5CRVA

Crystal structure of the bro domain of hd-ptp in a complex with the core region of stam2
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
361
structure length
357
Chain Sequence
b'MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKAPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
publication title Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 142
structure length 357
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 5crvA00
1ZB1A 5CRVA 3ULYA 2XS1A 2R03A 2OEWA 5CRUA 3UM0A 2R02A 3UM2A 2OEVA 3UM1A 3UM3A 3C3OA 3R9MA 3C3QA 2XS8A 3C3RA 3RAUA 3ZXPA 2R05A
chains in the Genus database with same CATH superfamily
3AU5A 4A3TA 5AYWD 4B0ZA 2KCLA 4CT4A 5CHEE 2X38A 3QWPA 3CSFA 3JUEA 5J90A 1P5QA 1WAO1 2H6GA 2HYZA 1HFAA 3AS4A 1IYGA 4ANUA 3CHRA 2J49A 2LXMA 5CEAA 3CK8A 1S0PA 1TN6A 5D0OD 1MJ0A 5KNGA 3L9TA 2L0IA 2VTBA 4G11A 4U7EB 1DVPA 1HF8A 4GCOA 1QQEA 3I4GA 2VGEA 4DX2A 1OWOA 3MCXA 3TWRA 4HFGA 2ILRA 3FTWA 4WWOA 3L6AA 4EHMA 3DSWA 3FU6A 4EPZA 3C98A 2E2EA 5AQ7A 4JHRA 3PNTB 5CMYA 1OWPA 3FU0A 4O1OA 2P9IG 1N52A 1IKND 4LG6A 3MEKA 2OVFA 3QARA 1RW2A 3LJ3A 4OVVA 4BT9A 3ML9A 1FT2A 3TXNA 3PZ4A 3ASFA 2BEDA 4LEUA 1UOHA 3LVQE 4HLLA 4BX8A 3SBSA 4Q69A 3ZEFA 3TG5A 3N71A 3BQOA 1EYHA 1O1SA 3K9IA 3T8MA 3ZIMA 4KVOA 3Q75A 3IBEA 5BUZA 3ESKA 4G8KA 2NXPA 2B6CA 3MX3A 4I6EA 3URZA 1EPUA 2YHEA 4G1TA 3U4TA 3PS6A 4UQZA 3PNLB 3PH0C 3UIPC 1N0RA 4F7AA 1JCQA 2BF0X 1BU9A 1TJCA 4WNEA 3L13A 2M63A 3EHQA 3PE4A 3Q5MA 3ZGQA 4LUNU 5CEDB 4AOFA 3EU5A 4TXQA 2XRZA 3CQGB 1TNZA 4WNGA 5HI7A 3FTSA 2GRPB 4N5QA 2ZU6B 2R03A 4LNGA 3VLFA 2VSXE 3CKBA 4UWLA 3MZLB 3MKQB 3ML8A 4HRMB 4YDWA 3T5VA 3KSLA 4FLBA 2DZNA 3GYZA 4FP7A 2VGXB 4ACKA 3ASOE 2H6HA 3UT7A 3UMVA 2JLBA 4ANVA 3EJNA 4R7LA 4OVUA 3LY7A 2XGOA 4KYOB 5BW8C 1QBQA 4RLYA 3RK6A 4GYWA 4BSZB 4GYYA 4C9BB 2WPVA 2EIJE 5LCWJ 3FTZA 5D2MC 4DI3A 1O1TA 3RO2A 3AS5A 1UJJA 3FHEA 3E4BA 3ONKA 3ZXSA 1Z3XA 3O4ZA 4UWKA 4LERA 4A1SA 4I2ZA 4TRQA 4EZLA 3Q4AB 3MKQA 2I2OA 4HI8A 1H19A 1DNPA 3QKYA 3ULQA 1E8WA 4K5BA 1K1AA 3RJVA 2PZIA 5JA4D 4FU3A 4HI9A 2RD0A 4YVOA 5G05J 2ZXWE 1KLXA 5EYPF 4J8DA 3SGHA 3S7DA 4CGWA 4N3CA 5AAOA 3FU3A 5E76A 3T5XA 3TAXA 3D9MA 4K5AB 5KNHD 2NYJA 3PEVB 3TWWA 2QYUA 4K0RA 3ONLA 2GRRB 3EDTB 3L54A 4JHKA 4JW1A 5BPPA 5JMND 2BUGA 3LPZA 2PQNA 4CT0A 1HZ4A 3LYAA 3WXXA 4PS3A 4J7WA 2EIKE 4GB9A 2IF4A 4APOA 3Q7AA 5CMWA 4UWFA 3T9KA 4FHKA 5BV1A 4BY6A 1E7VA 4DPRA 2UY1A 3E34A 4PH4B 5G2NA 1W3BA 3CVPA 3MV3B 2P9LG 4GAAA 2R05A 1VDYA 2WXKA 1ZBPA 2V4HC 4URKA 4GTQA 1NZNA 4J8SA 4M7CA 3HVEB 3UKUG 2ZISA 5JJ7A 2P9KG 4XKCA 3TWSA 4JVSA 3D9KA 2YQ8A 2LAHA 3SBTB 3W9GA 4HBDA 2A5UA 4LNBA 2IOSA 2XHEA 4HS2A 4XIFA 3DSUA 4IN3B 1D9SA 3LS8A 3RRUA 1NI1A 3BG1B 2XCBA 4N2QA 3UT8A 1EDUA 3ENEA 4GPKA 4I1OB 3EIQC 2WQ6A 3D9NA 3ZXPA 3BEEA 2WXRA 5AIJA 1U2VG 2NC9A 2KATA 3SFZA 4OAUC 4HOTA 3TGOA 3X2QE 4J0UA 2AJAA 1OY3D 5KJKA 2XEEA 1BI8B 2L9BA 1OXJA 2JABA 4L9PA 4JXTA 5G55A 3UX4A 1HH8A 1PAQA 