2PQNA

Crystal structure of yeast fis1 complexed with a fragment of yeast mdv1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
VDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondria fission 1 protein
publication title Structural basis for recruitment of mitochondrial fission complexes by Fis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Apoptosis
total genus 52
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pqnA01
5ARGA 3CVPA 3KAEA 2KCKA 3CEQA 3ASGA 2LNIA 5G04J 4I1AA 4GPKA 3SZ7A 5G05J 3Q47B 4AIFA 5M72A 2PL2A 4WNGA 1B89A 3ZGQA 4BWRA 4N2SA 1ZBPA 4HORA 4U0SA 5EKQD 2JLBA 3TGOA 3JYSA 3SF4A 3N71A 3TG5A 3U3WA 3MKRA 4GZ3A 2LSVA 3ASHA 2V5FA 2XCCA 1ELWA 4HOSA 3TAXA 3ZHEB 1HXIA 2HYZA 2GW1A 4BTAA 3RKVA 3LPZA 4G26A 3MA5A 2OOEA 4N5CA 4CDRA 4KXKB 2MHKA 4UQXA 3GZ1A 4U0ZA 3QOUA 2FBNA 4G25A 4XI9A 2KCVA 3RIBA 3O48A 4EQFA 3HYMB 1YA0A 3OXGA 3LCAA 4JA9A 3AS5A 1PC2A 4KBQA 3CVLA 1XNFA 3KD7A 4A1SA 5CCLA 2VGXA 4GZ6A 2WPVA 4WNEA 3RJVA 3KS2A 1A17A 1KLXA 5G04C 1ZU2A 4WNDA 3ZHEA 3CK8A 2Q7FA 5JJTA 5G05C 2WQHA 4YNDA 3QWWA 5KJNA 1QQEA 4YVQC 3S7FA 2XPIA 1TJCA 3LKUA 3E4BA 5KJKA 2LSUA 4J8FA 5EX0A 2XEVA 5D0QD 4NQ0A 4N3CA 3S7DA 3S7JA 2VQ2A 5LCWJ 1NZNA 3UQ3A 4G24A 4KYOB 3RU0A 3AS4A 4BTBA 4GZ5A 3OXFA 4N3AA 4AY5A 4RG9A 3R9AB 5DIZA 2KC7A 3Q49B 3S7BA 4RG6A 4XI0A 3CK7A 3ASDA 2E2EA 4XIFA 5FZRA 4Y6CA 3PE3A 4ME2A 1WAO1 4GA2A 4GCNA 2NC9A 4GA1A 3BEEA 2KATA 4G23A 3UPVA 2AVPA 4O6FA 4Y6WA 3CVQA 3RO2A 5DBKA 1WM5A 2C2LA 1IYGA 1OUVA 2VGXB 3QWPA 5ARFA 5C1DA 4LEUA 1KT0A 4APOA 3ZN3A 3QWVA 2VGYA 2FO7A 1FCHA 2FEZA 4UQYA 4U04A 4H7YA 2IF4A 1P5QA 1QZ2A 5FZQA 4F3VA 1HH8A 4ABNA 3UUXA 3GW4A 5CHEE 4N3BA 3IEGA 5HI7A 3URZA 5KJMA 4WUYA 5FTPA 5FJYA 3CVNA 2VSYA 4UI9J 2XCBA 2VYIA 1HZ4A 4WNFA 5LCWC 4I9EA 3ESKA 2PQNA 3Q15A 4HOQA 3WXXA 3LY8A 4JA7A 1NA0A 3NF1A 4HOTA 3PE4A 4J8EA 2C0LA 4JHRA 4J0UA 2I6HA 3LY7A 4I17A 5AYWD 2L6JA 2FF4A 4GYYA 4GYWA 4BT8A 2XGSA 4YVOA 2UY1B 2IFUA 5BT1A 4U07A 3EDTB 3ZPJA 3MV2B 3FFLA 3MEKA 4J8DA 5HQ8A 3CKBA 1KT1A 5A7DB 2FI7A 2Y4UA 1E96B 3LYAA 5D0OD 3QKYA 3AS8A 5KJLA 3QDNA 1ELRA 3RO3A 3LY9A 5BW8C 2HR2A 3FP3A 5CCMA 4CGWA 4JL0A 4N2QA 2QFCA 3MV3B 2UY1A 5FZSA 3VTXA 4IN3B 5JJ7A 2Y4TA 4HOUA 4UI9C 2UWJG 4GYOA 2BUGA 4GCOA 3CKCA 2PQRA 3GYZA 5EX3A 2YHCA 5JJ6A 4I2WA 4GA0A 2KCLA 3Q5MA 1Y8MA 4UI9K 2YQ8A 2PZIA 1IHGA 1W3BA 4W9RA 4UQZA 4BT9A 3CV0A 4I9CA 2J9QA 2P58C 3ULQA 4U0UA 3FWVA 2XGMA 5A6CA 3TG4A 2DBAA 3VTYA 4AY6A 2HO1A 3ZFWA 4G2VA 4N39A 3ASFA 2VSNA 4I2ZA 3OXLA 4NRHB 2R5SA 3K9IA 1NA3A 2ONDA 5BNWA 2C0MA 4B94A 3CK9A 3GZ2A 3Q4AB 5FT9A 2XGOA 4CGVA 3PDNA 4H7XA 3U4TA 4AM9A 4G1TA
chains in the Genus database with same CATH superfamily
5KNHD 1NL4A 4HFGA 2WXGA 3DPYA 4GZDA 4F6RD 5AARA 3JUEA 4U63A 1BPOA 4CRWA 3PH0C 3QJZA 3EHQA 3D9KA 3P2BA 1H2TC 4PS3A 5CBNA 3FDHA 3L08A 3B7SA 4I1AA 1SZAA 2P9LG 5ENQD 1E8WA 3FH8A 5LOZA 2LXMA 2WXKA 5M72A 2PL2A 3AG4E 5EIBE 4HNAD 3LJ3A 1N52A 4BWRA 4DUIA 1HFAA 3FHEA 5EN5D 5EKQD 2L9BA 2JLBA 4KMOA 3SF4A 3U9WA 4ACKA 3D3MA 5FIOA 4HB5A 1QBQA 3FUKA 1TNZA 3PS6A 2Y69E 4LUNU 1NP7A 4QFVA 4L9PA 1ELWA 3ZHEB 3L13A 4ANWA 3PEUB 3DSSA 1FVHA 2H6HA 4CDRA 3TXMA 5AQAA 4AVXA 4JW1A 2AXUA 3QC1A 5FINA 4U0ZA 3QOUA 2FBNA 4XI9A 1BI8B 2E0IA 4DI3A 3D9JA 2KCVA 4EQFA 1K1AA 4D10C 3HYMB 1EYHA 2P2CP 3LCAA 4JA9A 3AS5A 4TUMA 3OAWA 1H6PA 2WPVA 2I9CA 4WNEA 4LSZE 2HM8A 3UM1A 3KEZA 5G04C 3SBTB 3ZHEA 3FTSA 4HI9A 3HXFA 2NXPA 2WQHA 4YNDA 1E8XA 4HRNA 4PS7A 3AG2E 4UUCA 3PUKA 4FJZA 1Z5SC 3IBEA 5EX0A 1EPUA 2XEVA 4LRZA 4NQ0A 2CG3A 2VQ2A 5EDSA 3TWVA 3ZYMA 2R03A 1V54E 3ZYLA 2IO3C 3AS4A 1Z3YA 3LDZA 4GMJA 1SZ9A 3DWLG 4RG9A 4ILIA 4GAAA 3RAUA 5AQBA 3CHPA 3V79K 2E2EA 5E76A 1UG3A 3PE3A 2AWIA 4GCNA 3L9TA 3BEEA 1SA5A 3UPVA 1E7VA 4O6FA 3MX3A 3CVQA 4GTSA 3DSWA 3LVQE 2EILE 4LEUA 5JHBA 3DXMG 3ZXPA 4UQYA 4U04A 4H7YA 4DJAA 3B7BA 4JEUA 5FZQA 3HXCA 5FQ6A 2WMNA 3Q73A 4C0EA 3GW4A 4HLLA 5HI7A 4DPRA 4Z68A 3SHFA 1INZA 2DVWA 1S63A 3E34A 2VSYA 2OV8A 2XCBA 5ITZF 4FHKA 4OVUA 5LCWC 2R59A 4BEPA 5AAOA 3WXXA 3LY8A 2L0TB 3MGBA 1Y6IA 1NA0A 2XZDG 4URKA 1N4PA 3PE4A 4JHRA 2KBXA 3LY7A 4I17A 3AJIA 4PS8A 3D9HA 3B95A 3DSVA 4EECA 2OCCE 2GRNB 2P9UG 3DSXA 3UTMA 3BU8A 3ISMC 3Q7FA 3FTYA 3NOCD 5AQ7A 2IOLA 1K1BA 2UY1B 3NBNB 4G8KA 4O1OA 4XZ4A 3FTWA 2J07A 2P9KG 3EDTB 3FULA 4B93B 5T8IA 2LXLA 3T5XA 2CG2A 1SQMA 1U3CA 3DBSA 4I1MA 1ELKA 1MX4A 5BV0A 3B13A 1BD8A 3RO3A 3LY9A 3NZUA 3SO8A 1YYHA 5CBOA 4N2QA 3CVUA 3ONLA 2UY1A 4KT6B 3T9KA 4FLHA 3D9OA 4CYMD 5LFAA 2FULA 4APFA 2LAHA 2KXPC 3LVRE 2DZNA 4GMLA 2PNNA 3KEAA 2L0IA 3ZIMA 4IRUA 1N0QA 5A23A 2GRRB 5EILA 4I2WA 1TN8A 4GA0A 3ABME 3Q5MA 3LS8A 1S70B 4XEIG 2PZIA 3ZW3A 2GRPB 3CVWA 3TWRA 2J9QA 2X3MA 2IQCA 3CVXA 1LF8A 3ULQA 4U0UA 2XGMA 4BERA 3PUJA 3JXIA 4Q69A 5A6CA 2CHWA 3ZFWA 3ABKE 3ASFA 5CMYA 3L6AA 4I2ZA 3OXLA 1ZB1A 3T8MA 1NA3A 2X38A 3ZVVA 4IYPA 2WXJA 3PRZA 5FWQA 3C98A 1DCQA 5ARGA 4LERA 3L54A 4EBAA 3KAEA 4KZCA 1JWFA 2KCKA 3ASGA 5B3SE 2AJAA 2IEJA 1O1TA 3KSQA 2WXRA 1WDYA 4GPKA 4B8AA 2FO1E 5G05J 2JABA 3DSTA 4AIFA 2QYUA 3UKUG 3QB2A 2WXNA 3I3NA 4XX5A 1FT2A 3ZGQA 1ZBPA 4HORA 5ANLA 1OCZE 2VJ8A 4GTPA 3JYSA 2MOWA 4HS2A 3EUVA 3LEWA 2H6GA 4HVBA 3ASNE 3TAXA 4A63B 1HG2A 1N11A 4EZKA 3RKVA 3X2QE 3FU6A 3MA5A 4YDYA 2OOEA 4C48B 4DX2A 4OVVA 1HO8A 4KXKB 1HU3A 2IU1A 3FUHA 3RRNB 5G2NA 4UQXA 3GZ1A 2XZTG 2P9NG 3ONKA 4ATZD 5BPPA 4E85A 1YA0A 3OXGA 5H7PA 3PZ4A 1PC2A 3MYVA 3CVLA 3UX4A 1XNFA 3LJNA 5CCLA 1MX6A 