5CRVA

Crystal structure of the bro domain of hd-ptp in a complex with the core region of stam2
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
361
structure length
357
Chain Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKAPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
total genus 142
structure length 357
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 5crvA00
2R05A 3UM2A 3C3RA 2OEVA 1ZB1A 3UM3A 3C3OA 3ULYA 3RAUA 5CRUA 3ZXPA 2XS1A 2R03A 3UM0A 2OEWA 3UM1A 3R9MA 5CRVA 2R02A 3C3QA 2XS8A
chains in the Genus database with same CATH superfamily
1Z3XA 1WM5A 3D9PA 2AXUA 4HOTA 1KT1A 3VTXA 3O4ZA 3PDNA 1MHQA 4I1AA 1SA4A 4U0SA 5FIOA 4GA2A 5ARFA 3S7BA 3ULQA 3S2AA 5AYWD 4L1BA 4KXKB 2IY0C 4D10C 2RFAA 4CDMA 3D9HA 1WY6A 3RJVA 1INZA 5ENOD 2AW6A 2J9QA 1IHBA 3FUMA 2XRZA 1WDYA 1O1SA 4PDXA 4DK5A 1HE8A 3B7UX 3IHYA 1NFIE 5AJDA 4N2SA 3AS8A 3EHNA 4ILIA 3RO2A 4GCNA 3CR3A 4HOSA 3HXEA 3SQVA 1N95A 5EKQD 4Y6CA 3PZ2A 3Q75A 5CECB 3X2QE 5FQ8A 3V2XA 1UJJA 4AM9A 5T4YA 3TWQA 1B89A 3KD7A 3CSFA 2M63A 3T8KA 3D9JA 1JCQA 2CFUA 3KEAA 4IULA 2MRIA 4TUUA 3LJNA 3PEUB 3AG4E 2RKKA 5KJLA 4I6EA 3SY2A 3GW4A 4WWNA 4HB5A 4N3BA 3P1UA 4F53A 1JCSA 2QYUA 3ASGA 4KYOB 3SZ7A 3FH7A 2WXLA 4B89A 3G2WA 5CHEE 4N3CA 4PUCA 3IXEA 2UY1B 4CT4A 3U4TA 3ZU7B 4GYOA 4PS7A 4J8FA 4C48B 5G05C 4WWPA 2WMOA 2WM9A 5FWQA 4FHJA 2NSZA 4E6HA 4N5CA 2ZXWE 2NC9A 3R9AB 1D8DA 3MKQA 1EPUA 3ASFA 4J8DA 5J90A 1E7UA 4LNUD 3IHVA 4KZ0A 5JJTA 2EIJE 3Q49B 2XPYA 4I9EA 2Y4UA 3ABKE 1SZ9A 1FPPA 4JB8P 1P5QA 4LCTA 2BEDA 2WXPA 3UMVA 2J07A 5C2YA 2AJAA 4CGWA 5A23A 4OYSA 4G11A 4GA0A 3FHEA 3C5RA 1HG5A 4K5CA 2RFMA 2QFCA 2BUGA 5ENQD 5EDSA 5D2MC 5AENA 4G1TA 2CHWA 3SFYA 4DLOA 4GYWA 4BT9A 2KBXA 1IXVA 4G8LA 1EYHA 2VYIA 4JZYA 2VTBA 3FTXA 1OWNA 1E90A 2P9IG 1DCQA 3DSVA 4YVQC 3Q15A 3SFZA 3JCKC 2XCBA 4CYMD 1NL4A 4UUCA 1TYQG 4ZHBA 4UQZA 2WXGA 5AN8A 1IQRA 3URZA 2C0LA 2X3MA 1BU9A 2LNIA 2GGFA 1ZB1A 2WXJA 3ZXSA 3DXMG 4GB9A 5CBNA 3PUJA 3LYAA 1H2TC 4PS8A 3TWRA 4G24A 3PRZA 4JHJA 3VTYA 2OOEA 2JABA 2AVPA 4CDNA 1LTXA 3SO8A 4ZFHA 5LX8A 3NAWA 2A4ZA 2X6IA 4WNFA 2P9LG 4FA6A 2XCCA 3CHOA 3BG0B 1QBQA 4HXIA 4ATGA 4WNEA 2BKGA 4QFVA 2KXPC 3N71A 2J08A 5FQ7A 4EQFA 4TXRA 4IN3B 4B94A 3PH0C 2HE0A 1FVHA 5HI7A 3FU5A 3DSXA 1BPOA 4OAVB 5T3RA 5ENRD 4BSZB 3W9GA 3LEWA 1K8KG 4HRNA 4MLPA 3EJNA 2V4HC 4U95D 5G2NA 4YDWA 2EQXA 3E33A 3I5PA 3TWUA 5CBOA 3NOGD 3LS8A 1OXJA 5CRVA 5BV0A 2PM7A 3CSTA 3HVEA 2DZOA 1HU3A 1E8ZA 5G05J 3U64A 1A5EA 5HKPA 5EX3A 4CZ2D 3ONLA 2JLBA 3GZSA 5FZRA 2OCCE 5D0OD 2OV8A 3SGHA 3RRUA 3OAWA 3CVYA 5D66A 4EBAA 1S0PA 1E7VA 3C98A 3PZ4A 4YDEA 3AU4A 2V8SE 3E37A 4H7YA 4JC8A 4LUNU 4YNDA 2IOLA 4XKCA 2F8YA 1QQEA 1UJKA 2WXHA 4AXHA 3CK8A 1N0RA 2XENA 3FUFA 3R9MA 4RG9A 3IKOB 4DX2A 3ZRHA 3LKUA 4GAAA 2WXRA 5FQ6A 2R05A 4GTTA 5A7DB 3GZ1A 3FUEA 4N2QA 2DIWA 2LSUA 4WAFA 4GTPA 1HXIA 1SZAA 1YA0A 3UTMA 4RLYA 4FLBA 2UWJG 4I6GA 1BI7B 4AY5A 2VGXB 3I3NA 3ZFWA 2OVBA 3ZYKA 