4PS8A 3L22A 3PUKA 3UIOC 1SQMA 5JHAA 3FP3A 4K03A 4XI0A 4HOUA 4BFRA 1K1BA 3ASHA 4EBAA 1ZU2A 4HOSA 3P1UA 2J09A 1Y6IA 2ZIRA 3VLDA 1H2VC 4CZ2D 5G04J 2I1KA 4F6RD 2RFAA 5LCWC 2X6JA 4MLPA 2R17C 3RRMB 3S7JA 3CVVA 2X6HA 4J8FA 2FO7A 3I3NA 4FA6A 1IQRA 3LJNA 5EIDA 1N4QA 2IY0C 2YHCA 1S64A 5HQ8A 3ABLE 2I9CA 4DJAA 3FUIA 5FTPA 4U63A 3LXUX 3CK9A 2QY7A 1INZA 3BU8A 3HXFA 4UI9K 1KPSB 1TR4A 1V54E 1WDYA 1ELWA 2AXVA 5G05C 3Q73A 5AQAA 2HO1A 1JWFA 5KJLA 1HG2A 1X5BA 4O1PA 2EILE 3QK0A 2WM9A 4F3VA 3KEZA 1N4RA 3R7RA 1OWMA 2IFUA 2XEHA 1BLXB 3SNXA 3B7BA 2AW6A 2ZGGA 2EIME 5ENTD 3ZFWA 3UQ3A 3PDNA 2V5FA 3AJIA 4UQYA 2VSYA 3PE3A 4U07A 2OCCE 4CDRA 2AXUA 4NQ0A 4LCTA 4F53A 4GA2A 3I5PA 2P9UG 3SF4A 4BERA 2IQCA 1KT1A 5BNWA 3FY4A 1LF8A 5FZRA 2NSZA 1YMPA 4XE0A 1HU3A 2DZOA 3G2TA 3L17A 4MKTA 1QZ2A 1MHQA 2OOEA 5ENNA 2A4ZA 2GRQB 3CVLA 1TNUA 3PZDA 4B93B 1Y8MA 3CSTA 2YINA 1OT8A 5CECB 4K5CA 3CVUA 1DC2A 4U0UA 3UINC 1UG3A 4TXRA 1N0QA 4AM9A 3ZU7B 2Y4TA 3FH7A 4JHJA 3CHMA 1Z6TA 2WMNA 3Q15A 3CGHA 5ARFA 3U9WA 3ZUVB 2R59A 1SA5A 4JEHA 3OXFA 4XZ4A 2VGYA 1B89A 3HXBA 2WXOA 4GA0A 5FIOA 4A63B 4NACA 4TUMA 2ONDA 3FTYA 4E85A 1N11A 3IKOB 4FLHA 3QNKA 5HRYA 3DPDA 2FEZA 3QWWA 5D0QD 3UI2A 2KC7A 3V30A 3FUNA 4RQIA 4V3IA 1JWGA 4FJZA 3HXDA 3IXEA 4U0SA 4TXPA 5AN8A 3Q49B 2DWZA 3CQCB 1ELKA 1JPLA 5IY5E 4ATZD 2CHZA 2C0LA 2V4LA 3UXGA 4YDEA 4L23A 4BTBA 1WM5A 2XPIA 3IHYA 3JXIA 4F1PA 3V2XA 3MV2B 5KCMA 3FUEA 3UPVA 3DEPA 2LO6A 5ANRA 3DBSA 5B1BE 4ILHB 3RIBA 3EHRA 5A7DB 4GCNA 4CDMA 3UM1A 1O1RA 2A5EA 5CCMA 2J8SD 3J5QB 1JUQA 4BWRA 1OCOE 5ENPD 2AXZA 1S70B 5FZQA 2L0TB 3NZSA 2MRIA 1MX2A 4I6GA 3OAWA 5G04C 1XNFA 3LEWA 1AWCB 2XRYA 3EU9A 3LCAA 5D66A 5DIZA 5ARGA 4JL0A 4U0ZA 3HXEA 3FUKA 4KXKB 3SO8A 4AEZC 4DX1A 5LP0A 4GPMA 2R02A 3B7RL 2KZTA 4JZYA 4UI9J 2VQ2A 4H7YA 3AG2E 3NAWA 4HVBA 1SW6A 3CEQA 2IO3C 4FC8A 4U95D 3ESLA 2WXNA 3PZ1A 2WXLA 5LX8A 4YDOA 2J08A 3S7BA 4L2LA 3FUJA 3D9IA 4RG6A 3IHVA 1H2UA 3QDNA 5FWQA 5EX3A 5A23A 1SZ9A 2CFZA 1A5EA 3UM3A 3MKRA 4E6HA 2Q7FA 1L5JA 5FQ7A 4ZFHA 1E8YA 4GMRA 4KVMA 2PM7A 3UM0A 1UN9A 4G2VA 4Z68A 4RG9A 4I17A 3LKUA 3IEGA 4DLOA 4DX6D 1KZPA 4CDNA 2DVWA 3ULYA 2I6HA 5HKPA 3HXCA 1GW6A 4N39A 4U96D 3FEXA 3Q7FA 2FF4A 3QWVA 4G25A 4I9EA 3E37A 3D9JA 4GTTA 5AARA 3U66A 1Z3YA 5T8IA 3C3QA 3S2AA 4WWNA 2IJGX 4ATGA 3KEAA 4NRHB 1YYHA 3ZYMA 2UY1B 1MX4A 2BTDA 4YDYA 4GZ5A 3R9MA 4GTOA 2GW1A 4WUYA 3UKRG 4CYMD 4BEPA 1ZB1A 3C5RA 5EILA 3HIZA 1N9AA 2DCPA 3V31A 3VTYA 2KCVA 2X6KA 3ZVVA 2OEWA 1U3CA 2GROB 3L82A 3RSEG 5BXOA 4YVQC 3C3OA 1TEZA 2RFMA 4CRWA 5EKQD 4KZ0A 3Q9NC 4WWPA 2IO2C 5B3SE 4WNFA 2KM4A 4IYPA 3ULEG 3AS8A 3HG0D 3TWVA 2GRNB 2FULA 3DPYA 3R9AB 3CHOA 4B8AA 4L7TA 1NP7A 2MHKA 3D9OA 4MBGA 5AQBA 2DYRE 2Y1LE 5CRVA 3ASGA 3TG4A 4GZ6A 1BI7B 2F8XK 1NA3A 1V55E 4ANWA 4JB8P 1IQUA 2P9PG 3KD7A 1E8ZA 2OV8A 1HG5A 4I6JA 1E7UA 3SY2A 3MJWA 4TV3A 4MRUA 4UQXA 3FUHA 5EDSA 5HS0A 3S7FA 1KZOA 4B94A 4KT6B 4G26A 2VSOE 3TJPA 2KCKA 5LFAA 4GTVA 4BT8A 2ZGDA 1FT1A 3FH8A 