2KZTA 3BG0B 1IXVA 3KS2A 4C9BB 2Q7FA 2V8SE 3S7FA 4MLPA 4AOFA 2XPIA 5ENOD 2VTBA 3CR3A 5KJKA 5T3RA 2AXVA 2LSUA 5D0QD 4GPMA 2OVBA 3S7JA 3BUAA 2X6FA 4JZYA 4KYOB 3RU0A 3FY4A 3OXFA 1WG0A 3P1UA 3FTVA 3HXBA 4HRLA 4AY5A 1N4SA 2X6JA 1TYQG 3S7BA 1OCCE 1SVXA 4RG6A 3NQPA 2Y3AA 5D66A 4GA2A 2NC9A 5T4YA 4GTMA 4G23A 2AVPA 1E90A 3RO2A 5DBKA 5G55A 1IQRA 5ARFA 4R7LA 1JCRA 4U7EB 4DI4A 3ESLA 4GMRA 1Z6TA 1E8YA 1U2VG 1KT0A 3EIJA 1MYOA 3U66A 2MRIA 2F8XK 3QWVA 2FO7A 4ANVA 2ILRA 1TR4A 2IF4A 3ML8A 1P5QA 5KNGA 4DX7D 2DCPA 4A3TA 1O1SA 4MKTA 3B7UX 4V3IA 4N3BA 3URZA 4CCAA 4WUYA 3J5QB 4FP7A 5FJYA 3IXEA 3L16A 4GB9A 4O60A 4WNFA 4KVMA 4OAVB 5LP0A 3D9LA 3ESKA 1N54A 4G11A 3NF1A 1H6KA 2J8SD 4GTTA 5LX8A 2I6HA 5CEDB 5AYWD 5CEAA 2L6JA 5AJDA 5E75A 4ZFHA 3L17A 1QNFA 3MCXA 3QARA 4UWFA 5BUZA 4BX9A 4BT8A 2EIKE 4YVOA 5J90A 2ETCA 1LD8A 2VGEA 2M63A 3CIAA 4U07A 4YDWA 3FFLA 3TWQA 5HQ8A 3CKBA 1H2VC 4NACA 3CGHA 3SQVA 5D0OD 5CRUA 1E96B 1PAQA 2P9IG 3B7RL 4JHJA 1ELRA 3Q75A 5BW8C 2NSZA 2HR2A 3Q9NC 2X6HA 5CCMA 4CGWA 2IY0C 3ABLE 3R7RA 3C72A 3MV3B 3APCA 4LCTA 3RRMB 2XQ0A 2OEVA 4IN3B 4LG6A 2RD0A 2A5UA 1E8ZA 2JEKA 4UWKA 2Y1LE 3HVEA 1H2UA 4RVBA 3C3QA 4GYOA 2B6CA 3JUIA 3ZUVB 3APFA 1S64A 3CKCA 4I43A 4AXHA 3GYZA 2YNQA 2KCLA 2DIWA 3FUFA 4UI9K 2YQ8A 2Y0BG 1L5JA 3CLJA 4W9RA 2WB2A 2WQ6A 3F6QA 3FTUA 3CV0A 4GTOA 4BSZB 3T5VA 1E7UA 1HE8A 3EHNA 2J4DA 3TG4A 2DBAA 3VTYA 4UWGA 2YHEA 1TNBA 4NRHB 2R5SA 3K9IA 2J49A 2ZGGA 4GU5A 4BSXA 5BNWA 2V5QC 4JB8P 3CK9A 3Q4AB 1X5BA 3NB2A 3JXJA 3IHYA 4CGVA 4P29A 1N94A 3SD5A 3ZRHA 2HE0A 3NOGD 2WXOA 2QY7A 5D2MC 2LNIA 4I6JA 2XRYA 1BLXB 2A5EA 4FHJA 4HXIA 4F7AA 1O5MA 3DXKG 3TL5A 4I1OB 3AG3E 4WNGA 1NFIE 3UT8A 4AJWA 3HG0D 2ZXWE 3IKOB 4N2SA 4U0SA 3MKQA 4LNGA 3UXGA 1OWOA 3LXUX 2P9SG 2DYRE 1PY1A 1O1RA 3EHMA 3U3WA 3R9MA 1XGWA 4E6HA 3MKRA 4JVSA 4GZ3A 5ENPD 3ASHA 2I2OA 2V5FA 3DEPA 2XCCA 1EF1C 2BKKB 2EIJE 1HXIA 1N4QA 4NURA 2HYZA 2GW1A 4BTAA 3LPZA 3W9FA 4G26A 4N5CA 3AU5A 2GRMA 1OCRE 4YDEA 5ENTD 4G8LA 3SI5A 4G25A 3FUJA 1JWGA 3RIBA 3O48A 3FUNA 4DLOA 3D9NA 3BG1B 3PZDA 2H6FA 3JQ1A 4EHMA 3KD7A 4A1SA 2VGXA 4GZ6A 2OEWA 3UMVA 2L6BA 4JC8A 1Z3XA 1KLXA 1OWNA 1BI7B 4WNDA 2X6IA 2DZOA 4NIKA 2X6KA 5G05C 5KJNA 1LD7A 1MHQA 4DX5D 1TJCA 3FH7A 3LKUA 3PVLA 4DK5A 5B1BE 4XE0A 2R02A 4N3CA 3CHRA 1NZNA 5ENNA 3FTZA 1KZPA 4KZ0A 3UQ3A 4G24A 4RSYA 3TWWA 4BTBA 3UIPC 4BX8A 5AIJA 3TXNA 4B89A 4FA6A 4B0ZA 3QNKA 2WXPA 2BEDA 3EU5A 3CK7A 3ASDA 4ME2A 1K8KG 4ILHB 3C3OA 5B1AE 4GA1A 2KATA 4U95D 3IHVA 2WXMA 4FLBA 2A4ZA 5KBAA 4Y6WA 2NYJA 4DLQA 4F53A 2C2LA 5BXUA 1IYGA 3DEOA 2KZTB 3QWPA 1RZ4A 2GGFA 5C1DA 3C5RA 5KCMA 3VLDA 4APOA 3ZN3A 4K03A 1D8EA 3Q79A 2VGYA 1FCHA 4Q96A 4X8QA 1QZ2A 1V55E 1HH8A 1OWPA 2VTBB 3UINC 5AENA 1HF8A 3UUXA 3UIOC 4TXQA 3SY2A 3IEGA 5CERB 5KJMA 3PZ2A 2AXZA 2GROB 3CHMA 3CVNA 4UI9J 3NAWA 3FU5A 1JCSA 1DVPA 3D9IA 2P9PG 1HZ4A 3ENEA 3Q9UC 4FC8A 3ML9A 1KZOA 3Q15A 4HOQA 1MZCA 3CHQA 1OWMA 2XS1A 2V4HC 4HOTA 1KPSB 4OAUC 4J0UA 4C0MA 1BU9A 4ACLA 3RK6A 4AV7A 2PM6A 2WXIA 3V31A 3FU3A 3ULYA 1MX2A 2ZISA 1FT1A 4HI8A 1H6OA 3KSLA 4CEMA 3FUEA 4GYWA 3DSUA 3HIZA 2WMOA 3G2UA 4CT4A 2F0YA 1DCEA 3E32A 5JMND 2XPYA 2IFUA 3ZPJA 4BFRA 3MV2B 2R05A 3MEKA 2R17C 1KT1A 5CMWA 2I1JA 1D8DA 2BTDA 3LYAA 3QKYA 2R2LA 1FVFA 3AS8A 1HS6A 1JPLA 4PUCA 3D9PA 1N9AA 2RFMA 5CECB 3JCKC 3ASOE 3UM3A 3FP3A 2BF0X 2V0PA 3EU9A 3FEXA 3S2AA 2V4LA 4YDOA 4A1GA 3SGHA 3APDA 2QFCA 5FZSA 2XS8A 3ZU7B 2EQXA 1N0RA 2Y4TA 4HOUA 2GRQB 3FEYA 3PZ3A 1OT8A 1AP7A 1UOHA 2UWJG 4GCOA 5HS0A 3FUIA 1OY3D 5EX3A 3TWXA 4TRQA 2YHCA 4HQDA 5JJ6A 4U8HA 4PDXA 4FU3A 1Y8MA 2IONA 1UJKA 1IHGA 1W3BA 4UQZA 1HG5A 4BT9A 1IHBA 4I9CA 2P58C 1TNOA 1K3ZD 4EBAG 2ETBA 4HLEA 3JQ0A 3UT7A 1TNYA 2CFUA 3R7QA 2HO1A 1JCQA 4N39A 2QC9A 2VSNA 3V30A 3SFYA 4HBDA 5EYPF 1LTXA 3G2TA 3HXEA 1YMPA 2C0MA 4UWHA 3GZ2A 4XKBA 2WXLA 3PEVB 4DX6D 5FT9A 4IULA 2XGOA 2KM4A 2IOSA 3PDNA 4H7XA 3U4TA 3G2SA 2XRZA 3L22A 5CRVA 3CVPA 2XEEA 3CEQA 3FTXA 5FQ7A 3E33A 1SA4A 3HVEB 3HDXA 5G04J 4J8YA 4KVOA 4BY6A 3SZ7A 4XKCA 3Q47B 3CSTA 4BETA 1U3DA 1A5EA 2B0OE 5AJLA 1B89A 4BESA 3CQCB 2ETAA 1N4RA 1FPPA 4K5AB 2CFZA 1NI1A 3I4GA 1RW2A 4EPZA 3UI2A 3V2XA 2AW6A 4U8VD 3TGOA 3SFZA 3N71A 3TG5A 1AWCB 1MJ0A 3FU0A 3G2WA 2CHXA 3O4ZA 5ENSD 4CDMA 4M3OA 2LSVA 4TV3A 3EJNA 2YINA 2XEHA 4QQIA 4HOSA 3U64A 2WQ7A 4K5CA 4EZLA 1IQUA 4WWOA 2ZGDA 5JHAA 2MHKA 2GRLA 4CDNA 1GW6A 3QK0A 2PM7A 4J8SA 3ZEFA 3J5PA 1TNUA 3VLFA 3WG7E 4KBQA 4GTVA 4RLYA 4GTRA 4I6GA 3CVYA 3RJVA 4JPSA 2XENA 1A17A 4ILGA 3SNXA 1ZU2A 3CK8A 4WAFA 5JJTA 5JA4D 3QWWA 4U8YD 2MYOA 1QQEA 4L1BA 1X81A 3TWTA 4YVQC 3SBSA 4MRUA 4N5QA 3E4BA 1H0AA 3B7TA 3CQGB 5ANRA 3MKQB 4J8FA 1SW6A 4DX1A 3EIQC 4WWPA 3S7DA 2DYSE 4JD2G 4TXRA 4K0RA 3RSEG 2ZIRA 5LCWJ 1DC2A 2QZAA 4AEZC 4GZ5A 3DPDA 5AN8A 4GTQA 4N3AA 3R9AB 4JXTA 5DIZA 2KC7A 3ULEG 3Q49B 3UT4A 2RG8A 4XI0A 1MQSA 4XIFA 5FZRA 2WVIA 4Y6CA 1WAO1 1TN7A 3PZ1A 4TUUA 4JHKA 4O1PA 1UJJA 3CHSA 3UM2A 3SFXA 1WM5A 1UW4B 3W9GA 4HRMB 1OUVA 4CT0A 4UWLA 2CHZA 2VGXB 4TXPA 4F1SA 2F37A 5KWDA 3D9MA 5AQ9A 4WWNA 2FEZA 2I1KA 3DRAA 3QAQA 1N95A 2J4BA 4J7WA 4LNUD 5IY5E 3PREA 1OXJA 2VSXE 4F3VA 1TN6A 3E37A 5C2YA 3TJPA 4ABNA 3FH5A 5CHEE 4F1PA 3NZSA 5FTPA 1EDUA 1TEZA 3ZXSA 3FUDA 4GZCA 1Q2ZA 3G2VA 4L23A 2VYIA 1UN8A 4I9EA 5BV1A 2PQNA 4JA7A 2J09A 3PNLB 3ZKJA 2LAIA 4I6EA 5HKPA 4J8EA 2C0LA 2QYJA 3GZSA 4FULA 4JEHA 3I4RB 3T8KA 3I5PA 3UM0A 3RRUA 4ATGA 2FF4A 1S0PA 4L7TA 2RKKA 4GYYA 3EHRA 4L2YA 4PH4B 1UN9A 2F8YA 2XPZA 2XGSA 4Q94A 1JUQA 3MZLB 3Q78A 5EIDA 1YCSB 2LUHA 1D9SA 5ENRD 2IO2C 5BT1A 3V2OA 3FUMA 1IKND 2EINE 2XHEA 3AU4A 1HX8A 4J8DA 5A7DB 3TWSA 2IJGX 4DRXE 2FI7A 2Y4UA 4U96D 2WM9A 3CHOA 3ZYKA 5J08A 5KJLA 3QDNA 3ZNGA 4ZHBA 2WXFA 4CZ2D 4A3VA 2DWZA 5BXOA 4K5BA 1OCOE 4JL0A 4ANXA 3HHMA 3VTXA 3TWUA 3BQOA 2WXHA 4ANUA 2LO6A 4LNBA 3CSFA 1DNPA 4OYSA 4RQIA 2WXQA 5JJ7A 5FQ4A 1TJFA 4UI9C 3C3RA 3VLEA 4MS6A 2OVFA 2ZU6B 4J6IA 4AP2A 2H6IA 2BUGA 2PQRA 3L82A 2J08A 1WY6A 1VDYA 4MBGA 3UKRG 1G3NB 3OTNA 3MJWA 3ZYQA 4M7CA 4FADA 2BKGA 3PNTB 5HRYA 2RFAA 3CVVA 3FWVA 4FJYA 1QYMA 2EIME 4AY6A 2VSOE 3AAAC 4L2LA 5EYLA 4G2VA 3IV0A 3HXDA 4EZJA 2ONDA 4B94A 3AG1E 3E30A 5FQ8A 1H19A 3Q7AA 1OWLA 3HRAA 4A55A 4B8CB 4AM9A 4G1TA
