5CRVA

Crystal structure of the bro domain of hd-ptp in a complex with the core region of stam2
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
361
structure length
357
Chain Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKAPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
publication title Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 142
structure length 357
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 5crvA00
3UM1A 3UM0A 2OEVA 3UM3A 3ZXPA 2R02A 3C3QA 3RAUA 1ZB1A 3R9MA 2XS1A 5CRUA 2XS8A 2OEWA 5CRVA 3C3RA 2R03A 3ULYA 3UM2A 3C3OA 2R05A
chains in the Genus database with same CATH superfamily
1D8EA 2Y3AA 3J5PA 2VQ2A 4EBAA 3KAEA 3OXLA 3BEEA 5EX3A 2EIKE 5HS0A 2PQRA 4BX8A 2A5EA 3LY9A 4NQ0A 3D9JA 3U64A 1IKND 4I1MA 4L23A 3JXIA 1MYOA 3DEOA 1FVFA 3UX4A 4DLQA 1E8WA 3TWUA 2QY7A 2VJ8A 4C9BB 3EDTB 3HXFA 2YQ8A 5ENPD 5E76A 2J4DA 4JA7A 5FQ7A 3HXCA 1QYMA 3G2VA 4JHRA 5ITZF 1N9AA 4KT6B 3QWPA 4I17A 3D9IA 5KJKA 1TN6A 4BTAA 2CHWA 4DX1A 4CCAA 2XCBA 2I1KA 1WY6A 3HIZA 3QOUA 4FHJA 4AP2A 4EZLA 3IKOB 2IY0C 2ZGDA 4XIFA 4IRUA 2J49A 4F6RD 3CVNA 3UI2A 3FU3A 4TUMA 3CK7A 2ETCA 3Q4AB 3Q47B 4I9EA 3LEWA 3PEVB 2WXJA 3PH0C 1HO8A 3APFA 1OCRE 3UM1A 5EIBE 4UI9K 2VSYA 4X8QA 2Y69E 2GRPB 2VTBA 3AG1E 4Y6CA 3QWWA 3ASHA 3ZUVB 1P5QA 1SVXA 3Q9NC 3NZUA 4GMJA 5AARA 5KNGA 4LERA 4K03A 3TWRA 3S2AA 3UMVA 4G11A 4LRZA 1D9SA 1LD7A 3PRZA 3QAQA 3G2TA 3LJ3A 3AG3E 3JCKC 4R7LA 1OCCE 5B1BE 4RQIA 2AXUA 2IFUA 2GRMA 4LG6A 1N11A 1O1SA 2Y0BG 1BLXB 3HYMB 3G2UA 4DX6D 1MQSA 3U3WA 2X3MA 4FU3A 3MKQA 3HXDA 4M7CA 1EYHA 2X6IA 1LD8A 3SHFA 3ZHEA 2LXLA 5J90A 3ZU7B 5LCWJ 1X81A 5ENOD 4GA0A 2ETBA 4K5CA 1DNPA 5AQBA 2WXQA 1YCSB 4ANXA 1HX8A 3PZ2A 3R7RA 5D2MC 3ZEFA 3MYVA 4E85A 4O1PA 1V54E 3N71A 4HRLA 5CMWA 2XRZA 2HM8A 2BTDA 2YNQA 2I1JA 5FT9A 4UUCA 1LTXA 4I2ZA 2CG3A 4GA1A 1H2VC 4TXQA 4ABNA 4MRUA 3Q79A 2L0TB 4TXRA 1IQUA 2FBNA 5DIZA 3ZW3A 1QBQA 4JXTA 4KVOA 2DZOA 5ANLA 1TEZA 3Q78A 4KYOB 1HG2A 1N52A 2CFZA 1N4RA 4XZ4A 3WG7E 1MHQA 2C0LA 2QC9A 2WXNA 3RU0A 4Q96A 1U3CA 3QWVA 4FJYA 4DRXE 5CERB 2FI7A 2FF4A 4N2SA 3SY2A 3DSVA 3UKUG 1NFIE 1OWOA 5FTPA 2V4LA 4FLHA 4ZFHA 2H6FA 1IQRA 1ZU2A 3IHVA 4UQXA 1HU3A 4B94A 3BG1B 4U8HA 3D9PA 1N94A 2QZAA 3L13A 3RO2A 3C5RA 1FPPA 1EDUA 4MBGA 3P1UA 3CVVA 4N3AA 3FTXA 1JUQA 5AQ9A 2XZDG 3CV0A 3KD7A 4GTTA 3JUIA 4AM9A 4I6GA 5ARFA 3K9IA 1KZPA 3RRMB 3ZPJA 3F6QA 3FUEA 2VGXB 3HRAA 1FCHA 3C3RA 1SZ9A 2XPZA 1JWGA 4ANVA 4EZKA 4BESA 5B1AE 2XHEA 4C0EA 2LXMA 3S7FA 3LVQE 5AYWD 1SQMA 2XEEA 5HI7A 5M72A 4B0ZA 3B7RL 5FQ8A 5A7DB 2P9SG 4GCNA 2ZGGA 3Q73A 1DC2A 5BV1A 4YDEA 4NURA 3E30A 3NOGD 3Q49B 2RD0A 5KCMA 2YHEA 1MZCA 3UPVA 3CHMA 4GAAA 4FA6A 4DX2A 2GRLA 3Q9UC 3UINC 5LP0A 2P2CP 4JZYA 5KNHD 1Z3XA 3FY4A 3CHQA 4DPRA 4A1SA 3ULQA 4O6FA 2P9NG 3TGOA 4APOA 3FUKA 3V31A 5BXOA 1KLXA 1OT8A 1NA0A 2WXHA 4L2LA 3TG4A 1K1BA 4KMOA 1H19A 3UXGA 4GZ3A 2VTBB 5FZRA 5C1DA 3DPDA 4WAFA 4A3VA 1BD8A 3Q7FA 5AENA 2WB2A 4CT4A 