2PQNA

Crystal structure of yeast fis1 complexed with a fragment of yeast mdv1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
VDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Mitochondria fission 1 protein
publication title Structural basis for recruitment of mitochondrial fission complexes by Fis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 52
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pqnA01
2I6HA 4N5CA 4HOSA 2C0LA 3S7DA 4JHRA 3QWWA 4JA7A 2C2LA 1B89A 1ELRA 4KBQA 3QDNA 5JJ7A 3ULQA 4NQ0A 4JA9A 3RO3A 3ASHA 4BTBA 1P5QA 4GCNA 3MKRA 4I17A 2Q7FA 2FO7A 4WNGA 3OXFA 3AS8A 4KXKB 4J0UA 1KLXA 4UI9K 4EQFA 5HI7A 2QFCA 4U04A 4YNDA 5FTPA 3ZFWA 1ZU2A 3CKBA 5G05J 3GYZA 3CVQA 2FBNA 2P58C 4N3CA 2HYZA 3PDNA 2XCCA 4IN3B 2XGSA 2FEZA 4N39A 3AS4A 5CCLA 4YVOA 3PE4A 3QWVA 4J8EA 4B94A 2YQ8A 2YHCA 3ZHEB 2XEVA 3UQ3A 4N2QA 3Q15A 3FWVA 4UI9C 4CGVA 4GCOA 2MHKA 2C0MA 3WXXA 2KC7A 3MV3B 2PL2A 3URZA 2IFUA 4HOUA 3K9IA 4UI9J 5FZSA 1Y8MA 2PZIA 1KT1A 3CVLA 5CCMA 5HQ8A 2E2EA 4HOTA 5ARGA 1E96B 4AY5A 2UWJG 2XCBA 5BW8C 5G04J 2GW1A 4W9RA 1W3BA 3RO2A 5DBKA 3MEKA 3Q47B 3SZ7A 3Q49B 3Q5MA 2VQ2A 3S7JA 4BT9A 4YVQC 4GZ5A 3SF4A 5EX0A 4H7YA 5AYWD 2VGYA 3GZ2A 4CGWA 5FJYA 3CVNA 1WM5A 5A6CA 3HYMB 3JYSA 4GA1A 3RU0A 3TAXA 2JLBA 4U0UA 4G2VA 4AY6A 3PE3A 4I1AA 3LY9A 3QOUA 1IHGA 3RJVA 4Y6CA 3ASGA 2J9QA 4N3AA 4AM9A 3ESKA 4UQXA 4ABNA 1PC2A 2LSVA 3GW4A 1YA0A 2VYIA 4RG6A 3ZHEA 2XGOA 2AVPA 3RKVA 1TJCA 2KATA 3UPVA 4APOA 2KCLA 1HH8A 4BTAA 2UY1A 4BT8A 3CKCA 2KCVA 1OUVA 3CEQA 1IYGA 2HR2A 4N2SA 4JL0A 4A1SA 1WAO1 2VSNA 2UY1B 4I9CA 5JJ6A 4NRHB 3TGOA 3KAEA 3R9AB 4GA0A 4J8DA 2VSYA 5DIZA 3U4TA 4XI9A 1QQEA 1A17A 2OOEA 4ME2A 2FI7A 5D0QD 4I2ZA 2PQNA 3OXGA 3AS5A 4CDRA 1HZ4A 3QKYA 3LY7A 2BUGA 2VGXA 4U0ZA 2PQRA 4U07A 4WUYA 5KJLA 5KJNA 4GYWA 1NA3A 3CVPA 2VGXB 4KYOB 4O6FA 1NZNA 5KJKA 4J8FA 4I9EA 2Y4TA 5D0OD 3Q4AB 4BWRA 3O48A 1QZ2A 3S7BA 3OXLA 3GZ1A 3N71A 2FF4A 3IEGA 2LSUA 3ASDA 3BEEA 4XIFA 4G25A 4I2WA 3LKUA 5BT1A 3CK9A 4AIFA 5A7DB 4WNEA 4UQYA 1NA0A 5FZRA 2WPVA 5KJMA 5M72A 2XPIA 4RG9A 1FCHA 4G1TA 4GZ3A 3CV0A 3LCAA 2Y4UA 4HORA 4G23A 5G05C 3FP3A 4GA2A 4WNFA 5LCWC 4LEUA 3ZN3A 3MA5A 5C1DA 4GPKA 2HO1A 3U3WA 4GYYA 4U0SA 4XI0A 5FT9A 5LCWJ 5EKQD 5BNWA 3FFLA 3LPZA 2ONDA 4GZ6A 2XGMA 2LNIA 3QWPA 5CHEE 3VTYA 3LYAA 3MV2B 4G26A 4Y6WA 4N3BA 3S7FA 3UUXA 5JJTA 5EX3A 3EDTB 3CK8A 4F3VA 2KCKA 3VTXA 3TG4A 3ASFA 4H7XA 4GYOA 3CK7A 4WNDA 5G04C 4HOQA 1ELWA 1HXIA 3ZPJA 3E4BA 3LY8A 3ZGQA 3KD7A 2IF4A 5FZQA 2NC9A 2V5FA 3KS2A 2WQHA 3RIBA 1KT0A 2L6JA 5ARFA 3NF1A 2R5SA 3TG5A 1XNFA 4G24A 2DBAA 1ZBPA 4UQZA
chains in the Genus database with same CATH superfamily
4UWFA 4JA7A 2EQXA 1S70B 4O60A 1YMPA 2ZGGA 3ZKJA 2KZTB 3ULQA 2F8YA 3CHMA 2GRPB 4BTBA 3FTUA 5FQ6A 2WXKA 4GCNA 4JC8A 5H7PA 2FO7A 4WNGA 3NB2A 4ILIA 4G8LA 4R7LA 4GMLA 5KBAA 3UTMA 4C0MA 2QFCA 3AU4A 4HVBA 1JWFA 5ITZF 2V4HC 1OCZE 3QARA 4I43A 2GGFA 3AU5A 2P58C 4N3CA 4MLPA 3C3QA 2GRLA 1LTXA 4HRMB 2XCCA 5ENPD 2X6KA 2FEZA 1E8YA 3UIPC 3QWVA 2H6HA 2XEVA 1INZA 3VLEA 4APFA 3FWVA 2ILRA 3FUHA 1KPSB 4CGVA 2J4BA 2MHKA 3SNXA 4A1GA 2XQ0A 2P9IG 3ULEG 1OCOE 2IFUA 3FUDA 3K9IA 5FZSA 2WXNA 2OV8A 1HFAA 3CVXA 3TL5A 3UM0A 4HXIA 1IKND 5CERB 2DYSE 5CEDB 4HOTA 4Q94A 4CDNA 4LRZA 3L82A 2GROB 1U3DA 3MEKA 2X3MA 4TXQA 3Q5MA 2YINA 1N9AA 4BT9A 1MX6A 2ZGDA 3FTWA 5KCMA 3L13A 3ONLA 4AVXA 3QJZA 4HB5A 2HM8A 1LF8A 4CGWA 3CVNA 3LDZA 3EHMA 4BEPA 1WG0A 4Q96A 3X2QE 3WG7E 4G2VA 4AY6A 3PE3A 1MZCA 3SBSA 4ACLA 3BG0B 4GTTA 2VJ8A 3U66A 3MCXA 1AWCB 4HLEA 3ULYA 3EHRA 4OVVA 4JW1A 2X6FA 3J5PA 2A5UA 4TRQA 4ABNA 4DX1A 1PC2A 2VTBB 3GW4A 3HVEB 4XE0A 5CBNA 2WM9A 2ZXWE 5ENQD 3CQGB 1O1TA 2L0IA 2XENA 3DEOA 3ZYQA 2I2OA 2LO6A 3TWRA 3JXIA 1IYGA 2RFAA 3MKQA 2H6IA 2WXOA 2CG3A 3APFA 2IY0C 3B95A 2UY1B 1RZ4A 5JJ6A 3KAEA 2IU1A 3DXKG 1IXVA 5B1BE 4OAUC 1AP7A 1A17A 3ZIMA 1QQEA 2IOSA 3OTNA 3PNTB 3LVRE 2J08A 3E33A 3S2AA 2PQNA 4DLQA 3OXGA 3V2OA 2LUHA 2ZU6B 1N4PA 3LY7A 3SI5A 5FIOA 3ZXSA 2PQRA 5KJLA 5KJNA 4JD2G 4GYWA 5JMND 1N0RA 3FDHA 1NA3A 3CVPA 2WQ6A 2VGXB 1H2VC 5ENNA 4FU3A 5EDSA 4O6FA 4DK5A 3I3NA 4F1SA 1H2TC 1UG3A 1UN9A 2BKKB 3L9TA 2GRQB 1TJFA 4I9EA 4F1PA 5BXOA 1QZ2A 4IYPA 3D3MA 3JQ0A 1H6OA 2ETBA 1JUQA 5G2NA 3IHYA 3LJNA 3C5RA 2VTBA 4U7EB 2PNNA 3ASDA 2J8SD 5CMYA 5FINA 5BT1A 4GTQA 5A7DB 4WNEA 3T5VA 4QQIA 3B7UX 1H6KA 1V55E 3T8MA 1NA0A 2NSZA 4U95D 2CHXA 4IRUA 1JPLA 5KJMA 3DXMG 4HFGA 4RG9A 2Y4UA 1K8KG 2ETAA 4G23A 4B8AA 4WNFA 1N4RA 5LCWC 4P29A 4LEUA 4GPKA 2HO1A 3FU3A 1N4QA 3LPZA 4GTVA 2XPYA 4DJAA 3TWQA 2OEVA 4CZ2D 3ESLA 3MV2B 3AG4E 5FQ4A 3G2TA 3UXGA 3NOCD 3VTXA 1E7UA 5KWDA 1GW6A 3TG4A 4ILGA 2X6HA 3PZ3A 3HDXA 1WY6A 4GYOA 3VLDA 3CK7A 4HOQA 1ELWA 3E4BA 4XKCA 1HS6A 4A63B 2NC9A 3I4RB 5JA4D 4BSXA 3KS2A 1D8DA 3RIBA 2RD0A 2DIWA 2MRIA 3UT4A 1TN7A 2IO3C 4MKTA 3W9FA 4HNAD 3LVQE 4XX5A 1BD8A 3SQVA 1JCRA 4HLLA 3UMVA 2DBAA 1ZBPA 2I6HA 4DX2A 1SZAA 2C0LA 3S7DA 4JHRA 2L0TB 2CFZA 3TWUA 3QDNA 1TEZA 5JJ7A 4CT0A 4JA9A 2XS8A 4N5QA 3ZYLA 1U2VG 3D9MA 3TXMA 3ZW3A 4HRNA 3UIOC 2Q7FA 2LAIA 4JXTA 4U63A 4J0UA 2YHEA 4UI9K 3PH0C 3T8KA 3I4GA 3QK0A 1YYHA 4ILHB 1PAQA 3ZFWA 3DSXA 1ZU2A 3CKBA 1FT1A 3CVQA 5BUZA 4J8SA 1HG5A 1MHQA 3PZ1A 3ML9A 2P9NG 3BG1B 3R9MA 3MX3A 1BLXB 3AS4A 4YVOA 1SW6A 4B94A 2YQ8A 1E8WA 3Q15A 2WXFA 3L22A 3HXEA 3B7TA 3LXUX 5C2YA 3WXXA 2WXGA 4GTMA 2BEDA 3MJWA 2PL2A 3URZA 4HOUA 2WMOA 1NFIE 1Y8MA 2PZIA 3B13A 4FHKA 1N0QA 3JQ1A 4ANWA 