2ONDA 4HORA 3MCXA 3D3MA 4JHKA 2OEWA 2CFZA 3RRMB 4O1OA 2X38A 2DBAA 1ELKA 3HXBA 3UKUG 4HLEA 3C3RA 3FH5A 4HOUA 3NQPA 4ACLA 4K0RA 4IYPA 4JD2G 4GTSA 2HR2A 4ANWA 5LCWJ 3V31A 3BU8A 3HRAA 3G2TA 4LEUA 3MA5A 1MJ0A 4KZCA 2P9UG 4DLQA 1E96B 3NF1A 4F6RD 1XGWA 3JQ0A 4GZ5A 3TJPA 3EIJA 3V79K 2KCLA 2IONA 2IFUA 2Y69E 3MV2B 3IBEA 5EYLA 4NRHB 4B0ZA 2QC9A 3DBSA 2WXKA 1H2VC 4XIFA 3ZVVA 5FT9A 3CGHA 2VSNA 3DSWA 3ZHEA 3HHMA 1JCRA 2P58C 1RW2A 1KLXA 4JA7A 4LNBA 4A55A 2R03A 3ASOE 1A17A 3G2UA 5EYPF 2V5FA 3AG2E 3PVLA 3FUDA 2RD0A 2L0TB 5J08A 1U2VG 2IO2C 3NBNB 3BUAA 2P9NG 5G04J 3QJZA 3EHMA 5ANLA 3Q79A 3OTNA 2XS1A 1G3NB 1Z5SC 4EHMA 2IO3C 3CEQA 4GYYA 3ML9A 5KWDA 1OCRE 4GZDA 3RKVA 2I6HA 3PREA 3B7TA 4U0ZA 4U0UA 3L13A 3RIBA 1TJFA 5HQ8A 3QAQA 1JWGA 5AARA 4LG6A 2X6JA 4UWLA 2LXLA 4N3AA 2PL2A 3ML8A 4JW1A 4DUIA 1OY3D 3ZPJA 1TNOA 5CCMA 3TWWA 4J8EA 4U63A 3EHRA 3IEGA 4TV3A 3TGOA 3UKRG 5HS0A 3LPZA 4E85A 3WXXA 3I4GA 3LVQE 4NIKA 1TN7A 4P29A 2PNNA 4WNGA 3FTVA 2LSVA 3SI5A 1KZOA 5G04C 4NURA 4DX1A 2FI7A 3UM3A 4G2VA 2XGMA 1H6KA 2XZTG 5FJYA 4L23A 2PQNA 3FTUA 1S64A 2GRMA 3D9OA 3MEKA 4CT0A 4EBAG 2HYZA 1YMPA 4NACA 3MKRA 1U3DA 2AWIA 1HG2A 4Z68A 3UUXA 4KVMA 2R59A 3ZGQA 2WXFA 2E0IA 1MZCA 3JQ1A 4YDOA 4EPZA 1L5JA 2AXVA 4BX9A 1UN9A 4F7AA 5CERB 4HS2A 2KM4A 3ASNE 3KS2A 4H7XA 3E34A 5G55A 2FF4A 3DWLG 5BXOA 1DVPA 3BQOA 2P9SG 1HFAA 5LCWC 2CHZA 5KJMA 1XNFA 1Z3YA 3TWSA 1PY1A 3AS5A 5IY5E 4HI9A 4L2LA 2DYSE 2WXOA 2PQRA 5B3SE 2Y4TA 4AEZC 3PE3A 4XEIG 3E32A 3E30A 4XI0A 4HQDA 2ETBA 4F1PA 1UW4B 5ITZF 3O48A 5DBKA 3HG0D 1SW6A 2DZNA 2MHKA 2WVIA 4YDYA 4FJYA 4DI3A 4QQIA 2F8XK 4GTQA 4BEPA 3SHFA 3FH8A 1HH8A 4AJWA 3Q7AA 3FTSA 4WUYA 3Q5MA 5BPPA 3UINC 3C72A 2H6IA 1N4PA 4B8CB 3RU0A 4PS3A 3ZYMA 2WQ6A 2C0MA 4URKA 3L16A 1OWPA 3UXGA 3CVQA 4J8SA 4GMJA 1FT1A 5ARGA 3GZ2A 1WG0A 5AJLA 5EILA 3UT8A 3JYSA 2YINA 3BEEA 3DEOA 4DX6D 2WQHA 3HIZA 2XEVA 2GROB 2VQ2A 2L6BA 1ELRA 4TUMA 4GPMA 4Q94A 2WPVA 3QWPA 5AQ7A 4UQYA 1HO8A 1Q2ZA 3HXFA 3D9IA 3TXNA 3UQ3A 3Q4AB 3KSLA 3DXKG 1LD8A 2QY7A 3FY4A 3KAEA 1FVFA 1N0QA 4L2YA 2EIME 2Y0BG 3SFXA 2L6JA 4KT6B 3PNLB 1MX2A 4HRMB 4AP2A 2VGYA 3MZLB 2OVFA 4KMOA 4OVVA 3CHRA 1NP7A 3DSTA 5ENTD 2F0YA 3HXDA 1HS6A 1K3ZD 1HZ4A 1OT8A 3B95A 4AIFA 4IRUA 3DPDA 3CK9A 2P2CP 2LUHA 3UPVA 2CG2A 1D9SA 3FWVA 1Y8MA 2R17C 4R7LA 3UM0A 4HVBA 2NXPA 1IQUA 2FO1E 1AP7A 4K5AB 4TRQA 5AAOA 1ZBPA 3UT7A 3DPYA 4FHKA 3KSQA 1UN8A 3SNXA 2FEZA 4FULA 4RQIA 3ZUVB 3QWWA 5JHAA 3DSUA 4A63B 4AV7A 3CVLA 3CKCA 4RVBA 2IEJA 2Y1LE 4DX7D 2NYJA 4CCAA 1V55E 1N54A 1SA5A 4XZ4A 4EZJA 3S7JA 4GMRA 3AS4A 1N4QA 4JVSA 2ILRA 3EU9A 2J09A 4MBGA 1JWFA 3FP3A 3L22A 3VLEA 4FADA 3J5QB 1MYOA 2ZGDA 4ANVA 5KNHD 4U04A 5KNGA 3PZDA 3QK0A 2J49A 3B13A 4F3VA 3LJ3A 1KZPA 4RSYA 1PAQA 3ZIMA 4A1GA 3MX3A 3OXFA 3PUKA 4HBDA 4UQXA 2QZAA 1H2UA 2XS8A 3OXGA 3QDNA 1WAO1 3L9TA 4B93B 4M7CA 3FUKA 1AWCB 3Q7FA 4N39A 5ENPD 1OWOA 2WXIA 1YCSB 3FU3A 4GTOA 5KBAA 4LERA 2DCPA 2Y3AA 3LDZA 5BW8C 2VGEA 3FU6A 