5CRVA

Crystal structure of the bro domain of hd-ptp in a complex with the core region of stam2
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
361
structure length
357
Chain Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKAPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
publication title Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 142
structure length 357
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 5crvA00
3C3OA 3UM0A 2XS1A 3RAUA 3C3RA 3UM3A 5CRVA 3ZXPA 2R03A 3ULYA 3UM1A 5CRUA 3R9MA 2XS8A 1ZB1A 2R05A 3C3QA 2OEWA 2R02A 3UM2A 2OEVA
chains in the Genus database with same CATH superfamily
2A5UA 1OY3D 3UM3A 1XNFA 5ENRD 3B7SA 4AVXA 5CCMA 1IQRA 1H19A 2LXMA 2XEEA 2AVPA 4MLPA 2VSXE 3DXMG 4U8YD 4PDXA 3NZUA 3APDA 2ZGGA 4F3VA 4GZCA 3X2QE 4F1SA 1E96B 4BT9A 1NP7A 4DX7D 1SA4A 2XRYA 3B95A 1MX6A 3URZA 5ANLA 3FP3A 1EDUA 3FWVA 3TG4A 2PQNA 5BXOA 4FADA 4M7CA 1OT8A 1WAO1 3GW4A 4I1OB 5ENPD 1N95A 5FWQA 1OWMA 2LUHA 4CT4A 4ATZD 1OUVA 3F6QA 3AU5A 3TWUA 4QFVA 4GA0A 3J5PA 1FT2A 3T8MA 2IU1A 4U7EB 3E33A 5FIOA 1E7VA 2X38A 3CKBA 1S0PA 1DC2A 3OXFA 3BUAA 2KCLA 3UQ3A 3CHMA 5JA4D 3DSXA 4OYSA 3RK6A 4U0ZA 3CSTA 1U3CA 1NFIE 3NZSA 3L9TA 2A5EA 2XCBA 1WM5A 4Q96A 4KT6B 3FTSA 3GZ1A 5E75A 4ACLA 4HFGA 4WAFA 5H7PA 2F37A 3BEEA 1H0AA 1E90A 1DCQA 2XPIA 5KJLA 3UKUG 5A23A 3LPZA 2KBXA 4GTOA 3OTNA 5G04C 5JJ7A 3V2OA 4XEIG 3MJWA 1D9SA 2VGXA 3DSTA 2B6CA 2P9SG 1FPPA 1NZNA 4KZCA 3KEAA 3DRAA 4U96D 4GYYA 2X6KA 2DBAA 5FZSA 2PM7A 4FULA 1KLXA 2L0TB 4BTAA 3DEOA 1TJFA 4JHJA 4GTMA 2QYJA 4HVBA 4APOA 5CEAA 2IJGX 3UT7A 4WWPA 1UJJA 4DI4A 3LY9A 2HYZA 4TXPA 5ENSD 1TN6A 1OCRE 3Q9UC 4L23A 3P2BA 1HS6A 1HO8A 3JXIA 1TN8A 1W3BA 3SBSA 3FTZA 3TWVA 4N2SA 1AP7A 5ENNA 2P9NG 4B93B 2WMNA 2P9IG 1H6KA 4JB8P 3MV3B 2CHXA 4AV7A 4BETA 5D2MC 3CVUA 3FUDA 5AARA 1N9AA 4J8SA 3CVWA 4H7XA 2JABA 4ME2A 3AS8A 4GZ5A 3VLEA 3CVNA 4GTSA 2RD0A 3MKQB 4PUCA 3QARA 2VJ8A 4UWLA 3TWSA 3KSQA 3QWVA 1TN7A 3CK8A 2VQ2A 5FQ8A 4RSYA 5AQ7A 1Z6TA 3Q78A 2P9LG 4OAVB 4JZYA 2XGMA 2WXKA 5A6CA 1N4PA 2MRIA 4EPZA 3SGHA 1VDYA 3OAWA 4J8FA 3L13A 1KZPA 2RG8A 3L16A 1JWFA 3RAUA 1A17A 5BW8C 3LXUX 3UI2A 4HOTA 3FU3A 4EZJA 2FO1E 1HFAA 3Q5MA 2R17C 5LX8A 3LY8A 3ABLE 4U63A 1MHQA 3ISMC 2DYRE 1WY6A 3G2WA 3ZU7B 3ZFWA 5AQAA 2LSUA 2AW6A 2GROB 1Q2ZA 3ZN3A 4J8DA 1BPOA 5JMND 1HX8A 2IY0C 2KZTB 5CBOA 2JLBA 4U8VD 2IOLA 3L82A 3EU9A 4I43A 1G3NB 3PZDA 3NF1A 4AOFA 2C0MA 3ABME 2XQ0A 5EIDA 4DUIA 3PUJA 3PEVB 3SFXA 5J90A 3J5QB 4CZ2D 4ZFHA 2PL2A 3D9PA 3HXBA 5LCWC 2VSNA 3FFLA 1O1RA 4HLLA 4Y6CA 3V30A 1OWPA 3I4GA 2WXMA 3IXEA 3HVEA 4GCNA 3U66A 3B13A 4GYOA 3SFZA 1OCOE 5T8IA 1DNPA 4B89A 3SBTB 2P9KG 3WXXA 5JHBA 1LD7A 4RG9A 3CHSA 2BTDA 4YDWA 4YDEA 3HXEA 4IYPA 1N4QA 3GZ2A 2J09A 4FJYA 2X6JA 2XCCA 2VGYA 3MX3A 2E0IA 3ZIMA 3E32A 2LAIA 2MHKA 1K1BA 4UI9J 3GYZA 4NQ0A 2CG2A 2WXNA 5G55A 1IKND 1RZ4A 2QYUA 5KJKA 3FTWA 3EU5A 3ENEA 3NB2A 3MZLB 2WXHA 4WNGA 5D66A 5AN8A 3JCKC 2V8SE 