2GW1A 3X2QE 1JCQA 4YVOA 3LXUX 1H6KA 1H0AA 5BT1A 1ELWA 3LPZA 2L0IA 3RRUA 3RSEG 2WXOA 1TNUA 5EYPF 1SW6A 3KS2A 4ACKA 3NB2A 2V5FA 1O1TA 3JQ1A 3CGHA 3PUJA 1E90A 3AG2E 3Q75A 5FINA 2WMOA 2VSXE 3BU8A 3MKQB 5HQ8A 4PS7A 5CBOA 3ZHEB 3O48A 2XGOA 4GZ6A 4N2QA 3MGBA 4APFA 3RJVA 3APCA 5BUZA 3TXMA 3VLEA 3FUMA 1TJFA 1TYQG 5CECB 3BQOA 3ISMC 4J8EA 4JEHA 3G2WA 4JEUA 2I9CA 3EIJA 2WQ6A 1XNFA 2IU1A 1D8DA 3V2XA 3PNLB 3Q15A 3SZ7A 2MRIA 3ZXSA 4Z68A 1OWPA 4CT0A 3HXEA 4ILIA 3I5PA 4GTQA 3TL5A 4AJWA 4OAUC 5FIOA 4I1OB 3L17A 2E0IA 2Y4TA 3T8KA 3PZ1A 5JHAA 4FLBA 2RKKA 3LDZA 4DX7D 4Q94A 3CR3A 4U63A 3T8MA 1OY3D 4XEIG 4F1SA 5EIDA 4G2VA 2X6KA 1TN7A 5CEDB 2XEVA 1BI8B 2CG2A 3IHYA 1VDYA 4OVUA 4P29A 4AV7A 4BX9A 1MX2A 4U07A 4FP7A 5EILA 3KSLA 3LY8A 1DCEA 2P9LG 4JC8A 2QFCA 3CVUA 4U7EB 4J8FA 5A23A 2P9UG 1FT2A 2J09A 1HG5A 2VGXA 4ZHBA 4BERA 4HOUA 2KZTA 3CIAA 1G3NB 1E8ZA 1LF8A 1YYHA 3AG4E 3DRAA 2J07A 2QYJA 4HRNA 4JW1A 3SFXA 3SFYA 5CCLA 3SO8A 1HH8A 2F0YA 4A55A 3DSSA 4HBDA 1WM5A 2E2EA 4ANUA 4F3VA 3I4GA 4XX5A 2XPYA 4AIFA 1O5MA 4CGWA 5CRUA 3TWTA 5JJ7A 4CYMD 3FDHA 3C3OA 2X6FA 1H6PA 3EHMA 4KBQA 5BXUA 1JCRA 3ABKE 1K3ZD 4F7AA 3P2BA 3I3NA 4PUCA 3FUIA 3MCXA 2OCCE 3EHQA 1IHGA 5AIJA 3HDXA 4JB8P 2XPIA 4D10C 3AJIA 3ZYMA 5FJYA 2AXVA 3V2OA 3QDNA 3AS8A 4CDRA 1OWMA 5AJLA 1BPOA 4HS2A 4RG6A 4EBAG 5BPPA 2VSNA 1TNOA 4B8AA 1JWFA 1U2VG 3LJNA 4K5AB 3S7BA 2XS8A 4EZJA 4AOFA 2F8XK 2J9QA 4F1PA 3B13A 2NC9A 3CLJA 3GYZA 4FADA 3CKCA 2WMNA 2XEHA 3SQVA 1TNBA 4AY5A 3ASOE 3GZSA 2KCLA 3T5VA 1N95A 4UWGA 1Z3YA 2RFAA 2WPVA 1YA0A 4ILGA 3E32A 4HOSA 2AW6A 4C48B 1HS6A 1KPSB 4L9PA 1WG0A 3FUDA 4AY6A 2BUGA 3ONLA 4G1TA 3ASFA 3WXXA 2I2OA 3EJNA 1H2TC 3LKUA 3ZKJA 5FQ6A 1HZ4A 5CBNA 2BF0X 1PAQA 5FWQA 5G55A 2J8SD 3TWVA 3DXMG 2IOLA 1S63A 4KZCA 4BT8A 4JL0A 4WWNA 3QARA 5LOZA 3SFZA 4L1BA 3B95A 1W3BA 4U8VD 4EQFA 3DEPA 3FTYA 3PS6A 4FHKA 3KEZA 4Q69A 3HXBA 2I6HA 2OVBA 4LEUA 1NA3A 2JABA 4BWRA 3CVQA 2MYOA 4UWKA 5EN5D 4MS6A 3NF1A 3IBEA 1E7VA 3CK9A 3C98A 4HORA 1UJKA 3ZFWA 4LNUD 5AQAA 4I6JA 4RG9A 3FTUA 2IO2C 2NXPA 4GYWA 4KVMA 2R5SA 2LSVA 3UUXA 2MOWA 3IEGA 3C3QA 4WNGA 5T3RA 3TWQA 2HYZA 4PS8A 1K1AA 2XS1A 1AWCB 3CHRA 3FTZA 4K0RA 4UQYA 4PDXA 3APDA 4DUIA 4BSXA 4N5QA 3QJZA 3UM2A 4I6EA 2LAHA 3L16A 2P9IG 2NSZA 3QC1A 4UI9C 3L82A 1HXIA 3ENEA 1RZ4A 2WVIA 3JYSA 2LUHA 5A6CA 2L6JA 3ZYLA 1NL4A 3CKBA 1L5JA 3AS4A 3DPYA 3ASDA 2VGYA 2JLBA 4B93B 3MJWA 2KZTB 4JA9A 3ASGA 3W9FA 4ATZD 3LYAA 3E33A 5T8IA 2A4ZA 2DYRE 3QKYA 2CFUA 4K5BA 3DSXA 5AAOA 3EHRA 3PNTB 2CHZA 1SA5A 1TNYA 2GRNB 3DXKG 3CEQA 2KM4A 2EQXA 1OCOE 4WNDA 1DCQA 2B0OE 3MV3B 3PDNA 5JJ6A 4C0MA 4MLPA 2EILE 1ELRA 4HOTA 4BTBA 2KCKA 5ENTD 3CVWA 5LFAA 2RFMA 3OXGA 2WM9A 3FFLA 2H6GA 2UWJG 1DVPA 4QQIA 1MJ0A 5KBAA 4HQDA 3TJPA 3PE4A 4G8KA 3D9LA 4CDNA 2C2LA 3VLFA 1H6OA 4N3BA 3FTVA 2HE0A 4GCOA 5CHEE 4HXIA 4DX5D 3R9AB 1A17A 3QK0A 4PH4B 4BETA 3TWWA 4GA2A 2ETAA 2XENA 2P9KG 3SI5A 4XKBA 3D9KA 2LAIA 3RAUA 2KCVA 2UY1A 4EPZA 3UT7A 3Q7AA 1ELKA 