4LRZA

Crystal structure of the e.coli dhar(n)-dhal complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
211
structure length
211
Chain Sequence
GSSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription regulator
molecule keywords PTS-dependent dihydroxyacetone kinase, ADP-binding subunit D
publication title Coiled-Coil Helix Rotation Selects Repressing or Activating State of Transcriptional Regulator DhaR.
pubmed doi rcsb
source organism Escherichia coli
total genus 86
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lrzA00
3PNLB 1UN9A 4LRZA 1UN8A 2BTDA 3CR3A
chains in the Genus database with same CATH superfamily
2FBNA 4KVMA 4RVBA 3IHVA 3MCXA 3PZ3A 3APFA 1BI8B 4BX9A 1EYHA 3D9JA 4J8DA 1TN8A 4G25A 4PDXA 4YDOA 3RO2A 3PDNA 4TUMA 1TYQG 4DLOA 2Y4TA 1UN8A 3PEUB 4BSXA 3ZHEA 3Q7FA 1PC2A 4A55A 2OEWA 3RAUA 1KLXA 5KJMA 2WM9A 3AG4E 1E96B 5JMND 4G11A 1MJ0A 1TN6A 4GYYA 2LO6A 4Q94A 4V3IA 3U66A 2FULA 3Q47B 4EBAA 2XCCA 1OWPA 4DX7D 3FTSA 1WM5A 5EIBE 3UIPC 4I6GA 2CHXA 1JCSA 3LY8A 4GCNA 2BUGA 3HXEA 3O4ZA 5LOZA 1K1AA 1TNYA 3PNLB 1UG3A 5FZRA 2MRIA 3CVUA 5CBNA 4BERA 3UIOC 5BV1A 3KD7A 4OAUC 1S63A 3W9FA 3LVRE 3MJWA 5B3SE 5LX8A 3C3OA 3JQ0A 3OTNA 1IQRA 3S7BA 2MOWA 5CBOA 4HNAD 5EX3A 1HXIA 4UQYA 4HXIA 4WNFA 3DWLG 1NA3A 3RIBA 3GZ1A 2BKKB 5A23A 3PZ2A 1QZ2A 2MYOA 3ASOE 3LJ3A 4KZCA 2PL2A 5FZSA 4J8FA 2P9LG 2R02A 4I17A 5FQ4A 1H6PA 2EILE 2XS1A 3BQOA 3PE3A 2DVWA 3DSUA 1UJKA 3ZIMA 4HLEA 3CIAA 4AM9A 1WY6A 3CVYA 2V0PA 3E32A 2Y0BG 2XEVA 4U0UA 5AQ7A 3HDXA 3MGBA 4HRLA 3TL5A 5T4YA 2WXJA 2WXNA 1XNFA 4RLYA 2F8XK 4MBGA 2XGOA 2LUHA 3FUJA 2J4BA 1H6OA 4UQXA 3IKOB 4X8QA 2E2EA 1O1RA 2J08A 4GMLA 4HS2A 3K9IA 4GZ3A 4HBDA 2GRNB 4ANUA 1AP7A 3ESKA 2WMNA 5J90A 4JVSA 5FT9A 3G2SA 1K1BA 2XPZA 3CVLA 2VQ2A 3UMVA 4MS6A 3LY7A 4YVQC 4WNEA 4A3TA 3G2VA 3RU0A 5DBKA 3TWRA 3CK8A 4NIKA 4FHKA 4GU5A 2V5QC 2EIKE 2X6JA 3Q7AA 4J6IA 4LRZA 3J5QB 2AXUA 3DSXA 4CT4A 2X6FA 3EU9A 2I6HA 4RQIA 3UM1A 3SQVA 2LXLA 1MX4A 3E33A 2KC7A 1TEZA 1N0QA 1E7VA 2YHCA 1PAQA 5AAOA 2VTBB 4WWPA 3CHOA 1A17A 2WQ6A 2R05A 3Q15A 1IYGA 3L17A 4I1MA 4KBQA 3FH5A 2GROB 3PH0C 4YDWA 2KZTB 5T8IA 3U64A 2OCCE 4JHRA 3Q73A 3QWPA 3D9LA 3MYVA 5FIOA 2P2CP 4DX5D 3OXGA 5JJ7A 3BG0B 4CYMD 4HOQA 1E8ZA 2FEZA 4XE0A 5ANRA 1N4QA 1OT8A 3SF4A 2IJGX 4GTTA 2AVPA 1TN7A 4URKA 2LNIA 2GGFA 2GRRB 2V8SE 3KEAA 2DCPA 4I1AA 5CHEE 3KS2A 3FTYA 3FUIA 2X38A 1NI1A 3LY9A 5C2YA 4JB8P 2A4ZA 2P9PG 4F53A 1KPSB 3FY4A 4RG9A 3UKUG 2RG8A 4I2ZA 4BSZB 2BF0X 5KCMA 1QNFA 3AS5A 4FC8A 5B1AE 5LCWC 3B7TA 4TXQA 2WVIA 3ZYMA 3EIJA 3L6AA 5E75A 5EN5D 4ACLA 4GCOA 1SQMA 2LAHA 3VTXA 5CMWA 2VSXE 1N4RA 1A5EA 5D0QD 2RKKA 3MEKA 4R7LA 4LSZE 4TV3A 4GTSA 3TGOA 3UT7A 3TWWA 2PQRA 4HB5A 4N5CA 1ZBPA 3CHPA 2JEKA 3IBEA 3CVNA 4APOA 4J8EA 4L9PA 4UWGA 1ELKA 4AP2A 3ONLA 2CFZA 4N5QA 4GTQA 1N4SA 5JA4D 4IRUA 3SD5A 2ZGGA 3X2QE 3CK9A 4XIFA 1Z3XA 4GZDA 3ML8A 2ZXWE 1H6KA 2YINA 3I4RB 3TWXA 3C3RA 3TXMA 5E76A 5AENA 4GYWA 3FFLA 3HXFA 4JW1A 5CCMA 1BI7B 4H7YA 1YA0A 5ITZF 2EIJE 4U8VD 1E90A 4JPSA 2YNQA 3D9HA 4JD2G 3FH7A 2IOSA 4JZYA 5ENRD 3HXBA 5ARGA 3LPZA 5D2MC 1N4PA 1L5JA 4UWHA 4WNDA 4CRWA 3MX3A 4FADA 2B6CA 3EHRA 1OUVA 3CK7A 3IEGA 2DYRE 5CEAA 3CKBA 4U04A 4GTOA 3CVXA 4GPKA 4ATZD 2L9BA 5FQ7A 3GZSA 3Q49B 4XKBA 5BXOA 3UUXA 4U8HA 4TXRA 1OWOA 1TNBA 3OXLA 5AQAA 2QC9A 4P29A 3UKRG 2KM4A 4Q69A 4AXHA 3D3MA 1O1TA 4AY5A 3FULA 3PUKA 2OVFA 4TUUA 1YYHA 4DX2A 2OV8A 4PS7A 4GZ6A 2EINE 3ZN3A 1N52A 4F7AA 1DCQA 4HOTA 1Z5SC 2VTBA 1FT1A 2DZOA 3CKCA 4BEPA 4GYOA 4ATGA 1EF1C 2ZIRA 2C2LA 3DXMG 4GB9A 4XKCA 1ELWA 4ANWA 4I43A 2J49A 3ULYA 2IU1A 1RW2A 5KNHD 3ZYLA 2XRYA 3O48A 4HRNA 3NBNB 5BT1A 2PM6A 2KZTA 4CGWA 1FCHA 2DIWA 4IYPA 3CHRA 3FUDA 1BLXB 1NA0A 2OEVA 1TR4A 4NQ0A 2V5FA 1V54E 1FT2A 3PE4A 3QWVA 1HG5A 3QAQA 3Q9NC 4F1SA 4BTBA 3GW4A 4A3VA 1N94A 4DK5A 2WXPA 1YCSB 4E6HA 3SBSA 4EQFA 2X6HA 3AAAC 4OVVA 3UM2A 3Q9UC 4O1OA 2MHKA 3ZYKA 4C48B 5FWQA 3L13A 2Q7FA 3FU6A 3VTYA 3AS8A 4HOUA 3RO3A 1EDUA 3APDA 4G23A 4KZ0A 4LG6A 3UT4A 3NQPA 2GW1A 4J8YA 4NRHB 4FJYA 2ONDA 2R17C 3AG2E 2X3MA 1OCRE 4FA6A 2HM8A 4L2LA 1BU9A 4UWFA 5EKQD 3ZRHA 5D0OD 2IO2C 3C98A 4ABNA 5LCWJ 2EIME 1WG0A 1TNUA 1GW6A 2CG2A 2IONA 3ASHA 5B1BE 1HF8A 4FLHA 4I6EA 1H2TC 4G8LA 4EBAG 3UQ3A 2PNNA 4CEMA 2C0LA 2LSVA 1TJCA 3LYAA 4MLPA 1O5MA 3ZGQA 4C0EA 4PS8A 2VSYA 2R2LA 5HQ8A 2WQ7A 1SW6A 2VGXB 1HFAA 3EHMA 1G3NB 2Y69E 4BY6A 2AWIA 3MKQB 2WQHA 3DPDA 4DRXE 1UOHA 2C0MA 1JCQA 4AY6A 4HRMB 3DSSA 4B94A 4KMOA 4GZCA 1S0PA 3FTZA 3MKRA 2QZAA 2HR2A 4OYSA 2L6BA 3PNTB 4OVUA 1N95A 1ZU2A 5CMYA 4U8YD 2XENA 4N2SA 3HXDA 5AARA 4LNUD 5FTPA 4O6FA 5AJDA 4DPRA 3FUMA 1OCOE 2VSOE 5EDSA 1OXJA 5BPPA 1LTXA 4W9RA 4UI9C 5CRUA 2WXMA 4CDMA 1U2VG 5AQ9A 2BKGA 5KBAA 3L22A 2CFUA 3L9TA 2XCBA 3V31A 4BX8A 1K3ZD 5HS0A 