5CRVA

Crystal structure of the bro domain of hd-ptp in a complex with the core region of stam2
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
361
structure length
357
Chain Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKAPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
publication title Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0
pubmed doi rcsb
source organism Homo sapiens
total genus 142
structure length 357
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 5crvA00
2XS1A 3RAUA 3UM0A 3ULYA 3UM1A 3UM2A 3R9MA 2R03A 5CRUA 3C3QA 3C3OA 3UM3A 1ZB1A 2XS8A 3C3RA 2OEVA 2R02A 3ZXPA 5CRVA 2R05A 2OEWA
chains in the Genus database with same CATH superfamily
4WNGA 5EYPF 1MX6A 2WXKA 5G04J 1HF8A 1IXVA 3FEXA 2RD0A 1MJ0A 4GYWA 3PE3A 2J09A 2WXGA 4G8LA 2ETBA 3RJVA 4WWNA 4UQXA 4BESA 1Z3XA 2ZGDA 3FTYA 3ZNGA 4IYPA 4YVQC 4O60A 3CV0A 1S63A 3ABKE 3AG1E 3CVPA 4WUYA 4U0UA 4ACLA 4HORA 4GU5A 3ZXSA 1WG0A 3CK7A 3FU5A 3ML8A 2WXQA 3ZXPA 3PS6A 4QQIA 3B13A 3MZLB 1INZA 2WXPA 2Y3AA 4DX6D 1KZPA 3L08A 3LPZA 4LSZE 3FEYA 2QC9A 4ABNA 2VJ8A 4J8SA 4I6GA 4GTMA 2XRYA 1D8DA 4ANXA 1D8EA 4AEZC 3RIBA 3IEGA 3V30A 1MZCA 3SBSA 4N3CA 3FU3A 4LEUA 4GB9A 1FT2A 2F8YA 4I2ZA 4K0RA 2UWJG 2AWIA 4UI9C 2DVWA 3I4RB 1ELRA 5FINA 1S70B 1E8ZA 1NZNA 2WMOA 2XS8A 2OEVA 3UIOC 5CBOA 5CRVA 2YHCA 3I3NA 3KD7A 2V4LA 2ONDA 3TWWA 4JL0A 2B6CA 3U4TA 3BG0B 4GA2A 3GW4A 5LCWC 4ZHBA 4JEHA 2X38A 1MYOA 2NC9A 2RKKA 2PQNA 4G23A 4GTSA 3L17A 3OXFA 1BD8A 3GYZA 5FIOA 4HFGA 3DEOA 2C0MA 3FHEA 4HI8A 2V5FA 5LX8A 3ZYKA 4JB8P 4ATZD 1MQSA 2WQ6A 2XGSA 3JCKC 4JA7A 1KPSB 3CHRA 4U07A 4AIFA 4O1OA 4G24A 4DX5D 3EHQA 1ZU2A 2P9LG 2CG3A 3QJZA 2BTDA 3HVEA 4JPSA 3E37A 4ANVA 3TGOA 4FLBA 4U8HA 3RKVA 5BW8C 2P9SG 3ENEA 2GRRB 4AXHA 1BLXB 1OCOE 4JHJA 4GA1A 3P2BA 2AXUA 4KMOA 3ULQA 3LXUX 2BF0X 5FWQA 3E32A 3VLEA 3DRAA 3MV2B 4X8QA 4XE0A 1K1BA 2C0LA 3TWQA 3C5RA 1IYGA 4L2LA 3HXEA 3BUAA 2GRNB 4HLLA 2PNNA 2WXLA 1B89A 1OCRE 2EINE 3G2TA 2X6JA 1LF8A 1NL4A 5T8IA 4HS2A 1O1SA 2IOSA 3TJPA 5ARGA 2CFUA 4GMJA 2I2OA 3T8MA 4TV3A 2XCBA 3QAQA 3OXLA 1EYHA 2V8SE 4U0SA 4E85A 3AS8A 3CHMA 3UQ3A 5AQBA 2GRPB 2I1KA 1TN8A 3ABME 3CVUA 1OWOA 3CSFA 1S0PA 3DBSA 4GZDA 5D0OD 4N39A 1HU3A 3MJWA 4E6HA 3FTSA 5E76A 4TRQA 3ZIMA 2J08A 2EIKE 2A5UA 5FJYA 4G11A 4WAFA 1H2UA 4FADA 1L5JA 4AJWA 2JLBA 5KBAA 2L6BA 1Z3YA 3LVRE 1NFIE 3U3WA 4ANUA 2MHKA 5LFAA 4HOUA 4GCOA 2WPVA 2BKKB 3S7FA 4O6FA 4F7AA 2X3MA 4FA6A 4ILHB 4ACKA 3MKRA 4IRUA 2NSZA 4I43A 5CEDB 3RSEG 3CVVA 4EZJA 3Q47B 5CCMA 1Z6TA 3QDNA 3MX3A 1QQEA 1U3CA 5FTPA 5ARFA 3AU4A 2VGXA 3EDTB 2PL2A 3F6QA 2PM6A 3FY4A 3IXEA 3HXDA 2EIME 2IO3C 3B7BA 3JUIA 2GRMA 3CLJA 5AQAA 3O48A 3I5PA 5KJLA 3JYSA 1FPPA 3SD5A 2P2CP 3UM1A 1E96B 2J9QA 3D9MA 2GROB 5G55A 5AYWD 4ATGA 4EZKA 5KNHD 4UI9J 2VSXE 3IHYA 4GTRA 4G2VA 3DSVA 4OAVB 2DYRE 2RFMA 3G2UA 4UI9K 2HE0A 3U66A 1LD8A 2F8XK 3NOCD 1ZBPA 3PREA 3C72A 1N4SA 3Q73A 3PRZA 2XZDG 4J0UA 1BPOA 5C2YA 3E34A 4BX9A 