3Q75A 4HBDA 3EIQC 2ZGDA 2B0OE 3SY2A 3ESLA 2I1KA 4GA1A 3MYVA 3UM1A 1BLXB 3UIPC 5B1AE 4KZ0A 2FBNA 2CHWA 4LCTA 4FC8A 2H6IA 4BSXA 4UWFA 2NSZA 3CVVA 5B1BE 4MS6A 4HI9A 2Q7FA 3L6AA 3ULEG 3FUFA 3PZ2A 4K5BA 4BY6A 4K0RA 4ANVA 4MKTA 2EQXA 3CKCA 5ARGA 2WB2A 4HOSA 2F8YA 1IQUA 2Y4TA 4N3CA 4DX1A 3ABKE 3CEQA 2VTBB 3AG1E 5AJDA 1E8XA 1QBQA 5AAOA 3APFA 1O1TA 1E8ZA 2XZDG 2OEWA 4N2QA 2GRNB 3EIJA 3CVYA 1H2VC 4GTTA 5FZRA 5AENA 2V0PA 4GTVA 4C0MA 2CG3A 1BD8A 4TXRA 3S7JA 3FTXA 4LNUD 4EBAG 2P9PG 3D3MA 4G11A 1IHGA 3CLJA 2YINA 4RLYA 4PS8A 3LY7A 4GMLA 2DVWA 3ONKA 4DPRA 3R7QA 3E37A 4XI0A 2L0IA 4HRLA 4C0EA 1MZCA 1TNUA 3NAWA 4B0ZA 2P9UG 2IO3C 5T4YA 1NA0A 4FU3A 2GRLA 3T8KA 3KD7A 4ILIA 2DYSE 4CRWA 2PNNA 4CEMA 5KJNA 1TNZA 5AQBA 3Q7AA 3B7RL 5IY5E 2JEKA 2YHCA 4M3OA 2J9QA 4J7WA 5ENQD 3SHFA 3HIZA 3B7TA 2C0LA 4HOQA 3UINC 4LERA 3R9AB 3G2TA 3FHEA 3GZSA 3RU0A 4AY5A 4MRUA 2ZXWE 3ASFA 1HU3A 3I3NA 1K3ZD 3FTYA 3OXLA 2L6JA 2XGSA 1IHBA 3CVPA 4LSZE 2J4BA 4HLEA 1SA5A 2J4DA 3ESKA 4TXQA 2LSVA 5J08A 3ZYMA 3QB2A 1MJ0A 1GW6A 5FINA 4XI9A 1H6PA 2XS8A 3L54A 5G05C 3KS2A 3Q79A 2AXVA 1JCQA 2QFCA 3UMVA 4G8KA 1B89A 3JXJA 4LUNU 2YQ8A 1Z3XA 5EN5D 3CSFA 3QNKA 3QOUA 2WXQA 4DX2A 4EECA 4Y6WA 2R5SA 1FVFA 2HM8A 4UUCA 1WG0A 5AQ9A 5KWDA 3RO2A 4Q94A 3AG4E 5FQ7A 3T9KA 3U64A 4N3BA 4JVSA 1KZOA 3ZYKA 2GRPB 4I9CA 3PRZA 3SFYA 3FULA 3RJVA 4U95D 3DSWA 3ASDA 2WXLA 4GMRA 2WM9A 1UW4B 2IOSA 4CGVA 3D9OA 2RKKA 4BX9A 4ANWA 3EDTB 5CERB 3C98A 4U0SA 2XEVA 5BUZA 3O4ZA 3BG0B 3C3OA 2XPYA 2FF4A 3NBNB 4CDNA 3ZYQA 5T3RA 1N0RA 2XGOA 3IV0A 4GZ6A 2V5QC 2J8SD 3DEPA 4BSZB 1BI7B 2NYJA 1E8YA 4N39A 4P29A 4TV3A 4AM9A 2EIJE 5CMWA 2IQCA 4GTRA 4IRUA 1INZA 3CHRA 1ELRA 5EILA 3TAXA 3ZXSA 4GTQA 1AWCB 3D9KA 3B7BA 3CK7A 3JYSA 2BKGA 2WXGA 2DZNA 3HDXA 3UKRG 4ABNA 3TWRA 1SW6A 3PNTB 2IEJA 4A1GA 1HZ4A 4CGWA 5BPPA 4NIKA 3FUEA 4JD2G 2OVBA 3ASNE 2F0YA 3S7DA 1EYHA 3I4RB 3JQ1A 1BU9A 3ZKJA 3ZRHA 4EQFA 1N94A 4WNDA 3ASGA 1TNOA 3C3RA 4XX5A 3ZHEA 1K1AA 3MV2B 1S64A 1OCZE 2HE0A 3V31A 1YMPA 1JCSA 3RIBA 3T5XA 2EIME 3FU6A 4TUUA 2VGEA 3EHMA 4G1TA 2GRQB 4BFRA 4BEPA 5ARFA 3FH5A 2I9CA 1YA0A 4DX5D 4AIFA 2VGXB 2RFAA 3FUKA 2PM6A 1FT1A 2LNIA 1D8EA 2V4HC 1XGWA 4FJZA 4OVUA 3C5RA 4HRMB 3S7FA 3RKVA 4HB5A 5G04J 5C1DA 4N3AA 4E85A 3PZ4A 4U04A 4Q69A 1N54A 4EZLA 5CBNA 1ELKA 2AXZA 2J49A 5BXUA 3BU8A 1V54E 3CR3A 4YNDA 4O60A 4ANXA 2FI7A 3ZVVA 3FEYA 2Y3AA 5JJTA 4KVMA 1QZ2A 4ANUA 1TNYA 1WDYA 1UG3A 3SF4A 1TEZA 2EINE 3QK0A 5M72A 4GU5A 3DXKG 4I17A 2RFMA 2R2LA 3AU4A 4BT8A 3MKRA 4APFA 1YCSB 4EHMA 3AG3E 3BQOA 2MYOA 3LEWA 2KCKA 3TGOA 1P5QA 3PE3A 2CHZA 3LCAA 4NACA 5BV1A 4KXKB 1N0QA 3LJNA 4DJAA 1EF1C 3FH8A 3QAQA 4DX6D 1KT1A 4AJWA 2X6FA 4UQXA 5KCMA 3IHVA 3AG2E 4LEUA 1PC2A 4A63B 5G2NA 2H6FA 4ATGA 1FVHA 1OWLA 3VLDA 3W9GA 1U3DA 2UY1A 3CV0A 3Q73A 4JW1A 2IFUA 2KATA 4N5QA 2MOWA 3FUMA 4OVVA 3TJPA 4DRXE 2X3MA 4Z68A 2ETBA 2OV8A 4WWNA 4CCAA 3CQCB 4HQDA 5JJ6A 3CHQA 3DSUA 4KVOA 4I1MA 4JPSA 5D0QD 4URKA 3ZPJA 4G25A 2CFUA 