3MKQB 5HRYA 2J8SD 3ABME 3UM1A 2DYRE 5C1DA 4JL0A 2BF0X 1N9AA 1K1AA 3NZUA 1RZ4A 3CVVA 3T8MA 1DCEA 4N5QA 1S70B 4HLLA 3TG4A 4TXPA 3PZ3A 4BWRA 4BETA 2XEEA 5EX0A 1EF1C 2WXQA 1QZ2A 3SBSA 3APFA 5JHBA 2XQ0A 4J7WA 3CHQA 2HM8A 3B7SA 2VTBB 5KJKA 2V0PA 2L0IA 5D0QD 3GYZA 4I1MA 1BD8A 1X81A 1H0AA 4NQ0A 1FCHA 1VDYA 1BI8B 1QNFA 4XKBA 4AOFA 3TG5A 2H6GA 3PS6A 3ESLA 3TWXA 1K1BA 3FUNA 3EU5A 4UWKA 3LVRE 3TL5A 3NB2A 3L82A 2KATA 1OCOE 1N4RA 1E8YA 3L6AA 4BY6A 4AVXA 2XEHA 1BLXB 4ATZD 4YVOA 3JXJA 3UIPC 3PEVB 1NA3A 4CEMA 5CMWA 2I1KA 3CKBA 4CRWA 2XPZA 3AU5A 3QOUA 3PZ1A 3HDXA 3QWVA 5B1AE 4WNDA 3AG1E 4FP7A 3FTWA 2XZDG 4GMLA 3Q47B 4HOQA 5JJ6A 3DEPA 2LO6A 4UI9J 4BTAA 3I4RB 1FT2A 3ZN3A 4V3IA 3L17A 5BXUA 3LXUX 4W9RA 2FBNA 3FUHA 1YYHA 2KC7A 3ASDA 3UIOC 4G23A 4UWHA 4K03A 3CIAA 3ZKJA 2GRQB 2YHCA 3UT4A 5BT1A 5ANRA 3ONKA 3HYMB 4A3VA 2PM6A 1TN6A 3D9MA 1NZNA 5AIJA 4DX5D 3U3WA 5JMND 3UI2A 4JXTA 3Q9UC 4J0UA 5B1BE 2B6CA 1OWLA 1TEZA 3R7QA 3QKYA 3LCAA 5CEDB 4I9CA 2WXNA 3RRNB 2VJ8A 4KBQA 4I17A 2PZIA 4LRZA 2XPIA 4Y6WA 4HFGA 4U8HA 4ANXA 3HVEB 2A5EA 2I9CA 3W9FA 1LF8A 4FLHA 4L9PA 3LY9A 2I2OA 4BT8A 3CQGB 3ZYLA 2LAIA 2VSXE 1DC2A 4O1PA 3S7FA 4L7TA 3RSEG 3QARA 3ULYA 5FTPA 5ENNA 3B7RL 2XRYA 4X8QA 3MJWA 4ABNA 2WXMA 1IYGA 3L08A 3NOCD 3FTZA 1ZU2A 2GRRB 4JEUA 3FTYA 2Q7FA 2YNQA 4CGVA 3FUIA 3APCA 4ACKA 3V30A 1KT0A 1QYMA 4APFA 4O60A 2F37A 3ASHA 3Q78A 4BERA 4AY6A 1UG3A 3PE4A 4O6FA 2WB2A 4XI9A 3ZYQA 4K5BA 4CDRA 4MS6A 3ZNGA 2YHEA 4XE0A 4FU3A 3LY8A 4GZ6A 1EDUA 2XHEA 2MYOA 4ANUA 3MGBA 4U8VD 4B8AA 3FULA 3T5XA 4APOA 4XX5A 5EN5D 4JEHA 3F6QA 3T9KA 4TXQA 2KZTB 3VLFA 3QB2A 5CCLA 5LP0A 2R5SA 2VSOE 2GRLA 2J4BA 3CQCB 3CHSA 3CVNA 4GCOA 1MQSA 3SF4A 4C0MA 2CHXA 3QC1A 4GU5A 4MRUA 4U96D 1D8EA 3UM2A 4A1SA 5LFAA 2ETCA 3S7DA 5BNWA 2MOWA 4GTVA 1JUQA 3CK7A 5E75A 1OUVA 4UI9K 2P9KG 5A6CA 3TWVA 4J6IA 2BTDA 1JPLA 4JPSA 3FUJA 2DVWA 2UY1A 2X6KA 1O1TA 4GZ3A 4UWGA 2ZISA 3ENEA 3Q9NC 4I1OB 4UI9C 5E76A 5FINA 1PC2A 4J8YA 3AJIA 5KJNA 3V2OA 2GRPB 5DIZA 3R7RA 3EHQA 2KCVA 3CHPA 3BG1B 1Y6IA 3DSSA 2P9PG 5KCMA 4ME2A 4WWOA 1O5MA 2RG8A 3PNTB 3CLJA 3NZSA 1OCCE 5T8IA 2L9BA 3P2BA 4EZKA 3SBTB 3C3OA 4HI8A 3ZXPA 3EUVA 1N4SA 4LSZE 3FDHA 3KEZA 5FQ4A 5FZSA 1W3BA 2OEVA 3U66A 3ABLE 4LNGA 2ETAA 4BSXA 3ESKA 4DJAA 1NI1A 2GRNB 5JJ7A 1TNBA 2FO7A 2J4DA 3FEXA 2B0OE 2X6FA 3CVUA 3CVPA 2ZU6B 2XGSA 3EDTB 4I2WA 2R2LA 4OAUC 4JA9A 4UWFA 4I43A 3RO3A 1OWMA 3G2SA 3ZW3A 4G8KA 1IHGA 3C3QA 1MX6A 2IF4A 3RK6A 3JUEA 3FFLA 5EIDA 2ZIRA 4MKTA 3RAUA 1N11A 2H6HA 2IOSA 4BTBA 3ULEG 4U7EB 4EECA 2QYJA 3OXLA 4OVUA 4BESA 2WMNA 1TR4A 5FZQA 1TJCA 5CMYA 4DRXE 4I2ZA 1UOHA 3TXMA 2ZGGA 1E8WA 4GTMA 2WQ7A 5AQBA 3E4BA 2GW1A 5H7PA 2E2EA 4KVOA 2FULA 3EIQC 5BUZA 1IKND 1TNYA 1O1RA 2IU1A 2JEKA 3LY7A 1ELWA 2VSYA 4JHRA 4EZLA 2IJGX 2X6HA 2I1JA 2VGXA 2EIKE 3J5PA 4FC8A 5EIBE 1HF8A 3SD5A 3FEYA 1GW6A 3WG7E 3D9LA 4BFRA 3TWTA 1TNUA 1V54E 3MV3B 1NA0A 3JXIA 1Z6TA 1MX4A 3AAAC 3B7BA 1SQMA 3CHMA 2EINE 1OCZE 