA 1HFAA 5CMYA 2DCPA 3D9NA 3G2WA 5CMWA 2BF0X 1X5BA 5LP0A 1DVPA
chains in the Genus database with same CATH superfamily
2AWIA 3CKBA 5CCLA 4BSZB 4AEZC 1D9SA 3L82A 3CK9A 3FUNA 3V31A 4UQZA 2UWJG 4WWNA 3FUMA 3CVLA 2XHEA 1D8DA 3NAWA 3UT7A 3ASHA 3PZDA 4MRUA 4BX9A 5CHEE 3CHMA 3G2SA 1HG2A 2IFUA 3ISMC 4XE0A 2FO7A 1V55E 2LNIA 2LAHA 4F1PA 5ENTD 1TR4A 1FPPA 5JA4D 3C3RA 3CEQA 3QKYA 4DLQA 3OXLA 2JABA 1L5JA 3VLDA 3C3OA 3RIBA 4LSZE 3ZHEA 3WXXA 5CRVA 2HE0A 1TNYA 4JXTA 2ETBA 4X8QA 5AQAA 3VLEA 4Q69A 2XCCA 4GB9A 4B8CB 1TNUA 2CG2A 3ESLA 2C0MA 2XPZA 2WXQA 5AQBA 3PE4A 1OWMA 3SFZA 4J8SA 4K0RA 2OCCE 5AN8A 1WG0A 3UM1A 3AG2E 2X6JA 1E7UA 3FUDA 3DXKG 1LF8A 4NIKA 2WXPA 2ZU6B 1WAO1 2IEJA 3TXMA 4DPRA 3ZGQA 3V30A 5KNHD 3QDNA 3KEZA 4EHMA 4JHJA 3FTYA 1S64A 4FJYA 4MKTA 3UINC 3I3NA 2IOLA 2ZIRA 4U96D 4MBGA 1FT2A 2XS8A 3OXFA 3FU0A 3HIZA 3UI2A 3NOCD 1A5EA 4CT4A 3HHMA 5HI7A 1H6PA 3L9TA 1MQSA 1ELKA 2DYRE 3PVLA 2GGFA 3UXGA 1E8YA 3FUIA 3Q9NC 3EU5A 3PRZA 3DWLG 4H7XA 3B7TA 5HS0A 3NZUA 4TXQA 4DK5A 2VSXE 2ZGGA 2ZGDA 1G3NB 3S7DA 1ZU2A 4G8LA 5ARFA 2ZXWE 4I6GA 5HKPA 1KZOA 1HZ4A 2V8SE 2WQHA 4WWPA 3PUJA 4PS7A 4NRHB 4RG9A 2HR2A 3UPVA 4HI8A 4BFRA 4AV7A 3LCAA 3S7BA 2VGXA 4N2QA 3PH0C 1MYOA 2Y0BG 2XRYA 2J49A 3ZYKA 1D8EA 3ZN3A 2R02A 1NA3A 1SW6A 2C0LA 2CHXA 3ZPJA 4GZ5A 5CEDB 3CVYA 4FJZA 4U07A 4I17A 1EF1C 1N11A 2A5UA 4WUYA 4B89A 1HF8A 1KPSB 1N4QA 2KC7A 1O1TA 4ANXA 4JB8P 3L16A 3UIOC 2ETAA 3PREA 4BTAA 2LSUA 4G1TA 4B94A 3SI5A 3NQPA 3R7QA 4GPKA 2NC9A 2P9PG 1WY6A 4O60A 2QY7A 3FU6A 2CFUA 4ILIA 1P5QA 4U0UA 1TN7A 2EINE 5JJ6A 3D3MA 3U64A 1N0QA 1SVXA 2EIJE 3TXNA 4NURA 1DVPA 2LXLA 4FC8A 1JCQA 4O1PA 1UOHA 4BY6A 3DBSA 4I43A 5EDSA 3HXEA 1HE8A 4AY6A 4GCOA 3R9AB 3L13A 2MOWA 3ZYQA 4J8YA 5G05C 3LVRE 3ONKA 2H6GA 5AENA 2P9NG 2P58C 2YNQA 4JZYA 1O1RA 4CDMA 4AM9A 3UM2A 5LCWC 2DZOA 5E76A 3PZ2A 3SQVA 3FTUA 4KZ0A 4L2LA 2X38A 4YDWA 4U7EB 3UMVA 3MJWA 1BPOA 3PDNA 5BT1A 3EHMA 2DBAA 2WB2A 4UI9C 5KJMA 2IJGX 4CEMA 4CGVA 1OWLA 2Y1LE 3ML8A 4F1SA 4YVQC 3O48A 4MS6A 1A17A 2XQ0A 1ZB1A 4BT9A 2DCPA 4FA6A 3U66A 3APCA 1PY1A 3ZNGA 3CSFA 3UM3A 3J5QB 5BV1A 5A23A 2IF4A 3IBEA 4GZCA 3TWQA 1U2VG 5H7PA 2VTBA 4G23A 2F0YA 4R7LA 5G05J 3LEWA 4GTTA 2CFZA 3D9KA 2GRLA 3LY7A 2OVBA 2WM9A 2Y69E 3P1UA 5FZSA 3MKRA 4F7AA 4XX5A 4UUCA 1U3CA 4K5CA 4WWOA 4GTPA 3HRAA 2I9CA 3QARA 4GTSA 2XGSA 3ZXSA 3E30A 5FIOA 4AXHA 4KYOB 2WMOA 2P9SG 3UTMA 2ZISA 4WNEA 2LO6A 2P9KG 3C72A 4EBAA 4UI9J 2A5EA 2FBNA 5J90A 4URKA 1JUQA 4H7YA 3CHOA 4KVOA 4C0EA 1MX4A 3ZUVB 3DPDA 3NOGD 2Y3AA 4GCNA 1HFAA 2MYOA 3C5RA 3QWPA 1MZCA 5JJTA 4XKCA 3PZ4A 3ASDA 4BT8A 2X6FA 3CVQA 3KEAA 1S63A 4GZDA 5FZRA 3IV0A 3QAQA 1OWPA 3CV0A 5JHBA 1JCSA 2UY1A 1FCHA 2X6IA 3N71A 5EILA 3GZ2A 4TRQA 1HS6A 3AS8A 3AU4A 4U8HA 4IULA 4ANUA 2AVPA 3D9OA 4XI0A 4DJAA 3SY2A 3SFXA 4CDNA 2YINA 2RKKA 3D9HA 3RK6A 5KJLA 4NQ0A 2F37A 4J6IA 2R5SA 3GZSA 4UWKA 3DSXA 2HYZA 4HFGA 3D9IA 1PC2A 3ZYLA 2EIME 5CMWA 1TYQG 2WXHA 2BF0X 4A55A 4J8DA 2V5QC 4OAUC 5ANRA 2YHEA 4HLEA 3QWVA 1NP7A 2DVWA 5AQ9A 4RLYA 5CBNA 3FP3A 4DX5D 1E8XA 3DRAA 4JC8A 4HQDA 3ZEFA 1N4RA 1PAQA 2YHCA 2FULA 1N4SA 1LD8A 3E37A 3TL5A 1OCOE 5JMND 1FT1A 4GMLA 2DZNA 4I6EA 3CQCB 3G2UA 1TN8A 3FWVA 1E7VA 5ENPD 4ILHB 3MV2B 3LXUX 4WAFA 4WNDA 4EBAG 3TJPA 3RRUA 3BUAA 3CVVA 4AJWA 4GMJA 3UUXA 4A3VA 1MX2A 3FUKA 2CG3A 3CVNA 4UWLA 3QJZA 2P2CP 1WDYA 4OVUA 2P9UG 1IYGA 3CHSA 4BESA 3FU3A 2FO1E 4GPMA 4GTMA 5ENSD 5DBKA 4KVMA 4GZ6A 1TNOA 2L6JA 3IHVA 2GROB 3BU8A 5D0OD 3AS4A 1NL4A 1H6OA 4HOSA 1OCZE 3PNTB 4LEUA 5B1BE 4KXKB 4HOUA 4KMOA 3ZVVA 4CYMD 4N5CA 3RRMB 4FLBA 5JHAA 3UKRG 1Q2ZA 4L1BA 1SA5A 4BERA 2VYIA 1YMPA 2QYUA 3MX3A 2X3MA 2KCLA 3DSSA 4UI9K 1BI8B 5BV0A 4XZ4A 4UWFA 2BUGA 4ABNA 2VSYA 4HORA 2E2EA 1O1SA 4Y6WA 5EIBE 3FH5A 4DI3A 5AJLA 3DSTA 2FF4A 2OVFA 3K9IA 4APOA 3E33A 2GRRB 5FQ6A 1JWFA 3RRNB 4FU3A 1HO8A 5KCMA 2WXOA 2H6FA 2AJAA 3B95A 3TWTA 1AP7A 3FUFA 5ARGA 1UJKA 3UQ3A 3AS5A 4CCAA 3KAEA 4GA0A 2FI7A 4Q96A 5G55A 2PQRA 2VJ8A 3SF4A 1DC2A 2XGOA 3HG0D 3QOUA 3ZXPA 2Y4TA 4G25A 1EPUA 2P9IG 1IQRA 2CHZA 5D66A 5BW8C 3Q7AA 2YQ8A 4UWGA 3TWUA 2KZTB 4I1OB 4CRWA 4F53A 4UQYA 2I1JA 1TNBA 1H2TC 3QC1A 1BD8A 2KCKA 5T4YA 2DYSE 3HXFA 5LOZA 3B7SA 1IKND 1NZNA 3LY8A 2J4BA 3IKOB 1ZBPA 2JEKA 1YYHA 1N94A 3WG7E 4JHRA 3X2QE 5KWDA 2NYJA 2IQCA 2XEHA 3D9NA 3ESKA 4LG6A 4G8KA 2PZIA 1S70B 3D9PA 4YDOA 4L23A 3JXJA 3LYAA 1OWOA 3CHPA 2J09A 2MRIA 1E90A 1HH8A 3FEXA 1TNZA 2WXGA 2BEDA 5CBOA 4LUNU 4Q94A 5E75A 3U9WA 2GRQB 3LDZA 3TWWA 4IN3B 2KXPC 1HG5A 1EDUA 3HXDA 4JHKA 3FU5A 4OAVB 3QB2A 2H6IA 1JPLA 5HRYA 4AP2A 1VDYA 4U0ZA 5EKQD 3V2OA 1E8WA 3QK0A 4ZHBA 2PNNA 3D9LA 2WXLA 3HVEA 1YCSB 4FP7A 4UQXA 3BG1B 3OTNA 5FWQA 3I4RB 3OAWA 4N39A 5HQ8A 4PH4B 4IRUA 3O4ZA 4HRNA 3PUKA 2J4DA 3CGHA 3L54A 1OCRE 2L6BA 5G2NA 4MLPA 4HVBA 3D9JA 1DCEA 4ATGA 