3FU0A 1TJCA 5LFAA 2WXIA 2WPVA 4E6HA 5CRUA 1OWNA 4PS7A 5LP0A 2XEHA 4EZKA 3HRAA 2XPZA 4I9EA 3PZ1A 1RW2A 5FQ6A 3EUVA 4K5CA 1JCRA 4LNBA 2C2LA 2ONDA 5CMYA 3LYAA 3Q47B 3TWWA 5CECB 3APCA 1JPLA 3CGHA 4G26A 3L08A 1QNFA 1YYHA 2VYIA 3B7UX 3HVEB 2BEDA 2I1JA 3VTYA 4G2VA 5LCWJ 2BKKB 3PVLA 3E4BA 1S70B 4H7YA 3TL5A 4KMOA 1LF8A 2FEZA 2LXLA 4G8LA 4GTPA 2WXFA 2Y0BG 2BF0X 2XS1A 1SVXA 4RVBA 2LAHA 2KCVA 1UN9A 4A55A 1UJKA 4ILGA 3C3QA 1QQEA 1V55E 3QJZA 4J6IA 2R02A 1MQSA 1X5BA 4XZ4A 3MGBA 3RSEG 3SNXA 5HRYA 2V4LA 3UPVA 2WXJA 4HI8A 2ZU6B 3SO8A 3HG0D 5BNWA 2KC7A 3ZGQA 3V2XA 3UTMA 1MX2A 3CQGB 3PUKA 2X6HA 3ZYLA 2HO1A 4CYMD 3TXNA 4GPMA 3D9MA 4JHKA 4UQYA 1UOHA 2M63A 3G2VA 3ZUVB 2E2EA 4XKCA 2EIKE 1LD8A 5ITZF 2WQ7A 1L5JA 1H2UA 2OOEA 5FQ4A 3TG5A 2HR2A 3P1UA 2P58C 3ULQA 4K03A 3S2AA 2R03A 5ANRA 3AAAC 4HS2A 2ZISA 4O1OA 4GMJA 4A1SA 3QWWA 1MX4A 1X81A 1TNBA 2A4ZA 1OWOA 2GW1A 3FUJA 4F1PA 4HORA 3D9IA 4UWKA 5KNGA 3N71A 4GCOA 2ETCA 3FUNA 4F53A 3CHOA 1HH8A 3Q7FA 2NC9A 3D9NA 4U0UA 3D9HA 4FLHA 1HG5A 3ZEFA 3ASOE 2WXPA 4O6FA 3UM0A 3TWQA 2QY7A 2H6GA 2YNQA 4B8CB 3DSSA 1Z3YA 3CIAA 1H2TC 2DWZA 3QDNA 2XENA 4TUMA 3FUIA 4BWRA 3VLFA 3ZW3A 5LOZA 4BERA 4FHKA 3DSVA 4GZDA 4UWGA 1ZB1A 3PZ3A 1K8KG 1QYMA 3MA5A 4TRQA 4BESA 2GRMA 3FH7A 4YVOA 4XIFA 4N5CA 3V79K 3KSLA 4FLBA 3FTVA 3Q15A 4D10C 5DIZA 1D8DA 2J07A 1NL4A 5EX0A 4L7TA 2NXPA 5EYLA 4I6JA 3ZXPA 3SI5A 3C72A 3T5VA 4G24A 4WUYA 5HI7A 4B94A 4UI9K 4LRZA 3ONLA 1PAQA 3QKYA 3IKOB 2DZOA 3AS4A 3MKQA 1BI8B 4YVQC 2AXUA 4HNAD 3LVRE 2WQHA 1TYQG 4J8EA 3U4TA 1ZU2A 1N11A 4FA6A 2J08A 4LG6A 3IHYA 4HOUA 4UQZA 3MEKA 3UXGA 2I6HA 3G2SA 3KAEA 1ELWA 4BTBA 2XHEA 4V3IA 3UIOC 3K9IA 2R59A 3ULYA 4JL0A 2LO6A 3SZ7A 3VTXA 4JXTA 4U8HA 3IBEA 1OCCE 4XE0A 4NURA 3E30A 1S63A 4YDOA 5FZQA 3HHMA 2H6HA 5EIBE 2GRRB 2IONA 3ASHA 3NQPA 3FDHA 4ACKA 4KBQA 5G05J 2R05A 2X6IA 5B3SE 4I6GA 4I1AA 2AJAA 2KZTA 3EHQA 3EHNA 4J0UA 3W9FA 4GYWA 1SZ9A 2WVIA 2FO7A 5EYPF 3LJ3A 5FTPA 3PEUB 3L17A 4JHRA 1HF8A 2BUGA 3R7RA 1SQMA 3D9JA 4LNGA 4PH4B 3EJNA 3L22A 3LKUA 2KXPC 3UM2A 1JUQA 3HXDA 4L2YA 2FULA 2PQRA 2F8XK 1TR4A 4DLQA 3NOGD 3DBSA 2IF4A 5KJMA 3WG7E 3E34A 5KNHD 4AY6A 4GAAA 3MCXA 3LDZA 1Y6IA 3D9LA 4AEZC 1H6OA 3G2UA 4AXHA 4JA7A 3U9WA 5HQ8A 2VSOE 4L1BA 2GGFA 4B8AA 2VSYA 4FP7A 3ZNGA 3UT8A 3PREA 4O1PA 3PDNA 3O48A 4UI9C 3Q49B 3FUHA 5DBKA 2ILRA 1HG2A 2ZIRA 4J8YA 1Z5SC 3RRUA 3IEGA 2L9BA 5EDSA 2AWIA 3AJIA 3R9MA 3SQVA 3RRMB 1IXVA 3PNLB 4RG6A 5BT1A 2PZIA 2OEVA 1DCEA 3ML9A 3NOCD 3RO3A 4JA9A 3DPDA 4GB9A 4JC8A 3Q4AB 4CT0A 2OVFA 5KBAA 3ZHEB 3HXFA 3JUIA 1IYGA 4GZ3A 3EHRA 2Y1LE 5CCLA 4HXIA 3FU5A 4CDMA 5AJLA 4DLOA 4A3TA 5FJYA 1N4RA 1O1SA 1E7UA 3KEZA 5E76A 2P2CP 3DWLG 3PS6A 4RQIA 5CEDB 2OCCE 2UWJG 5JHAA 1NA3A 4JEHA 4A3VA 1O5MA 1SZAA 5HS0A 4GPKA 2WMOA 4R7LA 3LVQE 3OXGA 2IO2C 3U3WA 1EPUA 3DPYA 4EBAA 3FY4A 3TWTA 3UUXA 3FEXA 4WWOA 4ILHB 1KT0A 2DCPA 4G23A 4GA2A 5AYWD 4BX8A 4WNEA 2VTBA 1OXJA 1UN8A 1A5EA 3QC1A 3ML8A 2WXRA 1U2VG 4U07A 1KPSB 