4URKA 2V0PA 3CVWA 1RZ4A 4U8VD 4C48B 4A55A 5LCWJ 5AQ9A 2KZTB 5A23A 2P9NG 4F1SA 3FTXA 2LAHA 4HRLA 3ESKA 4JA9A 1K3ZD 4GMRA 1VDYA 5KCMA 4DI4A 5ENNA 2Q7FA 1JCQA 2XEEA 1OT8A 4NIKA 4I9EA 1HH8A 2BKGA 1HZ4A 4YDWA 4APOA 4XZ4A 3BU8A 5KWDA 3CVLA 5CCLA 3ULYA 3ZUVB 5LP0A 3TG4A 3NZUA 3ZKJA 3FTUA 4H7YA 2VSOE 3B7SA 3ASFA 4DPRA 4N3BA 5CERB 4CT4A 2XPYA 4JC8A 1TNOA 1TEZA 2WXJA 3MKQB 4KBQA 3QARA 5HS0A 2DCPA 3D9NA 2J8SD 3TWRA 3ULEG 3G2WA 4LCTA 3Q7AA 1HE8A 3ZVVA 4GZ5A 2V4HC 1X81A 4GTQA 1KLXA 4XKBA 4JW1A 4WNEA 2E0IA 3SFZA 3E30A 2R05A 1OCCE 2L9BA 2R59A 3V79K 2OVFA 1H0AA 3MGBA 4ME2A 3LY7A 1ELWA 4PH4B 2V5QC 3L22A 2P9UG 3AS5A 3NZSA 3SF4A 3HXBA 5HQ8A 3IKOB 2HO1A 4QFVA 2J49A 5ITZF 2YHEA 3RRNB 2OV8A 3JQ1A 3GZSA 4K5AB 3KAEA 2CG2A 3AG3E 2AW6A 1TJFA 5JHAA 3MEKA 3C3RA 5E75A 2IOLA 2LXLA 2OCCE 4OYSA 4BT8A 4YDEA 2DBAA 4R7LA 1UN9A 3LEWA 2WXRA 1H6KA 4GCNA 3L16A 2IY0C 5CRUA 2L0TB 3AAAC 4YDYA 4ANWA 4GPKA 4J6IA 2F0YA 4GZ6A 1PC2A 5ENSD 3SBTB 1TN6A 2ZISA 4A3TA 4P29A 1V54E 5BV0A 1D9SA 3R9MA 5A6CA 2VTBB 2C2LA 1GW6A 3CGHA 4GTTA 4K03A 1WY6A 4RLYA 3SFYA 1N94A 3ZN3A 4UUCA 3ZYMA 1BI8B 2CFZA 3CKBA 4NRHB 5FQ4A 4AV7A 1MHQA 4BT9A 4NQ0A 2XRZA 4TUMA 3DSXA 3PEVB 3D9PA 1H19A 1N0RA 3UX4A 1FCHA 4DLOA 4Z68A 3ZHEB 2LNIA 4GTVA 4HNAD 3DPDA 2X6KA 4RSYA 4C0MA 3S7JA 4DK5A 4U95D 3UKUG 2OVBA 4U63A 2WQ7A 1YCSB 1SQMA 3CVQA 1OY3D 1BU9A 4AOFA 2ETAA 3LY9A 3EHRA 2HYZA 2E2EA 3VLFA 4BFRA 4GYOA 1IKND 4JXTA 4B0ZA 4EECA 3CHQA 5BUZA 5AN8A 4GPMA 4U04A 2GGFA 3FTZA 3Q15A 5FZSA 4J8DA 2NYJA 2WVIA 2ZU6B 3ESLA 4F6RD 4B8AA 4CGWA 2GRLA 3FP3A 3OAWA 3FUMA 2IFUA 3CKCA 4PS3A 4WNDA 4WWOA 4BSZB 3FUHA 4PDXA 2KCVA 3Q75A 5EILA 4U0ZA 3O4ZA 3ZYQA 4J7WA 3C98A 1H2VC 5BNWA 1N4RA 4CZ2D 3SO8A 1SZ9A 2YNQA 3T8KA 4DRXE 2FO1E 4G26A 4LRZA 3MV3B 3L54A 3TXNA 3PEUB 3UM2A 4HOSA 1WAO1 4A1GA 4JHRA 4BWRA 1HXIA 2CHWA 4MRUA 3SQVA 5BT1A 2UY1B 1RW2A 1H6OA 5ANRA 3K9IA 4GYYA 5HKPA 1MX2A 1QYMA 3ZW3A 5DIZA 5AIJA 3MA5A 1EDUA 3RAUA 5EIDA 2PZIA 5B1AE 5HI7A 1SW6A 1IHGA 5D2MC 4ZFHA 3QKYA 1Q2ZA 4YDOA 1ZB1A 3D9KA 3HRAA 2CHXA 5EX0A 3DPYA 3HDXA 1W3BA 4C0EA 2R02A 4J8YA 2JABA 2P58C 4YNDA 3QB2A 3QWWA 1U3DA 4I9CA 1FT1A 3TWTA 4EBAG 2X6HA 3FFLA 4F3VA 1HX8A 5AAOA 2WXMA 2WXOA 4L1BA 4PS8A 5DBKA 5AJLA 1V55E 3PNTB 5CEAA 1SZAA 3B7TA 4KVMA 2H6FA 1QNFA 5FQ8A 4BETA 4WNFA 4I2WA 2R5SA 4AM9A 3ASGA 1IQRA 4G1TA 1KZOA 2JEKA 3FTVA 5BPPA 2ZGGA 1EPUA 4KYOB 5J08A 1WM5A 3ML9A 3V31A 3SNXA 3AG4E 2ZXWE 4HI9A 1K8KG 4ILGA 2NXPA 2FULA 2XZTG 3FWVA 4FLHA 3NQPA 1S64A 4I1MA 3QOUA 2MRIA 5KJNA 1HG2A 4KXKB 3UIPC 2XHEA 4KZ0A 4BY6A 2R17C 2Y4UA 2FI7A 2I9CA 4HOTA 2MYOA 3GZ2A 1N4PA 3PDNA 1DCQA 3Q9NC 4B8CB 1H6PA 1MX4A 3FH5A 4WWPA 5HRYA 2VGEA 1PAQA 4FJYA 1N52A 4Y6WA 2A5EA 5CMWA 4UWGA 1Y8MA 4TXPA 2DWZA 5IY5E 2Y69E 4TXRA 3IHVA 2Y4TA 2P9KG 4V3IA 4UWHA 1O1RA 1E8XA 2KZTA 2XGOA 4CEMA 4K5CA 4BSXA 2PM7A 1N4QA 3LDZA 5CBNA 4DUIA 3CQCB 3TWUA 1HS6A 2LXMA 4IULA 3HXFA 3CHPA 3PUKA 2KM4A 3LKUA 4B94A 3T9KA 3B7RL 4CYMD 1E90A 2IONA 2Y1LE 5JJ7A 