2XCCA

Crystal structure of pcrh from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
133
structure length
133
Chain Sequence
LAMLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein binding
molecule keywords REGULATORY PROTEIN PCRH
total genus 56
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xccA00
2YQ8A 2UY1B 2UY1A 4NQ0A 3K9IA 5DBKA 4GPKA 1PC2A 4J0UA 5EKQD 5JJ7A 4AY6A 2Y4TA 3LPZA 3ZHEA 3ZHEB 5CHEE 3S7JA 2VYIA 3CKBA 3ZFWA 4WNGA 3RIBA 3MV3B 4G2VA 4GZ3A 4A1SA 2BUGA 5AYWD 3CV0A 3QWWA 2P58C 2FEZA 2C0MA 2FO7A 4GCOA 4YVQC 5CCMA 2R5SA 3O48A 3SZ7A 3OXGA 1HXIA 3CVNA 3QOUA 4N3CA 1E96B 4U0ZA 4UQYA 4W9RA 5D0QD 3VTYA 4J8EA 4CDRA 3GW4A 1QQEA 4H7YA 3GZ2A 3LY7A 2Q7FA 1Y8MA 3CK9A 3MV2B 4G25A 5FZRA 4AY5A 3Q5MA 3IEGA 4BTAA 4KYOB 1TJCA 2WPVA 2VQ2A 2KCVA 4IN3B 3RKVA 4WNEA 3RU0A 5JJ6A 3OXFA 2PQNA 3CEQA 2I6HA 4GCNA 4GYOA 3Q15A 3RO2A 3U4TA 5HI7A 1P5QA 5LCWJ 2OOEA 3ULQA 3QWVA 3SF4A 3FWVA 3PDNA 1B89A 3CVPA 2E2EA 3ESKA 3Q47B 3Q4AB 4WUYA 1ELRA 2HYZA 3KD7A 2HO1A 3MA5A 4RG6A 4U07A 3TG4A 2WQHA 4G24A 5JJTA 5KJNA 2XGMA 2Y4UA 3CVLA 2FF4A 3CKCA 5FZQA 4BWRA 2DBAA 2KC7A 4APOA 5HQ8A 3ASDA 3LY9A 3URZA 3UPVA 2J9QA 1OUVA 4HOSA 1ZU2A 1ZBPA 4KBQA 4I2ZA 4N3AA 4KXKB 2PZIA 4F3VA 4GA2A 5G04C 2XEVA 5A6CA 3Q49B 3CK8A 4AM9A 2LNIA 4Y6WA 5A7DB 4GZ5A 2PQRA 2XGSA 3UUXA 1IHGA 3GYZA 3JYSA 3QDNA 4HOTA 2KCKA 5ARGA 1A17A 3RJVA 4CGWA 2VSNA 4JA9A 2KATA 4JHRA 4N5CA 5FTPA 2MHKA 4I1AA 5BW8C 4I9CA 4ME2A 5KJLA 1ELWA 2GW1A 3LKUA 3KS2A 1HZ4A 5C1DA 3ASHA 4J8DA 5G04J 4J8FA 4I2WA 4XIFA 4CGVA 4JA7A 2V5FA 4I17A 1NZNA 4HORA 1KLXA 4UQXA 3S7FA 4N2QA 2HR2A 3GZ1A 2AVPA 4BTBA 3AS5A 3WXXA 4GZ6A 4BT9A 5DIZA 2C0LA 5M72A 3PE4A 1KT1A 4AIFA 1NA3A 3CK7A 2IF4A 2VGXA 2VGXB 4GYWA 5KJKA 4N3BA 4H7XA 3LY8A 4BT8A 4RG9A 3MKRA 3N71A 2XCCA 2XPIA 2YHCA 4HOUA 4WNFA 5G05J 3LYAA 2XGOA 5D0OD 4G23A 3ASGA 2ONDA 4GYYA 5EX0A 2L6JA 2VGYA 5FT9A 2QFCA 3VTXA 3ASFA 1W3BA 4U0UA 2XCBA 4EQFA 3QKYA 1QZ2A 4UI9J 4WNDA 4Y6CA 3BEEA 5EX3A 1FCHA 5FJYA 3ZN3A 4G26A 4XI9A 2C2LA 3CVQA 5BT1A 4N2SA 1HH8A 2IFUA 4G1TA 3LCAA 4JL0A 3U3WA 2KCLA 3S7DA 2NC9A 4UI9K 3MEKA 3UQ3A 4UQZA 2LSUA 1WAO1 3TAXA 3ZGQA 3RO3A 3ZPJA 5ARFA 1NA0A 3KAEA 5KJMA 2UWJG 2VSYA 4GA0A 4U04A 4UI9C 5G05C 3R9AB 4N39A 5CCLA 4LEUA 3FFLA 3TG5A 3EDTB 3FP3A 4HOQA 4U0SA 2FBNA 1WM5A 2FI7A 3E4BA 3AS8A 3AS4A 3OXLA 4B94A 4XI0A 1XNFA 5BNWA 4ABNA 1KT0A 3NF1A 4GA1A 3HYMB 3QWPA 5FZSA 3S7BA 3TGOA 2LSVA 1IYGA 1YA0A 2PL2A 4I9EA 4YNDA 5LCWC 3PE3A 4NRHB 4YVOA 4O6FA 2JLBA