5ENRD 4DI4A 3PZDA 1TR4A 1UOHA 2Y4UA 3ULYA 1UJJA 1KZOA 3UKRG 4CZ2D 3QNKA 1HFAA 1AP7A 3ONKA 3RO3A 2KBXA 2J4BA 2XQ0A 1ZBPA 3ZVVA 4BSZB 2IEJA 4CEMA 3ESKA 3HHMA 4F53A 2IONA 2EINE 1HF8A 4J8SA 4AVXA 2X6HA 5KJLA 2BKKB 4W9RA 3V30A 1XGWA 2A5UA 4YDYA 3FH7A 2C0MA 4XI9A 4HB5A 4O60A 4UWHA 2OV8A 2P58C 4U95D 4BEPA 4GTRA 4U96D 4HI8A 4KXKB 3FH5A 2PZIA 3FP3A 1UG3A 3VTYA 3PE3A 5T4YA 4FULA 3BUAA 3PZ3A 5D66A 3RRNB 4J6IA 3L9TA 3ML8A 2LO6A 3JQ0A 1S64A 3E34A 4GMRA 3LCAA 2ZIRA 1N4PA 2Y1LE 2M63A 1WAO1 2V8SE 3HG0D 4RVBA 1OXJA 4HRMB 4EECA 4H7YA 2X6JA 1N4QA 1Z5SC 3DSTA 4B89A 4G26A 4ANWA 4L7TA 4GTOA 2J08A 3ZIMA 1N0RA 3PVLA 2AVPA 3NQPA 4N39A 2WQHA 5B3SE 1QQEA 3MKRA 3MX3A 4WNFA 1IXVA 3HVEB 3OXFA 3RK6A 2NYJA 3FUFA 4A63B 5G2NA 2FEZA 5C2YA 3ULEG 3CHOA 3D9NA 3UT8A 5FZSA 4LUNU 4G24A 2WXGA 3NOCD 1MX6A 1QZ2A 4L2YA 2X38A 3CSTA 3D9HA 2KC7A 2R03A 3EUVA 2DWZA 1UN8A 3GZ1A 4HLLA 2PL2A 4GMLA 4HFGA 4GZDA 3D9OA 1E8XA 1ZB1A 2LNIA 3ESLA 2BKGA 3CHPA 1RW2A 2PM7A 4UI9J 3B7SA 5G05C 1OWNA 4URKA 3T5XA 4MKTA 2PNNA 4G23A 1E96B 2CHXA 3IXEA 5BV0A 3FUJA 3EHNA 2XCCA 4TRQA 3FU6A 5HKPA 4CRWA 4RLYA 4GYOA 4OYSA 2WXKA 4PS3A 2WXLA 2RG8A 1SA4A 2MHKA 3OAWA 4GYYA 2R59A 4JD2G 1TNZA 1FVHA 3SF4A 3MZLB 1QNFA 4TXPA 2LSUA 3S7JA 4WUYA 2DVWA 3KSQA 1TN8A 3ZNGA 2OEWA 3AU4A 1OUVA 4TV3A 4ACLA 2YHCA 5D0OD 1NZNA 4FC8A 3AAAC 2WXIA 1JCSA 4DLOA 4WWPA 5JA4D 1NP7A 3VLDA 5H7PA 2Q7FA 3UTMA 3FUHA 3ZN3A 4YDWA 5E75A 2UY1B 2V5QC 5ANRA 1EF1C 4H7XA 3JUEA 3ZXPA 5AN8A 2YINA 4HOQA 4ME2A 3R9MA 2GGFA 4I2WA 1UN9A 1MX4A 3D3MA 1B89A 4GTMA 3SBSA 4JPSA 3C72A 4GB9A 1H2UA 5BNWA 4JHKA 3RKVA 4A3TA 3ZGQA 3UM3A 5FQ4A 2XRYA 2DIWA 3FTWA 2V4HC 3L6AA 5EKQD 1A5EA 3CQGB 1S70B 3W9GA 5EX0A 2L6BA 2KATA 4CDMA 5G04C 3B7TA 1V55E 2DYSE 2WXPA 3FEXA 3NAWA 4N3CA 2VYIA 3EIQC 2R2LA 1BI7B 2XGSA 3E37A 4XE0A 4DK5A 3J5QB 5DBKA 2ZISA 3DBSA 4GTVA 3T9KA 2B6CA 1X5BA 5KWDA 4DJAA 3ABLE 3O4ZA 2HR2A 2FO7A 4HI9A 2XZTG 1N0QA 4G25A 4O1OA 3IV0A 4GTPA 2P9PG 4LNBA 4IULA 3S7DA 3NBNB 3SBTB 2OOEA 3U9WA 3MV2B 2ILRA 5AJDA 3FEYA 4ATGA 4FJZA 4LNGA 2V0PA 4U0UA 4BT9A 3HVEA 3L22A 2PQNA 1E7UA 1K8KG 2L9BA 3BG0B 1OCZE 3DWLG 3TXNA 2AXZA 2GROB 3OTNA 5LX8A 3KEAA 4JVSA 4CGVA 3Q5MA 4QFVA 3CHSA 4J0UA 4LCTA 1Z6TA 2IQCA 5ENNA 2F37A 1E8YA 5ENSD 3MEKA 5BW8C 3L08A 4DI3A 3FWVA 3EU5A 4TUUA 2HO1A 2ZXWE 2VSOE 2IOSA 3URZA 3FTSA 3TWXA 3VTXA 2R17C 3CVPA 4IN3B 4OVVA 3FU5A 1PC2A 4HVBA 4J8DA 1YMPA 4E6HA 3CVXA 1Y6IA 4U0SA 5FZQA 5JHBA 4BFRA 3ZYKA 4RSYA 2IJGX 3CK8A 2EIME 1U3DA 3FHEA 3AU5A 1INZA 2PM6A 4GZ5A 2VGEA 2XGMA 4KZ0A 5CMYA 3U66A 3ZRHA 4NIKA 1IHBA 3UT4A 3B7UX 4G8LA 2BEDA 5G05J 5HRYA 4J8YA 4I9CA 3DSUA 4OAVB 2OEVA 4XI0A 5EDSA 3CVYA 3PREA 3FH8A 4U04A 5KJNA 3SNXA 3NZSA 5D0QD 1S0PA 4GZCA 3CQCB 1IYGA 4YDOA 1FT1A 1GW6A 3PEUB 3RIBA 2WQ7A 3FULA 2R05A 4Y6WA 3UM0A 4YNDA 3U4TA 2EIJE 3JXJA 3TG5A 5LCWC 1TJCA 2R02A 1KT1A 2FULA 2OVFA 4M3OA 1SZAA 5CCMA 1HE8A 5JJTA 3LY7A 2AJAA 3ZYQA 4I1AA 2WXRA 3I4RB 2ONDA 4U0ZA 1JPLA 1Y8MA 2H6HA 