5CRVA

Crystal structure of the bro domain of hd-ptp in a complex with the core region of stam2
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
361
structure length
357
Chain Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKAPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
total genus 142
structure length 357
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 5crvA00
3ULYA 3UM3A 5CRUA 2OEWA 2R03A 3C3OA 2R05A 1ZB1A 2OEVA 3RAUA 2R02A 3UM0A 5CRVA 2XS8A 3C3QA 3UM1A 3R9MA 3ZXPA 3C3RA 3UM2A 2XS1A
chains in the Genus database with same CATH superfamily
3I4GA 4ME2A 1TJFA 3HG0D 4BSXA 2L9BA 4GPMA 5AJLA 3LY8A 4CGVA 2OVBA 3BQOA 2OEVA 3AG4E 5CEAA 1GW6A 3DSVA 4FU3A 2OOEA 5EILA 3HVEB 4AIFA 4ILIA 2XZTG 3D3MA 4OAUC 4K0RA 2XGSA 1KZOA 1OCCE 2WQ7A 4I43A 3QNKA 4O60A 1MYOA 4FLBA 3TG4A 3TWWA 3LPZA 2R17C 2XEVA 2V0PA 3QKYA 1JCSA 1OWLA 2JLBA 3TG5A 2DYSE 1TYQG 4NRHB 5EIBE 4B93B 3UKRG 3I5PA 4KVOA 4CDNA 3FP3A 3L82A 3ENEA 4EBAA 2X6FA 1AP7A 2V8SE 2F37A 4XI0A 1TR4A 4EZJA 3HXCA 3SI5A 5FTPA 4K03A 4G11A 3U64A 2XQ0A 4U63A 1EPUA 5J90A 2PQNA 2ZU6B 4GA0A 2IY0C 3C3QA 4MBGA 3ZW3A 2IJGX 5AJDA 3UM2A 3IHYA 3DSXA 2WXMA 4YVQC 1H0AA 4ABNA 2V4LA 1PAQA 3TXNA 4TRQA 2P9PG 3JQ1A 2WMNA 2WPVA 3GZ1A 3B7BA 3JYSA 5AAOA 5KBAA 4YVOA 5EX0A 3CVYA 1N94A 3MKQB 3CVWA 3FUFA 1TNOA 3E30A 2CFZA 3S7FA 3SD5A 4TXQA 2PNNA 3CK7A 5FZRA 3ZU7B 4L23A 3EJNA 2UY1B 3PE4A 3TL5A 1UJJA 5ENNA 2QC9A 2GRLA 3B13A 3IV0A 4A1GA 3I3NA 2EINE 1D8EA 3IEGA 2F8YA 4U0SA 3PZDA 3S7DA 2H6HA 1N54A 4I2ZA 3IXEA 4L2YA 5C1DA 3CIAA 3CVLA 3E37A 2F0YA 3JQ0A 3ZHEA 3TWQA 2V5FA 5EYPF 4BTAA 5CMWA 3HXFA 3JUIA 4G25A 4WWNA 4U7EB 4L7TA 2NSZA 5G05C 4N3BA 4A55A 3RRMB 4GA2A 2J49A 1OCZE 3MA5A 4AY6A 3EHRA 2WXHA 1WY6A 4JB8P 1MHQA 3MV2B 4M7CA 3BG1B 1H2TC 3TGOA 3LJ3A 3ZYMA 4F53A 4GYWA 5CERB 3DXKG 1E96B 4GMRA 4D10C 2P9LG 3OTNA 1N0QA 3APDA 2QYUA 4LNUD 1Z3YA 2L6JA 4DPRA 3ABLE 3ASGA 3FTYA 1OUVA 3ZPJA 4HNAD 3ML8A 2LNIA 4BEPA 3L13A 3TWSA 3UX4A 5AIJA 3TWVA 3SO8A 3APFA 3PUKA 3ZEFA 2C0MA 2I6HA 2GGFA 5E75A 5AN8A 2LXMA 5DIZA 3CHRA 3MKQA 4G8KA 2I1JA 4J6IA 3QJZA 5JJTA 3B95A 2HR2A 1ZBPA 5AQ7A 2AXUA 5JHBA 3QB2A 3U9WA 1YCSB 4DX7D 2AWIA 5ENRD 3HXEA 3ZFWA 2XS1A 4WAFA 3EIJA 3EU9A 3L08A 3MX3A 1H6KA 4QFVA 5FQ4A 3PZ3A 4WNGA 3W9GA 3V79K 4G1TA 3NZSA 4BT8A 1FT2A 3Q5MA 3LY9A 2IU1A 3NZUA 4H7YA 4DX5D 4UUCA 5CHEE 4UQYA 4GTSA 1FPPA 2XPZA 1INZA 4CZ2D 4ANWA 5A6CA 3QDNA 2L0IA 2IF4A 2AXVA 2ILRA 4HI8A 2RD0A 1WAO1 4GTVA 4NQ0A 1ELRA 1BI8B 5M72A 1QQEA 4LG6A 2ZISA 4DK5A 3EUVA 3L17A 2IQCA 2CHWA 4GTOA 5HI7A 2V5QC 4O1OA 3QWWA 4Q96A 4DLOA 4LSZE 3DPDA 4EBAG 1VDYA 1TNBA 4YDEA 1TNYA 3ESLA 4YDYA 2GRQB 4LERA 2H6IA 1AWCB 3TWUA 3IHVA 2DCPA 1UOHA 1LTXA 5DBKA 1N52A 3RU0A 3TAXA 4N3CA 2A5UA 4X8QA 2XPIA 1Q2ZA 4MS6A 3TXMA 1OCOE 2LXLA 2RG8A 3FUEA 1MX2A 4KXKB 3FHEA 3E33A 2UWJG 2XZDG 3RKVA 2YHCA 2FO1E 1E8XA 2FULA 4G8LA 3RO3A 3HXBA 1V55E 3DSWA 1MZCA 3LJNA 4HQDA 2PZIA 4Q94A 3T5XA 1BU9A 1OY3D 