3CVLA 5HQ8A 1TNYA 4UWGA 4ACKA 5LP0A 2UWJG 3JCKC 5BW8C 3AG3E 4W9RA 5EILA 1W3BA 2VGEA 3RO2A 5LX8A 5DBKA 3UT8A 3PUKA 1O5MA 3SZ7A 3PS6A 3TWVA 3NAWA 2VQ2A 2IO2C 4O1OA 4J7WA 4V3IA 4YVQC 4G11A 4FLHA 4I1OB 2DZOA 4CRWA 5AYWD 3Q75A 2VGYA 4DUIA 4XZ4A 5AJLA 4JB8P 3CSTA 3Q9NC 1WM5A 3HYMB 3EU5A 2KXPC 2BTDA 4BFRA 3PEUB 3TAXA 4U0UA 3B7BA 4LNGA 3ASOE 1SZ9A 3LY9A 4RSYA 3RJVA 3O4ZA 3ASGA 4F53A 5KNGA 2J9QA 2X6IA 4E6HA 1DC2A 1UJKA 3TXNA 2NXPA 3U9WA 1TNOA 5HS0A 3APCA 2VYIA 4X8QA 1N95A 2DCPA 2PM7A 1OCRE 1K1BA 1MYOA 2P9PG 2AVPA 1TJCA 3UPVA 4L7TA 2WXHA 4APOA 4HQDA 1DNPA 1OCCE 3FUFA 4UWKA 1HH8A 4PDXA 3CEQA 4PH4B 5ENRD 2ZISA 2QY7A 4JL0A 4M7CA 4A1SA 2AW6A 3FULA 2F0YA 4I1MA 3R9AB 4F7AA 3MKQB 2VSYA 3JUEA 1NL4A 3TWSA 2WVIA 4ME2A 3CHQA 2FI7A 3UKUG 5D0QD 2I1KA 4YDYA 2IONA 3RRMB 2Y1LE 3PVLA 1L5JA 3QKYA 4NURA 5T8IA 3FTVA 2AXZA 1BU9A 4LG6A 3CSFA 3SD5A 3LEWA 1H0AA 1NZNA 4GTRA 2KBXA 3L08A 3UX4A 3W9GA 5EIBE 3NQPA 4TUMA 3SFYA 3G2UA 5D0OD 3Q4AB 1N52A 3HRAA 3Q9UC 4FLBA 2B6CA 3OXLA 2XZDG 2AJAA 4AJWA 2R05A 3FY4A 3UM2A 3N71A 2FF4A 5E76A 1DVPA 3ZYMA 1HE8A 3NBNB 3BEEA 3J5QB 4XIFA 4G25A 5FQ7A 3LKUA 2BKGA 2H6FA 4AIFA 5T3RA 5T4YA 2WPVA 3SGHA 2XPIA 1HX8A 4G1TA 1N11A 3SO8A 4C48B 4EBAA 4BX8A 3MA5A 3U3WA 4TUUA 4DI4A 5LCWJ 3FH7A 3FFLA 5E75A 2ONDA 2OEWA 3FEXA 4BY6A 1BI8B 2LAHA 2LNIA 3E30A 3LYAA 5AJDA 4HRLA 4Y6WA 2QZAA 4N3BA 5JJTA 5ANRA 3KSLA 5CMWA 5ENTD 5AQBA 5HKPA 5EYLA 2KCKA 1MJ0A 4CDMA 3KSQA 4MBGA 4L2LA 3D9JA 1Z3XA 2WXLA 3ABME 5J08A 3BU8A 1HXIA 1Z6TA 4I6JA 3ASNE 3ZGQA 1Z3YA 1N4SA 4ATGA 2V5FA 3ZVVA 4EBAG 3NOGD 5A23A 2MOWA 3NF1A 3SFZA 3TG5A 4DRXE 3TWWA 1XNFA 4FA6A 4UWLA 3KEAA 2FULA 2OCCE 3V31A 4BX9A 4L2YA 4N5CA 1S0PA 1UOHA 2CHWA 3D9OA 4XEIG 1B89A 1ELRA 4KZ0A 2XEHA 4FC8A 4GB9A 3B7RL 5EN5D 3RO3A 3RRNB 1Z5SC 3RRUA 3HHMA 3DSTA 1P5QA 3P2BA 4I17A 4HBDA 3ZUVB 3FU5A 4CT4A 3Q79A 5HI7A 1SVXA 5AENA 2P9SG 4A3TA 5B3SE 5G05J 3GYZA 4AEZC 3D9HA 3DSWA 1UW4B 3ML8A 2OVFA 4GTOA 4RVBA 1OXJA 3PDNA 1K3ZD 3D9PA 3DPYA 3R7RA 1DCQA 4IN3B 2XGSA 2KM4A 1HU3A 4FHJA 3CVYA 5CCLA 3PE4A 3DEPA 1TNBA 3U64A 4TV3A 2B0OE 4UI9C 3MYVA 4GCOA 4L1BA 1UJJA 4TXPA 3MV3B 2F37A 3HXDA 3HG0D 4C0EA 5HRYA 5AARA 3UM3A 4AV7A 3NZUA 5ARGA 3MZLB 1E96B 4AY5A 2XCBA 3DBSA 5G04J 2GW1A 2DYRE 4LNUD 1TR4A 4BETA 4FJZA 4I6GA 4MRUA 4GMJA 4A3VA 3CGHA 3KEZA 3C3OA 1OWMA 3RSEG 1ZB1A 3FTYA 3PZ4A 4I6EA 2WXQA 5A6CA 5JHBA 2X6JA 4D10C 5JHAA 3JYSA 3HIZA 4GTSA 5EIDA 3FEYA 4DX5D 4I1AA 1N54A 1IHGA 4QFVA 5BXUA 4L23A 3HXCA 5ENOD 2Y0BG 3D9LA 4AP2A 1VDYA 4N3AA 4PS7A 1TNUA 2WXMA 1QYMA 4OYSA 4UQXA 2LSVA 2AXUA 1YA0A 1HO8A 1SA5A 2A5EA 4ANUA 2NYJA 3RKVA 4YDWA 2WXJA 3PUJA 5AN8A 2KCLA 1LD7A 1YCSB 2GRMA 3R7QA 2BF0X 4BT8A 3JXJA 4BSZB 1OUVA 2HR2A 4N2SA 3EJNA 3ISMC 1S63A 3CVVA 2DWZA 1WAO1 3V79K 1H6PA 4NRHB 4GA0A 1E8ZA 1MX2A 1NI1A 4J8DA 1NP7A 4B89A 2EILE 2R03A 3IV0A 3U4TA 4EZKA 4FULA 4KVMA 2YNQA 4YDEA 4I2ZA 1H2UA 2XS1A 1O1RA 3AS5A 3ZEFA 4CDRA 2CHZA 3PZ2A 2BUGA 4U0ZA 4RQIA 3ZNGA 3HXFA 3UINC 4U07A 1K1AA 4GZCA 4EZLA 2XZTG 4K0RA 4LNBA 2WB2A 4CCAA 4GPMA 3NZSA 4JVSA 2Y4TA 1D9SA 4BWRA 3S7BA 4J8YA 5B1AE 4LCTA 3IEGA 3IHVA 4AOFA 2ETCA 4MS6A 4EZJA 3CK9A 1S64A 4WAFA 4B0ZA 4UQYA 3P1UA 1OWPA 4U96D 3I5PA 3JUIA 4F6RD 5M72A 5ANLA 1FCHA 4GZ3A 3CV0A 3Q73A 4HORA 2AXVA 2IEJA 2QC9A 3QNKA 3FP3A 1KZOA 4GA2A 2RG8A 2OVBA 2ZIRA 1E90A 2V8SE 1N94A 4GYYA 4U0SA 2HE0A 1X81A 5FT9A 1QBQA 1UN8A 5EKQD 5BNWA 3FUJA 1HG2A 2R2LA 5D2MC 4KMOA 4L9PA 2JEKA 3QWPA 2MYOA 5CHEE 3VTYA 5LOZA 4UWHA 4G26A 4IULA 3E34A 3S7FA 2L6BA 3UUXA 5EX3A 3CK8A 4F3VA 5AIJA 3BUAA 4EHMA 4EECA 4RLYA 3EHQA 4H7XA 1X5BA 2LXMA 3EU9A 1JWGA 2A4ZA 1V54E 4JZYA 3FUEA 3SBTB 2IOLA 4WWOA 1FPPA 3B7SA 3CVUA 1WDYA 5CRUA 4CEMA 3PREA 1O1SA 4PS3A 3CR3A 5ARFA 1H19A 2R5SA 3FU6A 4JHKA 3FTZA 4WWNA 2R17C 2VSOE 5CECB 4DI3A 4ZFHA 3CHPA 1TYQG 2KZTA 2I1JA 4HOSA 2X38A 4GMRA 3QWWA 3FU0A 2C2LA 3PEVB 3L6AA 4KBQA 2PM6A 4BERA 3E37A 3V30A 4NQ0A 3ZU7B 2V5QC 3ASHA 2Y69E 1QNFA 3MKRA 3ZYKA 1EYHA 3OXFA 3PZDA 3AS8A 4KXKB 2CG2A 1KLXA 3RAUA 4EQFA 5AAOA 2XRYA 4U04A 4YNDA 5EYPF 1OY3D 5LFAA 2QYUA 1FVFA 5FTPA 2J49A 3PRZA 3FTSA 2FBNA 1MX4A 4NIKA 3EUVA 2HYZA 4LSZE 2WMNA 2RKKA 4DX6D 4KT6B 3F6QA 4U8YD 3TJPA 4N39A 4AXHA 1U3CA 2WXRA 4J8EA 2J4DA 2YHCA 3ZHEB 3UQ3A 4N2QA 1DCEA 1JCSA 1ELKA 4ZHBA 1Q2ZA 2C0MA 2KC7A 1G3NB 4GAAA 2L9BA 3Q7AA 4UI9J 1TNZA 2IJGX 3V2XA 1KT1A 2WXPA 5CCMA 2XPZA 1IHBA 5IY5E 4M3OA 1E8XA 3ZXPA 4Z68A 2E2EA 4E85A 2VSXE 4B8CB 1EDUA 4PUCA 1LD8A 3EHNA 2CFUA 5AQ9A 3Q47B 3D9NA 3Q49B 2AWIA 3EIJA 1SQMA 3C98A 3S7JA 4GU5A 3BQOA 4BESA 4GZ5A 2H6GA 3SF4A 3T5XA 5EX0A 4A55A 3CHRA 4DX7D 4H7YA 1IQRA 3CQCB 4O1PA 1IQUA 3GZ2A 5ENSD 3DSSA 2F8XK 3IXEA 4FJYA 5FJYA 4JEHA 4FADA 1A5EA 5FQ8A 5J90A 2Y3AA 4GA1A 3LJ3A 3D9KA 4WWPA 3RU0A 4Q69A 3APDA 2JLBA 2R59A 3ABKE 3QOUA 3PNLB 1EF1C 1HF8A 3GZSA 4Y6CA 5G55A 1RW2A 5KNHD 3QAQA 3AAAC 3HVEA 3L16A 3E32A 3AG1E 4AM9A 3SHFA 3ESKA 4U8HA 1OWLA 3UM1A 3T9KA 1FT2A 1PY1A 1MQSA 2J07A 3OAWA 2GRRB 4RG6A 3ZHEA 2EIJE 2XRZA 2XGOA 3ZRHA 2KATA 3D9IA 2DZNA 4U8VD 1OWNA 4BTAA 2UY1A 4J6IA 3CKCA 5CEAA 2KCVA 4HI8A 4ANXA 2P9LG 4K5BA 3DPDA 4FP7A 5AQAA 2J09A 2VSNA 4I9CA 4K5AB 4K03A 3FTXA 3TGOA 4OAVB 5DIZA 1TN6A 3CHSA 4XI9A 2OOEA 3FH5A 3IKOB 2LXLA 3ENEA 3CIAA 3FUIA 4LERA 2JABA 2P9KG 4ATZD 1HZ4A 3TWTA 2VGXA 4NACA 3Q7FA 3UI2A 4URKA 1JCQA 1OWOA 2XEEA 4WUYA 2V4LA 1XGWA 3AG2E 2M63A 4LUNU 4KYOB 2QYJA 3L17A 3ABLE 5KJKA 4J8FA 4TXRA 3L54A 3FHEA 4ANVA 2IQCA 5BV0A 2E0IA 3IBEA 3O48A 4C9BB 2EINE 3SFXA 2EIKE 3GZ1A 4KVOA 2FO1E 3C72A 3CVWA 4GZDA 2LSUA 3CLJA 3FUKA 3C3RA 4HI9A 4HS2A 1BPOA 3UT7A 4EPZA 4I2WA 2GRNB 3TWXA 1KZPA 5BPPA 4KZCA 3RK6A 4GTPA 2R02A 2WQ7A 3DRAA 5FZRA 3ONKA 3DSVA 4JHJA 1SA4A 3MGBA 3LS8A 3CHOA 3LCAA 4PS8A 4CYMD 1E7VA 5G05C 1EPUA 3FH8A 3DSUA 3ZN3A 5CBOA 5C1DA 2XHEA 3AJIA 3FUNA 3Q78A 4XI0A 2P9UG 3HXBA 4B93B 2I9CA 4GZ6A 5FWQA 3G2WA 2XGMA 3UKRG 1FVHA 4K5CA 5BV1A 3SY2A 3QB2A 1Y6IA 5D66A 1OT8A 3EDTB 1D8EA 2WXIA 4XKBA 2DVWA 4UUCA 3ASFA 3EIQC 4WNDA 5G04C 4YDOA 1BI7B 3G2SA 3VLFA 3ZPJA 2V0PA 2RFMA 1TN8A 3LY8A 4DLOA 5AQ7A 4DPRA 3KD7A 2IF4A 5FZQA 3DWLG 2WQHA 3QC1A 1KT0A 2L6JA 4JEUA 2P2CP 4OVUA 4G8KA 4G24A 4JPSA 3G2VA 3FUMA 5CRVA 4UQZA 2EIME
