5CRVA

Crystal structure of the bro domain of hd-ptp in a complex with the core region of stam2
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
361
structure length
357
Chain Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKAPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
total genus 142
structure length 357
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 5crvA00
3ULYA 3ZXPA 3RAUA 5CRVA 5CRUA 3C3QA 3UM2A 3UM3A 2XS1A 2XS8A 2OEWA 2R05A 1ZB1A 3R9MA 2R02A 3C3RA 2R03A 3UM0A 3UM1A 3C3OA 2OEVA
chains in the Genus database with same CATH superfamily
2X6KA 4CDMA 2AWIA 4L2YA 4JB8P 4DX2A 3DEOA 3Q9UC 1TR4A 4JPSA 2XRYA 4ILGA 4U04A 3TWRA 2JABA 5AN8A 3CGHA 5C1DA 4I43A 3UM0A 5ENQD 4OVUA 4APFA 4RVBA 2WXMA 1IXVA 3DEPA 3I5PA 2CFZA 2E0IA 5T8IA 2J07A 2QYJA 2HO1A 3NAWA 1H6KA 4KZCA 5FWQA 2XHEA 2ZISA 2KCLA 3D9MA 5J08A 1TNOA 5EKQD 4Q94A 3LJNA 5A6CA 3WXXA 3ZYKA 4B94A 2PNNA 3J5QB 4GTRA 2F8YA 3D9JA 1A5EA 5CCLA 1EDUA 3D9NA 3TXNA 4V3IA 1WY6A 4A3TA 1EF1C 2Q7FA 1JPLA 3EIJA 1YCSB 4OYSA 1HE8A 4G26A 5BXOA 4DK5A 1D8DA 3WG7E 3FUMA 3UPVA 2LNIA 3CVUA 3QOUA 1VDYA 3C3RA 5JA4D 3AS8A 2H6FA 1U3DA 3CKCA 3Q75A 1UJJA 3W9FA 3FUFA 2X6JA 4HVBA 4DX7D 3GW4A 2IO2C 3JCKC 3PZ2A 4DX5D 2H6IA 2R2LA 1O1SA 3BQOA 3VLDA 2V5QC 2HM8A 2LXMA 2XCCA 4ME2A 3B7UX 4CDNA 4GPKA 1E90A 2XEHA 4ACLA 4GAAA 2PM6A 3C72A 4ACKA 2R05A 2RD0A 3UIPC 2V5FA 1SQMA 3RRMB 4CT0A 2R17C 4GZCA 5EYLA 4UWLA 2RKKA 4DLQA 1QYMA 2DZOA 2WXHA 3ZGQA 3UMVA 3MYVA 3Q73A 4OAVB 4FULA 2ZIRA 2WXJA 2Y1LE 5ENSD 3HHMA 5HI7A 1TEZA 2IQCA 4WWPA 3PRZA 2LAIA 5EX0A 3EHRA 2VGXB 5JHBA 2YHEA 2VJ8A 4B8CB 1MX6A 2GRNB 5J90A 3T5VA 3RRUA 4DJAA 4DX6D 2IU1A 3ULQA 3I4GA 4KVMA 4EBAA 4WAFA 2L0IA 4EZLA 2VSNA 1E8YA 3B7TA 4PDXA 3QJZA 5BPPA 2KZTB 4YDOA 1FT1A 3TWWA 4UWHA 3AG3E 4GU5A 1XNFA 5CECB 2BEDA 2OVBA 4N5QA 5BW8C 2E2EA 3CVWA 4FHJA 4N3AA 2J4BA 4E6HA 4YDWA 2VSOE 1K8KG 3SZ7A 3CVXA 4UI9C 4D10C 4L9PA 3IHYA 4BTBA 5G04J 2AW6A 1OXJA 3FU3A 3LXUX 3FDHA 2BKGA 1FCHA 3QKYA 1TN7A 3CKBA 4JHKA 3EHNA 2Y4TA 3FUJA 3Q47B 3EHMA 3TWVA 2XGOA 1IHBA 4C9BB 2OOEA 1D9SA 2CG3A 5H7PA 4GTQA 3AG2E 4I1MA 2XS8A 2VYIA 2XPIA 4JZYA 3NBNB 4ANXA 1H0AA 2V4HC 3B7SA 1H6PA 3CHOA 3RK6A 4FP7A 3UX4A 4F7AA 4RG6A 2FULA 1FPPA 4HLEA 2NC9A 1OWMA 2WXKA 1UN8A 4DI4A 2ILRA 4CZ2D 4JHRA 3B13A 1IHGA 1HG2A 2EIME 5ANLA 4GZ6A 1OWLA 4Y6CA 4ILIA 4BSZB 4GMRA 4GA0A 5KJMA 1KZOA 2IJGX 3ZYMA 2J09A 3N71A 4GTOA 3UM3A 4KXKB 5AYWD 2BF0X 4A63B 2EIJE 3QDNA 1BPOA 2HYZA 2L9BA 1X81A 4PS8A 1Z5SC 5A23A 2P9IG 4KZ0A 4G24A 4GZDA 4O6FA 4HOUA 1OWPA 1KT0A 4K5CA 3CIAA 1MX4A 3CHPA 4MRUA 3FUDA 3ZVVA 3T5XA 4G23A 3CSFA 3AG1E 4G11A 3PNTB 3TG4A 3UINC 5FQ8A 2P58C 2XEEA 3U9WA 3FWVA 1RZ4A 1TJCA 4XI0A 1W3BA 1AP7A 2LSVA 4LNBA 3UI2A 3ML8A 3IHVA 2OVFA 2V8SE 2AXVA 3MX3A 3CHRA 1EYHA 4TXRA 4AOFA 2OEWA 4Q96A 1S64A 5A7DB 5FJYA 4EECA 2DYRE 4GB9A 1FVHA 1QNFA 2ZGGA 3PUJA 4O1PA 4I1AA 2X6IA 4YVOA 4KT6B 3Q15A 4TUUA 3CLJA 3QK0A 1Z3XA 1KZPA 2RFMA 