chains in the Genus database with same CATH topology
3L22A 4LERA 3CVPA 3L54A 2WXOA 3KAEA 4HFGA 4KZCA 1JWFA 2WXGA 2KCKA 2QY7A 3CEQA 3ASGA 4GZDA 3FTXA 2LNIA 4I6JA 5FQ7A 4U63A 2XRYA 1BPOA 4CRWA 3HVEB 3PH0C 3QJZA 3HDXA 3D9KA 3P2BA 1H2TC 5G04J 4PS3A 4FHJA 4HXIA 3FDHA 3L08A 3B7SA 2WXRA 4KVOA 4I1AA 4GPKA 1SZAA 4B8AA 4BY6A 4F7AA 3SZ7A 5G05J 4XKCA 3Q47B 3CSTA 4AIFA 1E8WA 3FH8A 5LOZA 3TL5A 2WXKA 4I1OB 5M72A 1U3DA 3QB2A 2WXNA 2PL2A 3I3NA 4WNGA 4XX5A 5AJLA 1B89A 3UT8A 3ZGQA 3LJ3A 1N52A 4AJWA 4BWRA 3CQCB 3IKOB 4N2SA 1HFAA 1ZBPA 2CFZA 4HORA 5ANLA 3I4GA 2VJ8A 4AM9A 3FHEA 4U0SA 4EPZA 2AW6A 5EKQD 2L9BA 2JLBA 4KMOA 3MKQA 3TGOA 3SFZA 3JYSA 1OWOA 3LXUX 3SF4A 3N71A 3U9WA 3TG5A 4ACKA 3FU0A 3D3MA 2MOWA 3G2WA 2CHXA 3O4ZA 3FUKA 4HS2A 4CDMA 1PY1A 3PS6A 3EHMA 3LEWA 3U3WA 1XGWA 4M3OA 4E6HA 3MKRA 4JVSA 4GZ3A 4LUNU 4HVBA 2LSVA 1NP7A 3ASHA 4TV3A 2I2OA 4QFVA 3EJNA 2V5FA 2YINA 2XCCA 1ELWA 3U64A 3TAXA 1EF1C 3ZHEB 2WQ7A 4HOSA 1HXIA 4EZLA 1HG2A 4NURA 4EZKA 2HYZA 1IQUA 3L13A 2GW1A 4BTAA 3RKVA 4ANWA 3LPZA 3PEUB 4G26A 1FVHA 3FU6A 3MA5A 2OOEA 4N5CA 3AU5A 4OVVA 2GRMA 4WWOA 4C9BB 4CDRA 1HO8A 4KXKB 1HU3A 3TXMA 5JHAA 2MHKA 2GRLA 4CDNA 4AVXA 1GW6A 2IU1A 4JW1A 3SI5A 2AXUA 3FUHA 3RRNB 3QC1A 4UQXA 5G2NA 3GZ1A 3QK0A 4U0ZA 3QOUA 2FBNA 4G25A 4XI9A 3FUJA 2E0IA 2PM7A 4DI3A 3D9JA 1JWGA 2KCVA 4J8SA 3ZEFA 3RIBA 3O48A 4EQFA 3ONKA 3FUNA 5BPPA 4D10C 4E85A 3HYMB 1YA0A 3VLFA 4DLOA 1EYHA 3OXGA 3LCAA 3D9NA 4JA9A 3BG1B 3AS5A 1PC2A 3MYVA 3PZDA 4KBQA 3JQ1A 3CVLA 3UX4A 3OAWA 1XNFA 3KD7A 4A1SA 5CCLA 2VGXA 2KZTA 4GZ6A 3UMVA 3BG0B 2WPVA 4I6GA 2I9CA 4WNEA 3CVYA 3RJVA 4JC8A 2HM8A 4JPSA 3KS2A 1Z3XA 1A17A 1KLXA 1OWNA 3KEZA 4ILGA 5G04C 3SNXA 1ZU2A 4WNDA 3SBTB 2X6IA 3ZHEA 3CK8A 3FTSA 2Q7FA 2V8SE 4WAFA 5JJTA 2X6KA 5G05C 2NXPA 2WQHA 4YNDA 3QWWA 5KJNA 1E8XA 1QQEA 4L1BA 1MHQA 4YVQC 3SBSA 3S7FA 4MLPA 4AOFA 2XPIA 1TJCA 3FH7A 3LKUA 3PVLA 4MRUA 3E4BA 4PS7A 4DK5A 1H0AA 3B7TA 3CQGB 5ANRA 3CR3A 2VTBA 5KJKA 3MKQB 5T3RA 3PUKA 2AXVA 4FJZA 3IBEA 2LSUA 4J8FA 5EX0A 1EPUA 2XEVA 4LRZA 4XE0A 5D0QD 3EIQC 4WWPA 2OVBA 4NQ0A 2CG3A 3CHRA 4N3CA 3S7DA 3S7JA 4K0RA 2VQ2A 5EDSA 5LCWJ 1NZNA 5ENNA 3ZYMA 3FTZA 2X6FA 4KZ0A 3UQ3A 4G24A 4RSYA 3ZYLA 4JZYA 4KYOB 4AEZC 3RU0A 3FY4A 3AS4A 4BTBA 4GZ5A 3OXFA 3P1UA 3FTVA 1Z3YA 3DPDA 4BX8A 3LDZA 5AIJA 3TXNA 4B89A 4N3AA 4FA6A 4AY5A 4GMJA 3QNKA 1SZ9A 4RG9A 3R9AB 4ILIA 4JXTA 4B0ZA 5DIZA 2WXPA 2KC7A 2X6JA 3Q49B 4GAAA 3UT4A 2RG8A 3S7BA 4RG6A 3CHPA 3NQPA 4XI0A 1MQSA 3CK7A 3ASDA 2E2EA 4XIFA 5FZRA 2Y3AA 5E76A 2WVIA 4Y6CA 1UG3A 3PE3A 4ME2A 2AWIA 1WAO1 4ILHB 4GA2A 4GCNA 2NC9A 5T4YA 4TUUA 4JHKA 4GA1A 3BEEA 2KATA 1UJJA 4G23A 3IHVA 2WXMA 3CHSA 4FLBA 3UPVA 2A4ZA 1E7VA 2AVPA 4O6FA 3MX3A 4Y6WA 3CVQA 1E90A 3RO2A 5DBKA 4DLQA 1WM5A 2C2LA 4F53A 1UW4B 5G55A 1IYGA 1IQRA 3LVQE 1OUVA 4CT0A 4UWLA 2CHZA 2KZTB 2VGXB 3QWPA 5ARFA 2GGFA 4R7LA 5C1DA 4DI4A 3ESLA 1Z6TA 5KCMA 1E8YA 4LEUA 3VLDA 4F1SA 1KT0A 4APOA 5JHBA 3EIJA 3ZN3A 4K03A 3U66A 2MRIA 3QWVA 3D9MA 2VGYA 4WWNA 2FO7A 4ANVA 1FCHA 2FEZA 4UQYA 2ILRA 2I1KA 4U04A 4H7YA 4DJAA 3QAQA 4Q96A 2IF4A 3ML8A 4JEUA 1P5QA 2J4BA 1QZ2A 5FZQA 3PREA 2VSXE 4F3VA 1HH8A 5FQ6A 1OWPA 2VTBB 2DCPA 5C2YA 3TJPA 2WMNA 4ABNA 4A3TA 4MKTA 5AENA 1HF8A 3UUXA 3B7UX 4C0EA 3GW4A 3FH5A 4V3IA 5CHEE 4N3BA 3NZSA 3IEGA 5HI7A 3URZA 4DPRA 4CCAA 5KJMA 4WUYA 2AXZA 5FTPA 1EDUA 1TEZA 3ZXSA 3CHMA 5FJYA 4FP7A 3FUDA 4GZCA 3SHFA 1INZA 3L16A 3CVNA 2VSYA 2OV8A 4UI9J 3FU5A 2XCBA 3G2VA 4L23A 1DVPA 3D9IA 2VYIA 4GB9A 4FHKA 1HZ4A 3ENEA 1UN8A 4FC8A 4KVMA 4WNFA 4OVUA 5LCWC 2R59A 4I9EA 3ML9A 5LP0A 3D9LA 3ESKA 1N54A 2PQNA 5BV1A 3Q15A 4HOQA 4G11A 3WXXA 3LY8A 2L0TB 3CHQA 1Y6IA 3MGBA 4JA7A 1NA0A 2J09A 3PNLB 1OWMA 3NF1A 4URKA 2LAIA 4I6EA 4HOTA 1H6KA 3PE4A 4J8EA 2C0LA 4JHRA 4J0UA 4C0MA 5LX8A 2I6HA 3GZSA 3LY7A 4I17A 3RK6A 5AYWD 4ACLA 4AV7A 4FULA 4JEHA 2L6JA 3I4RB 4PS8A 2PM6A 5AJDA 5E75A 2WXIA 3I5PA 3FU3A 4EECA 3RRUA 3L17A 4ATGA 2FF4A 1QNFA 1S0PA 4L7TA 3MCXA 3QARA 4UWFA 5BUZA 4GYYA 4BX9A 4CEMA 4L2YA 3FTYA 3FUEA 4PH4B 1UN9A 4GYWA 2XPZA 4BT8A 2XGSA 4YVOA 4Q94A 2IOLA 5J90A 1JUQA 3HIZA 2WMOA 2UY1B 3G2UA 4CT4A 2M63A 3MZLB 4XZ4A 2XPYA 2IFUA 3CIAA 5BT1A 3FTWA 4U07A 2J07A 3EDTB 3FUMA 3ZPJA 3FULA 4BFRA 3MV2B 5T8IA 3FFLA 2XHEA 3MEKA 2R17C 1HX8A 3AU4A 3T5XA 4J8DA 5HQ8A 3CKBA 1KT1A 5A7DB 2IJGX 5CMWA 2FI7A 2CG2A 1H2VC 4NACA 2Y4UA 1SQMA 2I1JA 2WM9A 3CHOA 2BTDA 3CGHA 3ZYKA 1U3CA 1E96B 1PAQA 3LYAA 3DBSA 3QKYA 4I1MA 1ELKA 5D0OD 1FVFA 3AS8A 1HS6A 5J08A 3B7RL 4JHJA 5KJLA 3QDNA 1ELRA 1JPLA 5BV0A 3B13A 3RO3A 3LY9A 2NSZA 3D9PA 3NZUA 4PUCA 5BW8C 2HR2A 3JCKC 3FP3A 2BF0X 2WXFA 4A3VA 2V0PA 2X6HA 5CCMA 4CGWA 3FEXA 4JL0A 3S2AA 2V4LA 4N2QA 3R7RA 3CVUA 4A1GA 