3VLDA 1KPSB 1TNZA 5M72A 4M3OA 1S63A 4BX8A 3D9NA 5ENSD 5CEAA 3CV0A 2EILE 2DWZA 4FJZA 2LAHA 3CVWA 5JA4D 3T5VA 3ISMC 2CG3A 4RG6A 4C0EA 2LXMA 2R02A 3MYVA 3UX4A 2HO1A 2C2LA 3JUIA 2YQ8A 3K9IA 3G2VA 4HNAD 5BV1A 4GTRA 3ZHEB 2XGOA 4U07A 1LD7A 3ZEFA 4GPKA 4ILHB 2A5UA 3APDA 3AG3E 3U9WA 4C9BB 4A3TA 2V5QC 3D9KA 4ILGA 4G25A 4DI4A 5LOZA 4HRLA 3L54A 3FU0A 1U3CA 1E8XA 2V4LA 2KZTA 5CRUA 4F1SA 1X5BA 1N94A 1H6OA 4Q96A 3HXCA 2H6FA 2KCKA 1DNPA 5AQAA 3IV0A 4DPRA 3Q73A 3TAXA 1HX8A 4GZCA 2AXZA 4G26A 1TN8A 2BKKB 3QNKA 1SVXA 2IQCA 3CVXA 4U8YD 3DRAA 1H19A 4Q69A 4PH4B 4GA1A 4I6JA 1H6PA 5AQ9A 1N52A
chains in the Genus database with same CATH topology
2R05A 3UM2A 3C3RA 2OEVA 1ZB1A 3UM3A 3C3OA 3ULYA 3RAUA 5CRUA 3ZXPA 2XS1A 2OJQA 2R03A 3UM0A 2OEWA 3UM1A 3R9MA 4JIOA 5CRVA 2R02A 3C3QA 2XS8A 2OEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R05 A;  3UM2 A;  3C3R A;  2OEV A;  1ZB1 A;  3UM3 A;  3C3O A;  3ULY A;  3RAU A;  5CRU A;  3ZXP A;  2XS1 A;  2R03 A;  3UM0 A;  2OEW A;  3UM1 A;  3R9M A;  5CRV A;  2R02 A;  3C3Q A;  2XS8 A; 
#chains in the Genus database with same CATH topology
 1Z3X A;  1WM5 A;  3D9P A;  2AXU A;  4HOT A;  1KT1 A;  3VTX A;  3O4Z A;  3PDN A;  1MHQ A;  4I1A A;  1SA4 A;  4U0S A;  5FIO A;  4GA2 A;  5ARF A;  3S7B A;  3ULQ A;  3S2A A;  5AYW D;  4L1B A;  4KXK B;  2IY0 C;  4D10 C;  2RFA A;  4CDM A;  3D9H A;  1WY6 A;  3RJV A;  1INZ A;  5ENO D;  2AW6 A;  2J9Q A;  1IHB A;  3FUM A;  2XRZ A;  1WDY A;  1O1S A;  4PDX A;  4DK5 A;  1HE8 A;  3B7U X;  3IHY A;  1NFI E;  5AJD A;  4N2S A;  3AS8 A;  3EHN A;  4ILI A;  3RO2 A;  4GCN A;  3CR3 A;  4HOS A;  3HXE A;  3SQV A;  1N95 A;  5EKQ D;  4Y6C A;  3PZ2 A;  3Q75 A;  5CEC B;  3X2Q E;  5FQ8 A;  3V2X A;  1UJJ A;  4AM9 A;  5T4Y A;  3TWQ A;  1B89 A;  3KD7 A;  3CSF A;  2M63 A;  3T8K A;  3D9J A;  1JCQ A;  2CFU A;  3KEA A;  4IUL A;  2MRI A;  4TUU A;  3LJN A;  3PEU B;  3AG4 E;  2RKK A;  5KJL A;  4I6E A;  3SY2 A;  3GW4 A;  4WWN A;  4HB5 A;  4N3B A;  3P1U A;  4F53 A;  1JCS A;  2QYU A;  3ASG A;  4KYO B;  3SZ7 A;  3FH7 A;  2WXL A;  4B89 A;  3G2W A;  5CHE E;  4N3C A;  4PUC A;  3IXE A;  2UY1 B;  4CT4 A;  3U4T A;  3ZU7 B;  4GYO A;  4PS7 A;  4J8F A;  4C48 B;  5G05 C;  4WWP A;  2WMO A;  2WM9 A;  5FWQ A;  4FHJ A;  2NSZ A;  4E6H A;  4N5C A;  2ZXW E;  2NC9 A;  3R9A B;  1D8D A;  3MKQ A;  1EPU A;  3ASF A;  4J8D A;  5J90 A;  1E7U A;  4LNU D;  3IHV A;  4KZ0 A;  5JJT A;  2EIJ E;  3Q49 B;  2XPY A;  4I9E A;  2Y4U A;  3ABK E;  1SZ9 A;  1FPP A;  4JB8 P;  1P5Q A;  4LCT A;  2BED A;  2WXP A;  3UMV A;  2J07 A;  5C2Y A;  2AJA A;  4CGW A;  5A23 A;  4OYS A;  4G11 A;  4GA0 A;  3FHE A;  3C5R A;  1HG5 A;  4K5C A;  2RFM A;  2QFC A;  2BUG A;  5ENQ D;  5EDS A;  5D2M C;  5AEN A;  4G1T A;  2CHW A;  3SFY A;  4DLO A;  4GYW A;  4BT9 A;  2KBX A;  1IXV A;  4G8L A;  1EYH A;  2VYI A;  4JZY A;  2VTB A;  3FTX A;  1OWN A;  1E90 A;  2P9I G;  1DCQ A;  3DSV A;  4YVQ C;  3Q15 