chains in the Genus database with same CATH superfamily
2R02A 5T3RA 1PC2A 4GAAA 2VYIA 3RIBA 4FP7A 3ISMC 2IEJA 4GMRA 3CVNA 3QOUA 1EYHA 4P29A 3LY7A 3QK0A 3IEGA 5KCMA 5CRVA 3U4TA 4EECA 3DSSA 3T9KA 4ANUA 3PDNA 3CVPA 1MX2A 1ELRA 4WWPA 5EILA 4RG6A 2WQHA 4HRNA 3CVLA 4PS7A 2RFMA 3ZEFA 1ZU2A 2PZIA 5B1AE 5KWDA 4BSZB 1HO8A 1QNFA 3UUXA 2RFAA 3HXBA 1TN8A 4GTRA 3G2SA 2KATA 4DJAA 4AJWA 2E0IA 4JHJA 3DSTA 4B89A 2V5FA 3CHSA 2A5EA 2WXJA 4FULA 3DSVA 3LS8A 1TJFA 1H6OA 4DI3A 4H7XA 3KSLA 4RG9A 3MKRA 2ONDA 4GTOA 2VGYA 4BETA 3UT4A 3LJNA 4HNAD 3IHYA 2A4ZA 5ARFA 4LNUD 1N52A 4DX7D 1HG2A 3FFLA 4HI9A 2FBNA 2FI7A 3AS8A 4JVSA 1PY1A 5FINA 4O6FA 4U63A 3X2QE 3ZYQA 2QY7A 3ZHEB 3J5QB 1QBQA 1MQSA 5AYWD 4TUMA 2R5SA 4PS3A 5CERB 4JC8A 3HVEA 3FH7A 2ILRA 3MZLB 4V3IA 3SBSA 1Z3YA 3TWXA 5ITZF 2XRYA 2P9IG 2WXHA 1MX4A 2VQ2A 2L0IA 1A5EA 3JUIA 3Q9NC 4J8SA 4ZFHA 2XGMA 3GZSA 3BQOA 3LY9A 4DI4A 4U8HA 1JCRA 4XKCA 3CK8A 3TXNA 4I1AA 2MOWA 2DZOA 3Q9UC 4J8DA 2DCPA 2CHXA 3G2WA 3ZIMA 4HVBA 1TNUA 1DC2A 3LVRE 3ULYA 5JA4D 3FUHA 4TRQA 2VTBA 3IKOB 4FLBA 1JWFA 2DWZA 2J08A 2YHCA 4K5CA 2XGOA 3ABLE 4K0RA 2ZU6B 1MJ0A 3HXFA 4ACLA 4WNDA 3JXJA 1WG0A 3BEEA 1D8EA 1FCHA 3VLDA 4XI9A 4N2SA 3PZ1A 3R9MA 4EZKA 2V8SE 5ENPD 3RK6A 3PEVB 1SVXA 4GA0A 5CCLA 4U8YD 4ATGA 4B8CB 3EUVA 3V2OA 1WM5A 3CVXA 2P9KG 2HE0A 4GTSA 2I1KA 3ABKE 1IYGA 5FQ6A 3L17A 3LPZA 3UXGA 4GZ3A 3HG0D 3Q78A 2WXIA 3TJPA 3SZ7A 3SGHA 4JXTA 4OVUA 4BERA 2ZIRA 2WXPA 4BY6A 3GW4A 3CR3A 3UKUG 2H6GA 3MGBA 1Q2ZA 3CHMA 3CEQA 3FUEA 1DCEA 4Q94A 4ANVA 5CEDB 4HRMB 2PNNA 1KZPA 3QAQA 5FQ8A 4G24A 2Y4UA 3Q73A 3Q7FA 5G04C 1IQRA 4I1OB 2KCKA 5G2NA 3RJVA 2ETAA 2RG8A 2MHKA 4LCTA 4ME2A 3JUEA 2IOSA 3Q79A 5AN8A 2DVWA 3PNTB 1N0RA 1UN8A 3QARA 3CK7A 2GRPB 2VGXA 2XHEA 4UWLA 2FO1E 2IO3C 4WNFA 1HFAA 1UN9A 4B0ZA 3ASGA 2XPYA 3ZYKA 3ULEG 1OCCE 1SA4A 1N4RA 2DYRE 3HXCA 3PRZA 5BXOA 1NFIE 4AV7A 4L7TA 5JHBA 3R7QA 4CT0A 3L16A 1IKND 1BI7B 4DUIA 3SNXA 3EIQC 5EKQD 4M3OA 3CKBA 4G2VA 4M7CA 3Q7AA 2QC9A 5AENA 3R7RA 4YVQC 4F53A 1HXIA 3PZDA 4GTQA 4FHJA 1FT1A 3ML8A 2GROB 2GRNB 2FULA 3TWRA 3MKQA 1H6PA 4GYOA 4JB8P 1NP7A 1P5QA 3ULQA 4O1PA 2E2EA 4I6JA 3KD7A 3NZSA 3QNKA 5AQAA 4KBQA 3J5PA 5ENNA 1E7VA 3ONKA 2B0OE 3JYSA 4HOTA 4F1PA 3NOCD 3ZXPA 5B1BE 2J09A 3DEPA 1OWNA 3ZNGA 3FTXA 2GGFA 1Y6IA 4U7EB 3FH8A 3PE4A 5BPPA 5FQ7A 1K3ZD 1RZ4A 4GYYA 5FT9A 2QFCA 4EQFA 2QZAA 1QZ2A 5FJYA 4L23A 1HH8A 3C3QA 2BEDA 5G05C 3OAWA 3L08A 4WWOA 2BF0X 1XNFA 4IRUA 4B93B 4K5AB 3HYMB 3EHQA 1KPSB 2Y0BG 1JPLA 3ZKJA 4AY6A 3SD5A 1O1TA 3NBNB 4HLLA 3I3NA 2BUGA 4KT6B 