3HG0D 3W9GA 3CQGB 5AJLA 3S7FA 3SFYA 2IQCA 5A7DB 4EECA 3ESLA 3FTVA 4TXPA 5BV0A 5HRYA 5FJYA 4XEIG 2P9KG 1OCCE 3PVLA 4F1PA 2QYUA 3VLDA 3CVWA 3NZUA 1OY3D 2WXLA 2QFCA 1MYOA 1E8XA 3TG5A 1EPUA 5CERB 3KSQA 2A5EA 2IEJA 5JJTA 3URZA 2OOEA 2ZU6B 5BW8C 1E8YA 3OXFA 4DI3A 2FF4A 1MHQA 2P9IG 2I1KA 2YQ8A 4A1GA 4HVBA 1IQUA 3T5XA 1BD8A 3EJNA 3SNXA 2P58C 3FDHA 3B7BA 4CZ2D 4L2YA 5EIDA 4GA1A 4EHMA 3DSVA 1P5QA 4F3VA 3B13A 1VDYA 3ASNE 3LJNA 4G8KA 4EPZA 2Y3AA 2F37A 3FEXA 4IN3B 4ZHBA 1JPLA 4KYOB 5C1DA 3TWVA 3C72A 3FP3A 1Y8MA 1D9SA 4NURA 3DRAA 4BWRA 1N0RA 1YMPA 1JUQA 2XHEA 3U4TA 2PM7A 2JLBA 4WUYA 3ASGA 4I9CA 2VGYA 4ANVA 4GZ5A 3D9MA 3ASFA 2LSUA 3B7RL 3EHQA 1LD7A 5BUZA 2GRMA 3CSFA 1LF8A 3AG1E 3TJPA 3QWWA 3GYZA 2UY1B 4JA7A 3QOUA 3MA5A 4A63B 4BESA 2I1JA 3TWQA 4XI9A 3SFZA 3S7JA 3KSLA 2IO3C 3D9NA 4FJZA 3FWVA 1KZOA 4FU3A 3ASDA 4JEUA 3UTMA 3V30A 4CDRA 3PRZA 4LUNU 3U9WA 4FULA 1HX8A 2ETAA 4BTAA 1WAO1 4I9EA 2CHWA 1N9AA 5LP0A 2VGXA 2I9CA 5CEDB 4IULA 2XPYA 2ETCA 5KJNA 3MKQA 3Q5MA 4K03A 3MZLB 3ZXPA 1TNZA 1ZB1A 4YDYA 2XEEA 3IXEA 3Q79A 5DIZA 3QK0A 5KJLA 2ILRA 5CCLA 3QDNA 3NB2A 3AJIA 3LKUA 2P9NG 3L82A 3G2UA 4HI9A 1MX6A 3R9MA 2FI7A 3HYMB 3V79K 4HLLA 3DSWA 3I3NA 2FO1E 5EX0A 3HXCA 4UI9J 5JHBA 3PEVB 1MX2A 4GPMA 2NXPA 2X6KA 1DNPA 2IY0C 2LAIA 2HO1A 3L16A 4I6JA 4APFA 4AOFA 4EZKA 2RFAA 3CQCB 5HKPA 2Y1LE 4KT6B 1JWFA 3G2WA 3QB2A 2H6GA 1FPPA 1N11A 5T3RA 4AJWA 1HS6A 1E8WA 5KNGA 4WWOA 4BETA 1X5BA 4RG6A 1Y6IA 1HU3A 3CR3A 1SZAA 3P1UA 2HE0A 2YHEA 3WG7E 1Z3YA 3BUAA 4GMJA 2KCKA 3J5PA 3LS8A 4GMRA 3RKVA 4I1OB 5CRVA 3UI2A 2WXHA 2XQ0A 3CEQA 4XZ4A 4AVXA 5G05C 2J07A 1RZ4A 4U0ZA 3ZEFA 3FHEA 2IOLA 4B0ZA 4HI8A 3ABLE 3SGHA 3Q78A 4JHJA 3PZDA 1BPOA 1H2UA 4QFVA 4U0SA 4HQDA 3I4GA 4BT8A 2J09A 5ENSD 2ETBA 4Y6WA 4GTMA 1SA5A 1XGWA 4MKTA 4DI4A 3SHFA 2VGEA 4U96D 3ZVVA 4QQIA 1HE8A 4Y6CA 3FU5A 2DBAA 3SY2A 4PS3A 4ME2A 3N71A 3UT8A 3RSEG 3V2OA 3D9PA 2QY7A 3JUEA 2H6HA 4EZJA 3Q75A 5AIJA 2V4LA 3B95A 3JYSA 2WXIA 3DEOA 4Z68A 2WXOA 4JA9A 2NC9A 2A5UA 5J08A 4AV7A 4OAVB 5FZQA 3NOGD 1DCEA 3FUNA 4N3AA 2IF4A 4CDNA 4XI0A 1N54A 2M63A 3QNKA 3E30A 4BFRA 5G04C 4WWNA 2V4HC 3PZ1A 3PREA 1FVHA 4KXKB 4G1TA 3TWTA 4DUIA 4GTVA 2UY1A 4N3CA 5ENOD 1ELRA 3HVEB 4AIFA 3FUFA 4K0RA 4HORA 3ZNGA 2OVBA 1HG2A 5AN8A 1Q2ZA 3PUJA 4K5BA 4FHJA 4JC8A 3RRMB 2R59A 3DSTA 3HHMA 1JCRA 1OWMA 2L0IA 4B8AA 5HI7A 2L0TB 4RSYA 4K5CA 2XEHA 3TWSA 1IHBA 1NFIE 3EHNA 4DX6D 4L23A 3NAWA 2KATA 2XGMA 4UWKA 4WAFA 1U3DA 4FP7A 4UQZA 2XZDG 2I2OA 1SA4A 1JWGA 1KT0A 4EZLA 3FEYA 4U63A 1MZCA 3UPVA 2XRZA 4GA0A 4F6RD 3LVQE 5M72A 4WNGA 4M3OA 2Y4UA 2AW6A 3MV3B 5EILA 2BTDA 5FQ6A 3D9OA 1SZ9A 3IV0A 3EIQC 4JL0A 5FQ8A 2DWZA 3MV2B 4UUCA 4D10C 1DC2A 3KEZA 1DVPA 2GRLA 4J7WA 1Z6TA 2H6IA 5BXUA 1O1SA 3IHYA 4ILIA 5D66A 1H19A 1OWLA 3FU0A 2HYZA 4C9BB 2VYIA 3UM0A 2L6JA 5ENNA 5CECB 4XX5A 3ML9A 2AXZA 3T8MA 2NSZA 3E4BA 1UJJA 4E85A 3UX4A 3NZSA 3DEPA 1QYMA 2XS8A 4GA2A 1D8DA 3FUEA 3RK6A 5BNWA 5H7PA 3QKYA 3BG1B 2LXMA 3JUIA 4Q96A 3DBSA 2FO7A 3VLFA 3F6QA 3B7UX 3ZUVB 2AXVA 4DJAA 4PUCA 5EYLA 3ZXSA 1D8EA 1IKND 3DPYA 2CHZA 3G2TA 2NYJA 5EYPF 4I2WA 3CHSA 4GTPA 4G24A 3CV0A 2J8SD 1TNOA 1X81A 2WXFA 4JEHA 5ENTD 4CT0A 1KZPA 3PZ4A 4LNBA 3AU4A 5G2NA 3ONKA 2B0OE 1MQSA 2QYJA 4ILHB 5G05J 3C5RA 3JCKC 1B89A 4FLBA 3EU5A 1NL4A 3PS6A 3Q4AB 3SO8A 3ZPJA 4GTRA 5AYWD 4A1SA 5KJKA 1S64A 2UWJG 3SZ7A 2KXPC 3ZHEB 3R7RA 4M7CA 4UWLA 4L1BA 3CHQA 2KCLA 5JHAA 3ULQA 4TRQA 3JQ1A 3NF1A 2J4DA 2WPVA 2AJAA 1KT1A 1UN9A 3AU5A 4C0MA 4L7TA 1E7UA 5IY5E 3QC1A 4ANXA 3ULEG 2XGSA 5ENQD 2DYSE 3SI5A 1NP7A 2WXGA 2IFUA 2JABA 1FVFA 3BEEA 2CG3A 3ABME 3R9AB 1WDYA 3I5PA 1W3BA 3FTUA 4N39A 3UXGA 3S7DA 3CHMA 3CVPA 4UI9K 5G04J 3E34A 1U3CA 3LXUX 2RFMA 1IXVA 1S70B 2WMOA 1PY1A 4LEUA 4LNGA 4LERA 2KCVA 4DX1A 3ISMC 3T5VA 3QARA 2P9UG 3HVEA 4JXTA 3KAEA 3WXXA 2WXQA 1TJFA 3TG4A 4B8CB 2DZNA 5FINA 1QBQA 1HO8A 3T9KA 3LCAA 3ENEA 3B7SA 4BT9A 3D9KA 1H2VC 4J8SA 3ZYQA 3JXIA 3SBTB 4N2QA 3RRNB 3TXNA 4YNDA 4HFGA 3S2AA 1OCZE 3FH8A 2E0IA 3VLEA 3ZFWA 5ANLA 3C3QA 2XPIA 2WXRA 4DLQA 1NZNA 4GAAA 4HOSA 1SVXA 4H7XA 4YDEA 3U3WA 1LD8A 3ZW3A 3CLJA 4B93B 2VSNA 3RJVA 5A6CA 2WB2A 3QJZA 4ILGA 1QQEA 3HIZA 4B89A 5KWDA 3L54A 1V55E 3CVQA 3DXKG 2F0YA 2P9SG 4CCAA 3JXJA 3UM3A 2GRQB 4U07A 3TAXA 4ZFHA 2WXKA 4N3BA 5ARFA 3T8KA 4KVOA 2EQXA 2GRPB 3AG3E 4K5AB 3R7QA 5ENPD 3V2XA 2ZGDA 1UW4B 3EUVA 2R5SA 3UINC 4O60A 2F8YA 3FTWA 4PH4B 2BEDA 3FTXA 5G55A 3SFXA 3TWUA 5LFAA 3ABKE 1K8KG 1IHGA 4MRUA 2J9QA 3NOCD 2H6FA 3HRAA 1INZA 2XZTG 3L08A 3FUHA 4ACKA 3RRUA 4U95D 4G26A 2RD0A 3GZ2A 1HZ4A 3APCA 4NACA 3FUKA 4O1PA 4U7EB 1HH8A 2X6IA 2KBXA 4CGVA 5JJ6A 2PQNA 4JHKA 1H0AA 2VJ8A 3CSTA 3E37A 4J0UA 3P2BA 3BU8A 4LCTA 2ZISA 4AEZC 3ZU7B 3CGHA 3OAWA 3LEWA 3AS4A 3LDZA 4YVOA 3ZKJA 4G2VA 2R03A 1AWCB 3EDTB 1OWNA 2PZIA 3D9IA 3CVVA 3FU3A 5AQBA
