4LRZA

Crystal structure of the e.coli dhar(n)-dhal complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
211
structure length
211
Chain Sequence
GSSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coiled-Coil Helix Rotation Selects Repressing or Activating State of Transcriptional Regulator DhaR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transcription regulator
molecule keywords PTS-dependent dihydroxyacetone kinase, ADP-binding subunit D
total genus 86
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lrzA00
3PNLB 2BTDA 1UN9A 4LRZA 3CR3A 1UN8A
chains in the Genus database with same CATH superfamily
4XZ4A 3Q15A 4MRUA 1HXIA 2WMOA 3FH5A 3R9AB 1NZNA 2I2OA 2XHEA 1UJJA 3CIAA 3EDTB 2DWZA 5FZRA 4DX1A 1UOHA 4N3AA 1NL4A 1BLXB 2R2LA 3G2WA 3SFXA 4E6HA 3EHRA 1JWFA 4DK5A 1SA4A 4DLQA 4Z68A 3G2UA 4GTMA 4GTRA 2WXOA 2XPYA 1N94A 4F6RD 2ILRA 1KT1A 3CGHA 3W9GA 1E90A 4HRLA 4JEHA 5CERB 2WXPA 3QOUA 4KYOB 2UY1A 3L17A 3HXFA 3SQVA 3APFA 2J4BA 3CR3A 1IQUA 4H7YA 4GYYA 3MX3A 4L9PA 4PS8A 3ZFWA 5EILA 4CDMA 3TGOA 3FUNA 4O6FA 4W9RA 5B1AE 3QWVA 3O4ZA 4AP2A 2P9SG 2PM6A 3DRAA 2J4DA 3ZHEB 2DZOA 3X2QE 1KLXA 5B1BE 4L23A 3TWSA 4HOTA 2QFCA 4MBGA 3FEYA 5E75A 4GYOA 3VLEA 3DSSA 2XPZA 5CRUA 1S0PA 2P9PG 4EECA 3P1UA 3TWXA 4OYSA 1TEZA 1H6OA 2FEZA 3TG5A 5D2MC 3SD5A 1ELKA 5FZQA 1FCHA 3GW4A 3FUHA 4EQFA 2ZIRA 3LY7A 2LNIA 3GZSA 3AG3E 3TJPA 4DI3A 3DXMG 4AY5A 3JXJA 1KZPA 3UQ3A 3ASOE 3TXNA 3APCA 4JA7A 4PH4B 4B89A 3MEKA 3FU0A 2E2EA 4YDYA 5FQ8A 1YCSB 4Q94A 1BI7B 3KD7A 3SBSA 3AG1E 4G2VA 1UJKA 1IQRA 3C72A 4U7EB 2IJGX 4EBAA 2ZGGA 2WVIA 5JJTA 3BQOA 2BEDA 1E8ZA 2J9QA 4I1OB 4L1BA 1KZOA 4G11A 4DX6D 3FUFA 4BESA 1YMPA 3VTXA 4I9EA 3LVRE 1N4PA 4JVSA 1FVHA 4APFA 5G55A 1W3BA 3TL5A 3ZN3A 2WXFA 4O60A 4FLBA 3C3QA 4B94A 2LXMA 2WXJA 1JCRA 4A63B 1V54E 1DVPA 3AAAC 3DPDA 3ISMC 2CFZA 3NZUA 3SZ7A 3NOCD 2AW6A 1Z3YA 2I1JA 1NFIE 4ILIA 2J8SD 4JL0A 4GZCA 3SF4A 5BV1A 3HXBA 3Q9UC 3I5PA 4UWHA 3ULYA 3TAXA 2OOEA 2AXZA 2MRIA 3NBNB 2WM9A 3CHRA 5D0OD 4CDNA 3T5XA 3DXKG 3ESLA 3LEWA 3C3RA 3JUIA 1RW2A 1A5EA 4JD2G 3OAWA 4JC8A 3HXEA 4GZDA 4FC8A 1X5BA 2JEKA 2R03A 2LAIA 2HE0A 4PS7A 2BF0X 3HVEB 3FWVA 4DX2A 2NXPA 1O1RA 3HYMB 3E30A 1N11A 2XRZA 1DCQA 3E33A 4O1OA 4WNFA 3ESKA 5AN8A 2GRPB 3ONKA 4KZCA 3FFLA 3B7RL 5EX0A 2KATA 3OXLA 4K0RA 5EYLA 2B0OE 2GRRB 3ZPJA 5JHBA 2PQNA 3FTXA 3KAEA 1UN9A 1P5QA 3HHMA 1XGWA 4FHJA 3R7QA 5CEAA 2RFAA 5AARA 3RKVA 5HS0A 2GRLA 2V0PA 2IO3C 2WXKA 4HQDA 4B8AA 4GA2A 3ZYLA 4K5AB 5ENPD 1MQSA 3U9WA 2FO1E 1U2VG 3SGHA 3PRZA 3CVNA 4GPMA 3C98A 3J5PA 2VYIA 5C2YA 1QNFA 3RRNB 1HU3A 5AQAA 5CBOA 3GZ1A 4FULA 2IY0C 3AG2E 4B8CB 4G26A 3PNTB 1Q2ZA 3NF1A 4N5QA 2WXNA 1PY1A 5G05J 4DX7D 4AXHA 5JA4D 2ONDA 1EPUA 1TJFA 5ANLA 1D8DA 1OWLA 2XGOA 4GMRA 3HRAA 3B7UX 4J0UA 1HO8A 3FUEA 2WXLA 2WMNA 2PZIA 4BEPA 4U07A 2ZISA 2WQ6A 4BY6A 4E85A 1TNBA 3RO3A 2DYSE 3ZYMA 1N4RA 1HG5A 4H7XA 4NACA 5CCLA 3ZNGA 2XEHA 2DVWA 4TXPA 5KJKA 2DBAA 2FO7A 4BTBA 3VTYA 3PZ2A 1FT2A 4UUCA 5HI7A 2VTBA 2X6JA 4DI4A 1X81A 2L6JA 4IULA 4ILHB 3BU8A 1OCZE 2FI7A 2VSXE 3MV3B 3MCXA 2GGFA 4CGVA 3HVEA 3IKOB 1IKND 3CK9A 3ZIMA 2L0IA 2WXGA 2YHCA 2V5QC 3RAUA 5CCMA 3FUDA 2I1KA 3WXXA 4HNAD 4CEMA 2KC7A 4GPKA 2LSUA 3UXGA 3QC1A 1K1BA 2A5UA 2NYJA 4URKA 4G24A 3RJVA 1U3CA 2LAHA 3SNXA 4XKBA 1PC2A 3DPYA 3Q9NC 2XCBA 3PUJA 1ZB1A 3RRMB 1E96B 2H6HA 4CGWA 2P9LG 4MKTA 5JJ6A 3ZHEA 3U4TA 3AU4A 3ZYQA 4UI9J 2H6IA 3FUJA 2R02A 2J07A 5BNWA 2RFMA 3TXMA 3HDXA 4B93B 4P29A 4L7TA 1D8EA 2UY1B 2PL2A 4GCOA 5BW8C 1HH8A 3SHFA 2HR2A 5EKQD 4TXRA 1V55E 2WPVA 3ML9A 3Q4AB 3UTMA 3KEAA 3JQ0A 3RU0A 4GMJA 2R59A 3FTUA 2QY7A 3E37A 2X3MA 3D9IA 1TNUA 5FT9A 3IHVA 3QKYA 4A1SA 3L22A 5HRYA 4XI0A 3O48A 2QZAA 4HXIA 3HXCA 4I6EA 4Q69A 4NQ0A 2OVFA 5HQ8A 4XEIG 1S70B 4HB5A 1N0QA 3FY4A 4I43A 3T8KA 1BI8B 4M3OA 4UQXA 4A1GA 3HG0D 4JA9A 1QBQA 3FUIA 2R05A 3JXIA 1H19A 2DCPA 3ZYKA 4C48B 3QJZA 2RKKA 2F37A 4K03A 3RSEG 4C9BB 5FQ7A 1Y8MA 4U0ZA 4UI9C 4R7LA 3LY8A 1OXJA 1OWNA 3PS6A 4ZFHA 2Y1LE 2HO1A 4A3TA 4GMLA 4UWLA 1LD7A 3EHQA 3LVQE 1HG2A 4M7CA 2CG3A 4HVBA 5J08A 3AU5A 3IBEA 1DCEA 2VGYA 4GAAA 3GZ2A 4XKCA 3MA5A 2IONA 2IFUA 5G05C 3IEGA 1TN6A 4BTAA 2H6FA 3B7BA 1K8KG 2XENA 3I4RB 1QQEA 5LOZA 3ULEG 1TN8A 1SVXA 2P9NG 3UM3A 3S2AA 4HBDA 4JHKA 2YQ8A 3L13A 2CHWA 4YVOA 3Q49B 3FEXA 4GB9A 5KJMA 3ABLE 2OEWA 1IHGA 4F1SA 3AG4E 3CVVA 4NRHB 2FBNA 4GZ3A 3Q78A 4AVXA 3LPZA 1Y6IA 2L9BA 1N9AA 5J90A 3D9OA 5EIBE 1TNOA 4KVOA 1YA0A 1NA0A 4TV3A 3NZSA 3FH8A 5CHEE 3CQCB 4FP7A 4AIFA 1AWCB 4LEUA 4EZJA 3E4BA 4PDXA 1E8WA 2VGXA 1FVFA 2A5EA 3CHSA 4LNBA 4U96D 4TUUA 5LFAA 2WXHA 1E7UA 3TWRA 5AJDA 1JCQA 1QYMA 3LYAA 4AJWA 4J8FA 3L6AA 5DBKA 4GTTA 4WWOA 4JHRA 5ENRD 1AP7A 4BETA 3PREA 1MJ0A 5FZSA 3TWVA 3AS8A 3LY9A 4G8LA 4EHMA 4KBQA 3FDHA 4RG6A 