4AXHA 2WXRA 3AG3E 3LDZA 4OAUC 1TYQG 4N3CA 3JQ1A 3AG1E 5D0QD 1H6KA 1OWLA 3Q5MA 3DSXA 3RKVA 4L9PA 2LO6A 1BLXB 4OVVA 3Q4AB 4TV3A 4NURA 3E34A 3TG4A 1OCZE 3MCXA 5ENOD 4UWFA 1N4SA 1NL4A 4K03A 1ZBPA 2I2OA 1YYHA 4FC8A 1TNZA 2PQRA 3TWVA 3MX3A 2RD0A 5KNGA 1BD8A 3CQCB 4XIFA 4UWKA 3UIPC 1KLXA 4APFA 2LAHA 4BT8A 5AQ9A 3D3MA 1V55E 4G8KA 1E8ZA 1OY3D 3UPVA 3B7TA 4OAVB 5CECB 4C0EA 4DX2A 5LFAA 3S7DA 4KVMA 4BESA 2MYOA 3P1UA 3NOGD 2CHWA 2RKKA 1E7UA 5ANLA 1H0AA 3SI5A 3ENEA 4LRZA 2J07A 4ILIA 1O1SA 1FPPA 2X6HA 3DWLG 2WXQA 5J08A 1TEZA 4GTVA 1IXVA 4TUUA 2BTDA 1UJJA 5DIZA 3UIOC 4MS6A 3AAAC 3LJ3A 2WXKA 3E33A 5CHEE 2PM6A 2C0MA 5IY5E 4U0ZA 5E75A 3U64A 3L22A 3UM2A 2OEVA 3SFZA 1HX8A 4J8YA 4GCNA 3Q15A 3G2UA 4KMOA 4WAFA 3SO8A 3IBEA 4CYMD 5FWQA 1OT8A 1TN7A 3B95A 4BX9A 1VDYA 2V4LA 3L6AA 4N5QA 1N94A 3MYVA 4XKBA 4LNBA 5BXUA 1EPUA 3QDNA 5AARA 1LF8A 3C3OA 3FUFA 3ZVVA 4J6IA 3HHMA 3D9NA 3S7FA 2VSXE 4FLHA 2CFZA 2AJAA 3N71A 2XCCA 2CFUA 4BSXA 4BFRA 2IU1A 4HXIA 3EIJA 5EX3A 3D9IA 4EBAG 5BT1A 4K5BA 4UI9K 1LD8A 4QQIA 4YDEA 3ZGQA 1NA0A 2UWJG 3FP3A 4U8VD 4O60A 4A3TA 3APCA 4F7AA 3QJZA 2PL2A 4AP2A 4E6HA 4UUCA 4YDWA 5DBKA 5EYPF 4TXRA 5JJ7A 3ZHEA 5ENSD 2HM8A 3Q75A 3O4ZA 3UINC 2P9LG 1JUQA 3BG0B 4W9RA 3VTYA 3FEYA 5A23A 5FZRA 4J7WA 5JJ6A 2PQNA 1LD7A 3NAWA 5EIDA 2ZGGA 2L6BA 3B7BA 3HIZA 2P2CP 3DXKG 3ZW3A 4BEPA 1N11A 4GA2A 3KEZA 4PUCA 2VJ8A 1YCSB 2YINA 3KS2A 4XE0A 3W9FA 4RQIA 1BPOA 3CHPA 2X3MA 5CRUA 2VTBB 4HOUA 5D0OD 3PH0C 4NACA 4TXPA 1MZCA 4LERA 3ZN3A 3CVQA 2IFUA 4G1TA 5G55A 2OEWA 2Y3AA 3V2XA 1K1BA 2IY0C 4UI9C 3R9AB 5T8IA 3CLJA 3E4BA 3APDA 2L9BA 4PDXA 5FZSA 1DVPA 5G05J 2JLBA 1WY6A 3QWWA 5CCMA 3PUJA 4EHMA 4YDYA 1INZA 3PS6A 1TR4A 4AY5A 4JD2G 5CBNA 4DLOA 1FVHA 4LNGA 4JPSA 3OXFA 1E90A 3JXIA 3SF4A 2NXPA 4BTAA 4DPRA 4DK5A 1XGWA 2WB2A 1EF1C 5HQ8A 2IQCA 3PEUB 1MHQA 4EZLA 3Q49B 2LNIA 5A7DB 2XGSA 5KJLA 3LKUA 4GTPA 1HZ4A 2KXPC 5KBAA 2PM7A 4LG6A 2HR2A 3FTUA 1OWMA 2C0LA 3KEAA 2VGXB 3ZRHA 2WXMA 2XS1A 4CCAA 3UT7A 3CIAA 3IXEA 1HE8A 3W9GA 3CSTA 2IOLA 4ACKA 2LAIA 2F8YA 1U3DA 2QYJA 2X6KA 4GPMA 3ZYMA 2EIJE 3TWWA 4U0SA 3E32A 3AS4A 1KT0A 3DPYA 4I6EA 3EU5A 3HRAA 1IQUA 3UM1A 1W3BA 3PUKA 4NQ0A 4DLQA 2Y4TA 2DYSE 3ZFWA 2JABA 2P58C 1LTXA 3D9MA 1DCQA 2WXGA 2EILE 5EDSA 3FEXA 3CVYA 3GZ2A 1JCQA 4KYOB 2WPVA 3MKQB 3KSQA 2QYUA 3ZU7B 5LCWJ 4CDMA 1JWGA 1K1AA 2KZTA 5E76A 3FY4A 4ZHBA 3PREA 2V0PA 5BUZA 1OXJA 1TN6A 3PNLB 1OUVA 4GMLA 4HOSA 2J4DA 4DRXE 2GRRB 4GMJA 4I1MA 4HBDA 4JHKA 2ETCA 1DNPA 3LVQE 3WXXA 4C9BB 1OWOA 3CHRA 4GYWA 3L82A 