3MKQA 4L2YA 4F1PA 1KT1A 4Y6CA 4FULA 2R03A 5AQ7A 2IU1A 2LUHA 1SA4A 3C3OA 3DSTA 4L7TA 3LCAA 3DXMG 2IEJA 2WXIA 3FH8A 1O1TA 1UJKA 5KJMA 4CDNA 1DC2A 1Y6IA 5FT9A 3D9IA 1N0QA 1OXJA 3AJIA 4Q69A 1K1AA 3BEEA 3D9JA 2XS1A 3UMVA 3NB2A 4OAUC 4XI0A 4O1PA 5FQ7A 3UM0A 2VGXB 1H2TC 2L6JA 3TWVA 5AARA 3PH0C 2IQCA 4RQIA 4A63B 4TUUA 3ZRHA 3PUJA 2H6HA 5H7PA 4J8FA 1DCEA 3R7QA 4B93B 2QFCA 3TWSA 3ASDA 3Q5MA 1YMPA 3E4BA 3FUFA 4HB5A 3V2OA 3LYAA 2KXPC 1NA3A 4RG6A 3DEPA 4CDRA 1O5MA 1UN8A 2LSUA 1FVHA 3TXMA 5D66A 3QWVA 4HBDA 2VTBA 2DIWA 4FHJA 5B3SE 2WM9A 2XQ0A 3R9AB 1TNZA 3JXJA 3SZ7A 5AJDA 4CGVA 3MYVA 3ASHA 1Z5SC 3L6AA 4BERA 3TWXA 4HRMB 4L9PA 3IBEA 2DZNA 3VTYA 4B89A 2A4ZA 3UI2A 4FC8A 3X2QE 2AXVA 5J90A 3EJNA 5ENPD 4OVVA 3ZHEA 1E8WA 1OWLA 4XIFA 2LO6A 4M7CA 3KEZA 2H6IA 3CQGB 5BXOA 3L13A 2ZIRA 4KT6B 3B7UX 5G05C 2L0IA 3ZYLA 4CRWA 3OTNA 2XGMA 3ISMC 3E33A 2OOEA 3RRUA 3U9WA 2BUGA 2QZAA 4Q96A 5JJTA 4KZCA 5ENTD 3FUDA 1TR4A 4BX8A 3W9FA 3L9TA 3AG2E 4LNUD 3S7DA 4PUCA 3FU6A 4MBGA 4N3AA 1FVFA 3QK0A 3S7BA 5CECB 2DZOA 1IQUA 1U2VG 3UPVA 1LTXA 3DWLG 2H6GA 3LVQE 3FUEA 5KJKA 3FDHA 4EZLA 4I1OB 3UINC 5JJ6A 5FQ6A 5AENA 2GRQB 2UY1A 1EF1C 1UJJA 1E7UA 4GAAA 3KEAA 3NAWA 4Q94A 1TNUA 2Y0BG 4XX5A 4TXQA 1DNPA 2XEHA 4UWFA 3CVYA 3PZ4A 4DX1A 4U96D 3V2XA 4NURA 4KVOA 2ETCA 2DYSE 4BTBA 3PZ1A 3ONLA 4HVBA 3BG1B 4UQYA 2QYJA 4CDMA 2VSYA 4GZ3A 3WXXA 2GW1A 3CK9A 1JCRA 4HLEA 1TNBA 2EQXA 4AVXA 4APFA 2IF4A 2XPIA 4F53A 4AY6A 4JHKA 5EYLA 2VQ2A 4GA0A 4CCAA 3CVXA 4N5QA 5ENRD 1OWMA 2HM8A 5LOZA 4DX2A 2QYUA 3UM3A 1JWFA 1NA0A 3NBNB 2J4BA 1UOHA 4EPZA 3DXKG 2WMNA 2MOWA 3N71A 1A5EA 2KBXA 3L82A 2IJGX 1SVXA 5D0QD 5FZRA 3TL5A 2YINA 1JCSA 4DJAA 3HIZA 1XGWA 2AVPA 4J8EA 3PNLB 1AWCB 1HG5A 1TN7A 3HHMA 4RG9A 1P5QA 3J5PA 4EBAA 3SFXA 1PY1A 2FEZA 1A17A 4I6EA 4OVUA 4N2SA 2P9PG 3SY2A 5BV1A 3CHOA 3ZPJA 4FU3A 5T3RA 2X6FA 3Q78A 3CHSA 2B0OE 1OWNA 3CEQA 3UXGA 3UTMA 1JWGA 3HYMB 3PZ2A 2XCCA 4I17A 3FUIA 4LNGA 2YQ8A 2RFAA 2EIJE 2VYIA 4LG6A 2KC7A 3NOGD 5ENQD 3JXIA 1JPLA 5G2NA 3ZFWA 5JHBA 3PE4A 3EU9A 4N2QA 1E8YA 3FH7A 3D3MA 2BEDA 3TAXA 5BXUA 2XPZA 3Q4AB 1QBQA 2WXNA 3G2SA 4GTOA 2XEVA 3URZA 2LAIA 3VTXA 3J5QB 3FUNA 3HVEB 3U64A 2FO7A 4U7EB 5G04C 3RU0A 4AP2A 1N54A 1TJCA 3RK6A 4AY5A 1QZ2A 2ILRA 2R2LA 3QNKA 4A3VA 4G8KA 4H7XA 1ELKA 4NACA 3T5VA 3D9LA 3UUXA 2RG8A 2OEWA 3CR3A 3JUEA 5JA4D 1UW4B 2AJAA 4IN3B 3SI5A 5EIBE 1AP7A 4W9RA 5G05J 4JZYA 4K5BA 1TNYA 3ASNE 2WXFA 3Q49B 3FTWA 3UT7A 3KS2A 1OUVA 3DSUA 1N95A 3DSWA 2P9IG 4JVSA 2EILE 3AU5A 4DX7D 1N9AA 1NI1A 3EUVA 1YA0A 5M72A 4MLPA 4C9BB 3EHNA 3OXGA 2KATA 3GZ1A 3KSQA 3ZGQA 2I6HA 4I6JA 4U8YD 3UT8A 2M63A 3UKRG 2CHZA 2QY7A 1KT0A 3RO3A 4RVBA 4PS7A 4FHKA 4XI9A 5ENOD 3I4GA 3HXCA 3PZ3A 4YVOA 4XKCA 1XNFA 3EHMA 4GTPA 3APCA 3JQ0A 2X6IA 1HFAA 2HR2A 3AS4A 3FUJA 5EKQD 3W9GA 3G2VA 2J07A 3D9HA 4FJZA 2PQRA 3RRMB 4UWKA 2IO2C 1NP7A 1WDYA 2F37A 4HXIA 3SHFA 5FZQA 4I1AA 1SA5A 3Q9UC 5ANLA 4L23A 4LUNU 1OCZE 3T5XA 3WG7E 3S2AA 4LNBA 4G25A 2VSNA 