2J09A 2Y3AA 1BD8A 3G2TA 3C3OA 2V4LA 1O1TA 4YDWA 3TWQA 4N2QA 3DSTA 4FHKA 2WQ7A 2WXIA 5BUZA 4N39A 4HOQA 5FINA 2XRYA 2KZTA 1XNFA 3Q7AA 2F8YA 1BU9A 1YYHA 1NA3A 3ONLA 1KPSB 4DLOA 3AS4A 4C0MA 4CZ2D 3TWWA 3FH7A 3TG4A 2J08A 4ANWA 1ELWA 4N3BA 3CHOA 4U8HA 3DEOA 3UM2A 3CSTA 1OCRE 3I3NA 4EPZA 3ZXSA 1OY3D 4J6IA 3PDNA 5ANRA 5G04J 4LUNU 3B7SA 4N3CA 3MZLB 2X6FA 1FPPA 4HI9A 3PZ4A 3LXUX 3K9IA 3CEQA 2IF4A 4U63A 1DNPA 2EIME 1N4QA 4CDRA 1Z3XA 2P2CP 4DJAA 3UT4A 2AVPA 3OXFA 2WXQA 1JUQA 3LDZA 5AAOA 4F1PA 3BG1B 3QARA 4FU3A 5BPPA 1WG0A 4L2LA 5JHAA 2F8XK 2HYZA 3UM1A 4O1PA 3J5QB 3D9NA 4K5CA 2X6IA 1TN7A 1SQMA 3PE4A 5KBAA 4HLEA 4N5CA 3MKRA 3W9FA 5KWDA 2XZTG 4OAUC 3PH0C 3EU5A 3EU9A 4WWPA 4GA1A 3TWTA 2IOLA 4OVUA 4BWRA 3S7FA 4FA6A 1JPLA 5A6CA 3NQPA 1RZ4A 5M72A 2XZDG 3CVWA 5CMWA 4CRWA 1K1AA 3MKQA 4BT8A 4HRNA 4LG6A 5EDSA 3E32A 4GTPA 1K3ZD 4JHJA 2X6HA 4NURA 3PZ1A 4I9CA 4YNDA 2Q7FA 3MYVA 4JXTA 5T3RA 3EHMA 3L82A 4GZ6A 4LCTA 3IV0A 2XPIA 3D9HA 5AIJA 1UG3A 1IHBA 3VLFA 3AJIA 2WXMA 5C1DA 3OXGA 4WUYA 4FADA 1TNZA 2AWIA 2GRMA 2C0LA 2XS1A 4DX5D 2MYOA 2VTBB 3DSUA 3B13A 1H6KA 5JJ7A 1JWGA 4YVQC 5AQBA 3NB2A 5JMND 1UW4B 4XE0A 1HF8A 5AQ9A 3V2XA 3MV2B 1IYGA 3I4GA 2IU1A 2PNNA 3ZU7B 4FJYA 4UQZA 2KCKA 2LXLA 3N71A 3V30A 4APOA 3UINC 4ANVA 1DC2A 2EQXA 5KJLA 4HOUA 2Y0BG 4EBAG 4U8YD 3CV0A 2CHXA 3NOGD 4LRZA 1NI1A 4RLYA 2YNQA 2OV8A 4GCNA 5EN5D 3LCAA 3ML8A 3Q5MA 3PZ3A 2JABA 3JUEA 4OVVA 2EIKE 1HS6A 4OAVB 4JZYA 3HIZA 1NP7A 2AJAA 4G23A 3CVYA 1WY6A 5CRVA 2PM7A 3HXDA 5H7PA 2KBXA 3QNKA 1SW6A 3FTYA 4U0SA 1H2UA 1G3NB 3FTWA 5KNGA 2P9KG 3PE3A 4QFVA 2XEVA 2GRNB 1O1SA 3JYSA 4YDOA 1LD8A 4I6GA 3D9MA 5LP0A 3KSLA 4BFRA 3CVUA 1H6PA 4I2ZA 4WNDA 4UWKA 4BT9A 2WXRA 3EUVA 4HORA 4J8DA 4AOFA 3BUAA 2BKKB 1OCOE 5IY5E 1EYHA 2NC9A 3WG7E 4I6JA 2LO6A 1U3DA 4BSZB 3D9PA 1OT8A 3ZW3A 5KJNA 2P9UG 2PQRA 1TNYA 5HKPA 1WAO1 4FJZA 3V2OA 3U64A 3QDNA 4GTVA 1TR4A 4ATGA 2KM4A 3ABME 3RIBA 4YDEA 3SY2A 4C0EA 4TRQA 4U8VD 2Y69E 2BUGA 5EX3A 3T8MA 3CVXA 3JQ1A 2XEEA 2QYUA 3CVPA 2ETAA 3MJWA 2FULA 3S7BA 4ABNA 2EINE 4BSXA 4LNGA 2F0YA 3FTZA 1IXVA 3Q7FA 4BX9A 1SA5A 2OEVA 4F3VA 4PUCA 1N95A 3ULQA 5FTPA 4QQIA 4I1MA 1OWMA 4GA0A 4EZLA 1MZCA 5AQ7A 3CHQA 3UM0A 2CG2A 2GRQB 4CT0A 3KSQA 1MX6A 2C0MA 2JLBA 4CYMD 1TYQG 2Y4UA 4JPSA 3T5VA 5FQ4A 5ARFA 1OCCE 1LTXA 1WDYA 3L16A 4UWFA 4AY6A 2C2LA 3FHEA 3PNLB 3UT8A 2KCLA 4MLPA 5T4YA 2IO2C 5LCWJ 4WWNA 5D0QD 2CHZA 1JCSA 1UN8A 3JCKC 3Q73A 4F7AA 4CCAA 4N2SA 4I1AA 3ZEFA 5EIDA 1GW6A 4DUIA 3ZKJA 1QZ2A 3B95A 3S7DA 3UUXA 2YHEA 3V31A 3RO2A 2LUHA 4Q96A 5KNHD 4KMOA 4LSZE 4J7WA 3KEZA 3CLJA 1H0AA 3R7RA 4EZKA 3FULA 3UX4A 2R17C 1E8YA 4KVMA 2RG8A 2VGXB 2KZTB 4XIFA 3EIQC 5CECB 4KZ0A 4AM9A 3FUKA 1SZAA 1A17A 2L0TB 2DIWA 1MX2A 1O5MA 2B6CA 3CK8A 3PZDA 3FU3A 1N0RA 4RG9A 4MS6A 5BT1A 2WB2A 2KXPC 1E8XA 3AS5A 4LNUD 2J49A 3IHYA 4AV7A 5T8IA 3QAQA 3FU6A 3CVQA 2CFUA 2ZU6B 2XGMA 3CKBA 4HI8A 4XX5A 3FUMA 3MGBA 5DIZA 3G2SA 2MHKA 4IYPA 3DSWA 4U0UA 4UWGA 5D66A 4HLLA 2DZNA 4GTQA 4F53A 4UQYA 4ANXA 1WM5A 1ZU2A 2LSVA 4XI9A 4G1TA 1HX8A 4WNGA 2BKGA 2FF4A 3C5RA 3SO8A 4ACKA 3R9MA 3V79K 2OVBA 4IRUA 3UT7A 3ENEA 3PVLA 2VQ2A 4CT4A 5LX8A 2I6HA 3SFYA 1KT0A 5B3SE 2AXVA 3DWLG 3D9LA 3UIOC 4Y6WA 3ASGA 4UI9K 2E0IA 2KCVA 3VLDA 4DPRA 1MYOA 3FTSA 5FQ6A 3RK6A 5ENNA 2EIJE 3QWWA 1INZA 4BX8A 3KS2A 4V3IA 4GU5A 5EYPF 3UKRG 1MX4A 3PEVB 4KXKB 4ATZD 5ENSD 1VDYA 3DBSA 3UMVA 5A7DB 3ZXPA 3GYZA 2P58C 3QB2A 3PUKA 2R5SA 5FWQA 3LJ3A 2NSZA 4ILGA 5FJYA 2IEJA 3OTNA 3L54A 1N54A 1S63A 3APDA 5ENQD 2WQHA 4J8EA 1TJCA 1E7VA 4A55A 2BTDA 4K5BA 5CBNA 5G2NA 4ANUA 4B0ZA 2VSOE 4AEZC 1HE8A 1N52A 3RRUA 3UKUG 3EIJA 3G2VA 5BXUA 3CHMA 3L08A 1FT1A 3FTVA 2XS8A 5G04C 2MOWA 4D10C 3CHPA 2XCCA 4Y6CA 2YINA 3Q75A 3LJNA 5AYWD 1OWOA 4HS2A 2DYRE 2M63A 1EDUA 1Z5SC 3F6QA 3ASFA 3ASHA 4G25A 2IOSA 4PS3A 2GROB 3EJNA 1OWPA 3CKCA 1H2TC 4BERA 2A4ZA 2OCCE 1EF1C 1ELRA 2VSYA 4A3VA 2GW1A 5AJLA 5BXOA 5BV0A 5ARGA 1ZBPA 4HOSA 3URZA 2V8SE 3Q47B 4GTOA 4JW1A 4ACLA 2XGSA 1OUVA 1PAQA 3IXEA 4RQIA 5CEDB 1BPOA 1L5JA 3DEPA 4IN3B 5FIOA 1Z6TA 3CSFA 2H6GA 4GZ5A 2X6KA 3CQGB 3DSXA 3ABKE 2L6BA 3SBTB 3S7JA 3FP3A 2ZGDA 4ZHBA 4NIKA 5A23A 3ZRHA 3CVLA 4TUMA 4TXQA 2ETBA 4X8QA 2VJ8A 5E76A 1D9SA 3TWUA 3ZVVA 2QYJA 3EHNA 3D3MA 2RD0A 2I9CA 3BG0B 3SI5A 4WAFA 4HFGA 2Y4TA 3UPVA 4J8YA 1B89A 2V4HC 2XQ0A 4I2WA 3UI2A 3LKUA 1S64A 3E34A 4RSYA 1H2VC 5ITZF 3QWPA 4G8KA 3PEUB 3T9KA 4I17A 4RVBA 3UIPC 5CMYA 3D9JA 1HZ4A 3SFZA 5LCWC 4KT6B 4JB8P 2UWJG 2VGEA 4U95D 1SZ9A 1N4SA 5KCMA 1MHQA 3BEEA 4GTSA 3DSVA 4LERA 4WNEA 4U04A 2AXUA 3P2BA 2IQCA 3NAWA 4ME2A 3QK0A 3CK7A 3FU5A 3LS8A 2P9IG 4JEUA 4J8SA 3ZUVB 2V5FA 2QC9A 3ZGQA 3MKQB 1LF8A 3ASDA 3ASNE 4DRXE 1HFAA 5AENA 2HM8A 2ZXWE 4HRMB 3U3WA 2X38A 3B7TA 5ENOD 2ETCA 2EILE 3Q79A 5ENTD 3L9TA 4GYWA 3U66A 3D9KA 4L2YA 2VSNA 4FLHA