chains in the Genus database with same CATH topology
2KZTA 5LP0A 2I6HA 2I1JA 4L2YA 4N5CA 4HOSA 1SZAA 2C0LA 2X38A 1S0PA 3S7DA 4JHRA 2CHWA 3D9OA 3QWWA 2L0TB 4UWFA 4JA7A 2EQXA 3FU0A 2C2LA 2CFZA 1B89A 3PEVB 3L6AA 1ELRA 4KZ0A 4KBQA 2PM6A 3QDNA 4FC8A 4GB9A 1TEZA 2KZTB 3B7RL 4NQ0A 3ULQA 4CT0A 5JJ7A 4JA9A 3RO3A 3RRNB 3RRUA 3CHMA 3HHMA 3ZYLA 3D9MA 3TXMA 3ASHA 4BTBA 1P5QA 3FTUA 5FQ6A 3P2BA 3ZW3A 2WXKA 4GCNA 1QNFA 3MKRA 3ZYKA 1EYHA 4JC8A 4I17A 2Q7FA 2FO7A 4WNGA 3OXFA 3PZDA 3AS8A 4ILIA 4KXKB 2LAIA 4JXTA 4U63A 4R7LA 3FU5A 4GMLA 2CG2A 4J0UA 4CT4A 2YHEA 1KLXA 4UI9K 4C0MA 4EQFA 5HI7A 2XRYA 3PH0C 2QFCA 4U04A 4YNDA 3AU4A 5AENA 5LFAA 3I4GA 4HVBA 4A3TA 3QK0A 1JWFA 1FVFA 5FTPA 2J49A 4ILHB 1PAQA 3ZFWA 3PRZA 3QARA 1ZU2A 4I43A 2GGFA 3CKBA 5G05J 3AU5A 3GYZA 3FTSA 3CVQA 4AEZC 2FBNA 2P58C 5BUZA 4J8SA 1UW4B 1HG5A 2OVFA 3ML8A 4RVBA 4N3CA 2HYZA 3PDNA 4MLPA 2GRLA 1MHQA 2WMNA 3R7RA 3D9PA 3ML9A 4KT6B 3BG1B 2XCCA 4IN3B 2XGSA 2KM4A 2X6KA 3MX3A 1HU3A 4FHJA 3TJPA 3CVYA 2FEZA 4N39A 1E8YA 4AXHA 3AS4A 5CCLA 4YVOA 1U3CA 3PE4A 2WXRA 3QWVA 4J8EA 2J4DA 4B94A 2YQ8A 2YHCA 3ZHEB 2XEVA 3U64A 4TV3A 3UQ3A 4N2QA 1INZA 3VLEA 1ELKA 1E8WA 3Q15A 4APFA 2WXFA 3L22A 3FWVA 4UI9C 2ILRA 3B7TA 3FUHA 3LXUX 5C2YA 3MYVA 2J4BA 4GCOA 2MHKA 4L1BA 4CGVA 2C0MA 1UJJA 3WXXA 2WXGA 2KC7A 3SNXA 3MV3B 4A1GA 2XQ0A 3MJWA 2PL2A 3URZA 2IFUA 4GAAA 2L9BA 3FUDA 3K9IA 4HOUA 4UI9J 2WMOA 5FZSA 2WXNA 2IJGX 1Y8MA 2OV8A 2PZIA 1HFAA 3B13A 4FHKA 1KT1A 3TL5A 3CVXA 2WXPA 3JQ1A 4ANWA 3CVLA 4C0EA 5CCMA 2XPZA 4HXIA 5HQ8A 4M3OA 1E8XA 4AV7A 2E2EA 3NZUA 4E85A 4UWGA 4HOTA 5ARGA 3MZLB 4ACKA 1E96B 4AY5A 2UWJG 2XCBA 3JCKC 2VSXE 3DBSA 4Q94A 5G04J 4LRZA 5BW8C 2GW1A 1EDUA 4B8CB 4W9RA 4PUCA 4CDNA 1W3BA 1U3DA 3RO2A 5LX8A 5DBKA 3EHNA 2CFUA 3MEKA 3PUKA 3UT8A 3Q47B 4FJZA 4I6GA 3D9NA 3SZ7A 3PS6A 2X3MA 4MRUA 3Q49B 2YINA 3Q5MA 2AWIA 3EIJA 2VQ2A 1SQMA 4GMJA 3C98A 3S7JA 4GU5A 4BT9A 3FTWA 4V3IA 4YVQC 5KCMA 4GZ5A 4A3VA 3L13A 3CGHA 4G11A 4FLHA 3SF4A 3KEZA 4I1OB 4CRWA 3T5XA 5EX0A 1OWMA 3ONLA 4A55A 3CHRA 4H7YA 5AYWD 4AVXA 1IQRA 3QJZA 3CQCB 2VGYA 3FTYA 4I6EA 1IQUA 4XZ4A 5AJLA 3GZ2A 2WXQA 3ZIMA 2HM8A 3CSTA 1LF8A 4FJYA 4CGWA 5FJYA 3CVNA 1WM5A 4JEHA 4FADA 3HYMB 5A6CA 5JHBA 2X6JA 3LDZA 4D10C 3EHMA 5JHAA 5FQ8A 5J90A 3JYSA 2Y3AA 4GA1A 3LJ3A 3HIZA 3D9KA 2BTDA 4BFRA 4Q96A 4WWPA 3RU0A 4Q69A 3APDA 3PEUB 3TAXA 2JLBA 2R59A 4U0UA 3FEYA 4G2VA 4AY6A 3PE3A 4I1AA 1SZ9A 3LY9A 4RSYA 3SBSA 1N54A 3QOUA 3BG0B 4ACLA 3PNLB 1IHGA 1EF1C 4QFVA 1HF8A 3GZSA 4L23A 3RJVA 2VJ8A 3O4ZA 4Y6CA 3D9LA 3ASGA 5G55A 4F53A 3U66A 4AP2A 3MCXA 3QAQA 1VDYA 2J9QA 2X6IA 3HVEA 4N3AA 4PS7A 4HLEA 3L16A 2WXMA 4E6HA 4OVVA 4AM9A 4JW1A 2X6FA 3SHFA 3ESKA 2A5UA 4OYSA 4U8HA 4UQXA 1UJKA 3TXNA 1OWLA 2NXPA 4TRQA 3U9WA 4ABNA 3APCA 1PC2A 2VTBB 2LSVA 1PY1A 1MQSA 2AXUA 2J07A 3GW4A 3HVEB 1YA0A 2VYIA 2DCPA 2PM7A 4XE0A 3OAWA 4RG6A 3ZHEA 1HO8A 2WM9A 2XRZA 2XGOA 3ZRHA 3CQGB 4ANUA 2AVPA 3RKVA 1TJCA 2KATA 3D9IA 3UPVA 2L0IA 4L7TA 2WXHA 4APOA 2WXJA 3PUJA 1DNPA 2KCLA 3ZYQA 3FUFA 4UWKA 1OWNA 2I2OA 1HH8A 2GRMA 3R7QA 4BTAA 2BF0X 2UY1A 4BT8A 2LO6A 4J6IA 3CKCA 2KCVA 4ANXA 1OUVA 4PDXA 3CEQA 4PH4B 1IYGA 3MKQA 2HR2A 4N2SA 2WXOA 2CG3A 3DPDA 3EJNA 2QY7A 4JL0A 4FP7A 3CVVA 3APFA 4A1SA 1WAO1 2J09A 2VSNA 2UY1B 2AW6A 4I9CA 4K03A 3FTXA 5JJ6A 3FULA 4NRHB 3TGOA 3KAEA 4I1MA 3R9AB 2IU1A 4GA0A 1E8ZA 4J8DA 4F7AA 3MKQB 1NP7A 2VSYA 4B89A 5DIZA 3IV0A 3CHSA 3U4TA 4XI9A 4EZKA 1QQEA 1A17A 2IOSA 2WVIA 2OOEA 3OTNA 3PNTB 4FULA 3FH5A 4ME2A 3CHQA 3IKOB 2FI7A 2J08A 2YNQA 3LVRE 4KVMA 5D0QD 3S2AA 4I2ZA 3ENEA 2I1KA 2PQNA 3CIAA 3RRMB 2IONA 3FUIA 4DLQA 1H2UA 3OXGA 3AS5A 4LERA 3ZEFA 4CDRA 2ZU6B 2CHZA 3PVLA 1L5JA 1HZ4A 3QKYA 3LY7A 3SI5A 4NURA 2BUGA 2VGXA 4U0ZA 4NACA 3ZXSA 2PQRA 5T8IA 3FTVA 2AXZA 4U07A 4URKA 1OWOA 4WUYA 5KJLA 5KJNA 2V4LA 1XGWA 2M63A 4LUNU 3CSFA 4GZCA 3SD5A 4EZLA 4GYWA 4K0RA 3FDHA 1NA3A 3LEWA 3CVPA 2WQ6A 2WB2A 2VGXB 4CCAA 1H2VC 5ENNA 4FU3A 5EDSA 1H0AA 4KYOB 4O6FA 1NZNA 4DK5A 3I3NA 3L08A 4F1SA 1H2TC 1UG3A 3L17A 3UX4A 1UN9A 5KJKA 3NQPA 1TJFA 4J8FA 3NZSA 4JVSA 3L54A 3FHEA 3G2UA 2IQCA 2Y4TA 2E0IA 4I9EA 3Q4AB 5D0OD 4ANVA 4BWRA 5BV0A 3IBEA 3O48A 1QZ2A 4IYPA 1N52A 3D3MA 3JQ0A 3S7BA 4FLBA 3OXLA 4C9BB 4AJWA 1JUQA 3FY4A 4LCTA 5G2NA 3GZ1A 3N71A 4KVOA 3IHYA 2FF4A 3CVWA 3IEGA 1DVPA 3IHVA 5E76A 3ZYMA 2VTBA 1HE8A 4GZDA 4AOFA 2LSUA 3CLJA 3FUKA 3ASDA 3BEEA 4HS2A 4XIFA 1BPOA 4MS6A 5CMYA 3UT7A 4G25A 4I2WA 4EPZA 5FQ7A 3LKUA 5BT1A 4EZJA 3CK9A 4WAFA 5BPPA 4AIFA 4B0ZA 5A7DB 4KZCA 4WNEA 4UQYA 5T3RA 3RK6A 3T5VA 3B7UX 3P1UA 5T4YA 1H6KA 1OWPA 3T8MA 1NA0A 2NSZA 3I5PA 3JUIA 2CHXA 2WQ7A 5FZRA 4IRUA 3ONKA 1JPLA 2WPVA 5KJMA 3SGHA 4HFGA 2XPIA 1HX8A 4JHJA 5ANLA 5M72A 4RG9A 3MGBA 