3G2WA 3QK0A 3Q73A 4I2WA 3O4ZA 4F1SA 1V54E 3V31A 4PH4B 4J8DA 2Y69E 2Y4UA 4R7LA 3G2UA 1N4QA 4Y6WA 3OXLA 2XPYA 1ZU2A 5BW8C 5HRYA 4I6JA 4HBDA 3L22A 3UTMA 2KCVA 2X38A 5EIDA 5T4YA 3N71A 5EYLA 1TNZA 2AJAA 3ZGQA 4A63B 5FWQA 1TN8A 5ENSD 3LEWA 3MZLB 1D9SA 4U07A 3G2TA 3G2SA 4YNDA 2J07A 1N4PA 3C3RA 2BUGA 3URZA 3UMVA 3UQ3A 4OYSA 2DBAA 3FTUA 5EDSA 1HS6A 4NACA 2R05A 1KT0A 3FU6A 3HXDA 2PM7A 1LD8A 3D9MA 2EIJE 3MEKA 1OCRE 2HO1A 4HLLA 1G3NB 3VTXA 2LAIA 4GTQA 4FJYA 4DLQA 2YINA 3CVUA 4JXTA 3PREA 1IQRA 4JA9A 4MRUA 2PQRA 3DXMG 2WXNA 3ONLA 2RKKA 1TEZA 2BEDA 3LVRE 1IHGA 4WNFA 2L0TB 1XGWA 4C48B 1HFAA 3AS4A 4UWFA 5IY5E 4CDRA 4MKTA 4U8YD 3DSSA 3KEZA 3MJWA 3TJPA 2WMOA 1JWGA 3IBEA 1SZ9A 3D9OA 5CRVA 4BX9A 5G04C 3RK6A 4G26A 1DCQA 1S63A 3OXFA 1NL4A 3BU8A 1HU3A 4N3AA 3CV0A 4E85A 1X5BA 3RIBA 2CFUA 3C72A 3LDZA 5FZSA 3SBTB 3CVVA 4I1AA 4RVBA 4UI9J 3D9HA 3SZ7A 2XS8A 2CG2A 4XE0A 2E2EA 4FJZA 2IOLA 1K8KG 3FUJA 4UWLA 2I9CA 3ZNGA 4GYOA 4ATZD 3D9KA 4DX1A 3HIZA 3K9IA 1K3ZD 4Z68A 4OAVB 4L2LA 3RAUA 3JUEA 5LFAA 2E0IA 4HVBA 4TV3A 5FIOA 5EKQD 4GTTA 2J4BA 3DEOA 2P58C 3ULQA 2IFUA 3UT4A 5ANRA 4EQFA 4GCOA 2WQHA 1N0RA 3HYMB 3FTXA 2XEHA 1OT8A 4B0ZA 4IRUA 4DI3A 4DX2A 2DZOA 3KAEA 1OWPA 4U96D 3RSEG 2XRYA 2NYJA 1S70B 2XGOA 2Y1LE 3FUIA 1HF8A 1NA3A 4K5CA 3AU5A 3ESKA 4F1PA 2B0OE 3PUJA 3R9MA 1H6PA 5HS0A 3J5PA 4GCNA 4GTRA 5CRUA 2WB2A 2R03A 2XRZA 4GB9A 1MQSA 2ETAA 3UPVA 2P9KG 3HHMA 1MX4A 2BTDA 3PS6A 2GRNB 5BNWA 4B94A 3VLDA 3MGBA 3EU5A 1KT1A 1K1AA 3JXIA 3QARA 4JD2G 2KXPC 1U3CA 3CHQA 1NP7A 3Q9UC 1ELKA 3CHMA 3GZ2A 4HORA 4JEHA 3RRUA 4RLYA 4F3VA 1SQMA 3SNXA 4DRXE 5BXOA 1IHBA 4C0MA 4KZ0A 4P29A 4LRZA 2KM4A 4LCTA 3JCKC 3Q7FA 4FP7A 4IN3B 1O1RA 1WDYA 3ZYQA 3FUNA 3Q9NC 3B7UX 5G04J 3PH0C 3PE3A 5D0OD 1KZPA 2GRMA 4XIFA 4LNGA 4YDWA 2WXGA 4HFGA 3MCXA 2QFCA 1EDUA 4OVUA 2J4DA 1FT1A 1JWFA 1QNFA 2VSNA 3WXXA 4GTMA 3UM0A 3JXJA 4EZKA 2ZGGA 2VGXB 1Z3XA 4PS3A 3ZXPA 2R5SA 3DSUA 4RQIA 2X6IA 3ULYA 5AYWD 3I4RB 5JA4D 2RFMA 4L1BA 4TXPA 1HG5A 2OEWA 4TUMA 5KNGA 5EN5D 2P9NG 5FINA 2ZIRA 4CEMA 3DEPA 4AY5A 3PZ2A 4G24A 5CBNA 1WM5A 1N95A 3ZXSA 4HRLA 2ETCA 4JC8A 3EDTB 1SA4A 4GTPA 3CSTA 3APCA 3C3OA 5KJMA 5A7DB 3NB2A 2VYIA 1BPOA 5BV1A 3VLEA 2DVWA 3T8KA 3QWPA 3AU4A 3B7SA 3E34A 2KCLA 3SGHA 3U4TA 4AXHA 3VLFA 3O48A 3SBSA 1KLXA 5FZQA 2J09A 3MYVA 3PEUB 2J8SD 2PL2A 1A17A 4GPKA 4BX8A 3ASNE 4KT6B 4F6RD 3R7QA 1HX8A 2R2LA 3G2VA 2C2LA 4CDMA 3ABME 3E32A 2LUHA 5BPPA 3UT7A 5AARA 4XX5A 1Z5SC 2MHKA 2WXRA 5KCMA 3FY4A 2X6JA 5D0QD 1EYHA 5CECB 5AQAA 3L16A 3RRNB 2MYOA 2VGYA 4ANXA 4KBQA 3SF4A 1WG0A 4I9EA 3FFLA 4U0ZA 4U04A 4V3IA 2GROB 3MV3B 3MKRA 3CHPA 4N39A 1B89A 3GW4A 2KBXA 4J8YA 5ANLA 4HOSA 4N5CA 1JPLA 4CT0A 5KWDA 5ENTD 4HOUA 3Q49B 3FULA 4GA1A 4KYOB 1H2UA 4JEUA 2R59A 3CK9A 2FEZA 4JHRA 4EZLA 3KEAA 3FEXA 4BFRA 3EHMA 2XCCA 4APOA 4H7XA 5LX8A 3DBSA 3ZYKA 2J08A 4ANVA 4HRNA 5ITZF 4I9CA 1UW4B 3UM1A 3PDNA 2FF4A 1D8DA 2I2OA 1OWOA 5LOZA 4FULA 3D9NA 4C0EA 4GZ6A 3D9LA 