chains in the Genus database with same CATH topology
4XZ4A 3FUEA 3Q15A 2WXQA 4MRUA 1JUQA 3LDZA 2KZTB 2WXLA 2WMNA 1HXIA 2PZIA 3BG1B 3QARA 2WMOA 4XIFA 3EIQC 4FU3A 4U07A 5BPPA 4KZ0A 4AM9A 2WQ6A 4L2LA 3FH5A 3FUKA 1NZNA 3R9AB 1SZAA 5JHAA 2I2OA 2XHEA 1A17A 4BY6A 4E85A 2L0TB 2HYZA 1UJJA 3RO3A 2DIWA 3CIAA 3UX4A 3EDTB 3ZYMA 3D9NA 1HG5A 5FZRA 4H7XA 2X6IA 3CK8A 4NACA 5CCLA 1SQMA 3PZDA 3FU3A 3PE4A 4N3AA 4RG9A 4MS6A 5BT1A 2WB2A 5KJKA 2DBAA 2FO7A 4BTBA 3VTYA 4HLEA 3G2WA 4N5CA 1E8XA 3AS5A 3MKRA 5HI7A 4E6HA 2VTBA 2J49A 3IHYA 1JWFA 4DK5A 2X6JA 4AV7A 5T8IA 3QAQA 4DLQA 3FU6A 4DI4A 3CVQA 2L6JA 3PH0C 2CFUA 2ZU6B 3G2UA 4IULA 4ILHB 2XGMA 2WXOA 2XPYA 2FI7A 3CKBA 4XX5A 2VSXE 3FUMA 3MV3B 3MCXA 2GGFA 3MGBA 3HVEA 4WWPA 4GA1A 4CGVA 3IKOB 2ILRA 1KT1A 2IOLA 4OVUA 5DIZA 3CGHA 4BWRA 3G2SA 3S7FA 4FA6A 1JPLA 1E90A 5A6CA 3CK9A 3NQPA 2MHKA 4JEHA 3ZIMA 2L0IA 5M72A 2WXGA 2YHCA 4IYPA 3CVWA 5CCMA 5CMWA 4U0UA 2WXPA 4UWGA 3MKQA 3QOUA 4BT8A 3FUDA 4CRWA 2I1KA 3WXXA 5EDSA 4KYOB 2UY1A 3L17A 4CEMA 4JHJA 2X6HA 2KC7A 3APFA 4NURA 4F53A 4GPKA 4UQYA 4I9CA 4YNDA 2LSUA 2J4BA 2Q7FA 1IQUA 3CR3A 4H7YA 1WM5A 3MX3A 3QC1A 4GYYA 3MYVA 4ANXA 1ZU2A 4PS8A 2A5UA 2LSVA 4JXTA 4XI9A 3ZFWA 4G1TA 5T3RA 3EHMA 4URKA 4GZ6A 4LCTA 1HX8A 3IV0A 4WNGA 4CDMA 3TGOA 4G24A 3FUNA 4O6FA 3RJVA 2FF4A 2XPIA 4W9RA 4ACKA 1U3CA 2LAHA 3QWVA 3O4ZA 2OVBA 3SNXA 4IRUA 4XKBA 1PC2A 4AP2A 3UT7A 3ENEA 2PM6A 3PVLA 2J4DA 1UG3A 5AIJA 2VQ2A 2XCBA 4CT4A 3ZHEB 5LX8A 3VLFA 3PUJA 2WXMA 5C1DA 3OXGA 3RRMB 2I6HA 4WUYA 4FADA 1KLXA 4L23A 1E96B 2AWIA 1KT0A 2GRMA 4CGWA 2C0LA 4HOTA 4MKTA 2AXVA 5JJ6A 2QFCA 2VTBB 3B13A 3U4TA 3ZHEA 3AU4A 3FEYA 1H6KA 5JJ7A 3ZYQA 3D9LA 4UI9J 5E75A 4Y6WA 4GYOA 3ASGA 1JWGA 3VLEA 4UI9K 4YVQC 2E0IA 2XPZA 2KCVA 3VLDA 3FUJA 2J07A 5BNWA 4DPRA 3FTSA 5FQ6A 3RK6A 1S0PA 1UW4B 4XE0A 1HF8A 3TXMA 5ENNA 4EECA 3MV2B 3HDXA 1IYGA 3P1UA 3I4GA 4P29A 2IU1A 4L7TA 4OYSA 1TEZA 2UY1B 2PL2A 3QWWA 4GCOA 4FJYA 4UQZA 2KCKA 5BW8C 1HH8A 2FEZA 3TG5A 1INZA 4BX8A 3KS2A 3N71A 3SHFA 4V3IA 2HR2A 5EKQD 4APOA 4GU5A 3SD5A 4ANVA 2WPVA 3ML9A 1ELKA 3PEVB 3Q4AB 2EQXA 5FZQA 5KJLA 1FCHA 4KXKB 4HOUA 4EBAG 3JQ0A 3RU0A 4GMJA 2R59A 3CV0A 2CHXA 3FTUA 2QY7A 1VDYA 3DBSA 3GW4A 3UMVA 3FUHA 4EQFA 4LRZA 2X3MA 3D9IA 3LY7A 5A7DB 2LNIA 5FT9A 3GZSA 2YNQA 3GYZA 2OV8A 2P58C 3QB2A 3TJPA 4DI3A 3PUKA 2R5SA 3IHVA 3QKYA 5FWQA 3LJ3A 4GCNA 4A1SA 3L22A 2NSZA 3LCAA 4ILGA 4XI0A 5FJYA 4AY5A 3ML8A 3O48A 3Q5MA 3OTNA 4HXIA 4I6EA 4Q69A 3L54A 1N54A 4NQ0A 3UQ3A 4OVVA 2OVFA 5HQ8A 3TXNA 3APCA 4JA7A 4PH4B 1HS6A 4JZYA 4I43A 3APDA 3FY4A 4A1GA 4M3OA 4UQXA 4B89A 3MEKA 2WQHA 4J8EA 1TJCA 3FU0A 3HIZA 2E2EA 1NP7A 4JA9A 1E7VA 4G23A 3CVYA 5FQ8A 4A55A 1WY6A 4Q94A 2BTDA 5G2NA 3KD7A 3FUIA 3SBSA 4B0ZA 4ANUA 2VSOE 4AEZC 1HE8A 1N52A 3RRUA 1H19A 4G2VA 3EIJA 2PM7A 3G2VA 1UJKA 1IQRA 2DCPA 3CHMA 3L08A 2IJGX 3ZYKA 4EBAA 3QJZA 3FTVA 4K03A 2WVIA 5G04C 5JJTA 4C9BB 2MOWA 1E8ZA 3CHPA 2J9QA 2XCCA 3FTYA 3QNKA 4I1OB 5FQ7A 4D10C 4Y6CA 2YINA 1H2UA 4L1BA 4U0SA 1Y8MA 4G11A 4U0ZA 4UI9C 3FUFA 5AYWD 4R7LA 1OWOA 3LY8A 4HS2A 3VTXA 4I9EA 3LVRE 2M63A 3FTWA 4JVSA 1OWNA 1FVHA 1EDUA 3PS6A 4APFA 3ASFA 3PE3A 2HO1A 3ASHA 4QFVA 5G55A 2XEVA 4G25A 4GMLA 1W3BA 4UWLA 3TL5A 2IOSA 4PS3A 4A3TA 3ZN3A 2WXFA 3EJNA 1OWPA 3CKCA 1H2TC 3JYSA 3LVQE 4I6GA 2A4ZA 1HG2A 3D9MA 4FLBA 5LP0A 4B94A 2CG3A 4HVBA 5J08A 4BFRA 3CVUA 3AU5A 3IBEA 2VGYA 4GAAA 4I2ZA 4WNDA 4UWKA 3GZ2A 2WXJA 1EF1C 1ELRA 4BT9A 4XKCA 3OXFA 1DVPA 2VSYA 3DPDA 4A3VA 2CFZA 2IONA 3MA5A 2GW1A 3NZUA 2IFUA 5AJLA 2AW6A 3SZ7A 1Z3YA 5BV0A 5G05C 2I1JA 2WXRA 3IEGA 4HORA 5ARGA 4J8DA 4ILIA 4AOFA 1ZBPA 4HOSA 3URZA 4JL0A 1EYHA 2V8SE 4BTAA 4GZCA 3SF4A 2NC9A 3I4RB 3Q47B 5BV1A 1QQEA 4JW1A 5LOZA 4ACLA 2XGSA 1OUVA 3I5PA 4UWHA 4I6JA 3S2AA 1PAQA 4JHKA 2YQ8A 2LO6A 1U3DA 3L13A 2CHWA 3TAXA 4YVOA 3Q49B 3FEXA 4GB9A 2OOEA 2AXZA 2MRIA 5KJMA 3D9PA 2WM9A 3CHRA 5D0OD 1BPOA 3ZW3A 4CDNA 5KJNA 2PQRA 1L5JA 1IHGA 3T5XA 4F1SA 3CVVA 3ESLA 2FBNA 4IN3B 4NRHB 4GZ3A 1WAO1 4AVXA 4FJZA 1Z6TA 3CSFA 3LPZA 3LEWA 1Y6IA 4GZ5A 2L9BA 3JUIA 3U64A 3QDNA 2X6KA 3OAWA 5J90A 3CQGB 4JC8A 4GZDA 3D9OA 4FC8A 1X5BA 4ATGA 3SBTB 2JEKA 3S7JA 2KM4A 3FP3A 4KVOA 1YA0A 5A23A 1NA0A 2LAIA 3NZSA 4TV3A 3RIBA 3FH8A 5CHEE 3ZRHA 4C0EA 3CQCB 3U66A 4FP7A 3CVLA 4AIFA 4PS7A 2BF0X 3HVEB 3FWVA 4LEUA 4EZJA 3E4BA 2NXPA 2VJ8A 4TRQA 3HYMB 4PDXA 5E76A 1E8WA 2VGXA 1FVFA 3ZVVA 3CHSA 3EHNA 3D3MA 4TUUA 2BUGA 5LFAA 5EX3A 3T8MA 3CVXA 2XRZA 2RD0A 1E7UA 2WXHA 5AJDA 3JQ1A 2I9CA 3BG0B 3SI5A 4WAFA 3LYAA 4WNFA 3ESKA 4AJWA 4HFGA 4FLHA 4J8FA 3CVPA 2Y4TA 3UPVA 3MJWA 2FULA 1B89A 3ONKA 3FFLA 4KZCA 3B7RL 3L6AA 5DBKA 5EX0A 2KATA 3OXLA 4K0RA 3S7BA 4ABNA 2XQ0A 4I2WA 4WWOA 3LKUA 4JHRA 4BSXA 3ZPJA 5JHBA 2PQNA 4RSYA 3FTZA 1H2VC 4BX9A 3PREA 4F3VA 4PUCA 3QWPA 