chains in the Genus database with same CATH topology
1IQUA 3T5XA 2XGMA 4IRUA 4UWKA 2FBNA 4WAFA 3SD5A 1U3DA 4FP7A 4KVMA 4RVBA 3EJNA 3IHVA 3MCXA 4UQZA 2I2OA 3APFA 3CK9A 4XIFA 4BX9A 1JWGA 1KT0A 1Z3XA 3SNXA 4EZLA 2P58C 3FEYA 3FDHA 4U63A 1EYHA 3D9JA 4GZDA 3UPVA 4J8DA 3ML8A 4G25A 2XRZA 4PDXA 1H6KA 3RO2A 2YINA 3I4RB 3PDNA 4GA0A 3LVQE 4DLOA 3TXMA 2Y4TA 4L2YA 4WNGA 5E76A 5AENA 4M3OA 5M72A 4GYWA 4GA1A 3FFLA 2Y4UA 1UN8A 3PEUB 4BSXA 5CCMA 4JW1A 3ZHEA 1P5QA 4F3VA 1PC2A 2AW6A 3B13A 4A55A 1VDYA 3MV3B 4H7YA 1KLXA 2BTDA 5FQ6A 1YA0A 5KJMA 1E90A 2WM9A 4EPZA 3D9OA 2Y3AA 1SZ9A 2YNQA 4JPSA 3FEXA 1E96B 3FH7A 2IOSA 4G11A 4GYYA 4IN3B 4JZYA 5ARGA 2LO6A 3IV0A 3LPZA 4Q94A 3EIQC 4V3IA 3U66A 1JPLA 4JL0A 4KYOB 5FQ8A 2FULA 3MV2B 4D10C 3Q47B 4EBAA 2XCCA 1DVPA 3KEZA 1L5JA 1OWPA 4UWHA 5C1DA 2GRLA 4WNDA 4CRWA 1Z6TA 3FP3A 3MX3A 1Y8MA 4FADA 3IHYA 4ILIA 3FTSA 1OUVA 1WM5A 1H19A 3CK7A 1OWLA 3IEGA 3FU0A 4NURA 2HYZA 4C9BB 4I6GA 2VYIA 3CKBA 4U04A 2CHXA 4BWRA 1JUQA 2L6JA 5ENNA 2XHEA 3CVXA 4XX5A 3U4TA 3LY8A 4GCNA 4GPKA 2BUGA 5LOZA 3ML9A 3O4ZA 2PM7A 2L9BA 2AXZA 2JLBA 3T8MA 4WUYA 5FQ7A 3GZSA 2NSZA 3E4BA 3PNLB 1UG3A 3ASGA 1UJJA 3Q49B 4I9CA 2VGYA 4XKBA 4E85A 3UX4A 4ANVA 3NZSA 5FZRA 4GZ5A 3D9MA 3UUXA 2MRIA 4U8HA 3ASFA 1OWOA 2LSUA 3B7RL 4GA2A 3CVUA 5BUZA 3OXLA 3FUEA 4P29A 2GRMA 3CSFA 3KD7A 2KM4A 5BV1A 3RK6A 4Q69A 5BNWA 4L23A 1LF8A 4AXHA 3TJPA 3QKYA 3BG1B 3JUIA 3LVRE 3MJWA 3QWWA 5LX8A 4Q96A 3GYZA 3DBSA 3JQ0A 2UY1B 1IQRA 2FO7A 3OTNA 3D3MA 3VLFA 3S7BA 2MOWA 4JA7A 3QOUA 4AY5A 3FULA 3MA5A 5EX3A 3PUKA 3B7UX 2OVFA 4TUUA 2AXVA 1HXIA 4UQYA 4DJAA 4PUCA 4HXIA 3ZXSA 4WNFA 2I1JA 2OV8A 4PS7A 1NA3A 2CHZA 4GZ6A 3RIBA 4XI9A 3G2TA 3SFZA 3ZN3A 3S7JA 3GZ1A 1N52A 4I2WA 4F7AA 3D9NA 4FJZA 3FWVA 4HOTA 3CHSA 5A23A 1QZ2A 4G24A 3CV0A 4FU3A 3ASDA 3LJ3A 4JEUA 4CDRA 3PRZA 2VTBA 2WXFA 4KZCA 2PL2A 4JEHA 3CKCA 4LUNU 5FZSA 3U9WA 4CT0A 4FULA 1HX8A 4GYOA 4ATGA 4J8FA 1EF1C 4BTAA 4I17A 2C2LA 5FQ4A 1WAO1 4GB9A 4I9EA 4XKCA 1ELWA 2CHWA 3AU4A 3ONKA 3PE3A 5G2NA 4ANWA 4I43A 1MQSA 4ILHB 5G05J 2J49A 5LP0A 1UJKA 2IU1A 2VGXA 2I9CA 3ZIMA 3JCKC 4HLEA 3CIAA 3ZYLA 4IULA 2XPYA 2XRYA 3O48A 4AM9A 1WY6A 1B89A 5BT1A 5KJNA 3MKQA 3CVYA 2PM6A 4FLBA 2V0PA 3Q5MA 4K03A 2KZTA 2XEVA 3PS6A 3Q4AB 1FCHA 3MZLB 2DIWA 4U0UA 3ZPJA 4IYPA 4CGWA 3CHRA 3FUDA 5AYWD 3HDXA 3MGBA 4A1SA 1NA0A 5KJKA 5DIZA 3TL5A 3QK0A 5T4YA 2WXJA 5KJLA 2UWJG 4NQ0A 3SZ7A 3ZHEB 2V5FA 2WXNA 2ILRA 3R7RA 5CCLA 1XNFA 3PE4A 3QWVA 3QDNA 4UWLA 4L1BA 1HG5A 2XGOA 3CHQA 3QAQA 2KCLA 4F1SA 3FUJA 5JHAA 3LKUA 2J4BA 3ULQA 4TRQA 4BTBA 3G2UA 3GW4A 3JQ1A 4A3VA 4DK5A 2WXPA 4UQXA 2FI7A 3HYMB 3IKOB 3SBSA 4E6HA 3NF1A 2J4DA 2X6HA 2WPVA 4EQFA 2E2EA 1KT1A 1UN9A 2J08A 3AU5A 4GMLA 4HS2A 4OVVA 4C0MA 4L7TA 3K9IA 4GZ3A 1E7UA 2MHKA 3I3NA 3ZYKA 4ANUA 3ESKA 5FWQA 5EX0A 3QC1A 4ANXA 3L13A 2Q7FA 2XGSA 4UI9J 3FU6A 5JHBA 3PEVB 2WMNA 5J90A 3VTYA 3AS8A 4HOUA 4JVSA 1EDUA 5FT9A 3RO3A 3SI5A 3APDA 1NP7A 2WXGA 2IFUA 3G2SA 4G23A 4KZ0A 2NXPA 2XPZA 2X6KA 2LAIA 3BEEA 1FVFA 1DNPA 2CG3A 3NQPA 3UT4A 2GW1A 4NRHB 4FJYA 3R9AB 2ONDA 2R17C 2HO1A 3L16A 4I6JA 2X3MA 3I5PA 4FA6A 3CVLA 4APFA 2VQ2A 1W3BA 2HM8A 3FTUA 4L2LA 4MS6A 4UWFA 3UMVA 5EKQD 4AOFA 4EZKA 3LY7A 3ZRHA 5D0OD 4YVQC 4WNEA 4N39A 3C98A 4A3TA 3S7DA 4ABNA 3CHMA 3CQCB 3G2VA 3CVPA 4UI9K 5G04J 5DBKA 3RU0A 1U3CA 3LXUX 3CK8A 4FHKA 4KT6B 1JWFA 3G2WA 3QB2A 5LCWJ 4GU5A 2WMOA 2X6JA 5T3RA 1GW6A 2CG2A 4AJWA 1PY1A 2IONA 4LEUA 1HS6A 3ASHA 2KCVA 4J6IA 4LERA 4LRZA 1E8WA 4WWOA 3T5VA 3QARA 1X5BA 2AXUA 1HF8A 4CT4A 2X6FA 3HVEA 4JXTA 1Y6IA 4RG6A 1HU3A 4FLHA 2I6HA 1SZAA 3CR3A 1H2TC 3KAEA 2WXQA 4I6EA 3WXXA 3P1UA 2YHEA 4EBAG 3UQ3A 1TJFA 3TG4A 4B8CB 2KC7A 1Z3YA 1TEZA 4GMJA 1HO8A 1E7VA 2KCKA 3LCAA 2YHCA 3LS8A 4CEMA 1PAQA 3RKVA 2C0LA 4I1OB 2LSVA 1TJCA 3LYAA 2VTBB 4WWPA 3CHOA 1A17A 3ENEA 4MLPA 2WQ6A 3ZGQA 3B7SA 4PS8A 2WXHA 4C0EA 4BT9A 2XQ0A 3D9KA 1H2VC 4J8SA 3CEQA 4XZ4A 2VSYA 3ZYQA 3Q15A 4AVXA 3SBTB 4N2QA 3RRNB 3TXNA 5G05C 5HQ8A 2J07A 4YNDA 2WQ7A 4HFGA 3S2AA 1IYGA 4U0ZA 2VGXB 1HFAA 3ZEFA 3EHMA 3FHEA 3FH8A 2IOLA 4B0ZA 2E0IA 3L17A 4BY6A 3VLEA 4I1MA 3ZFWA 4KBQA 5ANLA 2XPIA 2WXRA 4DLQA 1NZNA 4GAAA 3SGHA 2AWIA 3MKQB 3FH5A 4JHJA 3PH0C 3U64A 3PZDA 2KZTB 2WQHA 5T8IA 4HOSA 3DPDA 4H7XA 1BPOA 4JHRA 1H2UA 2C0MA 4QFVA 4U0SA 3QWPA 3U3WA 3D9LA 3I4GA 3MYVA 4AY6A 3ZW3A 4BT8A 2J09A 3OXGA 3CLJA 5A6CA 2VSNA 4Y6WA 3RJVA 2WB2A 3QJZA 4B94A 5JJ7A 1XGWA 4KMOA 4MKTA 4GZCA 4DI4A 3SHFA 1S0PA 3FTZA 3BG0B 4ILGA 1QQEA 3MKRA 3HIZA 4HOQA 1E8ZA 4B89A 2FEZA 4XE0A 5ANRA 2HR2A 3ZVVA 4OYSA 3L54A 3PNTB 4OVUA 1HE8A 4Y6CA 1ZU2A 3CVQA 5CMYA 3FU5A 2DBAA 4CCAA 3SF4A 2IJGX 4PS3A 4N2SA 4U07A 4ME2A 3N71A 3UT8A 3TAXA 2AVPA 2WXKA 3D9PA 2QY7A 4N3BA 4O6FA 5FTPA 5ARFA 5AJDA 4URKA 4DPRA 2LNIA 3FUMA 2GGFA 