1PY1A 4NACA 3TWSA 2GRRB 4YVQC 4GU5A 3L54A 3D9MA 3V79K 3DSWA 3ABME 3GW4A 5ARGA 3LS8A 3MA5A 2FO1E 4GPMA 4J7WA 4B8CB 5CEAA 3G2SA 4WNEA 1N54A 2IF4A 2WXMA 4GTSA 4HNAD 3FU0A 2QYUA 2DZNA 5CRVA 5IY5E 3ML9A 4NRHB 4N5CA 5AQ7A 1EPUA 3CSFA 5EYLA 4WWOA 1WDYA 4A1GA 5KJMA 2JEKA 3SD5A 3PZ4A 2AWIA 4UWFA 2WXFA 4HLEA 3PUKA 2GRQB 2ZU6B 2KXPC 2F8YA 4XKCA 1Q2ZA 3FUNA 3CVLA 3QB2A 3UQ3A 1N4SA 2DBAA 3LVRE 4V3IA 2DCPA 1OWLA 4UWLA 3TAXA 5ENQD 4AEZC 4LSZE 4EHMA 5G04J 1UW4B 2IO3C 3AS5A 2H6IA 4GPKA 3SGHA 3GZ2A 4ILHB 3B7BA 3EU9A 3E4BA 1BU9A 4IYPA 1KT0A 1NI1A 4U8YD 5J08A 4BY6A 3UIOC 5JMND 3R7QA 4UQZA 4AXHA 3ASNE 3UIPC 4JHJA 1O1RA 4I43A
chains in the Genus database with same CATH topology
3UM1A 3UM0A 2OEVA 3UM3A 3ZXPA 4JIOA 2R02A 3C3QA 3RAUA 2OEXA 1ZB1A 3R9MA 2OJQA 2XS1A 5CRUA 2XS8A 2OEWA 5CRVA 3C3RA 2R03A 3ULYA 3UM2A 3C3OA 2R05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UM1 A;  3UM0 A;  2OEV A;  3UM3 A;  3ZXP A;  2R02 A;  3C3Q A;  3RAU A;  1ZB1 A;  3R9M A;  2XS1 A;  5CRU A;  2XS8 A;  2OEW A;  5CRV A;  3C3R A;  2R03 A;  3ULY A;  3UM2 A;  3C3O A;  2R05 A; 
#chains in the Genus database with same CATH topology
 1D8E A;  2Y3A A;  3J5P A;  2VQ2 A;  4EBA A;  3KAE A;  3OXL A;  3BEE A;  5EX3 A;  2EIK E;  5HS0 A;  2PQR A;  4BX8 A;  2A5E A;  3LY9 A;  4NQ0 A;  3D9J A;  3U64 A;  1IKN D;  4I1M A;  4L23 A;  3JXI A;  1MYO A;  3DEO A;  1FVF A;  3UX4 A;  4DLQ A;  1E8W A;  3TWU A;  2QY7 A;  2VJ8 A;  4C9B B;  3EDT B;  3HXF A;  2YQ8 A;  5ENP D;  5E76 A;  2J4D A;  4JA7 A;  5FQ7 A;  3HXC A;  1QYM A;  3G2V A;  4JHR A;  5ITZ F;  1N9A A;  4KT6 B;  3QWP A;  4I17 A;  3D9I A;  5KJK A;  1TN6 A;  4BTA A;  2CHW A;  4DX1 A;  4CCA A;  2XCB A;  2I1K A;  1WY6 A;  3HIZ A;  3QOU A;  4FHJ A;  4AP2 A;  4EZL A;  3IKO B;  2IY0 C;  2ZGD A;  4XIF A;  4IRU A;  2J49 A;  4F6R D;  3CVN A;  3UI2 A;  3FU3 A;  4TUM A;  3CK7 A;  2ETC A;  3Q4A B;  3Q47 B;  4I9E A;  3LEW A;  3PEV B;  2WXJ A;  3PH0 C;  1HO8 A;  3APF A;  1OCR E;  3UM1 A;  5EIB E;  4UI9 K;  2VSY A;  4X8Q A;  2Y69 E;  2GRP B;  2VTB A;  3AG1 E;  4Y6C A;  3QWW A;  3ASH A;  3ZUV B;  1P5Q A;  1SVX A;  3Q9N C;  3NZU A;  4GMJ A;  5AAR A;  5KNG A;  4LER A;  4K03 A;  3TWR A;  3S2A A;  3UMV A;  4G11 A;  4LRZ A;  1D9S A;  1LD7 A;  3PRZ A;  3QAQ A;  3G2T A;  3LJ3 A;  3AG3 E;  3JCK C;  4R7L A;  1OCC E;  5B1B E;  4RQI A;  2AXU A;  2IFU A;  2GRM A;  4LG6 A;  1N11 A;  1O1S A;  2Y0B G;  1BLX B;  3HYM B;  3G2U A;  4DX6 D;  1MQS A;  3U3W A;  2X3M A;  4FU3 A;  3MKQ A;  3HXD A;  4M7C A;  1EYH A;  2X6I A;  1LD8 A;  3SHF A;  3ZHE A;  2LXL A;  5J90 A;  3ZU7 B;  5LCW J;  1X81 A;  5ENO D;  4GA0 A;  2ETB A;  4K5C A;  1DNP A;  5AQB A;  2WXQ A;  1YCS B;  4ANX A;  1HX8 A;  3PZ2 A;  3R7R A;  5D2M C;  3ZEF A;  3MYV A;  4E85 A;  4O1P A;  1V54 E;  3N71 A;  4HRL A;  5CMW A;  2XRZ A;  2HM8 A;  2BTD A;  2YNQ A;  2I1J A;  5FT9 A;  4UUC A;  1LTX A;  4I2Z A;  2CG3 A;  4GA1 A;  1H2V C;  