A;  3SFZ A;  3JCK C;  2XCB A;  4CYM D;  1NL4 A;  4UUC A;  1TYQ G;  4ZHB A;  4UQZ A;  2WXG A;  5AN8 A;  1IQR A;  3URZ A;  2C0L A;  2X3M A;  1BU9 A;  2LNI A;  2GGF A;  1ZB1 A;  2WXJ A;  3ZXS A;  3DXM G;  4GB9 A;  5CBN A;  3PUJ A;  3LYA A;  1H2T C;  4PS8 A;  3TWR A;  4G24 A;  3PRZ A;  4JHJ A;  3VTY A;  2OOE A;  2JAB A;  2AVP A;  4CDN A;  1LTX A;  3SO8 A;  4ZFH A;  5LX8 A;  3NAW A;  2A4Z A;  2X6I A;  4WNF A;  2P9L G;  4FA6 A;  2XCC A;  3CHO A;  3BG0 B;  1QBQ A;  4HXI A;  4ATG A;  4WNE A;  2BKG A;  4QFV A;  2KXP C;  3N71 A;  2J08 A;  5FQ7 A;  4EQF A;  4TXR A;  4IN3 B;  4B94 A;  3PH0 C;  2HE0 A;  1FVH A;  5HI7 A;  3FU5 A;  3DSX A;  1BPO A;  4OAV B;  5T3R A;  5ENR D;  4BSZ B;  3W9G A;  3LEW A;  1K8K G;  4HRN A;  4MLP A;  3EJN A;  2V4H C;  4U95 D;  5G2N A;  4YDW A;  2EQX A;  3E33 A;  3I5P A;  3TWU A;  5CBO A;  3NOG D;  3LS8 A;  1OXJ A;  5CRV A;  5BV0 A;  2PM7 A;  3CST A;  3HVE A;  2DZO A;  1HU3 A;  1E8Z A;  5G05 J;  3U64 A;  1A5E A;  5HKP A;  5EX3 A;  4CZ2 D;  3ONL A;  2JLB A;  3GZS A;  5FZR A;  2OCC E;  5D0O D;  2OV8 A;  3SGH A;  3RRU A;  3OAW A;  3CVY A;  5D66 A;  4EBA A;  1S0P A;  1E7V A;  3C98 A;  3PZ4 A;  4YDE A;  3AU4 A;  2V8S E;  3E37 A;  4H7Y A;  4JC8 A;  4LUN U;  4YND A;  2IOL A;  4XKC A;  2F8Y A;  1QQE A;  1UJK A;  2WXH A;  4AXH A;  3CK8 A;  1N0R A;  2XEN A;  3FUF A;  3R9M A;  4RG9 A;  3IKO B;  4DX2 A;  3ZRH A;  3LKU A;  4GAA A;  2WXR A;  5FQ6 A;  2R05 A;  4GTT A;  5A7D B;  3GZ1 A;  3FUE A;  4N2Q A;  2DIW A;  2LSU A;  4WAF A;  4GTP A;  1HXI A;  1SZA A;  1YA0 A;  3UTM A;  4RLY A;  4FLB A;  2UWJ G;  4I6G A;  1BI7 B;  4AY5 A;  2VGX B;  3I3N A;  3ZFW A;  2OVB A;  3ZYK A;  2OND A;  4HOR A;  3MCX A;  3D3M A;  4JHK A;  2OEW A;  2CFZ A;  3RRM B;  4O1O A;  2X38 A;  2DBA A;  1ELK A;  3HXB A;  3UKU G;  4HLE A;  3C3R A;  3FH5 A;  4HOU A;  3NQP A;  4ACL A;  4K0R A;  4IYP A;  4JD2 G;  4GTS A;  2HR2 A;  4ANW A;  5LCW J;  3V31 A;  3BU8 A;  3HRA A;  3G2T A;  4LEU A;  3MA5 A;  1MJ0 A;  4KZC A;  2P9U G;  4DLQ A;  1E96 B;  3NF1 A;  4F6R D;  1XGW A;  3JQ0 A;  4GZ5 A;  3TJP A;  3EIJ A;  3V79 K;  2KCL A;  2ION A;  2IFU A;  2Y69 E;  3MV2 B;  3IBE A;  5EYL A;  4NRH B;  4B0Z A;  2QC9 A;  3DBS A;  2WXK A;  1H2V C;  4XIF A;  3ZVV A;  5FT9 A;  3CGH A;  2VSN A;  3DSW A;  3ZHE A;  3HHM A;  1JCR A;  2P58 C;  1RW2 A;  1KLX A;  4JA7 A;  4LNB A;  4A55 A;  2R03 A;  3ASO E;  1A17 A;  3G2U A;  5EYP F;  2V5F A;  3AG2 E;  3PVL A;  3FUD A;  2RD0 A;  2L0T B;  5J08 A;  1U2V G;  2IO2 C;  3NBN B;  3BUA A;  2P9N G;  5G04 J;  3QJZ A;  3EHM A;  5ANL A;  3Q79 A;  3OTN A;  2XS1 A;  1G3N B;  1Z5S C;  4EHM A;  2IO3 C;  3CEQ A;  4GYY A;  3ML9 A;  5KWD A;  1OCR E;  4GZD A;  3RKV A;  2I6H A;  3PRE A;  3B7T A;  4U0Z A;  4U0U A;  3L13 A;  3RIB A;  1TJF A;  5HQ8 A;  3QAQ A;  1JWG A;  5AAR A;  4LG6 A;  2X6J A;  4UWL A;  2LXL A;  4N3A A;  2PL2 A;  3ML8 A;  4JW1 A;  4DUI A;  1OY3 D;  3ZPJ A;  1TNO A;  5CCM A;  3TWW A;  4J8E A;  4U63 A;  3EHR A;  3IEG A;  4TV3 A;  3TGO A;  3UKR G;  5HS0 A;  3LPZ A;  4E85 A;  3WXX A;  3I4G A;  3LVQ E;  4NIK A;  1TN7 A;  4P29 A;  2PNN A;  4WNG A;  3FTV A;  2LSV A;  3SI5 A;  1KZO A;  5G04 C;  4NUR A;  4DX1 A;  2FI7 A;  3UM3 A;  4G2V A;  2XGM A;  1H6K A;  2XZT G;  5FJY A;  4L23 A;  2PQN A;  3FTU A;  1S64 A;  2GRM A;  3D9O A;  3MEK A;  4CT0 A;  4EBA G;  2HYZ A;  1YMP A;  4NAC A;  3MKR A;  1U3D A;  2AWI A;  1HG2 A;  4Z68 A;  3UUX A;  4KVM A;  2R59 A;  3ZGQ A;  2WXF A;  2E0I A;  1MZC A;  3JQ1 A;  4YDO A;  4EPZ A;  1L5J A;  2AXV A;  4BX9 A;  1UN9 A;  4F7A A;  5CER B;  4HS2 A;  2KM4 A;  3ASN E;  3KS2 A;  4H7X A;  3E34 A;  5G55 A;  2FF4 A;  3DWL G;  5BXO A;  1DVP A;  3BQO A;  2P9S G;  1HFA A;  5LCW C;  2CHZ A;  5KJM A;  1XNF A;  1Z3Y A;  3TWS A;  1PY1 A;  3AS5 A;  5IY5 E;  4HI9 A;  4L2L A;  2DYS E;  2WXO A;  2PQR A;  5B3S E;  2Y4T A;  4AEZ C;  3PE3 A;  4XEI G;  3E32 A;  3E30 A;  4XI0 A;  4HQD A;  2ETB A;  4F1P A;  1UW4 B;  5ITZ F;  3O48 A;  5DBK A;  3HG0 D;  1SW6 A;  2DZN A;  2MHK A;  2WVI A;  4YDY A;  4FJY A;  4DI3 A;  4QQI A;  2F8X K;  4GTQ A;  4BEP A;  3SHF A;  3FH8 A;  1HH8 A;  4AJW A;  3Q7A A;  3FTS A;  4WUY A;  3Q5M A;  5BPP A;  3UIN C;  3C72 A;  2H6I A;  1N4P A;  4B8C B;  3RU0 A;  4PS3 A;  3ZYM A;  2WQ6 A;  2C0M A;  4URK A;  3L16 A;  1OWP A;  3UXG A;  3CVQ A;  4J8S A;  4GMJ A;  1FT1 A;  5ARG A;  3GZ2 A;  1WG0 A;  5AJL A;  5EIL A;  3UT8 A;  3JYS A;  2YIN A;  3BEE A;  3DEO A;  4DX6 D;  2WQH A;  3HIZ A;  2XEV A;  2GRO B;  2VQ2 A;  2L6B A;  1ELR A;  4TUM A;  4GPM A;  4Q94 A;  2WPV A;  3QWP A;  5AQ7 A;  4UQY A;  1HO8 A;  1Q2Z A;  3HXF A;  3D9I A;  3TXN A;  3UQ3 A;  3Q4A B;  3KSL A;  3DXK G;  1LD8 A;  2QY7 A;  3FY4 A;  3KAE A;  1FVF A;  1N0Q A;  4L2Y A;  2EIM E;  2Y0B G;  3SFX A;  2L6J A;  4KT6 B;  3PNL B;  1MX2 A;  4HRM B;  4AP2 A;  2VGY A;  3MZL B;  2OVF A;  4KMO A;  4OVV A;  3CHR A;  1NP7 A;  3DST A;  5ENT D;  2F0Y A;  3HXD A;  1HS6 A;  1K3Z D;  1HZ4 A;  1OT8 A;  3B95 A;  4AIF A;  4IRU A;  3DPD A;  3CK9 A;  2P2C P;  2LUH A;  3UPV A;  2CG2 A;  1D9S A;  3FWV A;  1Y8M A;  2R17 C;  4R7L A;  3UM0 A;  4HVB A;  2NXP A;  1IQU A;  2FO1 E;  1AP7 A;  4K5A B;  4TRQ A;  5AAO A;  1ZBP A;  3UT7 A;  3DPY A;  4FHK A;  3KSQ A;  1UN8 A;  3SNX A;  2FEZ A;  4FUL A;  4RQI A;  3ZUV B;  3QWW A;  5JHA A;  3DSU A;  4A63 B;  4AV7 A;  3CVL A;  3CKC A;  4RVB A;  2IEJ A;  2Y1L E;  4DX7 D;  2NYJ A;  4CCA A;  1V55 E;  1N54 A;  1SA5 A;  4XZ4 A;  4EZJ A;  3S7J A;  4GMR A;  3AS4 A;  1N4Q A;  4JVS A;  2ILR A;  3EU9 A;  2J09 A;  4MBG A;  1JWF A;  3FP3 A;  3L22 A;  3VLE A;  4FAD A;  3J5Q B;  1MYO A;  2ZGD A;  4ANV A;  5KNH D;  4U04 A;  5KNG A;  3PZD A;  3QK0 A;  2J49 A;  3B13 A;  4F3V A;  3LJ3 A;  1KZP A;  4RSY A;  1PAQ A;  3ZIM A;  4A1G A;  3MX3 A;  3OXF A;  3PUK A;  4HBD A;  4UQX A;  2QZA A;  1H2U A;  2XS8 A;  3OXG A;  