3FTXA 3ULQA 5FZSA 5FTPA 3PEUB 4I1MA 1OWMA 3AS8A 1UN9A 3KAEA 4GA0A 4EZLA 4I17A 1P5QA 3HHMA 4RVBA 3LY9A 1XGWA 4KBQA 3CHQA 5CMYA 3FDHA 2CG2A 4FHJA 3R7QA 4CT0A 4RG6A 3D9JA 1HZ4A 2J09A 3RKVA 2Y3AA 3G2TA 3SFZA 2GRLA 2V4LA 2C0MA 2V0PA 2JLBA 5LCWC 4KT6B 4N2QA 2WXKA 2Y4UA 4JPSA 3T5VA 5FQ4A 4B8AA 4GA2A 4FHKA 3ZYLA 2UWJG 2WQ7A 5ARFA 2WXIA 1MQSA 4N39A 5BUZA 4HOQA 1SZ9A 3L16A 3U9WA 4UWFA 4AY6A 2C2LA 3FHEA 3PNLB 2XRYA 5KCMA 3UT8A 1MHQA 2KCLA 3BEEA 4MLPA 2KZTA 5T4YA 1XNFA 3SGHA 4LERA 3PRZA 1NA3A 3CVNA 3ONLA 4CDRA 5LCWJ 4WWNA 3C98A 2VYIA 4WNEA 1QNFA 5D0QD 4U04A 5C2YA 4DLOA 3AS4A 2AXUA 2CHZA 4C0MA 3RRNB 3P2BA 2IQCA 1HU3A 1UN8A 3FH7A 3GZ1A 3JCKC 3QK0A 3CK7A 3FU5A 3LS8A 4FULA 4ME2A 4CCAA 4F7AA 4N2SA 4I1AA 4JEUA 4J8SA 3TG4A 3ZEFA 2J08A 4ANWA 1ELWA 4N3BA 2V5FA 3CHOA 4U8HA 1GW6A 3ZGQA 3MKQB 1LF8A 3ASDA 3CSTA 4B8CB 3I3NA 4EPZA 1HFAA 5AENA 2HM8A 4G26A 1QZ2A 3ZXSA 4J6IA 3PDNA 5ANRA 3PNTB 5G04J 4LUNU 3U3WA 2X38A 3NF1A 3S7DA 3B7TA 3B7SA 2YHEA 3UUXA 2WXNA 1PY1A 4N3CA 3RO2A 3MZLB 5G05J 4Q96A 2X6FA 4AXHA 4KMOA 2ONDA 3KEZA 1EPUA 1TJFA 5ANLA 3CLJA 3LXUX 3K9IA 3CEQA 2IF4A 1OWLA 1H0AA 4U63A 2XGOA 1DNPA 3R7RA 4GYWA 4EZKA 3B7UX 3FULA 4J0UA 3D9KA 1Z3XA 1HO8A 4L2YA 2R17C 3UT4A 2AVPA 2VSNA 1E8YA 4DJAA 4KVMA 2RG8A 2VGXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNL B;  2BTD A;  1UN9 A;  4LRZ A;  3CR3 A;  1UN8 A; 
#chains in the Genus database with same CATH topology
 4XZ4 A;  3Q15 A;  4MRU A;  1HXI A;  2WMO A;  3FH5 A;  3R9A B;  1NZN A;  2I2O A;  2XHE A;  1UJJ A;  3CIA A;  3EDT B;  2DWZ A;  5FZR A;  4DX1 A;  1UOH A;  4N3A A;  1NL4 A;  1BLX B;  2R2L A;  3G2W A;  3SFX A;  4E6H A;  3EHR A;  1JWF A;  4DK5 A;  1SA4 A;  4DLQ A;  4Z68 A;  3G2U A;  4GTM A;  4GTR A;  2WXO A;  2XPY A;  1N94 A;  4F6R D;  2ILR A;  1KT1 A;  3CGH A;  3W9G A;  1E90 A;  4HRL A;  4JEH A;  5CER B;  2WXP A;  3QOU A;  4KYO B;  2UY1 A;  3L17 A;  3HXF A;  3SQV A;  3APF A;  2J4B A;  3CR3 A;  1IQU A;  4H7Y A;  4GYY A;  3MX3 A;  4L9P A;  4PS8 A;  3ZFW A;  5EIL A;  4CDM A;  3TGO A;  3FUN A;  4O6F A;  4W9R A;  5B1A E;  3QWV A;  3O4Z A;  4AP2 A;  2P9S G;  2PM6 A;  3DRA A;  2J4D A;  3ZHE B;  2DZO A;  3X2Q E;  1KLX A;  5B1B E;  4L23 A;  3TWS A;  4HOT A;  2QFC A;  4MBG A;  3FEY A;  5E75 A;  4GYO A;  3VLE A;  3DSS A;  2XPZ A;  5CRU A;  1S0P A;  2P9P G;  4EEC A;  3P1U A;  3TWX A;  4OYS A;  1TEZ A;  1H6O A;  2FEZ A;  3TG5 A;  5D2M C;  3SD5 A;  1ELK A;  5FZQ A;  1FCH A;  3GW4 A;  3FUH A;  4EQF A;  2ZIR A;  3LY7 A;  2LNI A;  3GZS A;  3AG3 E;  3TJP A;  4DI3 A;  3DXM G;  4AY5 A;  3JXJ A;  1KZP A;  3UQ3 A;  3ASO E;  3TXN A;  3APC A;  4JA7 A;  4PH4 B;  4B89 A;  3MEK A;  3FU0 A;  2E2E A;  4YDY A;  5FQ8 A;  1YCS B;  4Q94 A;  1BI7 B;  3KD7 A;  3SBS A;  3AG1 E;  4G2V A;  1UJK A;  1IQR A;  3C72 A;  4U7E B;  2IJG X;  4EBA A;  2ZGG A;  2WVI A;  5JJT A;  3BQO A;  2BED A;  1E8Z A;  2J9Q A;  4I1O B;  4L1B A;  1KZO A;  4G11 A;  4DX6 D;  3FUF A;  4BES A;  1YMP A;  3VTX A;  4I9E A;  3LVR E;  1N4P A;  4JVS A;  1FVH A;  4APF A;  5G55 A;  1W3B A;  3TL5 A;  3ZN3 A;  2WXF A;  4O60 A;  4FLB A;  3C3Q A;  4B94 A;  2LXM A;  2WXJ A;  1JCR A;  4A63 B;  1V54 E;  1DVP A;  3AAA C;  3DPD A;  3ISM C;  2CFZ A;  3NZU A;  3SZ7 A;  3NOC D;  2AW6 A;  1Z3Y A;  2I1J A;  1NFI E;  4ILI A;  2J8S D;  4JL0 A;  4GZC A;  3SF4 A;  5BV1 A;  3HXB A;  3Q9U C;  3I5P A;  4UWH A;  3ULY A;  3TAX A;  2OOE A;  2AXZ A;  2MRI A;  3NBN B;  2WM9 A;  3CHR A;  5D0O D;  4CDN A;  3T5X A;  3DXK G;  3ESL A;  3LEW A;  3C3R A;  3JUI A;  1RW2 A;  1A5E A;  4JD2 G;  3OAW A;  4JC8 A;  3HXE A;  4GZD A;  4FC8 A;  1X5B A;  2JEK A;  2R03 A;  2LAI A;  2HE0 A;  4PS7 A;  2BF0 X;  3HVE B;  3FWV A;  4DX2 A;  2NXP A;  1O1R A;  3HYM B;  3E30 A;  1N11 A;  2XRZ A;  1DCQ A;  3E33 A;  4O1O A;  4WNF A;  3ESK A;  5AN8 A;  2GRP B;  3ONK A;  4KZC A;  3FFL A;  3B7R L;  5EX0 A;  2KAT A;  3OXL A;  4K0R A;  5EYL A;  2B0O E;  2GRR B;  3ZPJ A;  5JHB A;  2PQN A;  3FTX A;  3KAE A;  1UN9 A;  1P5Q A;  3HHM A;  1XGW A;  4FHJ A;  3R7Q A;  5CEA A;  2RFA A;  5AAR A;  3RKV A;  5HS0 A;  2GRL A;  2V0P A;  2IO3 C;  2WXK A;  4HQD A;  4B8A A;  4GA2 A;  3ZYL A;  4K5A B;  5ENP D;  1MQS A;  3U9W A;  2FO1 E;  1U2V G;  3SGH A;  3PRZ A;  3CVN A;  4GPM A;  3C98 A;  3J5P A;  2VYI A;  5C2Y A;  1QNF A;  3RRN B;  1HU3 A;  5AQA A;  5CBO A;  3GZ1 A;  4FUL A;  2IY0 C;  3AG2 E;  4B8C B;  4G26 A;  3PNT B;  1Q2Z A;  3NF1 A;  4N5Q A;  2WXN A;  1PY1 A;  5G05 J;  4DX7 D;  4AXH A;  5JA4 D;  2OND A;  1EPU A;  1TJF A;  5ANL A;  1D8D A;  1OWL A;  2XGO A;  4GMR A;  3HRA A;  3B7U X;  4J0U A;  1HO8 A;  3FUE A;  2WXL A;  2WMN A;  2PZI A;  4BEP A;  4U07 A;  2ZIS A;  2WQ6 A;  4BY6 A;  4E85 A;  1TNB A;  3RO3 A;  2DYS