4YDOA 4PH4B 3LY8A 2DIWA 3OTNA 3LYAA 4G23A 4RVBA 2XCBA 1MX6A 3T8MA 2JEKA 3CVUA 3FULA 5KNHD 2GRMA 2AW6A 1WAO1 3FTWA 4ILHB 5KJMA 5CEAA 2VSYA 4ANWA 4NIKA 3EDTB 5J90A 4ABNA 2MRIA 4LSZE 4PS8A 3PE3A 5AQBA 3RSEG 2Y1LE 1AWCB 2VSOE 3EJNA 4FU3A 5EYLA 4GB9A 4A1SA 1Z5SC 3CSFA 5JHAA 3NZUA 4MBGA 4CT4A 1QQEA 3B13A 4E85A 5ENQD 3RU0A 4IULA 3PZ3A 3TXMA 1TNYA 2IONA 4JW1A 2I1JA 5AJDA 5KJNA 1E8XA 1U3CA 2A5UA 2OVBA 2R03A 3FUDA 4IYPA 4CGWA 4JA9A 2WMNA 3ZUVB 4MLPA 4MRUA 2XRZA 3DEOA 5D2MC 2V4HC 3MJWA 4D10C 2XPIA 3FU6A 5B3SE 3ASFA 4U0UA 2X38A 4UI9J 3ASOE 3CVVA 3LCAA 2P9UG 3D9JA 2NC9A 5CMYA 3FHEA 3TAXA 4UWGA 3G2VA 4B94A 4XI0A 4HS2A 4GA1A 3QWPA 3B7SA 5LCWC 2YQ8A 2UY1B 4BX8A 2CG2A 4WNGA 2OV8A 2FEZA 3U9WA 4UQYA 4HLEA 1MYOA 3I4RB 3CK9A 4XX5A 4IN3B 1BU9A 2I9CA 5HI7A 4CEMA 3QWVA 2WM9A 3F6QA 4L1BA 2HO1A 2ZISA 4B8AA 1O5MA 4FHKA 4BWRA 2ETBA 1E8YA 2L0TB 5C2YA 4I6GA 4GZ5A 1UG3A 4N5CA 4EBAA 1L5JA 4CZ2D 4U96D 4KZCA 4I2WA 4KVOA 3RRMB 4O1OA 2H6IA 4GZ6A 2F0YA 4AIFA 3D9KA 1YMPA 4N3BA 4FJYA 3D9OA 2XEEA 4C0MA 4G26A 3CQGB 3ESLA 1EDUA 3UQ3A 4RSYA 4EPZA 3KAEA 2P9SG 2EIME 4LEUA 5EIBE 3FUIA 2R2LA 4Q69A 2F37A 1YA0A 4YVOA 5HS0A 3K9IA 3DSUA 3S7JA 3DPDA 5CBOA 3UX4A 3CV0A 3IHVA 4GTTA 1S0PA 2FO7A 2KBXA 4GCOA 3VLEA 4AEZC 1E96B 1FVFA 4CDRA 2XS8A 1Y8MA 3C72A 1G3NB 1TJCA 2P9NG 2I6HA 3UM0A 3UT8A 3FWVA 4Z68A 1HS6A 2X6IA 4U07A 4CRWA 1GW6A 3JQ0A 4FJZA 2FF4A 3VLFA 1H19A 1Z6TA 2DBAA 2KC7A 3FUKA 2J9QA 2LXMA 4I2ZA 4N3AA 1PAQA 4KXKB 4FADA 3C98A 3L54A 3L13A 1IHBA 1S64A 3GYZA 1N4QA 1A17A 3D9LA 2H6HA 2VSNA 5FTPA 1AP7A 4I9CA 4HQDA 4GZDA 3ASHA 2WXLA 1KZOA 4LUNU 2AVPA 4BT9A 3AS5A 2WQ6A 1NA3A 3SQVA 2IF4A 2BKGA 4F6RD 4GTMA 2X6FA 3APFA 4RLYA 1ELKA 3VTXA 2AXUA 3UKRG 2C2LA 3JCKC 4A3VA 2KCLA 1X5BA 2P9PG 2R05A 2H6FA 3UMVA 4U04A 3E37A 3WG7E 2F8XK 4Q96A 3FTVA 5AAOA 4HOQA 3OXLA 1ZB1A 4AOFA 3PZ2A 2WMOA 4GZCA 4G8LA 3LEWA 3O48A 3HVEB 4J8EA 4TXQA 4JZYA 2NYJA 4XEIG 3FUJA 4DX6D 3TL5A 4G25A 2WXFA 2XEHA 4WNEA 5HRYA 1V54E 3CGHA 2OOEA 2NSZA 2CHZA 3ESKA 4HFGA 3FU5A 1N54A 3ZXSA 3ABME 2BKKB 1HF8A 3CKCA 3DBSA 3ASDA 4I43A 2VGEA 3SY2A 4UWHA 5T4YA 4F1SA 4XZ4A 4JHRA 3NB2A 2AXVA 2GW1A 2WXOA 1U2VG 4JA7A 4I17A 3V31A 1NZNA 2CG3A 3V79K 5LP0A 4C48B 3GZ1A 4G11A 5AQ7A 3RAUA 3QB2A 3FUMA 5EX0A 2L6JA 1OWPA 5AIJA 4AVXA 4Y6CA 5BV0A 1TNOA 2EIKE 4WWNA 2GRLA 2YNQA 4CDNA 1OCRE 3HXEA 3SBTB 3DSWA 1H2UA 2M63A 4GPKA 2ZGDA 3AU4A 1E8WA 3FUNA 1HG5A 2WXNA 3MV2B 2WQ7A 2KCVA 4FA6A 3RO2A 4HI8A 2AXZA 2KZTB 5FQ4A 1RW2A 2J8SD 2HYZA 1S63A 2IJGX 5EN5D 4L2YA 3TWUA 