3KSLA 4J8FA 3LYAA 3PZ4A 1QBQA 3Q75A 3SHFA 3F6QA 3UT8A 4FLHA 2KATA 2P9SG 3EIQC 3P1UA 4RSYA 2WQ6A 3J5QB 5FJYA 4GU5A 1XNFA 3QC1A 3CKCA 3FWVA 1DVPA 4NURA 2WXKA 4M3OA 4PDXA 4A3TA 3FUMA 2I1KA 4O6FA 5A23A 5FQ7A 5FT9A 4J8EA 4HOTA 5BT1A 3CK8A 2M63A 4KVMA 5KJKA 5CCMA 3D9PA 2DYRE 4U95D 1NA0A 3FUHA 5T8IA 3UUXA 3KS2A 1E8WA 2P9UG 4I1MA 2X6KA 4I6GA 4WNDA 2VGXA 1UG3A 3PVLA 1E8ZA 4DI4A 2Q7FA 2LSVA 1SA5A 4ZHBA 1K1BA 1E7UA 4QQIA 1N11A 4K5BA 4XI9A 4N2SA 2HYZA 3CHOA 3RO2A 3V30A 3Q7AA 3CGHA 4FC8A 2BF0X 3CR3A 4GMLA 1X81A 2YQ8A 1MJ0A 2WXIA 3PEVB 5LCWC 3CKBA 3RJVA 3QWVA 3ASDA 3DWLG 2VGEA 4BERA 4KMOA 4I17A 3BG0B 2QZAA 4BETA 2CHXA 4UQZA 3Q79A 5CEDB 4AV7A 3PNLB 3CVNA 1JCRA 1QYMA 2WM9A 1JUQA 1RZ4A 3AS5A 5D2MC 5FQ8A 2OCCE 3L9TA 3S7BA 2EILE 3V2XA 2UY1A 4HRMB 1YA0A 4Q69A 3SY2A 2VTBA 1OXJA 3PZ1A 2FO7A 4FA6A 5H7PA 3FTZA 3KSQA 1Y8MA 2AW6A 3B7TA 3T8MA 1FCHA 3VTYA 1LF8A 4EHMA 4W9RA 1P5QA 3D9IA 2EIKE 4UI9K 2H6GA 3ZKJA 3FTSA 2F8XK 3LKUA 4XKBA 1QZ2A 2X6HA 4C9BB 4CGWA 5ARFA 2X3MA 1HG2A 4AJWA 2J9QA 4AEZC 1MX6A 2IONA 3UINC 2OV8A 4U0UA 3FTWA 3CQCB 1TN6A 3DPYA 4XEIG 5B1AE 2XEEA 1SW6A 2PM6A 3FU3A 3HVEA 2L6BA 1N4SA 2XGMA 3ZUVB 5ENQD 1BLXB 1HZ4A 3EHNA 3HDXA 2KC7A 3TWTA 3WG7E 4BTBA 5CBOA 2WVIA 4L9PA 4HLEA 2VQ2A 3T5VA 3UXGA 4CT4A 2FBNA 3IKOB 4AM9A 4I1OB 4CCAA 4EECA 3DSTA 2LAHA 3ASOE 3NOGD 1UN9A 3B7RL 4YDOA 4K5AB 2XCBA 4ZFHA 3CSFA 4APFA 4JZYA 1RW2A 1BI7B 1NZNA 5J08A 3BEEA 3EHQA 3R7RA 1UJKA 3QOUA 4FHJA 1OWNA 3FU0A 2WXPA 3LVQE 3UM3A 4NIKA 4KZCA 1Z6TA 3C98A 4WUYA 3NF1A 5KNHD 3CQGB 3NQPA 2DWZA 5AQBA 2WXLA 3AAAC 2NXPA 3AG2E 3SQVA 3U66A 4G23A 5CCLA 3W9FA 4GZ5A 3LS8A 4O1PA 3UI2A 3Q4AB 2P9IG 4BESA 4PUCA 3ISMC 4J7WA 2OVFA 1S0PA 2IEJA 3U3WA 5JHAA 5G05J 4HXIA 1U3DA 3UKUG 2YHEA 2BKGA 3KD7A 4JPSA 3FH5A 3QAQA 2A4ZA 3OAWA 3GZSA 3P2BA 4CRWA 1SVXA 3Q78A 2HM8A 5KJNA 4BY6A 2CG3A 1E7VA 3ASHA 2KZTA 4U8HA 3AS8A 2YNQA 1IXVA 2ZGDA 1ZB1A 3DRAA 4GAAA 3SFXA 1ELWA 2A5EA 4XZ4A 3C5RA 2WXJA 3FU5A 5JMND 1O1TA 1HE8A 3OXGA 3ML9A 2IO2C 4ANUA 4DJAA 4RG6A 2JEKA 2WXQA 3TWRA 1DC2A 4HS2A 2VSOE 3BUAA 2GW1A 2R02A 3FTVA 5CMYA 1H19A 1NI1A 3AJIA 4BSZB 1IKND 4Y6CA 4ILHB 4JA7A 4TUUA 3CVQA 4U8VD 3X2QE 2FI7A 3S2AA 2Y0BG 2Y4TA 3CVPA 4FHKA 2AVPA 2VSXE 2P2CP 1HH8A 4JHKA 1NFIE 3FH8A 4B8CB 4J8SA 3NBNB 3AG1E 3S7JA 5E76A 4JW1A 1OWMA 2C0LA 5G2NA 1TJCA 3ASFA 3V2OA 2BKKB 4WWPA 4AP2A 5LCWJ 4RG9A 5ENOD 3LCAA 4A1SA 5BUZA 4B89A 3FEYA 2GRRB 2QY7A 1FVFA 2JABA 1FVHA 1H2VC 3E4BA 2CHZA 4UI9C 1YMPA 1HO8A 1PC2A 4B8AA 4BWRA 5BV0A 5ENPD 3CEQA 4BT9A 4EPZA 3FUKA 3L54A 1DCEA 4LNBA 5HQ8A 2MRIA 2ONDA 3Q47B 5B1BE 4AVXA 5JJ6A 2EIME 4GZCA 4WWOA 4GZDA 4GZ3A 3ZVVA 4LUNU 2KZTB 4XKCA 1DNPA 5EX3A 5B3SE 1U2VG 3ZRHA 3ABKE 3L6AA 2LSUA 4HB5A 5BXUA 2VTBB 3ZHEB 2RFAA 2DIWA 5C2YA 1Y6IA 2AXZA 2GRPB 5AENA 3ZYLA 1O1SA 3SFYA 3FH7A 4MLPA 3CLJA 2VSYA 3T9KA 1BD8A 3PNTB 3SFZA 4HI9A 2IO3C 5FQ6A 1SZAA 4DUIA 2Y3AA 3CHSA 4DX6D 1YYHA 4ACLA 1L5JA 1PY1A 5HKPA 1HXIA 1IQUA 3UIPC 5JJ7A 