E;  3ZYM A;  1N4R A;  1HG5 A;  4H7X A;  4NAC A;  5CCL A;  3ZNG A;  2XEH A;  2DVW A;  4TXP A;  5KJK A;  2DBA A;  2FO7 A;  4BTB A;  3VTY A;  3PZ2 A;  1FT2 A;  4UUC A;  5HI7 A;  2VTB A;  2X6J A;  4DI4 A;  1X81 A;  2L6J A;  4IUL A;  4ILH B;  3BU8 A;  1OCZ E;  2FI7 A;  2VSX E;  3MV3 B;  3MCX A;  2GGF A;  4CGV A;  3HVE A;  3IKO B;  1IKN D;  3CK9 A;  3ZIM A;  2L0I A;  2WXG A;  2YHC A;  2V5Q C;  3RAU A;  5CCM A;  3FUD A;  2I1K A;  3WXX A;  4HNA D;  4CEM A;  2KC7 A;  4GPK A;  2LSU A;  3UXG A;  3QC1 A;  1K1B A;  2A5U A;  2NYJ A;  4URK A;  4G24 A;  3RJV A;  1U3C A;  2LAH A;  3SNX A;  4XKB A;  1PC2 A;  3DPY A;  3Q9N C;  2XCB A;  3PUJ A;  1ZB1 A;  3RRM B;  1E96 B;  2H6H A;  4CGW A;  2P9L G;  4MKT A;  5JJ6 A;  3ZHE A;  3U4T A;  3AU4 A;  3ZYQ A;  4UI9 J;  2H6I A;  3FUJ A;  2R02 A;  2J07 A;  5BNW A;  2RFM A;  3TXM A;  3HDX A;  4B93 B;  4P29 A;  4L7T A;  1D8E A;  2UY1 B;  2PL2 A;  4GCO A;  5BW8 C;  1HH8 A;  3SHF A;  2HR2 A;  5EKQ D;  4TXR A;  1V55 E;  2WPV A;  3ML9 A;  3Q4A B;  3UTM A;  3KEA A;  3JQ0 A;  3RU0 A;  4GMJ A;  2R59 A;  3FTU A;  2QY7 A;  3E37 A;  2X3M A;  3D9I A;  1TNU A;  5FT9 A;  3IHV A;  3QKY A;  4A1S A;  3L22 A;  5HRY A;  4XI0 A;  3O48 A;  2QZA A;  4HXI A;  3HXC A;  4I6E A;  4Q69 A;  4NQ0 A;  2OVF A;  5HQ8 A;  4XEI G;  1S70 B;  4HB5 A;  1N0Q A;  3FY4 A;  4I43 A;  3T8K A;  1BI8 B;  4M3O A;  4UQX A;  4A1G A;  3HG0 D;  4JA9 A;  1QBQ A;  3FUI A;  2R05 A;  3JXI A;  1H19 A;  2DCP A;  3ZYK A;  4C48 B;  3QJZ A;  2RKK A;  2F37 A;  4K03 A;  3RSE G;  4C9B B;  5FQ7 A;  1Y8M A;  4U0Z A;  4UI9 C;  4R7L A;  3LY8 A;  1OXJ A;  1OWN A;  3PS6 A;  4ZFH A;  2Y1L E;  2HO1 A;  4A3T A;  4GML A;  4UWL A;  1LD7 A;  3EHQ A;  3LVQ E;  1HG2 A;  4M7C A;  2CG3 A;  4HVB A;  5J08 A;  3AU5 A;  3IBE A;  1DCE A;  2VGY A;  4GAA A;  3GZ2 A;  4XKC A;  3MA5 A;  2ION A;  2IFU A;  5G05 C;  3IEG A;  1TN6 A;  4BTA A;  2H6F A;  3B7B A;  1K8K G;  2XEN A;  3I4R B;  1QQE A;  5LOZ A;  3ULE G;  1TN8 A;  1SVX A;  2P9N G;  3UM3 A;  3S2A A;  4HBD A;  4JHK A;  2YQ8 A;  3L13 A;  2CHW A;  4YVO A;  3Q49 B;  3FEX A;  4GB9 A;  5KJM A;  3ABL E;  2OEW A;  1IHG A;  4F1S A;  3AG4 E;  3CVV A;  4NRH B;  2FBN A;  4GZ3 A;  3Q78 A;  4AVX A;  3LPZ A;  1Y6I A;  2L9B A;  1N9A A;  5J90 A;  3D9O A;  5EIB E;  1TNO A;  4KVO A;  1YA0 A;  1NA0 A;  4TV3 A;  3NZS A;  3FH8 A;  5CHE E;  3CQC B;  4FP7 A;  4AIF A;  1AWC B;  4LEU A;  4EZJ A;  3E4B A;  4PDX A;  1E8W A;  2VGX A;  1FVF A;  2A5E A;  3CHS A;  4LNB A;  4U96 D;  4TUU A;  5LFA A;  2WXH A;  1E7U A;  3TWR A;  5AJD A;  1JCQ A;  1QYM A;  3LYA A;  4AJW A;  4J8F A;  3L6A A;  5DBK A;  4GTT A;  4WWO A;  4JHR A;  5ENR D;  1AP7 A;  4BET A;  3PRE A;  1MJ0 A;  5FZS A;  3TWV A;  3AS8 A;  3LY9 A;  4G8L A;  4EHM A;  4KBQ A;  3FDH A;  4RG6 A;  2J09 A;  2Y3A A;  1BD8 A;  3G2T A;  3C3O A;  2V4L A;  1O1T A;  4YDW A;  3TWQ A;  4N2Q A;  3DST A;  4FHK A;  2WQ7 A;  2WXI A;  5BUZ A;  4N39 A;  4HOQ A;  5FIN A;  2XRY A;  2KZT A;  1XNF A;  3Q7A A;  2F8Y A;  1BU9 A;  1YYH A;  1NA3 A;  3ONL A;  1KPS B;  4DLO A;  3AS4 A;  4C0M A;  4CZ2 D;  3TWW A;  3FH7 A;  3TG4 A;  2J08 A;  4ANW A;  1ELW A;  4N3B A;  3CHO A;  4U8H A;  3DEO A;  3UM2 A;  3CST A;  1OCR E;  3I3N A;  4EPZ A;  3ZXS A;  1OY3 D;  4J6I A;  3PDN A;  5ANR A;  5G04 J;  4LUN U;  3B7S A;  4N3C A;  3MZL B;  2X6F A;  1FPP A;  4HI9 A;  3PZ4 A;  3LXU X;  3K9I A;  3CEQ A;  2IF4 A;  4U63 A;  1DNP A;  2EIM E;  1N4Q A;  4CDR A;  1Z3X A;  2P2C P;  4DJA A;  3UT4 A;  2AVP A;  3OXF A;  2WXQ A;  1JUQ A;  3LDZ A;  5AAO A;  4F1P A;  3BG1 B;  3QAR A;  4FU3 A;  5BPP A;  1WG0 A;  4L2L A;  5JHA A;  2F8X K;  2HYZ A;  3UM1 A;  4O1P A;  3J5Q B;  3D9N A;  4K5C A;  2X6I A;  1TN7 A;  1SQM A;  3PE4 A;  5KBA A;  4HLE A;  4N5C A;  3MKR A;  3W9F A;  5KWD A;  2XZT G;  4OAU C;  3PH0 C;  3EU5 A;  3EU9 A;  4WWP A;  4GA1 A;  3TWT A;  2IOL A;  4OVU A;  4BWR A;  3S7F A;  4FA6 A;  1JPL A;  5A6C A;  3NQP A;  1RZ4 A;  5M72 A;  2XZD G;  3CVW A;  5CMW A;  4CRW A;  1K1A A;  3MKQ A;  4BT8 A;  4HRN A;  4LG6 A;  5EDS A;  3E32 A;  4GTP A;  1K3Z D;  4JHJ A;  2X6H A;  4NUR A;  3PZ1 A;  4I9C A;  4YND A;  2Q7F A;  3MYV A;  4JXT A;  5T3R A;  3EHM A;  3L82 A;  4GZ6 A;  4LCT A;  3IV0 A;  2XPI A;  3D9H A;  5AIJ A;  1UG3 A;  1IHB A;  3VLF A;  3AJI A;  2WXM A;  5C1D A;  3OXG A;  4WUY A;  4FAD A;  1TNZ A;  2AWI A;  2GRM A;  2C0L A;  2XS1 A;  4DX5 D;  2MYO A;  2VTB B;  3DSU A;  3B13 A;  1H6K A;  5JJ7 A;  1JWG A;  4YVQ C;  5AQB A;  3NB2 A;  5JMN D;  1UW4 B;  4XE0 A;  1HF8 A;  5AQ9 A;  3V2X A;  3MV2 B;  1IYG A;  3I4G A;  2IU1 A;  2PNN A;  3ZU7 B;  4FJY A;  4UQZ A;  2KCK A;  2LXL A;  3N71 A;  3V30 A;  4APO A;  3UIN C;  4ANV A;  1DC2 A;  2EQX A;  5KJL A;  