4TXQ A;  4ABN A;  4MRU A;  3Q79 A;  2L0T B;  4TXR A;  1IQU A;  2FBN A;  5DIZ A;  3ZW3 A;  1QBQ A;  4JXT A;  4KVO A;  2DZO A;  5ANL A;  1TEZ A;  3Q78 A;  4KYO B;  1HG2 A;  1N52 A;  2CFZ A;  1N4R A;  4XZ4 A;  3WG7 E;  1MHQ A;  2C0L A;  2QC9 A;  2WXN A;  3RU0 A;  4Q96 A;  1U3C A;  3QWV A;  4FJY A;  4DRX E;  5CER B;  2FI7 A;  2FF4 A;  4N2S A;  3SY2 A;  3DSV A;  3UKU G;  1NFI E;  1OWO A;  5FTP A;  2V4L A;  4FLH A;  4ZFH A;  2H6F A;  1IQR A;  1ZU2 A;  3IHV A;  4UQX A;  1HU3 A;  4B94 A;  3BG1 B;  4U8H A;  3D9P A;  1N94 A;  2QZA A;  3L13 A;  3RO2 A;  3C5R A;  1FPP A;  1EDU A;  4MBG A;  3P1U A;  3CVV A;  4N3A A;  3FTX A;  1JUQ A;  5AQ9 A;  2XZD G;  3CV0 A;  3KD7 A;  4GTT A;  3JUI A;  4AM9 A;  4I6G A;  5ARF A;  3K9I A;  1KZP A;  3RRM B;  3ZPJ A;  3F6Q A;  3FUE A;  2VGX B;  3HRA A;  1FCH A;  3C3R A;  1SZ9 A;  2XPZ A;  1JWG A;  4ANV A;  4EZK A;  4BES A;  5B1A E;  2XHE A;  4C0E A;  2LXM A;  3S7F A;  3LVQ E;  5AYW D;  1SQM A;  2XEE A;  5HI7 A;  5M72 A;  4B0Z A;  3B7R L;  5FQ8 A;  5A7D B;  2P9S G;  4GCN A;  2ZGG A;  3Q73 A;  1DC2 A;  5BV1 A;  4YDE A;  4NUR A;  3E30 A;  3NOG D;  3Q49 B;  2RD0 A;  5KCM A;  2YHE A;  1MZC A;  3UPV A;  3CHM A;  4GAA A;  4FA6 A;  4DX2 A;  2GRL A;  3Q9U C;  3UIN C;  5LP0 A;  2P2C P;  4JZY A;  5KNH D;  1Z3X A;  3FY4 A;  3CHQ A;  4DPR A;  4A1S A;  3ULQ A;  4O6F A;  2P9N G;  3TGO A;  4APO A;  3FUK A;  3V31 A;  5BXO A;  1KLX A;  1OT8 A;  1NA0 A;  2WXH A;  4L2L A;  3TG4 A;  1K1B A;  4KMO A;  1H19 A;  3UXG A;  4GZ3 A;  2VTB B;  5FZR A;  5C1D A;  3DPD A;  4WAF A;  4A3V A;  1BD8 A;  3Q7F A;  5AEN A;  2WB2 A;  4CT4 A;  2GW1 A;  3X2Q E;  1JCQ A;  4YVO A;  3LXU X;  1H6K A;  1H0A A;  5BT1 A;  1ELW A;  3LPZ A;  2L0I A;  3RRU A;  3RSE G;  2WXO A;  1TNU A;  5EYP F;  1SW6 A;  3KS2 A;  4ACK A;  3NB2 A;  2V5F A;  1O1T A;  3JQ1 A;  3CGH A;  3PUJ A;  1E90 A;  3AG2 E;  3Q75 A;  5FIN A;  2WMO A;  2VSX E;  3BU8 A;  3MKQ B;  5HQ8 A;  4PS7 A;  5CBO A;  3ZHE B;  3O48 A;  2XGO A;  4GZ6 A;  4N2Q A;  3MGB A;  4APF A;  3RJV A;  3APC A;  5BUZ A;  3TXM A;  3VLE A;  3FUM A;  1TJF A;  1TYQ G;  5CEC B;  3BQO A;  3ISM C;  4J8E A;  4JEH A;  3G2W A;  4JEU A;  2I9C A;  3EIJ A;  2WQ6 A;  1XNF A;  2IU1 A;  1D8D A;  3V2X A;  3PNL B;  3Q15 A;  3SZ7 A;  2MRI A;  3ZXS A;  4Z68 A;  1OWP A;  4CT0 A;  3HXE A;  4ILI A;  3I5P A;  4GTQ A;  3TL5 A;  4AJW A;  4OAU C;  5FIO A;  4I1O B;  3L17 A;  2E0I A;  2Y4T A;  3T8K A;  3PZ1 A;  5JHA A;  4FLB A;  2RKK A;  3LDZ A;  4DX7 D;  4Q94 A;  3CR3 A;  4U63 A;  3T8M A;  1OY3 D;  4XEI G;  4F1S A;  5EID A;  4G2V A;  2X6K A;  1TN7 A;  5CED B;  2XEV A;  1BI8 B;  2CG2 A;  3IHY A;  1VDY A;  4OVU A;  4P29 A;  4AV7 A;  4BX9 A;  1MX2 A;  4U07 A;  4FP7 A;  5EIL A;  3KSL A;  3LY8 A;  1DCE A;  2P9L G;  4JC8 A;  2QFC A;  3CVU A;  4U7E B;  4J8F A;  5A23 A;  2P9U G;  1FT2 A;  2J09 A;  1HG5 A;  2VGX A;  4ZHB A;  4BER A;  4HOU A;  2KZT A;  3CIA A;  1G3N B;  