2XENA 2VJ8A 4LEUA 3ULEG 4FADA 1KPSB 5LP0A 4ILGA 2B6CA 4J0UA 4I6EA 3R9AB 3AG3E 2V4HC 1UN8A 5KJLA 2NC9A 3UIOC 1E8YA 3NOCD 4WNEA 2LO6A 1E90A 2ETBA 3GYZA 3HRAA 4IULA 2MOWA 2HE0A 3TWXA 1O5MA 2QYJA 4IYPA 2ZXWE 4CYMD 5G55A 5ARGA 4UWHA 1W3BA 4UWGA 1H6OA 4AOFA 4E6HA 3FDHA 4JL0A 1LD7A 4N2QA 4N5QA 5D66A 2IOSA 2H6FA 1N9AA 4PS7A 4JHJA 3D9JA 3LXUX 4UQXA 4A3VA 3PRZA 3Q15A 2DZNA 1S64A 3ZIMA 2WXFA 4ACKA 4OVVA 1TNUA 1TN7A 3LY7A 4URKA 4UWKA 4TXRA 2WXOA 4ATGA 3FUDA 1A5EA 4G2VA 3NAWA 1IYGA 4HOQA 4PS8A 5AQ9A 3CVXA 4GMJA 2KCKA 1EF1C 4F7AA 1JCQA 5T3RA 2EQXA 3ZN3A 1N4RA 4JVSA 3ONKA 2XHEA 4GYYA
chains in the Genus database with same CATH topology
3ULYA 3UM3A 2OJQA 5CRUA 2OEXA 2OEWA 2R03A 3C3OA 2R05A 1ZB1A 2OEVA 3RAUA 4JIOA 2R02A 3UM0A 5CRVA 2XS8A 3C3QA 3UM1A 3R9MA 3ZXPA 3C3RA 3UM2A 2XS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULY A;  3UM3 A;  5CRU A;  2OEW A;  2R03 A;  3C3O A;  2R05 A;  1ZB1 A;  2OEV A;  3RAU A;  2R02 A;  3UM0 A;  5CRV A;  2XS8 A;  3C3Q A;  3UM1 A;  3R9M A;  3ZXP A;  3C3R A;  3UM2 A;  2XS1 A; 
#chains in the Genus database with same CATH topology
 3I4G A;  4ME2 A;  1TJF A;  3HG0 D;  4BSX A;  2L9B A;  4GPM A;  5AJL A;  3LY8 A;  4CGV A;  2OVB A;  3BQO A;  2OEV A;  3AG4 E;  5CEA A;  1GW6 A;  3DSV A;  4FU3 A;  2OOE A;  5EIL A;  3HVE B;  4AIF A;  4ILI A;  2XZT G;  3D3M A;  4OAU C;  4K0R A;  2XGS A;  1KZO A;  1OCC E;  2WQ7 A;  4I43 A;  3QNK A;  4O60 A;  1MYO A;  4FLB A;  3TG4 A;  3TWW A;  3LPZ A;  2R17 C;  2XEV A;  2V0P A;  3QKY A;  1JCS A;  1OWL A;  2JLB A;  3TG5 A;  2DYS E;  1TYQ G;  4NRH B;  5EIB E;  4B93 B;  3UKR G;  3I5P A;  4KVO A;  4CDN A;  3FP3 A;  3L82 A;  3ENE A;  4EBA A;  2X6F A;  1AP7 A;  2V8S E;  2F37 A;  4XI0 A;  1TR4 A;  4EZJ A;  3HXC A;  3SI5 A;  5FTP A;  4K03 A;  4G11 A;  3U64 A;  2XQ0 A;  4U63 A;  1EPU A;  5J90 A;  2PQN A;  2ZU6 B;  4GA0 A;  2IY0 C;  3C3Q A;  4MBG A;  3ZW3 A;  2IJG X;  5AJD A;  3UM2 A;  3IHY A;  3DSX A;  2WXM A;  4YVQ C;  1H0A A;  4ABN A;  2V4L A;  1PAQ A;  3TXN A;  4TRQ A;  2P9P G;  3JQ1 A;  2WMN A;  2WPV A;  3GZ1 A;  3B7B A;  3JYS A;  5AAO A;  5KBA A;  4YVO A;  5EX0 A;  3CVY A;  1N94 A;  3MKQ B;  3CVW A;  3FUF A;  1TNO A;  3E30 A;  2CFZ A;  3S7F A;  3SD5 A;  4TXQ A;  2PNN A;  3CK7 A;  5FZR A;  3ZU7 B;  4L23 A;  3EJN A;  2UY1 B;  3PE4 A;  3TL5 A;  1UJJ A;  5ENN A;  2QC9 A;  2GRL A;  3B13 A;  3IV0 A;  4A1G A;  3I3N A;  2EIN E;  1D8E A;  3IEG A;  2F8Y A;  4U0S A;  3PZD A;  3S7D A;  2H6H A;  1N54 A;  4I2Z A;  3IXE A;  4L2Y A;  5C1D A;  3CIA A;  3CVL A;  3E37 A;  2F0Y A;  3JQ0 A;  3ZHE A;  3TWQ A;  2V5F A;  5EYP F;  4BTA A;  5CMW A;  3HXF A;  3JUI A;  4G25 A;  4WWN A;  4U7E B;  4L7T A;  2NSZ A;  5G05 C;  4N3B A;  4A55 A;  3RRM B;  4GA2 A;  2J49 A;  1OCZ E;  3MA5 A;  4AY6 A;  3EHR A;  2WXH A;  1WY6 A;  4JB8 P;  1MHQ A;  3MV2 B;  4M7C A;  3BG1 B;  1H2T C;  3TGO A;  3LJ3 A;  3ZYM A;  4F53 A;  4GYW A;  5CER