4HOU A;  2Y0B G;  4EBA G;  4U8Y D;  3CV0 A;  2CHX A;  3NOG D;  4LRZ A;  1NI1 A;  4RLY A;  2YNQ A;  2OV8 A;  4GCN A;  5EN5 D;  3LCA A;  3ML8 A;  3Q5M A;  3PZ3 A;  2JAB A;  3JUE A;  4OVV A;  2EIK E;  1HS6 A;  4OAV B;  4JZY A;  3HIZ A;  1NP7 A;  2AJA A;  4G23 A;  3CVY A;  1WY6 A;  5CRV A;  2PM7 A;  3HXD A;  5H7P A;  2KBX A;  3QNK A;  1SW6 A;  3FTY A;  4U0S A;  1H2U A;  1G3N B;  3FTW A;  5KNG A;  2P9K G;  3PE3 A;  4QFV A;  2XEV A;  2GRN B;  1O1S A;  3JYS A;  4YDO A;  1LD8 A;  4I6G A;  3D9M A;  5LP0 A;  3KSL A;  4BFR A;  3CVU A;  1H6P A;  4I2Z A;  4WND A;  4UWK A;  4BT9 A;  2WXR A;  3EUV A;  4HOR A;  4J8D A;  4AOF A;  3BUA A;  2BKK B;  1OCO E;  5IY5 E;  1EYH A;  2NC9 A;  3WG7 E;  4I6J A;  2LO6 A;  1U3D A;  4BSZ B;  3D9P A;  1OT8 A;  3ZW3 A;  5KJN A;  2P9U G;  2PQR A;  1TNY A;  5HKP A;  1WAO 1;  4FJZ A;  3V2O A;  3U64 A;  3QDN A;  4GTV A;  1TR4 A;  4ATG A;  2KM4 A;  3ABM E;  3RIB A;  4YDE A;  3SY2 A;  4C0E A;  4TRQ A;  4U8V D;  2Y69 E;  2BUG A;  5EX3 A;  3T8M A;  3CVX A;  3JQ1 A;  2XEE A;  2QYU A;  3CVP A;  2ETA A;  3MJW A;  2FUL A;  3S7B A;  4ABN A;  2EIN E;  4BSX A;  4LNG A;  2F0Y A;  3FTZ A;  1IXV A;  3Q7F A;  4BX9 A;  1SA5 A;  2OEV A;  4F3V A;  4PUC A;  1N95 A;  3ULQ A;  5FTP A;  4QQI A;  4I1M A;  1OWM A;  4GA0 A;  4EZL A;  1MZC A;  5AQ7 A;  3CHQ A;  3UM0 A;  2CG2 A;  2GRQ B;  4CT0 A;  3KSQ A;  1MX6 A;  2C0M A;  2JLB A;  4CYM D;  1TYQ G;  2Y4U A;  4JPS A;  3T5V A;  5FQ4 A;  5ARF A;  1OCC E;  1LTX A;  1WDY A;  3L16 A;  4UWF A;  4AY6 A;  2C2L A;  3FHE A;  3PNL B;  3UT8 A;  2KCL A;  4MLP A;  5T4Y A;  2IO2 C;  5LCW J;  4WWN A;  5D0Q D;  2CHZ A;  1JCS A;  1UN8 A;  3JCK C;  3Q73 A;  4F7A A;  4CCA A;  4N2S A;  4I1A A;  3ZEF A;  5EID A;  1GW6 A;  4DUI A;  3ZKJ A;  1QZ2 A;  3B95 A;  3S7D A;  3UUX A;  2YHE A;  3V31 A;  3RO2 A;  2LUH A;  4Q96 A;  5KNH D;  4KMO A;  4LSZ E;  4J7W A;  3KEZ A;  3CLJ A;  1H0A A;  3R7R A;  4EZK A;  3FUL A;  3UX4 A;  2R17 C;  1E8Y A;  4KVM A;  2RG8 A;  2VGX B;  2KZT B;  4XIF A;  3EIQ C;  5CEC B;  4KZ0 A;  4AM9 A;  3FUK A;  1SZA A;  1A17 A;  2L0T B;  2DIW A;  1MX2 A;  1O5M A;  2B6C A;  3CK8 A;  3PZD A;  3FU3 A;  1N0R A;  4RG9 A;  4MS6 A;  5BT1 A;  2WB2 A;  2KXP C;  1E8X A;  3AS5 A;  4LNU D;  2J49 A;  3IHY A;  4AV7 A;  5T8I A;  3QAQ A;  3FU6 A;  3CVQ A;  2CFU A;  2ZU6 B;  2XGM A;  3CKB A;  4HI8 A;  4XX5 A;  3FUM A;  3MGB A;  5DIZ A;  3G2S A;  2MHK A;  4IYP A;  3DSW A;  4U0U A;  4UWG A;  5D66 A;  4HLL A;  2DZN A;  4GTQ A;  4F53 A;  4UQY A;  4ANX A;  1WM5 A;  1ZU2 A;  2LSV A;  4XI9 A;  4G1T A;  1HX8 A;  4WNG A;  2BKG A;  2FF4 A;  3C5R A;  3SO8 A;  4ACK A;  3R9M A;  3V79 K;  2OVB A;  4IRU A;  3UT7 A;  3ENE A;  3PVL A;  2VQ2 A;  4CT4 A;  5LX8 A;  2I6H A;  3SFY A;  1KT0 A;  5B3S E;  2AXV A;  3DWL G;  3D9L A;  3UIO C;  4Y6W A;  3ASG A;  4UI9 K;  2E0I A;  2KCV A;  3VLD A;  4DPR A;  1MYO A;  3FTS A;  5FQ6 A;  3RK6 A;  5ENN A;  2EIJ E;  3QWW A;  1INZ A;  4BX8 A;  3KS2 A;  4V3I A;  4GU5 A;  5EYP F;  3UKR G;  1MX4 A;  3PEV B;  4KXK B;  4ATZ D;  5ENS D;  1VDY A;  3DBS A;  3UMV A;  5A7D B;  3ZXP A;  3GYZ A;  2P58 C;  3QB2 A;  3PUK A;  2R5S A;  5FWQ A;  3LJ3 A;  2NSZ A;  4ILG A;  5FJY A;  2IEJ A;  3OTN A;  3L54 A;  1N54 A;  1S63 A;  3APD A;  5ENQ D;  2WQH A;  4J8E A;  1TJC A;  1E7V A;  4A55 A;  2BTD A;  4K5B A;  5CBN A;  5G2N A;  4ANU A;  4B0Z A;  2VSO E;  4AEZ C;  1HE8 A;  1N52 A;  3RRU A;  3UKU G;  3EIJ A;  3G2V A;  5BXU A;  3CHM A;  3L08 A;  1FT1 A;  3FTV A;  2XS8 A;  5G04 C;  2MOW A;  4D10 C;  3CHP A;  2XCC A;  4Y6C A;  2YIN A;  3Q75 A;  3LJN A;  5AYW D;  1OWO A;  4HS2 A;  2DYR E;  2M63 A;  1EDU A;  1Z5S C;  3F6Q A;  3ASF A;  3ASH A;  4G25 A;  2IOS A;  4PS3 A;  2GRO B;  3EJN A;  1OWP A;  3CKC A;  1H2T C;  4BER A;  2A4Z A;  2OCC E;  1EF1 C;  1ELR A;  2VSY A;  4A3V A;  2GW1 A;  5AJL A;  5BXO A;  5BV0 A;  5ARG A;  1ZBP A;  4HOS A;  3URZ A;  2V8S E;  3Q47 B;  4GTO A;  4JW1 A;  4ACL A;  2XGS A;  1OUV A;  1PAQ A;  3IXE A;  4RQI A;  5CED B;  1BPO A;  1L5J A;  3DEP A;  4IN3 B;  5FIO A;  1Z6T A;  3CSF A;  2H6G A;  4GZ5 A;  2X6K A;  3CQG B;  3DSX A;  3ABK E;  2L6B A;  3SBT B;  3S7J A;  3FP3 A;  2ZGD A;  4ZHB A;  4NIK A;  5A23 A;  3ZRH A;  3CVL A;  4TUM A;  4TXQ A;  2ETB A;  4X8Q A;  2VJ8 A;  5E76 A;  1D9S A;  3TWU A;  3ZVV A;  2QYJ A;  3EHN A;  3D3M A;  2RD0 A;  2I9C A;  3BG0 B;  3SI5 A;  4WAF A;  4HFG A;  2Y4T A;  3UPV A;  4J8Y A;  1B89 A;  2V4H C;  2XQ0 A;  4I2W A;  3UI2 A;  3LKU A;  1S64 A;  3E34 A;  4RSY A;  1H2V C;  5ITZ F;  3QWP A;  4G8K A;  3PEU B;  3T9K A;  4I17 A;  4RVB A;  3UIP C;  5CMY A;  3D9J A;  1HZ4 A;  3SFZ A;  5LCW C;  4KT6 B;  4JB8 P;  2UWJ G;  2VGE A;  4U95 D;  1SZ9 A;  1N4S A;  5KCM A;  1MHQ A;  3BEE A;  4GTS A;  3DSV A;  4LER A;  4WNE A;  4U04 A;  2AXU A;  3P2B A;  2IQC A;  3NAW A;  4ME2 A;  3QK0 A;  3CK7 A;  3FU5 A;  3LS8 A;  2P9I G;  4JEU A;  4J8S A;  3ZUV B;  2V5F A;  2QC9 A;  3ZGQ A;  3MKQ B;  1LF8 A;  3ASD A;  3ASN E;  4DRX E;  1HFA A;  5AEN A;  2HM8 A;  2ZXW E;  4HRM B;  3U3W A;  2X38 A;  3B7T A;  5ENO D;  2ETC A;  2EIL E;  3Q79 A;  5ENT D;  3L9T A;  4GYW A;  3U66 A;  3D9K A;  4L2Y A;  2VSN A;  4FLH A; 
