3RRUA

X-ray crystal structure of the vhs domain of human tom1-like protein, northeast structural genomics consortium target hr3050e
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
DPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of the VHS domain of human TOM1-like protein, Northeast Structural Genomics Consortium Target HR3050E
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TOM1L1 protein
total genus 44
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rruA00
1H0AA 1SZ9A 1JWGA 1JWFA 2V8SE 3D9OA 2L0TB 2MOWA 3D9PA 4GZCA 1EDUA 2L0IA 1EYHA 3LDZA 4Q96A 1VDYA 3RRUA 3G2WA 3G2TA 3ONLA 1HF8A 3D9JA 5LP0A 1HG2A 2QY7A 3D9LA 3ZYQA 1HFAA 3G2UA 1XGWA 1UJJA 4FU3A 4HFGA 5CMWA 1LF8A 4NACA 1UJKA 1ELKA 1DVPA 3D9NA 3ZYKA 1JUQA 2BF0X 4FLBA 3D9KA 3D9MA 2KM4A 5LOZA 1PY1A 1SZAA 4JXTA 4AVXA 2DIWA 1INZA 5J08A 3G2SA 4GZDA 1HG5A 3G2VA 3ZYLA 2DCPA 3CLJA 4Q94A 5CMYA 3ONKA 1MHQA 3ZYMA 1HX8A 1JPLA 1X5BA 3D9IA 2LO6A
chains in the Genus database with same CATH superfamily
4G2VA 4TUMA 1Z3XA 2VSXE 3PZ2A 2YHCA 5ENSD 1YA0A 3D9LA 4G11A 4J8SA 3ESKA 2X6IA 1TN7A 4EBAA 2Y4UA 5BNWA 2GRLA 3MA5A 2RKKA 1HZ4A 5EYLA 4AP2A 1IHBA 3CHMA 4M7CA 2A5EA 5FT9A 3ZN3A 5C2YA 3SF4A 4KXKB 3ZVVA 4NRHB 1FCHA 3MYVA 4U96D 5CMYA 3E4BA 2AW6A 3TWRA 2QZAA 2WQ6A 3ASDA 3RRUA 1HH8A 1B89A 4BEPA 1JCSA 1K1BA 2VYIA 3DPDA 3MX3A 1N94A 4XKCA 3CIAA 5JJ7A 5A23A 1HG5A 3I3NA 1PC2A 4UWLA 2XEEA 4UQYA 4GA2A 4GTOA 5CECB 3O4ZA 5EX3A 1PAQA 3URZA 4LUNU 3DBSA 3PRZA 4IRUA 4GYWA 3ZW3A 4Q69A 5LCWC 1PY1A 4ACKA 5BXUA 4NQ0A 1FT2A 4J6IA 1NI1A 2EIME 3UT7A 3ZIMA 5DIZA 5FIOA 2R03A 2PQNA 2MRIA 3CVXA 3TJPA 2R02A 2V4HC 2WQHA 3ASOE 4FHKA 3G2VA 1XNFA 3ISMC 4GA1A 5EX0A 1N52A 4G23A 4GTQA 3CK9A 4AJWA 2UY1B 2L0TB 2V4LA 3DSSA 3PUKA 3V31A 3CHOA 2WXKA 1LF8A 2C2LA 1IQUA 1O5MA 3UINC 4GMLA 1OCOE 3D9HA 4AY5A 4AEZC 4OVVA 4J8EA 3FTZA 3IV0A 5KNGA 1EPUA 4UI9J 3SQVA 1YYHA 1SVXA 2YINA 2VGXB 3ML8A 3MKRA 4I43A 2DZNA 5FQ6A 5BV1A 4WNFA 3ZGQA 3S7FA 2FBNA 2QFCA 5CHEE 1KLXA 3MV3B 3NBNB 4JA7A 2H6GA 3AG4E 3ML9A 2ZISA 3SBTB 2VJ8A 2WM9A 4XIFA 3J5PA 2PQRA 3TG5A 2XZDG 1IYGA 1HG2A 3CSFA 3PS6A 5BXOA 4FU3A 3PEVB 5ENQD 4HXIA 4XI9A 3C5RA 1S64A 4DX7D 3E32A 4K5AB 3W9FA 3LJNA 4TXPA 4A3TA 1H6PA 4JHJA 3ZHEA 5KJLA 4I9CA 2E0IA 2DCPA 3LKUA 2YQ8A 2DYSE 2KXPC 3QAQA 1TNYA 4FULA 3K9IA 3LS8A 3ULQA 3HG0D 3R9MA 1OCZE 3CHPA 2V5QC 2XGSA 3F6QA 5ARGA 1W3BA 1TNUA 3AU4A 2A5UA 3UI2A 2MHKA 3DSVA 5HQ8A 5AAOA 1UN9A 4Y6CA 2HYZA 3ASHA 2BF0X 3N71A 2ILRA 3MCXA 2DVWA 1LTXA 3FUIA 5FTPA 4GCOA 1HS6A 3OTNA 2OV8A 1Y6IA 4RSYA 1YMPA 1U3CA 4G26A 2WXRA 2NXPA 5FZRA 3CSTA 3S7JA 2Y0BG 5CCMA 3C3OA 3SZ7A 2KM4A 3FFLA 3HVEB 3EJNA 2IF4A 2FF4A 3ZRHA 2LSVA 3SFYA 5CCLA 3CLJA 2B6CA 2X38A 1IQRA 3D9IA 4U7EB 3UT8A 4PDXA 3FU0A 2XQ0A 2LSUA 4DUIA 3AS5A 4MS6A 3U9WA 5CERB 1DC2A 4ANVA 4MKTA 2H6FA 4PH4B 3FUEA 2J4BA 5BV0A 4HQDA 3SO8A 3L9TA 3NZUA 4ZFHA 3TWQA 1FVFA 3MV2B 3BEEA 5BT1A 3EUVA 3JXIA 3RIBA 4UI9C 4I17A 3QNKA 5FQ8A 5G05J 1TYQG 3R7RA 1SZ9A 3WG7E 3CVNA 4AM9A 3RK6A 1RW2A 1HU3A 3TL5A 4CDRA 3HIZA 4E85A 2KATA 4H7YA 2RFMA 3ZUVB 1Z5SC 4Z68A 2WMOA 4D10C 2XCCA 2GRQB 2J09A 2P9NG 3JQ0A 4NIKA 5C1DA 3VLEA 3KS2A 3ZHEB 5FQ7A 3HDXA 1P5QA 5D0QD 2WXMA 1FPPA 2GROB 2CG3A 3KSLA 3O48A 3BG0B 4O60A 3IEGA 2X6FA 3LY8A 4FA6A 4EPZA 2XGMA 5JMND 1E7UA 2IJGX 2KBXA 4FLHA 5CRUA 5D0OD 4DI3A 4DRXE 4DX1A 3RSEG 3MJWA 2KCKA 4FADA 1Q2ZA 1BD8A 4L7TA 3D9KA 2BKGA 4H7XA 3HXBA 2CHZA 3NQPA 4TXRA 1SZAA 3P2BA 4WUYA 1BI7B 3P1UA 3Q75A 4EHMA 5EIDA 3JYSA 2I6HA 3FUNA 4DX6D 4CT4A 4I6JA 2KZTB 2DZOA 4UI9K 2XRZA 1NP7A 3FH5A 2XENA 1S0PA 5KJMA 2CHXA 2P2CP 4JA9A 2BKKB 3RRNB 3U66A 3L54A 4ATZD 1QNFA 5LCWJ 1X5BA 4ILIA 4XZ4A 2A4ZA 5KWDA 2EIJE 3AG2E 5AQ7A 1WG0A 5EILA 4B94A 4GPKA 4U0SA 1H6KA 2OVBA 4HFGA 3FUHA 3C72A 3OXFA 5D2MC 2WVIA 4DK5A 3EHQA 1O1RA 1A5EA 5JJ6A 2IEJA 4GCNA 1V54E 3APDA 3ASNE 3LXUX 3DPYA 3SFXA 3V2OA 2ZXWE 4HLLA 2GW1A 2AXVA 4K5BA 4FLBA 5AQAA 4OVUA 1N54A 4TUUA 1MX2A 3B13A 4U95D 2GRNB 3IKOB 4BESA 4UQXA 4K03A 3SY2A 3APCA 2EILE 3FU6A 3EHNA 1H2UA 4BT9A 1IKND 5ENPD 1AWCB 2P9IG 5EIBE 2Q7FA 3LPZA 4U0UA 2WB2A 2P9SG 5IY5E 4U0ZA 3FY4A 4LERA 3UKUG 3FEYA 5JA4D 3ZNGA 4CCAA 4ILGA 2JEKA 2CFUA 2VTBB 3VLDA 3FU5A 1N4PA 4N3BA 3ZPJA 4HOSA 3B7UX 2IO2C 3NB2A 1ELWA 2CFZA 3KAEA 1E90A 1MX6A 2WXHA 3AU5A 4U8YD 2IQCA 4G24A 1MJ0A 2Y4TA 2XS8A 3TXNA 4KZCA 1JWFA 3UIOC 2F0YA 3B7TA 1JCRA 3KD7A 3PH0C 3FUFA 2J07A 1Z3YA 3ASFA 5ITZF 3KEZA 4JB8P 4BWRA 4HVBA 5LX8A 4HB5A 3L08A 1X81A 3TXMA 1UG3A 2FO7A 2GRPB 4HOTA 3FTSA 2DYRE 4JVSA 4ANXA 4GZ3A 1UJJA 3TWWA 5T3RA 4MLPA 1H19A 4AXHA 3HYMB 4I1MA 2I9CA 4JW1A 1BLXB 4TRQA 2NYJA 3HRAA 2WXGA 1OWPA 3C98A 2P9KG 3DSXA 4YDWA 3QOUA 5H7PA 1K8KG 2LXMA 5CMWA 1DVPA 3UMVA 3LCAA 2NSZA 2R17C 4N3CA 5KNHD 3PEUB 1WDYA 4BY6A 1TEZA 1MYOA 3ABKE 3ONLA 3FTVA 5BPPA 3IHVA 2AXUA 5JHBA 5FJYA 4F7AA 3CHSA 1HXIA 3UIPC 4LSZE 3B7BA 2DBAA 2J08A 3LYAA 4DJAA 3TWVA 