1E8Z A;  1LF8 A;  1YYH A;  3AG4 E;  3DRA A;  2J07 A;  2QYJ A;  4HRN A;  4JW1 A;  3SFX A;  3SFY A;  5CCL A;  3SO8 A;  1HH8 A;  2F0Y A;  4A55 A;  3DSS A;  4HBD A;  1WM5 A;  2E2E A;  4ANU A;  4F3V A;  3I4G A;  4XX5 A;  2XPY A;  4AIF A;  1O5M A;  4CGW A;  5CRU A;  3TWT A;  5JJ7 A;  4CYM D;  3FDH A;  3C3O A;  2X6F A;  1H6P A;  3EHM A;  4KBQ A;  5BXU A;  1JCR A;  3ABK E;  1K3Z D;  4F7A A;  3P2B A;  3I3N A;  4PUC A;  3FUI A;  3MCX A;  2OCC E;  3EHQ A;  1IHG A;  5AIJ A;  3HDX A;  4JB8 P;  2XPI A;  4D10 C;  3AJI A;  3ZYM A;  5FJY A;  2AXV A;  3V2O A;  3QDN A;  3AS8 A;  4CDR A;  1OWM A;  5AJL A;  1BPO A;  4HS2 A;  4RG6 A;  4EBA G;  5BPP A;  2VSN A;  1TNO A;  4B8A A;  1JWF A;  1U2V G;  3LJN A;  4K5A B;  3S7B A;  2XS8 A;  4EZJ A;  4AOF A;  2F8X K;  2J9Q A;  4F1P A;  3B13 A;  2NC9 A;  3CLJ A;  3GYZ A;  4FAD A;  3CKC A;  2WMN A;  2XEH A;  3SQV A;  1TNB A;  4AY5 A;  3ASO E;  3GZS A;  2KCL A;  3T5V A;  1N95 A;  4UWG A;  1Z3Y A;  2RFA A;  2WPV A;  1YA0 A;  4ILG A;  3E32 A;  4HOS A;  2AW6 A;  4C48 B;  1HS6 A;  1KPS B;  4L9P A;  1WG0 A;  3FUD A;  4AY6 A;  2BUG A;  3ONL A;  4G1T A;  3ASF A;  3WXX A;  2I2O A;  3EJN A;  1H2T C;  3LKU A;  3ZKJ A;  5FQ6 A;  1HZ4 A;  5CBN A;  2BF0 X;  1PAQ A;  5FWQ A;  5G55 A;  2J8S D;  3TWV A;  3DXM G;  2IOL A;  1S63 A;  4KZC A;  4BT8 A;  4JL0 A;  4WWN A;  3QAR A;  5LOZ A;  3SFZ A;  4L1B A;  3B95 A;  1W3B A;  4U8V D;  4EQF A;  3DEP A;  3FTY A;  3PS6 A;  4FHK A;  3KEZ A;  4Q69 A;  3HXB A;  2I6H A;  2OVB A;  4LEU A;  1NA3 A;  2JAB A;  4BWR A;  3CVQ A;  2MYO A;  4UWK A;  5EN5 D;  4MS6 A;  3NF1 A;  3IBE A;  1E7V A;  3CK9 A;  3C98 A;  4HOR A;  1UJK A;  3ZFW A;  4LNU D;  5AQA A;  4I6J A;  4RG9 A;  3FTU A;  2IO2 C;  2NXP A;  4GYW A;  4KVM A;  2R5S A;  2LSV A;  3UUX A;  2MOW A;  3IEG A;  3C3Q A;  4WNG A;  5T3R A;  3TWQ A;  2HYZ A;  4PS8 A;  1K1A A;  2XS1 A;  1AWC B;  3CHR A;  3FTZ A;  4K0R A;  4UQY A;  4PDX A;  3APD A;  4DUI A;  4BSX A;  4N5Q A;  3QJZ A;  3UM2 A;  4I6E A;  2LAH A;  3L16 A;  2P9I G;  2NSZ A;  3QC1 A;  4UI9 C;  3L82 A;  1HXI A;  3ENE A;  1RZ4 A;  2WVI A;  3JYS A;  2LUH A;  5A6C A;  2L6J A;  3ZYL A;  1NL4 A;  3CKB A;  1L5J A;  3AS4 A;  3DPY A;  3ASD A;  2VGY A;  2JLB A;  4B93 B;  3MJW A;  2KZT B;  4JA9 A;  3ASG A;  3W9F A;  4ATZ D;  3LYA A;  3E33 A;  5T8I A;  2A4Z A;  2DYR E;  3QKY A;  2CFU A;  4K5B A;  3DSX A;  5AAO A;  3EHR A;  3PNT B;  2CHZ A;  1SA5 A;  1TNY A;  2GRN B;  3DXK G;  3CEQ A;  2KM4 A;  2EQX A;  1OCO E;  4WND A;  1DCQ A;  2B0O E;  3MV3 B;  3PDN A;  5JJ6 A;  4C0M A;  4MLP A;  2EIL E;  1ELR A;  4HOT A;  4BTB A;  2KCK A;  5ENT D;  3CVW A;  5LFA A;  2RFM A;  3OXG A;  2WM9 A;  3FFL A;  2H6G A;  2UWJ G;  1DVP A;  4QQI A;  1MJ0 A;  5KBA A;  4HQD A;  3TJP A;  3PE4 A;  4G8K A;  3D9L A;  4CDN A;  2C2L A;  3VLF A;  1H6O A;  4N3B A;  3FTV A;  2HE0 A;  4GCO A;  5CHE E;  4HXI A;  4DX5 D;  3R9A B;  1A17 A;  3QK0 A;  4PH4 