2VSOE 4KVOA 5EDSA 2EQXA 2V8SE 3R7QA 4EZJA 2DCPA 5AIJA 4I1AA 5CHEE 3KS2A 5BPPA 2V4LA 3FTYA 3FUIA 1UW4B 2X38A 3LY9A 4UI9C 4W9RA 2WXMA 4CDMA 2R5SA 3JYSA 2WXIA 5C2YA 2A4ZA 4F53A 3FTWA 4PH4B 2WXOA 4JA9A 2NC9A 3FY4A 3L22A 2A5UA 2CFUA 5J08A 4RG9A 4AV7A 2XCBA 3FTXA 5G55A 2RG8A 4I2ZA 5FZQA 3FUNA 4BX8A 4N3AA 2IF4A 4CDNA 5LFAA 4XI0A 2BF0X 5KCMA 1N54A 2M63A 3CQGB 1QNFA 3QNKA 5AJLA 4BFRA 1IHGA 3S7FA 3AS5A 4FC8A 4WWNA 5G04C 4MRUA 2J9QA 5LCWC 2IQCA 3B7TA 5A7DB 4EECA 2WVIA 3ESLA 1INZA 3FTVA 3L08A 3ZYMA 3PREA 1FVHA 5BV0A 3EIJA 3L6AA 4KXKB 5E75A 3FUHA 4ACKA 4G1TA 3RRUA 4G26A 5FJYA 2RD0A 3GZ2A 1HZ4A 4ACLA 4GCOA 1SQMA 3APCA 2UY1A 4N3CA 4NACA 3FUKA 3PVLA 2LAHA 1ELRA 3VTXA 3HVEB 4AIFA 1HH8A 5CMWA 2VSXE 2X6IA 3FUFA 4K0RA 3VLDA 4CGVA 5JJ6A 2PQNA 4HORA 4JHKA 3CVWA 5D0QD 1H0AA 3NZUA 2OVBA 2VJ8A 3CSTA 1HG2A 4J0UA 2WXLA 2QFCA 3P2BA 3MEKA 4R7LA 1E8XA 3TG5A 4LCTA 1EPUA 4TV3A 4AEZC 3CGHA 3OAWA 3LEWA 3TGOA 3UT7A 5JJTA 3PUJA 4JC8A 4FHJA 3URZA 3RRMB 2R59A 2PQRA 3AS4A 3HHMA 3LDZA 2OOEA 4N5CA 1ZBPA 2ZU6B 3CHPA 4YVOA 5BW8C 4G2VA 1OWMA 2JEKA 1E8YA 3CVNA 3IBEA 3OXFA 4APOA 2L0IA 4DI3A 4J8EA 4B8AA 5HI7A 2L0TB 2FF4A 4RSYA 1MHQA 4UWGA 1ELKA 3EDTB 4AP2A 1OWNA 3ONLA 2CFZA 2I1KA 2PZIA 2YQ8A 3D9IA 3CVVA 3FU3A 3EHNA 4A1GA 4HVBA 2KATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNL B;  1UN9 A;  4LRZ A;  1UN8 A;  2BTD A;  3CR3 A; 
#chains in the Genus database with same CATH topology
 2FBN A;  4KVM A;  4RVB A;  3IHV A;  3MCX A;  3PZ3 A;  3APF A;  1BI8 B;  4BX9 A;  1EYH A;  3D9J A;  4J8D A;  1TN8 A;  4G25 A;  4PDX A;  4YDO A;  3RO2 A;  3PDN A;  4TUM A;  1TYQ G;  4DLO A;  2Y4T A;  1UN8 A;  3PEU B;  4BSX A;  3ZHE A;  3Q7F A;  1PC2 A;  4A55 A;  2OEW A;  3RAU A;  1KLX A;  5KJM A;  2WM9 A;  3AG4 E;  1E96 B;  5JMN D;  4G11 A;  1MJ0 A;  1TN6 A;  4GYY A;  2LO6 A;  4Q94 A;  4V3I A;  3U66 A;  2FUL A;  3Q47 B;  4EBA A;  2XCC A;  1OWP A;  4DX7 D;  3FTS A;  1WM5 A;  5EIB E;  3UIP C;  4I6G A;  2CHX A;  1JCS A;  3LY8 A;  4GCN A;  2BUG A;  3HXE A;  3O4Z A;  5LOZ A;  1K1A A;  1TNY A;  3PNL B;  1UG3 A;  5FZR A;  2MRI A;  3CVU A;  5CBN A;  4BER A;  3UIO C;  5BV1 A;  3KD7 A;  4OAU C;  1S63 A;  3W9F A;  3LVR E;  3MJW A;  5B3S E;  5LX8 A;  3C3O A;  3JQ0 A;  3OTN A;  1IQR A;  3S7B A;  2MOW A;  5CBO A;  4HNA D;  5EX3 A;  1HXI A;  4UQY A;  4HXI A;  4WNF A;  3DWL G;  1NA3 A;  3RIB A;  3GZ1 A;  2BKK B;  5A23 A;  3PZ2 A;  1QZ2 A;  2MYO A;  3ASO E;  3LJ3 A;  4KZC A;  2PL2 A;  5FZS A;  4J8F A;  2P9L G;  2R02 A;  4I17 A;  5FQ4 A;  1H6P A;  2EIL E;  2XS1 A;  3BQO A;  3PE3 A;  2DVW A;  3DSU A;  1UJK A;  3ZIM A;  4HLE A;  3CIA A;  4AM9 A;  1WY6 A;  3CVY A;  2V0P A;  3E32 A;  2Y0B G;  2XEV A;  4U0U A;  5AQ7 A;  3HDX A;  3MGB A;  4HRL A;  3TL5 A;  5T4Y A;  2WXJ A;  2WXN A;  1XNF A;  4RLY A;  2F8X K;  4MBG A;  2XGO A;  2LUH A;  3FUJ A;  2J4B A;  1H6O A;  4UQX A;  3IKO B;  4X8Q A;  2E2E A;  1O1R A;  2J08 A;  4GML A;  4HS2 A;  3K9I A;  4GZ3 A;  4HBD A;  2GRN B;  4ANU A;  1AP7 A;  3ESK A;  2WMN A;  5J90 A;  4JVS A;  5FT9 A;  3G2S A;  1K1B A;  2XPZ A;  3CVL A;  2VQ2 A;  3UMV A;  4MS6 A;  3LY7 A;  4YVQ C;  4WNE A;  4A3T A;  3G2V A;  3RU0 A;  5DBK A;  3TWR A;  3CK8 A;  4NIK A;  4FHK A;  4GU5 A;  2V5Q C;  2EIK E;  2X6J A;  3Q7A A;  4J6I A;  4LRZ A;  3J5Q B;  2AXU A;  3DSX A;  4CT4 A;  2X6F A;  3EU9 A;  2I6H A;  4RQI A;  3UM1 A;  3SQV A;  2LXL A;  1MX4 A;  3E33 A;  2KC7 A;  1TEZ A;  1N0Q A;  1E7V A;  2YHC A;  1PAQ A;  5AAO A;  2VTB B;  4WWP A;  3CHO A;  1A17 A;  2WQ6 A;  2R05 A;  3Q15 A;  1IYG A;  3L17 A;  4I1M A;  4KBQ A;  3FH5 A;  2GRO B;  3PH0 C;  4YDW A;  2KZT B;  5T8I A;  3U64 A;  2OCC E;  4JHR A;  3Q73 A;  3QWP A;  3D9L A;  3MYV A;  5FIO A;  2P2C P;  4DX5 D;  3OXG A;  5JJ7 A;  3BG0 B;  4CYM D;  4HOQ A;  1E8Z A;  2FEZ A;  4XE0 A;  5ANR A;  1N4Q A;  1OT8 A;  3SF4 A;  2IJG X;  4GTT A;  2AVP A;  1TN7 A;  4URK A;  2LNI A;  2GGF A;  2GRR B;  2V8S E;  3KEA A;  2DCP A;  4I1A A;  5CHE E;  3KS2 A;  3FTY A;  3FUI A;  2X38 A;  1NI1 A;  3LY9 A;  5C2Y A;  4JB8 P;  2A4Z A;  2P9P G;  4F53 A;  1KPS B;  3FY4 A;  4RG9 A;  3UKU G;  2RG8 A;  4I2Z A;  4BSZ B;  2BF0 X;  5KCM A;  1QNF A;  3AS5 A;  4FC8 A;  5B1A E;  5LCW C;  3B7T A;  4TXQ A;  2WVI A;  3ZYM A;  3EIJ A;  3L6A A;  5E75 A;  5EN5 D;  4ACL A;  4GCO A;  1SQM A;  2LAH A;  3VTX A;  5CMW A;  2VSX E;  1N4R A;  1A5E A;  5D0Q D;  2RKK A;  3MEK A;  4R7L A;  4LSZ E;  4TV3 A;  4GTS A;  3TGO A;  3UT7 A;  3TWW A;  2PQR A;  4HB5 A;  4N5C A;  1ZBP A;  3CHP A;  2JEK A;  3IBE A;  3CVN A;  4APO A;  4J8E A;  4L9P A;  4UWG A;  1ELK A;  4AP2 A;  3ONL A;  2CFZ A;  4N5Q A;  4GTQ A;  1N4S A;  5JA4 D;  4IRU A;  3SD5 A;  2ZGG A;  3X2Q E;  3CK9 A;  4XIF A;  1Z3X A;  