4X8QA 3FH8A 4EBAG 3B7RL 5CEDB 4PS8A 3TG4A 1D9SA 2H6HA 1SQMA 3EHRA 3MGBA 4HI9A 3NZSA 5EYPF 4FC8A 3OAWA 2IOLA 5D66A 2XPIA 3MKQA 4NACA 3EU9A 4ANUA 3TWSA 3DWLG 3AS4A 3TWTA 3HXEA 3UPVA 2WQ7A 3SNXA 1LD8A 5G55A 4N2SA 3C3QA 3IXEA 3FDHA 4I2WA 2AWIA 4KVMA 2FEZA 2MYOA 2WXIA 1DNPA 5KCMA 5AN8A 3EIQC 3Q9NC 4AOFA 2B0OE 2Y1LE 1U2VG 3QDNA 3KSQA 3PNTB 1TR4A 4WWNA 3ASGA 1NA3A 3FTUA 1SA5A 4A63B 1SA4A 3IHYA 2PL2A 3L13A 1N0QA 2FI7A 3Q7AA 4PUCA 2BUGA 4CT0A 4B0ZA 4I1OB 2XEHA 5BUZA 2Y3AA 3CR3A 5AARA 1DCQA 1QQEA 3PZ4A 3DSUA 4HOUA 4L1BA 2WPVA 3RO3A 3Q15A 4GZDA 4P29A 1OWOA 3J5QB 3LVQE 2Y69E 1JWGA 3Q73A 3PNLB 1ZU2A 2I1JA 2NC9A 4CEMA 2KCVA 3JUEA 2IU1A 4F53A 1ELRA 2OVFA 2WXPA 4YVOA 3ULYA 4BX8A 2ZU6B 4N5CA 4TV3A 5G04C 2UWJG 4F1PA 3NOGD 3HVEA 2LAIA 4WNEA 4FHJA 4L9PA 1ELKA 1UOHA 3UX4A 2VSOE 2LAHA 1FT1A 3CVQA 2VSNA 4KT6B 1V55E 3LVRE 2ZIRA 1ZB1A 2C0MA 3E30A 4TXQA 3B95A 3QK0A 3CKCA 4AVXA 1E8WA 1MZCA 4A1SA 3HHMA 4MBGA 3D3MA 3R9AB 4B8CB 4RG9A 2YNQA 4O6FA 3CK7A 5ARFA 2X6HA 3ZU7B 2GRRB 3G2WA 3G2TA 3D9JA 3QB2A 3QWWA 3ABLE 3T8KA 2OOEA 4G8KA 4L23A 3CQGB 4K5CA 1N4SA 1UN8A 4JEHA 3QKYA 3CVWA 3S7BA 1Z6TA 3CVVA 4CDMA 2OEWA 5A6CA 3Q9UC 1TNOA 3L17A 2P9PG 4BTAA 3SGHA 3BG1B 4EZKA 4HRNA 1JUQA 3UKRG 3CEQA 5FWQA 3FU3A 2VSYA 3UUXA 2LXLA 2QYUA 2RFAA 4J8DA 5AIJA 2ETBA 5AQBA 4J8FA 4GU5A 4WAFA 4XKBA 2RD0A 5HRYA 4URKA 4N3AA 1H0AA 2ZGDA 3RJVA 4J0UA 2F8XK 2VGXA 3UM1A 3U64A 5JHAA 3CVUA 5KJNA 1E7VA 1OXJA 3QC1A 2KZTA 1NL4A 1OUVA 4ME2A 3T5VA 3D9OA 3LDZA 4Q96A 1N4QA 3PZ3A 4ZHBA 2WXNA 5BW8C 3Q49B 4M3OA 3ZXPA 1TNBA 1MX4A 1QBQA 3DSWA 4IN3B 2WXQA 3JQ1A 2XRYA 4BETA 4I6EA 3DXKG 4OAUC 3DEPA 3FTYA 4LNGA 1IXVA 3QWPA 4RVBA 5A7DB 3ZKJA 1RZ4A 3PREA 3SHFA 4O1OA 4U63A 4GTRA 1N11A 3EHMA 3OXLA 2WXJA 5ANRA 4DX5D 4HOQA 1KPSB 4JD2G 2PNNA 5FINA 4HS2A 1TN8A 2H6IA 4UUCA 2WMNA 3DRAA 4FJZA 3CVLA 2R2LA 3FH7A 3DSTA 4WWOA 3B7SA 3CHQA 4KMOA 1HX8A 2VQ2A 3QARA 3MKQB 3LJ3A 5T8IA 3KEAA 2X6KA 1O1SA 2R05A 2CHWA 4IULA 4C0EA 4C0MA 2P9UG 3PE4A 1OWMA 1E8ZA 4AV7A 2LUHA 2XPZA 3D9MA 2GRMA 2EIKE 2F8YA 1TN6A 4KBQA 3NAWA 3ABME 3AS8A 1TJCA 4F1SA 3FUDA 5AJLA 4WWPA 4CYMD 5KBAA 4XEIG 3RAUA 2IONA 3OXGA 4IYPA 3UM2A 1N9AA 3WXXA 3GW4A 4BSXA 4DLQA 3W9GA 4HLEA 2PM6A 1GW6A 3TGOA 2KC7A 4LG6A 2LO6A 1KZPA 2V8SE 4YDEA 1EDUA 3Q79A 1EYHA 4A3VA 2F37A 4I6GA 3U4TA 2OEVA 2E2EA 1DCEA 3V79K 2QC9A 2IO3C 3AJIA 3L22A 1BI8B 3FEXA 3VTYA 2VGYA 4JL0A 3ZFWA 2R5SA 3JXJA 3EDTB 3UQ3A 4CRWA 2V5FA 2YHEA 5ENNA 4K0RA 5LFAA 3R7QA 4LCTA 4YDYA 1ZBPA 2XHEA 1G3NB 4U07A 2OCCE 4QFVA 4DPRA 5EN5D 2BTDA 3X2QE 5ENOD 4N39A 3AG3E 4C9BB 2QY7A 1N0RA 4GTSA 1XGWA 2I1KA 4GTMA 1OWNA 4CGVA 1UJKA 3UM0A 3GZ1A 3FUMA 5T4YA 3NOCD 5B3SE 1H2TC 3DEOA 2J8SD 4QQIA 2R59A 5EKQD 3ESLA 1QYMA 2J4DA 4B93B 4NURA 1E8YA 2XCBA 4GB9A 4WNDA 3G2UA 2BEDA 5AYWD 4GTPA 3D9NA 3AAAC 4YNDA 3E37A 4JEUA 5AENA 3L82A 2EINE 3NF1A 5KJKA 4HNAD 2WXLA 3Q7FA 4EECA 2QYJA 2HR2A 4G1TA 4I1AA 5CBNA 2P58C 2XZTG 1E8XA 5B1AE 2LNIA 1N4RA 4GYYA 4FJYA 4N2QA 1S63A 4DLOA 4KZ0A 3CK8A 3L6AA 3BU8A 5HI7A 4G25A 1HF8A 3DXMG 2ETAA 4J7WA 4U8VD 4UQZA 5HS0A 5JJTA 5J90A 3LEWA 2AXZA 4DI4A 3JCKC 4R7LA 4BTBA 3T9KA 1OCRE 4JPSA 2M63A 4B8AA 3Q78A 4I2ZA 4EQFA 1WAO1 3HXFA 5FZSA 2C0LA 5E76A 4EZJA 3ENEA 3RO2A 3AG1E 1IHGA 3BQOA 1L5JA 5G2NA 3FUJA 5DBKA 5E75A 4GTTA 4HBDA 2XGOA 3MEKA 4GZCA 3T5XA 2CG2A 4UWGA 1HO8A 4LNBA 3FP3A 4LEUA 4CDNA 5FZQA 3PZDA 3UM3A 2PZIA 3S7DA 5LOZA 4MRUA 5CEAA 4JXTA 2FO1E 3EU5A 4AY6A 4A55A 1HE8A 3TWUA 3APFA 4GA0A 4HRMB 4GMRA 5LP0A 1D8EA 4JHKA 3CGHA 1BU9A 4F3VA 3RKVA 3QJZA 4APOA 4F6RD 2JABA 4GYOA 3G2SA 3VLFA 2EQXA 5HKPA 1KT0A 2UY1A 3GZSA 3SBSA 4ABNA 3Q4AB 2L0IA 4GZ5A 2AJAA 4WNGA 4G8LA 4UWKA 2AVPA 1OCCE 1K3ZD 2GGFA 1N95A 4XE0A 4ACLA 3CHRA 4V3IA 3SFZA 4N5QA 1K1AA 4O1PA 1MHQA 2VTBA 4RG6A 3I5PA 4LRZA 4Q94A 5CBOA 5EDSA 4PS3A 2J9QA 2XEVA 3HXCA 1YCSB 2ETCA 3QWVA 4RQIA 4KYOB 4GTVA 3PZ1A 4XX5A 2ZGGA 5ENRD 3RU0A 4U04A 2KCLA 3L16A 4RLYA 1KZOA 3PVLA 1Y8MA 1AP7A 3CVPA 3GYZA 4OYSA 4OAVB 1OY3D 5G05C 3IBEA 4BX9A 2L9BA 4GAAA 4HRLA 1NZNA 3UT4A 3RRMB 4A1GA 1H2VC 3FWVA 2VGEA 3TAXA 4ATGA 3ZXSA 4PS7A 2HE0A 2IY0C 4LNUD 4L2YA 4CZ2D 4W9RA 2X6JA 1TJFA 4E6HA 2IOSA 3FTWA 3SI5A 4ILHB 3MZLB 1WY6A 2DWZA 3LY9A 3UTMA 1NFIE 4HI8A 2V0PA 4UWHA 1O1TA 1JPLA 2L6BA 3CV0A 2XS1A 4GPMA 3LY7A 2I2OA 5AQ9A 2FULA 3V2XA 1UW4B 2J49A 4I9EA 5CRVA 2WXFA 3ZYLA 4C48B 3ZYKA 2IFUA 1VDYA 4YVQC 1QZ2A 3UXGA 2P9LG 1OT8A 4FP7A 4UWFA 2HO1A 1KT1A 1SW6A 3U3WA 3ONKA 3TWXA 3ZYMA 2X3MA 3PDNA 4CGWA 2RG8A 3D9PA 5G04J 4GMJA 3CQCB 2XPYA 3ZYQA 1D8DA 3S2AA 3I4GA 1BPOA 4JHRA 4GZ6A 3CKBA 5J08A 4U8HA 2PM7A 4KVOA 1H6OA 3C3RA 4L2LA 4BFRA 3T8MA 3ULEG 1E96B 3Q47B 5ENTD 1EF1C 3E33A 3I4RB 5B1BE 4ANWA 4AIFA 4DX2A 2HM8A 3EIJA 1NA0A 3ZEFA 4HORA 1INZA 4EZLA 3GZ2A 4BSZB 3FTXA 3E34A 4YDOA 5FQ4A 5M72A 2WXOA 4JZYA 1U3DA 3FHEA 5AJDA 3BUAA 4B89A 3FUKA 1TNZA 2L6JA 4BT8A 4Y6WA 1HFAA 1A17A 2ONDA 4BERA 2DIWA 3SD5A 3V30A 3Q5MA 1FVHA 1S70B 3HXDA 2MOWA 1WM5A 1OWLA 3FULA 3PE3A 2JLBA 1LD7A 4J8YA 1JCQA 4APFA 3JUIA 3VTXA 4JC8A 3PUJA 4XI0A 5ANLA 3CVYA 1MQSA