1FCHA 3LS8A 4G1TA 3CHOA 3CV0A 3LCAA 4GZ3A 4PS8A 2Y4UA 4HORA 2AXVA 1E7VA 4G23A 3QNKA 5G05C 3FP3A 4GA2A 4B8AA 4WNFA 2RG8A 2OVBA 4EBAA 5LCWC 4P29A 4BX8A 1EPUA 3FH8A 4LEUA 3ZN3A 3MA5A 5C1DA 4GPKA 2XHEA 1E90A 2HO1A 3U3WA 2V8SE 4GYYA 3FUNA 4U0SA 4TUUA 4XI0A 3FU3A 5FT9A 4DI4A 5LCWJ 1UN8A 3FH7A 5EKQD 3FFLA 5BNWA 5E75A 3FUJA 3LPZA 1HG2A 2I9CA 2ONDA 4GZ6A 5FWQA 3FEXA 3G2WA 4BY6A 2XPYA 2XGMA 4DJAA 2LAHA 2LNIA 4KMOA 2JEKA 3QWPA 1FVHA 5CHEE 3VTYA 3LYAA 3ESLA 3MV2B 5LOZA 4UWHA 5AJDA 4G26A 4Y6WA 5BV1A 5FQ4A 3G2TA 4IULA 4N3BA 3S7FA 3UUXA 3QB2A 1Y6IA 5ANRA 5JJTA 5CMWA 5EX3A 3EDTB 3CK8A 4F3VA 2KCKA 3VTXA 1E7UA 2WXIA 1GW6A 3TG4A 4ILGA 2X6HA 5AIJA 4XKBA 4EECA 3HDXA 1WY6A 3ASFA 4CDMA 4H7XA 4GYOA 3VLDA 1X5BA 3CK7A 4L2LA 3D9JA 1Z3XA 3EIQC 4WNDA 5G04C 4HOQA 1ELWA 2WXLA 1JWGA 5J08A 3G2SA 1HXIA 2A4ZA 3VLFA 3ZPJA 1Z6TA 2V0PA 4JZYA 3FUEA 3SBTB 3E4BA 4XKCA 2IOLA 3LY8A 4I6JA 4DLOA 4WWOA 3ZGQA 4DPRA 1Z3YA 1HS6A 3B7SA 3KD7A 2IF4A 5FZQA 3CVUA 4ATGA 2NC9A 3I4RB 2V5FA 3PREA 4CEMA 4BSXA 3KS2A 4PS3A 3CR3A 3ZVVA 4EBAG 2WQHA 3RIBA 2RD0A 2DIWA 3QC1A 1KT0A 5A23A 2L6JA 2MRIA 4JEUA 5ARFA 3UT4A 2MOWA 3NF1A 1H19A 4OVUA 3SFZA 2R5SA 3TG5A 3FU6A 4JHKA 1XNFA 3FTZA 2R17C 4WWNA 4FA6A 4G24A 4MKTA 2VSOE 3LVQE 4XX5A 4JPSA 4UWLA 3G2VA 4DI3A 3UMVA 3FUMA 2FULA 2DBAA 1ZBPA 4UQZA 3CHPA 4BX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6H A;  4N5C A;  4HOS A;  2C0L A;  3S7D A;  4JHR A;  3QWW A;  4JA7 A;  2C2L A;  1B89 A;  1ELR A;  4KBQ A;  3QDN A;  5JJ7 A;  3ULQ A;  4NQ0 A;  4JA9 A;  3RO3 A;  3ASH A;  4BTB A;  1P5Q A;  4GCN A;  3MKR A;  4I17 A;  2Q7F A;  2FO7 A;  4WNG A;  3OXF A;  3AS8 A;  4KXK B;  4J0U A;  1KLX A;  4UI9 K;  4EQF A;  5HI7 A;  2QFC A;  4U04 A;  4YND A;  5FTP A;  3ZFW A;  1ZU2 A;  3CKB A;  5G05 J;  3GYZ A;  3CVQ A;  2FBN A;  2P58 C;  4N3C A;  2HYZ A;  3PDN A;  2XCC A;  4IN3 B;  2XGS A;  2FEZ A;  4N39 A;  3AS4 A;  5CCL A;  4YVO A;  3PE4 A;  3QWV A;  4J8E A;  4B94 A;  2YQ8 A;  2YHC A;  3ZHE B;  2XEV A;  3UQ3 A;  4N2Q A;  3Q15 A;  3FWV A;  4UI9 C;  4CGV A;  4GCO A;  2MHK A;  2C0M A;  3WXX A;  2KC7 A;  3MV3 B;  2PL2 A;  3URZ A;  2IFU A;  4HOU A;  3K9I A;  4UI9 J;  5FZS A;  1Y8M A;  2PZI A;  1KT1 A;  3CVL A;  5CCM A;  5HQ8 A;  2E2E A;  4HOT A;  5ARG A;  1E96 B;  4AY5 A;  2UWJ G;  2XCB A;  5BW8 C;  5G04 J;  2GW1 A;  4W9R A;  1W3B A;  3RO2 A;  5DBK A;  3MEK A;  3Q47 B;  3SZ7 A;  3Q49 B;  3Q5M A;  2VQ2 A;  3S7J A;  4BT9 A;  4YVQ C;  4GZ5 A;  3SF4 A;  5EX0 A;  4H7Y A;  5AYW D;  2VGY A;  3GZ2 A;  4CGW A;  5FJY A;  3CVN A;  1WM5 A;  5A6C A;  3HYM B;  3JYS A;  4GA1 A;  3RU0 A;  3TAX A;  2JLB A;  4U0U A;  4G2V A;  4AY6 A;  3PE3 A;  4I1A A;  3LY9 A;  3QOU A;  1IHG A;  3RJV A;  4Y6C A;  3ASG A;  2J9Q A;  4N3A A;  4AM9 A;  3ESK A;  4UQX A;  4ABN A;  1PC2 A;  2LSV A;  3GW4 A;  1YA0 A;  2VYI A;  4RG6 A;  3ZHE A;  2XGO A;  2AVP A;  3RKV A;  1TJC A;  2KAT A;  3UPV A;  4APO A;  2KCL A;  1HH8 A;  4BTA A;  2UY1 A;  4BT8 A;  3CKC A;  2KCV A;  1OUV A;  3CEQ A;  1IYG A;  2HR2 A;  4N2S A;  4JL0 A;  4A1S A;  1WAO 1;  2VSN A;  2UY1 B;  4I9C A;  5JJ6 A;  4NRH B;  3TGO A;  3KAE A;  3R9A B;  4GA0 A;  4J8D A;  2VSY A;  5DIZ A;  3U4T A;  4XI9 A;  1QQE A;  1A17 A;  2OOE A;  4ME2 A;  2FI7 A;  5D0Q D;  4I2Z A;  2PQN A;  3OXG A;  3AS5 A;  4CDR A;  1HZ4 A;  3QKY A;  3LY7 A;  2BUG A;  2VGX A;  4U0Z A;  2PQR A;  4U07 A;  4WUY A;  5KJL A;  5KJN A;  4GYW A;  1NA3 A;  3CVP A;  2VGX B;  4KYO B;  4O6F A;  1NZN A;  5KJK A;  4J8F A;  4I9E A;  2Y4T A;  5D0O D;  3Q4A B;  4BWR A;  3O48 A;  1QZ2 A;  3S7B A;  3OXL A;  3GZ1 A;  3N71 A;  2FF4 A;  3IEG A;  2LSU A;  3ASD A;  3BEE A;  4XIF A;  4G25 A;  4I2W A;  3LKU A;  5BT1 A;  3CK9 A;  4AIF A;  5A7D B;  4WNE A;  4UQY A;  1NA0 A;  5FZR A;  2WPV A;  5KJM A;  5M72 A;  2XPI A;  4RG9 A;  1FCH A;  4G1T A;  4GZ3 A;  3CV0 A;  3LCA A;  2Y4U A;  4HOR A;  4G23 A;  5G05 C;  3FP3 A;  4GA2 A;  4WNF A;  5LCW C;  4LEU A;  3ZN3 A;  3MA5 A;  5C1D A;  4GPK A;  2HO1 A;  3U3W A;  4GYY A;  4U0S A;  4XI0 A;  5FT9 A;  5LCW J;  5EKQ D;  5BNW A;  3FFL A;  3LPZ A;  2OND A;  4GZ6 A;  2XGM A;  2LNI A;  3QWP A;  5CHE E;  3VTY A;  3LYA A;  3MV2 B;  4G26 A;  4Y6W A;  4N3B A;  3S7F A;  3UUX A;  5JJT A;  5EX3 A;  3EDT B;  3CK8 A;  4F3V A;  2KCK A;  3VTX A;  3TG4 A;  3ASF A;  4H7X A;  4GYO A;  3CK7 A;  4WND A;  5G04 C;  4HOQ A;  1ELW A;  1HXI A;  3ZPJ A;  3E4B A;  3LY8 A;  3ZGQ A;  3KD7 A;  2IF4 A;  5FZQ A;  2NC9 A;  2V5F A;  3KS2 A;  2WQH A;  3RIB A;  1KT0 A;  2L6J A;  5ARF A;  3NF1 A;  2R5S A;  3TG5 A;  1XNF A;  4G24 A;  2DBA A;  1ZBP A;  4UQZ A; 
#chains in the Genus database with same CATH topology