#chains in the Genus database with same CATH homology
 4XZ4 A;  3FUE A;  3Q15 A;  2WXQ A;  4MRU A;  1JUQ A;  3LDZ A;  2KZT B;  2WXL A;  2WMN A;  1HXI A;  2PZI A;  3BG1 B;  3QAR A;  2WMO A;  4XIF A;  3EIQ C;  4FU3 A;  4U07 A;  5BPP A;  4KZ0 A;  4AM9 A;  2WQ6 A;  4L2L A;  3FH5 A;  3FUK A;  1NZN A;  3R9A B;  1SZA A;  5JHA A;  2I2O A;  2XHE A;  1A17 A;  4BY6 A;  4E85 A;  2L0T B;  2HYZ A;  1UJJ A;  3RO3 A;  2DIW A;  3CIA A;  3UX4 A;  3EDT B;  3ZYM A;  3D9N A;  1HG5 A;  5FZR A;  4H7X A;  2X6I A;  3CK8 A;  4NAC A;  5CCL A;  1SQM A;  3PZD A;  3FU3 A;  3PE4 A;  4N3A A;  4RG9 A;  4MS6 A;  5BT1 A;  2WB2 A;  5KJK A;  2DBA A;  2FO7 A;  4BTB A;  3VTY A;  4HLE A;  3G2W A;  4N5C A;  1E8X A;  3AS5 A;  3MKR A;  5HI7 A;  4E6H A;  2VTB A;  2J49 A;  3IHY A;  1JWF A;  4DK5 A;  2X6J A;  4AV7 A;  5T8I A;  3QAQ A;  4DLQ A;  3FU6 A;  4DI4 A;  3CVQ A;  2L6J A;  3PH0 C;  2CFU A;  2ZU6 B;  3G2U A;  4IUL A;  4ILH B;  2XGM A;  2WXO A;  2XPY A;  2FI7 A;  3CKB A;  4XX5 A;  2VSX E;  3FUM A;  3MV3 B;  3MCX A;  2GGF A;  3MGB A;  3HVE A;  4WWP A;  4GA1 A;  4CGV A;  3IKO B;  2ILR A;  1KT1 A;  2IOL A;  4OVU A;  5DIZ A;  3CGH A;  4BWR A;  3G2S A;  3S7F A;  4FA6 A;  1JPL A;  1E90 A;  5A6C A;  3CK9 A;  3NQP A;  2MHK A;  4JEH A;  3ZIM A;  2L0I A;  5M72 A;  2WXG A;  2YHC A;  4IYP A;  3CVW A;  5CCM A;  5CMW A;  4U0U A;  2WXP A;  4UWG A;  3MKQ A;  3QOU A;  4BT8 A;  3FUD A;  4CRW A;  2I1K A;  3WXX A;  5EDS A;  4KYO B;  2UY1 A;  3L17 A;  4CEM A;  4JHJ A;  2X6H A;  2KC7 A;  3APF A;  4NUR A;  4F53 A;  4GPK A;  4UQY A;  4I9C A;  4YND A;  2LSU A;  2J4B A;  2Q7F A;  1IQU A;  3CR3 A;  4H7Y A;  1WM5 A;  3MX3 A;  3QC1 A;  4GYY A;  3MYV A;  4ANX A;  1ZU2 A;  4PS8 A;  2A5U A;  2LSV A;  4JXT A;  4XI9 A;  3ZFW A;  4G1T A;  5T3R A;  3EHM A;  4URK A;  4GZ6 A;  4LCT A;  1HX8 A;  3IV0 A;  4WNG A;  4CDM A;  3TGO A;  4G24 A;  3FUN A;  4O6F A;  3RJV A;  2FF4 A;  2XPI A;  4W9R A;  4ACK A;  1U3C A;  2LAH A;  3QWV A;  3O4Z A;  2OVB A;  3SNX A;  4IRU A;  4XKB A;  1PC2 A;  4AP2 A;  3UT7 A;  3ENE A;  2PM6 A;  3PVL A;  2J4D A;  1UG3 A;  5AIJ A;  2VQ2 A;  2XCB A;  4CT4 A;  3ZHE B;  5LX8 A;  3VLF A;  3PUJ A;  2WXM A;  5C1D A;  3OXG A;  3RRM B;  2I6H A;  4WUY A;  4FAD A;  1KLX A;  4L23 A;  1E96 B;  2AWI A;  1KT0 A;  2GRM A;  4CGW A;  2C0L A;  4HOT A;  4MKT A;  2AXV A;  5JJ6 A;  2QFC A;  2VTB B;  3B13 A;  3U4T A;  3ZHE A;  3AU4 A;  3FEY A;  1H6K A;  5JJ7 A;  3ZYQ A;  3D9L A;  4UI9 J;  5E75 A;  4Y6W A;  4GYO A;  3ASG A;  1JWG A;  3VLE A;  4UI9 K;  4YVQ C;  2E0I A;  2XPZ A;  2KCV A;  3VLD A;  3FUJ A;  2J07 A;  5BNW A;  4DPR A;  3FTS A;  5FQ6 A;  3RK6 A;  1S0P A;  1UW4 B;  4XE0 A;  1HF8 A;  3TXM A;  5ENN A;  4EEC A;  3MV2 B;  3HDX A;  1IYG A;  3P1U A;  3I4G A;  4P29 A;  2IU1 A;  4L7T A;  4OYS A;  1TEZ A;  2UY1 B;  2PL2 A;  3QWW A;  4GCO A;  4FJY A;  4UQZ A;  2KCK A;  5BW8 C;  1HH8 A;  2FEZ A;  3TG5 A;  1INZ A;  4BX8 A;  3KS2 A;  3N71 A;  3SHF A;  4V3I A;  2HR2 A;  5EKQ D;  4APO A;  4GU5 A;  3SD5 A;  4ANV A;  2WPV A;  3ML9 A;  1ELK A;  3PEV B;  3Q4A B;  2EQX A;  5FZQ A;  5KJL A;  1FCH A;  4KXK B;  4HOU A;  4EBA G;  3JQ0 A;  3RU0 A;  4GMJ A;  2R59 A;  3CV0 A;  2CHX A;  3FTU A;  2QY7 A;  1VDY A;  3DBS A;  3GW4 A;  3UMV A;  3FUH A;  4EQF A;  4LRZ A;  2X3M A;  3D9I A;  3LY7 A;  5A7D B;  2LNI A;  5FT9 A;  3GZS A;  2YNQ A;  3GYZ A;  2OV8 A;  2P58 C;  3QB2 A;  3TJP A;  4DI3 A;  3PUK A;  2R5S A;  3IHV A;  3QKY A;  5FWQ A;  3LJ3 A;  4GCN A;  4A1S A;  3L22 A;  2NSZ A;  3LCA A;  4ILG A;  4XI0 A;  5FJY A;  4AY5 A;  3ML8 A;  3O48 A;  3Q5M A;  3OTN A;  4HXI A;  4I6E A;  4Q69 A;  3L54 A;  1N54 A;  4NQ0 A;  3UQ3 A;  4OVV A;  2OVF A;  5HQ8 A;  3TXN A;  3APC A;  4JA7 A;  4PH4 B;  1HS6 A;  4JZY A;  4I43 A;  3APD A;  3FY4 A;  4A1G A;  4M3O A;  4UQX A;  4B89 A;  3MEK A;  2WQH A;  4J8E A;  1TJC A;  3FU0 A;  3HIZ A;  2E2E A;  1NP7 A;  4JA9 A;  1E7V A;  4G23 A;  3CVY A;  5FQ8 A;  4A55 A;  1WY6 A;  4Q94 A;  2BTD A;  5G2N A;  3KD7 A;  3FUI A;  3SBS A;  4B0Z A;  4ANU A;  2VSO E;  4AEZ C;  1HE8 A;  1N52 A;  3RRU A;  1H19 A;  4G2V A;  3EIJ A;  2PM7 A;  3G2V A;  1UJK A;  1IQR A;  2DCP A;  3CHM A;  3L08 A;  2IJG X;  3ZYK A;  4EBA A;  3QJZ A;  3FTV A;  4K03 A;  2WVI A;  5G04 C;  