chains in the Genus database with same CATH topology
4G2VA 4EECA 2HR2A 4DI3A 1Z3XA 2VSXE 4G1TA 2YHCA 3MJWA 1YA0A 3D9LA 2KCKA 4I1AA 4FADA 3HVEA 2LAIA 4WNEA 2P58C 4G11A 4FHJA 4L7TA 1ELKA 4J8SA 3ESKA 1E8XA 3D9KA 4H7XA 3UX4A 2CHZA 2LNIA 2X6IA 3NQPA 1SZAA 3P2BA 4WUYA 2VSOE 3P1UA 4GYYA 2LAHA 3JYSA 4FJYA 4EBAA 3CVQA 2VSNA 2Y4UA 4KT6B 2GRLA 5BNWA 2I6HA 4N2QA 3MA5A 3FUNA 4DLOA 4KZ0A 4CT4A 4I6JA 3CK8A 3L6AA 2KZTB 5HI7A 4UI9K 2XRZA 3LVRE 1NP7A 4G25A 1HF8A 1HZ4A 3FH5A 4AP2A 3CHMA 2C0MA 1S0PA 5KJMA 5FT9A 2CHXA 3ZN3A 4JA9A 5C2YA 3SF4A 3QK0A 4UQZA 3RRNB 4KXKB 5JJTA 3CKCA 3ZVVA 5J90A 3LEWA 2AXZA 4NRHB 4AVXA 1E8WA 1FCHA 3L54A 3U66A 3MYVA 4A1SA 4DI4A 3HHMA 3D3MA 3R9AB 3JCKC 4R7LA 5CMYA 3E4BA 4B8CB 1QNFA 2AW6A 5LCWJ 1X5BA 4RG9A 4BTBA 2YNQA 2WQ6A 4ILIA 4XZ4A 4O6FA 3CK7A 3ASDA 5ARFA 3RRUA 4JPSA 1HH8A 2A4ZA 2X6HA 3G2WA 3G2TA 2M63A 3D9JA 1B89A 3QB2A 3QWWA 4B8AA 4EQFA 4I2ZA 4B94A 4GPKA 4U0SA 1H6KA 1WAO1 5FZSA 2C0LA 2OVBA 4HFGA 5E76A 4EZJA 3DPDA 2VYIA 3MX3A 3ENEA 3FUHA 2OOEA 3RO2A 3OXFA 4XKCA 4L23A 3CIAA 3CQGB 2WVIA 1UN8A 4DK5A 4JEHA 5JJ7A 1IHGA 3QKYA 1HG5A 5A23A 1L5JA 3CVWA 5G2NA 3FUJA 3S7BA 1Z6TA 5DBKA 5E75A 3CVVA 3I3NA 5JJ6A 1PC2A 4CDMA 2XGOA 3MEKA 4GCNA 4UWLA 5A6CA 3APDA 4UQYA 4GZCA 4GA2A 2CG2A 3T5XA 3O4ZA 4UWGA 1HO8A 5EX3A 1PAQA 3FP3A 4LEUA 3LXUX 3L17A 4CDNA 3URZA 4LUNU 5FZQA 4BTAA 3DBSA 2GW1A 3BG1B 3PZDA 3PRZA 3SGHA 4EZKA 2AXVA 2PZIA 4IRUA 1JUQA 4FLBA 4GYWA 3ZW3A 4Q69A 3S7DA 4OVUA 5LOZA 4MRUA 1N54A 5LCWC 1PY1A 4TUUA 4ACKA 3B13A 4JXTA 3CEQA 4AY6A 5FWQA 3FU3A 3IKOB 4A55A 2VSYA 3UUXA 4UQXA 4K03A 4NQ0A 3APCA 4J6IA 1HE8A 3FU6A 3EHNA 1H2UA 3APFA 4BT9A 4GA0A 4J8DA 3UT7A 3ZIMA 2Q7FA 5AIJA 4JHKA 3LPZA 5LP0A 3CGHA 4U0UA 5DIZA 2WB2A 4J8FA 4GU5A 4U0ZA 3FY4A 4F3VA 4LERA 3RKVA 2PQNA 3FEYA 3QJZA 4APOA 4CCAA 2MRIA 3CVXA 4ILGA 2JEKA 2CFUA 4WAFA 3TJPA 2VTBB 4XKBA 3VLDA 2WQHA 3FU5A 2RD0A 4GYOA 3G2SA 3VLFA 4FHKA 2EQXA 3G2VA 1KT0A 1XNFA 2UY1A 4GA1A 4N3BA 5EX0A 3GZSA 1N52A 3SBSA 4URKA 4G23A 4N3AA 4ABNA 1H0AA 3CK9A 3ZPJA 4AJWA 4HOSA 2UY1B 3Q4AB 2L0TB 2V4LA 3RJVA 2L0IA 4J0UA 3PUKA 3B7UX 2VGXA 4GZ5A 4WNGA 4UWKA 2AVPA 3CHOA 2WXKA 1ELWA 2CFZA 3KAEA 1E90A 1LF8A 2C2LA 3U64A 1IQUA 2GGFA 2WXHA 5JHAA 3CVUA 5KJNA 4XE0A 1E7VA 3AU5A 4GMLA 4ACLA 4AY5A 3CHRA 4AEZC 4V3IA 3SFZA 3QC1A 2KZTA 2IQCA 4OVVA 1OUVA 4G24A 1MHQA 2Y4TA 4J8EA 4RG6A 3FTZA 2VTBA 3I5PA 4LRZA 3TXNA 4ME2A 4KZCA 3T5VA 1JWFA 3D9OA 3IV0A 4Q94A 3B7TA 3LDZA 4Q96A 3KD7A 5EDSA 3PH0C 4PS3A 2J9QA 1EPUA 4UI9J 2XEVA 3FUFA 2J07A 1Z3YA 3ASFA 3QWVA 2YINA 2VGXB 2WXNA 4KYOB 5BW8C 3ML8A 3MKRA 3KEZA 3Q49B 4I43A 4M3OA 5FQ6A 5BV1A 4WNFA 4XX5A 4BWRA 3RU0A 4U04A 2KCLA 3L16A 4HVBA 3PVLA 5LX8A 3ZGQA 3S7FA 4IN3B 3L08A 2FBNA 1Y8MA 2WXQA 1UG3A 3TXMA 2FO7A 3JQ1A 2XRYA 2QFCA 3CVPA 3GYZA 3FTSA 4OYSA 5CHEE 4HOTA 1KLXA 3MV3B 4JVSA 4ANXA 5G05C 3IBEA 4GZ3A 4BX9A 1UJJA 2L9BA 4I6EA 5T3RA 4MLPA 4GAAA 1H19A 4JA7A 4AXHA 1NZNA 3HYMB 3FTYA 4I1MA 3UT4A 3RRMB 3ML9A 4A1GA 1H2VC 2I9CA 4JW1A 3FWVA 3QWPA 4TRQA 3SBTB 4RVBA 2VJ8A 3TAXA 2WXGA 4ATGA 1OWPA 2WM9A 5A7DB 3C98A 3ZXSA 4PS7A 4XIFA 2PQRA 3TG5A 4L2YA 1IYGA 4W9RA 1HG2A 2X6JA 3CSFA 3PS6A 3PREA 3SHFA 3QOUA 4U63A 1TJFA 4FU3A 3PEVB 4E6HA 2IOSA 5CMWA 4HXIA 3EHMA 3FTWA 3OXLA 4XI9A 3SI5A 2WXJA 5ANRA 1DVPA 4ILHB 3UMVA 3LCAA 3MZLB 2NSZA 4HOQA 1WY6A 3LY9A 4A3TA 2R17C 4JHJA 3ZHEA 4N3CA 5KJLA 4I9CA 3PEUB 2E0IA 2DCPA 2V0PA 3LKUA 4UWHA 4HS2A 1JPLA 2YQ8A 4BY6A 3CV0A 1TEZA 3QAQA 3ONLA 4FULA 2WMNA 3K9IA 3LS8A 3LY7A 3FTVA 3ULQA 5BPPA 2I2OA 3IHVA 2FULA 2AXUA 4FJZA 3CVLA 1UW4B 5JHBA 5FJYA 3CHPA 3FH7A 4F7AA 3CHSA 1HXIA 4WWOA 2XGSA 3B7SA 2J49A 5ARGA 3CHQA 4I9EA 1W3BA 2WXFA 3ZYLA 3AU4A 4KMOA 1HX8A 2VQ2A 3ZYKA 2A5UA 2DBAA 2J08A 3QARA 3MKQB 3LJ3A 5T8IA 2MHKA 2IFUA 3LYAA 2X6KA 1VDYA 5HQ8A 1UN9A 4YVQC 2CHWA 1QZ2A 4DJAA 4IULA 4C0EA 4C0MA 3PE4A 3FH8A 4FP7A 4UWFA 4EBAG 2HO1A 1OWMA 4Y6CA 2HYZA 3B7RL 1E8ZA 3ASHA 2BF0X 2XPZA 4AV7A 3D9MA 2ILRA 1KT1A 2GRMA 3MCXA 3N71A 4PS8A 3TG4A 1SQMA 3FUIA 5FTPA 4KBQA 4GCOA 3MGBA 1HS6A 1TJCA 3AS8A 3FUDA 3ONKA 3OTNA 3NZSA 4WWPA 2X3MA 5AJLA 3ZYMA 3U3WA 2OV8A 3PDNA 4CGWA 1Y6IA 2RG8A 4RSYA 3D9PA 1U3CA 4FC8A 5G04J 2IONA 2WXRA 4G26A 2NXPA 4GMJA 3CQCB 2XPYA 3OAWA 5FZRA 2IOLA 3CSTA 3ZYQA 3OXGA 4IYPA 2XPIA 3MKQA 3S7JA 3S2AA 4NACA 3I4GA 3WXXA 4ANUA 5CCMA 3GW4A 3SZ7A 2KM4A 4BSXA 1BPOA 3FFLA 3HVEB 3AS4A 4JHRA 3EJNA 4GZ6A 4DLQA 2IF4A 2FF4A 4HLEA 3CKBA 5J08A 3ZRHA 2LSVA 3UPVA 2PM6A 4U8HA 1GW6A 2PM7A 5CCLA 3CLJA 4KVOA 3TGOA 2KC7A 4BFRA 4L2LA 3T8MA 2X38A 1IQRA 3D9IA 3SNXA 2LO6A 1E96B 2V8SE 5G55A 3UT8A 3Q47B 4PDXA 1EDUA 4N2SA 1EYHA 4A3VA 1EF1C 4I6GA 3U4TA 3FDHA 4I2WA 2AWIA 3FU0A 2XQ0A 2E2EA 2LSUA 3AS5A 4MS6A 3I4RB 4KVMA 2FEZA 2WXIA 3L22A 4ANWA 3FEXA 4AIFA 1DNPA 2HM8A 3VTYA 2VGYA 3EIJA 