3HG0D 1BI7B 3DSSA 3FUKA 1UG3A 3B95A 4BEPA 4EQFA 1X5BA 3CSTA 3IV0A 3NF1A 3ONKA 5EX3A 4DI3A 4GZCA 3VLDA 3R7RA 3CVNA 2AXZA 5EN5D 4A1SA 1DVPA 1TYQG 3C3QA 1HO8A 3LY8A 3LJ3A 2WB2A 5EDSA 3EIJA 4MS6A 3ABLE 2J4DA 1N11A 3ASOE 3APFA 1JUQA 3FULA 2WQHA 4DLQA 3BQOA 3Q79A 1IHBA 2VGYA 3FU0A 3SGHA 2XENA 4LERA 4N5CA 5CHEE 3Q7FA 4CT0A 3LJNA 3CK8A 3EU5A 5A7DB 5JMND 3ZEFA 4ILIA 5C1DA 3ZU7B 2KCLA 4JD2G 1G3NB 4JEUA 3CIAA 3MCXA 4UQZA 3TG5A 3APDA 1E7VA 3KSLA 4UWLA 2FF4A 5B1BE 5T4YA 2FBNA 3LS8A 1OWPA 4GMLA 4FP7A 1LD7A 3P1UA 3PZDA 4BTAA 2LSVA 3PVLA 4HOQA 2I1JA 5KNGA 5CMYA 3UT4A 2WXHA 3QWPA 4HQDA 4M3OA 3RO2A 1YYHA 4EHMA 4D10C 4HRNA 4MKTA 4XEIG 2KCKA 3QC1A 3EIQC 3D9OA
chains in the Genus database with same CATH topology
2XS1A 3RAUA 3UM0A 3ULYA 2OEXA 3UM1A 3UM2A 3R9MA 2R03A 5CRUA 3C3QA 3C3OA 3UM3A 1ZB1A 4JIOA 2XS8A 2OJQA 3C3RA 2OEVA 2R02A 3ZXPA 5CRVA 2R05A 2OEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XS1 A;  3RAU A;  3UM0 A;  3ULY A;  3UM1 A;  3UM2 A;  3R9M A;  2R03 A;  5CRU A;  3C3Q A;  3C3O A;  3UM3 A;  1ZB1 A;  2XS8 A;  3C3R A;  2OEV A;  2R02 A;  3ZXP A;  5CRV A;  2R05 A;  2OEW A; 
#chains in the Genus database with same CATH topology
 4WNG A;  5EYP F;  1MX6 A;  2WXK A;  5G04 J;  1HF8 A;  1IXV A;  3FEX A;  2RD0 A;  1MJ0 A;  4GYW A;  3PE3 A;  2J09 A;  2WXG A;  4G8L A;  2ETB A;  3RJV A;  4WWN A;  4UQX A;  4BES A;  1Z3X A;  2ZGD A;  3FTY A;  3ZNG A;  4IYP A;  4YVQ C;  4O60 A;  3CV0 A;  1S63 A;  3ABK E;  3AG1 E;  3CVP A;  4WUY A;  4U0U A;  4ACL A;  4HOR A;  4GU5 A;  3ZXS A;  1WG0 A;  3CK7 A;  3FU5 A;  3ML8 A;  2WXQ A;  3ZXP A;  3PS6 A;  4QQI A;  3B13 A;  3MZL B;  1INZ A;  2WXP A;  2Y3A A;  4DX6 D;  1KZP A;  3L08 A;  3LPZ A;  4LSZ E;  3FEY A;  2QC9 A;  4ABN A;  2VJ8 A;  4J8S A;  4I6G A;  4GTM A;  2XRY A;  1D8D A;  4ANX A;  1D8E A;  4AEZ C;  3RIB A;  3IEG A;  3V30 A;  1MZC A;  3SBS A;  4N3C A;  3FU3 A;  4LEU A;  4GB9 A;  1FT2 A;  2F8Y A;  4I2Z A;  4K0R A;  2UWJ G;  2AWI A;  4UI9 C;  2DVW A;  3I4R B;  1ELR A;  5FIN A;  1S70 B;  1E8Z A;  1NZN A;  2WMO A;  2XS8 A;  2OEV A;  3UIO C;  5CBO A;  5CRV A;  2YHC A;  3I3N A;  3KD7 A;  2V4L A;  2OND A;  3TWW A;  4JL0 A;  2B6C A;  3U4T A;  3BG0 B;  4GA2 A;  3GW4 A;  5LCW C;  4ZHB A;  4JEH A;  2X38 A;  1MYO A;  2NC9 A;  2RKK A;  2PQN A;  4G23 A;  4GTS A;  3L17 A;  3OXF A;  1BD8 A;  3GYZ A;  5FIO A;  4HFG A;  3DEO A;  2C0M A;  3FHE A;  4HI8 A;  2V5F A;  5LX8 A;  3ZYK A;  4JB8 P;  4ATZ D;  1MQS A;  2WQ6 A;  2XGS A;  3JCK C;  4JA7 A;  1KPS B;  3CHR A;  4U07 A;  4AIF A;  4O1O A;  4G24 A;  4DX5 D;  3EHQ A;  1ZU2 A;  2P9L G;  2CG3 A;  3QJZ A;  2BTD A;  3HVE A;  4JPS A;  3E37 A;  4ANV A;  3TGO A;  4FLB A;  4U8H A;  3RKV A;  5BW8 C;  2P9S G;  3ENE A;  2GRR B;  4AXH A;  1BLX B;  1OCO E;  4JHJ A;  4GA1 A;  3P2B A;  2AXU A;  4KMO A;  3ULQ A;  3LXU X;  2BF0 X;  5FWQ A;  3E32 A;  3VLE A;  3DRA A;  3MV2 B;  4X8Q A;  4XE0 A;  1K1B A;  2C0L A;  