B;  3DXK G;  1E96 B;  4GMR A;  4D10 C;  2P9L G;  3OTN A;  1N0Q A;  3APD A;  2QYU A;  4LNU D;  1Z3Y A;  2L6J A;  4DPR A;  3ABL E;  3ASG A;  3FTY A;  1OUV A;  3ZPJ A;  4HNA D;  3ML8 A;  2LNI A;  4BEP A;  3L13 A;  3TWS A;  3UX4 A;  5AIJ A;  3TWV A;  3SO8 A;  3APF A;  3PUK A;  3ZEF A;  2C0M A;  2I6H A;  2GGF A;  5E75 A;  5AN8 A;  2LXM A;  5DIZ A;  3CHR A;  3MKQ A;  4G8K A;  2I1J A;  4J6I A;  3QJZ A;  5JJT A;  3B95 A;  2HR2 A;  1ZBP A;  5AQ7 A;  2AXU A;  5JHB A;  3QB2 A;  3U9W A;  1YCS B;  4DX7 D;  2AWI A;  5ENR D;  3HXE A;  3ZFW A;  2XS1 A;  4WAF A;  3EIJ A;  3EU9 A;  3L08 A;  3MX3 A;  1H6K A;  4QFV A;  5FQ4 A;  3PZ3 A;  4WNG A;  3W9G A;  3V79 K;  4G1T A;  3NZS A;  4BT8 A;  1FT2 A;  3Q5M A;  3LY9 A;  2IU1 A;  3NZU A;  4H7Y A;  4DX5 D;  4UUC A;  5CHE E;  4UQY A;  4GTS A;  1FPP A;  2XPZ A;  1INZ A;  4CZ2 D;  4ANW A;  5A6C A;  3QDN A;  2L0I A;  2IF4 A;  2AXV A;  2ILR A;  4HI8 A;  2RD0 A;  1WAO 1;  4GTV A;  4NQ0 A;  1ELR A;  1BI8 B;  5M72 A;  1QQE A;  4LG6 A;  2ZIS A;  4DK5 A;  3EUV A;  3L17 A;  2IQC A;  2CHW A;  4GTO A;  5HI7 A;  2V5Q C;  4O1O A;  3QWW A;  4Q96 A;  4DLO A;  4LSZ E;  3DPD A;  4EBA G;  1VDY A;  1TNB A;  4YDE A;  1TNY A;  3ESL A;  4YDY A;  2GRQ B;  4LER A;  2H6I A;  1AWC B;  3TWU A;  3IHV A;  2DCP A;  1UOH A;  1LTX A;  5DBK A;  1N52 A;  3RU0 A;  3TAX A;  4N3C A;  2A5U A;  4X8Q A;  2XPI A;  1Q2Z A;  4MS6 A;  3TXM A;  1OCO E;  2LXL A;  2RG8 A;  3FUE A;  1MX2 A;  4KXK B;  3FHE A;  3E33 A;  2UWJ G;  2XZD G;  3RKV A;  2YHC A;  2FO1 E;  1E8X A;  2FUL A;  4G8L A;  3RO3 A;  3HXB A;  1V55 E;  3DSW A;  1MZC A;  3LJN A;  4HQD A;  2PZI A;  4Q94 A;  3T5X A;  1BU9 A;  1OY3 D;  3G2W A;  3QK0 A;  3Q73 A;  4I2W A;  3O4Z A;  4F1S A;  1V54 E;  3V31 A;  4PH4 B;  4J8D A;  2Y69 E;  2Y4U A;  4R7L A;  3G2U A;  1N4Q A;  4Y6W A;  3OXL A;  2XPY A;  1ZU2 A;  5BW8 C;  5HRY A;  4I6J A;  4HBD A;  3L22 A;  3UTM A;  2KCV A;  2X38 A;  5EID A;  5T4Y A;  3N71 A;  5EYL A;  1TNZ A;  2AJA A;  3ZGQ A;  4A63 B;  5FWQ A;  1TN8 A;  5ENS D;  3LEW A;  3MZL B;  1D9S A;  4U07 A;  3G2T A;  3G2S A;  4YND A;  2J07 A;  1N4P A;  3C3R A;  2BUG A;  3URZ A;  3UMV A;  3UQ3 A;  4OYS A;  2DBA A;  3FTU A;  5EDS A;  1HS6 A;  4NAC A;  2R05 A;  1KT0 A;  3FU6 A;  3HXD A;  2PM7 A;  1LD8 A;  3D9M A;  2EIJ E;  3MEK A;  1OCR E;  2HO1 A;  4HLL A;  1G3N B;  3VTX A;  2LAI A;  4GTQ A;  4FJY A;  4DLQ A;  2YIN A;  3CVU A;  4JXT A;  3PRE A;  1IQR A;  4JA9 A;  4MRU A;  2PQR A;  3DXM G;  2WXN A;  3ONL A;  2RKK A;  1TEZ A;  2BED A;  3LVR E;  1IHG A;  4WNF A;  2L0T B;  1XGW A;  4C48 B;  1HFA A;  3AS4 A;  4UWF A;  5IY5 E;  4CDR A;  4MKT A;  4U8Y D;  3DSS A;  3KEZ A;  3MJW A;  3TJP A;  2WMO A;  1JWG A;  3IBE A;  1SZ9 A;  3D9O A;  5CRV A;  4BX9 A;  5G04 C;  3RK6 A;  4G26 A;  1DCQ A;  1S63 A;  3OXF A;  1NL4 A;  3BU8 A;  1HU3 A;  4N3A A;  3CV0 A;  4E85 A;  1X5B A;  3RIB A;  2CFU A;  3C72 A;  3LDZ A;  5FZS