1NA0A 4TV3A 5KCMA 3U9WA 4JL0A 3ZEFA 4HORA 1INZA 4ANVA 4MKTA 3EIQC 2R5SA 3ZFWA 4EZLA 3GZ2A 3EDTB 4AOFA 3UQ3A 3FTXA 4PH4B 4CRWA 3FUEA 2J4BA 5BV0A 2V5FA 3QDNA 2YHEA 3NZUA 5ENNA 4K0RA 5LFAA 1FVFA 3R7QA 4LCTA 3PNTB 5FQ4A 3MV2B 5M72A 3BEEA 5BT1A 1ZBPA 2XHEA 4WWNA 2WXOA 4JZYA 3ASGA 1NA3A 3FTUA 4U07A 4F1SA 1U3DA 3FHEA 4QFVA 5AJDA 3RIBA 4UI9C 4DPRA 2BTDA 3IHYA 4N39A 2PL2A 3L13A 4I17A 4B89A 3QNKA 5FQ8A 5G05J 3R7RA 1SZ9A 3FUKA 3CVNA 4AM9A 2FI7A 2L6JA 3RK6A 1HU3A 3TL5A 4PUCA 2BUGA 4CT0A 4CDRA 3HIZA 4BT8A 4Y6WA 2KATA 4B0ZA 4C9BB 4E85A 2QY7A 4H7YA 4I1OB 1HFAA 1A17A 1XGWA 5BUZA 2I1KA 1OWNA 4CGVA 2Y3AA 1UJKA 2ONDA 3CR3A 3GZ1A 2WMOA 4D10C 2XCCA 1QQEA 3FUMA 5T4YA 4HOUA 2J09A 4L1BA 5G04C 2DIWA 2WPVA 3JQ0A 3RO3A 3SD5A 3Q15A 4GZDA 1H2TC 4P29A 5C1DA 3VLEA 3KS2A 3Q5MA 1FVHA 2R59A 1OWOA 3LVQE 5EKQD 3ZHEB 3ESLA 5FQ7A 3HDXA 1JWGA 1P5QA 2MOWA 5D0QD 1WM5A 2J4DA 2WXMA 1OWLA 3PNLB 3FULA 4NURA 1ZU2A 2CG3A 1E8YA 3PE3A 2XCBA 2I1JA 3O48A 4GB9A 3BG0B 4WNDA 2NC9A 3G2UA 5AYWD 2JLBA 4CEMA 3IEGA 2KCVA 3D9NA 2X6FA 3LY8A 4FA6A 4APFA 2IU1A 4EPZA 3JUIA 2XGMA 4YNDA 4F53A 1ELRA 3VTXA 4JEUA 5AENA 4JC8A 2OVFA 2WQ7A 3PUJA 1E7UA 2WXPA 4YVOA 2IJGX 3NF1A 4BX8A 2ZU6B 4XI0A 5KJKA 5ANLA 4FLHA 4N5CA 3CVYA 2UWJG 1MQSA 2WXLA 5D0OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0A A;  1SZ9 A;  1JWG A;  1JWF A;  2V8S E;  3D9O A;  2L0T B;  2MOW A;  3D9P A;  4GZC A;  1EDU A;  2L0I A;  1EYH A;  3LDZ A;  4Q96 A;  1VDY A;  3RRU A;  3G2W A;  3G2T A;  3ONL A;  1HF8 A;  3D9J A;  5LP0 A;  1HG2 A;  2QY7 A;  3D9L A;  3ZYQ A;  1HFA A;  3G2U A;  1XGW A;  1UJJ A;  4FU3 A;  4HFG A;  5CMW A;  1LF8 A;  4NAC A;  1UJK A;  1ELK A;  1DVP A;  3D9N A;  3ZYK A;  1JUQ A;  2BF0 X;  4FLB A;  3D9K A;  3D9M A;  2KM4 A;  5LOZ A;  1PY1 A;  1SZA A;  4JXT A;  4AVX A;  2DIW A;  1INZ A;  5J08 A;  3G2S A;  4GZD A;  1HG5 A;  3G2V A;  3ZYL A;  2DCP A;  3CLJ A;  4Q94 A;  5CMY A;  3ONK A;  1MHQ A;  3ZYM A;  1HX8 A;  1JPL A;  1X5B A;  3D9I A;  2LO6 A; 
#chains in the Genus database with same CATH topology
 4G2V A;  4TUM A;  1Z3X A;  2VSX E;  3PZ2 A;  2YHC A;  5ENS D;  1YA0 A;  3D9L A;  4G11 A;  4J8S A;  3ESK A;  2X6I A;  1TN7 A;  4EBA A;  2Y4U A;  5BNW A;  2GRL A;  3MA5 A;  2RKK A;  1HZ4 A;  5EYL A;  4AP2 A;  1IHB A;  3CHM A;  4M7C A;  2A5E A;  5FT9 A;  3ZN3 A;  5C2Y A;  3SF4 A;  4KXK B;  3ZVV A;  4NRH B;  1FCH A;  3MYV A;  4U96 D;  5CMY A;  3E4B A;  2AW6 A;  3TWR A;  2QZA A;  2WQ6 A;  3ASD A;  3RRU A;  1HH8 A;  1B89 A;  4BEP A;  1JCS A;  1K1B A;  2VYI A;  3DPD A;  3MX3 A;  1N94 A;  4XKC A;  3CIA A;  5JJ7 A;  5A23 A;  1HG5 A;  3I3N A;  1PC2 A;  4UWL A;  2XEE A;  4UQY A;  4GA2 A;  4GTO A;  5CEC B;  3O4Z A;  5EX3 A;  1PAQ A;  3URZ A;  4LUN U;  3DBS A;  3PRZ A;  4IRU A;  4GYW A;  3ZW3 A;  4Q69 A;  5LCW C;  1PY1 A;  4ACK A;  5BXU A;  4NQ0 A;  1FT2 A;  4J6I A;  1NI1 A;  2EIM E;  3UT7 A;  3ZIM A;  5DIZ A;  5FIO A;  2R03 A;  2PQN A;  2MRI A;  3CVX A;  3TJP A;  2R02 A;  2V4H C;  2WQH A;  3ASO E;  4FHK A;  3G2V A;  1XNF A;  3ISM C;  4GA1 A;  5EX0 A;  1N52 A;  4G23 A;  4GTQ A;  3CK9 A;  4AJW A;  2UY1 B;  2L0T B;  2V4L A;  3DSS A;  3PUK A;  3V31 A;  3CHO A;  2WXK A;  1LF8 A;  2C2L A;  1IQU A;  1O5M A;  3UIN C;  4GML A;  1OCO E;  3D9H A;  4AY5 A;  4AEZ C;  4OVV A;  4J8E A;  3FTZ A;  3IV0 A;  5KNG A;  1EPU A;  4UI9 J;  3SQV A;  1YYH A;  1SVX A;  2YIN A;  2VGX B;  3ML8 A;  3MKR A;  4I43 A;  2DZN A;  5FQ6 A;  5BV1 A;  4WNF A;  3ZGQ A;  3S7F A;  2FBN A;  2QFC A;  5CHE E;  1KLX A;  3MV3 B;  3NBN B;  4JA7 A;  2H6G A;  3AG4 E;  3ML9 A;  2ZIS A;  3SBT B;  2VJ8 A;  2WM9 A;  4XIF A;  3J5P A;  2PQR A;  3TG5 A;  2XZD G;  1IYG A;  1HG2 A;  3CSF A;  3PS6 A;  5BXO A;  4FU3 A;  3PEV B;  5ENQ D;  4HXI A;  4XI9 A;  3C5R A;  1S64 A;  4DX7 D;  3E32 A;  4K5A B;  3W9F A;  3LJN A;  4TXP A;  4A3T A;  1H6P A;  4JHJ A;  3ZHE A;  5KJL A;  4I9C A;  2E0I A;  2DCP A;  3LKU A;  2YQ8 A;  2DYS E;  2KXP C;  3QAQ A;  1TNY A;  4FUL A;  3K9I A;  3LS8 A;  3ULQ A;  3HG0 D;  3R9M A;  1OCZ E;  3CHP A;  2V5Q C;  2XGS A;  3F6Q A;  5ARG A;  1W3B A;  1TNU A;  3AU4 A;  2A5U A;  3UI2 A;  2MHK A;  3DSV A;  5HQ8 A;  5AAO A;  1UN9 A;  4Y6C A;  2HYZ A;  3ASH A;  2BF0 X;  3N71 A;  2ILR A;  3MCX A;  2DVW A;  1LTX A;  3FUI A;  5FTP A;  4GCO A;  1HS6 A;  3OTN A;  2OV8 A;  1Y6I A;  4RSY A;  1YMP A;  1U3C A;  4G26 A;  2WXR A;  2NXP A;  5FZR A;  3CST A;  3S7J A;  2Y0B G;  5CCM A;  3C3O A;  3SZ7 A;  2KM4 A;  3FFL A;  3HVE B;  3EJN A;  2IF4 A;  2FF4 A;  3ZRH A;  2LSV A;  3SFY A;  5CCL A;  3CLJ A;  2B6C A;  2X38 A;  1IQR A;  3D9I A;  4U7E B;  3UT8 A;  4PDX A;  3FU0 A;  2XQ0 A;  2LSU A;  4DUI A;  3AS5 A;  4MS6 A;  3U9W A;  5CER B;  1DC2 A;  4ANV A;  4MKT A;  2H6F A;  4PH4 B;  3FUE A;  2J4B A;  5BV0 A;  4HQD A;  3SO8 A;  3L9T A;  3NZU A;  4ZFH A;  3TWQ A;  1FVF A;  3MV2 B;  3BEE