4ANXA 3ONLA 3SGHA 3APDA 2QFCA 3HHMA 2UY1A 3APCA 3MV3B 5FZSA 4LCTA 3VTXA 2WXHA 3RRMB 4ANUA 2LO6A 2XQ0A 3CSFA 2EQXA 4KT6B 5ARGA 1DNPA 4IN3B 4EBAA 2RD0A 4FLHA 4OYSA 2WXQA 5JJ7A 3D9OA 2Y4TA 5FQ4A 1TJFA 4HOUA 4UI9C 5LFAA 2A5UA 2FULA 4MS6A 3VLEA 1E8ZA 3FEYA 4APFA 2LAHA 2JEKA 2OVFA 4UWKA 2ZU6B 3LVRE 3HVEA 1H2UA 4J6IA 4RVBA 4AP2A 2UWJG 4GMLA 4GYOA 2BUGA 2L0IA 4GCOA 3JUIA 3FUIA 3APFA 3CKCA 4AXHA 4I43A 2PQRA 3ZIMA 4IRUA 3GYZA 5A23A 5EX3A 4TRQA 2YHCA 2J08A 1WY6A 1VDYA 4I2WA 5JJ6A 4U8HA 4PDXA 4GA0A 2YNQA 2KCLA 3OTNA 3Q5MA 3MJWA 4FU3A 1Y8MA 2DIWA 3LS8A 2IONA 3ZYQA 3FUFA 4FADA 4UI9K 2YQ8A 1UJKA 3PNTB 2PZIA 1IHGA 3ZW3A 1W3BA 1L5JA 3CLJA 4UQZA 4W9RA 2WB2A 1HG5A 4BT9A 2WQ6A 3CVWA 3FTUA 3CV0A 4I9CA 2J9QA 2X3MA 2IQCA 2P58C 3CVXA 1LF8A 3ULQA 4U0UA 4EBAG 3CVVA 3FWVA 2XGMA 3T5VA 4FJYA 4HLEA 1E7UA 3PUJA 1HE8A 3EHNA 3JQ0A 3UT7A 4Q69A 5A6CA 2CHWA 2J4DA 2CFUA 3TG4A 2DBAA 3VTYA 3R7QA 2HO1A 2VSOE 4L2LA 3ZFWA 4AY6A 4G2VA 3IV0A 4UWGA 2YHEA 4N39A 3ASFA 5CMYA 2VSNA 3L6AA 4I2ZA 3OXLA 4NRHB 3T8MA 2R5SA 3K9IA 2J49A 3G2TA 1NA3A 2X38A 4EZJA 2ONDA 4GU5A 4BSXA 5BNWA 2C0MA 4B94A 4UWHA 3CK9A 3GZ2A 4XKBA 2WXLA 3Q4AB 3PEVB 3ZVVA 1X5BA 5FQ8A 1H19A 4IYPA 2WXJA 3PRZA 5FWQA 5FT9A 1OWLA 3C98A 4A55A 4IULA 2XGOA 4B8CB 3IHYA 2KM4A 4CGVA 2IOSA 4P29A 3PDNA 4H7XA 3SD5A 3U4TA 3G2SA 3ZRHA 4G1TA 2XRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ARG A;  3CVP A;  3KAE A;  2KCK A;  3CEQ A;  3ASG A;  2LNI A;  5G04 J;  4I1A A;  4GPK A;  3SZ7 A;  5G05 J;  3Q47 B;  4AIF A;  5M72 A;  2PL2 A;  4WNG A;  1B89 A;  3ZGQ A;  4BWR A;  4N2S A;  1ZBP A;  4HOR A;  4U0S A;  5EKQ D;  2JLB A;  3TGO A;  3JYS A;  3SF4 A;  3N71 A;  3TG5 A;  3U3W A;  3MKR A;  4GZ3 A;  2LSV A;  3ASH A;  2V5F A;  2XCC A;  1ELW A;  4HOS A;  3TAX A;  3ZHE B;  1HXI A;  2HYZ A;  2GW1 A;  4BTA A;  3RKV A;  3LPZ A;  4G26 A;  3MA5 A;  2OOE A;  4N5C A;  4CDR A;  4KXK B;  2MHK A;  4UQX A;  3GZ1 A;  4U0Z A;  3QOU A;  2FBN A;  4G25 A;  4XI9 A;  2KCV A;  3RIB A;  3O48 A;  4EQF A;  3HYM B;  1YA0 A;  3OXG A;  3LCA A;  4JA9 A;  3AS5 A;  1PC2 A;  4KBQ A;  3CVL A;  1XNF A;  3KD7 A;  4A1S A;  5CCL A;  2VGX A;  4GZ6 A;  2WPV A;  4WNE A;  3RJV A;  3KS2 A;  1A17 A;  1KLX A;  5G04 C;  1ZU2 A;  4WND A;  3ZHE A;  3CK8 A;  2Q7F A;  5JJT A;  5G05 C;  2WQH A;  4YND A;  3QWW A;  5KJN A;  1QQE A;  4YVQ C;  3S7F A;  2XPI A;  1TJC A;  3LKU A;  3E4B A;  5KJK A;  2LSU A;  4J8F A;  5EX0 A;  2XEV A;  5D0Q D;  4NQ0 A;  4N3C A;  3S7D A;  3S7J A;  2VQ2 A;  5LCW J;  1NZN A;  3UQ3 A;  4G24 A;  4KYO B;  3RU0 A;  3AS4 A;  4BTB A;  4GZ5 A;  3OXF A;  4N3A A;  4AY5 A;  4RG9 A;  3R9A B;  5DIZ A;  2KC7 A;  3Q49 B;  3S7B A;  4RG6 A;  4XI0 A;  3CK7 A;  3ASD A;  2E2E A;  4XIF A;  5FZR A;  4Y6C A;  3PE3 A;  4ME2 A;  1WAO 1;  4GA2 A;  4GCN A;  2NC9 A;  4GA1 A;  3BEE A;  2KAT A;  4G23 A;  3UPV A;  2AVP A;  4O6F A;  4Y6W A;  3CVQ A;  3RO2 A;  5DBK A;  1WM5 A;  2C2L A;  1IYG A;  1OUV A;  2VGX B;  3QWP A;  5ARF A;  5C1D A;  4LEU A;  1KT0 A;  4APO A;  3ZN3 A;  3QWV A;  2VGY A;  2FO7 A;  1FCH A;  2FEZ A;  4UQY A;  4U04 A;  4H7Y A;  2IF4 A;  1P5Q A;  1QZ2 A;  5FZQ A;  4F3V A;  1HH8 A;  4ABN A;  3UUX A;  3GW4 A;  5CHE E;  4N3B A;  3IEG A;  5HI7 A;  3URZ A;  5KJM A;  4WUY A;  5FTP A;  5FJY A;  3CVN A;  2VSY A;  4UI9 J;  2XCB A;  2VYI A;  1HZ4 A;  4WNF A;  5LCW C;  4I9E A;  3ESK A;  2PQN A;  3Q15 A;  4HOQ A;  3WXX A;  3LY8 A;  4JA7 A;  1NA0 A;  3NF1 A;  4HOT A;  3PE4 A;  4J8E A;  2C0L A;  4JHR A;  4J0U A;  2I6H A;  3LY7 A;  4I17 A;  5AYW D;  2L6J A;  2FF4 A;  4GYY A;  4GYW A;  4BT8 A;  2XGS A;  4YVO A;  2UY1 B;  2IFU A;  5BT1 A;  4U07 A;  3EDT B;  3ZPJ A;  3MV2 B;  3FFL A;  3MEK A;  4J8D A;  5HQ8 A;  3CKB A;  1KT1 A;  5A7D B;  2FI7 A;  2Y4U A;  1E96 B;  3LYA A;  5D0O D;  3QKY A;  3AS8 A;  5KJL A;  3QDN A;  1ELR A;  3RO3 A;  3LY9 A;  5BW8 C;  2HR2 A;  3FP3 A;  5CCM A;  4CGW A;  4JL0 A;  4N2Q A;  2QFC A;  3MV3 B;  2UY1 A;  5FZS A;  3VTX A;  4IN3 B;  5JJ7 A;  2Y4T A;  4HOU A;  4UI9 C;  2UWJ G;  4GYO A;  2BUG A;  4GCO A;  3CKC A;  2PQR A;  3GYZ A;  5EX3 A;  2YHC A;  5JJ6 A;  4I2W A;  4GA0 A;  2KCL A;  3Q5M A;  1Y8M A;  4UI9 K;  2YQ8 A;  2PZI A;  1IHG A;  1W3B A;  4W9R A;  4UQZ A;  4BT9 A;  3CV0 A;  4I9C A;  2J9Q A;  2P58 C;  3ULQ A;  4U0U A;  3FWV A;  2XGM A;  5A6C A;  3TG4 A;  2DBA A;  3VTY A;  4AY6 A;  2HO1 A;  3ZFW A;  4G2V A;  4N39 A;  3ASF A;  2VSN A;  4I2Z A;  3OXL A;  4NRH B;  2R5S A;  3K9I A;  1NA3 A;  2OND A;  5BNW A;  2C0M A;  4B94 A;  3CK9 A;  3GZ2 A;  3Q4A B;  5FT9 A;  2XGO A;  4CGV A;  3PDN A;  4H7X A;  3U4T A;  4AM9 A;  4G1T A; 
#chains in the Genus database with same CATH topology