1N4SA 4AXHA 3ZNGA 1SA4A 4I6GA 3NOCD 4XX5A 4B0ZA 2CHXA 3OTNA 4UWGA 4ABNA 3ASFA 4LNUD 3FU6A 4N2SA 5ENOD 4NURA 3CVNA 2VQ2A 3Q5MA 5CMYA 3HRAA 5LOZA 4ATZD 3QWVA 1QQEA 4L2LA 4BSXA 1LD7A 3L9TA 3BUAA 3E30A 4JD2G 5FZSA 3OXFA 3ONKA 2C0MA 3JQ1A 3AS4A 2XENA 1PAQA 1WDYA 1NP7A 1TN8A 4AM9A 4LNGA 4BERA 3VTXA 3ML9A 1H2UA 3TGOA 4DUIA 1BLXB 3L82A 4XI9A 2AXUA 2VSXE 3RKVA 4I6EA 4KMOA 3JXJA 3CK9A 3D9IA 5BT1A 4XE0A 3C98A 2ZXWE 2B6CA 4W9RA 3RO2A 3ZKJA 3JYSA 4UUCA 3SNXA 4ATGA 1QZ2A 4TXPA 1L5JA 4GTVA 2Y4UA 4K5AB 4FADA 1NA0A 3PVLA 4I2WA 4PS3A 4NACA 2DVWA 3FH7A 4B93B 3FTXA 3TWUA 3L22A 4E85A 2C0LA 3DXKG 3D9HA 4DI3A 2H6GA 3ASDA 3Q7AA 4GTSA 4RSYA 2KBXA 3EUVA 4ILHB 4MBGA 3G2WA 3FU0A 1UJKA 4HFGA 4IYPA 3CVVA 1N4PA 3G2SA 1OWNA 3DPYA 3OXGA 1WM5A 3FEYA 2IFUA 5CBOA 2XZDG 5EILA 4HOTA 1SW6A 4I2ZA 2FI7A 5FQ7A 3SD5A 2MHKA 3ABKE 5AARA 1HZ4A 1IQUA 1OUVA 4JC8A 4IULA 3G2VA 3J5PA 4WWNA 1ELKA 3SQVA 2KATA 4HBDA 3SO8A 3HDXA 4O60A 3MGBA 4BESA 2X6FA 3DPDA 4YNDA 1E8ZA 2VSYA 2R59A 3FUIA 3L54A 1DCQA 4BEPA 2KZTA 2FO1E 3C5RA 5E75A 1JCSA 3UM2A 2IF4A 4HOSA 1HX8A 1TNBA 1HG5A 4UWKA 3IXEA 4BETA 5G05J 2WXGA 2YQ8A 4L1BA 4L23A 4AY5A 3CHSA 2X3MA 4YVQC 3FULA 1H2TC 3ABLE 1XGWA 3TWSA 4GA1A 4HRMB 4JL0A 1UN9A 4TV3A 2Y0BG 1S70B 1YMPA 2FBNA 3EU9A 4B8AA 3RRNB 3DXMG 5FZRA 3DSWA 3QC1A 2J8SD 1K3ZD 2XCBA 3PH0C 3L08A 3HYMB 4WNGA 3DRAA 4HLLA 3UT4A 1LTXA 3ULYA 2CHZA 2WQ7A 2IOLA 1N4QA 3FUEA 3BEEA 3I3NA 4GTPA 2NXPA 4I6JA 3ZHEB 3HVEB 4HNAD 1U2VG 3S7FA 3X2QE 4G25A 3AU4A 4BY6A 2QZAA 3MZLB 3L13A 3NQPA 2WM9A 4GYOA 3V79K 4HB5A 2P9SG 3B95A 1FT2A 1K1AA 3L6AA 3FEXA 1MQSA 1E7UA 2BTDA 3P2BA 2VGYA 1NA3A 3ZUVB 5G2NA 3F6QA 3E37A 3LYAA 3RIBA 5CHEE 3LY9A 5FTPA 3JUIA 4N39A 1ELRA 2KXPC 2WQ6A 3LVQE 4GA2A 1IKND 4UI9K 4CYMD 1N11A 3UKUG 3PZDA 3LDZA 4JA7A 1H2VC 5C2YA 1QBQA 2F8XK 2A4ZA 2X6HA 3NF1A 1UW4B 4MS6A 4CCAA 2J9QA 3S7JA 1DC2A 4TXQA 3TG5A 4GYYA 1N0RA 2PZIA 4URKA 5KNHD 2I2OA 2DWZA 5CEDB 5FINA 4C0EA 1TNZA 3APCA 5B3SE 3HG0D 3CVPA 1MZCA 3KS2A 4JEUA 5KNGA 2XPYA 1OCRE 5DBKA 4GZ3A 4CEMA 2XQ0A 3NB2A 4NIKA 5KWDA 5G04C 4G2VA 4GYWA 3UT8A 1OY3D 3LEWA 2FO7A 1OCZE 1O1TA 2QYUA 2XGMA 3G2UA 4I9EA 1E8XA 3FH8A 5JJ7A 3HXDA 3Q9NC 2GRRB 3JXIA 4KVOA 3G2TA 1G3NB 3VTYA 2L0TB 5CCMA 2WMNA 4HI9A 1E8WA 3ASHA 3AS5A 5KJLA 3UQ3A 3FTUA 3NZUA 2LAHA 3ESKA 5KJKA 1OCOE 3CQCB 3ZEFA 4C0MA 1B89A 3KAEA 2I9CA 4XZ4A 3ZRHA 5EN5D 2M63A 3PS6A 4Y6WA 1Y6IA 1INZA 3O48A 4AJWA 2WPVA 3AJIA 3KEAA 4AP2A 1OWOA 3Q49B 4I1OB 4K03A 1O5MA 3GZSA 1SZAA 5ENPD 3L17A 4LERA 5G55A 1E7VA 4F6RD 3LKUA 4OVVA 3SBTB 2VTBA 1JCQA 3EIQC 2IO3C 1Z6TA 4ZHBA 1S0PA 4ANVA 2XZTG 3FP3A 2LO6A 3Q4AB 4DRXE 3PNLB 3EDTB 4U07A 3ASGA 2ZGDA 2A5EA 4LG6A 3DBSA 1HXIA 4J8SA 1SA5A 4H7XA 2NSZA 5CRVA 3TJPA 4DX1A 3TWQA 5EYPF 4GTMA 3SHFA 2XGSA 4XKBA 1IQRA 3NZSA 3GYZA 4ANUA 4CGWA 3HXFA 3RO3A 5CMWA 5BXUA 3LVRE 2QFCA 2NYJA 3PZ4A 5CRUA 5T4YA 2KCKA 2EILE 5DIZA 4EBAG 3FFLA 3KD7A 3SBSA 4UQYA 3PDNA 3QWWA 2IOSA 4TRQA 1MYOA 4G8KA 4Q69A 