1X81A 4GA1A 3ZYQA 3CVWA 4UI9C 3PZ2A 5ANLA 4C0MA 4L1BA 1N4PA 4ILIA 4HB5A 5ENSD 5BXUA 5ITZF 1G3NB 5FJYA 3FTUA 2XS1A 2P9SG 2WXQA 4AVXA 3ZYKA 3TWQA 1MYOA 3SFYA 3KAEA 2CG3A 3QC1A 4WAFA 3RU0A 4OYSA 2DBAA 1E8XA 4ABNA 3B7SA 3CHPA 3PZ3A 4PDXA 3RRNB 4JD2G 2J9QA 3ZW3A 3ZKJA 4UWHA 1H6PA 1E90A 4HRNA 4J8YA 3UTMA 5ENRD 2PQRA 3LY8A 4N2SA 4DX7D 3RO3A 3ASDA 3RKVA 2OVBA 2CHXA 5CBOA 3VTXA 1SZAA 1E96B 2DYSE 4QQIA 1IHGA 3EHNA 4KBQA 2EQXA 2RKKA 3GZ1A 3B13A 4JA9A 3CK7A 2WQHA 3ZHEB 4AIFA 2GRLA 4O6FA 4I43A 3AU4A 2LNIA 4Q94A 1A17A 3D9HA 1FCHA 3KS2A 3FTXA 4DI4A 2XPZA 4EQFA 4BTAA 2DIWA 4ANXA 4I9CA 3QOUA 1NA0A 2WXGA 1KT0A 2F37A 1H6KA 4A1GA 3FTVA 3SI5A 3CHSA 2LSVA 5KJMA 1PC2A 3G2UA 3Q47B 4FJYA 3U3WA 4U8VD 2CFUA 4N3BA 5EN5D 4B8CB 1JCSA 4CEMA 4I2WA 3NOCD 4AJWA 1NFIE 5AQ9A 1YA0A 3ZHEA 3AG1E 3MGBA 5M72A 3UUXA 5FQ8A 2XQ0A 4GTMA 4KMOA 2XGSA 2Y3AA 3DEOA 3SFXA 1FPPA 3CVNA 1MQSA 1U3DA 1N4SA 3GZSA 5BV0A 4HQDA 4GZDA 3ZN3A 2J07A 2H6IA 1FVFA 5CERB 3G2SA 3JXJA 1YCSB 5KBAA 3SZ7A 1OUVA 1HE8A 3NOGD 4XEIG 4APFA 3DSVA 2BKGA 1IXVA 1AP7A 4X8QA 4BX9A 5AENA 3TWUA 5FZSA 3UT4A 2CG2A 3ABKE 5B1AE 4JPSA 2QC9A 5EX0A 4DUIA 3D3MA 3JQ0A 3WG7E 3ZPJA 2J4BA 4AP2A 5LOZA 3E30A 4GTRA 1DCQA 4PS7A 4DLQA 1Q2ZA 2P9NG 4QFVA 3IV0A 3DWLG 4BESA 5T3RA 2OEVA 2VYIA 2LUHA 5CBNA 3O48A 2C0MA 3CIAA 1QYMA 3F6QA 2WXHA 2X6IA 3GW4A 4FADA 4GTSA 3CVQA 2KZTB 4WNDA 4CCAA 2LXLA 5AJLA 3DSTA 2GRMA 1HO8A 4A55A 5JHBA 4GZCA 5FINA 4O60A 3APCA 2KBXA 3LY9A 2HM8A 2V5QC 1D8DA 4HRLA 4NURA 2WMOA 4GZ3A 1TYQG 3C3RA 4UUCA 3HRAA 5AJDA 4F1SA 5FQ6A 1HX8A 2WXPA 3QB2A 3JUIA 1HXIA 1EF1C 2XZTG 3PVLA 2XGMA 3DRAA 3ZRHA 4N5CA 3SHFA 4ZHBA 3Q9UC 3V79K 3FUDA 2XPYA 1N94A 2WXFA 4NIKA 4BETA 4GMLA 2L6JA 4AV7A 3BUAA 2CHWA 4U8HA 3NB2A 4RVBA 4DK5A 1LD8A 3RAUA 3CV0A 4LNUD 3ISMC 4GTPA 3EHMA 2YNQA 2QYJA 2WXJA 5BT1A 1H2TC 3OXGA 3HDXA 3JYSA 4CGVA 3TWXA 1NL4A 5T4YA 2PM6A 3I4RB 5ENOD 1TN7A 3B7TA 4RSYA 1BD8A 2QZAA 5ENQD 2PNNA 1SA4A 2HR2A 2ETBA 3GZ2A 3PRZA 2LAIA 3ZYLA 1TNOA 1N54A 4W9RA 1PY1A 1D8EA 3APFA 1BPOA 1TNBA 3HYMB 3FDHA 1FVHA 4Y6WA 1DCEA 4GMJA 2V8SE 2QFCA 2RG8A 3CHQA 2VGXA 3OTNA 4EECA 2FBNA 2IOLA 4HOQA 4HLEA 4Y6CA 4JA7A 3W9FA 3AG3E 1OCRE 2XCCA 2BKKB 4H7XA 3CVXA 3FUMA 3FU5A 1TNYA 1UW4B 2VSNA 4ME2A 3SD5A 3E32A 3UM2A 4JC8A 2LSUA 3CVYA 2C2LA 5C2YA 4TUUA 3OXLA 3DSXA 2F0YA 4J8EA 4EZJA 1Z5SC 2GGFA 5FT9A 3L16A 1JCRA 5FQ4A 2E0IA 4LSZE 3ABME 4P29A 3NZUA 4D10C 2JEKA 1K8KG 2Y4UA 3NQPA 4BSXA 1UN8A 4AY6A 5J08A 3APDA 2IU1A 3MA5A 3J5PA 4N3AA 3Q79A 4U04A 3D9LA 2P2CP 4I1AA 3ASNE 2XS8A 2IEJA 2UWJG 3PEUB 2FO1E 2MYOA 3FH5A 4M3OA 3KSQA 4MS6A 5DBKA 4GYOA 3JQ1A 3FEYA 2ETAA 1OWLA 5KJNA 3JCKC 3TL5A 4KZCA 3BG0B 3DXMG 4PUCA 2XEVA 5EIBE 2MOWA 4EZKA 4AXHA 4U8YD 3EIJA 1ELRA 4G24A 3B7UX 3DSSA 2HE0A 3FWVA 5KWDA 4G23A 3L08A 3HHMA 3TWTA 4J6IA 2WQ7A 3V2OA 3QJZA 5EYLA 3CKCA 1IHBA 3Q78A 3G2VA 2L6BA 3FULA 4I1MA 4FHJA 2X3MA 2AWIA 4HNAD 5CRUA 4IULA 4EBAG 3NBNB 3DXKG 4Q96A 3SQVA 3QAQA 1UJKA 1MZCA 2VJ8A 