3CR3A 3V79K 3QWWA 1H2UA 2PM7A 3PS6A 4KZCA 1BLXB 3W9GA 2PM6A 2HO1A 4XEIG 2L9BA 5FQ8A 4NACA 3LVQE 2A4ZA 2R03A 2CHWA 3CLJA 3ML9A 3Q9UC 2QC9A 4I9EA 1N0RA 2PL2A 3MV3B 3MCXA 3MYVA 1H0AA 5EX3A 4HS2A 4JL0A 3SNXA 3SGHA 2RFAA 1BU9A 3MZLB 4AIFA 3FUHA 5IY5E 3NZSA 3SBTB 2IY0C 4GZ3A 1Y8MA 2BKGA 2QFCA 5B3SE 2ETCA 3MA5A 3Q5MA 4L7TA 4HLLA 3GZ1A 5CMYA 2RD0A 1NI1A 2L0TB 4ACLA 2GRNB 3ULYA 1TEZA 1UJJA 3Q15A 1ELWA 5CRUA 2EILE 1FVHA 4N2SA 3OXGA 1S0PA 5KNGA 1K1AA 2GRMA 3FY4A 3FH7A 4EQFA 1N95A 3FH8A 5ENOD 2AXUA 3JQ1A 3FTZA 3UKUG 2WXRA 5LCWJ 3ENEA 3FTWA 2M63A 2WQ6A 2L0IA 4TV3A 5FQ7A 3GW4A 3C98A 1X81A 3U4TA 4C0MA 4WNGA 2LXMA 3ZFWA 2Y4UA 1KT0A 3LPZA 4LRZA 3UM0A 4GTQA 3IHYA 4PS8A 1Z3YA 3APDA 4C48B 4L9PA 3TWVA 1QQEA 3SHFA 5ENNA 4FHJA 3RO3A 3ZYMA 4TUMA 4BETA 4AOFA 2WXNA 2VGYA 2HM8A 1BI7B 1NFIE 4CZ2D 4I1AA 4B93B 1XNFA 3F6QA 2F8XK 3NB2A 1QBQA 2KM4A 3LY9A 4RQIA 1NA0A 5ENQD 5C2YA 4I2WA 3VLFA 3MKQB 2J07A 1HXIA 3NF1A 3RKVA 3CQGB 4DX6D 5EX0A 3SZ7A 2E0IA 4K03A 4DLOA 1E8ZA 3L6AA 1OY3D 3LKUA 3L08A 2JLBA 2EIKE 3G2WA 4AY5A 4DX1A 1KZPA 4FHKA 4DX2A 3HXCA 2XEVA 2ILRA 2IONA 4N5QA 3P2BA 2EQXA 4V3IA 2J8SD 2X6HA 3S7JA 3ZIMA 2V4LA 1K1BA 4OVVA 1KLXA 2FEZA 4E85A 4TUUA 4HBDA 4GA2A 4TXPA 1OWNA 3R7RA 2R59A 2KCVA 3MEKA 4G26A 5AARA 3TG4A 4N3AA 4EPZA 4HB5A 2BKKB 3Q75A 3EHRA 3PZ1A 3V2XA 3G2TA 4D10C 2P9LG 3AAAC 4K5BA 5T3RA 1INZA 3RAUA 5BNWA 5D2MC 5A7DB 4W9RA 3RJVA 4I6JA 2XEEA 4J7WA 1QNFA 1H6KA 2R2LA 4FLHA 4XIFA 2J9QA 3Q47B 5LP0A 5BXUA 5LFAA 4M3OA 1MX6A 1FVFA 2VSNA 3PE3A 1MJ0A 5KBAA 4EECA 3RU0A 3HDXA 3DSUA 1UN8A 4ATZD 3TWRA 3D9MA 4U0SA 1HU3A 3SBSA 5AIJA 1U3DA 3DEPA 4JVSA 4LNUD 2QYJA 2WXKA 3UX4A 4LNBA 3CVUA 2IOSA 1ELRA 3SFYA 1KT1A 3EIJA 5D0QD 1K3ZD 5FQ4A 2XZTG 4JEUA 3T9KA 3CK8A 3E32A 2RFMA 1HX8A 2WXFA 3J5PA 4YNDA 3GYZA 3ZRHA 1IHBA 3EU9A 1IHGA 3C3QA 4M7CA 1OT8A 3FTXA 3EDTB 3FULA 1AWCB 2OEVA 3I4GA 5CEAA 1IQUA 3KSLA 3CSTA 2LSVA 3ASFA 3ASNE 1K8KG 4E6HA 4CGWA 3FUEA 5FINA 3UT8A 2I2OA 4HI9A 5EYPF 3ZHEB 3RSEG 3CVPA 5M72A 4IYPA 3G2VA 4ANVA 1UN9A 3L17A 3FEYA 2XGMA 4DRXE 2KZTA 3Q79A 1N4PA 4ANWA 2DIWA 1Y6IA 4RG6A 4AVXA 1JWGA 4JEHA 4O1OA 1MHQA 1SQMA 2KBXA 5C1DA 3BEEA 1O5MA 5ITZF 4GYWA 4TXRA 3ZW3A 3HXBA 3FUJA 1Z3XA 2AXVA 4B0ZA 4EZLA 2WXMA 4N3CA 5KJKA 2XS1A 2NXPA 4I1MA 4Y6CA 4DX7D 4ZFHA 3JUEA 3AJIA 3BG0B 1OXJA 3ASOE 4FADA 3E34A 5AJDA 4I9CA 3FTVA 1Z6TA 3ULQA 5LX8A 3B7UX 2QZAA 4G2VA 4APFA 4ACKA 1IXVA 1TN6A 3R9MA 4PS3A 4UWHA 4J8FA 4JD2G 2GRPB 1V54E 2H6HA 1E96B 2KATA 3T8MA 4U8YD 1QZ2A 3EJNA 1QYMA 2IO3C 4YDEA 4A1SA 1SA4A 4XI9A 4GYYA 4CT0A 4GAAA 3CK7A 3ONLA 3TG5A 2B6CA 4HXIA 4A63B 3JXIA 2R17C 4ME2A 5FZQA 2VSOE 4HNAD 4GYOA 2WXJA 3E4BA 4A3TA 5FJYA 3AG4E 1SZAA 2LUHA 2OEWA 2XPIA 3DXMG 2RG8A 3JCKC 2VQ2A 2WXIA 3HYMB 4I2ZA 4YVOA 2BTDA 4J8EA 4B8AA 3I5PA 4XKBA 3T5VA 4GMRA 3ZKJA 3ZU7B 1Z5SC 1OCCE 3CHRA 4LNGA 1H2VC 1TJFA 4RSYA 2VGXB 3TWXA 2ONDA 4F6RD 3CHQA 3KD7A 3ABME 3LJNA 4G11A 2R05A 4U04A 4BWRA 3URZA 4LERA 1N9AA 2PQNA 4Z68A 2WPVA 3Q7FA 5FTPA 5T8IA 2WVIA 2MHKA 3B7BA 4J0UA 3CVWA 2WMNA 3IXEA 2V5FA 2XZDG 5J08A 3EUVA 5ANLA 3HVEB 3EHNA 2Q7FA 3FDHA 2DWZA 4LCTA 2XCBA 3S2AA 3TAXA 3DPYA 5A6CA 3FFLA 2OOEA 2LAIA 4KBQA 4GTRA 3Q4AB 2I1KA 5AQ7A 1H19A 3QNKA 2XPYA 4PUCA 1SZ9A 2WQ7A 3ULEG 3CKCA 3B13A 2C2LA 3Q49B 2GW1A 3FTSA 3L22A 4L2YA 4DI4A 5EN5D 1EYHA 3S7FA 4BEPA 3U3WA 3TWSA 3Q78A 4JA7A 5BUZA 4ILGA 2IU1A 3T5XA 4P29A 3EHQA 4C9BB 4A1GA 2AW6A 3BQOA 3VTXA 3FHEA 3KS2A 1OUVA 1LD7A 3SO8A 4JA9A 1DCQA 1YA0A 4YDYA 4PDXA 5EIDA 3DEOA 4HOQA 2OV8A 3ABLE 2XENA 3MKQA 3PNLB 1N52A 4GU5A 3TGOA 3UIPC 4U63A 1WM5A 4OYSA 2VTBB 3KSQA 1LTXA 5AYWD 1UG3A 4O6FA 4CDRA 3IEGA 1RW2A 4U95D 4KT6B 4EZKA 4BTBA 3JQ0A 4QQIA 3JUIA 1W3BA 4FULA 3RO2A 4GA1A 3CVXA 2J08A 2IO2C 2V0PA 3AU5A 4K5AB 3PEVB 4F3VA 1GW6A 2X6KA 2V4HC 3LJ3A 2F8YA 2VGEA 5JJ7A 5G04C 3VTYA 4N3BA 3AG1E 2B0OE 4U8VD 1B89A 5FT9A 4HRLA 4BX8A 3DSWA 5EYLA 1TJCA 5ENRD 5BPPA 1XGWA 2AXZA 4GTVA 3Q73A 4BSXA 5AAOA 3W9FA 4RVBA 1N54A 1RZ4A 3LS8A 3PEUB 3NBNB 5B1AE 4DUIA 3PZ3A 4QFVA 3ASGA 3DSVA 5CECB 3T8KA 4G24A 1UW4B 3JYSA 2UY1B 5CCMA 3B7RL 4HRMB 3APFA 4JW1A 1JCRA 1DNPA 3EIQC 2XRZA 3UT4A 3ABKE 5G04J 5BXOA 5CERB 4GTOA 2I6HA 3SD5A 5KJNA 3MGBA 4JPSA 2NSZA 5DIZA 4WNFA 3CIAA 4EZJA 3AG3E 4HOTA 1X5BA
chains in the Genus database with same CATH topology