2IEJA 3CQGB 3CK8A 2DCPA 4BFRA 3SFXA 2JEKA 3V30A 4J0UA 3V2OA 1UG3A 4PUCA 3U3WA 3S2AA 3TXMA 3DSUA 4KBQA 4N3CA 2OEVA 5AJLA 3CVQA 1HU3A 4O1OA 3ESLA 4K5BA 2I1KA 3ASNE 3FUNA 2XRZA 2F0YA 4JA9A 4J8DA 2KC7A 1FVFA 1ZU2A 1O1RA 3AAAC 1E96B 3E34A 3FTSA 4U7EB 2VGXA 4GCOA 3DSSA 3HXEA 4K0RA 1BI7B 4J8YA 4U8VD 4BT9A 5JHAA 1KLXA 4U95D 4G1TA 3PE4A 4YDYA 2WXQA 1NL4A 4JEHA 4U63A 3TWTA 2WXIA 2BKKB 2CG2A 4HORA 3R9AB 4IN3B 5EDSA 4PS7A 3OAWA 3U66A 2A5UA 4N2QA 1IYGA 2RFAA 2KM4A 2V4LA 1N54A 3VLEA 5FZQA 1NI1A 5AQ9A 4I17A 3ZYLA 3S7DA 3FU5A 3QB2A 5EX3A 2GRLA 4UQZA 3S7BA 3IEGA 3Q79A 4B89A 1UOHA 5D0QD 1LD8A 4EPZA 3OXLA 3ASOE 3HVEA 2WXNA 1MJ0A 3CSTA 4H7YA 5ENTD 4RQIA 3ZN3A 1U3CA 4R7LA 4U0ZA 4WNEA 2P9KG 3Q78A 1K1BA 3CEQA 3UTMA 3IV0A 3ZPJA 3GZ1A 2YHCA 4CDRA 1TNUA 2P2CP 1NFIE 4GMJA 4GCNA 4FC8A 2MYOA 2ETAA 2LSUA 4N5CA 3PZ1A 3DSTA 4QFVA 4HOQA 3ZU7B 2DYSE 5D2MC 2FF4A 3D3MA 2GROB 3K9IA 2P9NG 4UWFA 2P9UG 3PREA 4J6IA 1PY1A 4JW1A 4MLPA 1S63A 3E33A 1WG0A 4XIFA 1DVPA 4LSZE 3NOGD 4WUYA 2EINE 3AG4E 5AQ7A 2GRMA 3B7BA 2F37A 5EIDA 5HQ8A 4BT8A 3D9LA 4FLHA 1Q2ZA 4F3VA 2GGFA 3DWLG 2GRQB 4HRLA 2Y3AA 4KYOB 3O4ZA 4HI8A 5JJTA 1HH8A 4LEUA 3T9KA 1MHQA 3GZ2A 4J8FA 2KCVA 3KSLA 3MEKA 3IKOB 5LX8A 2P9LG 5ENNA 3UKRG 2AVPA 1PC2A 4A1GA 2IONA 4LCTA 4F1PA 4BX8A 3UIOC 3T8KA 2RG8A 5BUZA 3PUKA 2WXLA 4BX9A 1JWGA 2OV8A 3MKRA 3CV0A 3JUEA 4HXIA 1Y8MA 4GPMA 3PEVB 1V55E 3ZHEA 3QWPA 4X8QA 1N9AA 1TNYA 3B7RL 1N94A 2WXPA 5KJNA 3IBEA 3SFZA 4FA6A 3FTYA 1N95A 5AQBA 3PE3A 2WMOA 4C48B 1YA0A 1GW6A 5ITZF 3BG1B 3W9GA 2PQNA 4RLYA 3ONLA 4AIFA 1DCEA 3MA5A 4JXTA 2EQXA 2VTBB 3ZXPA 3FUHA 2UY1B 2UY1A 1KT1A 3C3QA 3ENEA 4FJYA 5B1AE 4GTTA 5FQ6A 1RW2A 1H6OA 4U8YD 2YINA 3HIZA 4G8LA 3SI5A 1D8EA 2R03A 5LCWJ 3E32A 5FIOA 1N0QA 4HS2A 1YYHA 2WQHA 3FHEA 4EZJA 4UQXA 5G05C 5JJ6A 5FQ4A 5EIBE 4BWRA 4WWOA 2V0PA 5IY5E 4WNFA 2ZU6B 3LY8A 4GZ5A 1N4RA 4BTAA 2DBAA 3MJWA 3ISMC 3U4TA 1ZBPA 2DIWA 3U64A 3P1UA 2XPZA 3KSQA 3CVYA 3R7RA 3URZA 1HS6A 3L16A 1BU9A 2LXLA 4ANWA 1N52A 3D9OA 4LUNU 5AQAA 1JUQA 5AAOA 4L7TA 2I6HA 5D66A 2MRIA 5LCWC 1HO8A 3BU8A 4DPRA 4A1SA 2LUHA 3MV2B 4AY6A 4CT4A 5JMND 4APOA 3PZ3A 3QARA 4U0UA 2ETCA 3DSVA 1P5QA 4J7WA 3UT7A 2QY7A 2J4DA 4F53A 3APDA 5HS0A 4NQ0A 4MKTA 5BNWA 3SFYA 3D9KA 3ZXSA 2WB2A 4NRHB 1X5BA 4FJZA 3SGHA 2MOWA 2Y69E 5LFAA 3AU5A 3EJNA 5E76A 3R7QA 2GRPB 3ZW3A 2DZNA 2J08A 3MCXA 5ARGA 1OT8A 1NZNA 1TN6A 2C2LA 5HRYA 3Q7FA 2ONDA 3ZYQA 4LRZA 2L6JA 1JWFA 2AXZA 1JCRA 4YDEA 2J49A 3UM1A 5M72A 2EIKE 1MX2A 2JLBA 4EZKA 5CBNA 4HRNA 5T3RA 3JQ0A 3TAXA 3BG0B 3LY7A 2L6BA 2B0OE 3LCAA 2IY0C 1KPSB 1HFAA 3LJ3A 3MKQB 3CHQA 2PQRA 1DNPA 4FU3A 4XKCA 2WXOA 5CERB 2WXRA 5AJDA 4CRWA 5KCMA 4F1SA 5ARFA 1V54E 2OCCE 3FTZA 3CVLA 3T8MA 1BI8B 3FH5A 1LF8A 2HE0A 2R02A 3TWXA 4N3BA 3ZIMA 5FT9A 2FEZA 3FTVA 2BUGA 3SY2A 5ENRD 3C3OA 3VLFA 2XEVA 4QQIA 4EQFA 4ZFHA 4U8HA 2H6HA 4TUMA 3CR3A 5B1BE 1WAO1 2ETBA 1ELWA 1SZ9A 3KEZA 5D0OD 5BV1A 3QNKA 1H19A 3HXBA 4P29A 3E4BA 2YNQA 