 4UWF A;  4JA7 A;  2EQX A;  1S70 B;  4O60 A;  1YMP A;  2ZGG A;  3ZKJ A;  2KZT B;  3ULQ A;  2F8Y A;  3CHM A;  2GRP B;  4BTB A;  3FTU A;  5FQ6 A;  2WXK A;  4GCN A;  4JC8 A;  5H7P A;  2FO7 A;  4WNG A;  3NB2 A;  4ILI A;  4G8L A;  4R7L A;  4GML A;  5KBA A;  3UTM A;  4C0M A;  2QFC A;  3AU4 A;  4HVB A;  1JWF A;  5ITZ F;  2V4H C;  1OCZ E;  3QAR A;  4I43 A;  2GGF A;  3AU5 A;  2P58 C;  4N3C A;  4MLP A;  3C3Q A;  2GRL A;  1LTX A;  4HRM B;  2XCC A;  5ENP D;  2X6K A;  2FEZ A;  1E8Y A;  3UIP C;  3QWV A;  2H6H A;  2XEV A;  1INZ A;  3VLE A;  4APF A;  3FWV A;  2ILR A;  3FUH A;  1KPS B;  4CGV A;  2J4B A;  2MHK A;  3SNX A;  4A1G A;  2XQ0 A;  2P9I G;  3ULE G;  1OCO E;  2IFU A;  3FUD A;  3K9I A;  5FZS A;  2WXN A;  2OV8 A;  1HFA A;  3CVX A;  3TL5 A;  3UM0 A;  4HXI A;  1IKN D;  5CER B;  2DYS E;  5CED B;  4HOT A;  4Q94 A;  4CDN A;  4LRZ A;  3L82 A;  2GRO B;  1U3D A;  3MEK A;  2X3M A;  4TXQ A;  3Q5M A;  2YIN A;  1N9A A;  4BT9 A;  1MX6 A;  2ZGD A;  3FTW A;  5KCM A;  3L13 A;  3ONL A;  4AVX A;  3QJZ A;  4HB5 A;  2HM8 A;  1LF8 A;  4CGW A;  3CVN A;  3LDZ A;  3EHM A;  4BEP A;  1WG0 A;  4Q96 A;  3X2Q E;  3WG7 E;  4G2V A;  4AY6 A;  3PE3 A;  1MZC A;  3SBS A;  4ACL A;  3BG0 B;  4GTT A;  2VJ8 A;  3U66 A;  3MCX A;  1AWC B;  4HLE A;  3ULY A;  3EHR A;  4OVV A;  4JW1 A;  2X6F A;  3J5P A;  2A5U A;  4TRQ A;  4ABN A;  4DX1 A;  1PC2 A;  2VTB B;  3GW4 A;  3HVE B;  4XE0 A;  5CBN A;  2WM9 A;  2ZXW E;  5ENQ D;  3CQG B;  1O1T A;  2L0I A;  2XEN A;  3DEO A;  3ZYQ A;  2I2O A;  2LO6 A;  3TWR A;  3JXI A;  1IYG A;  2RFA A;  3MKQ A;  2H6I A;  2WXO A;  2CG3 A;  3APF A;  2IY0 C;  3B95 A;  2UY1 B;  1RZ4 A;  5JJ6 A;  3KAE A;  2IU1 A;  3DXK G;  1IXV A;  5B1B E;  4OAU C;  1AP7 A;  1A17 A;  3ZIM A;  1QQE A;  2IOS A;  3OTN A;  3PNT B;  3LVR E;  2J08 A;  3E33 A;  3S2A A;  2PQN A;  4DLQ A;  3OXG A;  3V2O A;  2LUH A;  2ZU6 B;  1N4P A;  3LY7 A;  3SI5 A;  5FIO A;  3ZXS A;  2PQR A;  5KJL A;  5KJN A;  4JD2 G;  4GYW A;  5JMN D;  1N0R A;  3FDH A;  1NA3 A;  3CVP A;  2WQ6 A;  2VGX B;  1H2V C;  5ENN A;  4FU3 A;  5EDS A;  4O6F A;  4DK5 A;  3I3N A;  4F1S A;  1H2T C;  1UG3 A;  1UN9 A;  2BKK B;  3L9T A;  2GRQ B;  1TJF A;  4I9E A;  4F1P A;  5BXO A;  1QZ2 A;  4IYP A;  3D3M A;  3JQ0 A;  1H6O A;  2ETB A;  1JUQ A;  5G2N A;  3IHY A;  3LJN A;  3C5R A;  2VTB A;  4U7E B;  2PNN A;  3ASD A;  2J8S D;  5CMY A;  5FIN A;  5BT1 A;  4GTQ A;  5A7D B;  4WNE A;  3T5V A;  4QQI A;  3B7U X;  1H6K A;  1V55 E;  3T8M A;  1NA0 A;  2NSZ A;  4U95 D;  2CHX A;  4IRU A;  1JPL A;  5KJM A;  3DXM G;  4HFG A;  4RG9 A;  2Y4U A;  1K8K G;  2ETA A;  4G23 A;  4B8A A;  4WNF A;  1N4R A;  5LCW C;  4P29 A;  4LEU A;  4GPK A;  2HO1 A;  3FU3 A;  1N4Q A;  3LPZ A;  4GTV A;  2XPY A;  4DJA A;  3TWQ A;  2OEV A;  4CZ2 D;  3ESL A;  3MV2 B;  3AG4 E;  5FQ4 A;  3G2T A;  3UXG A;  3NOC D;  3VTX A;  1E7U A;  5KWD A;  1GW6 A;  3TG4 A;  4ILG A;  2X6H A;  3PZ3 A;  3HDX A;  1WY6 A;  4GYO A;  3VLD A;  3CK7 A;  4HOQ A;  1ELW A;  3E4B A;  4XKC A;  1HS6 A;  4A63 B;  2NC9 A;  3I4R B;  5JA4 D;  4BSX A;  3KS2 A;  1D8D A;  3RIB A;  2RD0 A;  2DIW A;  2MRI A;  3UT4 A;  1TN7 A;  2IO3 C;  4MKT A;  3W9F A;  4HNA D;  3LVQ E;  4XX5 A;  1BD8 A;  3SQV A;  1JCR A;  4HLL A;  3UMV A;  2DBA A;  1ZBP A;  2I6H A;  4DX2 A;  1SZA A;  2C0L A;  3S7D A;  4JHR A;  2L0T B;  2CFZ A;  3TWU A;  3QDN A;  1TEZ A;  5JJ7 A;  4CT0 A;  4JA9 A;  2XS8 A;  4N5Q A;  3ZYL A;  1U2V G;  3D9M A;  3TXM A;  3ZW3 A;  4HRN A;  3UIO C;  2Q7F A;  2LAI A;  4JXT A;  4U63 A;  4J0U A;  2YHE A;  4UI9 K;  3PH0 C;  3T8K A;  3I4G A;  3QK0 A;  1YYH A;  4ILH B;  1PAQ A;  3ZFW A;  3DSX A;  1ZU2 A;  3CKB A;  1FT1 A;  3CVQ A;  5BUZ A;  4J8S A;  1HG5 A;  1MHQ A;  3PZ1 A;  3ML9 A;  2P9N G;  3BG1 B;  3R9M A;  3MX3 A;  1BLX B;  3AS4 A;  4YVO A;  1SW6 A;  4B94 A;  2YQ8 A;  1E8W A;  3Q15 A;  2WXF A;  3L22 A;  3HXE A;  3B7T A;  3LXU X;  5C2Y A;  3WXX A;  2WXG A;  4GTM A;  2BED A;  3MJW A;  2PL2 A;  3URZ A;  4HOU A;  2WMO A;  1NFI E;  1Y8M A;  2PZI A;  3B13 A;  4FHK A;  1N0Q A;  3JQ1 A;  4ANW A;  3CVL A;  5HQ8 A;  1TNY A;  4UWG A;  4ACK A;  5LP0 A;  2UWJ G;  3JCK C;  5BW8 C;  3AG3 E;  4W9R A;  5EIL A;  1W3B A;  2VGE A;  3RO2 A;  5LX8 A;  5DBK A;  3UT8 A;  3PUK A;  1O5M A;  3SZ7 A;  3PS6 A;  3TWV A;  3NAW A;  2VQ2 A;  2IO2 C;  4O1O A;  4J7W A;  4V3I A;  4YVQ C;  4G11 A;  4FLH A;  4I1O B;  2DZO A;  4CRW A;  5AYW D;  3Q75 A;  2VGY A;  4DUI A;  4XZ4 A;  5AJL A;  4JB8 P;  3CST A;  3Q9N C;  1WM5 A;  3HYM B;  3EU5 A;  2KXP C;  2BTD A;  4BFR A;  3PEU B;  3TAX A;  4U0U A;  3B7B A;  4LNG A;  3ASO E;  1SZ9 A;  3LY9 A;  4RSY A;  3RJV A;  3O4Z A;  3ASG A;  4F53 A;  5KNG A;  2J9Q A;  2X6I A;  4E6H A;  1DC2 A;  1UJK A;  3TXN A;  2NXP A;  3U9W A;  1TNO A;  5HS0 A;  3APC A;  2VYI A;  4X8Q A;  1N95 A;  2DCP A;  2PM7 A;  1OCR E;  1K1B A;  1MYO A;  2P9P G;  2AVP A;  1TJC A;  3UPV A;  4L7T A;  2WXH A;  4APO A;  4HQD A;  1DNP A;  1OCC E;  3FUF A;  4UWK A;  1HH8 A;  4PDX A;  3CEQ A;  4PH4 B;  5ENR D;  2ZIS A;  2QY7 A;  4JL0 A;  4M7C A;  4A1S A;  2AW6 A;  3FUL A;  2F0Y A;  4I1M A;  3R9A B;  4F7A A;  3MKQ B;  2VSY A;  3JUE A;  1NL4 A;  3TWS A;  2WVI A;  4ME2 A;  3CHQ A;  2FI7 A;  3UKU G;  5D0Q D;  2I1K A;  4YDY A;  2ION A;  3RRM B;  2Y1L E;  3PVL A;  1L5J A;  3QKY A;  4NUR A;  5T8I A;  3FTV A;  2AXZ A;  1BU9 A;  4LG6 A;  3CSF A;  3SD5 A;  3LEW A;  1H0A A;  1NZN A;  4GTR A;  2KBX A;  3L08 A;  3UX4 A;  3W9G A;  5EIB E;  3NQP A;  4TUM A;  3SFY A;  3G2U A;  5D0O D;  3Q4A B;  1N52 A;  3HRA A;  3Q9U C;  4FLB A;  2B6C A;  3OXL A;  2XZD G;  2AJA A;  4AJW A;  2R05 A;  3FY4 A;  3UM2 A;  3N71 A;  2FF4 A;  5E76 A;  1DVP A;  3ZYM A;  1HE8 A;  3NBN B;  3BEE A;  3J5Q B;  4XIF A;  4G25 A;  5FQ7 A;  3LKU A;  2BKG A;  2H6F A;  4AIF A;  5T3R A;  5T4Y A;  2WPV A;  3SGH A;  2XPI A;  1HX8 A;  4G1T A;  1N11 A;  3SO8 A;  4C48 B;  4EBA A;  4BX8 A;  3MA5 A;  3U3W A;  4TUU A;  4DI4 A;  5LCW J;  3FH7 A;  3FFL A;  5E75 A;  2OND A;  2OEW A;  3FEX A;  4BY6 A;  1BI8 B;  2LAH A;  2LNI A;  3E30 A;  3LYA A;  5AJD A;  4HRL A;  4Y6W