3HVEA 3P2BA 4XKBA 3FFLA 1H0AA 1WG0A 1H6OA 5E75A 4B89A 4OAVB 3FUFA 3LDZA 3NF1A 1N95A 4JEUA 1QNFA 3E33A 2WB2A 2B0OE 3C72A 4C48B 2PL2A 4HORA 4HXIA 4DRXE 2R2LA 2Y69E 3ZNGA 3PUJA 3TXMA 2KXPC 3PREA 3D9PA 2P58C 2EINE 1LD7A 1OCCE 4C0EA 4DX5D 4YNDA 2AVPA 3CR3A 1OWNA 2F8YA 4G8LA 4LRZA 1K3ZD 3G2WA 1XGWA 4XI9A 4FULA 3LVRE 3T8KA 4A3VA 2FI7A 2WXIA 3MYVA 2H6FA 1SVXA 2WXMA 3R7QA 2I1JA 5A6CA 4XX5A 2Y0BG 2ETCA 3AAAC 3EUVA 3VLEA 1WY6A 2XENA 3CLJA 4ACLA 1OCZE 2X6FA 1HS6A 2XZDG 3AG4E 4ILGA 4GU5A 4L2YA 5CCLA 1S63A 1LTXA 4AY5A 2VTBB 1MX6A 5H7PA 2J4DA 5JJ6A 2IONA 3U64A 1RZ4A 2R5SA 5C1DA 1O5MA 5JJTA 1TN8A 1TJFA 2V0PA 4UWGA 2WVIA 3B95A 4IRUA
chains in the Genus database with same CATH topology
1ZB1A 5CRVA 3ULYA 2XS1A 2R03A 2OEXA 4JIOA 2OEWA 5CRUA 2R02A 3UM0A 3UM2A 2OEVA 3UM1A 3UM3A 3C3OA 3R9MA 3C3QA 2XS8A 3C3RA 3RAUA 3ZXPA 2OJQA 2R05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB1 A;  5CRV A;  3ULY A;  2XS1 A;  2R03 A;  2OEW A;  5CRU A;  3UM0 A;  2R02 A;  3UM2 A;  2OEV A;  3UM1 A;  3UM3 A;  3C3O A;  3R9M A;  3C3Q A;  2XS8 A;  3C3R A;  3RAU A;  3ZXP A;  2R05 A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  4A3T A;  5AYW D;  4B0Z A;  2KCL A;  4CT4 A;  5CHE E;  2X38 A;  3QWP A;  3CSF A;  3JUE A;  5J90 A;  1P5Q A;  1WAO 1;  2H6G A;  2HYZ A;  1HFA A;  3AS4 A;  1IYG A;  4ANU A;  3CHR A;  2J49 A;  2LXM A;  5CEA A;  3CK8 A;  1S0P A;  1TN6 A;  5D0O D;  1MJ0 A;  5KNG A;  3L9T A;  2L0I A;  2VTB A;  4G11 A;  4U7E B;  1DVP A;  1HF8 A;  4GCO A;  1QQE A;  3I4G A;  2VGE A;  4DX2 A;  1OWO A;  3MCX A;  3TWR A;  4HFG A;  2ILR A;  3FTW A;  4WWO A;  3L6A A;  4EHM A;  3DSW A;  3FU6 A;  4EPZ A;  3C98 A;  2E2E A;  5AQ7 A;  4JHR A;  3PNT B;  5CMY A;  1OWP A;  3FU0 A;  4O1O A;  2P9I G;  1N52 A;  1IKN D;  4LG6 A;  3MEK A;  2OVF A;  3QAR A;  1RW2 A;  3LJ3 A;  4OVV A;  4BT9 A;  3ML9 A;  1FT2 A;  3TXN A;  3PZ4 A;  3ASF A;  2BED A;  4LEU A;  1UOH A;  3LVQ E;  4HLL A;  4BX8 A;  3SBS A;  4Q69 A;  3ZEF A;  3TG5 A;  3N71 A;  3BQO A;  1EYH A;  1O1S A;  3K9I A;  3T8M A;  3ZIM A;  4KVO A;  3Q75 A;  3IBE A;  5BUZ A;  3ESK A;  4G8K A;  2NXP A;  2B6C A;  3MX3 A;  4I6E A;  3URZ A;  1EPU A;  2YHE A;  4G1T A;  3U4T A;  3PS6 A;  4UQZ A;  3PNL B;  3PH0 C;  3UIP C;  1N0R A;  4F7A A;  1JCQ A;  2BF0 X;  1BU9 A;  1TJC A;  4WNE A;  3L13 A;  2M63 A;  3EHQ A;  3PE4 A;  3Q5M A;  3ZGQ A;  4LUN U;  5CED B;  4AOF A;  3EU5 A;  4TXQ A;  2XRZ A;  3CQG B;  1TNZ A;  4WNG A;  5HI7 A;  3FTS A;  2GRP B;  4N5Q A;  2ZU6 B;  2R03 A;  4LNG A;  3VLF A;  2VSX E;  3CKB A;  4UWL A;  3MZL B;  3MKQ B;  3ML8 A;  4HRM B;  4YDW A;  3T5V A;  3KSL A;  4FLB A;  2DZN A;  3GYZ A;  4FP7 A;  2VGX B;  4ACK A;  3ASO E;  2H6H A;  3UT7 A;  3UMV A;  2JLB A;  4ANV A;  3EJN A;  4R7L A;  4OVU A;  3LY7 A;  2XGO A;  4KYO B;  5BW8 C;  1QBQ A;  4RLY A;  3RK6 A;  4GYW A;  4BSZ B;  4GYY A;  4C9B B;  2WPV A;  2EIJ E;  5LCW J;  3FTZ A;  5D2M C;  