3TWQ A;  3C5R A;  1IYG A;  4L2L A;  3HXE A;  3BUA A;  2GRN B;  4HLL A;  2PNN A;  2WXL A;  1B89 A;  1OCR E;  2EIN E;  3G2T A;  2X6J A;  1LF8 A;  1NL4 A;  5T8I A;  4HS2 A;  1O1S A;  2IOS A;  3TJP A;  5ARG A;  2CFU A;  4GMJ A;  2I2O A;  3T8M A;  4TV3 A;  2XCB A;  3QAQ A;  3OXL A;  1EYH A;  2V8S E;  4U0S A;  4E85 A;  3AS8 A;  3CHM A;  3UQ3 A;  5AQB A;  2GRP B;  2I1K A;  1TN8 A;  3ABM E;  3CVU A;  1OWO A;  3CSF A;  1S0P A;  3DBS A;  4GZD A;  5D0O D;  4N39 A;  1HU3 A;  3MJW A;  4E6H A;  3FTS A;  5E76 A;  4TRQ A;  3ZIM A;  2J08 A;  2EIK E;  2A5U A;  5FJY A;  4G11 A;  4WAF A;  1H2U A;  4FAD A;  1L5J A;  4AJW A;  2JLB A;  5KBA A;  2L6B A;  1Z3Y A;  3LVR E;  1NFI E;  3U3W A;  4ANU A;  2MHK A;  5LFA A;  4HOU A;  4GCO A;  2WPV A;  2BKK B;  3S7F A;  4O6F A;  4F7A A;  2X3M A;  4FA6 A;  4ILH B;  4ACK A;  3MKR A;  4IRU A;  2NSZ A;  4I43 A;  5CED B;  3RSE G;  3CVV A;  4EZJ A;  3Q47 B;  5CCM A;  1Z6T A;  3QDN A;  3MX3 A;  1QQE A;  1U3C A;  5FTP A;  5ARF A;  3AU4 A;  2VGX A;  3EDT B;  2PL2 A;  3F6Q A;  2PM6 A;  3FY4 A;  3IXE A;  3HXD A;  2EIM E;  2IO3 C;  3B7B A;  3JUI A;  2GRM A;  3CLJ A;  5AQA A;  3O48 A;  3I5P A;  5KJL A;  3JYS A;  1FPP A;  3SD5 A;  2P2C P;  3UM1 A;  1E96 B;  2J9Q A;  3D9M A;  2GRO B;  5G55 A;  5AYW D;  4ATG A;  4EZK A;  5KNH D;  4UI9 J;  2VSX E;  3IHY A;  4GTR A;  4G2V A;  3DSV A;  4OAV B;  2DYR E;  2RFM A;  3G2U A;  4UI9 K;  2HE0 A;  3U66 A;  1LD8 A;  2F8X K;  3NOC D;  1ZBP A;  3PRE A;  3C72 A;  1N4S A;  3Q73 A;  3PRZ A;  2XZD G;  4J0U A;  1BPO A;  5C2Y A;  3E34 A;  4BX9 A;  4URK A;  2V0P A;  3CVW A;  1RZ4 A;  4U8V D;  4C48 B;  4A55 A;  5LCW J;  5AQ9 A;  2KZT B;  5A23 A;  2P9N G;  4F1S A;  3FTX A;  2LAH A;  4HRL A;  3ESK A;  4JA9 A;  1K3Z D;  4GMR A;  1VDY A;  5KCM A;  4DI4 A;  5ENN A;  2Q7F A;  1JCQ A;  2XEE A;  1OT8 A;  4NIK A;  4I9E A;  1HH8 A;  2BKG A;  1HZ4 A;  4YDW A;  4APO A;  4XZ4 A;  3BU8 A;  5KWD A;  3CVL A;  5CCL A;  3ULY A;  3ZUV B;  5LP0 A;  3TG4 A;  3NZU A;  3ZKJ A;  3FTU A;  4H7Y A;  2VSO E;  3B7S A;  3ASF A;  4DPR A;  4N3B A;  5CER B;  4CT4 A;  2XPY A;  4JC8 A;  1TNO A;  1TEZ A;  2WXJ A;  3MKQ B;  4KBQ A;  3QAR A;  5HS0 A;  2DCP A;  3D9N A;  2J8S D;  3TWR A;  3ULE G;  3G2W A;  4LCT A;  3Q7A A;  1HE8 A;  3ZVV A;  4GZ5 A;  2V4H C;  1X81 A;  4GTQ A;  1KLX A;  4XKB A;  4JW1 A;  4WNE A;  2E0I A;  3SFZ A;  3E30 A;  2R05 A;  1OCC E;  2L9B A;  2R59 A;  3V79 K;  2OVF A;  1H0A A;  3MGB A;  4ME2 A;  3LY7 A;  1ELW A;  4PH4 B;  2V5Q C;  3L22 A;  2P9U G;  3AS5 A;  3NZS A;  3SF4 A;  3HXB A;  5HQ8 A;  3IKO B;  2HO1 A;  4QFV A;  2J49 A;  5ITZ F;  2YHE A;  3RRN B;  2OV8 A;  3JQ1 A;  3GZS A;  4K5A B;  3KAE A;  2CG2 A;  3AG3 E;  2AW6 A;  1TJF A;  5JHA A;  3MEK A;  3C3R A;  5E75 A;  2IOL A;  2LXL A;  2OCC E;  4OYS A;  4BT8 A;  4YDE A;  2DBA A;  4R7L A;  1UN9 A;  3LEW A;  2WXR A;  1H6K A;  4GCN A;  3L16 A;  2IY0 C;  5CRU A;  2L0T B;  3AAA C;  4YDY