3ZW3A 2AWIA 3FUJA 1Z3XA 3O4ZA 2AXVA 3PUKA 3CKBA 4B0ZA 5CCLA 4WNEA 2LO6A 2J4DA 3CGHA 4EZLA 4EBAA 3L54A 4AEZC 4UI9J 2WXMA 3CK9A 4N3CA 5KJKA 3FUNA 5G2NA 2FBNA 4UQZA 5J90A 2UWJG 4URKA 1JUQA 2NXPA 3D9JA 3CHOA 4H7YA 4I1MA 4KVOA 4MLPA 4WWNA 4Y6CA 4ATGA 4C0EA 3FUMA 3CVLA 3CR3A 2XHEA 3QWWA 3DPDA 1H2UA 3UT7A 2PM7A 3BG0B 3ASHA 2Y3AA 4GCNA 3PZDA 4MRUA 1HFAA 3PS6A 5CHEE 4KZCA 4BX9A 3QWPA 4FADA 3CHMA 5JJTA 5AJDA 2PM6A 3G2SA 4XKCA 2HO1A 4I9CA 3ASDA 1HG2A 3FTVA 4BT8A 1Z6TA 2IFUA 2L9BA 3ULQA 4XE0A 5LX8A 2X6FA 2FO7A 3B7UX 5FQ8A 3CVQA 4NACA 4GZDA 3LVQE 2A4ZA 2LNIA 2CHWA 5FZRA 4G2VA 3CLJA 3ML9A 4I9EA 3IV0A 3QAQA 2LAHA 4APFA 4ACKA 2PL2A 1OWPA 3CV0A 3MV3B 3MCXA 4PS3A 4UWHA 5JHBA 4J8FA 3MYVA 1H0AA 3CEQA 5EX3A 3QKYA 4DLQA 4HS2A 1E96B 3OXLA 2KATA 3T8MA 4JL0A 2UY1A 1FCHA 1QZ2A 3SNXA 3EJNA 1L5JA 3VLDA 3RIBA 3SGHA 2X6IA 3N71A 3MZLB 3GZ2A 3ZHEA 4AIFA 3FUHA 3WXXA 4TRQA 4A1SA 1HS6A 3AS8A 4XI9A 3AU4A 4GYYA 4U8HA 4IULA 3NZSA 4GAAA 4JXTA 3SBTB 4CT0A 3CK7A 2AVPA 3ONLA 4GZ3A 3TG5A 4ANUA 1Y8MA 2QFCA 3D9OA 4XI0A 4DJAA 4HXIA 3MA5A 3Q5MA 4L7TA 3VLEA 2R17C 4Q69A 3GZ1A 4ME2A 4CDNA 5FZQA 2YINA 5CMYA 2VSOE 2XCCA 2RD0A 4GYOA 3RK6A 2L0TB 2WXJA 4GB9A 4ACLA 3E4BA 5KJLA 4NQ0A 4B8CB 1TEZA 4A3TA 5FJYA 1UJJA 2CG2A 3ESLA 3Q15A 2C0MA 1ELWA 2XPZA 4J6IA 1SZAA 1FVHA 2R5SA 4N2SA 2XPIA 2WXQA 3OXGA 3GZSA 1OWMA 3PE4A 4UWKA 1S0PA 2HYZA 3SFZA 4J8SA 4K0RA 4HFGA 4HVBA 3D9IA 1PC2A 2RG8A 2GRMA 3FY4A 3ZYLA 3JCKC 2VQ2A 3FH7A 4EQFA 2WXIA 5CMWA 3FH8A 3HYMB 2WXHA 2BF0X 4I2ZA 2AXUA 4YVOA 2BTDA 3JQ1A 4J8EA 3FTZA 4A55A 4B8AA 4J8DA 3I5PA 4XKBA 5ANRA 2YHEA 3T5VA 2WXRA 2X6JA 3QWVA 4HLEA 1E7UA 1NP7A 5LCWJ 3ENEA 3FTWA 2M63A 3FP3A 3FUDA 1E8XA 2WQ6A 1LF8A 4JC8A 2L0IA 2WXPA 3ZEFA 4TV3A 5FQ7A 3GW4A 2ZU6B 1WAO1 3C98A 3CHRA 3TXMA 1PAQA 1H2VC 2YHCA 4DPRA 1TJFA 2FULA 4RSYA 3ZGQA 2VGXB 3TL5A 3U4TA 4C0MA 4WNGA 4GMLA 3QDNA 2ONDA 3KEZA 3ZFWA 2Y4UA 3CHQA 3KD7A 4I6EA 1KT0A 3LPZA 4JHJA 4G11A 4LRZA 3CQCB 3G2UA 3FTYA 3IHYA 4PS8A 4U04A 3FWVA 1E7VA 4FJYA 3URZA 4LERA 4BWRA 4MKTA 2PQNA 1Z3YA 3I3NA 2IOLA 3APDA 1QQEA 2WPVA 3SHFA 5ENNA 4ILHB 4FHJA 3MV2B 3LXUX 4WAFA 3RO3A 3ZYMA 5FTPA 5T8IA 2WVIA 4WNDA 4EBAG 3OXFA 2MHKA 3FU0A 3HIZA 4J0UA 3CVWA 4AOFA 2WXNA 3TJPA 2WMNA 2VGYA 3RRUA 2V5FA 2HM8A 3CVVA 4CT4A 4AJWA 3HHMA 5HI7A 4GMJA 3UUXA 5J08A 4A3VA 3FUKA 4I1AA 1XNFA 2CG3A 5ANLA 3HVEB 3CVNA 1MQSA 1ELKA 4UWLA 3QJZA 3EHNA 4OVUA 3PVLA 2GGFA 2Q7FA 1IYGA 3FDHA 4LCTA 1E8YA 2KM4A 2XCBA 3FUIA 3CHSA 3S2AA 3LY9A 3PRZA 3TAXA 1NA0A 3FU3A 4H7XA 4I2WA 5C2YA 3VLFA 3FFLA 5A6CA 2OOEA 3MKQB 2J07A 5DBKA 3B7TA 2LAIA 4KBQA 1HXIA 3NF1A 4KVMA 4GZ6A 3NZUA 2L6JA 4DK5A 2VSXE 3RKVA 3CQGB 3IHVA 5EX0A 3SZ7A 2E0IA 4K03A 5D0OD 3AS4A 3Q4AB 2I1KA 1H19A 3QNKA 2XPYA 4DLOA 4PUCA 1E8ZA 3S7DA 3L6AA 1SZ9A 1ZU2A 2WQ7A 4HOSA 3CKCA 3B13A 3LKUA 3L08A 5ARFA 3PNTB 2C2LA 4LEUA 2JLBA 3Q49B 4KXKB 4HOUA 2GW1A 3G2WA 4I6GA 4KMOA 3ZVVA 4AY5A 4FHKA 4N5CA 3RRMB 2XEVA 1HZ4A 2V8SE 4FLBA 3FTSA 2ILRA 5JHAA 2IONA 3L22A 2WQHA 4WWPA 3PUJA 4PS7A 4L1BA 4NRHB 4RG9A 4L2YA 2HR2A 3UPVA 4DI4A 4BFRA 2VYIA 4AV7A 1EYHA 3MX3A 2X3MA 3LCAA 3S7BA 2KCLA 2VGXA 3P2BA 2EQXA 4UI9K 4V3IA 3S7FA 2X6HA 4N2QA 5BV0A 4XZ4A 3S7JA 4UWFA 3ZIMA 2V4LA 3U3WA 3PH0C 2BUGA 4JA7A 4ABNA 4OVVA 2VSYA 5BUZA 4ILGA 2XRYA 1KLXA 2J49A 4HORA 2E2EA 2FEZA 3ZYKA 4E85A 3ZN3A 2IU1A 4Y6WA 3FH5A 1NA3A 4TUUA 4GA2A 2C0LA 2CHXA 4DI3A 5AJLA 3T5XA 3ZPJA 4GZ5A 4P29A 3CVYA 4FJZA 1OWNA 4C9BB 4U07A 4I17A 1EF1C 2FF4A 2OVFA 4A1GA 3R7RA 2AW6A 3K9IA 2R59A 2KCVA 4APOA 2A5UA 3MEKA 1HF8A 4G26A 4WUYA 3VTXA 4B89A 2KC7A 3TG4A 4ANXA 3FHEA 5FQ6A 3KS2A 4N3AA 4EPZA 1JWFA 3L16A 3RRNB 1OUVA 4FU3A 1HO8A 5KCMA 3G2TA 4D10C 2WXOA 4JA9A 3PREA 4BTAA 2LSUA 1YA0A 4G1TA 4PDXA 5T3RA 4B94A 1INZA 3SI5A 3NQPA 3FUFA 3R7QA 5BNWA 4GPKA 5ARGA 4HOQA 2OV8A 2NC9A 5A7DB 1UJKA 1WY6A 2QY7A 3UQ3A 4W9RA 3MKQA 3FU6A 3AS5A 3RJVA 2CFUA 4I6JA 4ILIA 1P5QA 4U0UA 4CCAA 5JJ6A 3KAEA 4GA0A 1QNFA 2FI7A 3D3MA 3PNLB 1H6KA 1N52A 3U64A 4Q96A 4FLHA 4GU5A 5G55A 2PQRA 3TGOA 4XIFA 2VJ8A 3SF4A 3TXNA 2XGOA 2J9QA 4NURA 3Q47B 1DVPA 5LP0A 4U63A 1WM5A 4FC8A 4OYSA 5LFAA 2VTBB 4M3OA 1FVFA 3QOUA 2Y4TA 4BY6A 2VSNA 4G25A 1EPUA 3DBSA 3PE3A 1IQRA 2CHZA 5AYWD 1UG3A 4O6FA 4CDRA 4EECA 3IEGA 5BW8C 3RU0A 2YQ8A 4I43A 3HDXA 4UWGA 5EDSA 1HE8A 4KT6B 2KZTB 1UN8A 4EZKA 4BTBA 4AY6A 4GCOA 4I1OB 3L13A 3R9AB 3JQ0A 2MOWA 4CRWA 4F53A 3D9MA 4U0SA 3ZYQA 1HU3A 3JUIA 3SBSA 1W3BA 4FULA 3RO2A 4UQYA 4GA1A 3CVXA 2I1JA 2J08A 1H2TC 5G05C 5AIJA 3LVRE 3ONKA 1U3DA 4JVSA 3QC1A 5AENA 2V0PA 2KCKA 3AU5A 5T4YA 3PEVB 2WXKA 3UX4A 1GW6A 4F3VA 2P58C 2YNQA 2X6KA 4JZYA 4CDMA 4AM9A 5LOZA 3B7SA 3CVUA 2IOSA 1NZNA 3LY8A 2J4BA 1ELRA 3LJ3A 3IKOB 1ZBPA 2JEKA 5JJ7A 5G04C 5LCWC 3VTYA 1KT1A 4N3BA 3EIJA 5D0QD 4JHRA 5FQ4A 2IQCA 5E76A 4JEUA 3CK8A 3FTUA 4KZ0A 4L2LA 1B89A 2X38A 3D9NA 5FT9A 3ESKA 1HX8A 4BX8A 3UMVA 1TJCA 2WXFA 3MJWA 1BPOA 3PDNA 5BPPA 1XGWA 2PZIA 4YNDA 2AXZA 3D9PA 5BT1A 3GYZA 3EHMA 2DBAA 4L23A 4BSXA 2WB2A 3ZRHA 4RVBA 1N54A 3LYAA 1OWOA 4UI9C 5KJMA 3CHPA 2IJGX 4CEMA 2J09A 1IHGA 2MRIA 1E90A 3LS8A 4CGVA 1OWLA 1HH8A 3FTXA 3ML8A 3EDTB 3FEXA 4F1SA 4YVQC 3FULA 2WXGA 3O48A 3PEUB 1A17A 2XQ0A 4MS6A 4BT9A 2DCPA 4QFVA 4LUNU 3I4GA 4Q94A 3ASGA 5E75A 3U9WA 4FA6A 1IQUA 3U66A 3APCA 1PY1A 4G24A 3CSTA 1UW4B 3LDZA 3CSFA 