4DI3 A;  1O1T A;  3RO2 A;  3AS5 A;  1UJJ A;  3FHE A;  3E4B A;  3ONK A;  3ZXS A;  1Z3X A;  3O4Z A;  4UWK A;  4LER A;  4A1S A;  4I2Z A;  4TRQ A;  4EZL A;  3Q4A B;  3MKQ A;  2I2O A;  4HI8 A;  1H19 A;  1DNP A;  3QKY A;  3ULQ A;  1E8W A;  4K5B A;  1K1A A;  3RJV A;  2PZI A;  5JA4 D;  4FU3 A;  4HI9 A;  2RD0 A;  4YVO A;  5G05 J;  2ZXW E;  1KLX A;  5EYP F;  4J8D A;  3SGH A;  3S7D A;  4CGW A;  4N3C A;  5AAO A;  3FU3 A;  5E76 A;  3T5X A;  3TAX A;  3D9M A;  4K5A B;  5KNH D;  2NYJ A;  3PEV B;  3TWW A;  2QYU A;  4K0R A;  3ONL A;  2GRR B;  3EDT B;  3L54 A;  4JHK A;  4JW1 A;  5BPP A;  5JMN D;  2BUG A;  3LPZ A;  2PQN A;  4CT0 A;  1HZ4 A;  3LYA A;  3WXX A;  4PS3 A;  4J7W A;  2EIK E;  4GB9 A;  2IF4 A;  4APO A;  3Q7A A;  5CMW A;  4UWF A;  3T9K A;  4FHK A;  5BV1 A;  4BY6 A;  1E7V A;  4DPR A;  2UY1 A;  3E34 A;  4PH4 B;  5G2N A;  1W3B A;  3CVP A;  3MV3 B;  2P9L G;  4GAA A;  2R05 A;  1VDY A;  2WXK A;  1ZBP A;  2V4H C;  4URK A;  4GTQ A;  1NZN A;  4J8S A;  4M7C A;  3HVE B;  3UKU G;  2ZIS A;  5JJ7 A;  2P9K G;  4XKC A;  3TWS A;  4JVS A;  3D9K A;  2YQ8 A;  2LAH A;  3SBT B;  3W9G A;  4HBD A;  2A5U A;  4LNB A;  2IOS A;  2XHE A;  4HS2 A;  4XIF A;  3DSU A;  4IN3 B;  1D9S A;  3LS8 A;  3RRU A;  1NI1 A;  3BG1 B;  2XCB A;  4N2Q A;  3UT8 A;  1EDU A;  3ENE A;  4GPK A;  4I1O B;  3EIQ C;  2WQ6 A;  3D9N A;  3ZXP A;  3BEE A;  2WXR A;  5AIJ A;  1U2V G;  2NC9 A;  2KAT A;  3SFZ A;  4OAU C;  4HOT A;  3TGO A;  3X2Q E;  4J0U A;  2AJA A;  1OY3 D;  5KJK A;  2XEE A;  1BI8 B;  2L9B A;  1OXJ A;  2JAB A;  4L9P A;  4JXT A;  5G55 A;  3UX4 A;  1HH8 A;  1PAQ A;  4PS8 A;  3L22 A;  3PUK A;  3UIO C;  1SQM A;  5JHA A;  3FP3 A;  4K03 A;  4XI0 A;  4HOU A;  4BFR A;  1K1B A;  3ASH A;  4EBA A;  1ZU2 A;  4HOS A;  3P1U A;  2J09 A;  1Y6I A;  2ZIR A;  3VLD A;  1H2V C;  4CZ2 D;  5G04 J;  2I1K A;  4F6R D;  2RFA A;  5LCW C;  2X6J A;  4MLP A;  2R17 C;  3RRM B;  3S7J A;  3CVV A;  2X6H A;  4J8F A;  2FO7 A;  3I3N A;  4FA6 A;  1IQR A;  3LJN A;  5EID A;  1N4Q A;  2IY0 C;  2YHC A;  1S64 A;  5HQ8 A;  3ABL E;  2I9C A;  4DJA A;  3FUI A;  5FTP A;  4U63 A;  3LXU X;  3CK9 A;  2QY7 A;  1INZ A;  3BU8 A;  3HXF A;  4UI9 K;  1KPS B;  1TR4 A;  1V54 E;  1WDY A;  1ELW A;  2AXV A;  5G05 C;  3Q73 A;  5AQA A;  2HO1 A;  1JWF A;  5KJL A;  1HG2 A;  1X5B A;  4O1P A;  2EIL E;  3QK0 A;  2WM9 A;  4F3V A;  3KEZ A;  1N4R A;  3R7R A;  1OWM A;  2IFU A;  2XEH A;  1BLX B;  3SNX A;  3B7B A;  2AW6 A;  2ZGG A;  2EIM E;  5ENT D;  3ZFW A;  3UQ3 A;  3PDN A;  2V5F A;  3AJI A;  4UQY A;  2VSY A;  3PE3 A;  4U07 A;  2OCC E;  4CDR A;  2AXU A;  4NQ0 A;  4LCT A;  4F53 A;  4GA2 A;  3I5P A;  2P9U G;  3SF4 A;  4BER A;  2IQC A;  1KT1 A;  5BNW A;  3FY4 A;  1LF8 A;  5FZR A;  2NSZ A;  1YMP A;  4XE0 A;  1HU3 A;  2DZO A;  3G2T A;  3L17 A;  4MKT A;  1QZ2 A;  1MHQ A;  2OOE A;  5ENN A;  2A4Z A;  2GRQ B;  3CVL A;  1TNU A;  3PZD A;  4B93 B;  1Y8M A;  3CST A;  2YIN A;  1OT8 A;  5CEC B;  4K5C A;  3CVU A;  1DC2 A;  4U0U A;  3UIN C;  1UG3 A;  4TXR A;  1N0Q A;  4AM9 A;  3ZU7 B;  2Y4T A;  3FH7 A;  4JHJ A;  3CHM A;  1Z6T A;  2WMN A;  3Q15 A;  3CGH A;  5ARF A;  3U9W A;  3ZUV B;  2R59 A;  1SA5 A;  4JEH A;  3OXF A;  4XZ4 A;  2VGY A;  1B89 A;  3HXB A;  2WXO A;  4GA0 A;  5FIO A;  4A63 B;  4NAC A;  4TUM A;  2OND A;  3FTY A;  4E85 A;  1N11 A;  3IKO B;  4FLH A;  3QNK A;  5HRY A;  3DPD A;  2FEZ A;  3QWW A;  5D0Q D;  3UI2 A;  2KC7 A;  3V30 A;  3FUN A;  4RQI A;  4V3I A;  1JWG A;  4FJZ A;  3HXD A;  3IXE A;  4U0S A;  4TXP A;  5AN8 A;  3Q49 B;  2DWZ A;  3CQC B;  1ELK A;  1JPL A;  5IY5 E;  4ATZ D;  2CHZ A;  2C0L A;  2V4L A;  3UXG A;  4YDE A;  4L23 A;  4BTB A;  1WM5 A;  2XPI A;  3IHY A;  3JXI A;  4F1P A;  3V2X A;  3MV2 B;  5KCM A;  3FUE A;  3UPV A;  3DEP A;  2LO6 A;  5ANR A;  3DBS A;  5B1B E;  4ILH B;  3RIB A;  3EHR A;  5A7D B;  4GCN A;  4CDM A;  3UM1 A;  1O1R A;  2A5E A;  5CCM A;  2J8S D;  3J5Q B;  1JUQ A;  4BWR A;  1OCO E;  5ENP D;  2AXZ A;  1S70 B;  5FZQ A;  2L0T B;  3NZS A;  2MRI A;  1MX2 A;  4I6G A;  3OAW A;  5G04 C;  1XNF A;  3LEW A;  1AWC B;  2XRY A;  3EU9 A;  3LCA A;  5D66 A;  5DIZ A;  5ARG A;  4JL0 A;  4U0Z A;  3HXE A;  3FUK A;  4KXK B;  3SO8 A;  4AEZ C;  4DX1 A;  5LP0 A;  4GPM A;  2R02 A;  3B7R L;  2KZT A;  4JZY A;  4UI9 J;  2VQ2 A;  4H7Y A;  3AG2 E;  3NAW A;  4HVB A;  1SW6 A;  3CEQ A;  2IO3 C;  4FC8 A;  4U95 D;  3ESL A;  2WXN A;  3PZ1 A;  2WXL A;  5LX8 A;  4YDO A;  2J08 A;  3S7B A;  4L2L A;  3FUJ A;  3D9I A;  4RG6 A;  3IHV A;  1H2U A;  3QDN A;  5FWQ A;  5EX3 A;  5A23 A;  1SZ9 A;  2CFZ A;  1A5E A;  3UM3 A;  3MKR A;  4E6H A;  2Q7F A;  1L5J A;  5FQ7 A;  4ZFH A;  1E8Y A;  4GMR A;  4KVM A;  2PM7 A;  3UM0 A;  1UN9 A;  4G2V A;  4Z68 A;  4RG9 A;  4I17 A;  3LKU A;  3IEG A;  4DLO A;  4DX6 D;  1KZP A;  4CDN A;  2DVW A;  3ULY A;  2I6H A;  5HKP A;  3HXC A;  1GW6 A;  4N39 A;  4U96 D;  3FEX A;  3Q7F A;  2FF4 A;  3QWV A;  4G25 A;  4I9E A;  3E37 A;  3D9J A;  4GTT A;  5AAR A;  3U66 A;  1Z3Y A;  5T8I A;  3C3Q A;  3S2A A;  4WWN A;  2IJG X;  4ATG A;  3KEA A;  4NRH B;  1YYH A;  3ZYM A;  2UY1 B;  1MX4 A;  2BTD A;  4YDY A;  4GZ5 A;  3R9M A;  4GTO A;  2GW1 A;  4WUY A;  3UKR G;  4CYM D;  4BEP A;  1ZB1 A;  3C5R A;  5EIL A;  3HIZ A;  1N9A A;  2DCP A;  3V31 A;  3VTY A;  2KCV A;  2X6K A;  3ZVV A;  2OEW A;  1U3C A;  2GRO B;  3L82 A;  3RSE G;  5BXO A;  4YVQ C;  3C3O A;  1TEZ A;  2RFM A;  4CRW A;  5EKQ D;  4KZ0 A;  3Q9N C;  4WWP A;  2IO2 C;  5B3S E;  4WNF A;  2KM4 A;  4IYP A;  3ULE G;  3AS8 A;  3HG0 D;  3TWV A;  2GRN B;  2FUL A;  3DPY A;  3R9A B;  3CHO A;  4B8A A;  4L7T A;  1NP7 A;  2MHK A;  3D9O A;  4MBG A;  5AQB A;  2DYR E;  2Y1L E;  5CRV A;  3ASG A;  3TG4 A;  4GZ6 A;  1BI7 B;  2F8X K;  1NA3 A;  1V55 E;  4ANW A;  4JB8 P;  1IQU A;  2P9P G;  3KD7 A;  1E8Z A;  2OV8 A;  1HG5 A;  4I6J A;  1E7U A;  3SY2 A;  3MJW A;  4TV3 A;  4MRU A;  4UQX A;  3FUH A;  5EDS