 5KNH D;  1NL4 A;  4HFG A;  2WXG A;  3DPY A;  4GZD A;  4F6R D;  5AAR A;  3JUE A;  4U63 A;  1BPO A;  4CRW A;  3PH0 C;  3QJZ A;  3EHQ A;  3D9K A;  3P2B A;  1H2T C;  4PS3 A;  5CBN A;  3FDH A;  3L08 A;  3B7S A;  4I1A A;  1SZA A;  2P9L G;  5ENQ D;  1E8W A;  3FH8 A;  5LOZ A;  2LXM A;  2WXK A;  5M72 A;  2PL2 A;  3AG4 E;  5EIB E;  4HNA D;  3LJ3 A;  1N52 A;  4BWR A;  4DUI A;  1HFA A;  3FHE A;  5EN5 D;  5EKQ D;  2L9B A;  2JLB A;  4KMO A;  3SF4 A;  3U9W A;  4ACK A;  3D3M A;  5FIO A;  4HB5 A;  1QBQ A;  3FUK A;  1TNZ A;  3PS6 A;  2Y69 E;  4LUN U;  1NP7 A;  4QFV A;  4L9P A;  1ELW A;  3ZHE B;  3L13 A;  4ANW A;  3PEU B;  3DSS A;  1FVH A;  2H6H A;  4CDR A;  3TXM A;  5AQA A;  4AVX A;  4JW1 A;  2AXU A;  3QC1 A;  5FIN A;  4U0Z A;  3QOU A;  2FBN A;  4XI9 A;  1BI8 B;  2E0I A;  4DI3 A;  3D9J A;  2KCV A;  4EQF A;  1K1A A;  4D10 C;  3HYM B;  1EYH A;  2P2C P;  3LCA A;  4JA9 A;  3AS5 A;  4TUM A;  3OAW A;  1H6P A;  2WPV A;  2I9C A;  4WNE A;  4LSZ E;  2HM8 A;  3UM1 A;  3KEZ A;  5G04 C;  3SBT B;  3ZHE A;  3FTS A;  4HI9 A;  3HXF A;  2NXP A;  2WQH A;  4YND A;  1E8X A;  4HRN A;  4PS7 A;  3AG2 E;  4UUC A;  3PUK A;  4FJZ A;  1Z5S C;  3IBE A;  5EX0 A;  1EPU A;  2XEV A;  4LRZ A;  4NQ0 A;  2CG3 A;  2VQ2 A;  5EDS A;  3TWV A;  3ZYM A;  2R03 A;  1V54 E;  3ZYL A;  2IO3 C;  3AS4 A;  1Z3Y A;  3LDZ A;  4GMJ A;  1SZ9 A;  3DWL G;  4RG9 A;  4ILI A;  4GAA A;  3RAU A;  5AQB A;  3CHP A;  3V79 K;  2E2E A;  5E76 A;  1UG3 A;  3PE3 A;  2AWI A;  4GCN A;  3L9T A;  3BEE A;  1SA5 A;  3UPV A;  1E7V A;  4O6F A;  3MX3 A;  3CVQ A;  4GTS A;  3DSW A;  3LVQ E;  2EIL E;  4LEU A;  5JHB A;  3DXM G;  3ZXP A;  4UQY A;  4U04 A;  4H7Y A;  4DJA A;  3B7B A;  4JEU A;  5FZQ A;  3HXC A;  5FQ6 A;  2WMN A;  3Q73 A;  4C0E A;  3GW4 A;  4HLL A;  5HI7 A;  4DPR A;  4Z68 A;  3SHF A;  1INZ A;  2DVW A;  1S63 A;  3E34 A;  2VSY A;  2OV8 A;  2XCB A;  5ITZ F;  4FHK A;  4OVU A;  5LCW C;  2R59 A;  4BEP A;  5AAO A;  3WXX A;  3LY8 A;  2L0T B;  3MGB A;  1Y6I A;  1NA0 A;  2XZD G;  4URK A;  1N4P A;  3PE4 A;  4JHR A;  2KBX A;  3LY7 A;  4I17 A;  3AJI A;  4PS8 A;  3D9H A;  3B95 A;  3DSV A;  4EEC A;  2OCC E;  2GRN B;  2P9U G;  3DSX A;  3UTM A;  3BU8 A;  3ISM C;  3Q7F A;  3FTY A;  3NOC D;  5AQ7 A;  2IOL A;  1K1B A;  2UY1 B;  3NBN B;  4G8K A;  4O1O A;  4XZ4 A;  3FTW A;  2J07 A;  2P9K G;  3EDT B;  3FUL A;  4B93 B;  5T8I A;  2LXL A;  3T5X A;  2CG2 A;  1SQM A;  1U3C A;  3DBS A;  4I1M A;  1ELK A;  1MX4 A;  5BV0 A;  3B13 A;  1BD8 A;  3RO3 A;  3LY9 A;  3NZU A;  3SO8 A;  1YYH A;  5CBO A;  4N2Q A;  3CVU A;  3ONL A;  2UY1 A;  4KT6 B;  3T9K A;  4FLH A;  3D9O A;  4CYM D;  5LFA A;  2FUL A;  4APF A;  2LAH A;  2KXP C;  3LVR E;  2DZN A;  4GML A;  2PNN A;  3KEA A;  2L0I A;  3ZIM A;  4IRU A;  1N0Q A;  5A23 A;  2GRR B;  5EIL A;  4I2W A;  1TN8 A;  4GA0 A;  3ABM E;  3Q5M A;  3LS8 A;  1S70 B;  4XEI G;  2PZI A;  3ZW3 A;  2GRP B;  3CVW A;  3TWR A;  2J9Q A;  2X3M A;  2IQC A;  3CVX A;  1LF8 A;  3ULQ A;  4U0U A;  2XGM A;  4BER A;  3PUJ A;  3JXI A;  4Q69 A;  5A6C A;  2CHW A;  3ZFW A;  3ABK E;  3ASF A;  5CMY A;  3L6A A;  4I2Z A;  3OXL A;  1ZB1 A;  3T8M A;  1NA3 A;  2X38 A;  3ZVV A;  4IYP A;  2WXJ A;  3PRZ A;  5FWQ A;  3C98 A;  1DCQ A;  5ARG A;  4LER A;  3L54 A;  4EBA A;  3KAE A;  4KZC A;  1JWF A;  2KCK A;  3ASG A;  5B3S E;  2AJA A;  2IEJ A;  1O1T A;  3KSQ A;  2WXR A;  1WDY A;  4GPK A;  4B8A A;  2FO1 E;  5G05 J;  2JAB A;  3DST A;  4AIF A;  2QYU A;  3UKU G;  3QB2 A;  2WXN A;  3I3N A;  4XX5 A;  1FT2 A;  3ZGQ A;  1ZBP A;  4HOR A;  5ANL A;  1OCZ E;  2VJ8 A;  4GTP A;  3JYS A;  2MOW A;  4HS2 A;  3EUV A;  3LEW A;  2H6G A;  4HVB A;  3ASN E;  3TAX A;  4A63 B;  1HG2 A;  1N11 A;  4EZK A;  3RKV A;  3X2Q E;  3FU6 A;  3MA5 A;  4YDY A;  2OOE A;  4C48 B;  4DX2 A;  4OVV A;  1HO8 A;  4KXK B;  1HU3 A;  2IU1 A;  3FUH A;  3RRN B;  5G2N A;  4UQX A;  3GZ1 A;  2XZT G;  2P9N G;  3ONK A;  4ATZ D;  5BPP A;  4E85 A;  1YA0 A;  3OXG A;  5H7P A;  3PZ4 A;  1PC2 A;  3MYV A;  3CVL A;  3UX4 A;  1XNF A;  3LJN A;  5CCL A;  1MX6 A;  2KZT A;  3BG0 B;  1IXV A;  3KS2 A;  4C9B B;  2Q7F A;  2V8S E;  3S7F A;  4MLP A;  4AOF A;  2XPI A;  5ENO D;  2VTB A;  3CR3 A;  5KJK A;  5T3R A;  2AXV A;  2LSU A;  5D0Q D;  4GPM A;  2OVB A;  3S7J A;  3BUA A;  2X6F A;  4JZY A;  4KYO B;  3RU0 A;  3FY4 A;  3OXF A;  1WG0 A;  3P1U A;  3FTV A;  3HXB A;  4HRL A;  4AY5 A;  1N4S A;  2X6J A;  1TYQ G;  3S7B A;  1OCC E;  1SVX A;  4RG6 A;  3NQP A;  2Y3A A;  5D66 A;  4GA2 A;  2NC9 A;  5T4Y A;  4GTM A;  4G23 A;  2AVP A;  1E90 A;  3RO2 A;  5DBK A;  5G55 A;  1IQR A;  5ARF A;  4R7L A;  1JCR A;  4U7E B;  4DI4 A;  3ESL A;  4GMR A;  1Z6T A;  1E8Y A;  1U2V G;  1KT0 A;  3EIJ A;  1MYO A;  3U66 A;  2MRI A;  2F8X K;  3QWV A;  2FO7 A;  4ANV A;  2ILR A;  1TR4 A;  2IF4 A;  3ML8 A;  1P5Q A;  5KNG A;  4DX7 D;  2DCP A;  4A3T A;  1O1S A;  4MKT A;  3B7U X;  4V3I A;  4N3B A;  3URZ A;  4CCA A;  4WUY A;  3J5Q B;  4FP7 A;  5FJY A;  3IXE A;  3L16 A;  4GB9 A;  4O60 A;  4WNF A;  4KVM A;  4OAV B;  5LP0 A;  3D9L A;  3ESK A;  1N54 A;  4G11 A;  3NF1 A;  1H6K A;  2J8S D;  4GTT A;  5LX8 A;  2I6H A;  5CED B;  5AYW D;  5CEA A;  2L6J A;  5AJD A;  5E75 A;  4ZFH A;  3L17 A;  1QNF A;  3MCX A;  3QAR A;  4UWF A;  5BUZ A;  4BX9 A;  4BT8 A;  2EIK E;  4YVO A;  5J90 A;  2ETC A;  1LD8 A;  2VGE A;  2M63 A;  3CIA A;  4U07 A;  4YDW A;  3FFL A;  3TWQ A;  5HQ8 A;  3CKB A;  1H2V C;  4NAC A;  3CGH A;  3SQV A;  5D0O D;  5CRU A;  1E96 B;  1PAQ A;  2P9I G;  3B7R L;  4JHJ A;  1ELR A;  3Q75 A;  5BW8 C;  2NSZ A;  2HR2 A;  3Q9N C;  2X6H A;  5CCM A;  4CGW A;  2IY0 C;  3ABL E;  3R7R A;  3C72 A;  3MV3 B;  3APC A;  4LCT A;  3RRM B;  2XQ0 A;  2OEV A;  4IN3 B;  4LG6 A;  2RD0 A;  2A5U A;  1E8Z A;  2JEK A;  4UWK A;  2Y1L E;  3HVE A;  1H2U A;  4RVB A;  3C3Q A;  4GYO A;  2B6C A;  3JUI A;  3ZUV B;  3APF A;  1S64 A;  3CKC A;  4I43 A;  4AXH A;  3GYZ A;  2YNQ A;  2KCL A;  2DIW A;  3FUF A;  4UI9 K;  2YQ8 A;  2Y0B G;  1L5J A;  3CLJ A;  4W9R A;  2WB2 A;  2WQ6 A;  3F6Q A;  3FTU A;  3CV0 A;  4GTO A;  4BSZ B;  3T5V A;  1E7U A;  1HE8 A;  