5JJT A;  4C9B B;  2MOW A;  1E8Z A;  3CHP A;  2J9Q A;  2XCC A;  3FTY A;  3QNK A;  4I1O B;  5FQ7 A;  4D10 C;  4Y6C A;  2YIN A;  1H2U A;  4L1B A;  4U0S A;  1Y8M A;  4G11 A;  4U0Z A;  4UI9 C;  3FUF A;  5AYW D;  4R7L A;  1OWO A;  3LY8 A;  4HS2 A;  3VTX A;  4I9E A;  3LVR E;  2M63 A;  3FTW A;  4JVS A;  1OWN A;  1FVH A;  1EDU A;  3PS6 A;  4APF A;  3ASF A;  3PE3 A;  2HO1 A;  3ASH A;  4QFV A;  5G55 A;  2XEV A;  4G25 A;  4GML A;  1W3B A;  4UWL A;  3TL5 A;  2IOS A;  4PS3 A;  4A3T A;  3ZN3 A;  2WXF A;  3EJN A;  1OWP A;  3CKC A;  1H2T C;  3JYS A;  3LVQ E;  4I6G A;  2A4Z A;  1HG2 A;  3D9M A;  4FLB A;  5LP0 A;  4B94 A;  2CG3 A;  4HVB A;  5J08 A;  4BFR A;  3CVU A;  3AU5 A;  3IBE A;  2VGY A;  4GAA A;  4I2Z A;  4WND A;  4UWK A;  3GZ2 A;  2WXJ A;  1EF1 C;  1ELR A;  4BT9 A;  4XKC A;  3OXF A;  1DVP A;  2VSY A;  3DPD A;  4A3V A;  2CFZ A;  2ION A;  3MA5 A;  2GW1 A;  3NZU A;  2IFU A;  5AJL A;  2AW6 A;  3SZ7 A;  1Z3Y A;  5BV0 A;  5G05 C;  2I1J A;  2WXR A;  3IEG A;  4HOR A;  5ARG A;  4J8D A;  4ILI A;  4AOF A;  1ZBP A;  4HOS A;  3URZ A;  4JL0 A;  1EYH A;  2V8S E;  4BTA A;  4GZC A;  3SF4 A;  2NC9 A;  3I4R B;  3Q47 B;  5BV1 A;  1QQE A;  4JW1 A;  5LOZ A;  4ACL A;  2XGS A;  1OUV A;  3I5P A;  4UWH A;  4I6J A;  3S2A A;  1PAQ A;  4JHK A;  2YQ8 A;  2LO6 A;  1U3D A;  3L13 A;  2CHW A;  3TAX A;  4YVO A;  3Q49 B;  3FEX A;  4GB9 A;  2OOE A;  2AXZ A;  2MRI A;  5KJM A;  3D9P A;  2WM9 A;  3CHR A;  5D0O D;  1BPO A;  3ZW3 A;  4CDN A;  5KJN A;  2PQR A;  1L5J A;  1IHG A;  3T5X A;  4F1S A;  3CVV A;  3ESL A;  2FBN A;  4IN3 B;  4NRH B;  4GZ3 A;  1WAO 1;  4AVX A;  4FJZ A;  1Z6T A;  3CSF A;  3LPZ A;  3LEW A;  1Y6I A;  4GZ5 A;  2L9B A;  3JUI A;  3U64 A;  3QDN A;  2X6K A;  3OAW A;  5J90 A;  3CQG B;  4JC8 A;  4GZD A;  3D9O A;  4FC8 A;  1X5B A;  4ATG A;  3SBT B;  2JEK A;  3S7J A;  2KM4 A;  3FP3 A;  4KVO A;  1YA0 A;  5A23 A;  1NA0 A;  2LAI A;  3NZS A;  4TV3 A;  3RIB A;  3FH8 A;  5CHE E;  3ZRH A;  4C0E A;  3CQC B;  3U66 A;  4FP7 A;  3CVL A;  4AIF A;  4PS7 A;  2BF0 X;  3HVE B;  3FWV A;  4LEU A;  4EZJ A;  3E4B A;  2NXP A;  2VJ8 A;  4TRQ A;  3HYM B;  4PDX A;  5E76 A;  1E8W A;  2VGX A;  1FVF A;  3ZVV A;  3CHS A;  3EHN A;  3D3M A;  4TUU A;  2BUG A;  5LFA A;  5EX3 A;  3T8M A;  3CVX A;  2XRZ A;  2RD0 A;  1E7U A;  2WXH A;  5AJD A;  3JQ1 A;  2I9C A;  3BG0 B;  3SI5 A;  4WAF A;  3LYA A;  4WNF A;  3ESK A;  4AJW A;  4HFG A;  4FLH A;  4J8F A;  3CVP A;  2Y4T A;  3UPV A;  3MJW A;  2FUL A;  1B89 A;  3ONK A;  3FFL A;  4KZC A;  3B7R L;  3L6A A;  5DBK A;  5EX0 A;  2KAT A;  3OXL A;  4K0R A;  3S7B A;  4ABN A;  2XQ0 A;  4I2W A;  4WWO A;  3LKU A;  4JHR A;  4BSX A;  3ZPJ A;  5JHB A;  2PQN A;  4RSY A;  3FTZ A;  1H2V C;  4BX9 A;  3PRE A;  4F3V A;  4PUC A;  3QWP A;  3FTX A;  3ULQ A;  5FZS A;  5FTP A;  3PEU B;  4I1M A;  1OWM A;  3AS8 A;  1UN9 A;  3KAE A;  4GA0 A;  4EZL A;  4I17 A;  1P5Q A;  3HHM A;  4RVB A;  3LY9 A;  1XGW A;  4KBQ A;  3CHQ A;  5CMY A;  3FDH A;  2CG2 A;  4FHJ A;  3R7Q A;  4CT0 A;  4RG6 A;  3D9J A;  1HZ4 A;  2J09 A;  3RKV A;  2Y3A A;  3G2T A;  3SFZ A;  2GRL A;  2V4L A;  2C0M A;  2V0P A;  2JLB A;  5LCW C;  4KT6 B;  4N2Q A;  2WXK A;  2Y4U A;  4JPS A;  3T5V A;  5FQ4 A;  4B8A A;  4GA2 A;  4FHK A;  3ZYL A;  2UWJ G;  2WQ7 A;  5ARF A;  2WXI A;  1MQS A;  4N39 A;  5BUZ A;  4HOQ A;  1SZ9 A;  3L16 A;  3U9W A;  4UWF A;  4AY6 A;  2C2L A;  3FHE A;  3PNL B;  2XRY A;  5KCM A;  3UT8 A;  1MHQ A;  2KCL A;  3BEE A;  4MLP A;  2KZT A;  5T4Y A;  1XNF A;  3SGH A;  4LER A;  3PRZ A;  1NA3 A;  3CVN A;  3ONL A;  4CDR A;  5LCW J;  4WWN A;  3C98 A;  2VYI A;  4WNE A;  1QNF A;  5D0Q D;  4U04 A;  5C2Y A;  4DLO A;  3AS4 A;  2AXU A;  2CHZ A;  4C0M A;  3RRN B;  3P2B A;  2IQC A;  1HU3 A;  1UN8 A;  3FH7 A;  3GZ1 A;  3JCK C;  3QK0 A;  3CK7 A;  3FU5 A;  3LS8 A;  4FUL A;  4ME2 A;  4CCA A;  4F7A A;  4N2S A;  4I1A A;  4JEU A;  4J8S A;  3TG4 A;  3ZEF A;  2J08 A;  4ANW A;  1ELW A;  4N3B A;  2V5F A;  3CHO A;  4U8H A;  1GW6 A;  3ZGQ A;  3MKQ B;  1LF8 A;  3ASD A;  3CST A;  4B8C B;  3I3N A;  4EPZ A;  1HFA A;  5AEN A;  2HM8 A;  4G26 A;  1QZ2 A;  3ZXS A;  4J6I A;  3PDN A;  5ANR A;  3PNT B;  5G04 J;  4LUN U;  3U3W A;  2X38 A;  3NF1 A;  3S7D A;  3B7T A;  3B7S A;  2YHE A;  3UUX A;  2WXN A;  1PY1 A;  4N3C A;  3RO2 A;  3MZL B;  5G05 J;  4Q96 A;  2X6F A;  4AXH A;  4KMO A;  2OND A;  3KEZ A;  1EPU A;  1TJF A;  5ANL A;  3CLJ A;  3LXU X;  3K9I A;  3CEQ A;  2IF4 A;  1OWL A;  1H0A A;  4U63 A;  2XGO A;  1DNP A;  3R7R A;  4GYW A;  4EZK A;  3B7U X;  3FUL A;  4J0U A;  3D9K A;  1Z3X A;  1HO8 A;  4L2Y A;  2R17 C;  3UT4 A;  2AVP A;  2VSN A;  1E8Y A;  4DJA A;  4KVM A;  2RG8 A;  2VGX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...