A;  5HS0 A;  3S7F A;  1KZO A;  4B94 A;  4KT6 B;  4G26 A;  2VSO E;  3TJP A;  2KCK A;  5LFA A;  4GTV A;  4BT8 A;  2ZGD A;  1FT1 A;  3FH8 A;  1X81 A;  4GA1 A;  3ZYQ A;  3CVW A;  4UI9 C;  3PZ2 A;  5ANL A;  4C0M A;  4L1B A;  1N4P A;  4ILI A;  4HB5 A;  5ENS D;  5BXU A;  5ITZ F;  1G3N B;  5FJY A;  3FTU A;  2XS1 A;  2P9S G;  2WXQ A;  4AVX A;  3ZYK A;  3TWQ A;  1MYO A;  3SFY A;  3KAE A;  2CG3 A;  3QC1 A;  4WAF A;  3RU0 A;  4OYS A;  2DBA A;  1E8X A;  4ABN A;  3B7S A;  3CHP A;  3PZ3 A;  4PDX A;  3RRN B;  4JD2 G;  2J9Q A;  3ZW3 A;  3ZKJ A;  4UWH A;  1H6P A;  1E90 A;  4HRN A;  4J8Y A;  3UTM A;  5ENR D;  2PQR A;  3LY8 A;  4N2S A;  4DX7 D;  3RO3 A;  3ASD A;  3RKV A;  2OVB A;  2CHX A;  5CBO A;  3VTX A;  1SZA A;  1E96 B;  2DYS E;  4QQI A;  1IHG A;  3EHN A;  4KBQ A;  2EQX A;  2RKK A;  3GZ1 A;  3B13 A;  4JA9 A;  3CK7 A;  2WQH A;  3ZHE B;  4AIF A;  2GRL A;  4O6F A;  4I43 A;  3AU4 A;  2LNI A;  4Q94 A;  1A17 A;  3D9H A;  1FCH A;  3KS2 A;  3FTX A;  4DI4 A;  2XPZ A;  4EQF A;  4BTA A;  2DIW A;  4ANX A;  4I9C A;  3QOU A;  1NA0 A;  2WXG A;  1KT0 A;  2F37 A;  1H6K A;  4A1G A;  3FTV A;  3SI5 A;  3CHS A;  2LSV A;  5KJM A;  1PC2 A;  3G2U A;  3Q47 B;  4FJY A;  3U3W A;  4U8V D;  2CFU A;  4N3B A;  5EN5 D;  4B8C B;  1JCS A;  4CEM A;  4I2W A;  3NOC D;  4AJW A;  1NFI E;  5AQ9 A;  1YA0 A;  3ZHE A;  3AG1 E;  3MGB A;  5M72 A;  3UUX A;  5FQ8 A;  2XQ0 A;  4GTM A;  4KMO A;  2XGS A;  2Y3A A;  3DEO A;  3SFX A;  1FPP A;  3CVN A;  1MQS A;  1U3D A;  1N4S A;  3GZS A;  5BV0 A;  4HQD A;  4GZD A;  3ZN3 A;  2J07 A;  2H6I A;  1FVF A;  5CER B;  3G2S A;  3JXJ A;  1YCS B;  5KBA A;  3SZ7 A;  1OUV A;  1HE8 A;  3NOG D;  4XEI G;  4APF A;  3DSV A;  2BKG A;  1IXV A;  1AP7 A;  4X8Q A;  4BX9 A;  5AEN A;  3TWU A;  5FZS A;  3UT4 A;  2CG2 A;  3ABK E;  5B1A E;  4JPS A;  2QC9 A;  5EX0 A;  4DUI A;  3D3M A;  3JQ0 A;  3WG7 E;  3ZPJ A;  2J4B A;  4AP2 A;  5LOZ A;  3E30 A;  4GTR A;  1DCQ A;  4PS7 A;  4DLQ A;  1Q2Z A;  2P9N G;  4QFV A;  3IV0 A;  3DWL G;  4BES A;  5T3R A;  2OEV A;  2VYI A;  2LUH A;  5CBN A;  3O48 A;  2C0M A;  3CIA A;  1QYM A;  3F6Q A;  2WXH A;  2X6I A;  3GW4 A;  4FAD A;  4GTS A;  3CVQ A;  2KZT B;  4WND A;  4CCA A;  2LXL A;  5AJL A;  3DST A;  2GRM A;  1HO8 A;  4A55 A;  5JHB A;  4GZC A;  5FIN A;  4O60 A;  3APC A;  2KBX A;  3LY9 A;  2HM8 A;  2V5Q C;  1D8D A;  4HRL A;  4NUR A;  2WMO A;  4GZ3 A;  1TYQ G;  3C3R A;  4UUC A;  3HRA A;  5AJD A;  4F1S A;  5FQ6 A;  1HX8 A;  2WXP A;  3QB2 A;  3JUI A;  1HXI A;  1EF1 C;  2XZT G;  3PVL A;  2XGM A;  3DRA A;  3ZRH A;  4N5C A;  3SHF A;  4ZHB A;  3Q9U C;  3V79 K;  3FUD A;  2XPY A;  1N94 A;  2WXF A;  4NIK A;  4BET A;  4GML A;  2L6J A;  4AV7 A;  3BUA A;  2CHW A;  4U8H A;  3NB2 A;  4RVB A;  4DK5 A;  1LD8 A;  3RAU A;  3CV0 A;  4LNU D;  3ISM C;  4GTP A;  3EHM A;  2YNQ A;  2QYJ A;  2WXJ A;  5BT1 A;  1H2T C;  3OXG A;  3HDX A;  3JYS A;  4CGV A;  3TWX A;  1NL4 A;  5T4Y A;  