3EHN A;  2J4D A;  3TG4 A;  2DBA A;  3VTY A;  4UWG A;  2YHE A;  1TNB A;  4NRH B;  2R5S A;  3K9I A;  2J49 A;  2ZGG A;  4GU5 A;  4BSX A;  5BNW A;  2V5Q C;  4JB8 P;  3CK9 A;  3Q4A B;  1X5B A;  3NB2 A;  3JXJ A;  3IHY A;  4CGV A;  4P29 A;  1N94 A;  3SD5 A;  3ZRH A;  2HE0 A;  3NOG D;  2WXO A;  2QY7 A;  5D2M C;  2LNI A;  4I6J A;  2XRY A;  1BLX B;  2A5E A;  4FHJ A;  4HXI A;  4F7A A;  1O5M A;  3DXK G;  3TL5 A;  4I1O B;  3AG3 E;  4WNG A;  1NFI E;  3UT8 A;  4AJW A;  3HG0 D;  2ZXW E;  3IKO B;  4N2S A;  4U0S A;  3MKQ A;  4LNG A;  3UXG A;  1OWO A;  3LXU X;  2P9S G;  2DYR E;  1PY1 A;  1O1R A;  3EHM A;  3U3W A;  3R9M A;  1XGW A;  4E6H A;  3MKR A;  4JVS A;  4GZ3 A;  5ENP D;  3ASH A;  2I2O A;  2V5F A;  3DEP A;  2XCC A;  1EF1 C;  2BKK B;  2EIJ E;  1HXI A;  1N4Q A;  4NUR A;  2HYZ A;  2GW1 A;  4BTA A;  3LPZ A;  3W9F A;  4G26 A;  4N5C A;  3AU5 A;  2GRM A;  1OCR E;  4YDE A;  5ENT D;  4G8L A;  3SI5 A;  4G25 A;  3FUJ A;  1JWG A;  3RIB A;  3O48 A;  3FUN A;  4DLO A;  3D9N A;  3BG1 B;  3PZD A;  2H6F A;  3JQ1 A;  4EHM A;  3KD7 A;  4A1S A;  2VGX A;  4GZ6 A;  2OEW A;  3UMV A;  2L6B A;  4JC8 A;  1Z3X A;  1KLX A;  1OWN A;  1BI7 B;  4WND A;  2X6I A;  2DZO A;  4NIK A;  2X6K A;  5G05 C;  5KJN A;  1LD7 A;  1MHQ A;  4DX5 D;  1TJC A;  3FH7 A;  3LKU A;  3PVL A;  4DK5 A;  5B1B E;  4XE0 A;  2R02 A;  4N3C A;  3CHR A;  1NZN A;  5ENN A;  3FTZ A;  1KZP A;  4KZ0 A;  3UQ3 A;  4G24 A;  4RSY A;  3TWW A;  4BTB A;  3UIP C;  4BX8 A;  5AIJ A;  3TXN A;  4B89 A;  4FA6 A;  4B0Z A;  3QNK A;  2WXP A;  2BED A;  3EU5 A;  3CK7 A;  3ASD A;  4ME2 A;  1K8K G;  4ILH B;  3C3O A;  5B1A E;  4GA1 A;  2KAT A;  4U95 D;  3IHV A;  2WXM A;  4FLB A;  2A4Z A;  5KBA A;  4Y6W A;  2NYJ A;  4DLQ A;  4F53 A;  2C2L A;  5BXU A;  1IYG A;  3DEO A;  2KZT B;  3QWP A;  1RZ4 A;  2GGF A;  5C1D A;  3C5R A;  5KCM A;  3VLD A;  4APO A;  3ZN3 A;  4K03 A;  1D8E A;  3Q79 A;  2VGY A;  1FCH A;  4Q96 A;  4X8Q A;  1QZ2 A;  1V55 E;  1HH8 A;  1OWP A;  2VTB B;  3UIN C;  5AEN A;  1HF8 A;  3UUX A;  3UIO C;  4TXQ A;  3SY2 A;  3IEG A;  5CER B;  5KJM A;  3PZ2 A;  2AXZ A;  2GRO B;  3CHM A;  3CVN A;  4UI9 J;  3NAW A;  3FU5 A;  1JCS A;  1DVP A;  3D9I A;  2P9P G;  1HZ4 A;  3ENE A;  3Q9U C;  4FC8 A;  3ML9 A;  1KZO A;  3Q15 A;  4HOQ A;  1MZC A;  3CHQ A;  1OWM A;  2XS1 A;  2V4H C;  4HOT A;  1KPS B;  4OAU C;  4J0U A;  4C0M A;  1BU9 A;  4ACL A;  3RK6 A;  4AV7 A;  2PM6 A;  2WXI A;  3V31 A;  3FU3 A;  3ULY A;  1MX2 A;  2ZIS A;  1FT1 A;  4HI8 A;  1H6O A;  3KSL A;  4CEM A;  3FUE A;  4GYW A;  3DSU A;  3HIZ A;  2WMO A;  3G2U A;  4CT4 A;  2F0Y A;  1DCE A;  3E32 A;  5JMN D;  2XPY A;  2IFU A;  3ZPJ A;  4BFR A;  3MV2 B;  2R05 A;  3MEK A;  2R17 C;  1KT1 A;  5CMW A;  2I1J A;  1D8D A;  2BTD A;  3LYA A;  3QKY A;  2R2L A;  1FVF A;  3AS8 A;  1HS6 A;  1JPL A;  4PUC A;  3D9P A;  1N9A A;  2RFM A;  5CEC B;  3JCK C;  3ASO E;  3UM3 A;  3FP3 A;  2BF0 X;  2V0P A;  3EU9 A;  3FEX A;  3S2A A;  2V4L A;  4YDO A;  4A1G A;  3SGH A;  3APD A;  2QFC A;  5FZS A;  2XS8 A;  3ZU7 B;  2EQX A;  1N0R A;  2Y4T A;  4HOU A;  2GRQ B;  3FEY A;  3PZ3 A;  1OT8 A;  1AP7 A;  1UOH A;  2UWJ G;  4GCO A;  5HS0 A;  3FUI A;  1OY3 D;  5EX3 A;  3TWX A;  4TRQ A;  2YHC A;  4HQD A;  5JJ6 A;  4U8H A;  4PDX A;  4FU3 A;  1Y8M A;  2ION A;  1UJK A;  1IHG A;  1W3B A;  4UQZ A;  1HG5 A;  4BT9 A;  1IHB A;  4I9C A;  2P58 C;  1TNO A;  1K3Z D;  4EBA G;  2ETB A;  4HLE A;  3JQ0 A;  3UT7 A;  1TNY A;  2CFU A;  3R7Q A;  2HO1 A;  1JCQ A;  4N39 A;  2QC9 A;  2VSN A;  3V30 A;  3SFY A;  4HBD A;  5EYP F;  1LTX A;  3G2T A;  3HXE A;  1YMP A;  2C0M A;  4UWH A;  3GZ2 A;  4XKB A;  2WXL A;  3PEV B;  4DX6 D;  5FT9 A;  4IUL A;  2XGO A;  2KM4 A;  2IOS A;  3PDN A;  4H7X A;  3U4T A;  3G2S A;  2XRZ A;  3L22 A;  5CRV A;  3CVP A;  2XEE A;  3CEQ A;  3FTX A;  5FQ7 A;  3E33 A;  1SA4 A;  3HVE B;  3HDX A;  5G04 J;  4J8Y A;  4KVO A;  4BY6 A;  3SZ7 A;  4XKC A;  3Q47 B;  3CST A;  4BET A;  1U3D A;  1A5E A;  2B0O E;  5AJL A;  1B89 A;  4BES A;  3CQC B;  2ETA A;  1N4R A;  1FPP A;  4K5A B;  2CFZ A;  1NI1 A;  3I4G A;  1RW2 A;  4EPZ A;  3UI2 A;  3V2X A;  2AW6 A;  4U8V D;  3TGO A;  3SFZ A;  3N71 A;  3TG5 A;  1AWC B;  1MJ0 A;  3FU0 A;  3G2W A;  2CHX A;  3O4Z A;  5ENS D;  4CDM A;  4M3O A;  2LSV A;  4TV3 A;  3EJN A;  2YIN A;  2XEH A;  4QQI A;  4HOS A;  3U64 A;  2WQ7 A;  4K5C A;  4EZL A;  1IQU A;  4WWO A;  2ZGD A;  5JHA A;  2MHK A;  2GRL A;  4CDN A;  1GW6 A;  3QK0 A;  2PM7 A;  4J8S A;  3ZEF A;  3J5P A;  1TNU A;  3VLF A;  3WG7 E;  4KBQ A;  4GTV A;  4RLY A;  4GTR A;  4I6G A;  3CVY A;  3RJV A;  4JPS A;  2XEN A;  1A17 A;  4ILG A;  3SNX A;  1ZU2 A;  3CK8 A;  4WAF A;  5JJT A;  5JA4 D;  3QWW A;  4U8Y D;  2MYO A;  1QQE A;  4L1B A;  1X81 A;  3TWT A;  4YVQ C;  3SBS A;  4MRU A;  4N5Q A;  3E4B A;  1H0A A;  3B7T A;  3CQG B;  5ANR A;  3MKQ B;  4J8F A;  1SW6 A;  4DX1 A;  3EIQ C;  4WWP A;  3S7D A;  2DYS E;  4JD2 G;  4TXR A;  4K0R A;  3RSE G;  2ZIR A;  5LCW J;  1DC2 A;  2QZA A;  4AEZ C;  4GZ5 A;  3DPD A;  5AN8 A;  4GTQ A;  4N3A A;  3R9A B;  4JXT A;  5DIZ A;  2KC7 A;  3ULE G;  3Q49 B;  3UT4 A;  2RG8 A;  4XI0 A;  1MQS A;  4XIF A;  5FZR A;  2WVI A;  4Y6C A;  1WAO 1;  1TN7 A;  3PZ1 A;  4TUU A;  4JHK A;  4O1P A;  1UJJ A;  3CHS A;  3UM2 A;  3SFX A;  1WM5 A;  1UW4 B;  3W9G A;  4HRM B;  1OUV A;  4CT0 A;  4UWL A;  2CHZ A;  2VGX B;  4TXP A;  4F1S A;  2F37 