2LSVA 3ASFA 3JYSA 4E6HA 4IN3B 5BV1A 4CGWA 1HG5A 5A23A 1EDUA 3FUEA 2IF4A 3IBEA 4GZCA 3UT8A 2UY1B 5CCMA 2I2OA 4JHKA 3FU5A 2VTBA 3QB2A 4G23A 3B7RL 1JPLA 4R7LA 3ZHEB 4AP2A 1VDYA 5G05J 4U0ZA 5EKQD 3LEWA 1E8WA 3CVPA 3QK0A 2CFZA 4IYPA 3G2VA 5M72A 3D9KA 4ANVA 3APFA 2GRLA 1UN9A 3D9LA 3LY7A 2WXLA 4JW1A 2OVBA 3L17A 3FEYA 2XGMA 3HVEA 2WM9A 1DNPA 3EIQC 2KZTA 2XRZA 3UT4A 3P1UA 4ANWA 5FZSA 3MKRA 4F7AA 4FP7A 4XX5A 2DIWA 5G04J 1U3CA 4UQXA 4WWOA 1Y6IA 4RG6A 4AVXA 1JWGA 2I9CA 3BG1B 3OTNA 3QARA 2I6HA 4JEHA 5FWQA 3SD5A 5KJNA 3I4RB 1MHQA 3MGBA 1SQMA 2XGSA 3ZXSA 4JPSA 3OAWA 2NSZA 5DIZA 4WNFA 3CIAA 4EZJA 4AXHA 5C1DA 4KYOB 3BEEA 2WMOA 4HOTA 4N39A 5HQ8A 4GYWA 4PH4B 1X5BA 4IRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX8 A;  3ONK A;  2L0T B;  4Q94 A;  3G2S A;  2V8S E;  1HG2 A;  4FLB A;  1UJJ A;  3ZYK A;  1PY1 A;  2LO6 A;  1XGW A;  3RRU A;  1INZ A;  3LDZ A;  3G2T A;  3D9P A;  2DIW A;  4NAC A;  4GZD A;  5J08 A;  5LOZ A;  1SZA A;  1HG5 A;  1EDU A;  1UJK A;  3CLJ A;  4AVX A;  4GZC A;  1JWG A;  2QY7 A;  4JXT A;  3ONL A;  1JUQ A;  3D9J A;  4FU3 A;  1ELK A;  3G2U A;  3D9O A;  1EYH A;  1SZ9 A;  1MHQ A;  1LF8 A;  4HFG A;  1JPL A;  3D9I A;  1HF8 A;  2L0I A;  2MOW A;  1VDY A;  3D9M A;  3ZYQ A;  2KM4 A;  3D9L A;  4Q96 A;  3ZYL A;  1H0A A;  1JWF A;  3ZYM A;  3G2V A;  3D9K A;  1HFA A;  5CMY A;  2DCP A;  3D9N A;  3G2W A;  5CMW A;  2BF0 X;  1X5B A;  5LP0 A;  1DVP A; 
#chains in the Genus database with same CATH topology
 2AWI A;  3CKB A;  5CCL A;  4BSZ B;  4AEZ C;  1D9S A;  3L82 A;  3CK9 A;  3FUN A;  3V31 A;  4UQZ A;  2UWJ G;  4WWN A;  3FUM A;  3CVL A;  2XHE A;  1D8D A;  3NAW A;  3UT7 A;  3ASH A;  3PZD A;  4MRU A;  4BX9 A;  5CHE E;  3CHM A;  3G2S A;  1HG2 A;  2IFU A;  3ISM C;  4XE0 A;  2FO7 A;  1V55 E;  2LNI A;  2LAH A;  4F1P A;  5ENT D;  1TR4 A;  1FPP A;  5JA4 D;  3C3R A;  3CEQ A;  3QKY A;  4DLQ A;  3OXL A;  2JAB A;  1L5J A;  3VLD A;  3C3O A;  3RIB A;  4LSZ E;  3ZHE A;  3WXX A;  5CRV A;  2HE0 A;  1TNY A;  4JXT A;  2ETB A;  4X8Q A;  5AQA A;  3VLE A;  4Q69 A;  2XCC A;  4GB9 A;  4B8C B;  1TNU A;  2CG2 A;  3ESL A;  2C0M A;  2XPZ A;  2WXQ A;  5AQB A;  3PE4 A;  1OWM A;  3SFZ A;  4J8S A;  4K0R A;  2OCC E;  5AN8 A;  1WG0 A;  3UM1 A;  3AG2 E;  2X6J A;  1E7U A;  3FUD A;  3DXK G;  1LF8 A;  4NIK A;  2WXP A;  2ZU6 B;  1WAO 1;  2IEJ A;  3TXM A;  4DPR A;  3ZGQ A;  3V30 A;  5KNH D;  3QDN A;  3KEZ A;  4EHM A;  4JHJ A;  3FTY A;  1S64 A;  4FJY A;  4MKT A;  3UIN C;  3I3N A;  2IOL A;  2ZIR A;  4U96 D;  4MBG A;  1FT2 A;  2XS8 A;  3OXF A;  3FU0 A;  3HIZ A;  3UI2 A;  3NOC D;  1A5E A;  4CT4 A;  3HHM A;  5HI7 A;  1H6P A;  3L9T A;  1MQS A;  1ELK A;  2DYR E;  3PVL A;  2GGF A;  3UXG A;  1E8Y A;  3FUI A;  3Q9N C;  3EU5 A;  3PRZ A;  3DWL G;  4H7X A;  3B7T A;  5HS0 A;  3NZU A;  4TXQ A;  4DK5 A;  2VSX E;  2ZGG A;  2ZGD A;  1G3N B;  3S7D A;  1ZU2 A;  4G8L A;  5ARF A;  2ZXW E;  4I6G A;  5HKP A;  1KZO A;  1HZ4 A;  2V8S E;  2WQH A;  4WWP A;  3PUJ A;  4PS7 A;  4NRH B;  4RG9 A;  2HR2 A;  3UPV A;  4HI8 A;  4BFR A;  4AV7 A;  3LCA A;  3S7B A;  2VGX A;  4N2Q A;  3PH0 C;  1MYO A;  2Y0B G;  2XRY A;  2J49 A;  3ZYK A;  1D8E A;  3ZN3 A;  2R02 A;  1NA3 A;  1SW6 A;  2C0L A;  2CHX A;  3ZPJ A;  4GZ5 A;  5CED B;  3CVY A;  4FJZ A;  4U07 A;  4I17 A;  1EF1 C;  1N11 A;  2A5U A;  4WUY A;  4B89 A;  1HF8 A;  1KPS B;  1N4Q A;  2KC7 A;  1O1T A;  4ANX A;  4JB8 P;  3L16 A;  3UIO C;  2ETA A;  3PRE A;  4BTA A;  2LSU A;  4G1T A;  4B94 A;  3SI5 A;  3NQP A;  3R7Q A;  4GPK A;  2NC9 A;  2P9P G;  1WY6 A;  4O60 A;  2QY7 A;  3FU6 A;  2CFU A;  4ILI A;  1P5Q A;  4U0U A;  1TN7 A;  2EIN E;  5JJ6 A;  3D3M A;  3U64 A;  1N0Q A;  1SVX A;  2EIJ E;  3TXN A;  4NUR A;  1DVP A;  2LXL A;  4FC8 A;  1JCQ A;  4O1P A;  1UOH A;  4BY6 A;  3DBS A;  4I43 A;  5EDS A;  3HXE A;  1HE8 A;  4AY6 A;  4GCO A;  3R9A B;  3L13 A;  2MOW A;  3ZYQ A;  4J8Y A;  5G05 C;  3LVR E;  3ONK A;  2H6G A;  5AEN A;  2P9N G;  2P58 C;  2YNQ A;  4JZY A;  1O1R A;  4CDM A;  4AM9 A;  3UM2 A;  5LCW C;  2DZO A;  5E76 A;  3PZ2 A;  3SQV A;  3FTU A;  4KZ0 A;  4L2L A;  2X38 A;  4YDW A;  4U7E B;  3UMV A;  3MJW A;  1BPO A;  3PDN A;  5BT1 A;  3EHM A;  2DBA A;  2WB2 A;  4UI9 C;  5KJM A;  2IJG X;  4CEM A;  4CGV A;  1OWL A;  2Y1L E;  3ML8 A;  4F1S A;  4YVQ C;  3O48 A;  4MS6 A;  1A17 A;  2XQ0 A;  1ZB1 A;  4BT9 A;  2DCP A;  4FA6 A;  3U66 A;  3APC A;  1PY1 A;  3ZNG A;  3CSF A;  3UM3 A;  3J5Q B;  5BV1 A;  5A23 A;  2IF4 A;  3IBE A;  4GZC A;  3TWQ A;  1U2V G;  5H7P A;  2VTB A;  4G23 A;  2F0Y A;  4R7L A;  5G05 J;  3LEW A;  4GTT A;  2CFZ A;  3D9K A;  2GRL A;  3LY7 A;  2OVB A;  2WM9 A;  2Y69 E;  3P1U A;  5FZS A;  3MKR A;  4F7A A;  4XX5 A;  4UUC A;  1U3C A;  4K5C A;  4WWO A;  4GTP A;  