A;  5BT1 A;  3EUV A;  3JXI A;  3RIB A;  4UI9 C;  4I17 A;  3QNK A;  5FQ8 A;  5G05 J;  1TYQ G;  3R7R A;  1SZ9 A;  3WG7 E;  3CVN A;  4AM9 A;  3RK6 A;  1RW2 A;  1HU3 A;  3TL5 A;  4CDR A;  3HIZ A;  4E85 A;  2KAT A;  4H7Y A;  2RFM A;  3ZUV B;  1Z5S C;  4Z68 A;  2WMO A;  4D10 C;  2XCC A;  2GRQ B;  2J09 A;  2P9N G;  3JQ0 A;  4NIK A;  5C1D A;  3VLE A;  3KS2 A;  3ZHE B;  5FQ7 A;  3HDX A;  1P5Q A;  5D0Q D;  2WXM A;  1FPP A;  2GRO B;  2CG3 A;  3KSL A;  3O48 A;  3BG0 B;  4O60 A;  3IEG A;  2X6F A;  3LY8 A;  4FA6 A;  4EPZ A;  2XGM A;  5JMN D;  1E7U A;  2IJG X;  2KBX A;  4FLH A;  5CRU A;  5D0O D;  4DI3 A;  4DRX E;  4DX1 A;  3RSE G;  3MJW A;  2KCK A;  4FAD A;  1Q2Z A;  1BD8 A;  4L7T A;  3D9K A;  2BKG A;  4H7X A;  3HXB A;  2CHZ A;  3NQP A;  4TXR A;  1SZA A;  3P2B A;  4WUY A;  1BI7 B;  3P1U A;  3Q75 A;  4EHM A;  5EID A;  3JYS A;  2I6H A;  3FUN A;  4DX6 D;  4CT4 A;  4I6J A;  2KZT B;  2DZO A;  4UI9 K;  2XRZ A;  1NP7 A;  3FH5 A;  2XEN A;  1S0P A;  5KJM A;  2CHX A;  2P2C P;  4JA9 A;  2BKK B;  3RRN B;  3U66 A;  3L54 A;  4ATZ D;  1QNF A;  5LCW J;  1X5B A;  4ILI A;  4XZ4 A;  2A4Z A;  5KWD A;  2EIJ E;  3AG2 E;  5AQ7 A;  1WG0 A;  5EIL A;  4B94 A;  4GPK A;  4U0S A;  1H6K A;  2OVB A;  4HFG A;  3FUH A;  3C72 A;  3OXF A;  5D2M C;  2WVI A;  4DK5 A;  3EHQ A;  1O1R A;  1A5E A;  5JJ6 A;  2IEJ A;  4GCN A;  1V54 E;  3APD A;  3ASN E;  3LXU X;  3DPY A;  3SFX A;  3V2O A;  2ZXW E;  4HLL A;  2GW1 A;  2AXV A;  4K5B A;  4FLB A;  5AQA A;  4OVU A;  1N54 A;  4TUU A;  1MX2 A;  3B13 A;  4U95 D;  2GRN B;  3IKO B;  4BES A;  4UQX A;  4K03 A;  3SY2 A;  3APC A;  2EIL E;  3FU6 A;  3EHN A;  1H2U A;  4BT9 A;  1IKN D;  5ENP D;  1AWC B;  2P9I G;  5EIB E;  2Q7F A;  3LPZ A;  4U0U A;  2WB2 A;  2P9S G;  5IY5 E;  4U0Z A;  3FY4 A;  4LER A;  3UKU G;  3FEY A;  5JA4 D;  3ZNG A;  4CCA A;  4ILG A;  2JEK A;  2CFU A;  2VTB B;  3VLD A;  3FU5 A;  1N4P A;  4N3B A;  3ZPJ A;  4HOS A;  3B7U X;  2IO2 C;  3NB2 A;  1ELW A;  2CFZ A;  3KAE A;  1E90 A;  1MX6 A;  2WXH A;  3AU5 A;  4U8Y D;  2IQC A;  4G24 A;  1MJ0 A;  2Y4T A;  2XS8 A;  3TXN A;  4KZC A;  1JWF A;  3UIO C;  2F0Y A;  3B7T A;  1JCR A;  3KD7 A;  3PH0 C;  3FUF A;  2J07 A;  1Z3Y A;  3ASF A;  5ITZ F;  3KEZ A;  4JB8 P;  4BWR A;  4HVB A;  5LX8 A;  4HB5 A;  3L08 A;  1X81 A;  3TXM A;  1UG3 A;  2FO7 A;  2GRP B;  4HOT A;  3FTS A;  2DYR E;  4JVS A;  4ANX A;  4GZ3 A;  1UJJ A;  3TWW A;  5T3R A;  4MLP A;  1H19 A;  4AXH A;  3HYM B;  4I1M A;  2I9C A;  4JW1 A;  1BLX B;  4TRQ A;  2NYJ A;  3HRA A;  2WXG A;  1OWP A;  3C98 A;  2P9K G;  3DSX A;  4YDW A;  3QOU A;  5H7P A;  1K8K G;  2LXM A;  5CMW A;  1DVP A;  3UMV A;  3LCA A;  2NSZ A;  2R17 C;  4N3C A;  5KNH D;  3PEU B;  1WDY A;  4BY6 A;  1TEZ A;  1MYO A;  3ABK E;  3ONL A;  3FTV A;  5BPP A;  3IHV A;  2AXU A;  5JHB A;  5FJY A;  4F7A A;  3CHS A;  1HXI A;  3UIP C;  4LSZ E;  3B7B A;  2DBA A;  2J08 A;  3LYA A;  4DJA A;  3TWV A;  4X8Q A;  3FH8 A;  4EBA G;  3B7R L;  5CED B;  4PS8 A;  3TG4 A;  1D9S A;  2H6H A;  1SQM A;  3EHR A;  3MGB A;  4HI9 A;  3NZS A;  5EYP F;  4FC8 A;  3OAW A;  2IOL A;  5D66 A;  2XPI A;  3MKQ A;  4NAC A;  3EU9 A;  4ANU A;  3TWS A;  3DWL G;  3AS4 A;  3TWT A;  3HXE A;  3UPV A;  2WQ7 A;  3SNX A;  1LD8 A;  5G55 A;  4N2S A;  3C3Q A;  3IXE A;  3FDH A;  4I2W A;  2AWI A;  4KVM A;  2FEZ A;  2MYO A;  2WXI A;  1DNP A;  5KCM A;  5AN8 A;  3EIQ C;  3Q9N C;  4AOF A;  2B0O E;  2Y1L E;  1U2V G;  3QDN A;  3KSQ A;  3PNT B;  1TR4 A;  4WWN A;  3ASG A;  1NA3 A;  3FTU A;  1SA5 A;  4A63 B;  1SA4 A;  3IHY A;  2PL2 A;  3L13 A;  1N0Q A;  2FI7 A;  3Q7A A;  4PUC A;  2BUG A;  4CT0 A;  4B0Z A;  4I1O B;  2XEH A;  5BUZ A;  2Y3A A;  3CR3 A;  5AAR A;  1DCQ A;  1QQE A;  3PZ4 A;  3DSU A;  4HOU A;  4L1B A;  2WPV A;  3RO3 A;  3Q15 A;  4GZD A;  4P29 A;  1OWO A;  3J5Q B;  3LVQ E;  2Y69 E;  1JWG A;  3Q73 A;  3PNL B;  1ZU2 A;  2I1J A;  2NC9 A;  4CEM A;  2KCV A;  3JUE A;  2IU1 A;  4F53 A;  1ELR A;  2OVF A;  2WXP A;  4YVO A;  3ULY A;  4BX8 A;  2ZU6 B;  4N5C A;  4TV3 A;  5G04 C;  2UWJ G;  4F1P A;  3NOG D;  3HVE A;  2LAI A;  4WNE A;  4FHJ A;  4L9P A;  1ELK A;  1UOH A;  3UX4 A;  2VSO E;  2LAH A;  1FT1 A;  3CVQ A;  2VSN A;  4KT6 B;  1V55 E;  3LVR E;  2ZIR A;  1ZB1 A;  2C0M A;  3E30 A;  4TXQ A;  3B95 A;  3QK0 A;  3CKC A;  4AVX A;  1E8W A;  1MZC A;  4A1S A;  3HHM A;  4MBG A;  3D3M A;  3R9A B;  4B8C B;  4RG9 A;  2YNQ A;  4O6F A;  3CK7 A;  5ARF A;  2X6H A;  3ZU7 B;  2GRR B;  3G2W A;  3G2T A;  3D9J A;  3QB2 A;  3QWW A;  3ABL E;  3T8K A;  2OOE A;  4G8K A;  4L23 A;  3CQG B;  4K5C A;  1N4S A;  1UN8 A;  4JEH A;  3QKY A;  3CVW A;  3S7B A;  1Z6T A;  3CVV A;  4CDM A;  2OEW A;  5A6C A;  3Q9U C;  1TNO A;  3L17 A;  2P9P G;  4BTA A;  3SGH A;  3BG1 B;  4EZK A;  4HRN A;  1JUQ A;  3UKR G;  3CEQ A;  5FWQ A;  3FU3 A;  2VSY A;  3UUX A;  2LXL A;  2QYU A;  2RFA A;  