4GZD A;  3ML8 A;  2ZXW E;  1H6K A;  2YIN A;  3I4R B;  3TWX A;  3C3R A;  3TXM A;  5E76 A;  5AEN A;  4GYW A;  3FFL A;  3HXF A;  4JW1 A;  5CCM A;  1BI7 B;  4H7Y A;  1YA0 A;  5ITZ F;  2EIJ E;  4U8V D;  1E90 A;  4JPS A;  2YNQ A;  3D9H A;  4JD2 G;  3FH7 A;  2IOS A;  4JZY A;  5ENR D;  3HXB A;  5ARG A;  3LPZ A;  5D2M C;  1N4P A;  1L5J A;  4UWH A;  4WND A;  4CRW A;  3MX3 A;  4FAD A;  2B6C A;  3EHR A;  1OUV A;  3CK7 A;  3IEG A;  2DYR E;  5CEA A;  3CKB A;  4U04 A;  4GTO A;  3CVX A;  4GPK A;  4ATZ D;  2L9B A;  5FQ7 A;  3GZS A;  3Q49 B;  4XKB A;  5BXO A;  3UUX A;  4U8H A;  4TXR A;  1OWO A;  1TNB A;  3OXL A;  5AQA A;  2QC9 A;  4P29 A;  3UKR G;  2KM4 A;  4Q69 A;  4AXH A;  3D3M A;  1O1T A;  4AY5 A;  3FUL A;  3PUK A;  2OVF A;  4TUU A;  1YYH A;  4DX2 A;  2OV8 A;  4PS7 A;  4GZ6 A;  2EIN E;  3ZN3 A;  1N52 A;  4F7A A;  1DCQ A;  4HOT A;  1Z5S C;  2VTB A;  1FT1 A;  2DZO A;  3CKC A;  4BEP A;  4GYO A;  4ATG A;  1EF1 C;  2ZIR A;  2C2L A;  3DXM G;  4GB9 A;  4XKC A;  1ELW A;  4ANW A;  4I43 A;  2J49 A;  3ULY A;  2IU1 A;  1RW2 A;  5KNH D;  3ZYL A;  2XRY A;  3O48 A;  4HRN A;  3NBN B;  5BT1 A;  2PM6 A;  2KZT A;  4CGW A;  1FCH A;  2DIW A;  4IYP A;  3CHR A;  3FUD A;  1BLX B;  1NA0 A;  2OEV A;  1TR4 A;  4NQ0 A;  2V5F A;  1V54 E;  1FT2 A;  3PE4 A;  3QWV A;  1HG5 A;  3QAQ A;  3Q9N C;  4F1S A;  4BTB A;  3GW4 A;  4A3V A;  1N94 A;  4DK5 A;  2WXP A;  1YCS B;  4E6H A;  3SBS A;  4EQF A;  2X6H A;  3AAA C;  4OVV A;  3UM2 A;  3Q9U C;  4O1O A;  2MHK A;  3ZYK A;  4C48 B;  5FWQ A;  3L13 A;  2Q7F A;  3FU6 A;  3VTY A;  3AS8 A;  4HOU A;  3RO3 A;  1EDU A;  3APD A;  4G23 A;  4KZ0 A;  4LG6 A;  3UT4 A;  3NQP A;  2GW1 A;  4J8Y A;  4NRH B;  4FJY A;  2OND A;  2R17 C;  3AG2 E;  2X3M A;  1OCR E;  4FA6 A;  2HM8 A;  4L2L A;  1BU9 A;  4UWF A;  5EKQ D;  3ZRH A;  5D0O D;  2IO2 C;  3C98 A;  4ABN A;  5LCW J;  2EIM E;  1WG0 A;  1TNU A;  1GW6 A;  2CG2 A;  2ION A;  3ASH A;  5B1B E;  1HF8 A;  4FLH A;  4I6E A;  1H2T C;  4G8L A;  4EBA G;  3UQ3 A;  2PNN A;  4CEM A;  2C0L A;  2LSV A;  1TJC A;  3LYA A;  4MLP A;  1O5M A;  3ZGQ A;  4C0E A;  4PS8 A;  2VSY A;  2R2L A;  5HQ8 A;  2WQ7 A;  1SW6 A;  2VGX B;  1HFA A;  3EHM A;  1G3N B;  2Y69 E;  4BY6 A;  2AWI A;  3MKQ B;  2WQH A;  3DPD A;  4DRX E;  1UOH A;  2C0M A;  1JCQ A;  4AY6 A;  4HRM B;  3DSS A;  4B94 A;  4KMO A;  4GZC A;  1S0P A;  3FTZ A;  3MKR A;  2QZA A;  2HR2 A;  4OYS A;  2L6B A;  3PNT B;  4OVU A;  1N95 A;  1ZU2 A;  5CMY A;  4U8Y D;  2XEN A;  4N2S A;  3HXD A;  5AAR A;  4LNU D;  5FTP A;  4O6F A;  5AJD A;  4DPR A;  3FUM A;  1OCO E;  2VSO E;  5EDS A;  1OXJ A;  5BPP A;  1LTX A;  4W9R A;  4UI9 C;  5CRU A;  2WXM A;  4CDM A;  1U2V G;  5AQ9 A;  2BKG A;  5KBA A;  3L22 A;  2CFU A;  3L9T A;  2XCB A;  3V31 A;  4BX8 A;  1K3Z D;  5HS0 A;  3HG0 D;  3W9G A;  3CQG B;  5AJL A;  3S7F A;  3SFY A;  2IQC A;  5A7D B;  4EEC A;  3ESL A;  3FTV A;  4TXP A;  5BV0 A;  5HRY A;  5FJY A;  4XEI G;  2P9K G;  1OCC E;  3PVL A;  4F1P A;  2QYU A;  3VLD A;  3CVW A;  3NZU A;  1OY3 D;  2WXL A;  2QFC A;  1MYO A;  1E8X A;  3TG5 A;  1EPU A;  5CER B;  3KSQ A;  2A5E A;  2IEJ A;  5JJT A;  3URZ A;  2OOE A;  2ZU6 B;  5BW8 C;  1E8Y A;  3OXF A;  4DI3 A;  2FF4 A;  1MHQ A;  2P9I G;  2I1K A;  2YQ8 A;  4A1G A;  4HVB A;  1IQU A;  3T5X A;  1BD8 A;  3EJN A;  3SNX A;  2P58 C;  3FDH A;  3B7B A;  4CZ2 D;  4L2Y A;  5EID A;  4GA1 A;  4EHM A;  3DSV A;  1P5Q A;  4F3V A;  3B13 A;  1VDY A;  3ASN E;  3LJN A;  4G8K A;  4EPZ A;  2Y3A A;  2F37 A;  3FEX A;  4IN3 B;  4ZHB A;  1JPL A;  4KYO B;  5C1D A;  3TWV A;  3C72 A;  3FP3 A;  1Y8M A;  1D9S A;  4NUR A;  3DRA A;  4BWR A;  1N0R A;  1YMP A;  1JUQ A;  2XHE A;  3U4T A;  2PM7 A;  2JLB A;  4WUY A;  3ASG A;  4I9C A;  2VGY A;  4ANV A;  4GZ5 A;  3D9M A;  3ASF A;  2LSU A;  3B7R L;  3EHQ A;  1LD7 A;  5BUZ A;  2GRM A;  3CSF A;  1LF8 A;  3AG1 E;  3TJP A;  3QWW A;  3GYZ A;  2UY1 B;  4JA7 A;  3QOU A;  3MA5 A;  4A63 B;  4BES A;  2I1J A;  3TWQ A;  4XI9 A;  3SFZ A;  3S7J A;  3KSL A;  2IO3 C;  3D9N A;  4FJZ A;  3FWV A;  1KZO A;  4FU3 A;  3ASD A;  4JEU A;  3UTM A;  3V30 A;  4CDR A;  3PRZ A;  4LUN U;  3U9W A;  4FUL A;  1HX8 A;  2ETA A;  4BTA A;  1WAO 1;  4I9E A;  2CHW A;  1N9A A;  5LP0 A;  2VGX A;  2I9C A;  5CED B;  4IUL A;  2XPY A;  2ETC A;  5KJN A;  3MKQ A;  3Q5M A;  4K03 A;  3MZL B;  3ZXP A;  1TNZ A;  1ZB1 A;  4YDY A;  2XEE A;  3IXE A;  3Q79 A;  5DIZ A;  3QK0 A;  5KJL A;  2ILR A;  5CCL A;  3QDN A;  3NB2 A;  3AJI A;  3LKU A;  2P9N G;  3L82 A;  3G2U A;  4HI9 A;  1MX6 A;  3R9M A;  2FI7 A;  3HYM B;  3V79 K;  4HLL A;  3DSW A;  3I3N A;  2FO1 E;  5EX0 A;  3HXC A;  4UI9 J;  5JHB A;  3PEV B;  1MX2 A;  4GPM A;  2NXP A;  2X6K A;  1DNP A;  2IY0 C;  2LAI A;  2HO1 A;  3L16 