2PM6 A;  3I4R B;  5ENO D;  1TN7 A;  3B7T A;  4RSY A;  1BD8 A;  2QZA A;  5ENQ D;  2PNN A;  1SA4 A;  2HR2 A;  2ETB A;  3GZ2 A;  3PRZ A;  2LAI A;  3ZYL A;  1TNO A;  1N54 A;  4W9R A;  1PY1 A;  1D8E A;  3APF A;  1BPO A;  1TNB A;  3HYM B;  3FDH A;  1FVH A;  4Y6W A;  1DCE A;  4GMJ A;  2V8S E;  2QFC A;  2RG8 A;  3CHQ A;  2VGX A;  3OTN A;  4EEC A;  2FBN A;  2IOL A;  4HOQ A;  4HLE A;  4Y6C A;  4JA7 A;  3W9F A;  3AG3 E;  1OCR E;  2XCC A;  2BKK B;  4H7X A;  3CVX A;  3FUM A;  3FU5 A;  1TNY A;  1UW4 B;  2VSN A;  4ME2 A;  3SD5 A;  3E32 A;  3UM2 A;  4JC8 A;  2LSU A;  3CVY A;  2C2L A;  5C2Y A;  4TUU A;  3OXL A;  3DSX A;  2F0Y A;  4J8E A;  4EZJ A;  1Z5S C;  2GGF A;  5FT9 A;  3L16 A;  1JCR A;  5FQ4 A;  2E0I A;  4LSZ E;  3ABM E;  4P29 A;  3NZU A;  4D10 C;  2JEK A;  1K8K G;  2Y4U A;  3NQP A;  4BSX A;  1UN8 A;  4AY6 A;  5J08 A;  3APD A;  2IU1 A;  3MA5 A;  3J5P A;  4N3A A;  3Q79 A;  4U04 A;  3D9L A;  2P2C P;  4I1A A;  3ASN E;  2XS8 A;  2IEJ A;  2UWJ G;  3PEU B;  2FO1 E;  2MYO A;  3FH5 A;  4M3O A;  3KSQ A;  4MS6 A;  5DBK A;  4GYO A;  3JQ1 A;  3FEY A;  2ETA A;  1OWL A;  5KJN A;  3JCK C;  3TL5 A;  4KZC A;  3BG0 B;  3DXM G;  4PUC A;  2XEV A;  5EIB E;  2MOW A;  4EZK A;  4AXH A;  4U8Y D;  3EIJ A;  1ELR A;  4G24 A;  3B7U X;  3DSS A;  2HE0 A;  3FWV A;  5KWD A;  4G23 A;  3L08 A;  3HHM A;  3TWT A;  4J6I A;  2WQ7 A;  3V2O A;  3QJZ A;  5EYL A;  3CKC A;  1IHB A;  3Q78 A;  3G2V A;  2L6B A;  3FUL A;  4I1M A;  4FHJ A;  2X3M A;  2AWI A;  4HNA D;  5CRU A;  4IUL A;  4EBA G;  3NBN B;  3DXK G;  4Q96 A;  3SQV A;  3QAQ A;  1UJK A;  1MZC A;  2VJ8 A;  3HVE A;  3P2B A;  4XKB A;  3FFL A;  1H0A A;  1WG0 A;  1H6O A;  5E75 A;  4B89 A;  4OAV B;  3FUF A;  3LDZ A;  3NF1 A;  1N95 A;  4JEU A;  1QNF A;  3E33 A;  2WB2 A;  2B0O E;  3C72 A;  4C48 B;  2PL2 A;  4HOR A;  4HXI A;  4DRX E;  2R2L A;  2Y69 E;  3ZNG A;  3PUJ A;  3TXM A;  2KXP C;  3PRE A;  3D9P A;  2P58 C;  2EIN E;  1LD7 A;  1OCC E;  4C0E A;  4DX5 D;  4YND A;  2AVP A;  3CR3 A;  1OWN A;  2F8Y A;  4G8L A;  4LRZ A;  1K3Z D;  3G2W A;  1XGW A;  4XI9 A;  4FUL A;  3LVR E;  3T8K A;  4A3V A;  2FI7 A;  2WXI A;  3MYV A;  2H6F A;  1SVX A;  2WXM A;  3R7Q A;  2I1J A;  5A6C A;  4XX5 A;  2Y0B G;  2ETC A;  3AAA C;  3EUV A;  3VLE A;  1WY6 A;  2XEN A;  3CLJ A;  4ACL A;  1OCZ E;  2X6F A;  1HS6 A;  2XZD G;  3AG4 E;  4ILG A;  4GU5 A;  4L2Y A;  5CCL A;  1S63 A;  1LTX A;  4AY5 A;  2VTB B;  1MX6 A;  5H7P A;  2J4D A;  5JJ6 A;  2ION A;  3U64 A;  1RZ4 A;  2R5S A;  5C1D A;  1O5M A;  5JJT A;  1TN8 A;  1TJF A;  2V0P A;  4UWG A;  2WVI A;  3B95 A;  4IRU A; 
#chains in the Genus database with same CATH homology
 1ZB1 A;  5CRV A;  3ULY A;  2XS1 A;  2R03 A;  2OEX A;  4JIO A;  2OEW A;  5CRU A;  2R02 A;  3UM0 A;  3UM2 A;  2OEV A;  3UM1 A;  3UM3 A;  3C3O A;  3R9M A;  3C3Q A;  2XS8 A;  3C3R A;  3RAU A;  3ZXP A;  2OJQ A;  2R05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...