4J8D A;  5AIJ A;  2ETB A;  5AQB A;  4J8F A;  4GU5 A;  4WAF A;  4XKB A;  2RD0 A;  5HRY A;  4URK A;  4N3A A;  1H0A A;  2ZGD A;  3RJV A;  4J0U A;  2F8X K;  2VGX A;  3UM1 A;  3U64 A;  5JHA A;  3CVU A;  5KJN A;  1E7V A;  1OXJ A;  3QC1 A;  2KZT A;  1NL4 A;  1OUV A;  4ME2 A;  3T5V A;  3D9O A;  3LDZ A;  4Q96 A;  1N4Q A;  3PZ3 A;  4ZHB A;  2WXN A;  5BW8 C;  3Q49 B;  4M3O A;  3ZXP A;  1TNB A;  1MX4 A;  1QBQ A;  3DSW A;  4IN3 B;  2WXQ A;  3JQ1 A;  2XRY A;  4BET A;  4I6E A;  3DXK G;  4OAU C;  3DEP A;  3FTY A;  4LNG A;  1IXV A;  3QWP A;  4RVB A;  5A7D B;  3ZKJ A;  1RZ4 A;  3PRE A;  3SHF A;  4O1O A;  4U63 A;  4GTR A;  1N11 A;  3EHM A;  3OXL A;  2WXJ A;  5ANR A;  4DX5 D;  4HOQ A;  1KPS B;  4JD2 G;  2PNN A;  5FIN A;  4HS2 A;  1TN8 A;  2H6I A;  4UUC A;  2WMN A;  3DRA A;  4FJZ A;  3CVL A;  2R2L A;  3FH7 A;  3DST A;  4WWO A;  3B7S A;  3CHQ A;  4KMO A;  1HX8 A;  2VQ2 A;  3QAR A;  3MKQ B;  3LJ3 A;  5T8I A;  3KEA A;  2X6K A;  1O1S A;  2R05 A;  2CHW A;  4IUL A;  4C0E A;  4C0M A;  2P9U G;  3PE4 A;  1OWM A;  1E8Z A;  4AV7 A;  2LUH A;  2XPZ A;  3D9M A;  2GRM A;  2EIK E;  2F8Y A;  1TN6 A;  4KBQ A;  3NAW A;  3ABM E;  3AS8 A;  1TJC A;  4F1S A;  3FUD A;  5AJL A;  4WWP A;  4CYM D;  5KBA A;  4XEI G;  3RAU A;  2ION A;  3OXG A;  4IYP A;  3UM2 A;  1N9A A;  3WXX A;  3GW4 A;  4BSX A;  4DLQ A;  3W9G A;  4HLE A;  2PM6 A;  1GW6 A;  3TGO A;  2KC7 A;  4LG6 A;  2LO6 A;  1KZP A;  2V8S E;  4YDE A;  1EDU A;  3Q79 A;  1EYH A;  4A3V A;  2F37 A;  4I6G A;  3U4T A;  2OEV A;  2E2E A;  1DCE A;  3V79 K;  2QC9 A;  2IO3 C;  3AJI A;  3L22 A;  1BI8 B;  3FEX A;  3VTY A;  2VGY A;  4JL0 A;  3ZFW A;  2R5S A;  3JXJ A;  3EDT B;  3UQ3 A;  4CRW A;  2V5F A;  2YHE A;  5ENN A;  4K0R A;  5LFA A;  3R7Q A;  4LCT A;  4YDY A;  1ZBP A;  2XHE A;  1G3N B;  4U07 A;  2OCC E;  4QFV A;  4DPR A;  5EN5 D;  2BTD A;  3X2Q E;  5ENO D;  4N39 A;  3AG3 E;  4C9B B;  2QY7 A;  1N0R A;  4GTS A;  1XGW A;  2I1K A;  4GTM A;  1OWN A;  4CGV A;  1UJK A;  3UM0 A;  3GZ1 A;  3FUM A;  5T4Y A;  3NOC D;  5B3S E;  1H2T C;  3DEO A;  2J8S D;  4QQI A;  2R59 A;  5EKQ D;  3ESL A;  1QYM A;  2J4D A;  4B93 B;  4NUR A;  1E8Y A;  2XCB A;  4GB9 A;  4WND A;  3G2U A;  2BED A;  5AYW D;  4GTP A;  3D9N A;  3AAA C;  4YND A;  3E37 A;  4JEU A;  5AEN A;  3L82 A;  2EIN E;  3NF1 A;  5KJK A;  4HNA D;  2WXL A;  3Q7F A;  4EEC A;  2QYJ A;  2HR2 A;  4G1T A;  4I1A A;  5CBN A;  2P58 C;  2XZT G;  1E8X A;  5B1A E;  2LNI A;  1N4R A;  4GYY A;  4FJY A;  4N2Q A;  1S63 A;  4DLO A;  4KZ0 A;  3CK8 A;  3L6A A;  3BU8 A;  5HI7 A;  4G25 A;  1HF8 A;  3DXM G;  2ETA A;  4J7W A;  4U8V D;  4UQZ A;  5HS0 A;  5JJT A;  5J90 A;  3LEW A;  2AXZ A;  4DI4 A;  3JCK C;  4R7L A;  4BTB A;  3T9K A;  1OCR E;  4JPS A;  2M63 A;  4B8A A;  3Q78 A;  4I2Z A;  4EQF A;  1WAO 1;  3HXF A;  5FZS A;  2C0L A;  5E76 A;  4EZJ A;  3ENE A;  3RO2 A;  3AG1 E;  1IHG A;  3BQO A;  1L5J A;  5G2N A;  3FUJ A;  5DBK A;  5E75 A;  4GTT A;  4HBD A;  2XGO A;  3MEK A;  4GZC A;  3T5X A;  2CG2 A;  4UWG A;  1HO8 A;  4LNB A;  3FP3 A;  4LEU A;  4CDN A;  5FZQ A;  3PZD A;  3UM3 A;  2PZI A;  3S7D A;  5LOZ A;  4MRU A;  5CEA A;  4JXT A;  2FO1 E;  3EU5 A;  4AY6 A;  4A55 A;  1HE8 A;  3TWU A;  3APF A;  4GA0 A;  4HRM B;  4GMR A;  5LP0 A;  1D8E A;  4JHK A;  3CGH A;  1BU9 A;  4F3V A;  3RKV A;  3QJZ A;  4APO A;  4F6R D;  2JAB A;  4GYO A;  3G2S A;  3VLF A;  2EQX A;  5HKP A;  1KT0 A;  2UY1 A;  3GZS A;  3SBS A;  4ABN A;  3Q4A B;  2L0I A;  4GZ5 A;  2AJA A;  4WNG A;  4G8L A;  4UWK A;  2AVP A;  1OCC E;  1K3Z D;  2GGF A;  1N95 A;  4XE0 A;  4ACL A;  3CHR A;  4V3I A;  3SFZ A;  4N5Q A;  1K1A A;  4O1P A;  1MHQ A;  2VTB A;  4RG6 A;  3I5P A;  4LRZ A;  4Q94 A;  5CBO A;  5EDS A;  4PS3 A;  2J9Q A;  2XEV A;  3HXC A;  1YCS B;  2ETC A;  3QWV A;  4RQI A;  4KYO B;  4GTV A;  3PZ1 A;  4XX5 A;  2ZGG A;  5ENR D;  3RU0 A;  4U04 A;  2KCL A;  3L16 A;  4RLY A;  1KZO A;  3PVL A;  1Y8M A;  1AP7 A;  3CVP A;  3GYZ A;  4OYS A;  4OAV B;  1OY3 D;  5G05 C;  3IBE A;  4BX9 A;  2L9B A;  4GAA A;  4HRL A;  1NZN A;  3UT4 A;  3RRM B;  4A1G A;  1H2V C;  3FWV A;  2VGE A;  3TAX A;  4ATG A;  3ZXS A;  4PS7 A;  2HE0 A;  2IY0 C;  4LNU D;  4L2Y A;  4CZ2 D;  4W9R A;  2X6J A;  1TJF A;  4E6H A;  2IOS A;  3FTW A;  3SI5 A;  4ILH B;  3MZL B;  1WY6 A;  2DWZ A;  3LY9 A;  3UTM A;  1NFI E;  4HI8 A;  2V0P A;  4UWH A;  1O1T A;  1JPL A;  2L6B A;  3CV0 A;  2XS1 A;  4GPM A;  3LY7 A;  2I2O A;  5AQ9 A;  2FUL A;  3V2X A;  1UW4 B;  2J49 A;  4I9E A;  5CRV A;  2WXF A;  3ZYL A;  4C48 B;  3ZYK A;  2IFU A;  1VDY A;  4YVQ C;  1QZ2 A;  3UXG A;  2P9L G;  1OT8 A;  4FP7 A;  4UWF A;  2HO1 A;  1KT1 A;  1SW6 A;  3U3W A;  3ONK A;  3TWX A;  3ZYM A;  2X3M A;  3PDN A;  4CGW A;  2RG8 A;  3D9P A;  5G04 J;  4GMJ A;  3CQC B;  2XPY A;  3ZYQ A;  1D8D A;  3S2A A;  3I4G A;  1BPO A;  4JHR A;  4GZ6 A;  3CKB A;  5J08 A;  4U8H A;  2PM7 A;  4KVO A;  1H6O A;  3C3R A;  4L2L A;  4BFR A;  3T8M A;  3ULE G;  1E96 B;  3Q47 B;  5ENT D;  1EF1 C;  3E33 A;  3I4R B;  5B1B E;  4ANW A;  4AIF A;  4DX2 A;  2HM8 A;  3EIJ A;  1NA0 A;  3ZEF A;  4HOR A;  1INZ A;  4EZL A;  3GZ2 A;  4BSZ B;  3FTX A;  3E34 A;  4YDO A;  5FQ4 A;  5M72 A;  2WXO A;  4JZY A;  1U3D A;  3FHE A;  5AJD A;  3BUA A;  4B89 A;  3FUK A;  1TNZ A;  2L6J A;  4BT8 A;  4Y6W A;  1HFA A;  1A17 A;  2OND A;  4BER A;  2DIW A;  3SD5 A;  3V30 A;  3Q5M A;  1FVH A;  1S70 B;  3HXD A;  2MOW A;  1WM5 A;  1OWL A;  3FUL A;  3PE3 A;  2JLB A;  1LD7 A;  4J8Y A;  1JCQ A;  4APF A;  3JUI A;  3VTX A;  4JC8 A;  3PUJ A;  4XI0 A;  5ANL A;  3CVY A;  1MQS A; 