2QC9A 2WVIA 3APFA 4AEZC 4OAUC 2WXFA 3ABME 3PEUB 3ULEG 3CK7A 2I1JA 3EU5A 1TJFA 5HKPA 3RU0A 3MV3B 3CHMA 3LPZA 1A17A 4J8EA 1EPUA 4M3OA 5KBAA 4Z68A 3ZFWA 2X38A 4U0SA 2P9PG 5BV0A 4M7CA 1HF8A 4EHMA 4A3VA 3UXGA 4I9CA 3TL5A 4FHKA 4FLBA 4AV7A 1Z3YA 2UWJG 4RG9A 2XS1A 5AENA 4IRUA 3QAQA 1OCCE 5AIJA 5ANRA 5CEAA 2VGEA 4JVSA 2GW1A 2PM7A 3SF4A 3V31A 3LS8A 3I4RB 1AWCB 4GMLA 1BD8A 4U96D 1SVXA 3FTWA 4AVXA 4CGVA 3RJVA 4JHJA 4DLOA 3FUKA 1TYQG 3V2XA 3DSXA 4WNDA 2CHWA 4A55A 5LP0A 3RAUA 2HR2A 2PL2A 3HXCA 4UI9J 3UUXA 2AJAA 4HQDA 2R5SA 4XEIG 3EHQA 1ZB1A 3R9MA 2CFUA 3D9PA 4PH4B 3FY4A 3MKQA 3RSEG
chains in the Genus database with same CATH topology
3ULYA 3ZXPA 4JIOA 3RAUA 5CRVA 5CRUA 3C3QA 3UM2A 3UM3A 2XS1A 2XS8A 2OEWA 2R05A 1ZB1A 3R9MA 2R02A 2OJQA 3C3RA 2R03A 3UM0A 3UM1A 3C3OA 2OEVA 2OEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULY A;  3ZXP A;  3RAU A;  5CRV A;  5CRU A;  3C3Q A;  3UM2 A;  3UM3 A;  2XS1 A;  2XS8 A;  2OEW A;  2R05 A;  1ZB1 A;  3R9M A;  2R02 A;  3C3R A;  2R03 A;  3UM0 A;  3UM1 A;  3C3O A;  2OEV A; 
#chains in the Genus database with same CATH topology
 2X6K A;  4CDM A;  2AWI A;  4L2Y A;  4JB8 P;  4DX2 A;  3DEO A;  3Q9U C;  1TR4 A;  4JPS A;  2XRY A;  4ILG A;  4U04 A;  3TWR A;  2JAB A;  5AN8 A;  3CGH A;  5C1D A;  4I43 A;  3UM0 A;  5ENQ D;  4OVU A;  4APF A;  4RVB A;  2WXM A;  1IXV A;  3DEP A;  3I5P A;  2CFZ A;  2E0I A;  5T8I A;  2J07 A;  2QYJ A;  2HO1 A;  3NAW A;  1H6K A;  4KZC A;  5FWQ A;  2XHE A;  2ZIS A;  2KCL A;  3D9M A;  5J08 A;  1TNO A;  5EKQ D;  4Q94 A;  3LJN A;  5A6C A;  3WXX A;  3ZYK A;  4B94 A;  2PNN A;  3J5Q B;  4GTR A;  2F8Y A;  3D9J A;  1A5E A;  5CCL A;  1EDU A;  3D9N A;  3TXN A;  4V3I A;  1WY6 A;  4A3T A;  1EF1 C;  2Q7F A;  1JPL A;  3EIJ A;  1YCS B;  4OYS A;  1HE8 A;  4G26 A;  5BXO A;  4DK5 A;  1D8D A;  3WG7 E;  3FUM A;  3UPV A;  2LNI A;  3CVU A;  3QOU A;  1VDY A;  3C3R A;  5JA4 D;  3AS8 A;  2H6F A;  1U3D A;  3CKC A;  3Q75 A;  1UJJ A;  3W9F A;  3FUF A;  2X6J A;  4HVB A;  4DX7 D;  3GW4 A;  2IO2 C;  3JCK C;  3PZ2 A;  4DX5 D;  2H6I A;  2R2L A;  1O1S A;  3BQO A;  3VLD A;  2V5Q C;  2HM8 A;  2LXM A;  2XCC A;  4ME2 A;  3B7U X;  4CDN A;  4GPK A;  1E90 A;  2XEH A;  4ACL A;  4GAA A;  2PM6 A;  3C72 A;  4ACK A;  2R05 A;  2RD0 A;  3UIP C;  2V5F A;  1SQM A;  3RRM B;  4CT0 A;  2R17 C;  4GZC A;  5EYL A;  4UWL A;  2RKK A;  4DLQ A;  1QYM A;  2DZO A;  2WXH A;  3ZGQ A;  3UMV A;  3MYV A;  3Q73 A;  4OAV B;  4FUL A;  2ZIR A;  2WXJ A;  2Y1L E;  5ENS D;  3HHM A;  5HI7 A;  1TEZ A;  2IQC A;  4WWP A;  3PRZ A;  2LAI A;  5EX0 A;  3EHR A;  2VGX B;  5JHB A;  2YHE A;  2VJ8 A;  4B8C B;  1MX6 A;  2GRN B;  5J90 A;  3T5V A;  3RRU A;  4DJA A;  4DX6 D;  2IU1 A;  3ULQ A;  3I4G A;  4KVM A;  4EBA A;  4WAF A;  2L0I A;  4EZL A;  2VSN A;  1E8Y A;  3B7T A;  4PDX A;  3QJZ A;  5BPP A;  2KZT B;  4YDO A;  1FT1 A;  3TWW A;  4UWH A;  3AG3 E;  4GU5 A;  1XNF A;  5CEC B;  2BED