A;  4I6J A;  4APF A;  4AOF A;  4EZK A;  2RFA A;  3CQC B;  5HKP A;  2Y1L E;  4KT6 B;  1JWF A;  3G2W A;  3QB2 A;  2H6G A;  1FPP A;  1N11 A;  5T3R A;  4AJW A;  1HS6 A;  1E8W A;  5KNG A;  4WWO A;  4BET A;  1X5B A;  4RG6 A;  1Y6I A;  1HU3 A;  3CR3 A;  1SZA A;  3P1U A;  2HE0 A;  2YHE A;  3WG7 E;  1Z3Y A;  3BUA A;  4GMJ A;  2KCK A;  3J5P A;  3LS8 A;  4GMR A;  3RKV A;  4I1O B;  5CRV A;  3UI2 A;  2WXH A;  2XQ0 A;  3CEQ A;  4XZ4 A;  4AVX A;  5G05 C;  2J07 A;  1RZ4 A;  4U0Z A;  3ZEF A;  3FHE A;  2IOL A;  4B0Z A;  4HI8 A;  3ABL E;  3SGH A;  3Q78 A;  4JHJ A;  3PZD A;  1BPO A;  1H2U A;  4QFV A;  4U0S A;  4HQD A;  3I4G A;  4BT8 A;  2J09 A;  5ENS D;  2ETB A;  4Y6W A;  4GTM A;  1SA5 A;  1XGW A;  4MKT A;  4DI4 A;  3SHF A;  2VGE A;  4U96 D;  3ZVV A;  4QQI A;  1HE8 A;  4Y6C A;  3FU5 A;  2DBA A;  3SY2 A;  4PS3 A;  4ME2 A;  3N71 A;  3UT8 A;  3RSE G;  3V2O A;  3D9P A;  2QY7 A;  3JUE A;  2H6H A;  4EZJ A;  3Q75 A;  5AIJ A;  2V4L A;  3B95 A;  3JYS A;  2WXI A;  3DEO A;  4Z68 A;  2WXO A;  4JA9 A;  2NC9 A;  2A5U A;  5J08 A;  4AV7 A;  4OAV B;  5FZQ A;  3NOG D;  1DCE A;  3FUN A;  4N3A A;  2IF4 A;  4CDN A;  4XI0 A;  1N54 A;  2M63 A;  3QNK A;  3E30 A;  4BFR A;  5G04 C;  4WWN A;  2V4H C;  3PZ1 A;  3PRE A;  1FVH A;  4KXK B;  4G1T A;  3TWT A;  4DUI A;  4GTV A;  2UY1 A;  4N3C A;  5ENO D;  1ELR A;  3HVE B;  4AIF A;  3FUF A;  4K0R A;  4HOR A;  3ZNG A;  2OVB A;  1HG2 A;  5AN8 A;  1Q2Z A;  3PUJ A;  4K5B A;  4FHJ A;  4JC8 A;  3RRM B;  2R59 A;  3DST A;  3HHM A;  1JCR A;  1OWM A;  2L0I A;  4B8A A;  5HI7 A;  2L0T B;  4RSY A;  4K5C A;  2XEH A;  3TWS A;  1IHB A;  1NFI E;  3EHN A;  4DX6 D;  4L23 A;  3NAW A;  2KAT A;  2XGM A;  4UWK A;  4WAF A;  1U3D A;  4FP7 A;  4UQZ A;  2XZD G;  2I2O A;  1SA4 A;  1JWG A;  1KT0 A;  4EZL A;  3FEY A;  4U63 A;  1MZC A;  3UPV A;  2XRZ A;  4GA0 A;  4F6R D;  3LVQ E;  5M72 A;  4WNG A;  4M3O A;  2Y4U A;  2AW6 A;  3MV3 B;  5EIL A;  2BTD A;  5FQ6 A;  3D9O A;  1SZ9 A;  3IV0 A;  3EIQ C;  4JL0 A;  5FQ8 A;  2DWZ A;  3MV2 B;  4UUC A;  4D10 C;  1DC2 A;  3KEZ A;  1DVP A;  2GRL A;  4J7W A;  1Z6T A;  2H6I A;  5BXU A;  1O1S A;  3IHY A;  4ILI A;  5D66 A;  1H19 A;  1OWL A;  3FU0 A;  2HYZ A;  4C9B B;  2VYI A;  3UM0 A;  2L6J A;  5ENN A;  5CEC B;  4XX5 A;  3ML9 A;  2AXZ A;  3T8M A;  2NSZ A;  3E4B A;  1UJJ A;  4E85 A;  3UX4 A;  3NZS A;  3DEP A;  1QYM A;  2XS8 A;  4GA2 A;  1D8D A;  3FUE A;  3RK6 A;  5BNW A;  5H7P A;  3QKY A;  3BG1 B;  2LXM A;  3JUI A;  4Q96 A;  3DBS A;  2FO7 A;  3VLF A;  3F6Q A;  3B7U X;  3ZUV B;  2AXV A;  4DJA A;  4PUC A;  5EYL A;  3ZXS A;  1D8E A;  1IKN D;  3DPY A;  2CHZ A;  3G2T A;  2NYJ A;  5EYP F;  4I2W A;  3CHS A;  4GTP A;  4G24 A;  3CV0 A;  2J8S D;  1TNO A;  1X81 A;  2WXF A;  4JEH A;  5ENT D;  4CT0 A;  1KZP A;  3PZ4 A;  4LNB A;  3AU4 A;  5G2N A;  3ONK A;  2B0O E;  1MQS A;  2QYJ A;  4ILH B;  5G05 J;  3C5R A;  3JCK C;  1B89 A;  4FLB A;  3EU5 A;  1NL4 A;  3PS6 A;  3Q4A B;  3SO8 A;  3ZPJ A;  4GTR A;  5AYW D;  4A1S A;  5KJK A;  1S64 A;  2UWJ G;  3SZ7 A;  2KXP C;  3ZHE B;  3R7R A;  4M7C A;  4UWL A;  4L1B A;  3CHQ A;  2KCL A;  5JHA A;  3ULQ A;  4TRQ A;  3JQ1 A;  3NF1 A;  2J4D A;  2WPV A;  2AJA A;  1KT1 A;  1UN9 A;  3AU5 A;  4C0M A;  4L7T A;  1E7U A;  5IY5 E;  3QC1 A;  4ANX A;  3ULE G;  2XGS A;  5ENQ D;  2DYS E;  3SI5 A;  1NP7 A;  2WXG A;  2IFU A;  2JAB A;  1FVF A;  3BEE A;  2CG3 A;  3ABM E;  3R9A B;  1WDY A;  3I5P A;  1W3B A;  3FTU A;  4N39 A;  3UXG A;  3S7D A;  3CHM A;  3CVP A;  4UI9 K;  5G04 J;  3E34 A;  1U3C A;  3LXU X;  2RFM A;  1IXV A;  1S70 B;  2WMO A;  1PY1 A;  4LEU A;  4LNG A;  4LER A;  2KCV A;  4DX1 A;  3ISM C;  3T5V A;  3QAR A;  2P9U G;  3HVE A;  4JXT A;  3KAE A;  3WXX A;  2WXQ A;  1TJF A;  3TG4 A;  4B8C B;  2DZN A;  5FIN A;  1QBQ A;  1HO8 A;  3T9K A;  3LCA A;  3ENE A;  3B7S A;  4BT9 A;  3D9K A;  1H2V C;  4J8S A;  3ZYQ A;  3JXI A;  3SBT B;  4N2Q A;  3RRN B;  3TXN A;  4YND A;  4HFG A;  3S2A A;  1OCZ E;  3FH8 A;  2E0I A;  3VLE A;  3ZFW A;  5ANL A;  3C3Q A;  2XPI A;  2WXR A;  4DLQ A;  1NZN A;  4GAA A;  4HOS A;  1SVX A;  4H7X A;  4YDE A;  3U3W A;  1LD8 A;  3ZW3 A;  3CLJ A;  4B93 B;  2VSN A;  3RJV A;  5A6C A;  2WB2 A;  3QJZ A;  4ILG A;  1QQE A;  3HIZ A;  4B89 A;  5KWD A;  3L54 A;  1V55 E;  3CVQ A;  3DXK G;  2F0Y A;  2P9S G;  4CCA A;  3JXJ A;  3UM3 A;  2GRQ B;  4U07 A;  3TAX A;  4ZFH A;  2WXK A;  4N3B A;  5ARF A;  3T8K A;  4KVO A;  2EQX A;  2GRP B;  3AG3 E;  4K5A B;  3R7Q A;  5ENP D;  3V2X A;  2ZGD A;  1UW4 B;  3EUV A;  2R5S A;  3UIN C;  4O60 A;  2F8Y A;  3FTW A;  4PH4 B;  2BED A;  3FTX A;  5G55 A;  3SFX A;  3TWU A;  5LFA A;  3ABK E;  1K8K G;  1IHG A;  4MRU A;  2J9Q A;  3NOC D;  2H6F A;  3HRA A;  1INZ A;  2XZT G;  3L08 A;  3FUH A;  4ACK A;  3RRU A;  4U95 D;  4G26 A;  2RD0 A;  3GZ2 A;  1HZ4 A;  3APC A;  4NAC A;  3FUK A;  4O1P A;  4U7E B;  1HH8 A;  2X6I A;  2KBX A;  4CGV A;  5JJ6 A;  2PQN A;  4JHK A;  1H0A A;  2VJ8 A;  3CST A;  3E37 A;  4J0U A;  3P2B A;  3BU8 A;  4LCT A;  2ZIS A;  4AEZ C;  3ZU7 B;  3CGH A;  3OAW A;  3LEW A;  3AS4 A;  3LDZ A;  4YVO A;  3ZKJ A;  4G2V A;  2R03 A;  1AWC B;  3EDT B;  1OWN A;  2PZI A;  3D9I A;  3CVV A;  3FU3 A;  5AQB A; 