3HRA A;  2I9C A;  3QAR A;  4GTS A;  2XGS A;  3ZXS A;  3E30 A;  5FIO A;  4AXH A;  4KYO B;  2WMO A;  2P9S G;  3UTM A;  2ZIS A;  4WNE A;  2LO6 A;  2P9K G;  3C72 A;  4EBA A;  4UI9 J;  2A5E A;  2FBN A;  5J90 A;  4URK A;  1JUQ A;  4H7Y A;  3CHO A;  4KVO A;  4C0E A;  1MX4 A;  3ZUV B;  3DPD A;  3NOG D;  2Y3A A;  4GCN A;  1HFA A;  2MYO A;  3C5R A;  3QWP A;  1MZC A;  5JJT A;  4XKC A;  3PZ4 A;  3ASD A;  4BT8 A;  2X6F A;  3CVQ A;  3KEA A;  1S63 A;  4GZD A;  5FZR A;  3IV0 A;  3QAQ A;  1OWP A;  3CV0 A;  5JHB A;  1JCS A;  2UY1 A;  1FCH A;  2X6I A;  3N71 A;  5EIL A;  3GZ2 A;  4TRQ A;  1HS6 A;  3AS8 A;  3AU4 A;  4U8H A;  4IUL A;  4ANU A;  2AVP A;  3D9O A;  4XI0 A;  4DJA A;  3SY2 A;  3SFX A;  4CDN A;  2YIN A;  2RKK A;  3D9H A;  3RK6 A;  5KJL A;  4NQ0 A;  2F37 A;  4J6I A;  2R5S A;  3GZS A;  4UWK A;  3DSX A;  2HYZ A;  4HFG A;  3D9I A;  1PC2 A;  3ZYL A;  2EIM E;  5CMW A;  1TYQ G;  2WXH A;  2BF0 X;  4A55 A;  4J8D A;  2V5Q C;  4OAU C;  5ANR A;  2YHE A;  4HLE A;  3QWV A;  1NP7 A;  2DVW A;  5AQ9 A;  4RLY A;  5CBN A;  3FP3 A;  4DX5 D;  1E8X A;  3DRA A;  4JC8 A;  4HQD A;  3ZEF A;  1N4R A;  1PAQ A;  2YHC A;  2FUL A;  1N4S A;  1LD8 A;  3E37 A;  3TL5 A;  1OCO E;  5JMN D;  1FT1 A;  4GML A;  2DZN A;  4I6E A;  3CQC B;  3G2U A;  1TN8 A;  3FWV A;  1E7V A;  5ENP D;  4ILH B;  3MV2 B;  3LXU X;  4WAF A;  4WND A;  4EBA G;  3TJP A;  3RRU A;  3BUA A;  3CVV A;  4AJW A;  4GMJ A;  3UUX A;  4A3V A;  1MX2 A;  3FUK A;  2CG3 A;  3CVN A;  4UWL A;  3QJZ A;  2P2C P;  1WDY A;  4OVU A;  2P9U G;  1IYG A;  3CHS A;  4BES A;  3FU3 A;  2FO1 E;  4GPM A;  4GTM A;  5ENS D;  5DBK A;  4KVM A;  4GZ6 A;  1TNO A;  2L6J A;  3IHV A;  2GRO B;  3BU8 A;  5D0O D;  3AS4 A;  1NL4 A;  1H6O A;  4HOS A;  1OCZ E;  3PNT B;  4LEU A;  5B1B E;  4KXK B;  4HOU A;  4KMO A;  3ZVV A;  4CYM D;  4N5C A;  3RRM B;  4FLB A;  5JHA A;  3UKR G;  1Q2Z A;  4L1B A;  1SA5 A;  4BER A;  2VYI A;  1YMP A;  2QYU A;  3MX3 A;  2X3M A;  2KCL A;  3DSS A;  4UI9 K;  1BI8 B;  5BV0 A;  4XZ4 A;  4UWF A;  2BUG A;  4ABN A;  2VSY A;  4HOR A;  2E2E A;  1O1S A;  4Y6W A;  5EIB E;  3FH5 A;  4DI3 A;  5AJL A;  3DST A;  2FF4 A;  2OVF A;  3K9I A;  4APO A;  3E33 A;  2GRR B;  5FQ6 A;  1JWF A;  3RRN B;  4FU3 A;  1HO8 A;  5KCM A;  2WXO A;  2H6F A;  2AJA A;  3B95 A;  3TWT A;  1AP7 A;  3FUF A;  5ARG A;  1UJK A;  3UQ3 A;  3AS5 A;  4CCA A;  3KAE A;  4GA0 A;  2FI7 A;  4Q96 A;  5G55 A;  2PQR A;  2VJ8 A;  3SF4 A;  1DC2 A;  2XGO A;  3HG0 D;  3QOU A;  3ZXP A;  2Y4T A;  4G25 A;  1EPU A;  2P9I G;  1IQR A;  2CHZ A;  5D66 A;  5BW8 C;  3Q7A A;  2YQ8 A;  4UWG A;  3TWU A;  2KZT B;  4I1O B;  4CRW A;  4F53 A;  4UQY A;  2I1J A;  1TNB A;  1H2T C;  3QC1 A;  1BD8 A;  2KCK A;  5T4Y A;  2DYS E;  3HXF A;  5LOZ A;  3B7S A;  1IKN D;  1NZN A;  3LY8 A;  2J4B A;  3IKO B;  1ZBP A;  2JEK A;  1YYH A;  1N94 A;  3WG7 E;  4JHR A;  3X2Q E;  5KWD A;  2NYJ A;  2IQC A;  2XEH A;  3D9N A;  3ESK A;  4LG6 A;  4G8K A;  2PZI A;  1S70 B;  3D9P A;  4YDO A;  4L23 A;  3JXJ A;  3LYA A;  1OWO A;  3CHP A;  2J09 A;  2MRI A;  1E90 A;  1HH8 A;  3FEX A;  1TNZ A;  2WXG A;  2BED A;  5CBO A;  4LUN U;  4Q94 A;  5E75 A;  3U9W A;  2GRQ B;  3LDZ A;  3TWW A;  4IN3 B;  2KXP C;  1HG5 A;  1EDU A;  3HXD A;  4JHK A;  3FU5 A;  4OAV B;  3QB2 A;  2H6I A;  1JPL A;  5HRY A;  4AP2 A;  1VDY A;  4U0Z A;  5EKQ D;  3V2O A;  1E8W A;  3QK0 A;  4ZHB A;  2PNN A;  3D9L A;  2WXL A;  3HVE A;  1YCS B;  4FP7 A;  4UQX A;  3BG1 B;  3OTN A;  5FWQ A;  3I4R B;  3OAW A;  4N39 A;  5HQ8 A;  4PH4 B;  4IRU A;  3O4Z A;  4HRN A;  3PUK A;  2J4D A;  3CGH A;  3L54 A;  1OCR E;  2L6B A;  5G2N A;  4MLP A;  4HVB A;  3D9J A;  1DCE A;  4ATG A;  3CR3 A;  3V79 K;  3QWW A;  1H2U A;  2PM7 A;  3PS6 A;  4KZC A;  1BLX B;  3W9G A;  2PM6 A;  2HO1 A;  4XEI G;  2L9B A;  5FQ8 A;  4NAC A;  3LVQ E;  2A4Z A;  2R03 A;  2CHW A;  3CLJ A;  3ML9 A;  3Q9U C;  2QC9 A;  4I9E A;  1N0R A;  2PL2 A;  3MV3 B;  3MCX A;  3MYV A;  1H0A A;  5EX3 A;  4HS2 A;  4JL0 A;  3SNX A;  3SGH A;  2RFA A;  1BU9 A;  3MZL B;  4AIF A;  3FUH A;  5IY5 E;  3NZS A;  3SBT B;  2IY0 C;  4GZ3 A;  1Y8M A;  2BKG A;  2QFC A;  5B3S E;  2ETC A;  3MA5 A;  3Q5M A;  4L7T A;  4HLL A;  3GZ1 A;  5CMY A;  2RD0 A;  1NI1 A;  2L0T B;  4ACL A;  2GRN B;  3ULY A;  1TEZ A;  1UJJ A;  3Q15 A;  1ELW A;  5CRU A;  2EIL E;  1FVH A;  4N2S A;  3OXG A;  1S0P A;  5KNG A;  1K1A A;  2GRM A;  3FY4 A;  3FH7 A;  4EQF A;  1N95 A;  3FH8 A;  5ENO D;  2AXU A;  3JQ1 A;  3FTZ A;  3UKU G;  2WXR A;  5LCW J;  3ENE A;  3FTW A;  2M63 A;  2WQ6 A;  2L0I A;  4TV3 A;  5FQ7 A;  3GW4 A;  3C98 A;  1X81 A;  3U4T A;  4C0M A;  4WNG A;  2LXM A;  3ZFW A;  2Y4U A;  1KT0 A;  3LPZ A;  4LRZ A;  3UM0 A;  4GTQ A;  3IHY A;  4PS8 A;  1Z3Y A;  3APD A;  4C48 