A;  2OVB A;  4N5Q A;  5BW8 C;  2E2E A;  3CVW A;  4FHJ A;  4N3A A;  2J4B A;  4E6H A;  4YDW A;  2VSO E;  1K8K G;  3SZ7 A;  3CVX A;  4UI9 C;  4D10 C;  4L9P A;  3IHY A;  4BTB A;  5G04 J;  2AW6 A;  1OXJ A;  3FU3 A;  3LXU X;  3FDH A;  2BKG A;  1FCH A;  3QKY A;  1TN7 A;  3CKB A;  4JHK A;  3EHN A;  2Y4T A;  3FUJ A;  3Q47 B;  3EHM A;  3TWV A;  2XGO A;  1IHB A;  4C9B B;  2OOE A;  1D9S A;  2CG3 A;  5H7P A;  4GTQ A;  3AG2 E;  4I1M A;  2XS8 A;  2VYI A;  2XPI A;  4JZY A;  3NBN B;  4ANX A;  1H0A A;  2V4H C;  3B7S A;  1H6P A;  3CHO A;  3RK6 A;  4FP7 A;  3UX4 A;  4F7A A;  4RG6 A;  2FUL A;  1FPP A;  4HLE A;  2NC9 A;  1OWM A;  2WXK A;  1UN8 A;  4DI4 A;  2ILR A;  4CZ2 D;  4JHR A;  3B13 A;  1IHG A;  1HG2 A;  2EIM E;  5ANL A;  4GZ6 A;  1OWL A;  4Y6C A;  4ILI A;  4BSZ B;  4GMR A;  4GA0 A;  5KJM A;  1KZO A;  2IJG X;  3ZYM A;  2J09 A;  3N71 A;  4GTO A;  3UM3 A;  4KXK B;  5AYW D;  2BF0 X;  4A63 B;  2EIJ E;  3QDN A;  1BPO A;  2HYZ A;  2L9B A;  1X81 A;  4PS8 A;  1Z5S C;  5A23 A;  2P9I G;  4KZ0 A;  4G24 A;  4GZD A;  4O6F A;  4HOU A;  1OWP A;  1KT0 A;  4K5C A;  3CIA A;  1MX4 A;  3CHP A;  4MRU A;  3FUD A;  3ZVV A;  3T5X A;  4G23 A;  3CSF A;  3AG1 E;  4G11 A;  3PNT B;  3TG4 A;  3UIN C;  5FQ8 A;  2P58 C;  2XEE A;  3U9W A;  3FWV A;  1RZ4 A;  1TJC A;  4XI0 A;  1W3B A;  1AP7 A;  2LSV A;  4LNB A;  3UI2 A;  3ML8 A;  3IHV A;  2OVF A;  2V8S E;  2AXV A;  3MX3 A;  3CHR A;  1EYH A;  4TXR A;  4AOF A;  2OEW A;  4Q96 A;  1S64 A;  5A7D B;  5FJY A;  4EEC A;  2DYR E;  4GB9 A;  1FVH A;  1QNF A;  2ZGG A;  3PUJ A;  4O1P A;  4I1A A;  2X6I A;  4YVO A;  4KT6 B;  3Q15 A;  4TUU A;  3CLJ A;  3QK0 A;  1Z3X A;  1KZP A;  2RFM A;  1N4S A;  4AXH A;  3ZNG A;  1SA4 A;  4I6G A;  3NOC D;  4XX5 A;  4B0Z A;  2CHX A;  3OTN A;  4UWG A;  4ABN A;  3ASF A;  4LNU D;  3FU6 A;  4N2S A;  5ENO D;  4NUR A;  3CVN A;  2VQ2 A;  3Q5M A;  5CMY A;  3HRA A;  5LOZ A;  4ATZ D;  3QWV A;  1QQE A;  4L2L A;  4BSX A;  1LD7 A;  3L9T A;  3BUA A;  3E30 A;  4JD2 G;  5FZS A;  3OXF A;  3ONK A;  2C0M A;  3JQ1 A;  3AS4 A;  2XEN A;  1PAQ A;  1WDY A;  1NP7 A;  1TN8 A;  4AM9 A;  4LNG A;  4BER A;  3VTX A;  3ML9 A;  1H2U A;  3TGO A;  4DUI A;  1BLX B;  3L82 A;  4XI9 A;  2AXU A;  2VSX E;  3RKV A;  4I6E A;  4KMO A;  3JXJ A;  3CK9 A;  3D9I A;  5BT1 A;  4XE0 A;  3C98 A;  2ZXW E;  2B6C A;  4W9R A;  3RO2 A;  3ZKJ A;  3JYS A;  4UUC A;  3SNX A;  4ATG A;  1QZ2 A;  4TXP A;  1L5J A;  4GTV A;  2Y4U A;  4K5A B;  4FAD A;  1NA0 A;  3PVL A;  4I2W A;  4PS3 A;  4NAC A;  2DVW A;  3FH7 A;  4B93 B;  3FTX A;  3TWU A;  3L22 A;  4E85 A;  2C0L A;  3DXK G;  3D9H A;  4DI3 A;  2H6G A;  3ASD A;  3Q7A A;  4GTS A;  4RSY A;  2KBX A;  3EUV A;  4ILH B;  4MBG A;  3G2W A;  3FU0 A;  1UJK A;  4HFG A;  4IYP A;  3CVV A;  1N4P A;  3G2S A;  1OWN A;  3DPY A;  3OXG A;  1WM5 A;  3FEY A;  2IFU A;  5CBO A;  2XZD G;  5EIL A;  4HOT A;  1SW6 A;  4I2Z A;  2FI7 A;  5FQ7 A;  3SD5 A;  2MHK