A;  4ANW A;  4GPK A;  4J6I A;  2F0Y A;  4GZ6 A;  1PC2 A;  5ENS D;  3SBT B;  1TN6 A;  2ZIS A;  4A3T A;  4P29 A;  1V54 E;  5BV0 A;  1D9S A;  3R9M A;  5A6C A;  2VTB B;  2C2L A;  1GW6 A;  3CGH A;  4GTT A;  4K03 A;  1WY6 A;  4RLY A;  3SFY A;  1N94 A;  3ZN3 A;  4UUC A;  3ZYM A;  1BI8 B;  2CFZ A;  3CKB A;  4NRH B;  5FQ4 A;  4AV7 A;  1MHQ A;  4BT9 A;  4NQ0 A;  2XRZ A;  4TUM A;  3DSX A;  3PEV B;  3D9P A;  1H19 A;  1N0R A;  3UX4 A;  1FCH A;  4DLO A;  4Z68 A;  3ZHE B;  2LNI A;  4GTV A;  4HNA D;  3DPD A;  2X6K A;  4RSY A;  4C0M A;  3S7J A;  4DK5 A;  4U95 D;  3UKU G;  2OVB A;  4U63 A;  2WQ7 A;  1YCS B;  1SQM A;  3CVQ A;  1OY3 D;  1BU9 A;  4AOF A;  2ETA A;  3LY9 A;  3EHR A;  2HYZ A;  2E2E A;  3VLF A;  4BFR A;  4GYO A;  1IKN D;  4JXT A;  4B0Z A;  4EEC A;  3CHQ A;  5BUZ A;  5AN8 A;  4GPM A;  4U04 A;  2GGF A;  3FTZ A;  3Q15 A;  5FZS A;  4J8D A;  2NYJ A;  2WVI A;  2ZU6 B;  3ESL A;  4F6R D;  4B8A A;  4CGW A;  2GRL A;  3FP3 A;  3OAW A;  3FUM A;  2IFU A;  3CKC A;  4PS3 A;  4WND A;  4WWO A;  4BSZ B;  3FUH A;  4PDX A;  2KCV A;  3Q75 A;  5EIL A;  4U0Z A;  3O4Z A;  3ZYQ A;  4J7W A;  3C98 A;  1H2V C;  5BNW A;  1N4R A;  4CZ2 D;  3SO8 A;  1SZ9 A;  2YNQ A;  3T8K A;  4DRX E;  2FO1 E;  4G26 A;  4LRZ A;  3MV3 B;  3L54 A;  3TXN A;  3PEU B;  3UM2 A;  4HOS A;  1WAO 1;  4A1G A;  4JHR A;  4BWR A;  1HXI A;  2CHW A;  4MRU A;  3SQV A;  5BT1 A;  2UY1 B;  1RW2 A;  1H6O A;  5ANR A;  3K9I A;  4GYY A;  5HKP A;  1MX2 A;  1QYM A;  3ZW3 A;  5DIZ A;  5AIJ A;  3MA5 A;  1EDU A;  3RAU A;  5EID A;  2PZI A;  5B1A E;  5HI7 A;  1SW6 A;  1IHG A;  5D2M C;  4ZFH A;  3QKY A;  1Q2Z A;  4YDO A;  1ZB1 A;  3D9K A;  3HRA A;  2CHX A;  5EX0 A;  3DPY A;  3HDX A;  1W3B A;  4C0E A;  2R02 A;  4J8Y A;  2JAB A;  2P58 C;  4YND A;  3QB2 A;  3QWW A;  1U3D A;  4I9C A;  1FT1 A;  3TWT A;  4EBA G;  2X6H A;  3FFL A;  4F3V A;  1HX8 A;  5AAO A;  2WXM A;  2WXO A;  4L1B A;  4PS8 A;  5DBK A;  5AJL A;  1V55 E;  3PNT B;  5CEA A;  1SZA A;  3B7T A;  4KVM A;  2H6F A;  1QNF A;  5FQ8 A;  4BET A;  4WNF A;  4I2W A;  2R5S A;  4AM9 A;  3ASG A;  1IQR A;  4G1T A;  1KZO A;  2JEK A;  3FTV A;  5BPP A;  2ZGG A;  1EPU A;  4KYO B;  5J08 A;  1WM5 A;  3ML9 A;  3V31 A;  3SNX A;  3AG4 E;  2ZXW E;  4HI9 A;  1K8K G;  4ILG A;  2NXP A;  2FUL A;  2XZT G;  3FWV A;  4FLH A;  3NQP A;  1S64 A;  4I1M A;  3QOU A;  2MRI A;  5KJN A;  1HG2 A;  4KXK B;  3UIP C;  2XHE A;  4KZ0 A;  4BY6 A;  2R17 C;  2Y4U A;  2FI7 A;  2I9C A;  4HOT A;  2MYO A;  3GZ2 A;  1N4P A;  3PDN A;  1DCQ A;  3Q9N C;  4B8C B;  1H6P A;  1MX4 A;  3FH5 A;  4WWP A;  5HRY A;  2VGE A;  1PAQ A;  4FJY A;  1N52 A;  4Y6W A;  2A5E A;  5CMW A;  4UWG A;  1Y8M A;  4TXP A;  2DWZ A;  5IY5 E;  2Y69 E;  4TXR A;  3IHV A;  2Y4T A;  2P9K G;  4V3I A;  4UWH A;  1O1R A;  1E8X A;  2KZT A;  2XGO A;  4CEM A;  4K5C A;  4BSX A;  2PM7 A;  1N4Q A;  3LDZ A;  5CBN A;  4DUI A;  3CQC B;  3TWU A;  1HS6 A;  2LXM A;  4IUL A;  3HXF A;  