B;  4L9P A;  3TWV A;  1QQE A;  3SHF A;  5ENN A;  4FHJ A;  3RO3 A;  3ZYM A;  4TUM A;  4BET A;  4AOF A;  2WXN A;  2VGY A;  2HM8 A;  1BI7 B;  1NFI E;  4CZ2 D;  4I1A A;  4B93 B;  1XNF A;  3F6Q A;  2F8X K;  3NB2 A;  1QBQ A;  2KM4 A;  3LY9 A;  4RQI A;  1NA0 A;  5ENQ D;  5C2Y A;  4I2W A;  3VLF A;  3MKQ B;  2J07 A;  1HXI A;  3NF1 A;  3RKV A;  3CQG B;  4DX6 D;  5EX0 A;  3SZ7 A;  2E0I A;  4K03 A;  4DLO A;  1E8Z A;  3L6A A;  1OY3 D;  3LKU A;  3L08 A;  2JLB A;  2EIK E;  3G2W A;  4AY5 A;  4DX1 A;  1KZP A;  4FHK A;  4DX2 A;  3HXC A;  2XEV A;  2ILR A;  2ION A;  4N5Q A;  3P2B A;  2EQX A;  4V3I A;  2J8S D;  2X6H A;  3S7J A;  3ZIM A;  2V4L A;  1K1B A;  4OVV A;  1KLX A;  2FEZ A;  4E85 A;  4TUU A;  4HBD A;  4GA2 A;  4TXP A;  1OWN A;  3R7R A;  2R59 A;  2KCV A;  3MEK A;  4G26 A;  5AAR A;  3TG4 A;  4N3A A;  4EPZ A;  4HB5 A;  2BKK B;  3Q75 A;  3EHR A;  3PZ1 A;  3V2X A;  3G2T A;  4D10 C;  2P9L G;  3AAA C;  4K5B A;  5T3R A;  1INZ A;  3RAU A;  5BNW A;  5D2M C;  5A7D B;  4W9R A;  3RJV A;  4I6J A;  2XEE A;  4J7W A;  1QNF A;  1H6K A;  2R2L A;  4FLH A;  4XIF A;  2J9Q A;  3Q47 B;  5LP0 A;  5BXU A;  5LFA A;  4M3O A;  1MX6 A;  1FVF A;  2VSN A;  3PE3 A;  1MJ0 A;  5KBA A;  4EEC A;  3RU0 A;  3HDX A;  3DSU A;  1UN8 A;  4ATZ D;  3TWR A;  3D9M A;  4U0S A;  1HU3 A;  3SBS A;  5AIJ A;  1U3D A;  3DEP A;  4JVS A;  4LNU D;  2QYJ A;  2WXK A;  3UX4 A;  4LNB A;  3CVU A;  2IOS A;  1ELR A;  3SFY A;  1KT1 A;  3EIJ A;  5D0Q D;  1K3Z D;  5FQ4 A;  2XZT G;  4JEU A;  3T9K A;  3CK8 A;  3E32 A;  2RFM A;  1HX8 A;  2WXF A;  3J5P A;  4YND A;  3GYZ A;  3ZRH A;  1IHB A;  3EU9 A;  1IHG A;  3C3Q A;  4M7C A;  1OT8 A;  3FTX A;  3EDT B;  3FUL A;  1AWC B;  2OEV A;  3I4G A;  5CEA A;  1IQU A;  3KSL A;  3CST A;  2LSV A;  3ASF A;  3ASN E;  1K8K G;  4E6H A;  4CGW A;  3FUE A;  5FIN A;  3UT8 A;  2I2O A;  4HI9 A;  5EYP F;  3ZHE B;  3RSE G;  3CVP A;  5M72 A;  4IYP A;  3G2V A;  4ANV A;  1UN9 A;  3L17 A;  3FEY A;  2XGM A;  4DRX E;  2KZT A;  3Q79 A;  1N4P A;  4ANW A;  2DIW A;  1Y6I A;  4RG6 A;  4AVX A;  1JWG A;  4JEH A;  4O1O A;  1MHQ A;  1SQM A;  2KBX A;  5C1D A;  3BEE A;  1O5M A;  5ITZ F;  4GYW A;  4TXR A;  3ZW3 A;  3HXB A;  3FUJ A;  1Z3X A;  2AXV A;  4B0Z A;  4EZL A;  2WXM A;  4N3C A;  5KJK A;  2XS1 A;  2NXP A;  4I1M A;  4Y6C A;  4DX7 D;  4ZFH A;  3JUE A;  3AJI A;  3BG0 B;  1OXJ A;  3ASO E;  4FAD A;  3E34 A;  5AJD A;  4I9C A;  3FTV A;  1Z6T A;  3ULQ A;  5LX8 A;  3B7U X;  2QZA A;  4G2V A;  4APF A;  4ACK A;  1IXV A;  1TN6 A;  3R9M A;  4PS3 A;  4UWH A;  4J8F A;  4JD2 G;  2GRP B;  1V54 E;  2H6H A;  1E96 B;  2KAT A;  3T8M A;  4U8Y D;  1QZ2 A;  3EJN A;  1QYM A;  2IO3 C;  4YDE A;  4A1S A;  1SA4 A;  4XI9 A;  4GYY A;  4CT0 A;  4GAA A;  3CK7 A;  3ONL A;  3TG5 A;  2B6C A;  4HXI A;  4A63 B;  3JXI A;  2R17 C;  4ME2 A;  5FZQ A;  2VSO E;  4HNA D;  4GYO A;  2WXJ A;  3E4B A;  4A3T A;  5FJY A;  3AG4 E;  1SZA A;  2LUH A;  2OEW A;  2XPI A;  3DXM G;  2RG8 A;  3JCK C;  2VQ2 A;  2WXI A;  3HYM B;  4I2Z A;  4YVO A;  2BTD A;  4J8E A;  4B8A A;  3I5P A;  4XKB A;  3T5V A;  4GMR A;  3ZKJ A;  3ZU7 B;  1Z5S C;  1OCC E;  3CHR A;  4LNG A;  1H2V C;  1TJF A;  4RSY A;  2VGX B;  3TWX A;  2OND A;  4F6R D;  3CHQ A;  3KD7 A;  3ABM E;  3LJN A;  4G11 A;  2R05 A;  4U04 A;  4BWR A;  3URZ A;  4LER A;  1N9A A;  2PQN A;  4Z68 A;  2WPV A;  3Q7F A;  5FTP A;  5T8I A;  2WVI A;  2MHK A;  3B7B A;  4J0U A;  3CVW A;  2WMN A;  3IXE A;  2V5F A;  2XZD G;  5J08 A;  3EUV A;  5ANL A;  3HVE B;  3EHN A;  2Q7F A;  3FDH A;  2DWZ A;  4LCT A;  2XCB A;  3S2A A;  3TAX A;  3DPY A;  5A6C A;  3FFL A;  2OOE A;  2LAI A;  4KBQ A;  4GTR A;  3Q4A B;  2I1K A;  5AQ7 A;  1H19 A;  3QNK A;  2XPY A;  4PUC A;  1SZ9 A;  2WQ7 A;  3ULE G;  3CKC A;  3B13 A;  2C2L A;  3Q49 B;  2GW1 A;  3FTS A;  3L22 A;  4L2Y A;  4DI4 A;  5EN5 D;  1EYH A;  3S7F A;  4BEP A;  3U3W A;  3TWS A;  3Q78 A;  4JA7 A;  5BUZ A;  4ILG A;  2IU1 A;  3T5X A;  4P29 A;  3EHQ A;  4C9B B;  4A1G A;  2AW6 A;  3BQO A;  3VTX A;  3FHE A;  3KS2 A;  1OUV A;  1LD7 A;  3SO8 A;  4JA9 A;  1DCQ A;  1YA0 A;  4YDY A;  4PDX A;  5EID A;  3DEO A;  4HOQ A;  2OV8 A;  3ABL E;  2XEN A;  3MKQ A;  3PNL B;  1N52 A;  4GU5 A;  3TGO A;  3UIP C;  4U63 A;  1WM5 A;  4OYS A;  2VTB B;  3KSQ A;  1LTX A;  5AYW D;  1UG3 A;  4O6F A;  4CDR A;  3IEG A;  1RW2 A;  4U95 D;  4KT6 B;  4EZK A;  4BTB A;  3JQ0 A;  4QQI A;  3JUI A;  1W3B A;  4FUL A;  3RO2 A;  4GA1 A;  3CVX A;  2J08 A;  2IO2 C;  2V0P A;  3AU5 A;  4K5A B;  3PEV B;  4F3V A;  1GW6 A;  2X6K A;  2V4H C;  3LJ3 A;  2F8Y A;  2VGE A;  5JJ7 A;  5G04 C;  3VTY A;  4N3B A;  3AG1 E;  2B0O E;  4U8V D;  1B89 A;  5FT9 A;  4HRL A;  4BX8 A;  3DSW A;  5EYL A;  1TJC A;  5ENR D;  5BPP A;  1XGW A;  2AXZ A;  4GTV A;  3Q73 A;  4BSX A;  5AAO A;  3W9F A;  4RVB A;  1N54 A;  1RZ4 A;  3LS8 A;  3PEU B;  3NBN B;  5B1A E;  4DUI A;  3PZ3 A;  4QFV A;  3ASG A;  3DSV A;  5CEC B;  3T8K A;  4G24 A;  1UW4 B;  3JYS A;  2UY1 B;  5CCM A;  3B7R L;  4HRM B;  3APF A;  4JW1 A;  1JCR A;  1DNP A;  3EIQ C;  2XRZ A;  3UT4 A;  3ABK E;  5G04 J;  5BXO A;  5CER B;  4GTO A;  2I6H A;  3SD5 A;  5KJN A;  3MGB A;  4JPS A;  2NSZ A;  5DIZ A;  4WNF A;  3CIA A;  4EZJ A;  3AG3 E;  4HOT A;  1X5B A; 