B;  4BET A;  3TWW A;  4GA2 A;  2ETA A;  2XEN A;  2P9K G;  3SI5 A;  4XKB A;  3D9K A;  2LAI A;  3RAU A;  2KCV A;  2UY1 A;  4EPZ A;  3UT7 A;  3Q7A A;  1ELK A;  5ENR D;  4DI4 A;  3PZD A;  1TR4 A;  1UOH A;  2Y4U A;  3ULY A;  1UJJ A;  1KZO A;  3UKR G;  4CZ2 D;  3QNK A;  1HFA A;  1AP7 A;  3ONK A;  3RO3 A;  2KBX A;  2J4B A;  2XQ0 A;  1ZBP A;  3ZVV A;  4BSZ B;  2IEJ A;  4CEM A;  3ESK A;  3HHM A;  4F53 A;  2ION A;  2EIN E;  1HF8 A;  4J8S A;  4AVX A;  2X6H A;  5KJL A;  2BKK B;  4W9R A;  3V30 A;  1XGW A;  2A5U A;  4YDY A;  3FH7 A;  2C0M A;  4XI9 A;  4HB5 A;  4O60 A;  4UWH A;  2OV8 A;  2P58 C;  4U95 D;  4BEP A;  4GTR A;  4U96 D;  4HI8 A;  4KXK B;  3FH5 A;  2PZI A;  3FP3 A;  1UG3 A;  3VTY A;  3PE3 A;  5T4Y A;  4FUL A;  3BUA A;  3PZ3 A;  5D66 A;  3RRN B;  4J6I A;  3L9T A;  3ML8 A;  2LO6 A;  3JQ0 A;  1S64 A;  3E34 A;  4GMR A;  3LCA A;  2ZIR A;  1N4P A;  2Y1L E;  2M63 A;  1WAO 1;  2V8S E;  3HG0 D;  4RVB A;  1OXJ A;  4HRM B;  4EEC A;  4H7Y A;  2X6J A;  1N4Q A;  1Z5S C;  3DST A;  4B89 A;  4G26 A;  4ANW A;  4L7T A;  4GTO A;  2J08 A;  3ZIM A;  1N0R A;  3PVL A;  2AVP A;  3NQP A;  4N39 A;  2WQH A;  5B3S E;  1QQE A;  3MKR A;  3MX3 A;  4WNF A;  1IXV A;  3HVE B;  3OXF A;  3RK6 A;  2NYJ A;  3FUF A;  4A63 B;  5G2N A;  2FEZ A;  5C2Y A;  3ULE G;  3CHO A;  3D9N A;  3UT8 A;  5FZS A;  4LUN U;  4G24 A;  2WXG A;  3NOC D;  1MX6 A;  1QZ2 A;  4L2Y A;  2X38 A;  3CST A;  3D9H A;  2KC7 A;  2R03 A;  3EUV A;  2DWZ A;  1UN8 A;  3GZ1 A;  4HLL A;  2PL2 A;  4GML A;  4HFG A;  4GZD A;  3D9O A;  1E8X A;  1ZB1 A;  2LNI A;  3ESL A;  2BKG A;  3CHP A;  1RW2 A;  2PM7 A;  4UI9 J;  3B7S A;  5G05 C;  1OWN A;  4URK A;  3T5X A;  4MKT A;  2PNN A;  4G23 A;  1E96 B;  2CHX A;  3IXE A;  5BV0 A;  3FUJ A;  3EHN A;  2XCC A;  4TRQ A;  3FU6 A;  5HKP A;  4CRW A;  4RLY A;  4GYO A;  4OYS A;  2WXK A;  4PS3 A;  2WXL A;  2RG8 A;  1SA4 A;  2MHK A;  3OAW A;  4GYY A;  2R59 A;  4JD2 G;  1TNZ A;  1FVH A;  3SF4 A;  3MZL B;  1QNF A;  4TXP A;  2LSU A;  3S7J A;  4WUY A;  2DVW A;  3KSQ A;  1TN8 A;  3ZNG A;  2OEW A;  3AU4 A;  1OUV A;  4TV3 A;  4ACL A;  2YHC A;  5D0O D;  1NZN A;  4FC8 A;  3AAA C;  2WXI A;  1JCS A;  4DLO A;  4WWP A;  5JA4 D;  1NP7 A;  3VLD A;  5H7P A;  2Q7F A;  3UTM A;  3FUH A;  3ZN3 A;  4YDW A;  5E75 A;  2UY1 B;  2V5Q C;  5ANR A;  1EF1 C;  4H7X A;  3JUE A;  3ZXP A;  5AN8 A;  2YIN A;  4HOQ A;  4ME2 A;  3R9M A;  2GGF A;  4I2W A;  1UN9 A;  1MX4 A;  3D3M A;  1B89 A;  4GTM A;  3SBS A;  4JPS A;  3C72 A;  4GB9 A;  1H2U A;  5BNW A;  4JHK A;  3RKV A;  4A3T A;  3ZGQ A;  3UM3 A;  5FQ4 A;  2XRY A;  2DIW A;  3FTW A;  2V4H C;  3L6A A;  5EKQ D;  1A5E A;  3CQG B;  1S70 B;  3W9G A;  5EX0 A;  2L6B A;  2KAT A;  4CDM A;  5G04 C;  3B7T A;  1V55 E;  2DYS E;  2WXP A;  3FEX A;  3NAW A;  4N3C A;  2VYI A;  3EIQ C;  2R2L A;  1BI7 B;  2XGS A;  3E37 A;  4XE0 A;  4DK5 A;  3J5Q B;  5DBK A;  2ZIS A;  3DBS A;  4GTV A;  3T9K A;  2B6C A;  