3CHPA 2DIWA 1PY1A 2YHEA 4I2ZA 5D0OD 4UWHA 1ZBPA 4F6RD 2ETAA 2XZTG 4KYOB 4CDRA 5CHEE 3CVQA 3HYMB 1NI1A 3FTUA 2Y69E 1LTXA 4FHJA 4K5AB 4IN3B 1DVPA 4PS3A 1FCHA 3TWXA 4QQIA 5CRVA 4DI3A 2KM4A 1N4SA 4MBGA 1N52A 1JWGA 2L6BA 3PE4A 5C2YA 3I5PA 1Y8MA 2UY1B 4C48B 4DK5A 4W9RA 3S7BA 3TXMA 4HRNA 3RRNB 4IULA 4F7AA 2V5FA 1HE8A 3Q9NC 4I6EA 5BV0A 4ZHBA 3CVLA 3BG1B 3UX4A 2QZAA 5EKQD 5EX3A 3CK9A 3JQ0A 3SD5A 5AIJA 4L2LA 2WXOA 4NRHB 3PH0C 4WNFA 3CVXA 3HXCA 4JEUA 2CFZA 1MYOA 4L9PA 2EILE 4XKBA 4X8QA 4AP2A 2WQ6A 4C9BB 4OAUC 3AS5A 3QWPA 4I2WA 5FT9A 2QC9A 5ENTD 2Y4UA 3JUEA 2I2OA 3LS8A 3UT4A 5ENOD 2XRZA 5HKPA 5A7DB 4YDYA 1HXIA 1E8WA
chains in the Genus database with same CATH topology
3C3OA 3UM0A 2XS1A 3RAUA 3C3RA 3UM3A 5CRVA 3ZXPA 2OJQA 4JIOA 2R03A 3ULYA 3UM1A 5CRUA 2OEXA 3R9MA 2XS8A 1ZB1A 2R05A 3C3QA 2OEWA 2R02A 3UM2A 2OEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3O A;  3UM0 A;  2XS1 A;  3RAU A;  3C3R A;  3UM3 A;  5CRV A;  3ZXP A;  2R03 A;  3ULY A;  3UM1 A;  5CRU A;  3R9M A;  2XS8 A;  1ZB1 A;  2R05 A;  3C3Q A;  2OEW A;  2R02 A;  3UM2 A;  2OEV A; 
#chains in the Genus database with same CATH topology
 2A5U A;  1OY3 D;  3UM3 A;  1XNF A;  5ENR D;  3B7S A;  4AVX A;  5CCM A;  1IQR A;  1H19 A;  2LXM A;  2XEE A;  2AVP A;  4MLP A;  2VSX E;  3DXM G;  4U8Y D;  4PDX A;  3NZU A;  3APD A;  2ZGG A;  4F3V A;  4GZC A;  3X2Q E;  4F1S A;  1E96 B;  4BT9 A;  1NP7 A;  4DX7 D;  1SA4 A;  2XRY A;  3B95 A;  1MX6 A;  3URZ A;  5ANL A;  3FP3 A;  1EDU A;  3FWV A;  3TG4 A;  2PQN A;  5BXO A;  4FAD A;  4M7C A;  1OT8 A;  1WAO 1;  3GW4 A;  4I1O B;  5ENP D;  1N95 A;  5FWQ A;  1OWM A;  2LUH A;  4CT4 A;  4ATZ D;  1OUV A;  3F6Q A;  3AU5 A;  3TWU A;  4QFV A;  4GA0 A;  3J5P A;  1FT2 A;  3T8M A;  2IU1 A;  4U7E B;  3E33 A;  5FIO A;  1E7V A;  2X38 A;  3CKB A;  1S0P A;  1DC2 A;  3OXF A;  3BUA A;  2KCL A;  3UQ3 A;  3CHM A;  5JA4 D;  3DSX A;  4OYS A;  3RK6 A;  4U0Z A;  3CST A;  1U3C A;  1NFI E;  3NZS A;  3L9T A;  2A5E A;  2XCB A;  1WM5 A;  4Q96 A;  4KT6 B;  3FTS A;  3GZ1 A;  5E75 A;  4ACL A;  4HFG A;  4WAF A;  5H7P A;  2F37 A;  3BEE A;  1H0A A;  1E90 A;  1DCQ A;  2XPI A;  5KJL A;  3UKU G;  5A23 A;  3LPZ A;  2KBX A;  4GTO A;  3OTN A;  5G04 C;  5JJ7 A;  3V2O A;  4XEI G;  3MJW A;  1D9S A;  2VGX A;  3DST A;  2B6C A;  2P9S G;  1FPP A;  1NZN A;  4KZC A;  3KEA A;  3DRA A;  4U96 D;  4GYY A;  2X6K A;  2DBA A;  5FZS A;  2PM7 A;  4FUL A;  1KLX A;  2L0T B;  4BTA A;  3DEO A;  1TJF A;  4JHJ A;  4GTM A;  2QYJ A;  4HVB A;  4APO A;  5CEA A;  2IJG X;  3UT7 A;  4WWP A;  1UJJ A;  4DI4 A;  3LY9 A;  2HYZ A;  4TXP A;  5ENS D;  1TN6 A;  1OCR E;  3Q9U C;  4L23 A;  3P2B A;  1HS6 A;  1HO8 A;  3JXI A;  1TN8 A;  1W3B A;  3SBS A;  3FTZ A;  3TWV A;  4N2S A;  1AP7 A;  5ENN A;  2P9N G;  4B93 B;  2WMN A;  2P9I G;  1H6K A;  4JB8 P;  3MV3 B;  2CHX A;  4AV7 A;  4BET A;  5D2M C;  3CVU A;  3FUD A;  5AAR A;  1N9A A;  4J8S A;  3CVW A;  4H7X