A;  2QZA A;  4N3B A;  5JJT A;  5ANR A;  3KSL A;  5CMW A;  5ENT D;  5AQB A;  5HKP A;  5EYL A;  2KCK A;  1MJ0 A;  4CDM A;  3KSQ A;  4MBG A;  4L2L A;  3D9J A;  1Z3X A;  2WXL A;  3ABM E;  5J08 A;  3BU8 A;  1HXI A;  1Z6T A;  4I6J A;  3ASN E;  3ZGQ A;  1Z3Y A;  1N4S A;  4ATG A;  2V5F A;  3ZVV A;  4EBA G;  3NOG D;  5A23 A;  2MOW A;  3NF1 A;  3SFZ A;  3TG5 A;  4DRX E;  3TWW A;  1XNF A;  4FA6 A;  4UWL A;  3KEA A;  2FUL A;  2OCC E;  3V31 A;  4BX9 A;  4L2Y A;  4N5C A;  1S0P A;  1UOH A;  2CHW A;  3D9O A;  4XEI G;  1B89 A;  1ELR A;  4KZ0 A;  2XEH A;  4FC8 A;  4GB9 A;  3B7R L;  5EN5 D;  3RO3 A;  3RRN B;  1Z5S C;  3RRU A;  3HHM A;  3DST A;  1P5Q A;  3P2B A;  4I17 A;  4HBD A;  3ZUV B;  3FU5 A;  4CT4 A;  3Q79 A;  5HI7 A;  1SVX A;  5AEN A;  2P9S G;  4A3T A;  5B3S E;  5G05 J;  3GYZ A;  4AEZ C;  3D9H A;  3DSW A;  1UW4 B;  3ML8 A;  2OVF A;  4GTO A;  4RVB A;  1OXJ A;  3PDN A;  1K3Z D;  3D9P A;  3DPY A;  3R7R A;  1DCQ A;  4IN3 B;  2XGS A;  2KM4 A;  1HU3 A;  4FHJ A;  3CVY A;  5CCL A;  3PE4 A;  3DEP A;  1TNB A;  3U64 A;  4TV3 A;  2B0O E;  4UI9 C;  3MYV A;  4GCO A;  4L1B A;  1UJJ A;  4TXP A;  3MV3 B;  2F37 A;  3HXD A;  3HG0 D;  4C0E A;  5HRY A;  5AAR A;  3UM3 A;  4AV7 A;  3NZU A;  5ARG A;  3MZL B;  1E96 B;  4AY5 A;  2XCB A;  3DBS A;  5G04 J;  2GW1 A;  2DYR E;  4LNU D;  1TR4 A;  4BET A;  4FJZ A;  4I6G A;  4MRU A;  4GMJ A;  4A3V A;  3CGH A;  3KEZ A;  3C3O A;  1OWM A;  3RSE G;  1ZB1 A;  3FTY A;  3PZ4 A;  4I6E A;  2WXQ A;  5A6C A;  5JHB A;  2X6J A;  4D10 C;  5JHA A;  3JYS A;  3HIZ A;  4GTS A;  5EID A;  3FEY A;  4DX5 D;  4I1A A;  1N54 A;  1IHG A;  4QFV A;  5BXU A;  4L23 A;  3HXC A;  5ENO D;  2Y0B G;  3D9L A;  4AP2 A;  1VDY A;  4N3A A;  4PS7 A;  1TNU A;  2WXM A;  1QYM A;  4OYS A;  4UQX A;  2LSV A;  2AXU A;  1YA0 A;  1HO8 A;  1SA5 A;  2A5E A;  4ANU A;  2NYJ A;  3RKV A;  4YDW A;  2WXJ A;  3PUJ A;  5AN8 A;  2KCL A;  1LD7 A;  1YCS B;  2GRM A;  3R7Q A;  2BF0 X;  4BT8 A;  3JXJ A;  4BSZ B;  1OUV A;  2HR2 A;  4N2S A;  3EJN A;  3ISM C;  1S63 A;  3CVV A;  2DWZ A;  1WAO 1;  3V79 K;  1H6P A;  4NRH B;  4GA0 A;  1E8Z A;  1MX2 A;  1NI1 A;  4J8D A;  1NP7 A;  4B89 A;  2EIL E;  2R03 A;  3IV0 A;  3U4T A;  4EZK A;  4FUL A;  4KVM A;  2YNQ A;  4YDE A;  4I2Z A;  1H2U A;  2XS1 A;  1O1R A;  3AS5 A;  3ZEF A;  4CDR A;  2CHZ A;  3PZ2 A;  2BUG A;  4U0Z A;  4RQI A;  3ZNG A;  3HXF A;  3UIN C;  4U07 A;  1K1A A;  4GZC A;  4EZL A;  2XZT G;  4K0R A;  4LNB A;  2WB2 A;  4CCA A;  4GPM A;  3NZS A;  4JVS A;  2Y4T A;  1D9S A;  4BWR A;  3S7B A;  4J8Y A;  5B1A E;  4LCT A;  3IEG A;  3IHV A;  4AOF A;  2ETC A;  4MS6 A;  4EZJ A;  3CK9 A;  1S64 A;  4WAF A;  4B0Z A;  4UQY A;  3P1U A;  1OWP A;  4U96 D;  3I5P A;  3JUI A;  4F6R D;  5M72 A;  5ANL A;  1FCH A;  4GZ3 A;  3CV0 A;  3Q73 A;  4HOR A;  2AXV A;  2IEJ A;  2QC9 A;  3QNK A;  3FP3 A;  1KZO A;  4GA2 A;  2RG8 A;  2OVB A;  2ZIR A;  1E90 A;  2V8S E;  1N94 A;  4GYY A;  4U0S A;  2HE0 A;  1X81 A;  5FT9 A;  1QBQ A;  1UN8 A;  5EKQ D;  5BNW A;  3FUJ A;  1HG2 A;  2R2L A;  5D2M C;  4KMO A;  4L9P A;  2JEK A;  3QWP A;  2MYO A;  5CHE E;  3VTY A;  5LOZ A;  4UWH A;  4G26 A;  4IUL A;  3E34 A;  3S7F A;  2L6B A;  3UUX A;  5EX3 A;  3CK8 A;  4F3V A;  5AIJ A;  3BUA A;  4EHM A;  4EEC A;  4RLY A;  3EHQ A;  4H7X A;  1X5B A;  2LXM A;  3EU9 A;  1JWG A;  2A4Z A;  1V54 E;  4JZY A;  3FUE A;  3SBT B;  2IOL A;  4WWO A;  1FPP A;  3B7S A;  3CVU A;  1WDY A;  5CRU A;  4CEM A;  3PRE A;  1O1S A;  4PS3 A;  3CR3 A;  5ARF A;  1H19 A;  2R5S A;  3FU6 A;  4JHK A;  3FTZ A;  4WWN A;  2R17 C;  2VSO E;  5CEC B;  4DI3 A;  4ZFH A;  3CHP A;  1TYQ G;  2KZT A;  2I1J A;  4HOS A;  2X38 A;  4GMR A;  3QWW A;  3FU0 A;  2C2L A;  3PEV B;  3L6A A;  4KBQ A;  2PM6 A;  4BER A;  3E37 A;  3V30 A;  4NQ0 A;  3ZU7 B;  2V5Q C;  3ASH A;  2Y69 E;  1QNF A;  3MKR A;  3ZYK A;  1EYH A;  3OXF A;  3PZD A;  3AS8 A;  4KXK B;  2CG2 A;  1KLX A;  3RAU A;  4EQF A;  5AAO A;  2XRY A;  4U04 A;  4YND A;  5EYP F;  1OY3 D;  5LFA A;  2QYU A;  1FVF A;  5FTP A;  2J49 A;  3PRZ A;  3FTS A;  2FBN A;  1MX4 A;  4NIK A;  3EUV A;  2HYZ A;  4LSZ E;  2WMN A;  2RKK A;  4DX6 D;  4KT6 B;  3F6Q A;  4U8Y D;  3TJP A;  4N39 A;  4AXH A;  1U3C A;  2WXR A;  4J8E A;  2J4D A;  2YHC A;  3ZHE B;  3UQ3 A;  4N2Q A;  1DCE A;  1JCS A;  1ELK A;  4ZHB A;  1Q2Z A;  2C0M A;  2KC7 A;  1G3N B;  4GAA A;  2L9B A;  3Q7A A;  4UI9 J;  1TNZ A;  2IJG X;  3V2X A;  1KT1 A;  2WXP A;  5CCM A;  2XPZ A;  1IHB A;  5IY5 E;  4M3O A;  1E8X A;  3ZXP A;  4Z68 A;  2E2E A;  4E85 A;  2VSX E;  4B8C B;  1EDU A;  4PUC A;  1LD8 A;  3EHN A;  2CFU A;  5AQ9 A;  3Q47 B;  3D9N A;  3Q49 B;  2AWI A;  3EIJ A;  1SQM A;  3C98 A;  3S7J A;  4GU5 A;  3BQO A;  4BES A;  4GZ5 A;  2H6G A;  3SF4 A;  3T5X A;  5EX0 A;  4A55 A;  3CHR A;  4DX7 D;  4H7Y A;  1IQR A;  3CQC B;  4O1P A;  1IQU A;  3GZ2 A;  5ENS D;  3DSS A;  2F8X K;  3IXE A;  4FJY A;  5FJY A;  4JEH A;  4FAD A;  1A5E A;  5FQ8 A;  5J90 A;  2Y3A A;  4GA1 A;  3LJ3 A;  3D9K A;  4WWP A;  3RU0 A;  4Q69 A;  3APD A;  2JLB A;  2R59 A;  3ABK E;  3QOU A;  3PNL B;  1EF1 C;  1HF8 A;  3GZS A;  4Y6C A;  5G55 A;  1RW2 A;  5KNH D;  3QAQ A;  3AAA C;  3HVE A;  3L16 A;  3E32 A;  3AG1 E;  4AM9 A;  3SHF A;  3ESK A;  4U8H A;  1OWL A;  3UM1 A;  3T9K A;  1FT2 A;  1PY1 A;  1MQS A;  2J07 A;  3OAW A;  2GRR B;  4RG6 A;  3ZHE A;  2EIJ E;  2XRZ A;  2XGO A;  3ZRH A;  