#chains in the Genus database with same CATH homology
 1IQU A;  3T5X A;  2XGM A;  4IRU A;  4UWK A;  2FBN A;  4WAF A;  3SD5 A;  1U3D A;  4FP7 A;  4KVM A;  4RVB A;  3EJN A;  3IHV A;  3MCX A;  4UQZ A;  2I2O A;  3APF A;  3CK9 A;  4XIF A;  4BX9 A;  1JWG A;  1KT0 A;  1Z3X A;  3SNX A;  4EZL A;  2P58 C;  3FEY A;  3FDH A;  4U63 A;  1EYH A;  3D9J A;  4GZD A;  3UPV A;  4J8D A;  3ML8 A;  4G25 A;  2XRZ A;  4PDX A;  1H6K A;  3RO2 A;  2YIN A;  3I4R B;  3PDN A;  4GA0 A;  3LVQ E;  4DLO A;  3TXM A;  2Y4T A;  4L2Y A;  4WNG A;  5E76 A;  5AEN A;  4M3O A;  5M72 A;  4GYW A;  4GA1 A;  3FFL A;  2Y4U A;  1UN8 A;  3PEU B;  4BSX A;  5CCM A;  4JW1 A;  3ZHE A;  1P5Q A;  4F3V A;  1PC2 A;  2AW6 A;  3B13 A;  4A55 A;  1VDY A;  3MV3 B;  4H7Y A;  1KLX A;  2BTD A;  5FQ6 A;  1YA0 A;  5KJM A;  1E90 A;  2WM9 A;  4EPZ A;  3D9O A;  2Y3A A;  1SZ9 A;  2YNQ A;  4JPS A;  3FEX A;  1E96 B;  3FH7 A;  2IOS A;  4G11 A;  4GYY A;  4IN3 B;  4JZY A;  5ARG A;  2LO6 A;  3IV0 A;  3LPZ A;  4Q94 A;  3EIQ C;  4V3I A;  3U66 A;  1JPL A;  4JL0 A;  4KYO B;  5FQ8 A;  2FUL A;  3MV2 B;  4D10 C;  3Q47 B;  4EBA A;  2XCC A;  1DVP A;  3KEZ A;  1L5J A;  1OWP A;  4UWH A;  5C1D A;  2GRL A;  4WND A;  4CRW A;  1Z6T A;  3FP3 A;  3MX3 A;  1Y8M A;  4FAD A;  3IHY A;  4ILI A;  3FTS A;  1OUV A;  1WM5 A;  1H19 A;  3CK7 A;  1OWL A;  3IEG A;  3FU0 A;  4NUR A;  2HYZ A;  4C9B B;  4I6G A;  2VYI A;  3CKB A;  4U04 A;  2CHX A;  4BWR A;  1JUQ A;  2L6J A;  5ENN A;  2XHE A;  3CVX A;  4XX5 A;  3U4T A;  3LY8 A;  4GCN A;  4GPK A;  2BUG A;  5LOZ A;  3ML9 A;  3O4Z A;  2PM7 A;  2L9B A;  2AXZ A;  2JLB A;  3T8M A;  4WUY A;  5FQ7 A;  3GZS A;  2NSZ A;  3E4B A;  3PNL B;  1UG3 A;  3ASG A;  1UJJ A;  3Q49 B;  4I9C A;  2VGY A;  4XKB A;  4E85 A;  3UX4 A;  4ANV A;  3NZS A;  5FZR A;  4GZ5 A;  3D9M A;  3UUX A;  2MRI A;  4U8H A;  3ASF A;  1OWO A;  2LSU A;  3B7R L;  4GA2 A;  3CVU A;  5BUZ A;  3OXL A;  3FUE A;  4P29 A;  2GRM A;  3CSF A;  3KD7 A;  2KM4 A;  5BV1 A;  3RK6 A;  4Q69 A;  5BNW A;  4L23 A;  1LF8 A;  4AXH A;  3TJP A;  3QKY A;  3BG1 B;  3JUI A;  3LVR E;  3MJW A;  3QWW A;  5LX8 A;  4Q96 A;  3GYZ A;  3DBS A;  3JQ0 A;  2UY1 B;  1IQR A;  2FO7 A;  3OTN A;  3D3M A;  3VLF A;  3S7B A;  2MOW A;  4JA7 A;  3QOU A;  4AY5 A;  3FUL A;  3MA5 A;  5EX3 A;  3PUK A;  3B7U X;  2OVF A;  4TUU A;  2AXV A;  1HXI A;  4UQY A;  4DJA A;  4PUC A;  4HXI A;  3ZXS A;  4WNF A;  2I1J A;  2OV8 A;  4PS7 A;  1NA3 A;  2CHZ A;  4GZ6 A;  3RIB A;  4XI9 A;  3G2T A;  3SFZ A;  3ZN3 A;  3S7J A;  3GZ1 A;  1N52 A;  4I2W A;  4F7A A;  3D9N A;  4FJZ A;  3FWV A;  4HOT A;  3CHS A;  5A23 A;  1QZ2 A;  4G24 A;  3CV0 A;  4FU3 A;  3ASD A;  3LJ3 A;  4JEU A;  4CDR A;  3PRZ A;  2VTB A;  2WXF A;  4KZC A;  2PL2 A;  4JEH A;  3CKC A;  4LUN U;  5FZS A;  3U9W A;  4CT0 A;  4FUL A;  1HX8 A;  4GYO A;  4ATG A;  4J8F A;  1EF1 C;  4BTA A;  4I17 A;  2C2L A;  5FQ4 A;  1WAO 1;  4GB9 A;  4I9E A;  4XKC A;  1ELW A;  2CHW A;  3AU4 A;  3ONK A;  3PE3 A;  5G2N A;  4ANW A;  4I43 A;  1MQS A;  4ILH B;  5G05 J;  2J49 A;  5LP0 A;  1UJK A;  2IU1 A;  2VGX A;  2I9C A;  3ZIM A;  3JCK C;  4HLE A;  3CIA A;  3ZYL A;  4IUL A;  2XPY A;  2XRY A;  3O48 A;  4AM9 A;  1WY6 A;  1B89 A;  5BT1 A;  5KJN A;  3MKQ A;  3CVY A;  2PM6 A;  4FLB A;  2V0P A;  3Q5M A;  4K03 A;  2KZT A;  2XEV A;  3PS6 A;  3Q4A B;  1FCH A;  3MZL B;  2DIW A;  4U0U A;  3ZPJ A;  4IYP A;  4CGW A;  3CHR A;  3FUD A;  5AYW D;  3HDX A;  3MGB A;  4A1S A;  1NA0 A;  5KJK A;  5DIZ A;  3TL5 A;  3QK0 A;  5T4Y A;  2WXJ A;  5KJL A;  2UWJ G;  4NQ0 A;  3SZ7 A;  3ZHE B;  2V5F A;  2WXN A;  2ILR A;  3R7R A;  5CCL A;  1XNF A;  3PE4 A;  3QWV A;  3QDN A;  4UWL A;  4L1B A;  1HG5 A;  2XGO A;  3CHQ A;  3QAQ A;  2KCL A;  4F1S A;  3FUJ A;  5JHA A;  3LKU A;  2J4B A;  3ULQ A;  4TRQ A;  4BTB A;  3G2U A;  3GW4 A;  3JQ1 A;  4A3V A;  4DK5 A;  2WXP A;  4UQX A;  2FI7 A;  3HYM B;  3IKO B;  3SBS A;  4E6H A;  3NF1 A;  2J4D A;  2X6H A;  2WPV A;  4EQF A;  2E2E A;  1KT1 A;  1UN9 A;  2J08 A;  3AU5 A;  4GML A;  4HS2 A;  4OVV A;  4C0M A;  4L7T A;  3K9I A;  4GZ3 A;  1E7U A;  2MHK A;  3I3N A;  3ZYK A;  4ANU A;  3ESK A;  5FWQ A;  5EX0 A;  3QC1 A;  4ANX A;  3L13 A;  2Q7F A;  2XGS A;  4UI9 J;  3FU6 A;  5JHB A;  3PEV B;  2WMN A;  5J90 A;  3VTY A;  3AS8 A;  