A;  3SBT B;  3CVV A;  4I1A A;  4RVB A;  4UI9 J;  3D9H A;  3SZ7 A;  2XS8 A;  2CG2 A;  4XE0 A;  2E2E A;  4FJZ A;  2IOL A;  1K8K G;  3FUJ A;  4UWL A;  2I9C A;  3ZNG A;  4GYO A;  4ATZ D;  3D9K A;  4DX1 A;  3HIZ A;  3K9I A;  1K3Z D;  4Z68 A;  4OAV B;  4L2L A;  3RAU A;  3JUE A;  5LFA A;  2E0I A;  4HVB A;  4TV3 A;  5FIO A;  5EKQ D;  4GTT A;  2J4B A;  3DEO A;  2P58 C;  3ULQ A;  2IFU A;  3UT4 A;  5ANR A;  4EQF A;  4GCO A;  2WQH A;  1N0R A;  3HYM B;  3FTX A;  2XEH A;  1OT8 A;  4B0Z A;  4IRU A;  4DI3 A;  4DX2 A;  2DZO A;  3KAE A;  1OWP A;  4U96 D;  3RSE G;  2XRY A;  2NYJ A;  1S70 B;  2XGO A;  2Y1L E;  3FUI A;  1HF8 A;  1NA3 A;  4K5C A;  3AU5 A;  3ESK A;  4F1P A;  2B0O E;  3PUJ A;  3R9M A;  1H6P A;  5HS0 A;  3J5P A;  4GCN A;  4GTR A;  5CRU A;  2WB2 A;  2R03 A;  2XRZ A;  4GB9 A;  1MQS A;  2ETA A;  3UPV A;  2P9K G;  3HHM A;  1MX4 A;  2BTD A;  3PS6 A;  2GRN B;  5BNW A;  4B94 A;  3VLD A;  3MGB A;  3EU5 A;  1KT1 A;  1K1A A;  3JXI A;  3QAR A;  4JD2 G;  2KXP C;  1U3C A;  3CHQ A;  1NP7 A;  3Q9U C;  1ELK A;  3CHM A;  3GZ2 A;  4HOR A;  4JEH A;  3RRU A;  4RLY A;  4F3V A;  1SQM A;  3SNX A;  4DRX E;  5BXO A;  1IHB A;  4C0M A;  4KZ0 A;  4P29 A;  4LRZ A;  2KM4 A;  4LCT A;  3JCK C;  3Q7F A;  4FP7 A;  4IN3 B;  1O1R A;  1WDY A;  3ZYQ A;  3FUN A;  3Q9N C;  3B7U X;  5G04 J;  3PH0 C;  3PE3 A;  5D0O D;  1KZP A;  2GRM A;  4XIF A;  4LNG A;  4YDW A;  2WXG A;  4HFG A;  3MCX A;  2QFC A;  1EDU A;  4OVU A;  2J4D A;  1FT1 A;  1JWF A;  1QNF A;  2VSN A;  3WXX A;  4GTM A;  3UM0 A;  3JXJ A;  4EZK A;  2ZGG A;  2VGX B;  1Z3X A;  4PS3 A;  3ZXP A;  2R5S A;  3DSU A;  4RQI A;  2X6I A;  3ULY A;  5AYW D;  3I4R B;  5JA4 D;  2RFM A;  4L1B A;  4TXP A;  1HG5 A;  2OEW A;  4TUM A;  5KNG A;  5EN5 D;  2P9N G;  5FIN A;  2ZIR A;  4CEM A;  3DEP A;  4AY5 A;  3PZ2 A;  4G24 A;  5CBN A;  1WM5 A;  1N95 A;  3ZXS A;  4HRL A;  2ETC A;  4JC8 A;  3EDT B;  1SA4 A;  4GTP A;  3CST A;  3APC A;  3C3O A;  5KJM A;  5A7D B;  3NB2 A;  2VYI A;  1BPO A;  5BV1 A;  3VLE A;  2DVW A;  3T8K A;  3QWP A;  3AU4 A;  3B7S A;  3E34 A;  2KCL A;  3SGH A;  3U4T A;  4AXH A;  3VLF A;  3O48 A;  3SBS A;  1KLX A;  5FZQ A;  2J09 A;  3MYV A;  3PEU B;  2J8S D;  2PL2 A;  1A17 A;  4GPK A;  4BX8 A;  3ASN E;  4KT6 B;  4F6R D;  3R7Q A;  1HX8 A;  2R2L A;  3G2V A;  2C2L A;  4CDM A;  3ABM E;  3E32 A;  2LUH A;  5BPP A;  3UT7 A;  5AAR A;  4XX5 A;  1Z5S C;  2MHK A;  2WXR A;  5KCM A;  3FY4 A;  2X6J A;  5D0Q D;  1EYH A;  5CEC B;  5AQA A;  3L16 A;  3RRN B;  2MYO A;  2VGY A;  4ANX A;  4KBQ A;  3SF4 A;  1WG0 A;  4I9E A;  3FFL A;  4U0Z A;  4U04 A;  4V3I A;  2GRO B;  3MV3 B;  3MKR A;  3CHP A;  4N39 A;  1B89 A;  3GW4 A;  2KBX A;  4J8Y A;  5ANL A;  4HOS A;  4N5C A;  1JPL A;  4CT0 A;  5KWD A;  5ENT D;  4HOU A;  3Q49 B;  3FUL A;  4GA1 A;  4KYO B;  1H2U A;  4JEU A;  2R59 A;  3CK9 A;  2FEZ A;  4JHR A;  4EZL A;  3KEA A;  3FEX A;  4BFR A;  3EHM A;  2XCC A;  