A;  2JAB A;  4ME2 A;  3AS8 A;  4GZ5 A;  3VLE A;  3CVN A;  4GTS A;  2RD0 A;  3MKQ B;  4PUC A;  3QAR A;  2VJ8 A;  4UWL A;  3TWS A;  3KSQ A;  3QWV A;  1TN7 A;  3CK8 A;  2VQ2 A;  5FQ8 A;  4RSY A;  5AQ7 A;  1Z6T A;  3Q78 A;  2P9L G;  4OAV B;  4JZY A;  2XGM A;  2WXK A;  5A6C A;  1N4P A;  2MRI A;  4EPZ A;  3SGH A;  1VDY A;  3OAW A;  4J8F A;  3L13 A;  1KZP A;  2RG8 A;  3L16 A;  1JWF A;  3RAU A;  1A17 A;  5BW8 C;  3LXU X;  3UI2 A;  4HOT A;  3FU3 A;  4EZJ A;  2FO1 E;  1HFA A;  3Q5M A;  2R17 C;  5LX8 A;  3LY8 A;  3ABL E;  4U63 A;  1MHQ A;  3ISM C;  2DYR E;  1WY6 A;  3G2W A;  3ZU7 B;  3ZFW A;  5AQA A;  2LSU A;  2AW6 A;  2GRO B;  1Q2Z A;  3ZN3 A;  4J8D A;  1BPO A;  5JMN D;  1HX8 A;  2IY0 C;  2KZT B;  5CBO A;  2JLB A;  4U8V D;  2IOL A;  3L82 A;  3EU9 A;  4I43 A;  1G3N B;  3PZD A;  3NF1 A;  4AOF A;  2C0M A;  3ABM E;  2XQ0 A;  5EID A;  4DUI A;  3PUJ A;  3PEV B;  3SFX A;  5J90 A;  3J5Q B;  4CZ2 D;  4ZFH A;  2PL2 A;  3D9P A;  3HXB A;  5LCW C;  2VSN A;  3FFL A;  1O1R A;  4HLL A;  4Y6C A;  3V30 A;  1OWP A;  3I4G A;  2WXM A;  3IXE A;  3HVE A;  4GCN A;  3U66 A;  3B13 A;  4GYO A;  3SFZ A;  1OCO E;  5T8I A;  1DNP A;  4B89 A;  3SBT B;  2P9K G;  3WXX A;  5JHB A;  1LD7 A;  4RG9 A;  3CHS A;  2BTD A;  4YDW A;  4YDE A;  3HXE A;  4IYP A;  1N4Q A;  3GZ2 A;  2J09 A;  4FJY A;  2X6J A;  2XCC A;  2VGY A;  3MX3 A;  2E0I A;  3ZIM A;  3E32 A;  2LAI A;  2MHK A;  1K1B A;  4UI9 J;  3GYZ A;  4NQ0 A;  2CG2 A;  2WXN A;  5G55 A;  1IKN D;  1RZ4 A;  2QYU A;  5KJK A;  3FTW A;  3EU5 A;  3ENE A;  3NB2 A;  3MZL B;  2WXH A;  4WNG A;  5D66 A;  5AN8 A;  3JCK C;  2V8S E;  3Q75 A;  4HBD A;  3EIQ C;  2ZGD A;  2B0O E;  3SY2 A;  3ESL A;  2I1K A;  4GA1 A;  3MYV A;  3UM1 A;  1BLX B;  3UIP C;  5B1A E;  4KZ0 A;  2FBN A;  2CHW A;  4LCT A;  4FC8 A;  2H6I A;  4BSX A;  4UWF A;  2NSZ A;  3CVV A;  5B1B E;  4MS6 A;  4HI9 A;  2Q7F A;  3L6A A;  3ULE G;  3FUF A;  3PZ2 A;  4K5B A;  4BY6 A;  4K0R A;  4ANV A;  4MKT A;  2EQX A;  3CKC A;  5ARG A;  2WB2 A;  4HOS A;  2F8Y A;  1IQU A;  2Y4T A;  4N3C A;  4DX1 A;  3ABK E;  3CEQ A;  2VTB B;  3AG1 E;  5AJD A;  1E8X A;  1QBQ A;  5AAO A;  3APF A;  1O1T A;  1E8Z A;  2XZD G;  2OEW A;  4N2Q A;  2GRN B;  3EIJ A;  3CVY A;  1H2V C;  4GTT A;  5FZR A;  5AEN A;  2V0P A;  4GTV A;  4C0M A;  2CG3 A;  1BD8 A;  4TXR A;  3S7J A;  3FTX A;  4LNU D;  4EBA G;  2P9P G;  3D3M A;  4G11 A;  1IHG A;  3CLJ A;  2YIN A;  4RLY A;  4PS8 A;  3LY7 A;  4GML A;  2DVW A;  3ONK A;  4DPR A;  3R7Q A;  3E37 A;  4XI0 A;  2L0I A;  4HRL A;  4C0E A;  1MZC A;  1TNU A;  3NAW A;  4B0Z A;  2P9U G;  2IO3 C;  5T4Y A;  1NA0 A;  4FU3 A;  2GRL A;  3T8K A;  3KD7 A;  4ILI A;  2DYS E;  4CRW A;  2PNN A;  4CEM A;  5KJN A;  1TNZ A;  5AQB A;  3Q7A A;  3B7R L;  5IY5 E;  2JEK A;  2YHC A;  4M3O A;  2J9Q A;  4J7W A;  5ENQ D;  3SHF A;  3HIZ A;  3B7T A;  2C0L A;  4HOQ A;  3UIN C;  4LER A;  3R9A B;  3G2T A;  3FHE A;  3GZS A;  3RU0 A;  