#chains in the Genus database with same CATH homology
 3ZW3 A;  2AWI A;  3FUJ A;  1Z3X A;  3O4Z A;  2AXV A;  3PUK A;  3CKB A;  4B0Z A;  5CCL A;  4WNE A;  2LO6 A;  2J4D A;  3CGH A;  4EZL A;  4EBA A;  3L54 A;  4AEZ C;  4UI9 J;  2WXM A;  3CK9 A;  4N3C A;  5KJK A;  3FUN A;  5G2N A;  2FBN A;  4UQZ A;  5J90 A;  2UWJ G;  4URK A;  1JUQ A;  2NXP A;  3D9J A;  3CHO A;  4H7Y A;  4I1M A;  4KVO A;  4MLP A;  4WWN A;  4Y6C A;  4ATG A;  4C0E A;  3FUM A;  3CVL A;  3CR3 A;  2XHE A;  3QWW A;  3DPD A;  1H2U A;  3UT7 A;  2PM7 A;  3BG0 B;  3ASH A;  2Y3A A;  4GCN A;  3PZD A;  4MRU A;  1HFA A;  3PS6 A;  5CHE E;  4KZC A;  4BX9 A;  3QWP A;  4FAD A;  3CHM A;  5JJT A;  5AJD A;  2PM6 A;  3G2S A;  4XKC A;  2HO1 A;  4I9C A;  3ASD A;  1HG2 A;  3FTV A;  4BT8 A;  1Z6T A;  2IFU A;  2L9B A;  3ULQ A;  4XE0 A;  5LX8 A;  2X6F A;  2FO7 A;  3B7U X;  5FQ8 A;  3CVQ A;  4NAC A;  4GZD A;  3LVQ E;  2A4Z A;  2LNI A;  2CHW A;  5FZR A;  4G2V A;  3CLJ A;  3ML9 A;  4I9E A;  3IV0 A;  3QAQ A;  2LAH A;  4APF A;  4ACK A;  2PL2 A;  1OWP A;  3CV0 A;  3MV3 B;  3MCX A;  4PS3 A;  4UWH A;  5JHB A;  4J8F A;  3MYV A;  1H0A A;  3CEQ A;  5EX3 A;  3QKY A;  4DLQ A;  4HS2 A;  1E96 B;  3OXL A;  2KAT A;  3T8M A;  4JL0 A;  2UY1 A;  1FCH A;  1QZ2 A;  3SNX A;  3EJN A;  1L5J A;  3VLD A;  3RIB A;  3SGH A;  2X6I A;  3N71 A;  3MZL B;  3GZ2 A;  3ZHE A;  4AIF A;  3FUH A;  3WXX A;  4TRQ A;  4A1S A;  1HS6 A;  3AS8 A;  4XI9 A;  3AU4 A;  4GYY A;  4U8H A;  4IUL A;  3NZS A;  4GAA A;  4JXT A;  3SBT B;  4CT0 A;  3CK7 A;  2AVP A;  3ONL A;  4GZ3 A;  3TG5 A;  4ANU A;  1Y8M A;  2QFC A;  3D9O A;  4XI0 A;  4DJA A;  4HXI A;  3MA5 A;  3Q5M A;  4L7T A;  3VLE A;  2R17 C;  4Q69 A;  3GZ1 A;  4ME2 A;  4CDN A;  5FZQ A;  2YIN A;  5CMY A;  2VSO E;  2XCC A;  2RD0 A;  4GYO A;  3RK6 A;  2L0T B;  2WXJ A;  4GB9 A;  4ACL A;  3E4B A;  5KJL A;  4NQ0 A;  4B8C B;  1TEZ A;  4A3T A;  5FJY A;  1UJJ A;  2CG2 A;  3ESL A;  3Q15 A;  2C0M A;  1ELW A;  2XPZ A;  4J6I A;  1SZA A;  1FVH A;  2R5S A;  4N2S A;  2XPI A;  2WXQ A;  3OXG A;  3GZS A;  1OWM A;  3PE4 A;  4UWK A;  1S0P A;  2HYZ A;  3SFZ A;  4J8S A;  4K0R A;  4HFG A;  4HVB A;  3D9I A;  1PC2 A;  2RG8 A;  2GRM A;  3FY4 A;  3ZYL A;  3JCK C;  2VQ2 A;  3FH7 A;  4EQF A;  2WXI A;  5CMW A;  3FH8 A;  3HYM B;  2WXH A;  2BF0 X;  4I2Z A;  2AXU A;  4YVO A;  2BTD A;  3JQ1 A;  4J8E A;  3FTZ A;  4A55 A;  4B8A A;  4J8D A;  3I5P A;  4XKB A;  5ANR A;  2YHE A;  3T5V A;  2WXR A;  2X6J A;  3QWV A;  4HLE A;  1E7U A;  1NP7 A;  5LCW J;  3ENE A;  3FTW A;  2M63 A;  3FP3 A;  3FUD A;  1E8X A;  2WQ6 A;  1LF8 A;  4JC8 A;  2L0I A;  2WXP A;  3ZEF A;  4TV3 A;  5FQ7 A;  3GW4 A;  2ZU6 B;  1WAO 1;  3C98 A;  3CHR A;  3TXM A;  1PAQ A;  1H2V C;  2YHC A;  4DPR A;  1TJF A;  2FUL A;  4RSY A;  3ZGQ A;  2VGX B;  3TL5 A;  3U4T A;  4C0M A;  4WNG A;  4GML A;  3QDN A;  2OND A;  3KEZ A;  3ZFW A;  2Y4U A;  3CHQ A;  3KD7 A;  4I6E A;  1KT0 A;  3LPZ A;  4JHJ A;  4G11 A;  4LRZ A;  3CQC B;  3G2U A;  3FTY A;  3IHY A;  4PS8 A;  4U04 A;  3FWV A;  1E7V A;  4FJY A;  3URZ A;  4LER A;  4BWR A;  4MKT A;  2PQN A;  1Z3Y A;  3I3N A;  2IOL A;  3APD A;  1QQE A;  2WPV A;  3SHF A;  5ENN A;  4ILH B;  4FHJ A;  3MV2 B;  3LXU X;  4WAF A;  3RO3 A;  3ZYM A;  5FTP A;  5T8I A;  2WVI A;  4WND A;  4EBA G;  3OXF A;  2MHK A;  3FU0 A;  3HIZ A;  4J0U A;  3CVW A;  4AOF A;  2WXN A;  3TJP A;  2WMN A;  2VGY A;  3RRU A;  2V5F A;  2HM8 A;  3CVV A;  4CT4 A;  4AJW A;  3HHM A;  5HI7 A;  4GMJ A;  3UUX A;  5J08 A;  4A3V A;  3FUK A;  4I1A A;  1XNF A;  2CG3 A;  5ANL A;  3HVE B;  3CVN A;  1MQS A;  1ELK A;  4UWL A;  3QJZ A;  3EHN A;  4OVU A;  3PVL A;  2GGF A;  2Q7F A;  1IYG A;  3FDH A;  4LCT A;  1E8Y A;  2KM4 A;  2XCB A;  3FUI A;  3CHS A;  3S2A A;  3LY9 A;  3PRZ A;  3TAX A;  1NA0 A;  3FU3 A;  4H7X A;  4I2W A;  5C2Y A;  3VLF A;  3FFL A;  5A6C A;  2OOE A;  3MKQ B;  2J07 A;  5DBK A;  3B7T A;  2LAI A;  4KBQ A;  1HXI A;  3NF1 A;  4KVM A;  4GZ6 A;  3NZU A;  2L6J A;  4DK5 A;  2VSX E;  3RKV A;  3CQG B;  3IHV A;  5EX0 A;  3SZ7 A;  2E0I A;  4K03 A;  5D0O D;  3AS4 A;  3Q4A B;  2I1K A;  1H19 A;  3QNK A;  2XPY A;  4DLO A;  4PUC A;  1E8Z A;  3S7D A;  3L6A A;  1SZ9 A;  1ZU2 A;  2WQ7 A;  4HOS A;  3CKC A;  3B13 A;  3LKU A;  3L08 A;  5ARF A;  