A;  5KWD A;  3D9M A;  5AQ9 A;  4WWN A;  2FEZ A;  2I1K A;  3DRA A;  3QAQ A;  1N95 A;  2J4B A;  4J7W A;  4LNU D;  5IY5 E;  3PRE A;  1OXJ A;  2VSX E;  4F3V A;  1TN6 A;  3E37 A;  5C2Y A;  3TJP A;  4ABN A;  3FH5 A;  5CHE E;  4F1P A;  3NZS A;  5FTP A;  1EDU A;  1TEZ A;  3ZXS A;  3FUD A;  4GZC A;  1Q2Z A;  3G2V A;  4L23 A;  2VYI A;  1UN8 A;  4I9E A;  5BV1 A;  2PQN A;  4JA7 A;  2J09 A;  3PNL B;  3ZKJ A;  2LAI A;  4I6E A;  5HKP A;  4J8E A;  2C0L A;  2QYJ A;  3GZS A;  4FUL A;  4JEH A;  3I4R B;  3T8K A;  3I5P A;  3UM0 A;  3RRU A;  4ATG A;  2FF4 A;  1S0P A;  4L7T A;  2RKK A;  4GYY A;  3EHR A;  4L2Y A;  4PH4 B;  1UN9 A;  2F8Y A;  2XPZ A;  2XGS A;  4Q94 A;  1JUQ A;  3MZL B;  3Q78 A;  5EID A;  1YCS B;  2LUH A;  1D9S A;  5ENR D;  2IO2 C;  5BT1 A;  3V2O A;  3FUM A;  1IKN D;  2EIN E;  2XHE A;  3AU4 A;  1HX8 A;  4J8D A;  5A7D B;  3TWS A;  2IJG X;  4DRX E;  2FI7 A;  2Y4U A;  4U96 D;  2WM9 A;  3CHO A;  3ZYK A;  5J08 A;  5KJL A;  3QDN A;  3ZNG A;  4ZHB A;  2WXF A;  4CZ2 D;  4A3V A;  2DWZ A;  5BXO A;  4K5B A;  1OCO E;  4JL0 A;  4ANX A;  3HHM A;  3VTX A;  3TWU A;  3BQO A;  2WXH A;  4ANU A;  2LO6 A;  4LNB A;  3CSF A;  1DNP A;  4OYS A;  4RQI A;  2WXQ A;  5JJ7 A;  5FQ4 A;  1TJF A;  4UI9 C;  3C3R A;  3VLE A;  4MS6 A;  2OVF A;  2ZU6 B;  4J6I A;  4AP2 A;  2H6I A;  2BUG A;  2PQR A;  3L82 A;  2J08 A;  1WY6 A;  1VDY A;  4MBG A;  3UKR G;  1G3N B;  3OTN A;  3MJW A;  3ZYQ A;  4M7C A;  4FAD A;  2BKG A;  3PNT B;  5HRY A;  2RFA A;  3CVV A;  3FWV A;  4FJY A;  1QYM A;  2EIM E;  4AY6 A;  2VSO E;  3AAA C;  4L2L A;  5EYL A;  4G2V A;  3IV0 A;  3HXD A;  4EZJ A;  2OND A;  4B94 A;  3AG1 E;  3E30 A;  5FQ8 A;  1H19 A;  3Q7A A;  1OWL A;  3HRA A;  4A55 A;  4B8C B;  4AM9 A;  4G1T A; 
#chains in the Genus database with same CATH homology
 3L22 A;  4LER A;  3CVP A;  3L54 A;  2WXO A;  3KAE A;  4HFG A;  4KZC A;  1JWF A;  2WXG A;  2KCK A;  2QY7 A;  3CEQ A;  3ASG A;  4GZD A;  3FTX A;  2LNI A;  4I6J A;  5FQ7 A;  4U63 A;  2XRY A;  1BPO A;  4CRW A;  3HVE B;  3PH0 C;  3QJZ A;  3HDX A;  3D9K A;  3P2B A;  1H2T C;  5G04 J;  4PS3 A;  4FHJ A;  4HXI A;  3FDH A;  3L08 A;  3B7S A;  2WXR A;  4KVO A;  4I1A A;  4GPK A;  1SZA A;  4B8A A;  4BY6 A;  4F7A A;  3SZ7 A;  5G05 J;  4XKC A;  3Q47 B;  3CST A;  4AIF A;  1E8W A;  3FH8 A;  5LOZ A;  3TL5 A;  2WXK A;  4I1O B;  5M72 A;  1U3D A;  3QB2 A;  2WXN A;  2PL2 A;  3I3N A;  4WNG A;  4XX5 A;  5AJL A;  1B89 A;  3UT8 A;  3ZGQ A;  3LJ3 A;  1N52 A;  4AJW A;  4BWR A;  3CQC B;  3IKO B;  4N2S A;  1HFA A;  1ZBP A;  2CFZ A;  4HOR A;  5ANL A;  3I4G A;  2VJ8 A;  4AM9 A;  3FHE A;  4U0S A;  4EPZ A;  2AW6 A;  5EKQ D;  2L9B A;  2JLB A;  4KMO A;  3MKQ A;  3TGO A;  3SFZ A;  3JYS A;  1OWO A;  3LXU X;  3SF4 A;  3N71 A;  3U9W A;  3TG5 A;  4ACK A;  3FU0 A;  3D3M A;  2MOW A;  3G2W A;  2CHX A;  3O4Z A;  3FUK A;  4HS2 A;  4CDM A;  1PY1 A;  3PS6 A;  3EHM A;  3LEW A;  3U3W A;  1XGW A;  4M3O A;  4E6H A;  3MKR A;  4JVS A;  4GZ3 A;  4LUN U;  4HVB A;  2LSV A;  1NP7 A;  3ASH A;  4TV3 A;  2I2O A;  4QFV A;  3EJN A;  2V5F A;  2YIN A;  2XCC A;  1ELW A;  3U64 A;  3TAX A;  1EF1 C;  3ZHE B;  2WQ7 A;  4HOS A;  1HXI A;  4EZL A;  1HG2 A;  4NUR A;  4EZK A;  2HYZ A;  1IQU A;  3L13 A;  2GW1 A;  4BTA A;  3RKV A;  4ANW A;  3LPZ A;  3PEU B;  4G26 A;  1FVH A;  3FU6 A;  3MA5 A;  2OOE A;  4N5C A;  3AU5 A;  4OVV A;  2GRM A;  4WWO A;  4C9B B;  4CDR A;  1HO8 A;  4KXK B;  1HU3 A;  3TXM A;  5JHA A;  2MHK A;  2GRL A;  4CDN A;  4AVX A;  1GW6 A;  2IU1 A;  4JW1 A;  3SI5 A;  2AXU A;  3FUH A;  3RRN B;  3QC1 A;  4UQX A;  5G2N A;  3GZ1 A;  3QK0 A;  4U0Z A;  3QOU A;  2FBN A;  4G25 A;  4XI9 A;  3FUJ A;  2E0I A;  2PM7 A;  4DI3 A;  3D9J A;  1JWG A;  2KCV A;  4J8S A;  3ZEF A;  3RIB A;  3O48 A;  4EQF A;  3ONK A;  3FUN A;  5BPP A;  4D10 C;  4E85 A;  3HYM B;  1YA0 A;  3VLF A;  4DLO A;  1EYH A;  3OXG A;  3LCA A;  3D9N A;  4JA9 A;  3BG1 B;  3AS5 A;  1PC2 A;  3MYV A;  3PZD A;  4KBQ A;  3JQ1 A;  3CVL A;  3UX4 A;  3OAW A;  1XNF A;  3KD7 A;  4A1S A;  5CCL A;  2VGX A;  2KZT A;  4GZ6 A;  3UMV A;  3BG0 B;  2WPV A;  4I6G A;  2I9C A;  4WNE A;  3CVY A;  3RJV A;  4JC8 A;  2HM8 A;  4JPS A;  3KS2 A;  1Z3X A;  1A17 A;  1KLX A;  1OWN A;  3KEZ A;  4ILG A;  5G04 C;  3SNX A;  1ZU2 A;  4WND A;  3SBT B;  2X6I A;  3ZHE A;  3CK8 A;  3FTS A;  2Q7F A;  2V8S E;  4WAF A;  5JJT A;  2X6K A;  5G05 C;  2NXP A;  2WQH A;  4YND A;  3QWW A;  5KJN A;  1E8X A;  1QQE A;  4L1B A;  1MHQ A;  4YVQ C;  3SBS A;  3S7F A;  4MLP A;  4AOF A;  2XPI A;  1TJC A;  3FH7 A;  3LKU A;  3PVL A;  4MRU A;  3E4B A;  4PS7 A;  4DK5 A;  1H0A A;  3B7T A;  3CQG B;  5ANR A;  3CR3 A;  2VTB A;  5KJK A;  3MKQ B;  5T3R A;  3PUK A;  2AXV A;  4FJZ A;  3IBE A;  2LSU A;  4J8F A;  5EX0 A;  1EPU A;  2XEV A;  4LRZ A;  4XE0 A;  5D0Q D;  3EIQ C;  4WWP A;  2OVB A;  4NQ0 A;  2CG3 A;  3CHR A;  4N3C A;  3S7D A;  3S7J A;  4K0R A;  2VQ2 A;  5EDS A;  5LCW J;  1NZN A;  5ENN A;  3ZYM A;  3FTZ A;  2X6F A;  4KZ0 A;  3UQ3 A;  4G24 A;  4RSY A;  3ZYL A;  4JZY A;  4KYO B;  4AEZ C;  3RU0 A;  3FY4 A;  3AS4 A;  4BTB A;  4GZ5 A;  3OXF A;  3P1U A;  3FTV A;  1Z3Y A;  3DPD A;  4BX8 A;  3LDZ A;  5AIJ A;  3TXN A;  4B89 A;  4N3A A;  4FA6 A;  4AY5 A;  4GMJ A;  3QNK A;  1SZ9 A;  4RG9 A;  3R9A B;  4ILI A;  4JXT A;  4B0Z A;  5DIZ A;  2WXP A;  2KC7 A;  2X6J A;  3Q49 B;  4GAA A;  3UT4 A;  2RG8 A;  3S7B A;  