3QDN A;  1WAO 1;  3L9T A;  4B93 B;  4M7C A;  3FUK A;  1AWC B;  3Q7F A;  4N39 A;  5ENP D;  1OWO A;  2WXI A;  1YCS B;  3FU3 A;  4GTO A;  5KBA A;  4LER A;  2DCP A;  2Y3A A;  3LDZ A;  5BW8 C;  2VGE A;  3FU6 A;  3MKQ B;  5HRY A;  2J8S D;  3ABM E;  3UM1 A;  2DYR E;  5C1D A;  4JL0 A;  2BF0 X;  1N9A A;  1K1A A;  3NZU A;  1RZ4 A;  3CVV A;  3T8M A;  1DCE A;  4N5Q A;  1S70 B;  4HLL A;  3TG4 A;  4TXP A;  3PZ3 A;  4BWR A;  4BET A;  2XEE A;  5EX0 A;  1EF1 C;  2WXQ A;  1QZ2 A;  3SBS A;  3APF A;  5JHB A;  2XQ0 A;  4J7W A;  3CHQ A;  2HM8 A;  3B7S A;  2VTB B;  5KJK A;  2V0P A;  2L0I A;  5D0Q D;  3GYZ A;  4I1M A;  1BD8 A;  1X81 A;  1H0A A;  4NQ0 A;  1FCH A;  1VDY A;  1BI8 B;  1QNF A;  4XKB A;  4AOF A;  3TG5 A;  2H6G A;  3PS6 A;  3ESL A;  3TWX A;  1K1B A;  3FUN A;  3EU5 A;  4UWK A;  3LVR E;  3TL5 A;  3NB2 A;  3L82 A;  2KAT A;  1OCO E;  1N4R A;  1E8Y A;  3L6A A;  4BY6 A;  4AVX A;  2XEH A;  1BLX B;  4ATZ D;  4YVO A;  3JXJ A;  3UIP C;  3PEV B;  1NA3 A;  4CEM A;  5CMW A;  2I1K A;  3CKB A;  4CRW A;  2XPZ A;  3AU5 A;  3QOU A;  3PZ1 A;  3HDX A;  3QWV A;  5B1A E;  4WND A;  3AG1 E;  4FP7 A;  3FTW A;  2XZD G;  4GML A;  3Q47 B;  4HOQ A;  5JJ6 A;  3DEP A;  2LO6 A;  4UI9 J;  4BTA A;  3I4R B;  1FT2 A;  3ZN3 A;  4V3I A;  3L17 A;  5BXU A;  3LXU X;  4W9R A;  2FBN A;  3FUH A;  1YYH A;  2KC7 A;  3ASD A;  3UIO C;  4G23 A;  4UWH A;  4K03 A;  3CIA A;  3ZKJ A;  2GRQ B;  2YHC A;  3UT4 A;  5BT1 A;  5ANR A;  3ONK A;  3HYM B;  4A3V A;  2PM6 A;  1TN6 A;  3D9M A;  1NZN A;  5AIJ A;  4DX5 D;  3U3W A;  5JMN D;  3UI2 A;  4JXT A;  3Q9U C;  4J0U A;  5B1B E;  2B6C A;  1OWL A;  1TEZ A;  3R7Q A;  3QKY A;  3LCA A;  5CED B;  4I9C A;  2WXN A;  3RRN B;  2VJ8 A;  4KBQ A;  4I17 A;  2PZI A;  4LRZ A;  2XPI A;  4Y6W A;  4HFG A;  4U8H A;  4ANX A;  3HVE B;  2A5E A;  2I9C A;  3W9F A;  1LF8 A;  4FLH A;  4L9P A;  3LY9 A;  2I2O A;  4BT8 A;  3CQG B;  3ZYL A;  2LAI A;  2VSX E;  1DC2 A;  4O1P A;  3S7F A;  4L7T A;  3RSE G;  3QAR A;  3ULY A;  5FTP A;  5ENN A;  3B7R L;  2XRY A;  4X8Q A;  3MJW A;  4ABN A;  2WXM A;  1IYG A;  3L08 A;  3NOC D;  3FTZ A;  1ZU2 A;  2GRR B;  4JEU A;  3FTY A;  2Q7F A;  2YNQ A;  4CGV A;  3FUI A;  3APC A;  4ACK A;  3V30 A;  1KT0 A;  1QYM A;  4APF A;  4O60 A;  2F37 A;  3ASH A;  3Q78 A;  4BER A;  4AY6 A;  1UG3 A;  3PE4 A;  4O6F A;  2WB2 A;  4XI9 A;  3ZYQ A;  4K5B A;  4CDR A;  4MS6 A;  3ZNG A;  2YHE A;  4XE0 A;  4FU3 A;  3LY8 A;  4GZ6 A;  1EDU A;  2XHE A;  2MYO A;  4ANU A;  3MGB A;  4U8V D;  4B8A A;  3FUL A;  3T5X A;  4APO A;  4XX5 A;  5EN5 D;  4JEH A;  3F6Q A;  3T9K A;  4TXQ A;  2KZT B;  3VLF A;  3QB2 A;  5CCL A;  5LP0 A;  2R5S A;  2VSO E;  2GRL A;  2J4B A;  3CQC B;  3CHS A;  3CVN A;  4GCO A;  1MQS A;  3SF4 A;  4C0M A;  2CHX A;  3QC1 A;  4GU5 A;  4MRU A;  4U96 D;  1D8E A;  3UM2 A;  4A1S A;  5LFA A;  2ETC A;  3S7D A;  5BNW A;  2MOW A;  4GTV A;  1JUQ A;  3CK7 A;  5E75 A;  1OUV A;  4UI9 K;  