2KAT A;  3D9I A;  2DZN A;  4U8V D;  1OWN A;  4BTA A;  2UY1 A;  4J6I A;  3CKC A;  5CEA A;  2KCV A;  4HI8 A;  4ANX A;  2P9L G;  4K5B A;  3DPD A;  4FP7 A;  5AQA A;  2J09 A;  2VSN A;  4I9C A;  4K5A B;  4K03 A;  3FTX A;  3TGO A;  4OAV B;  5DIZ A;  1TN6 A;  3CHS A;  4XI9 A;  2OOE A;  3FH5 A;  3IKO B;  2LXL A;  3ENE A;  3CIA A;  3FUI A;  4LER A;  2JAB A;  2P9K G;  4ATZ D;  1HZ4 A;  3TWT A;  2VGX A;  4NAC A;  3Q7F A;  3UI2 A;  4URK A;  1JCQ A;  1OWO A;  2XEE A;  4WUY A;  2V4L A;  1XGW A;  3AG2 E;  2M63 A;  4LUN U;  4KYO B;  2QYJ A;  3L17 A;  3ABL E;  5KJK A;  4J8F A;  4TXR A;  3L54 A;  3FHE A;  4ANV A;  2IQC A;  5BV0 A;  2E0I A;  3IBE A;  3O48 A;  4C9B B;  2EIN E;  3SFX A;  2EIK E;  3GZ1 A;  4KVO A;  2FO1 E;  3C72 A;  3CVW A;  4GZD A;  2LSU A;  3CLJ A;  3FUK A;  3C3R A;  4HI9 A;  4HS2 A;  1BPO A;  3UT7 A;  4EPZ A;  4I2W A;  2GRN B;  3TWX A;  1KZP A;  5BPP A;  4KZC A;  3RK6 A;  4GTP A;  2R02 A;  2WQ7 A;  3DRA A;  5FZR A;  3ONK A;  3DSV A;  4JHJ A;  1SA4 A;  3MGB A;  3LS8 A;  3CHO A;  3LCA A;  4PS8 A;  4CYM D;  1E7V A;  5G05 C;  1EPU A;  3FH8 A;  3DSU A;  3ZN3 A;  5CBO A;  5C1D A;  2XHE A;  3AJI A;  3FUN A;  3Q78 A;  4XI0 A;  2P9U G;  3HXB A;  4B93 B;  2I9C A;  4GZ6 A;  5FWQ A;  3G2W A;  2XGM A;  3UKR G;  1FVH A;  4K5C A;  5BV1 A;  3SY2 A;  3QB2 A;  1Y6I A;  5D66 A;  1OT8 A;  3EDT B;  1D8E A;  2WXI A;  4XKB A;  2DVW A;  4UUC A;  3ASF A;  3EIQ C;  4WND A;  5G04 C;  4YDO A;  1BI7 B;  3G2S A;  3VLF A;  3ZPJ A;  2V0P A;  2RFM A;  1TN8 A;  3LY8 A;  4DLO A;  5AQ7 A;  4DPR A;  3KD7 A;  2IF4 A;  5FZQ A;  3DWL G;  2WQH A;  3QC1 A;  1KT0 A;  2L6J A;  4JEU A;  2P2C P;  4OVU A;  4G8K A;  4G24 A;  4JPS A;  3G2V A;  3FUM A;  5CRV A;  4UQZ A;  2EIM E; 
#chains in the Genus database with same CATH homology
 2KZT A;  5LP0 A;  2I6H A;  2I1J A;  4L2Y A;  4N5C A;  4HOS A;  1SZA A;  2C0L A;  2X38 A;  1S0P A;  3S7D A;  4JHR A;  2CHW A;  3D9O A;  3QWW A;  2L0T B;  4UWF A;  4JA7 A;  2EQX A;  3FU0 A;  2C2L A;  2CFZ A;  1B89 A;  3PEV B;  3L6A A;  1ELR A;  4KZ0 A;  4KBQ A;  2PM6 A;  3QDN A;  4FC8 A;  4GB9 A;  1TEZ A;  2KZT B;  3B7R L;  4NQ0 A;  3ULQ A;  4CT0 A;  5JJ7 A;  4JA9 A;  3RO3 A;  3RRN B;  3RRU A;  3CHM A;  3HHM A;  3ZYL A;  3D9M A;  3TXM A;  3ASH A;  4BTB A;  1P5Q A;  3FTU A;  5FQ6 A;  3P2B A;  3ZW3 A;  2WXK A;  4GCN A;  1QNF A;  3MKR A;  3ZYK A;  1EYH A;  4JC8 A;  4I17 A;  2Q7F A;  2FO7 A;  4WNG A;  3OXF A;  3PZD A;  3AS8 A;  4ILI A;  4KXK B;  2LAI A;  4JXT A;  4U63 A;  4R7L A;  3FU5 A;  4GML A;  2CG2 A;  4J0U A;  4CT4 A;  2YHE A;  1KLX A;  4UI9 K;  4C0M A;  4EQF A;  5HI7 A;  2XRY A;  3PH0 C;  2QFC A;  4U04 A;  4YND A;  3AU4 A;  5AEN A;  5LFA A;  3I4G A;  4HVB A;  4A3T A;  3QK0 A;  1JWF A;  1FVF A;  5FTP A;  2J49 A;  4ILH B;  1PAQ A;  3ZFW A;  3PRZ A;  3QAR A;  1ZU2 A;  4I43 A;  2GGF A;  3CKB A;  5G05 J;  3AU5 A;  3GYZ A;  3FTS A;  3CVQ A;  4AEZ C;  2FBN A;  2P58 C;  5BUZ A;  4J8S A;  1UW4 B;  1HG5 A;  2OVF A;  3ML8 A;  4RVB A;  4N3C A;  2HYZ A;  3PDN A;  4MLP A;  2GRL A;  1MHQ A;  2WMN A;  3R7R A;  3D9P A;  3ML9 A;  4KT6 B;  3BG1 B;  2XCC A;  4IN3 B;  2XGS A;  2KM4 A;  2X6K A;  3MX3 A;  1HU3 A;  4FHJ A;  3TJP A;  3CVY A;  2FEZ A;  4N39 A;  1E8Y A;  4AXH A;  3AS4 A;  5CCL A;  4YVO A;  1U3C A;  3PE4 A;  2WXR A;  3QWV A;  4J8E A;  2J4D A;  4B94 A;  2YQ8 A;  2YHC A;  3ZHE B;  2XEV A;  3U64 A;  4TV3 A;  3UQ3 A;  4N2Q A;  1INZ A;  3VLE A;  1ELK A;  1E8W A;  3Q15 A;  4APF A;  2WXF A;  3L22 A;  3FWV A;  4UI9 C;  2ILR A;  3B7T A;  3FUH A;  3LXU X;  5C2Y A;  3MYV A;  2J4B A;  4GCO A;  2MHK A;  4L1B A;  4CGV A;  2C0M A;  1UJJ A;  3WXX A;  2WXG A;  2KC7 A;  3SNX A;  3MV3 B;  4A1G A;  2XQ0 A;  3MJW A;  2PL2 A;  3URZ A;  2IFU A;  4GAA A;  2L9B A;  3FUD A;  3K9I A;  4HOU A;  4UI9 J;  2WMO A;  5FZS A;  2WXN A;  2IJG X;  1Y8M A;  2OV8 A;  2PZI A;  1HFA A;  3B13 A;  4FHK A;  1KT1 A;  3TL5 A;  3CVX A;  2WXP A;  3JQ1 A;  4ANW A;  3CVL A;  4C0E A;  5CCM A;  2XPZ A;  4HXI A;  5HQ8 A;  4M3O A;  1E8X A;  4AV7 A;  2E2E A;  3NZU A;  4E85 A;  4UWG A;  4HOT A;  5ARG A;  3MZL B;  4ACK A;  1E96 B;  4AY5 A;  2UWJ G;  2XCB A;  3JCK C;  2VSX E;  3DBS A;  4Q94 A;  5G04 J;  4LRZ A;  5BW8 C;  2GW1 A;  1EDU A;  4B8C B;  4W9R A;  4PUC A;  4CDN A;  1W3B A;  1U3D A;  3RO2 A;  5LX8 A;  5DBK A;  3EHN A;  2CFU A;  3MEK A;  3PUK A;  3UT8 A;  3Q47 B;  4FJZ A;  4I6G A;  3D9N A;  3SZ7 A;  3PS6 A;  2X3M A;  4MRU A;  3Q49 B;  2YIN A;  3Q5M A;  2AWI A;  3EIJ A;  2VQ2 A;  1SQM A;  4GMJ A;  3C98 A;  3S7J A;  4GU5 A;  4BT9 A;  3FTW A;  4V3I A;  4YVQ C;  5KCM A;  4GZ5 A;  4A3V A;  3L13 A;  3CGH A;  4G11 A;  4FLH A;  3SF4 A;  3KEZ A;  4I1O B;  4CRW A;  3T5X A;  5EX0 A;  1OWM A;  3ONL A;  4A55 A;  3CHR A;  4H7Y A;  5AYW D;  4AVX A;  1IQR A;  3QJZ A;  3CQC B;  2VGY A;  3FTY A;  4I6E A;  1IQU A;  4XZ4 A;  5AJL A;  3GZ2 A;  2WXQ A;  3ZIM A;  2HM8 A;  3CST A;  1LF8 A;  4FJY A;  4CGW A;  5FJY A;  3CVN A;  1WM5 A;  4JEH A;  4FAD A;  3HYM B;  5A6C A;  5JHB A;  2X6J A;  3LDZ A;  4D10 C;  3EHM A;  5JHA A;  5FQ8 A;  5J90 A;  3JYS A;  2Y3A A;  4GA1 A;  3LJ3 A;  3HIZ A;  3D9K A;  2BTD A;  4BFR A;  4Q96 A;  4WWP A;  3RU0 A;  4Q69 A;  3APD A;  3PEU B;  3TAX A;  2JLB A;  2R59 A;  4U0U A;  3FEY A;  4G2V A;  4AY6 A;  3PE3 A;  4I1A A;  1SZ9 A;  3LY9 A;  4RSY A;  3SBS A;  1N54 A;  3QOU A;  