4ATZD 4DX5D 2WVIA 4AM9A 4Y6WA 1IHGA 3FU0A 1JCSA 2OCCE 5C1DA 5G04J 4A55A 4CGVA 3BUAA 3T5XA 4HORA 3UTMA 4N2QA 4BTBA 5M72A 4ANXA 2XQ0A 5D66A 3L9TA 4GU5A 4QFVA 1N0QA 5CMWA 3FH5A 3V30A 1UJKA 1H2VC 3U3WA 3ZPJA 2YHEA 3BU8A 2LXLA 4N39A 2X6JA 4U95D 3TG5A 5BNWA 3HXDA 3SHFA 4A63B 2LSVA 4I9EA 4YNDA 3PZ4A 3C3RA 4DX1A 3D9HA 3MV3B 3AJIA 3OXGA 2J4BA 3SFYA 4H7YA 2Q7FA 2B6CA 3IV0A 1WDYA 4MKTA 4L2LA 3QC1A 5ENTD 1B89A 4WUYA 3AG2E 2Y69E 3MA5A 3SFXA 5JJTA 3T8KA 4HB5A 4JEHA 2J49A 3FTYA 5AJLA 4APOA 2R59A 1N4PA 3I5PA 3G2TA 3AU5A 3PVLA 1Z3XA 3TWSA 3EHRA 1UOHA 1ELWA 3ZYLA 3D9PA 1SZ9A 2DZNA 4R7LA 1KT1A 3TWQA 3BG1B 5KJKA 1UW4B 1O1RA 4HRLA 2GRQB 1FT2A 3FTZA 1SQMA 2LUHA 3QKYA 3FDHA 1BI8B 4JL0A 3MEKA 4UQZA 2LSUA 3RO3A 3C5RA 3EHNA 1D8DA 3LXUX 3CHQA 3NQPA 1SA5A 3NF1A 3TGOA 3UM3A 2R17C 4NRHB 2UY1A 3CHOA 4J0UA 3DRAA 3HDXA 3E30A 5ENRD 2KM4A 1OCOE 3RRNB 3EHMA 3UI2A 1X81A 4OYSA 3S2AA 3AG4E 2EINE 2XZTG 3RRUA 1QYMA 2V5QC 3I4GA 5BV1A 1SW6A 1HU3A 1K8KG 2XENA 1TNBA 2IO2C 3Q47B 2AWIA 3P2BA 5FZQA 1NI1A 3URZA 4URKA 3B7RL 1SZAA 3ONLA 4F3VA 2XEVA 5A6CA 3B7UX 3DXMG 4A1GA 2OVFA 5ARGA 4X8QA 5BW8C 5LX8A 5HKPA 3FTSA 4J8FA 4UQXA 1N9AA 3T5VA 5ANRA 2XPZA 2XZDG 1S70B 1D9SA 5JMND 2EQXA 3FU3A 1H2TC 4JEUA 3CVWA 3U66A 3ASNE 4KZ0A 3TWTA 4ILGA 5FIOA 3EU9A 1N95A 5LOZA 3S7BA 3ML9A 4EZJA 5H7PA 2ZXWE
chains in the Genus database with same CATH topology
3PUKA 5T3RA 4NQ0A 4DLQA 1JPLA 1PC2A 2WMOA 4GZCA 4AY6A 2Y4TA 3SD5A 4GAAA 2VYIA 3ZFWA 3RIBA 3I3NA 2BUGA 4FP7A 4KT6B 4AXHA 2WXRA 2P58C 3D9MA 3LDZA 3LEWA 3O48A 2WXGA 3CVNA 3JQ1A 3QOUA 4N3CA 3HVEB 5D0QD 4J8EA 4JZYA 5EDSA 1EYHA 3FEXA 3CVYA 4P29A 3FUJA 3GZ2A 3LY7A 1H6KA 3QK0A 4G25A 1OWLA 3TL5A 3Q5MA 3IEGA 4KYOB 2WPVA 2WXFA 3MKQB 3RKVA 5KCMA 4WNEA 3CGHA 3U4TA 4EECA 2LO6A 4OVVA 5LCWJ 2OOEA 4ANUA 4CDMA 2NSZA 1JWGA 2CHZA 2KZTA 3PDNA 5E76A 3CVPA 3ESKA 3Q4AB 4HFGA 4NURA 4TV3A 3FU5A 1ELRA 3FY4A 4WWPA 3TG4A 3PREA 4RG6A 2WQHA 2V0PA 1N54A 3CVLA 3MCXA 4PS7A 4UWFA 1HF8A 3CKCA 3ZXSA 5BUZA 3DBSA 3PNLB 3ASDA 4I43A 4K03A 3ZEFA 1OUVA 4GMLA 4HOSA 1ZU2A 1ZBPA 2I2OA 4UWHA 2PZIA 5T4YA 4F1SA 4FC8A 1HO8A 1QNFA 2PQRA 3UUXA 2J4DA 4XZ4A 3G2SA 4JHRA 2KATA 3MX3A 4GMJA 2RD0A 4DJAA 2AXVA 2GW1A 4I1MA 4AJWA 2WXOA 2E0IA 3CQCB 4XIFA 4UWKA 4JA7A 4JHJA 4JHKA 4B89A 2V5FA 4I17A 1NZNA 2CG3A 1KLXA 5LP0A 3CHSA 1DNPA 3GZ1A 3LVQE 2WXJA 4G11A 4FULA 3LS8A 3WXXA 1TJFA 4C9BB 3QB2A 1OWOA 4DI3A 3CHRA 4GYWA 4APFA 4H7XA 3LY8A 4PH4B 2DIWA 2LAHA 4RG9A 4BT8A 3MKRA 3OTNA 3LYAA 3D3MA 3FUMA 4G23A 1E8ZA 2ONDA 5EX0A 