3CHP A;  3PUK A;  2KM4 A;  3LKU A;  4B94 A;  3T9K A;  3B7R L;  4CYM D;  1E90 A;  2ION A;  2Y1L E;  5JJ7 A;  3MKQ A;  4L2Y A;  4F1P A;  1KT1 A;  4Y6C A;  4FUL A;  2R03 A;  5AQ7 A;  2IU1 A;  2LUH A;  1SA4 A;  3C3O A;  3DST A;  4L7T A;  3LCA A;  3DXM G;  2IEJ A;  2WXI A;  3FH8 A;  1O1T A;  1UJK A;  5KJM A;  4CDN A;  1DC2 A;  1Y6I A;  5FT9 A;  3D9I A;  1N0Q A;  1OXJ A;  3AJI A;  4Q69 A;  1K1A A;  3BEE A;  3D9J A;  2XS1 A;  3UMV A;  3NB2 A;  4OAU C;  4XI0 A;  4O1P A;  5FQ7 A;  3UM0 A;  2VGX B;  1H2T C;  2L6J A;  3TWV A;  5AAR A;  3PH0 C;  2IQC A;  4RQI A;  4A63 B;  4TUU A;  3ZRH A;  3PUJ A;  2H6H A;  5H7P A;  4J8F A;  1DCE A;  3R7Q A;  4B93 B;  2QFC A;  3TWS A;  3ASD A;  3Q5M A;  1YMP A;  3E4B A;  3FUF A;  4HB5 A;  3V2O A;  3LYA A;  2KXP C;  1NA3 A;  4RG6 A;  3DEP A;  4CDR A;  1O5M A;  1UN8 A;  2LSU A;  1FVH A;  3TXM A;  5D66 A;  3QWV A;  4HBD A;  2VTB A;  2DIW A;  4FHJ A;  5B3S E;  2WM9 A;  2XQ0 A;  3R9A B;  1TNZ A;  3JXJ A;  3SZ7 A;  5AJD A;  4CGV A;  3MYV A;  3ASH A;  1Z5S C;  3L6A A;  4BER A;  3TWX A;  4HRM B;  4L9P A;  3IBE A;  2DZN A;  3VTY A;  4B89 A;  2A4Z A;  3UI2 A;  4FC8 A;  3X2Q E;  2AXV A;  5J90 A;  3EJN A;  5ENP D;  4OVV A;  3ZHE A;  1E8W A;  1OWL A;  4XIF A;  2LO6 A;  4M7C A;  3KEZ A;  2H6I A;  3CQG B;  5BXO A;  3L13 A;  2ZIR A;  4KT6 B;  3B7U X;  5G05 C;  2L0I A;  3ZYL A;  4CRW A;  3OTN A;  2XGM A;  3ISM C;  3E33 A;  2OOE A;  3RRU A;  3U9W A;  2BUG A;  2QZA A;  4Q96 A;  5JJT A;  4KZC A;  5ENT D;  3FUD A;  1TR4 A;  4BX8 A;  3W9F A;  3L9T A;  3AG2 E;  4LNU D;  3S7D A;  4PUC A;  3FU6 A;  4MBG A;  4N3A A;  1FVF A;  3QK0 A;  3S7B A;  5CEC B;  2DZO A;  1IQU A;  1U2V G;  3UPV A;  1LTX A;  3DWL G;  2H6G A;  3LVQ E;  3FUE A;  5KJK A;  3FDH A;  4EZL A;  4I1O B;  3UIN C;  5JJ6 A;  5FQ6 A;  5AEN A;  2GRQ B;  2UY1 A;  1EF1 C;  1UJJ A;  1E7U A;  4GAA A;  3KEA A;  3NAW A;  4Q94 A;  1TNU A;  2Y0B G;  4XX5 A;  4TXQ A;  1DNP A;  2XEH A;  4UWF A;  3CVY A;  3PZ4 A;  4DX1 A;  4U96 D;  3V2X A;  4NUR A;  4KVO A;  2ETC A;  2DYS E;  4BTB A;  3PZ1 A;  3ONL A;  4HVB A;  3BG1 B;  4UQY A;  2QYJ A;  4CDM A;  2VSY A;  4GZ3 A;  3WXX A;  2GW1 A;  3CK9 A;  1JCR A;  4HLE A;  1TNB A;  2EQX A;  4AVX A;  4APF A;  2IF4 A;  2XPI A;  4F53 A;  4AY6 A;  4JHK A;  5EYL A;  2VQ2 A;  4GA0 A;  4CCA A;  3CVX A;  4N5Q A;  5ENR D;  1OWM A;  2HM8 A;  5LOZ A;  4DX2 A;  2QYU A;  3UM3 A;  1JWF A;  1NA0 A;  3NBN B;  2J4B A;  1UOH A;  4EPZ A;  3DXK G;  2WMN A;  2MOW A;  3N71 A;  1A5E A;  2KBX A;  3L82 A;  2IJG X;  1SVX A;  5D0Q D;  5FZR A;  3TL5 A;  2YIN A;  1JCS A;  4DJA A;  3HIZ A;  1XGW A;  2AVP A;  4J8E A;  3PNL B;  1AWC B;  1HG5 A;  1TN7 A;  3HHM A;  4RG9 A;  1P5Q A;  3J5P A;  4EBA A;  3SFX A;  1PY1 A;  2FEZ A;  1A17 A;  4I6E A;  4OVU A;  4N2S A;  2P9P G;  3SY2 A;  5BV1 A;  3CHO A;  3ZPJ A;  4FU3 A;  5T3R A;  2X6F A;  3Q78 A;  3CHS A;  2B0O E;  1OWN A;  3CEQ A;  3UXG A;  3UTM A;  