A;  3ABK E;  5AAR A;  1HZ4 A;  1IQU A;  1OUV A;  4JC8 A;  4IUL A;  3G2V A;  3J5P A;  4WWN A;  1ELK A;  3SQV A;  2KAT A;  4HBD A;  3SO8 A;  3HDX A;  4O60 A;  3MGB A;  4BES A;  2X6F A;  3DPD A;  4YND A;  1E8Z A;  2VSY A;  2R59 A;  3FUI A;  3L54 A;  1DCQ A;  4BEP A;  2KZT A;  2FO1 E;  3C5R A;  5E75 A;  1JCS A;  3UM2 A;  2IF4 A;  4HOS A;  1HX8 A;  1TNB A;  1HG5 A;  4UWK A;  3IXE A;  4BET A;  5G05 J;  2WXG A;  2YQ8 A;  4L1B A;  4L23 A;  4AY5 A;  3CHS A;  2X3M A;  4YVQ C;  3FUL A;  1H2T C;  3ABL E;  1XGW A;  3TWS A;  4GA1 A;  4HRM B;  4JL0 A;  1UN9 A;  4TV3 A;  2Y0B G;  1S70 B;  1YMP A;  2FBN A;  3EU9 A;  4B8A A;  3RRN B;  3DXM G;  5FZR A;  3DSW A;  3QC1 A;  2J8S D;  1K3Z D;  2XCB A;  3PH0 C;  3L08 A;  3HYM B;  4WNG A;  3DRA A;  4HLL A;  3UT4 A;  1LTX A;  3ULY A;  2CHZ A;  2WQ7 A;  2IOL A;  1N4Q A;  3FUE A;  3BEE A;  3I3N A;  4GTP A;  2NXP A;  4I6J A;  3ZHE B;  3HVE B;  4HNA D;  1U2V G;  3S7F A;  3X2Q E;  4G25 A;  3AU4 A;  4BY6 A;  2QZA A;  3MZL B;  3L13 A;  3NQP A;  2WM9 A;  4GYO A;  3V79 K;  4HB5 A;  2P9S G;  3B95 A;  1FT2 A;  1K1A A;  3L6A A;  3FEX A;  1MQS A;  1E7U A;  2BTD A;  3P2B A;  2VGY A;  1NA3 A;  3ZUV B;  5G2N A;  3F6Q A;  3E37 A;  3LYA A;  3RIB A;  5CHE E;  3LY9 A;  5FTP A;  3JUI A;  4N39 A;  1ELR A;  2KXP C;  2WQ6 A;  3LVQ E;  4GA2 A;  1IKN D;  4UI9 K;  4CYM D;  1N11 A;  3UKU G;  3PZD A;  3LDZ A;  4JA7 A;  1H2V C;  5C2Y A;  1QBQ A;  2F8X K;  2A4Z A;  2X6H A;  3NF1 A;  1UW4 B;  4MS6 A;  4CCA A;  2J9Q A;  3S7J A;  1DC2 A;  4TXQ A;  3TG5 A;  4GYY A;  1N0R A;  2PZI A;  4URK A;  5KNH D;  2I2O A;  2DWZ A;  5CED B;  5FIN A;  4C0E A;  1TNZ A;  3APC A;  5B3S E;  3HG0 D;  3CVP A;  1MZC A;  3KS2 A;  4JEU A;  5KNG A;  2XPY A;  1OCR E;  5DBK A;  4GZ3 A;  4CEM A;  2XQ0 A;  3NB2 A;  4NIK A;  5KWD A;  5G04 C;  4G2V A;  4GYW A;  3UT8 A;  1OY3 D;  3LEW A;  2FO7 A;  1OCZ E;  1O1T A;  2QYU A;  2XGM A;  3G2U A;  4I9E A;  1E8X A;  3FH8 A;  5JJ7 A;  3HXD A;  3Q9N C;  2GRR B;  3JXI A;  4KVO A;  3G2T A;  1G3N B;  3VTY A;  2L0T B;  5CCM A;  2WMN A;  4HI9 A;  1E8W A;  3ASH A;  3AS5 A;  5KJL A;  3UQ3 A;  3FTU A;  3NZU A;  2LAH A;  3ESK A;  5KJK A;  1OCO E;  3CQC B;  3ZEF A;  4C0M A;  1B89 A;  3KAE A;  2I9C A;  4XZ4 A;  3ZRH A;  5EN5 D;  2M63 A;  3PS6 A;  4Y6W A;  1Y6I A;  1INZ A;  3O48 A;  4AJW A;  2WPV A;  3AJI A;  3KEA A;  4AP2 A;  1OWO A;  3Q49 B;  4I1O B;  4K03 A;  1O5M A;  3GZS A;  1SZA A;  5ENP D;  3L17 A;  4LER A;  5G55 A;  1E7V A;  4F6R D;  3LKU A;  4OVV A;  3SBT B;  2VTB A;  1JCQ A;  3EIQ C;  2IO3 C;  1Z6T A;  4ZHB A;  1S0P A;  4ANV A;  2XZT G;  3FP3 A;  2LO6 A;  3Q4A B;  4DRX E;  3PNL B;  3EDT B;  4U07 A;  3ASG A;  2ZGD A;  2A5E A;  4LG6 A;  3DBS A;  1HXI A;  4J8S A;  1SA5 A;  4H7X A;  2NSZ A;  5CRV A;  3TJP A;  4DX1 A;  3TWQ A;  5EYP F;  4GTM A;  3SHF A;  2XGS A;  4XKB A;  1IQR A;  3NZS A;  3GYZ A;  4ANU A;  4CGW A;  3HXF A;  3RO3 A;  