4HOU A;  4JVS A;  1EDU A;  5FT9 A;  3RO3 A;  3SI5 A;  3APD A;  1NP7 A;  2WXG A;  2IFU A;  3G2S A;  4G23 A;  4KZ0 A;  2NXP A;  2XPZ A;  2X6K A;  2LAI A;  3BEE A;  1FVF A;  1DNP A;  2CG3 A;  3NQP A;  3UT4 A;  2GW1 A;  4NRH B;  4FJY A;  3R9A B;  2OND A;  2R17 C;  2HO1 A;  3L16 A;  4I6J A;  2X3M A;  3I5P A;  4FA6 A;  3CVL A;  4APF A;  2VQ2 A;  1W3B A;  2HM8 A;  3FTU A;  4L2L A;  4MS6 A;  4UWF A;  3UMV A;  5EKQ D;  4AOF A;  4EZK A;  3LY7 A;  3ZRH A;  5D0O D;  4YVQ C;  4WNE A;  4N39 A;  3C98 A;  4A3T A;  3S7D A;  4ABN A;  3CHM A;  3CQC B;  3G2V A;  3CVP A;  4UI9 K;  5G04 J;  5DBK A;  3RU0 A;  1U3C A;  3LXU X;  3CK8 A;  4FHK A;  4KT6 B;  1JWF A;  3G2W A;  3QB2 A;  5LCW J;  4GU5 A;  2WMO A;  2X6J A;  5T3R A;  1GW6 A;  2CG2 A;  4AJW A;  1PY1 A;  2ION A;  4LEU A;  1HS6 A;  3ASH A;  2KCV A;  4J6I A;  4LER A;  4LRZ A;  1E8W A;  4WWO A;  3T5V A;  3QAR A;  1X5B A;  2AXU A;  1HF8 A;  4CT4 A;  2X6F A;  3HVE A;  4JXT A;  1Y6I A;  4RG6 A;  1HU3 A;  4FLH A;  2I6H A;  1SZA A;  3CR3 A;  1H2T C;  3KAE A;  2WXQ A;  4I6E A;  3WXX A;  3P1U A;  2YHE A;  4EBA G;  3UQ3 A;  1TJF A;  3TG4 A;  4B8C B;  2KC7 A;  1Z3Y A;  1TEZ A;  4GMJ A;  1HO8 A;  1E7V A;  2KCK A;  3LCA A;  2YHC A;  3LS8 A;  4CEM A;  1PAQ A;  3RKV A;  2C0L A;  4I1O B;  2LSV A;  1TJC A;  3LYA A;  2VTB B;  4WWP A;  3CHO A;  1A17 A;  3ENE A;  4MLP A;  2WQ6 A;  3ZGQ A;  3B7S A;  4PS8 A;  2WXH A;  4C0E A;  4BT9 A;  2XQ0 A;  3D9K A;  1H2V C;  4J8S A;  3CEQ A;  4XZ4 A;  2VSY A;  3ZYQ A;  3Q15 A;  4AVX A;  3SBT B;  4N2Q A;  3RRN B;  3TXN A;  5G05 C;  5HQ8 A;  2J07 A;  4YND A;  2WQ7 A;  4HFG A;  3S2A A;  1IYG A;  4U0Z A;  2VGX B;  1HFA A;  3ZEF A;  3EHM A;  3FHE A;  3FH8 A;  2IOL A;  4B0Z A;  2E0I A;  3L17 A;  4BY6 A;  3VLE A;  4I1M A;  3ZFW A;  4KBQ A;  5ANL A;  2XPI A;  2WXR A;  4DLQ A;  1NZN A;  4GAA A;  3SGH A;  2AWI A;  3MKQ B;  3FH5 A;  4JHJ A;  3PH0 C;  3U64 A;  3PZD A;  2KZT B;  2WQH A;  5T8I A;  4HOS A;  3DPD A;  4H7X A;  1BPO A;  4JHR A;  1H2U A;  2C0M A;  4QFV A;  4U0S A;  3QWP A;  3U3W A;  3D9L A;  3I4G A;  3MYV A;  4AY6 A;  3ZW3 A;  4BT8 A;  2J09 A;  3OXG A;  3CLJ A;  5A6C A;  2VSN A;  4Y6W A;  3RJV A;  2WB2 A;  3QJZ A;  4B94 A;  5JJ7 A;  1XGW A;  4KMO A;  4MKT A;  4GZC A;  4DI4 A;  3SHF A;  1S0P A;  3FTZ A;  3BG0 B;  4ILG A;  1QQE A;  3MKR A;  3HIZ A;  4HOQ A;  1E8Z A;  4B89 A;  2FEZ A;  4XE0 A;  5ANR A;  2HR2 A;  3ZVV A;  4OYS A;  3L54 A;  3PNT B;  4OVU A;  1HE8 A;  4Y6C A;  1ZU2 A;  3CVQ A;  5CMY A;  3FU5 A;  2DBA A;  4CCA A;  3SF4 A;  2IJG X;  4PS3 A;  4N2S A;  4U07 A;  4ME2 A;  3N71 A;  3UT8 A;  3TAX A;  2AVP A;  2WXK A;  3D9P A;  2QY7 A;  4N3B A;  4O6F A;  5FTP A;  5ARF A;  5AJD A;  4URK A;  4DPR A;  2LNI A;  3FUM A;  2GGF A;  2VSO E;  4KVO A;  5EDS A;  2EQX A;  2V8S E;  3R7Q A;  4EZJ A;  2DCP A;  5AIJ A;  4I1A A;  5CHE E;  3KS2 A;  5BPP A;  2V4L A;  3FTY A;  3FUI A;  1UW4 B;  2X38 A;  3LY9 A;  4UI9 C;  4W9R A;  2WXM A;  4CDM A;  2R5S A;  3JYS A;  2WXI A;  5C2Y A;  2A4Z A;  4F53 A;  3FTW A;  4PH4 B;  2WXO A;  4JA9 A;  2NC9 A;  3FY4 A;  3L22 A;  2A5U A;  2CFU A;  5J08 A;  4RG9 A;  4AV7 A;  2XCB A;  3FTX A;  5G55 A;  2RG8 A;  4I2Z A;  5FZQ A;  3FUN A;  4BX8 A;  4N3A A;  2IF4 A;  4CDN A;  5LFA A;  4XI0 A;  2BF0 X;  5KCM A;  1N54 A;  2M63 A;  3CQG B;  1QNF A;  3QNK A;  5AJL A;  4BFR A;  1IHG A;  3S7F A;  3AS5 A;  4FC8 A;  4WWN A;  5G04 C;  4MRU A;  2J9Q A;  5LCW C;  2IQC A;  3B7T A;  5A7D B;  4EEC A;  2WVI A;  3ESL A;  1INZ A;  3FTV A;  3L08 A;  3ZYM A;  3PRE A;  1FVH A;  5BV0 A;  3EIJ A;  3L6A A;  4KXK B;  5E75 A;  3FUH A;  4ACK A;  4G1T A;  3RRU A;  4G26 A;  5FJY A;  2RD0 A;  3GZ2 A;  1HZ4 A;  4ACL A;  4GCO A;  1SQM A;  3APC A;  2UY1 A;  4N3C A;  4NAC A;  3FUK A;  3PVL A;  2LAH A;  1ELR A;  3VTX A;  3HVE B;  4AIF A;  1HH8 A;  5CMW A;  2VSX E;  2X6I A;  3FUF A;  4K0R A;  3VLD A;  4CGV A;  5JJ6 A;  2PQN A;  4HOR A;  4JHK A;  3CVW A;  5D0Q D;  1H0A A;  3NZU A;  2OVB A;  2VJ8 A;  3CST A;  1HG2 A;  4J0U A;  2WXL A;  2QFC A;  3P2B A;  3MEK A;  4R7L A;  1E8X A;  3TG5 A;  4LCT A;  1EPU A;  4TV3 A;  4AEZ C;  3CGH A;  3OAW A;  3LEW A;  3TGO A;  3UT7 A;  5JJT A;  3PUJ A;  4JC8 A;  4FHJ A;  3URZ A;  3RRM B;  2R59 A;  2PQR A;  3AS4 A;  3HHM A;  3LDZ A;  2OOE A;  4N5C A;  1ZBP A;  2ZU6 B;  3CHP A;  4YVO A;  5BW8 C;  4G2V A;  1OWM A;  2JEK A;  1E8Y A;  3CVN A;  3IBE A;  3OXF A;  4APO A;  2L0I A;  4DI3 A;  4J8E A;  4B8A A;  5HI7 A;  2L0T B;  2FF4 A;  4RSY A;  1MHQ A;  4UWG A;  1ELK A;  3EDT B;  4AP2 A;  1OWN A;  3ONL A;  2CFZ A;  2I1K A;  2PZI A;  2YQ8 A;  3D9I A;  3CVV A;  3FU3 A;  3EHN A;  4A1G A;  4HVB A;  2KAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...