1JWG A;  3HYM B;  3PZ2 A;  2XCC A;  4I17 A;  3FUI A;  4LNG A;  2YQ8 A;  2RFA A;  2EIJ E;  2VYI A;  4LG6 A;  2KC7 A;  3NOG D;  5ENQ D;  3JXI A;  1JPL A;  5G2N A;  3ZFW A;  5JHB A;  3PE4 A;  3EU9 A;  4N2Q A;  1E8Y A;  3FH7 A;  3D3M A;  2BED A;  3TAX A;  5BXU A;  2XPZ A;  3Q4A B;  1QBQ A;  2WXN A;  3G2S A;  4GTO A;  2XEV A;  3URZ A;  2LAI A;  3VTX A;  3J5Q B;  3FUN A;  3HVE B;  3U64 A;  2FO7 A;  4U7E B;  5G04 C;  3RU0 A;  4AP2 A;  1N54 A;  1TJC A;  3RK6 A;  4AY5 A;  1QZ2 A;  2ILR A;  2R2L A;  3QNK A;  4A3V A;  4G8K A;  4H7X A;  1ELK A;  4NAC A;  3T5V A;  3D9L A;  3UUX A;  2RG8 A;  2OEW A;  3CR3 A;  3JUE A;  5JA4 D;  1UW4 B;  2AJA A;  4IN3 B;  3SI5 A;  5EIB E;  1AP7 A;  4W9R A;  5G05 J;  4JZY A;  4K5B A;  1TNY A;  3ASN E;  2WXF A;  3Q49 B;  3FTW A;  3UT7 A;  3KS2 A;  1OUV A;  3DSU A;  1N95 A;  3DSW A;  2P9I G;  4JVS A;  2EIL E;  3AU5 A;  4DX7 D;  1N9A A;  1NI1 A;  3EUV A;  1YA0 A;  5M72 A;  4MLP A;  4C9B B;  3EHN A;  3OXG A;  2KAT A;  3GZ1 A;  3KSQ A;  3ZGQ A;  2I6H A;  4I6J A;  4U8Y D;  3UT8 A;  2M63 A;  3UKR G;  2CHZ A;  2QY7 A;  1KT0 A;  3RO3 A;  4RVB A;  4PS7 A;  4FHK A;  4XI9 A;  5ENO D;  3I4G A;  3HXC A;  3PZ3 A;  4YVO A;  4XKC A;  1XNF A;  3EHM A;  4GTP A;  3APC A;  3JQ0 A;  2X6I A;  1HFA A;  2HR2 A;  3AS4 A;  3FUJ A;  5EKQ D;  3W9G A;  3G2V A;  2J07 A;  3D9H A;  4FJZ A;  2PQR A;  3RRM B;  4UWK A;  2IO2 C;  1NP7 A;  1WDY A;  2F37 A;  4HXI A;  3SHF A;  5FZQ A;  4I1A A;  1SA5 A;  3Q9U C;  5ANL A;  4L23 A;  4LUN U;  1OCZ E;  3T5X A;  3WG7 E;  3S2A A;  4LNB A;  4G25 A;  2VSN A;  3HG0 D;  1BI7 B;  3DSS A;  3FUK A;  1UG3 A;  3B95 A;  4BEP A;  4EQF A;  1X5B A;  3CST A;  3IV0 A;  3NF1 A;  3ONK A;  5EX3 A;  4DI3 A;  4GZC A;  3VLD A;  3R7R A;  3CVN A;  2AXZ A;  5EN5 D;  4A1S A;  1DVP A;  1TYQ G;  3C3Q A;  1HO8 A;  3LY8 A;  3LJ3 A;  2WB2 A;  5EDS A;  3EIJ A;  4MS6 A;  3ABL E;  2J4D A;  1N11 A;  3ASO E;  3APF A;  1JUQ A;  3FUL A;  2WQH A;  4DLQ A;  3BQO A;  3Q79 A;  1IHB A;  2VGY A;  3FU0 A;  3SGH A;  2XEN A;  4LER A;  4N5C A;  5CHE E;  3Q7F A;  4CT0 A;  3LJN A;  3CK8 A;  3EU5 A;  5A7D B;  5JMN D;  3ZEF A;  4ILI A;  5C1D A;  3ZU7 B;  2KCL A;  4JD2 G;  1G3N B;  4JEU A;  3CIA A;  3MCX A;  4UQZ A;  3TG5 A;  3APD A;  1E7V A;  3KSL A;  4UWL A;  2FF4 A;  5B1B E;  5T4Y A;  2FBN A;  3LS8 A;  1OWP A;  4GML A;  4FP7 A;  1LD7 A;  3P1U A;  3PZD A;  4BTA A;  2LSV A;  3PVL A;  4HOQ A;  2I1J A;  5KNG A;  5CMY A;  3UT4 A;  2WXH A;  3QWP A;  4HQD A;  4M3O A;  3RO2 A;  1YYH A;  4EHM A;  4D10 C;  4HRN A;  4MKT A;  4XEI G;  2KCK A;  3QC1 A;  3EIQ C;  3D9O A; 
#chains in the Genus database with same CATH homology
 2XS1 A;  3RAU A;  3UM0 A;  3ULY A;  2OEX A;  3UM1 A;  3UM2 A;  3R9M A;  2R03 A;  5CRU A;  3C3Q A;  3C3O A;  3UM3 A;  1ZB1 A;  4JIO A;  2XS8 A;  2OJQ A;  3C3R A;  2OEV A;  2R02 A;  3ZXP A;  5CRV A;  2R05 A;  2OEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...