4APO A;  4H7X A;  5LX8 A;  3DBS A;  3ZYK A;  2J08 A;  4ANV A;  4HRN A;  5ITZ F;  4I9C A;  1UW4 B;  3UM1 A;  3PDN A;  2FF4 A;  1D8D A;  2I2O A;  1OWO A;  5LOZ A;  4FUL A;  3D9N A;  4C0E A;  4GZ6 A;  3D9L A;  3KSL A;  4J8F A;  3LYA A;  3PZ4 A;  1QBQ A;  3Q75 A;  3SHF A;  3F6Q A;  3UT8 A;  4FLH A;  2KAT A;  2P9S G;  3EIQ C;  3P1U A;  4RSY A;  2WQ6 A;  3J5Q B;  5FJY A;  4GU5 A;  1XNF A;  3QC1 A;  3CKC A;  3FWV A;  1DVP A;  4NUR A;  2WXK A;  4M3O A;  4PDX A;  4A3T A;  3FUM A;  2I1K A;  4O6F A;  5A23 A;  5FQ7 A;  5FT9 A;  4J8E A;  4HOT A;  5BT1 A;  3CK8 A;  2M63 A;  4KVM A;  5KJK A;  5CCM A;  3D9P A;  2DYR E;  4U95 D;  1NA0 A;  3FUH A;  5T8I A;  3UUX A;  3KS2 A;  1E8W A;  2P9U G;  4I1M A;  2X6K A;  4I6G A;  4WND A;  2VGX A;  1UG3 A;  3PVL A;  1E8Z A;  4DI4 A;  2Q7F A;  2LSV A;  1SA5 A;  4ZHB A;  1K1B A;  1E7U A;  4QQI A;  1N11 A;  4K5B A;  4XI9 A;  4N2S A;  2HYZ A;  3CHO A;  3RO2 A;  3V30 A;  3Q7A A;  3CGH A;  4FC8 A;  2BF0 X;  3CR3 A;  4GML A;  1X81 A;  2YQ8 A;  1MJ0 A;  2WXI A;  3PEV B;  5LCW C;  3CKB A;  3RJV A;  3QWV A;  3ASD A;  3DWL G;  2VGE A;  4BER A;  4KMO A;  4I17 A;  3BG0 B;  2QZA A;  4BET A;  2CHX A;  4UQZ A;  3Q79 A;  5CED B;  4AV7 A;  3PNL B;  3CVN A;  1JCR A;  1QYM A;  2WM9 A;  1JUQ A;  1RZ4 A;  3AS5 A;  5D2M C;  5FQ8 A;  2OCC E;  3L9T A;  3S7B A;  2EIL E;  3V2X A;  2UY1 A;  4HRM B;  1YA0 A;  4Q69 A;  3SY2 A;  2VTB A;  1OXJ A;  3PZ1 A;  2FO7 A;  4FA6 A;  5H7P A;  3FTZ A;  3KSQ A;  1Y8M A;  2AW6 A;  3B7T A;  3T8M A;  1FCH A;  3VTY A;  1LF8 A;  4EHM A;  4W9R A;  1P5Q A;  3D9I A;  2EIK E;  4UI9 K;  2H6G A;  3ZKJ A;  3FTS A;  2F8X K;  3LKU A;  4XKB A;  1QZ2 A;  2X6H A;  4C9B B;  4CGW A;  5ARF A;  2X3M A;  1HG2 A;  4AJW A;  2J9Q A;  4AEZ C;  1MX6 A;  2ION A;  3UIN C;  2OV8 A;  4U0U A;  3FTW A;  3CQC B;  1TN6 A;  3DPY A;  4XEI G;  5B1A E;  2XEE A;  1SW6 A;  2PM6 A;  3FU3 A;  3HVE A;  2L6B A;  1N4S A;  2XGM A;  3ZUV B;  5ENQ D;  1BLX B;  1HZ4 A;  3EHN A;  3HDX A;  2KC7 A;  3TWT A;  3WG7 E;  4BTB A;  5CBO A;  2WVI A;  4L9P A;  4HLE A;  2VQ2 A;  3T5V A;  3UXG A;  4CT4 A;  2FBN A;  3IKO B;  4AM9 A;  4I1O B;  4CCA A;  4EEC A;  3DST A;  2LAH A;  3ASO E;  3NOG D;  1UN9 A;  3B7R L;  4YDO A;  4K5A B;  2XCB A;  4ZFH A;  3CSF A;  4APF A;  4JZY A;  1RW2 A;  1BI7 B;  1NZN A;  5J08 A;  3BEE A;  3EHQ A;  3R7R A;  1UJK A;  3QOU A;  4FHJ A;  1OWN A;  3FU0 A;  2WXP A;  3LVQ E;  3UM3 A;  4NIK A;  4KZC A;  1Z6T A;  3C98 A;  4WUY A;  3NF1 A;  5KNH D;  3CQG B;  3NQP A;  2DWZ A;  5AQB A;  2WXL A;  3AAA C;  2NXP A;  3AG2 E;  3SQV A;  3U66 A;  4G23 A;  5CCL A;  3W9F A;  4GZ5 A;  3LS8 A;  4O1P A;  3UI2 A;  3Q4A B;  2P9I G;  4BES A;  4PUC A;  3ISM C;  4J7W A;  2OVF A;  1S0P A;  2IEJ A;  3U3W A;  5JHA A;  5G05 J;  4HXI A;  1U3D A;  3UKU G;  2YHE A;  2BKG A;  3KD7 A;  4JPS A;  3FH5 A;  3QAQ A;  2A4Z A;  3OAW A;  3GZS A;  3P2B A;  4CRW A;  1SVX A;  3Q78 A;  