#chains in the Genus database with same CATH homology
 4G2V A;  4EEC A;  2HR2 A;  4DI3 A;  1Z3X A;  2VSX E;  4G1T A;  2YHC A;  3MJW A;  1YA0 A;  3D9L A;  2KCK A;  4I1A A;  4FAD A;  3HVE A;  2LAI A;  4WNE A;  2P58 C;  4G11 A;  4FHJ A;  4L7T A;  1ELK A;  4J8S A;  3ESK A;  1E8X A;  3D9K A;  4H7X A;  3UX4 A;  2CHZ A;  2LNI A;  2X6I A;  3NQP A;  1SZA A;  3P2B A;  4WUY A;  2VSO E;  3P1U A;  4GYY A;  2LAH A;  3JYS A;  4FJY A;  4EBA A;  3CVQ A;  2VSN A;  2Y4U A;  4KT6 B;  2GRL A;  5BNW A;  2I6H A;  4N2Q A;  3MA5 A;  3FUN A;  4DLO A;  4KZ0 A;  4CT4 A;  4I6J A;  3CK8 A;  3L6A A;  2KZT B;  5HI7 A;  4UI9 K;  2XRZ A;  3LVR E;  1NP7 A;  4G25 A;  1HF8 A;  1HZ4 A;  3FH5 A;  4AP2 A;  3CHM A;  2C0M A;  1S0P A;  5KJM A;  5FT9 A;  2CHX A;  3ZN3 A;  4JA9 A;  5C2Y A;  3SF4 A;  3QK0 A;  4UQZ A;  3RRN B;  4KXK B;  5JJT A;  3CKC A;  3ZVV A;  5J90 A;  3LEW A;  2AXZ A;  4NRH B;  4AVX A;  1E8W A;  1FCH A;  3L54 A;  3U66 A;  3MYV A;  4A1S A;  4DI4 A;  3HHM A;  3D3M A;  3R9A B;  3JCK C;  4R7L A;  5CMY A;  3E4B A;  4B8C B;  1QNF A;  2AW6 A;  5LCW J;  1X5B A;  4RG9 A;  4BTB A;  2YNQ A;  2WQ6 A;  4ILI A;  4XZ4 A;  4O6F A;  3CK7 A;  3ASD A;  5ARF A;  3RRU A;  4JPS A;  1HH8 A;  2A4Z A;  2X6H A;  3G2W A;  3G2T A;  2M63 A;  3D9J A;  1B89 A;  3QB2 A;  3QWW A;  4B8A A;  4EQF A;  4I2Z A;  4B94 A;  4GPK A;  4U0S A;  1H6K A;  1WAO 1;  5FZS A;  2C0L A;  2OVB A;  4HFG A;  5E76 A;  4EZJ A;  3DPD A;  2VYI A;  3MX3 A;  3ENE A;  3FUH A;  2OOE A;  3RO2 A;  3OXF A;  4XKC A;  4L23 A;  3CIA A;  3CQG B;  2WVI A;  1UN8 A;  4DK5 A;  4JEH A;  5JJ7 A;  1IHG A;  3QKY A;  1HG5 A;  5A23 A;  1L5J A;  3CVW A;  5G2N A;  3FUJ A;  3S7B A;  1Z6T A;  5DBK A;  5E75 A;  3CVV A;  3I3N A;  5JJ6 A;  1PC2 A;  4CDM A;  2XGO A;  3MEK A;  4GCN A;  4UWL A;  5A6C A;  3APD A;  4UQY A;  4GZC A;  4GA2 A;  2CG2 A;  3T5X A;  3O4Z A;  4UWG A;  1HO8 A;  5EX3 A;  1PAQ A;  3FP3 A;  4LEU A;  3LXU X;  3L17 A;  4CDN A;  3URZ A;  4LUN U;  5FZQ A;  4BTA A;  3DBS A;  2GW1 A;  3BG1 B;  3PZD A;  3PRZ A;  3SGH A;  4EZK A;  2AXV A;  2PZI A;  4IRU A;  1JUQ A;  4FLB A;  4GYW A;  3ZW3 A;  4Q69 A;  3S7D A;  4OVU A;  5LOZ A;  4MRU A;  1N54 A;  5LCW C;  1PY1 A;  4TUU A;  4ACK A;  3B13 A;  4JXT A;  3CEQ A;  4AY6 A;  5FWQ A;  3FU3 A;  3IKO B;  4A55 A;  2VSY A;  3UUX A;  4UQX A;  4K03 A;  4NQ0 A;  3APC A;  4J6I A;  1HE8 A;  3FU6 A;  3EHN A;  1H2U A;  3APF A;  4BT9 A;  4GA0 A;  4J8D A;  3UT7 A;  3ZIM A;  2Q7F A;  5AIJ A;  4JHK A;  3LPZ A;  5LP0 A;  3CGH A;  4U0U A;  5DIZ A;  2WB2 A;  4J8F A;  4GU5 A;  4U0Z A;  3FY4 A;  4F3V A;  4LER A;  3RKV A;  2PQN A;  3FEY A;  3QJZ A;  4APO A;  4CCA A;  2MRI A;  3CVX A;  4ILG A;  2JEK A;  2CFU A;  4WAF A;  3TJP A;  2VTB B;  4XKB A;  3VLD A;  2WQH A;  3FU5 A;  2RD0 A;  4GYO A;  3G2S A;  3VLF A;  4FHK A;  2EQX A;  3G2V A;  1KT0 A;  1XNF A;  2UY1 A;  4GA1 A;  4N3B A;  5EX0 A;  3GZS A;  1N52 A;  3SBS A;  4URK A;  4G23 A;  4N3A A;  4ABN A;  1H0A A;  3CK9 A;  3ZPJ A;  4AJW A;  4HOS A;  2UY1 B;  3Q4A B;  2L0T B;  2V4L A;  3RJV A;  2L0I A;  4J0U A;  3PUK A;  3B7U X;  2VGX A;  4GZ5 A;  4WNG A;  4UWK A;  2AVP A;  3CHO A;  2WXK A;  1ELW A;  2CFZ A;  3KAE A;  1E90 A;  1LF8 A;  2C2L A;  3U64 A;  1IQU A;  2GGF A;  2WXH A;  5JHA A;  3CVU A;  5KJN A;  4XE0 A;  1E7V A;  3AU5 A;  4GML A;  4ACL A;  4AY5 A;  3CHR A;  4AEZ C;  4V3I A;  3SFZ A;  3QC1 A;  2KZT A;  2IQC A;  4OVV A;  1OUV A;  4G24 A;  1MHQ A;  2Y4T A;  4J8E A;  4RG6 A;  3FTZ A;  2VTB A;  3I5P A;  4LRZ A;  3TXN A;  4ME2 A;  4KZC A;  3T5V A;  1JWF A;  3D9O A;  3IV0 A;  4Q94 A;  3B7T A;  3LDZ A;  4Q96 A;  3KD7 A;  5EDS A;  3PH0 C;  4PS3 A;  2J9Q A;  1EPU A;  4UI9 J;  2XEV A;  3FUF A;  2J07 A;  1Z3Y A;  3ASF A;  3QWV A;  2YIN A;  2VGX B;  2WXN A;  4KYO B;  5BW8 C;  3ML8 A;  3MKR A;  3KEZ A;  3Q49 B;  4I43 A;  4M3O A;  5FQ6 A;  5BV1 A;  4WNF A;  4XX5 A;  4BWR A;  3RU0 A;  4U04 A;  2KCL A;  3L16 A;  4HVB A;  3PVL A;  5LX8 A;  3ZGQ A;  3S7F A;  4IN3 B;  3L08 A;  2FBN A;  1Y8M A;  2WXQ A;  1UG3 A;  3TXM A;  2FO7 A;  3JQ1 A;  2XRY A;  2QFC A;  3CVP A;  3GYZ A;  3FTS A;  4OYS A;  5CHE E;  