3PNT B;  2C2L A;  4LEU A;  2JLB A;  3Q49 B;  4KXK B;  4HOU A;  2GW1 A;  3G2W A;  4I6G A;  4KMO A;  3ZVV A;  4AY5 A;  4FHK A;  4N5C A;  3RRM B;  2XEV A;  1HZ4 A;  2V8S E;  4FLB A;  3FTS A;  2ILR A;  5JHA A;  2ION A;  3L22 A;  2WQH A;  4WWP A;  3PUJ A;  4PS7 A;  4L1B A;  4NRH B;  4RG9 A;  4L2Y A;  2HR2 A;  3UPV A;  4DI4 A;  4BFR A;  2VYI A;  4AV7 A;  1EYH A;  3MX3 A;  2X3M A;  3LCA A;  3S7B A;  2KCL A;  2VGX A;  3P2B A;  2EQX A;  4UI9 K;  4V3I A;  3S7F A;  2X6H A;  4N2Q A;  5BV0 A;  4XZ4 A;  3S7J A;  4UWF A;  3ZIM A;  2V4L A;  3U3W A;  3PH0 C;  2BUG A;  4JA7 A;  4ABN A;  4OVV A;  2VSY A;  5BUZ A;  4ILG A;  2XRY A;  1KLX A;  2J49 A;  4HOR A;  2E2E A;  2FEZ A;  3ZYK A;  4E85 A;  3ZN3 A;  2IU1 A;  4Y6W A;  3FH5 A;  1NA3 A;  4TUU A;  4GA2 A;  2C0L A;  2CHX A;  4DI3 A;  5AJL A;  3T5X A;  3ZPJ A;  4GZ5 A;  4P29 A;  3CVY A;  4FJZ A;  1OWN A;  4C9B B;  4U07 A;  4I17 A;  1EF1 C;  2FF4 A;  2OVF A;  4A1G A;  3R7R A;  2AW6 A;  3K9I A;  2R59 A;  2KCV A;  4APO A;  2A5U A;  3MEK A;  1HF8 A;  4G26 A;  4WUY A;  3VTX A;  4B89 A;  2KC7 A;  3TG4 A;  4ANX A;  3FHE A;  5FQ6 A;  3KS2 A;  4N3A A;  4EPZ A;  1JWF A;  3L16 A;  3RRN B;  1OUV A;  4FU3 A;  1HO8 A;  5KCM A;  3G2T A;  4D10 C;  2WXO A;  4JA9 A;  3PRE A;  4BTA A;  2LSU A;  1YA0 A;  4G1T A;  4PDX A;  5T3R A;  4B94 A;  1INZ A;  3SI5 A;  3NQP A;  3FUF A;  3R7Q A;  5BNW A;  4GPK A;  5ARG A;  4HOQ A;  2OV8 A;  2NC9 A;  5A7D B;  1UJK A;  1WY6 A;  2QY7 A;  3UQ3 A;  4W9R A;  3MKQ A;  3FU6 A;  3AS5 A;  3RJV A;  2CFU A;  4I6J A;  4ILI A;  1P5Q A;  4U0U A;  4CCA A;  5JJ6 A;  3KAE A;  4GA0 A;  1QNF A;  2FI7 A;  3D3M A;  3PNL B;  1H6K A;  1N52 A;  3U64 A;  4Q96 A;  4FLH A;  4GU5 A;  5G55 A;  2PQR A;  3TGO A;  4XIF A;  2VJ8 A;  3SF4 A;  3TXN A;  2XGO A;  2J9Q A;  4NUR A;  3Q47 B;  1DVP A;  5LP0 A;  4U63 A;  1WM5 A;  4FC8 A;  4OYS A;  5LFA A;  2VTB B;  4M3O A;  1FVF A;  3QOU A;  2Y4T A;  4BY6 A;  2VSN A;  4G25 A;  1EPU A;  3DBS A;  3PE3 A;  1IQR A;  2CHZ A;  5AYW D;  1UG3 A;  4O6F A;  4CDR A;  4EEC A;  3IEG A;  5BW8 C;  3RU0 A;  2YQ8 A;  4I43 A;  3HDX A;  4UWG A;  5EDS A;  1HE8 A;  4KT6 B;  2KZT B;  1UN8 A;  4EZK A;  4BTB A;  4AY6 A;  4GCO A;  4I1O B;  3L13 A;  3R9A B;  3JQ0 A;  2MOW A;  4CRW A;  4F53 A;  3D9M A;  4U0S A;  3ZYQ A;  1HU3 A;  3JUI A;  3SBS A;  1W3B A;  4FUL A;  3RO2 A;  4UQY A;  4GA1 A;  3CVX A;  2I1J A;  2J08 A;  1H2T C;  5G05 C;  5AIJ A;  3LVR E;  3ONK A;  1U3D A;  4JVS A;  3QC1 A;  5AEN A;  2V0P A;  2KCK A;  3AU5 A;  5T4Y A;  3PEV B;  2WXK A;  3UX4 A;  1GW6 A;  4F3V A;  2P58 C;  2YNQ A;  2X6K A;  4JZY A;  4CDM A;  4AM9 A;  5LOZ A;  3B7S A;  3CVU A;  2IOS A;  1NZN A;  3LY8 A;  2J4B A;  1ELR A;  3LJ3 A;  3IKO B;  1ZBP A;  2JEK A;  5JJ7 A;  5G04 C;  5LCW C;  3VTY A;  1KT1 A;  4N3B A;  3EIJ A;  5D0Q D;  4JHR A;  5FQ4 A;  2IQC A;  5E76 A;  4JEU A;  3CK8 A;  3FTU A;  4KZ0 A;  4L2L A;  1B89 A;  2X38 A;  3D9N A;  5FT9 A;  3ESK A;  1HX8 A;  4BX8 A;  3UMV A;  1TJC A;  2WXF A;  3MJW A;  1BPO A;  3PDN A;  5BPP A;  1XGW A;  2PZI A;  4YND A;  2AXZ A;  3D9P A;  5BT1 A;  3GYZ A;  3EHM A;  2DBA A;  4L23 A;  4BSX A;  2WB2 A;  3ZRH A;  4RVB A;  1N54 A;  3LYA A;  1OWO A;  4UI9 C;  5KJM A;  3CHP A;  2IJG X;  4CEM A;  2J09 A;  1IHG A;  2MRI A;  1E90 A;  3LS8 A;  4CGV A;  1OWL A;  1HH8 A;  3FTX A;  3ML8 A;  3EDT B;  3FEX A;  4F1S A;  4YVQ C;  3FUL A;  2WXG A;  3O48 A;  3PEU B;  1A17 A;  2XQ0 A;  4MS6 A;  4BT9 A;  2DCP A;  4QFV A;  4LUN U;  3I4G A;  4Q94 A;  3ASG A;  5E75 A;  3U9W A;  4FA6 A;  1IQU A;  3U66 A;  3APC A;  1PY1 A;  4G24 A;  3CST A;  1UW4 B;  3LDZ A;  3CSF A;  2LSV A;  3ASF A;  3JYS A;  4E6H A;  4IN3 B;  5BV1 A;  4CGW A;  1HG5 A;  5A23 A;  1EDU A;  3FUE A;  2IF4 A;  3IBE A;  4GZC A;  3UT8 A;  2UY1 B;  5CCM A;  2I2O A;  4JHK A;  3FU5 A;  2VTB A;  3QB2 A;  4G23 A;  3B7R L;  1JPL A;  4R7L A;  3ZHE B;  4AP2 A;  1VDY A;  5G05 J;  4U0Z A;  5EKQ D;  3LEW A;  1E8W A;  3CVP A;  3QK0 A;  2CFZ A;  4IYP A;  3G2V A;  5M72 A;  3D9K A;  4ANV A;  3APF A;  2GRL A;  1UN9 A;  3D9L A;  3LY7 A;  2WXL A;  4JW1 A;  2OVB A;  3L17 A;  3FEY A;  2XGM A;  3HVE A;  2WM9 A;  1DNP A;  3EIQ C;  2KZT A;  2XRZ A;  3UT4 A;  3P1U A;  4ANW A;  5FZS A;  3MKR A;  4F7A A;  4FP7 A;  4XX5 A;  2DIW A;  5G04 J;  1U3C A;  4UQX A;  4WWO A;  1Y6I A;  4RG6 A;  4AVX A;  1JWG A;  2I9C A;  3BG1 B;  3OTN A;  3QAR A;  2I6H A;  4JEH A;  5FWQ A;  3SD5 A;  5KJN A;  3I4R B;  1MHQ A;  3MGB A;  1SQM A;  2XGS A;  3ZXS A;  4JPS A;  3OAW A;  2NSZ A;  5DIZ A;  4WNF A;  3CIA A;  4EZJ A;  4AXH A;  5C1D A;  4KYO B;  3BEE A;  2WMO A;  4HOT A;  4N39 A;  5HQ8 A;  4GYW A;  4PH4 B;  1X5B A;  4IRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...