2L6JA 2VGYA 1OWPA 4RVBA 5AIJA 4AVXA 3UPVA 2XCBA 4Y6CA 3B7TA 3T8MA 2JEKA 5BV0A 3UT4A 4C0EA 3IHYA 5LFAA 3CVUA 3FULA 2GRMA 3S7DA 2AW6A 4KVMA 4WWNA 2GRLA 1WAO1 2A4ZA 3FTWA 3P1UA 4ILHB 5ARFA 1N52A 5KJMA 2CHWA 2VSYA 1E7UA 5ANLA 2YNQA 1HG2A 4ANWA 1H0AA 3SI5A 3FFLA 3EDTB 3ENEA 5J90A 4LRZA 2FBNA 2FI7A 2J07A 3AS8A 4ILIA 4ABNA 2X6HA 4JVSA 1PY1A 2MRIA 2WXQA 4CDNA 5J08A 1TEZA 4PS8A 4TUUA 3SBTB 3PE3A 2BTDA 1UJJA 4O6FA 5DIZA 1H2UA 4U63A 4MS6A 2M63A 4GPKA 3ZYQA 3LJ3A 2WXKA 2QY7A 2VSOE 3EJNA 4FU3A 3ZHEB 5CHEE 2PM6A 1MQSA 4GB9A 4A1SA 5AYWD 2C0MA 3AU4A 3CSFA 2R5SA 1E8WA 4PS3A 4JC8A 4U0ZA 5JHAA 3FUNA 3HVEA 3FH7A 2ILRA 3MZLB 3NZUA 1HG5A 4V3IA 4CT4A 1QQEA 3SBSA 1Z3YA 5E75A 2WXNA 3U64A 3B13A 2XRYA 3MV2B 3L22A 2WQ7A 2WXHA 2VQ2A 2KCVA 2L0IA 3SFZA 4E85A 4FA6A 3RU0A 1HX8A 4IULA 4GCNA 3RO2A 3Q15A 3JUIA 3G2UA 4KMOA 3TXMA 4WAFA 2AXZA 2KZTB 4J8SA 5FQ4A 2IONA 2HYZA 3IBEA 2IJGX 4JW1A 5FWQA 2I1JA 5AJDA 2XGMA 1VDYA 4BX9A 5KJNA 2V4LA 4L2YA 3GZSA 3LY9A 4DI4A 1E8XA 3L6AA 4U8HA 3MYVA 1U3CA 4XKBA 4XKCA 2A5UA 2WVIA 2OVBA 3CK8A 4AM9A 4Y6WA 3FUDA 1EPUA 1IHGA 3FU0A 4IYPA 3QDNA 4CGWA 3TXNA 4JA9A 2WMNA 1LF8A 3FUFA 4I1AA 2MOWA 3ZVVA 4J6IA 4MLPA 5C1DA 4J8DA 5G04J 4A55A 2DCPA 4CGVA 3T5XA 3HHMA 4HORA 2CHXA 3D9NA 3G2WA 3ZIMA 3S7FA 4N2QA 2VSXE 4FLHA 4BTBA 4MRUA 4HVBA 5M72A 2XRZA 4ANXA 3LVRE 2CFZA 3FUHA 3MJWA 4TRQA 2XQ0A 2VTBA 3IKOB 4FLBA 1JWFA 4D10C 2J08A 3N71A 2XCCA 2XPIA 2YHCA 4K0RA 2XGOA 3FU6A 2ZU6B 2CFUA 4GU5A 4QFVA 4ACLA 2IU1A 4BSXA 4BFRA 5CMWA 3ASFA 4HXIA 2X38A 3FH5A 4U0UA 4UI9J 3EIJA 4WNDA 3BEEA 5EX3A 1FCHA 3D9IA 3VLDA 4EBAG 4XI9A 5BT1A 4N2SA 4EZKA 2V8SE 3CVVA 3LCAA 1UJKA 1H2VC 3U3WA 3D9JA 2NC9A 4UI9K 5CMYA 3FHEA 3TAXA 3ZGQA 3RK6A 3PEVB 3ZPJA 1NA0A 4UWGA 2YHEA 2UWJG 4GA0A 5CCLA 4N39A 4ATGA 3G2VA 2X6JA 3TG5A 3FP3A 4B8CB 1WM5A 5BNWA 4B94A 3SHFA 4XI0A 4A3TA 3CVXA 4HS2A 2I1KA 4GA1A 3APCA 3QWPA 4F7AA 3QJZA 2LSVA 3B7SA 1IYGA 2PL2A 4AP2A 4I9EA 4YNDA 4E6HA 5LCWC 5FQ6A 3L17A 2YQ8A 2UY1B 5DBKA 4BX8A 5JJ7A 3LPZA 3ZHEA 2HM8A 2CG2A 4WNGA 3MV3B 4GZ3A 3O4ZA 2OV8A 2FEZA 3U9WA 2WXIA 3TJPA 1JUQA 3SZ7A 3OXGA 3SGHA 4JXTA 2J4BA 3BG0B 4OVUA 4UQYA 2WXPA 4W9RA 3VTYA 4BY6A 3GW4A 3CR3A 4HLEA 3FEYA 3I4RB 4H7YA 5A23A 2Q7FA 3CK9A 3MGBA 5FZRA 3IV0A 4XX5A 4MKTA 4IN3B 3CHMA 4L2LA 5JJ6A 2PQNA 2I9CA 3CEQA 3FUEA 4Q94A 4ANVA 3QC1A 5HI7A 4CEMA 3QWVA 2WM9A 1B89A 4WUYA 3QAQA 4L1BA 3HIZA 2HO1A 3MA5A 5FQ8A 4B8AA 4G24A 5JJTA 2Y4UA 4FHKA 4JEHA 4BWRA 2J49A 3FTYA 5AJLA 4APOA 3ZW3A 1E8YA 2L0TB 5C2YA 2R59A 3I5PA 3G2TA 4GA2A 