4HOT A;  1KLX A;  3MV3 B;  4JVS A;  4ANX A;  5G05 C;  3IBE A;  4GZ3 A;  4BX9 A;  1UJJ A;  2L9B A;  4I6E A;  5T3R A;  4MLP A;  4GAA A;  1H19 A;  4JA7 A;  4AXH A;  1NZN A;  3HYM B;  3FTY A;  4I1M A;  3UT4 A;  3RRM B;  3ML9 A;  4A1G A;  1H2V C;  2I9C A;  4JW1 A;  3FWV A;  3QWP A;  4TRQ A;  3SBT B;  4RVB A;  2VJ8 A;  3TAX A;  2WXG A;  4ATG A;  1OWP A;  2WM9 A;  5A7D B;  3C98 A;  3ZXS A;  4PS7 A;  4XIF A;  2PQR A;  3TG5 A;  4L2Y A;  1IYG A;  4W9R A;  1HG2 A;  2X6J A;  3CSF A;  3PS6 A;  3PRE A;  3SHF A;  3QOU A;  4U63 A;  1TJF A;  4FU3 A;  3PEV B;  4E6H A;  2IOS A;  5CMW A;  4HXI A;  3EHM A;  3FTW A;  3OXL A;  4XI9 A;  3SI5 A;  2WXJ A;  5ANR A;  1DVP A;  4ILH B;  3UMV A;  3LCA A;  3MZL B;  2NSZ A;  4HOQ A;  1WY6 A;  3LY9 A;  4A3T A;  2R17 C;  4JHJ A;  3ZHE A;  4N3C A;  5KJL A;  4I9C A;  3PEU B;  2E0I A;  2DCP A;  2V0P A;  3LKU A;  4UWH A;  4HS2 A;  1JPL A;  2YQ8 A;  4BY6 A;  3CV0 A;  1TEZ A;  3QAQ A;  3ONL A;  4FUL A;  2WMN A;  3K9I A;  3LS8 A;  3LY7 A;  3FTV A;  3ULQ A;  5BPP A;  2I2O A;  3IHV A;  2FUL A;  2AXU A;  4FJZ A;  3CVL A;  1UW4 B;  5JHB A;  5FJY A;  3CHP A;  3FH7 A;  4F7A A;  3CHS A;  1HXI A;  4WWO A;  2XGS A;  3B7S A;  2J49 A;  5ARG A;  3CHQ A;  4I9E A;  1W3B A;  2WXF A;  3ZYL A;  3AU4 A;  4KMO A;  1HX8 A;  2VQ2 A;  3ZYK A;  2A5U A;  2DBA A;  2J08 A;  3QAR A;  3MKQ B;  3LJ3 A;  5T8I A;  2MHK A;  2IFU A;  3LYA A;  2X6K A;  1VDY A;  5HQ8 A;  1UN9 A;  4YVQ C;  2CHW A;  1QZ2 A;  4DJA A;  4IUL A;  4C0E A;  4C0M A;  3PE4 A;  3FH8 A;  4FP7 A;  4UWF A;  4EBA G;  2HO1 A;  1OWM A;  4Y6C A;  2HYZ A;  3B7R L;  1E8Z A;  3ASH A;  2BF0 X;  2XPZ A;  4AV7 A;  3D9M A;  2ILR A;  1KT1 A;  2GRM A;  3MCX A;  3N71 A;  4PS8 A;  3TG4 A;  1SQM A;  3FUI A;  5FTP A;  4KBQ A;  4GCO A;  3MGB A;  1HS6 A;  1TJC A;  3AS8 A;  3FUD A;  3ONK A;  3OTN A;  3NZS A;  4WWP A;  2X3M A;  5AJL A;  3ZYM A;  3U3W A;  2OV8 A;  3PDN A;  4CGW A;  1Y6I A;  2RG8 A;  4RSY A;  3D9P A;  1U3C A;  4FC8 A;  5G04 J;  2ION A;  2WXR A;  4G26 A;  2NXP A;  4GMJ A;  3CQC B;  2XPY A;  3OAW A;  5FZR A;  2IOL A;  3CST A;  3ZYQ A;  3OXG A;  4IYP A;  2XPI A;  3MKQ A;  3S7J A;  3S2A A;  4NAC A;  3I4G A;  3WXX A;  4ANU A;  5CCM A;  3GW4 A;  3SZ7 A;  2KM4 A;  4BSX A;  1BPO A;  3FFL A;  3HVE B;  3AS4 A;  4JHR A;  3EJN A;  4GZ6 A;  4DLQ A;  2IF4 A;  2FF4 A;  4HLE A;  3CKB A;  5J08 A;  3ZRH A;  2LSV A;  3UPV A;  2PM6 A;  4U8H A;  1GW6 A;  2PM7 A;  5CCL A;  3CLJ A;  4KVO A;  3TGO A;  2KC7 A;  4BFR A;  4L2L A;  3T8M A;  2X38 A;  1IQR A;  3D9I A;  3SNX A;  2LO6 A;  1E96 B;  2V8S E;  5G55 A;  3UT8 A;  3Q47 B;  4PDX A;  1EDU A;  4N2S A;  1EYH A;  4A3V A;  1EF1 C;  4I6G A;  3U4T A;  3FDH A;  4I2W A;  2AWI A;  3FU0 A;  2XQ0 A;  2E2E A;  2LSU A;  3AS5 A;  4MS6 A;  3I4R B;  4KVM A;  2FEZ A;  2WXI A;  3L22 A;  4ANW A;  3FEX A;  4AIF A;  1DNP A;  2HM8 A;  3VTY A;  2VGY A;  3EIJ A;  1NA0 A;  4TV3 A;  5KCM A;  3U9W A;  4JL0 A;  3ZEF A;  4HOR A;  1INZ A;  4ANV A;  4MKT A;  3EIQ C;  2R5S A;  3ZFW A;  4EZL A;  3GZ2 A;  3EDT B;  4AOF A;  3UQ3 A;  3FTX A;  4PH4 B;  4CRW A;  3FUE A;  2J4B A;  5BV0 A;  2V5F A;  3QDN A;  2YHE A;  3NZU A;  5ENN A;  4K0R A;  5LFA A;  1FVF A;  3R7Q A;  4LCT A;  3PNT B;  5FQ4 A;  3MV2 B;  5M72 A;  3BEE A;  5BT1 A;  1ZBP A;  2XHE A;  4WWN A;  2WXO A;  4JZY A;  3ASG A;  1NA3 A;  3FTU A;  4U07 A;  4F1S A;  1U3D A;  3FHE A;  4QFV A;  5AJD A;  3RIB A;  4UI9 C;  4DPR A;  2BTD A;  3IHY A;  4N39 A;  2PL2 A;  3L13 A;  4I17 A;  4B89 A;  3QNK A;  5FQ8 A;  5G05 J;  3R7R A;  1SZ9 A;  3FUK A;  3CVN A;  4AM9 A;  2FI7 A;  2L6J A;  3RK6 A;  1HU3 A;  3TL5 A;  4PUC A;  2BUG A;  4CT0 A;  4CDR A;  3HIZ A;  4BT8 A;  4Y6W A;  2KAT A;  4B0Z A;  4C9B B;  4E85 A;  2QY7 A;  4H7Y A;  4I1O B;  1HFA A;  1A17 A;  1XGW A;  5BUZ A;  2I1K A;  1OWN A;  4CGV A;  2Y3A A;  1UJK A;  2OND A;  3CR3 A;  3GZ1 A;  2WMO A;  4D10 C;  2XCC A;  1QQE A;  3FUM A;  5T4Y A;  4HOU A;  2J09 A;  4L1B A;  5G04 C;  2DIW A;  2WPV A;  3JQ0 A;  3RO3 A;  3SD5 A;  3Q15 A;  4GZD A;  1H2T C;  4P29 A;  5C1D A;  3VLE A;  3KS2 A;  3Q5M A;  1FVH A;  2R59 A;  1OWO A;  3LVQ E;  5EKQ D;  3ZHE B;  3ESL A;  5FQ7 A;  3HDX A;  1JWG A;  1P5Q A;  2MOW A;  5D0Q D;  1WM5 A;  2J4D A;  2WXM A;  1OWL A;  3PNL B;  3FUL A;  4NUR A;  1ZU2 A;  2CG3 A;  1E8Y A;  3PE3 A;  2XCB A;  2I1J A;  3O48 A;  4GB9 A;  3BG0 B;  4WND A;  2NC9 A;  3G2U A;  5AYW D;  2JLB A;  4CEM A;  3IEG A;  2KCV A;  3D9N A;  2X6F A;  3LY8 A;  4FA6 A;  4APF A;  2IU1 A;  4EPZ A;  3JUI A;  2XGM A;  4YND A;  4F53 A;  1ELR A;  3VTX A;  4JEU A;  5AEN A;  4JC8 A;  2OVF A;  2WQ7 A;  3PUJ A;  1E7U A;  2WXP A;  4YVO A;  2IJG X;  3NF1 A;  4BX8 A;  2ZU6 B;  4XI0 A;  5KJK A;  5ANL A;  4FLH A;  4N5C A;  3CVY A;  2UWJ G;  1MQS A;  2WXL A;  5D0O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...