3BG0 B;  4ACL A;  3PNL B;  1IHG A;  1EF1 C;  4QFV A;  1HF8 A;  3GZS A;  4L23 A;  3RJV A;  2VJ8 A;  3O4Z A;  4Y6C A;  3D9L A;  3ASG A;  5G55 A;  4F53 A;  3U66 A;  4AP2 A;  3MCX A;  3QAQ A;  1VDY A;  2J9Q A;  2X6I A;  3HVE A;  4N3A A;  4PS7 A;  4HLE A;  3L16 A;  2WXM A;  4E6H A;  4OVV A;  4AM9 A;  4JW1 A;  2X6F A;  3SHF A;  3ESK A;  2A5U A;  4OYS A;  4U8H A;  4UQX A;  1UJK A;  3TXN A;  1OWL A;  2NXP A;  4TRQ A;  3U9W A;  4ABN A;  3APC A;  1PC2 A;  2VTB B;  2LSV A;  1PY1 A;  1MQS A;  2AXU A;  2J07 A;  3GW4 A;  3HVE B;  1YA0 A;  2VYI A;  2DCP A;  2PM7 A;  4XE0 A;  3OAW A;  4RG6 A;  3ZHE A;  1HO8 A;  2WM9 A;  2XRZ A;  2XGO A;  3ZRH A;  3CQG B;  4ANU A;  2AVP A;  3RKV A;  1TJC A;  2KAT A;  3D9I A;  3UPV A;  2L0I A;  4L7T A;  2WXH A;  4APO A;  2WXJ A;  3PUJ A;  1DNP A;  2KCL A;  3ZYQ A;  3FUF A;  4UWK A;  1OWN A;  2I2O A;  1HH8 A;  2GRM A;  3R7Q A;  4BTA A;  2BF0 X;  2UY1 A;  4BT8 A;  2LO6 A;  4J6I A;  3CKC A;  2KCV A;  4ANX A;  1OUV A;  4PDX A;  3CEQ A;  4PH4 B;  1IYG A;  3MKQ A;  2HR2 A;  4N2S A;  2WXO A;  2CG3 A;  3DPD A;  3EJN A;  2QY7 A;  4JL0 A;  4FP7 A;  3CVV A;  3APF A;  4A1S A;  1WAO 1;  2J09 A;  2VSN A;  2UY1 B;  2AW6 A;  4I9C A;  4K03 A;  3FTX A;  5JJ6 A;  3FUL A;  4NRH B;  3TGO A;  3KAE A;  4I1M A;  3R9A B;  2IU1 A;  4GA0 A;  1E8Z A;  4J8D A;  4F7A A;  3MKQ B;  1NP7 A;  2VSY A;  4B89 A;  5DIZ A;  3IV0 A;  3CHS A;  3U4T A;  4XI9 A;  4EZK A;  1QQE A;  1A17 A;  2IOS A;  2WVI A;  2OOE A;  3OTN A;  3PNT B;  4FUL A;  3FH5 A;  4ME2 A;  3CHQ A;  3IKO B;  2FI7 A;  2J08 A;  2YNQ A;  3LVR E;  4KVM A;  5D0Q D;  3S2A A;  4I2Z A;  3ENE A;  2I1K A;  2PQN A;  3CIA A;  3RRM B;  2ION A;  3FUI A;  4DLQ A;  1H2U A;  3OXG A;  3AS5 A;  4LER A;  3ZEF A;  4CDR A;  2ZU6 B;  2CHZ A;  3PVL A;  1L5J A;  1HZ4 A;  3QKY A;  3LY7 A;  3SI5 A;  4NUR A;  2BUG A;  2VGX A;  4U0Z A;  4NAC A;  3ZXS A;  2PQR A;  5T8I A;  3FTV A;  2AXZ A;  4U07 A;  4URK A;  1OWO A;  4WUY A;  5KJL A;  5KJN A;  2V4L A;  1XGW A;  2M63 A;  4LUN U;  3CSF A;  4GZC A;  3SD5 A;  4EZL A;  4GYW A;  4K0R A;  3FDH A;  1NA3 A;  3LEW A;  3CVP A;  2WQ6 A;  2WB2 A;  2VGX B;  4CCA A;  1H2V C;  5ENN A;  4FU3 A;  5EDS A;  1H0A A;  4KYO B;  4O6F A;  1NZN A;  4DK5 A;  3I3N A;  3L08 A;  4F1S A;  1H2T C;  1UG3 A;  3L17 A;  3UX4 A;  1UN9 A;  5KJK A;  3NQP A;  1TJF A;  4J8F A;  3NZS A;  4JVS A;  3L54 A;  3FHE A;  3G2U A;  2IQC A;  2Y4T A;  2E0I A;  4I9E A;  3Q4A B;  5D0O D;  4ANV A;  4BWR A;  5BV0 A;  3IBE A;  3O48 A;  1QZ2 A;  4IYP A;  1N52 A;  3D3M A;  3JQ0 A;  3S7B A;  4FLB A;  3OXL A;  4C9B B;  4AJW A;  1JUQ A;  3FY4 A;  4LCT A;  5G2N A;  3GZ1 A;  3N71 A;  4KVO A;  3IHY A;  2FF4 A;  3CVW A;  3IEG A;  1DVP A;  3IHV A;  5E76 A;  3ZYM A;  2VTB A;  1HE8 A;  4GZD A;  4AOF A;  2LSU A;  3CLJ A;  3FUK A;  3ASD A;  3BEE A;  4HS2 A;  4XIF A;  1BPO A;  4MS6 A;  5CMY A;  3UT7 A;  4G25 A;  4I2W A;  4EPZ A;  5FQ7 A;  3LKU A;  5BT1 A;  4EZJ A;  3CK9 A;  4WAF A;  5BPP A;  4AIF A;  4B0Z A;  5A7D B;  4KZC A;  4WNE A;  4UQY A;  5T3R A;  3RK6 A;  3T5V A;  3B7U X;  3P1U A;  5T4Y A;  1H6K A;  1OWP A;  3T8M A;  1NA0 A;  2NSZ A;  3I5P A;  3JUI A;  2CHX A;  2WQ7 A;  5FZR A;  4IRU A;  3ONK A;  1JPL A;  2WPV A;  5KJM A;  3SGH A;  4HFG A;  2XPI A;  1HX8 A;  4JHJ A;  5ANL A;  5M72 A;  4RG9 A;  3MGB A;  1FCH A;  3LS8 A;  4G1T A;  3CHO A;  3CV0 A;  3LCA A;  4GZ3 A;  4PS8 A;  2Y4U A;  4HOR A;  2AXV A;  1E7V A;  4G23 A;  3QNK A;  5G05 C;  3FP3 A;  4GA2 A;  4B8A A;  4WNF A;  2RG8 A;  2OVB A;  4EBA A;  5LCW C;  4P29 A;  4BX8 A;  1EPU A;  3FH8 A;  4LEU A;  3ZN3 A;  3MA5 A;  5C1D A;  4GPK A;  2XHE A;  1E90 A;  2HO1 A;  3U3W A;  2V8S E;  4GYY A;  3FUN A;  4U0S A;  4TUU A;  4XI0 A;  3FU3 A;  5FT9 A;  4DI4 A;  5LCW J;  1UN8 A;  3FH7 A;  5EKQ D;  3FFL A;  5BNW A;  5E75 A;  3FUJ A;  3LPZ A;  1HG2 A;  2I9C A;  2OND A;  4GZ6 A;  5FWQ A;  3FEX A;  3G2W A;  4BY6 A;  2XPY A;  2XGM A;  4DJA A;  2LAH A;  2LNI A;  4KMO A;  2JEK A;  3QWP A;  1FVH A;  5CHE E;  3VTY A;  3LYA A;  3ESL A;  3MV2 B;  5LOZ A;  4UWH A;  5AJD A;  4G26 A;  4Y6W A;  5BV1 A;  5FQ4 A;  3G2T A;  4IUL A;  4N3B A;  3S7F A;  3UUX A;  3QB2 A;  1Y6I A;  5ANR A;  5JJT A;  5CMW A;  5EX3 A;  3EDT B;  3CK8 A;  4F3V A;  2KCK A;  3VTX A;  1E7U A;  2WXI A;  1GW6 A;  3TG4 A;  4ILG A;  2X6H A;  5AIJ A;  4XKB A;  4EEC A;  3HDX A;  1WY6 A;  3ASF A;  4CDM A;  4H7X A;  4GYO A;  3VLD A;  1X5B A;  3CK7 A;  4L2L A;  3D9J A;  1Z3X A;  3EIQ C;  4WND A;  5G04 C;  4HOQ A;  1ELW A;  2WXL A;  1JWG A;  5J08 A;  3G2S A;  1HXI A;  2A4Z A;  3VLF A;  3ZPJ A;  1Z6T A;  2V0P A;  4JZY A;  3FUE A;  3SBT B;  3E4B A;  4XKC A;  2IOL A;  3LY8 A;  4I6J A;  4DLO A;  4WWO A;  3ZGQ A;  4DPR A;  1Z3Y A;  1HS6 A;  3B7S A;  3KD7 A;  2IF4 A;  5FZQ A;  3CVU A;  4ATG A;  2NC9 A;  3I4R B;  2V5F A;  3PRE A;  4CEM A;  4BSX A;  3KS2 A;  4PS3 A;  3CR3 A;  3ZVV A;  4EBA G;  2WQH A;  3RIB A;  2RD0 A;  2DIW A;  3QC1 A;  1KT0 A;  5A23 A;  2L6J A;  2MRI A;  4JEU A;  5ARF A;  3UT4 A;  2MOW A;  3NF1 A;  1H19 A;  4OVU A;  3SFZ A;  2R5S A;  3TG5 A;  3FU6 A;  4JHK A;  1XNF A;  3FTZ A;  2R17 C;  4WWN A;  4FA6 A;  4G24 A;  4MKT A;  2VSO E;  3LVQ E;  4XX5 A;  4JPS A;  4UWL A;  3G2V A;  4DI3 A;  3UMV A;  3FUM A;  2FUL A;  2DBA A;  1ZBP A;  4UQZ A;  3CHP A;  4BX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...