4RG6 A;  3CHP A;  3NQP A;  4XI0 A;  1MQS A;  3CK7 A;  3ASD A;  2E2E A;  4XIF A;  5FZR A;  2Y3A A;  5E76 A;  2WVI A;  4Y6C A;  1UG3 A;  3PE3 A;  4ME2 A;  2AWI A;  1WAO 1;  4ILH B;  4GA2 A;  4GCN A;  2NC9 A;  5T4Y A;  4TUU A;  4JHK A;  4GA1 A;  3BEE A;  2KAT A;  1UJJ A;  4G23 A;  3IHV A;  2WXM A;  3CHS A;  4FLB A;  3UPV A;  2A4Z A;  1E7V A;  2AVP A;  4O6F A;  3MX3 A;  4Y6W A;  3CVQ A;  1E90 A;  3RO2 A;  5DBK A;  4DLQ A;  1WM5 A;  2C2L A;  4F53 A;  1UW4 B;  5G55 A;  1IYG A;  1IQR A;  3LVQ E;  1OUV A;  4CT0 A;  4UWL A;  2CHZ A;  2KZT B;  2VGX B;  3QWP A;  5ARF A;  2GGF A;  4R7L A;  5C1D A;  4DI4 A;  3ESL A;  1Z6T A;  5KCM A;  1E8Y A;  4LEU A;  3VLD A;  4F1S A;  1KT0 A;  4APO A;  5JHB A;  3EIJ A;  3ZN3 A;  4K03 A;  3U66 A;  2MRI A;  3QWV A;  3D9M A;  2VGY A;  4WWN A;  2FO7 A;  4ANV A;  1FCH A;  2FEZ A;  4UQY A;  2ILR A;  2I1K A;  4U04 A;  4H7Y A;  4DJA A;  3QAQ A;  4Q96 A;  2IF4 A;  3ML8 A;  4JEU A;  1P5Q A;  2J4B A;  1QZ2 A;  5FZQ A;  3PRE A;  2VSX E;  4F3V A;  1HH8 A;  5FQ6 A;  1OWP A;  2VTB B;  2DCP A;  5C2Y A;  3TJP A;  2WMN A;  4ABN A;  4A3T A;  4MKT A;  5AEN A;  1HF8 A;  3UUX A;  3B7U X;  4C0E A;  3GW4 A;  3FH5 A;  4V3I A;  5CHE E;  4N3B A;  3NZS A;  3IEG A;  5HI7 A;  3URZ A;  4DPR A;  4CCA A;  5KJM A;  4WUY A;  2AXZ A;  5FTP A;  1EDU A;  1TEZ A;  3ZXS A;  3CHM A;  5FJY A;  4FP7 A;  3FUD A;  4GZC A;  3SHF A;  1INZ A;  3L16 A;  3CVN A;  2VSY A;  2OV8 A;  4UI9 J;  3FU5 A;  2XCB A;  3G2V A;  4L23 A;  1DVP A;  3D9I A;  2VYI A;  4GB9 A;  4FHK A;  1HZ4 A;  3ENE A;  1UN8 A;  4FC8 A;  4KVM A;  4WNF A;  4OVU A;  5LCW C;  2R59 A;  4I9E A;  3ML9 A;  5LP0 A;  3D9L A;  3ESK A;  1N54 A;  2PQN A;  5BV1 A;  3Q15 A;  4HOQ A;  4G11 A;  3WXX A;  3LY8 A;  2L0T B;  3CHQ A;  1Y6I A;  3MGB A;  4JA7 A;  1NA0 A;  2J09 A;  3PNL B;  1OWM A;  3NF1 A;  4URK A;  2LAI A;  4I6E A;  4HOT A;  1H6K A;  3PE4 A;  4J8E A;  2C0L A;  4JHR A;  4J0U A;  4C0M A;  5LX8 A;  2I6H A;  3GZS A;  3LY7 A;  4I17 A;  3RK6 A;  5AYW D;  4ACL A;  4AV7 A;  4FUL A;  4JEH A;  2L6J A;  3I4R B;  4PS8 A;  2PM6 A;  5AJD A;  5E75 A;  2WXI A;  3I5P A;  3FU3 A;  4EEC A;  3RRU A;  3L17 A;  4ATG A;  2FF4 A;  1QNF A;  1S0P A;  4L7T A;  3MCX A;  3QAR A;  4UWF A;  5BUZ A;  4GYY A;  4BX9 A;  4CEM A;  4L2Y A;  3FTY A;  3FUE A;  4PH4 B;  1UN9 A;  4GYW A;  2XPZ A;  4BT8 A;  2XGS A;  4YVO A;  4Q94 A;  2IOL A;  5J90 A;  1JUQ A;  3HIZ A;  2WMO A;  2UY1 B;  3G2U A;  4CT4 A;  2M63 A;  3MZL B;  4XZ4 A;  2XPY A;  2IFU A;  3CIA A;  5BT1 A;  3FTW A;  4U07 A;  2J07 A;  3EDT B;  3FUM A;  3ZPJ A;  3FUL A;  4BFR A;  3MV2 B;  5T8I A;  3FFL A;  2XHE A;  3MEK A;  2R17 C;  1HX8 A;  3AU4 A;  3T5X A;  4J8D A;  5HQ8 A;  3CKB A;  1KT1 A;  5A7D B;  2IJG X;  5CMW A;  2FI7 A;  2CG2 A;  1H2V C;  4NAC A;  2Y4U A;  1SQM A;  2I1J A;  2WM9 A;  3CHO A;  2BTD A;  3CGH A;  3ZYK A;  1U3C A;  1E96 B;  1PAQ A;  3LYA A;  3DBS A;  3QKY A;  4I1M A;  1ELK A;  5D0O D;  1FVF A;  3AS8 A;  1HS6 A;  5J08 A;  3B7R L;  4JHJ A;  5KJL A;  3QDN A;  1ELR A;  1JPL A;  5BV0 A;  3B13 A;  3RO3 A;  3LY9 A;  2NSZ A;  3D9P A;  3NZU A;  4PUC A;  5BW8 C;  2HR2 A;  3JCK C;  3FP3 A;  2BF0 X;  2WXF A;  4A3V A;  2V0P A;  2X6H A;  5CCM A;  4CGW A;  3FEX A;  4JL0 A;  3S2A A;  2V4L A;  4N2Q A;  3R7R A;  3CVU A;  4A1G A;  4ANX A;  3ONL A;  3SGH A;  3APD A;  2QFC A;  3HHM A;  2UY1 A;  3APC A;  3MV3 B;  5FZS A;  4LCT A;  3VTX A;  2WXH A;  3RRM B;  4ANU A;  2LO6 A;  2XQ0 A;  3CSF A;  2EQX A;  4KT6 B;  5ARG A;  1DNP A;  4IN3 B;  4EBA A;  2RD0 A;  4FLH A;  4OYS A;  2WXQ A;  5JJ7 A;  3D9O A;  2Y4T A;  5FQ4 A;  1TJF A;  4HOU A;  4UI9 C;  5LFA A;  2A5U A;  2FUL A;  4MS6 A;  3VLE A;  1E8Z A;  3FEY A;  4APF A;  2LAH A;  2JEK A;  2OVF A;  4UWK A;  2ZU6 B;  3LVR E;  3HVE A;  1H2U A;  4J6I A;  4RVB A;  4AP2 A;  2UWJ G;  4GML A;  4GYO A;  2BUG A;  2L0I A;  4GCO A;  3JUI A;  3FUI A;  3APF A;  3CKC A;  4AXH A;  4I43 A;  2PQR A;  3ZIM A;  4IRU A;  3GYZ A;  5A23 A;  5EX3 A;  4TRQ A;  2YHC A;  2J08 A;  1WY6 A;  1VDY A;  4I2W A;  5JJ6 A;  4U8H A;  4PDX A;  4GA0 A;  2YNQ A;  2KCL A;  3OTN A;  3Q5M A;  3MJW A;  4FU3 A;  1Y8M A;  2DIW A;  3LS8 A;  2ION A;  3ZYQ A;  3FUF A;  4FAD A;  4UI9 K;  2YQ8 A;  1UJK A;  3PNT B;  2PZI A;  1IHG A;  3ZW3 A;  1W3B A;  1L5J A;  3CLJ A;  4UQZ A;  4W9R A;  2WB2 A;  1HG5 A;  4BT9 A;  2WQ6 A;  3CVW A;  3FTU A;  3CV0 A;  4I9C A;  2J9Q A;  2X3M A;  2IQC A;  2P58 C;  3CVX A;  1LF8 A;  3ULQ A;  4U0U A;  4EBA G;  3CVV A;  3FWV A;  2XGM A;  3T5V A;  4FJY A;  4HLE A;  1E7U A;  3PUJ A;  1HE8 A;  3EHN A;  3JQ0 A;  3UT7 A;  4Q69 A;  5A6C A;  2CHW A;  2J4D A;  2CFU A;  3TG4 A;  2DBA A;  3VTY A;  3R7Q A;  2HO1 A;  2VSO E;  4L2L A;  3ZFW A;  4AY6 A;  4G2V A;  3IV0 A;  4UWG A;  2YHE A;  4N39 A;  3ASF A;  5CMY A;  2VSN A;  3L6A A;  4I2Z A;  3OXL A;  4NRH B;  3T8M A;  2R5S A;  3K9I A;  2J49 A;  3G2T A;  1NA3 A;  2X38 A;  4EZJ A;  2OND A;  4GU5 A;  4BSX A;  5BNW A;  2C0M A;  4B94 A;  4UWH A;  3CK9 A;  3GZ2 A;  4XKB A;  2WXL A;  3Q4A B;  3PEV B;  3ZVV A;  1X5B A;  5FQ8 A;  1H19 A;  4IYP A;  2WXJ A;  3PRZ A;  5FWQ A;  5FT9 A;  1OWL A;  3C98 A;  4A55 A;  4IUL A;  2XGO A;  4B8C B;  3IHY A;  2KM4 A;  4CGV A;  2IOS A;  4P29 A;  3PDN A;  4H7X A;  3SD5 A;  3U4T A;  3G2S A;  3ZRH A;  4G1T A;  2XRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...