3KEZA 1IQRA 5G04C 4PUCA 4I6GA 4I1OB 4GZ5A 2VJ8A 3AU5A 3PVLA 2KCKA 1Z3XA 5G2NA 3RJVA 2RG8A 1UG3A 4N5CA 4EBAA 2MHKA 1L5JA 4LCTA 4ME2A 2YINA 4KZCA 1ELWA 3ZYLA 3KS2A 4XE0A 4I2WA 4KVOA 3RRMB 2IOSA 1BPOA 3D9PA 1SZ9A 3CHPA 4GZ6A 3PNTB 1UN8A 3QARA 2X3MA 4R7LA 1KT1A 4AIFA 3CK7A 2XHEA 2VGXA 3BG1B 3D9KA 4UWLA 2VTBB 5KJKA 4N3BA 1UW4B 4FJYA 4WNFA 1HFAA 4HOUA 1UN9A 5D0OD 3PH0C 4NACA 4B0ZA 3ASGA 3FTZA 2XPYA 1SQMA 3ZYKA 3D9OA 3QKYA 4LERA 3ZN3A 3FDHA 4G26A 4C0MA 3CQGB 3CVQA 2IFUA 4G1TA 5G55A 3ESLA 1EDUA 4JL0A 2Y3AA 3MEKA 3UQ3A 4RSYA 2LSUA 4UQZA 3RO3A 3EHNA 4EPZA 3KAEA 3LXUX 3PRZA 3CHQA 4UI9C 3R9AB 5T8IA 4LEUA 3NQPA 3CLJA 3FUIA 4AV7A 3E4BA 4L7TA 3APDA 5JHBA 2L9BA 3R7QA 3NF1A 4CT0A 4PDXA 5FZSA 3L16A 4Q69A 3TGOA 1DVPA 1YA0A 2R17C 4NRHB 4YVOA 5G05J 2JLBA 2UY1A 3K9IA 3SNXA 3EIQC 3CHOA 4J0UA 5EKQD 1WY6A 4M3OA 3S7JA 3DPDA 3HDXA 3CKBA 4G2VA 2KM4A 3UX4A 3RRNB 3CV0A 3QWWA 3IHVA 5AENA 1S0PA 2FO7A 4YVQC 4GCOA 3R7RA 3VLEA 5CCMA 3EHMA 4F53A 4AEZC 3PUJA 1HXIA 4OYSA 1E96B 3S2AA 3PZDA 4FHJA 1FVFA 4CDRA 1INZA 3RRUA 3ML8A 3PS6A 1Y8MA 2FULA 4AY5A 1TJCA 3MKQA 4DLOA 1FVHA 3I4GA 5BV1A 4JPSA 3OXFA 1HU3A 2I6HA 4GYOA 3UT8A 1NP7A 1P5QA 1E90A 3ULQA 3SF4A 2NXPA 3FWVA 2E2EA 3Q47B 4I6JA 1HS6A 2X6IA 2AWIA 3KD7A 4U07A 3NZSA 4BTAA 4CRWA 3QNKA 1GW6A 3P2BA 3JQ0A 4DPRA 4FJZA 4DK5A 2FF4A 3VLFA 5FZQA 1XGWA 1H19A 1Z6TA 2WB2A 2DBAA 1EF1C 2KC7A 3FUKA 2IQCA 3URZA 5HQ8A 4URKA 2J9QA 3B7RL 1SZAA 3PEUB 4KBQA 4I2ZA 4N3AA 1PAQA 3ONLA 4KXKB 5ENNA 1MHQA 4F3VA 4FADA 4EZLA 2XEVA 3C98A 3L54A 5A6CA 3Q49B 1E7VA 3ONKA 3B7UX 3L13A 2LNIA 5A7DB 2XGSA 4A1GA 2OVFA 3GYZA 3JYSA 4HOTA 5ARGA 1A17A 3D9LA 2VSNA 5FTPA 5BW8C 4I9CA 5KJLA 3LKUA 5LX8A 1HZ4A 4GZDA 3ASHA 3FTSA 2WXLA 4J8FA 4LUNU 2PM7A 4UQXA 2J09A 1OWNA 3FTXA 2HR2A 2AVPA 4BT9A 3AS5A 2WQ6A 3FTUA 1OWMA 2C0LA 2GGFA 3T5VA 1Y6IA 3FH8A 3PE4A 1NA3A 5ANRA 5BPPA 2IF4A 2VGXB 3ZRHA 5FQ7A 2XPZA 2WXMA 4CCAA 2X6FA 3APFA 3CIAA 3UT7A 4GYYA 1ELKA 2EQXA 2QFCA 3FU3A 5FT9A 1HE8A 1H2TC 3VTXA 3CSTA 4JEUA 4EQFA 1QZ2A 2AXUA 2IOLA 5FJYA 4ACKA 3CVWA 2LAIA 3U66A 4L23A 2C2LA 3JCKC 1HH8A 1U3DA 4A3VA 2KCLA 2X6KA 1X5BA 4KZ0A 3UMVA 3ZYMA 4U04A 5G05C 3OAWA 4ILGA 3L08A 4WWOA 4Q96A 3FTVA 2BF0X 4HOQA 4U0SA 3AS4A 3OXLA 1XNFA 4IRUA 1KT0A 5LOZA 3S7BA 3HYMB 4I6EA 3ML9A 4AOFA 4EZJA 1IQUA 1W3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQ8 A;  2UY1 B;  2UY1 A;  4NQ0 A;  3K9I A;  5DBK A;  4GPK A;  1PC2 A;  4J0U A;  5EKQ D;  5JJ7 A;  4AY6 A;  2Y4T A;  3LPZ A;  3ZHE A;  3ZHE B;  5CHE E;  3S7J