5CMW A;  5BXU A;  3LVR E;  2QFC A;  2NYJ A;  3PZ4 A;  5CRU A;  5T4Y A;  2KCK A;  2EIL E;  5DIZ A;  4EBA G;  3FFL A;  3KD7 A;  3SBS A;  4UQY A;  3PDN A;  3QWW A;  2IOS A;  4TRQ A;  1MYO A;  4G8K A;  4Q69 A;  2IEJ A;  3CQG B;  3CK8 A;  2DCP A;  4BFR A;  3SFX A;  2JEK A;  3V30 A;  4J0U A;  3V2O A;  1UG3 A;  4PUC A;  3U3W A;  3S2A A;  3TXM A;  3DSU A;  4KBQ A;  4N3C A;  2OEV A;  5AJL A;  3CVQ A;  1HU3 A;  4O1O A;  3ESL A;  4K5B A;  2I1K A;  3ASN E;  3FUN A;  2XRZ A;  2F0Y A;  4JA9 A;  4J8D A;  2KC7 A;  1FVF A;  1ZU2 A;  1O1R A;  3AAA C;  1E96 B;  3E34 A;  3FTS A;  4U7E B;  2VGX A;  4GCO A;  3DSS A;  3HXE A;  4K0R A;  1BI7 B;  4J8Y A;  4U8V D;  4BT9 A;  5JHA A;  1KLX A;  4U95 D;  4G1T A;  3PE4 A;  4YDY A;  2WXQ A;  1NL4 A;  4JEH A;  4U63 A;  3TWT A;  2WXI A;  2BKK B;  2CG2 A;  4HOR A;  3R9A B;  4IN3 B;  5EDS A;  4PS7 A;  3OAW A;  3U66 A;  2A5U A;  4N2Q A;  1IYG A;  2RFA A;  2KM4 A;  2V4L A;  1N54 A;  3VLE A;  5FZQ A;  1NI1 A;  5AQ9 A;  4I17 A;  3ZYL A;  3S7D A;  3FU5 A;  3QB2 A;  5EX3 A;  2GRL A;  4UQZ A;  3S7B A;  3IEG A;  3Q79 A;  4B89 A;  1UOH A;  5D0Q D;  1LD8 A;  4EPZ A;  3OXL A;  3ASO E;  3HVE A;  2WXN A;  1MJ0 A;  3CST A;  4H7Y A;  5ENT D;  4RQI A;  3ZN3 A;  1U3C A;  4R7L A;  4U0Z A;  4WNE A;  2P9K G;  3Q78 A;  1K1B A;  3CEQ A;  3UTM A;  3IV0 A;  3ZPJ A;  3GZ1 A;  2YHC A;  4CDR A;  1TNU A;  2P2C P;  1NFI E;  4GMJ A;  4GCN A;  4FC8 A;  2MYO A;  2ETA A;  2LSU A;  4N5C A;  3PZ1 A;  3DST A;  4QFV A;  4HOQ A;  3ZU7 B;  2DYS E;  5D2M C;  2FF4 A;  3D3M A;  2GRO B;  3K9I A;  2P9N G;  4UWF A;  2P9U G;  3PRE A;  4J6I A;  1PY1 A;  4JW1 A;  4MLP A;  1S63 A;  3E33 A;  1WG0 A;  4XIF A;  1DVP A;  4LSZ E;  3NOG D;  4WUY A;  2EIN E;  3AG4 E;  5AQ7 A;  2GRM A;  3B7B A;  2F37 A;  5EID A;  5HQ8 A;  4BT8 A;  3D9L A;  4FLH A;  1Q2Z A;  4F3V A;  2GGF A;  3DWL G;  2GRQ B;  4HRL A;  2Y3A A;  4KYO B;  3O4Z A;  4HI8 A;  5JJT A;  1HH8 A;  4LEU A;  3T9K A;  1MHQ A;  3GZ2 A;  4J8F A;  2KCV A;  3KSL A;  3MEK A;  3IKO B;  5LX8 A;  2P9L G;  5ENN A;  3UKR G;  2AVP A;  1PC2 A;  4A1G A;  2ION A;  4LCT A;  4F1P A;  4BX8 A;  3UIO C;  3T8K A;  2RG8 A;  5BUZ A;  3PUK A;  2WXL A;  4BX9 A;  1JWG A;  2OV8 A;  3MKR A;  3CV0 A;  3JUE A;  4HXI A;  1Y8M A;  4GPM A;  3PEV B;  1V55 E;  3ZHE A;  3QWP A;  4X8Q A;  1N9A A;  1TNY A;  3B7R L;  1N94 A;  2WXP A;  5KJN A;  3IBE A;  3SFZ A;  4FA6 A;  3FTY A;  1N95 A;  5AQB A;  3PE3 A;  2WMO A;  4C48 B;  1YA0 A;  1GW6 A;  5ITZ F;  3BG1 B;  3W9G A;  2PQN A;  4RLY A;  3ONL A;  4AIF A;  1DCE A;  3MA5 A;  4JXT A;  2EQX A;  2VTB B;  3ZXP A;  3FUH A;  2UY1 B;  2UY1 A;  1KT1 A;  3C3Q A;  3ENE A;  4FJY A;  5B1A E;  4GTT A;  5FQ6 A;  1RW2 A;  1H6O A;  4U8Y D;  2YIN A;  3HIZ A;  4G8L A;  3SI5 A;  1D8E A;  2R03 A;  5LCW J;  3E32 A;  5FIO A;  1N0Q A;  4HS2 A;  1YYH A;  2WQH A;  3FHE A;  4EZJ A;  4UQX A;  5G05 C;  5JJ6 A;  5FQ4 A;  5EIB E;  4BWR A;  