1X5B A;  5KWD A;  4DJA A;  3ABL E;  3O4Z A;  2HR2 A;  2FO7 A;  4HI9 A;  2XZT G;  1N0Q A;  4G25 A;  4O1O A;  3IV0 A;  4GTP A;  2P9P G;  4LNB A;  4IUL A;  3S7D A;  3NBN B;  3SBT B;  2OOE A;  3U9W A;  3MV2 B;  2ILR A;  5AJD A;  3FEY A;  4ATG A;  4FJZ A;  4LNG A;  2V0P A;  4U0U A;  4BT9 A;  3HVE A;  3L22 A;  2PQN A;  1E7U A;  1K8K G;  2L9B A;  3BG0 B;  1OCZ E;  3DWL G;  3TXN A;  2AXZ A;  2GRO B;  3OTN A;  5LX8 A;  3KEA A;  4JVS A;  4CGV A;  3Q5M A;  4QFV A;  3CHS A;  4J0U A;  4LCT A;  1Z6T A;  2IQC A;  5ENN A;  2F37 A;  1E8Y A;  5ENS D;  3MEK A;  5BW8 C;  3L08 A;  4DI3 A;  3FWV A;  3EU5 A;  4TUU A;  2HO1 A;  2ZXW E;  2VSO E;  2IOS A;  3URZ A;  3FTS A;  3TWX A;  3VTX A;  2R17 C;  3CVP A;  4IN3 B;  4OVV A;  3FU5 A;  1PC2 A;  4HVB A;  4J8D A;  1YMP A;  4E6H A;  3CVX A;  1Y6I A;  4U0S A;  5FZQ A;  5JHB A;  4BFR A;  3ZYK A;  4RSY A;  2IJG X;  3CK8 A;  2EIM E;  1U3D A;  3FHE A;  3AU5 A;  1INZ A;  2PM6 A;  4GZ5 A;  2VGE A;  2XGM A;  4KZ0 A;  5CMY A;  3U66 A;  3ZRH A;  4NIK A;  1IHB A;  3UT4 A;  3B7U X;  4G8L A;  2BED A;  5G05 J;  5HRY A;  4J8Y A;  4I9C A;  3DSU A;  4OAV B;  2OEV A;  4XI0 A;  5EDS A;  3CVY A;  3PRE A;  3FH8 A;  4U04 A;  5KJN A;  3SNX A;  3NZS A;  5D0Q D;  1S0P A;  4GZC A;  3CQC B;  1IYG A;  4YDO A;  1FT1 A;  1GW6 A;  3PEU B;  3RIB A;  2WQ7 A;  3FUL A;  2R05 A;  4Y6W A;  3UM0 A;  4YND A;  3U4T A;  2EIJ E;  3JXJ A;  3TG5 A;  5LCW C;  1TJC A;  2R02 A;  1KT1 A;  2FUL A;  2OVF A;  4M3O A;  1SZA A;  5CCM A;  1HE8 A;  5JJT A;  3LY7 A;  2AJA A;  3ZYQ A;  4I1A A;  2WXR A;  3I4R B;  2OND A;  4U0Z A;  1JPL A;  1Y8M A;  2H6H A;  1PY1 A;  4NAC A;  3TWS A;  2GRR B;  4YVQ C;  4GU5 A;  3L54 A;  3D9M A;  3V79 K;  3DSW A;  3ABM E;  3GW4 A;  5ARG A;  3LS8 A;  3MA5 A;  2FO1 E;  4GPM A;  4J7W A;  4B8C B;  5CEA A;  3G2S A;  4WNE A;  1N54 A;  2IF4 A;  2WXM A;  4GTS A;  4HNA D;  3FU0 A;  2QYU A;  2DZN A;  5CRV A;  5IY5 E;  3ML9 A;  4NRH B;  4N5C A;  5AQ7 A;  1EPU A;  3CSF A;  5EYL A;  4WWO A;  1WDY A;  4A1G A;  5KJM A;  2JEK A;  3SD5 A;  3PZ4 A;  2AWI A;  4UWF A;  2WXF A;  4HLE A;  3PUK A;  2GRQ B;  2ZU6 B;  2KXP C;  2F8Y A;  4XKC A;  1Q2Z A;  3FUN A;  3CVL A;  3QB2 A;  3UQ3 A;  1N4S A;  2DBA A;  3LVR E;  4V3I A;  2DCP A;  1OWL A;  4UWL A;  3TAX A;  5ENQ D;  4AEZ C;  4LSZ E;  4EHM A;  5G04 J;  1UW4 B;  2IO3 C;  3AS5 A;  2H6I A;  4GPK A;  3SGH A;  3GZ2 A;  4ILH B;  3B7B A;  3EU9 A;  3E4B A;  1BU9 A;  4IYP A;  1KT0 A;  1NI1 A;  4U8Y D;  5J08 A;  4BY6 A;  3UIO C;  5JMN D;  3R7Q A;  4UQZ A;  4AXH A;  3ASN E;  3UIP C;  4JHJ A;  1O1R A;  4I43 A; 
#chains in the Genus database with same CATH homology
 3UM1 A;  3UM0 A;  2OEV A;  3UM3 A;  3ZXP A;  4JIO A;  2R02 A;  3C3Q A;  3RAU A;  2OEX A;  1ZB1 A;  3R9M A;  2OJQ A;  2XS1 A;  5CRU A;  2XS8 A;  2OEW A;  5CRV A;  3C3R A;  2R03 A;  3ULY A;  3UM2 A;  3C3O A;  2R05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...