2HM8 A;  5KJN A;  4BY6 A;  2CG3 A;  1E7V A;  3ASH A;  2KZT A;  4U8H A;  3AS8 A;  2YNQ A;  1IXV A;  2ZGD A;  1ZB1 A;  3DRA A;  4GAA A;  3SFX A;  1ELW A;  2A5E A;  4XZ4 A;  3C5R A;  2WXJ A;  3FU5 A;  5JMN D;  1O1T A;  1HE8 A;  3OXG A;  3ML9 A;  2IO2 C;  4ANU A;  4DJA A;  4RG6 A;  2JEK A;  2WXQ A;  3TWR A;  1DC2 A;  4HS2 A;  2VSO E;  3BUA A;  2GW1 A;  2R02 A;  3FTV A;  5CMY A;  1H19 A;  1NI1 A;  3AJI A;  4BSZ B;  1IKN D;  4Y6C A;  4ILH B;  4JA7 A;  4TUU A;  3CVQ A;  4U8V D;  3X2Q E;  2FI7 A;  3S2A A;  2Y0B G;  2Y4T A;  3CVP A;  4FHK A;  2AVP A;  2VSX E;  2P2C P;  1HH8 A;  4JHK A;  1NFI E;  3FH8 A;  4B8C B;  4J8S A;  3NBN B;  3AG1 E;  3S7J A;  5E76 A;  4JW1 A;  1OWM A;  2C0L A;  5G2N A;  1TJC A;  3ASF A;  3V2O A;  2BKK B;  4WWP A;  4AP2 A;  5LCW J;  4RG9 A;  5ENO D;  3LCA A;  4A1S A;  5BUZ A;  4B89 A;  3FEY A;  2GRR B;  2QY7 A;  1FVF A;  2JAB A;  1FVH A;  1H2V C;  3E4B A;  2CHZ A;  4UI9 C;  1YMP A;  1HO8 A;  1PC2 A;  4B8A A;  4BWR A;  5BV0 A;  5ENP D;  3CEQ A;  4BT9 A;  4EPZ A;  3FUK A;  3L54 A;  1DCE A;  4LNB A;  5HQ8 A;  2MRI A;  2OND A;  3Q47 B;  5B1B E;  4AVX A;  5JJ6 A;  2EIM E;  4GZC A;  4WWO A;  4GZD A;  4GZ3 A;  3ZVV A;  4LUN U;  2KZT B;  4XKC A;  1DNP A;  5EX3 A;  5B3S E;  1U2V G;  3ZRH A;  3ABK E;  3L6A A;  2LSU A;  4HB5 A;  5BXU A;  2VTB B;  3ZHE B;  2RFA A;  2DIW A;  5C2Y A;  1Y6I A;  2AXZ A;  2GRP B;  5AEN A;  3ZYL A;  1O1S A;  3SFY A;  3FH7 A;  4MLP A;  3CLJ A;  2VSY A;  3T9K A;  1BD8 A;  3PNT B;  3SFZ A;  4HI9 A;  2IO3 C;  5FQ6 A;  1SZA A;  4DUI A;  2Y3A A;  3CHS A;  4DX6 D;  1YYH A;  4ACL A;  1L5J A;  1PY1 A;  5HKP A;  1HXI A;  1IQU A;  3UIP C;  5JJ7 A;  2XEN A;  2VJ8 A;  4LEU A;  3ULE G;  4FAD A;  1KPS B;  5LP0 A;  4ILG A;  2B6C A;  4J0U A;  4I6E A;  3R9A B;  3AG3 E;  2V4H C;  1UN8 A;  5KJL A;  2NC9 A;  3UIO C;  1E8Y A;  3NOC D;  4WNE A;  2LO6 A;  1E90 A;  2ETB A;  3GYZ A;  3HRA A;  4IUL A;  2MOW A;  2HE0 A;  3TWX A;  1O5M A;  2QYJ A;  4IYP A;  2ZXW E;  4CYM D;  5G55 A;  5ARG A;  4UWH A;  1W3B A;  4UWG A;  1H6O A;  4AOF A;  4E6H A;  3FDH A;  4JL0 A;  1LD7 A;  4N2Q A;  4N5Q A;  5D66 A;  2IOS A;  2H6F A;  1N9A A;  4PS7 A;  4JHJ A;  3D9J A;  3LXU X;  4UQX A;  4A3V A;  3PRZ A;  3Q15 A;  2DZN A;  1S64 A;  3ZIM A;  2WXF A;  4ACK A;  4OVV A;  1TNU A;  1TN7 A;  3LY7 A;  4URK A;  4UWK A;  4TXR A;  2WXO A;  4ATG A;  3FUD A;  1A5E A;  4G2V A;  3NAW A;  1IYG A;  4HOQ A;  4PS8 A;  5AQ9 A;  3CVX A;  4GMJ A;  2KCK A;  1EF1 C;  4F7A A;  1JCQ A;  5T3R A;  2EQX A;  3ZN3 A;  1N4R A;  4JVS A;  3ONK A;  2XHE A;  4GYY A; 
#chains in the Genus database with same CATH homology
 3ULY A;  3UM3 A;  2OJQ A;  5CRU A;  2OEX A;  2OEW A;  2R03 A;  3C3O A;  2R05 A;  1ZB1 A;  2OEV A;  3RAU A;  4JIO A;  2R02 A;  3UM0 A;  5CRV A;  2XS8 A;  3C3Q A;  3UM1 A;  3R9M A;  3ZXP A;  3C3R A;  3UM2 A;  2XS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...