4AY5 A;  4MRU A;  2ZXW E;  3ASF A;  1HU3 A;  3I3N A;  1K3Z D;  3FTY A;  3OXL A;  2L6J A;  2XGS A;  1IHB A;  3CVP A;  4LSZ E;  2J4B A;  4HLE A;  1SA5 A;  2J4D A;  3ESK A;  4TXQ A;  2LSV A;  5J08 A;  3ZYM A;  3QB2 A;  1MJ0 A;  1GW6 A;  5FIN A;  4XI9 A;  1H6P A;  2XS8 A;  3L54 A;  5G05 C;  3KS2 A;  3Q79 A;  2AXV A;  1JCQ A;  2QFC A;  3UMV A;  4G8K A;  1B89 A;  3JXJ A;  4LUN U;  2YQ8 A;  1Z3X A;  5EN5 D;  3CSF A;  3QNK A;  3QOU A;  2WXQ A;  4DX2 A;  4EEC A;  4Y6W A;  2R5S A;  1FVF A;  2HM8 A;  4UUC A;  1WG0 A;  5AQ9 A;  5KWD A;  3RO2 A;  4Q94 A;  3AG4 E;  5FQ7 A;  3T9K A;  3U64 A;  4N3B A;  4JVS A;  1KZO A;  3ZYK A;  2GRP B;  4I9C A;  3PRZ A;  3SFY A;  3FUL A;  3RJV A;  4U95 D;  3DSW A;  3ASD A;  2WXL A;  4GMR A;  2WM9 A;  1UW4 B;  2IOS A;  4CGV A;  3D9O A;  2RKK A;  4BX9 A;  4ANW A;  3EDT B;  5CER B;  3C98 A;  4U0S A;  2XEV A;  5BUZ A;  3O4Z A;  3BG0 B;  3C3O A;  2XPY A;  2FF4 A;  3NBN B;  4CDN A;  3ZYQ A;  5T3R A;  1N0R A;  2XGO A;  3IV0 A;  4GZ6 A;  2V5Q C;  2J8S D;  3DEP A;  4BSZ B;  1BI7 B;  2NYJ A;  1E8Y A;  4N39 A;  4P29 A;  4TV3 A;  4AM9 A;  2EIJ E;  5CMW A;  2IQC A;  4GTR A;  4IRU A;  1INZ A;  3CHR A;  1ELR A;  5EIL A;  3TAX A;  3ZXS A;  4GTQ A;  1AWC B;  3D9K A;  3B7B A;  3CK7 A;  3JYS A;  2BKG A;  2WXG A;  2DZN A;  3HDX A;  3UKR G;  4ABN A;  3TWR A;  1SW6 A;  3PNT B;  2IEJ A;  4A1G A;  1HZ4 A;  4CGW A;  5BPP A;  4NIK A;  3FUE A;  4JD2 G;  2OVB A;  3ASN E;  2F0Y A;  3S7D A;  1EYH A;  3I4R B;  3JQ1 A;  1BU9 A;  3ZKJ A;  3ZRH A;  4EQF A;  1N94 A;  4WND A;  3ASG A;  1TNO A;  3C3R A;  4XX5 A;  3ZHE A;  1K1A A;  3MV2 B;  1S64 A;  1OCZ E;  2HE0 A;  3V31 A;  1YMP A;  1JCS A;  3RIB A;  3T5X A;  2EIM E;  3FU6 A;  4TUU A;  2VGE A;  3EHM A;  4G1T A;  2GRQ B;  4BFR A;  4BEP A;  5ARF A;  3FH5 A;  2I9C A;  1YA0 A;  4DX5 D;  4AIF A;  2VGX B;  2RFA A;  3FUK A;  2PM6 A;  1FT1 A;  2LNI A;  1D8E A;  2V4H C;  1XGW A;  4FJZ A;  4OVU A;  3C5R A;  4HRM B;  3S7F A;  3RKV A;  4HB5 A;  5G04 J;  5C1D A;  4N3A A;  4E85 A;  3PZ4 A;  4U04 A;  4Q69 A;  1N54 A;  4EZL A;  5CBN A;  1ELK A;  2AXZ A;  2J49 A;  5BXU A;  3BU8 A;  1V54 E;  3CR3 A;  4YND A;  4O60 A;  4ANX A;  2FI7 A;  3ZVV A;  3FEY A;  2Y3A A;  5JJT A;  4KVM A;  1QZ2 A;  4ANU A;  1TNY A;  1WDY A;  1UG3 A;  3SF4 A;  1TEZ A;  2EIN E;  3QK0 A;  5M72 A;  4GU5 A;  3DXK G;  4I17 A;  2RFM A;  2R2L A;  3AU4 A;  4BT8 A;  3MKR A;  4APF A;  1YCS B;  4EHM A;  3AG3 E;  3BQO A;  2MYO A;  3LEW A;  2KCK A;  3TGO A;  1P5Q A;  3PE3 A;  2CHZ A;  3LCA A;  4NAC A;  5BV1 A;  4KXK B;  1N0Q A;  3LJN A;  4DJA A;  1EF1 C;  3FH8 A;  3QAQ A;  4DX6 D;  1KT1 A;  4AJW A;  2X6F A;  4UQX A;  5KCM A;  3IHV A;  3AG2 E;  4LEU A;  1PC2 A;  4A63 B;  5G2N A;  2H6F A;  4ATG A;  1FVH A;  1OWL A;  3VLD A;  3W9G A;  1U3D A;  2UY1 A;  3CV0 A;  3Q73 A;  4JW1 A;  2IFU A;  2KAT A;  4N5Q A;  2MOW A;  3FUM A;  4OVV A;  3TJP A;  4DRX E;  2X3M A;  4Z68 