2P9K G;  5A6C A;  3TWV A;  4J6I A;  2BTD A;  1JPL A;  4JPS A;  3FUJ A;  2DVW A;  2UY1 A;  2X6K A;  1O1T A;  4GZ3 A;  4UWG A;  2ZIS A;  3ENE A;  3Q9N C;  4I1O B;  4UI9 C;  5E76 A;  5FIN A;  1PC2 A;  4J8Y A;  3AJI A;  5KJN A;  3V2O A;  2GRP B;  5DIZ A;  3R7R A;  3EHQ A;  2KCV A;  3CHP A;  3BG1 B;  1Y6I A;  3DSS A;  2P9P G;  5KCM A;  4ME2 A;  4WWO A;  1O5M A;  2RG8 A;  3PNT B;  3CLJ A;  3NZS A;  1OCC E;  5T8I A;  2L9B A;  3P2B A;  4EZK A;  3SBT B;  3C3O A;  4HI8 A;  3ZXP A;  3EUV A;  1N4S A;  4LSZ E;  3FDH A;  3KEZ A;  5FQ4 A;  5FZS A;  1W3B A;  2OEV A;  3U66 A;  3ABL E;  4LNG A;  2ETA A;  4BSX A;  3ESK A;  4DJA A;  1NI1 A;  2GRN B;  5JJ7 A;  1TNB A;  2FO7 A;  2J4D A;  3FEX A;  2B0O E;  2X6F A;  3CVU A;  3CVP A;  2ZU6 B;  2XGS A;  3EDT B;  4I2W A;  2R2L A;  4OAU C;  4JA9 A;  4UWF A;  4I43 A;  3RO3 A;  1OWM A;  3G2S A;  3ZW3 A;  4G8K A;  1IHG A;  3C3Q A;  1MX6 A;  2IF4 A;  3RK6 A;  3JUE A;  3FFL A;  5EID A;  2ZIR A;  4MKT A;  3RAU A;  1N11 A;  2H6H A;  2IOS A;  4BTB A;  3ULE G;  4U7E B;  4EEC A;  2QYJ A;  3OXL A;  4OVU A;  4BES A;  2WMN A;  1TR4 A;  5FZQ A;  1TJC A;  5CMY A;  4DRX E;  4I2Z A;  1UOH A;  3TXM A;  2ZGG A;  1E8W A;  4GTM A;  2WQ7 A;  5AQB A;  3E4B A;  2GW1 A;  5H7P A;  2E2E A;  4KVO A;  2FUL A;  3EIQ C;  5BUZ A;  1IKN D;  1TNY A;  1O1R A;  2IU1 A;  2JEK A;  3LY7 A;  1ELW A;  2VSY A;  4JHR A;  4EZL A;  2IJG X;  2X6H A;  2I1J A;  2VGX A;  2EIK E;  3J5P A;  4FC8 A;  5EIB E;  1HF8 A;  3SD5 A;  3FEY A;  1GW6 A;  3WG7 E;  3D9L A;  4BFR A;  3TWT A;  1TNU A;  1V54 E;  3MV3 B;  1NA0 A;  3JXI A;  1Z6T A;  1MX4 A;  3AAA C;  3B7B A;  1SQM A;  3CHM A;  2EIN E;  1OCZ E;  3VLD A;  1KPS B;  1TNZ A;  5M72 A;  4M3O A;  1S63 A;  4BX8 A;  3D9N A;  5ENS D;  5CEA A;  3CV0 A;  2EIL E;  2DWZ A;  4FJZ A;  2LAH A;  3CVW A;  5JA4 D;  3T5V A;  3ISM C;  2CG3 A;  4RG6 A;  4C0E A;  2LXM A;  2R02 A;  3MYV A;  3UX4 A;  2HO1 A;  2C2L A;  3JUI A;  2YQ8 A;  3K9I A;  3G2V A;  4HNA D;  5BV1 A;  4GTR A;  3ZHE B;  2XGO A;  4U07 A;  1LD7 A;  3ZEF A;  4GPK A;  4ILH B;  2A5U A;  3APD A;  3AG3 E;  3U9W A;  4C9B B;  4A3T A;  2V5Q C;  3D9K A;  4ILG A;  4G25 A;  4DI4 A;  5LOZ A;  4HRL A;  3L54 A;  3FU0 A;  1U3C A;  1E8X A;  2V4L A;  2KZT A;  5CRU A;  4F1S A;  1X5B A;  1N94 A;  1H6O A;  4Q96 A;  3HXC A;  2H6F A;  2KCK A;  1DNP A;  5AQA A;  3IV0 A;  4DPR A;  3Q73 A;  3TAX A;  1HX8 A;  4GZC A;  2AXZ A;  4G26 A;  1TN8 A;  2BKK B;  3QNK A;  1SVX A;  2IQC A;  3CVX A;  4U8Y D;  3DRA A;  1H19 A;  4Q69 A;  4PH4 B;  4GA1 A;  4I6J A;  1H6P A;  5AQ9 A;  1N52 A; 
#chains in the Genus database with same CATH homology
 2R05 A;  3UM2 A;  3C3R A;  2OEV A;  1ZB1 A;  3UM3 A;  3C3O A;  3ULY A;  3RAU A;  5CRU A;  3ZXP A;  2XS1 A;  2OJQ A;  2R03 A;  3UM0 A;  2OEW A;  3UM1 A;  3R9M A;  4JIO A;  5CRV A;  2R02 A;  3C3Q A;  2XS8 A;  2OEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...