4WWO A;  2V0P A;  5IY5 E;  4WNF A;  2ZU6 B;  3LY8 A;  4GZ5 A;  1N4R A;  4BTA A;  2DBA A;  3MJW A;  3ISM C;  3U4T A;  1ZBP A;  2DIW A;  3U64 A;  3P1U A;  2XPZ A;  3KSQ A;  3CVY A;  3R7R A;  3URZ A;  1HS6 A;  3L16 A;  1BU9 A;  2LXL A;  4ANW A;  1N52 A;  3D9O A;  4LUN U;  5AQA A;  1JUQ A;  5AAO A;  4L7T A;  2I6H A;  5D66 A;  2MRI A;  5LCW C;  1HO8 A;  3BU8 A;  4DPR A;  4A1S A;  2LUH A;  3MV2 B;  4AY6 A;  4CT4 A;  5JMN D;  4APO A;  3PZ3 A;  3QAR A;  4U0U A;  2ETC A;  3DSV A;  1P5Q A;  4J7W A;  3UT7 A;  2QY7 A;  2J4D A;  4F53 A;  3APD A;  5HS0 A;  4NQ0 A;  4MKT A;  5BNW A;  3SFY A;  3D9K A;  3ZXS A;  2WB2 A;  4NRH B;  1X5B A;  4FJZ A;  3SGH A;  2MOW A;  2Y69 E;  5LFA A;  3AU5 A;  3EJN A;  5E76 A;  3R7Q A;  2GRP B;  3ZW3 A;  2DZN A;  2J08 A;  3MCX A;  5ARG A;  1OT8 A;  1NZN A;  1TN6 A;  2C2L A;  5HRY A;  3Q7F A;  2OND A;  3ZYQ A;  4LRZ A;  2L6J A;  1JWF A;  2AXZ A;  1JCR A;  4YDE A;  2J49 A;  3UM1 A;  5M72 A;  2EIK E;  1MX2 A;  2JLB A;  4EZK A;  5CBN A;  4HRN A;  5T3R A;  3JQ0 A;  3TAX A;  3BG0 B;  3LY7 A;  2L6B A;  2B0O E;  3LCA A;  2IY0 C;  1KPS B;  1HFA A;  3LJ3 A;  3MKQ B;  3CHQ A;  2PQR A;  1DNP A;  4FU3 A;  4XKC A;  2WXO A;  5CER B;  2WXR A;  5AJD A;  4CRW A;  5KCM A;  4F1S A;  5ARF A;  1V54 E;  2OCC E;  3FTZ A;  3CVL A;  3T8M A;  1BI8 B;  3FH5 A;  1LF8 A;  2HE0 A;  2R02 A;  3TWX A;  4N3B A;  3ZIM A;  5FT9 A;  2FEZ A;  3FTV A;  2BUG A;  3SY2 A;  5ENR D;  3C3O A;  3VLF A;  2XEV A;  4QQI A;  4EQF A;  4ZFH A;  4U8H A;  2H6H A;  4TUM A;  3CR3 A;  5B1B E;  1WAO 1;  2ETB A;  1ELW A;  1SZ9 A;  3KEZ A;  5D0O D;  5BV1 A;  3QNK A;  1H19 A;  3HXB A;  4P29 A;  3E4B A;  2YNQ A;  2QC9 A;  2WVI A;  3APF A;  4AEZ C;  4OAU C;  2WXF A;  3ABM E;  3PEU B;  3ULE G;  3CK7 A;  2I1J A;  3EU5 A;  1TJF A;  5HKP A;  3RU0 A;  3MV3 B;  3CHM A;  3LPZ A;  1A17 A;  4J8E A;  1EPU A;  4M3O A;  5KBA A;  4Z68 A;  3ZFW A;  2X38 A;  4U0S A;  2P9P G;  5BV0 A;  4M7C A;  1HF8 A;  4EHM A;  4A3V A;  3UXG A;  4I9C A;  3TL5 A;  4FHK A;  4FLB A;  4AV7 A;  1Z3Y A;  2UWJ G;  4RG9 A;  2XS1 A;  5AEN A;  4IRU A;  3QAQ A;  1OCC E;  5AIJ A;  5ANR A;  5CEA A;  2VGE A;  4JVS A;  2GW1 A;  2PM7 A;  3SF4 A;  3V31 A;  3LS8 A;  3I4R B;  1AWC B;  4GML A;  1BD8 A;  4U96 D;  1SVX A;  3FTW A;  4AVX A;  4CGV A;  3RJV A;  4JHJ A;  4DLO A;  3FUK A;  1TYQ G;  3V2X A;  3DSX A;  4WND A;  2CHW A;  4A55 A;  5LP0 A;  3RAU A;  2HR2 A;  2PL2 A;  3HXC A;  4UI9 J;  3UUX A;  2AJA A;  4HQD A;  2R5S A;  4XEI G;  3EHQ A;  1ZB1 A;  3R9M A;  2CFU A;  3D9P A;  4PH4 B;  3FY4 A;  3MKQ A;  3RSE G; 
#chains in the Genus database with same CATH homology
 3ULY A;  3ZXP A;  4JIO A;  3RAU A;  5CRV A;  5CRU A;  3C3Q A;  3UM2 A;  3UM3 A;  2XS1 A;  2XS8 A;  2OEW A;  2R05 A;  1ZB1 A;  3R9M A;  2R02 A;  2OJQ A;  3C3R A;  2R03 A;  3UM0 A;  3UM1 A;  3C3O A;  2OEV A;  2OEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...