A;  2ETB A;  2OV8 A;  4WWN A;  4CCA A;  3CQC B;  4HQD A;  5JJ6 A;  3CHQ A;  3DSU A;  4KVO A;  4I1M A;  4JPS A;  5D0Q D;  4URK A;  3ZPJ A;  4G25 A;  2CFU A;  3FU0 A;  1TJC A;  5LFA A;  2WXI A;  2WPV A;  4E6H A;  5CRU A;  1OWN A;  4PS7 A;  5LP0 A;  2XEH A;  4EZK A;  3HRA A;  2XPZ A;  4I9E A;  3PZ1 A;  1RW2 A;  5FQ6 A;  3EUV A;  4K5C A;  1JCR A;  4LNB A;  2C2L A;  2OND A;  5CMY A;  3LYA A;  3Q47 B;  3TWW A;  5CEC B;  3APC A;  1JPL A;  3CGH A;  4G26 A;  3L08 A;  1QNF A;  1YYH A;  2VYI A;  3B7U X;  3HVE B;  2BED A;  2I1J A;  3VTY A;  4G2V A;  5LCW J;  2BKK B;  3PVL A;  3E4B A;  1S70 B;  4H7Y A;  3TL5 A;  4KMO A;  1LF8 A;  2FEZ A;  2LXL A;  4G8L A;  4GTP A;  2WXF A;  2Y0B G;  2BF0 X;  2XS1 A;  1SVX A;  4RVB A;  2LAH A;  2KCV A;  1UN9 A;  4A55 A;  1UJK A;  4ILG A;  3C3Q A;  1QQE A;  1V55 E;  3QJZ A;  4J6I A;  2R02 A;  1MQS A;  1X5B A;  4XZ4 A;  3MGB A;  3RSE G;  3SNX A;  5HRY A;  2V4L A;  3UPV A;  2WXJ A;  4HI8 A;  2ZU6 B;  3SO8 A;  3HG0 D;  5BNW A;  2KC7 A;  3ZGQ A;  3V2X A;  3UTM A;  1MX2 A;  3CQG B;  3PUK A;  2X6H A;  3ZYL A;  2HO1 A;  4CYM D;  3TXN A;  4GPM A;  3D9M A;  4JHK A;  4UQY A;  1UOH A;  2M63 A;  3G2V A;  3ZUV B;  2E2E A;  4XKC A;  2EIK E;  1LD8 A;  5ITZ F;  2WQ7 A;  1L5J A;  1H2U A;  2OOE A;  5FQ4 A;  3TG5 A;  2HR2 A;  3P1U A;  2P58 C;  3ULQ A;  4K03 A;  3S2A A;  2R03 A;  5ANR A;  3AAA C;  4HS2 A;  2ZIS A;  4O1O A;  4GMJ A;  4A1S A;  3QWW A;  1MX4 A;  1X81 A;  1TNB A;  2A4Z A;  1OWO A;  2GW1 A;  3FUJ A;  4F1P A;  4HOR A;  3D9I A;  4UWK A;  5KNG A;  3N71 A;  4GCO A;  2ETC A;  3FUN A;  4F53 A;  3CHO A;  1HH8 A;  3Q7F A;  2NC9 A;  3D9N A;  4U0U A;  3D9H A;  4FLH A;  1HG5 A;  3ZEF A;  3ASO E;  2WXP A;  4O6F A;  3UM0 A;  3TWQ A;  2QY7 A;  2H6G A;  2YNQ A;  4B8C B;  3DSS A;  1Z3Y A;  3CIA A;  1H2T C;  2DWZ A;  3QDN A;  2XEN A;  4TUM A;  3FUI A;  4BWR A;  3VLF A;  3ZW3 A;  5LOZ A;  4BER A;  4FHK A;  3DSV A;  4GZD A;  4UWG A;  1ZB1 A;  3PZ3 A;  1K8K G;  1QYM A;  3MA5 A;  4TRQ A;  4BES A;  2GRM A;  3FH7 A;  4YVO A;  4XIF A;  4N5C A;  3V79 K;  3KSL A;  4FLB A;  3FTV A;  3Q15 A;  4D10 C;  5DIZ A;  1D8D A;  2J07 A;  1NL4 A;  5EX0 A;  4L7T A;  2NXP A;  5EYL A;  4I6J A;  3ZXP A;  3SI5 A;  3C72 A;  3T5V A;  4G24 A;  4WUY A;  5HI7 A;  4B94 A;  4UI9 K;  4LRZ A;  3ONL A;  1PAQ A;  3QKY A;  3IKO B;  2DZO A;  3AS4 A;  3MKQ A;  1BI8 B;  4YVQ C;  2AXU A;  4HNA D;  3LVR E;  2WQH A;  1TYQ G;  4J8E A;  3U4T A;  1ZU2 A;  1N11 A;  4FA6 A;  2J08 A;  4LG6 A;  3IHY A;  4HOU A;  4UQZ A;  3MEK A;  3UXG A;  2I6H A;  3G2S A;  3KAE A;  1ELW A;  4BTB A;  2XHE A;  4V3I A;  3UIO C;  3K9I A;  2R59 A;  3ULY A;  4JL0 A;  2LO6 A;  3SZ7 A;  3VTX A;  4JXT A;  4U8H A;  3IBE A;  1OCC E;  4XE0 A;  4NUR A;  3E30 A;  1S63 A;  4YDO A;  5FZQ A;  3HHM A;  2H6H A;  5EIB E;  2GRR B;  2ION A;  3ASH A;  3NQP A;  3FDH A;  4ACK A;  4KBQ A;  5G05 J;  2R05 A;  2X6I A;  5B3S E;  4I6G A;  4I1A A;  2AJA A;  2KZT A;  3EHQ A;  3EHN A;  4J0U A;  3W9F A;  4GYW A;  1SZ9 A;  2WVI A;  2FO7 A;  5EYP F;  3LJ3 A;  5FTP A;  3PEU B;  3L17 A;  4JHR A;  1HF8 A;  2BUG A;  3R7R A;  1SQM A;  3D9J A;  4LNG A;  4PH4 B;  3EJN A;  3L22 A;  3LKU A;  2KXP C;  3UM2 A;  1JUQ A;  3HXD A;  4L2Y A;  2FUL A;  2PQR A;  2F8X K;  1TR4 A;  4DLQ A;  3NOG D;  3DBS A;  2IF4 A;  5KJM A;  3WG7 E;  3E34 A;  5KNH D;  4AY6 A;  4GAA A;  3MCX A;  3LDZ A;  1Y6I A;  3D9L A;  4AEZ C;  1H6O A;  3G2U A;  4AXH A;  4JA7 A;  3U9W A;  5HQ8 A;  2VSO E;  4L1B A;  2GGF A;  4B8A A;  2VSY A;  4FP7 A;  3ZNG A;  3UT8 A;  3PRE A;  4O1P A;  3PDN A;  3O48 A;  4UI9 C;  3Q49 B;  3FUH A;  5DBK A;  2ILR A;  1HG2 A;  2ZIR A;  4J8Y A;  1Z5S C;  3RRU A;  3IEG A;  2L9B A;  5EDS A;  2AWI A;  3AJI A;  3R9M A;  3SQV A;  3RRM B;  1IXV A;  3PNL B;  4RG6 A;  5BT1 A;  2PZI A;  2OEV A;  1DCE A;  3ML9 A;  3NOC D;  3RO3 A;  4JA9 A;  3DPD A;  4GB9 A;  4JC8 A;  3Q4A B;  4CT0 A;  2OVF A;  5KBA A;  3ZHE B;  3HXF A;  3JUI A;  1IYG A;  4GZ3 A;  3EHR A;  2Y1L E;  5CCL A;  4HXI A;  3FU5 A;  4CDM A;  5AJL A;  4DLO A;  4A3T A;  5FJY A;  1N4R A;  1O1S A;  1E7U A;  3KEZ A;  5E76 A;  2P2C P;  3DWL G;  3PS6 A;  4RQI A;  5CED B;  2OCC E;  2UWJ G;  5JHA A;  1NA3 A;  4JEH A;  4A3V A;  1O5M A;  1SZA A;  5HS0 A;  4GPK A;  2WMO A;  4R7L A;  3LVQ E;  3OXG A;  2IO2 C;  3U3W A;  1EPU A;  3DPY A;  4EBA A;  3FY4 A;  3TWT A;  3UUX A;  3FEX A;  4WWO A;  4ILH B;  1KT0 A;  2DCP A;  4G23 A;  4GA2 A;  5AYW D;  4BX8 A;  4WNE A;  2VTB A;  1OXJ A;  1UN8 A;  1A5E A;  3QC1 A;  3ML8 A;  2WXR A;  1U2V G;  4U07 A;  1KPS B;  3CHP A;  2DIW A;  1PY1 A;  2YHE A;  4I2Z A;  5D0O D;  4UWH A;  1ZBP A;  4F6R D;  2ETA A;  2XZT G;  4KYO B;  4CDR A;  5CHE E;  3CVQ A;  3HYM B;  1NI1 A;  3FTU A;  2Y69 E;  1LTX A;  4FHJ A;  4K5A B;  4IN3 B;  1DVP A;  4PS3 A;  1FCH A;  3TWX A;  4QQI A;  5CRV A;  4DI3 A;  2KM4 A;  1N4S A;  4MBG A;  1N52 A;  1JWG A;  2L6B A;  3PE4 A;  5C2Y A;  3I5P A;  1Y8M A;  2UY1 B;  4C48 B;  4DK5 A;  4W9R A;  3S7B A;  3TXM A;  4HRN A;  3RRN B;  4IUL A;  4F7A A;  2V5F A;  1HE8 A;  3Q9N C;  4I6E A;  5BV0 A;  4ZHB A;  3CVL A;  3BG1 B;  3UX4 A;  2QZA A;  5EKQ D;  5EX3 A;  3CK9 A;  3JQ0 A;  3SD5 A;  5AIJ A;  4L2L A;  2WXO A;  4NRH B;  3PH0 C;  4WNF A;  3CVX A;  3HXC A;  4JEU A;  2CFZ A;  1MYO A;  4L9P A;  2EIL E;  4XKB A;  4X8Q A;  4AP2 A;  2WQ6 A;  4C9B B;  4OAU C;  3AS5 A;  3QWP A;  4I2W A;  5FT9 A;  2QC9 A;  5ENT D;  2Y4U A;  3JUE A;  2I2O A;  3LS8 A;  3UT4 A;  5ENO D;  2XRZ A;  5HKP A;  5A7D B;  4YDY A;  1HXI A;  1E8W A; 
#chains in the Genus database with same CATH homology
 3C3O A;  3UM0 A;  2XS1 A;  3RAU A;  3C3R A;  3UM3 A;  5CRV A;  3ZXP A;  2OJQ A;  4JIO A;  2R03 A;  3ULY A;  3UM1 A;  5CRU A;  2OEX A;  3R9M A;  2XS8 A;  1ZB1 A;  2R05 A;  3C3Q A;  2OEW A;  2R02 A;  3UM2 A;  2OEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...