A;  2VYI A;  3CKB A;  3ZFW A;  4WNG A;  3RIB A;  3MV3 B;  4G2V A;  4GZ3 A;  4A1S A;  2BUG A;  5AYW D;  3CV0 A;  3QWW A;  2P58 C;  2FEZ A;  2C0M A;  2FO7 A;  4GCO A;  4YVQ C;  5CCM A;  2R5S A;  3O48 A;  3SZ7 A;  3OXG A;  1HXI A;  3CVN A;  3QOU A;  4N3C A;  1E96 B;  4U0Z A;  4UQY A;  4W9R A;  5D0Q D;  3VTY A;  4J8E A;  4CDR A;  3GW4 A;  1QQE A;  4H7Y A;  3GZ2 A;  3LY7 A;  2Q7F A;  1Y8M A;  3CK9 A;  3MV2 B;  4G25 A;  5FZR A;  4AY5 A;  3Q5M A;  3IEG A;  4BTA A;  4KYO B;  1TJC A;  2WPV A;  2VQ2 A;  2KCV A;  4IN3 B;  3RKV A;  4WNE A;  3RU0 A;  5JJ6 A;  3OXF A;  2PQN A;  3CEQ A;  2I6H A;  4GCN A;  4GYO A;  3Q15 A;  3RO2 A;  3U4T A;  5HI7 A;  1P5Q A;  5LCW J;  2OOE A;  3ULQ A;  3QWV A;  3SF4 A;  3FWV A;  3PDN A;  1B89 A;  3CVP A;  2E2E A;  3ESK A;  3Q47 B;  3Q4A B;  4WUY A;  1ELR A;  2HYZ A;  3KD7 A;  2HO1 A;  3MA5 A;  4RG6 A;  4U07 A;  3TG4 A;  2WQH A;  4G24 A;  5JJT A;  5KJN A;  2XGM A;  2Y4U A;  3CVL A;  2FF4 A;  3CKC A;  5FZQ A;  4BWR A;  2DBA A;  2KC7 A;  4APO A;  5HQ8 A;  3ASD A;  3LY9 A;  3URZ A;  3UPV A;  2J9Q A;  1OUV A;  4HOS A;  1ZU2 A;  1ZBP A;  4KBQ A;  4I2Z A;  4N3A A;  4KXK B;  2PZI A;  4F3V A;  4GA2 A;  5G04 C;  2XEV A;  5A6C A;  3Q49 B;  3CK8 A;  4AM9 A;  2LNI A;  4Y6W A;  5A7D B;  4GZ5 A;  2PQR A;  2XGS A;  3UUX A;  1IHG A;  3GYZ A;  3JYS A;  3QDN A;  4HOT A;  2KCK A;  5ARG A;  1A17 A;  3RJV A;  4CGW A;  2VSN A;  4JA9 A;  2KAT A;  4JHR A;  4N5C A;  5FTP A;  2MHK A;  4I1A A;  5BW8 C;  4I9C A;  4ME2 A;  5KJL A;  1ELW A;  2GW1 A;  3LKU A;  3KS2 A;  1HZ4 A;  5C1D A;  3ASH A;  4J8D A;  5G04 J;  4J8F A;  4I2W A;  4XIF A;  4CGV A;  4JA7 A;  2V5F A;  4I17 A;  1NZN A;  4HOR A;  1KLX A;  4UQX A;  3S7F A;  4N2Q A;  2HR2 A;  3GZ1 A;  2AVP A;  4BTB A;  3AS5 A;  3WXX A;  4GZ6 A;  4BT9 A;  5DIZ A;  2C0L A;  5M72 A;  3PE4 A;  1KT1 A;  4AIF A;  1NA3 A;  3CK7 A;  2IF4 A;  2VGX A;  2VGX B;  4GYW A;  5KJK A;  4N3B A;  4H7X A;  3LY8 A;  4BT8 A;  4RG9 A;  3MKR A;  3N71 A;  2XCC A;  2XPI A;  2YHC A;  4HOU A;  4WNF A;  5G05 J;  3LYA A;  2XGO A;  5D0O D;  4G23 A;  3ASG A;  2OND A;  4GYY A;  5EX0 A;  2L6J A;  2VGY A;  5FT9 A;  2QFC A;  3VTX A;  3ASF A;  1W3B A;  4U0U A;  2XCB A;  4EQF A;  3QKY A;  1QZ2 A;  4UI9 J;  4WND A;  4Y6C A;  3BEE A;  5EX3 A;  1FCH A;  5FJY A;  3ZN3 A;  4G26 A;  4XI9 A;  2C2L A;  3CVQ A;  5BT1 A;  4N2S A;  1HH8 A;  2IFU A;  4G1T A;  3LCA A;  4JL0 A;  3U3W A;  2KCL A;  3S7D A;  2NC9 A;  4UI9 K;  3MEK A;  3UQ3 A;  4UQZ A;  2LSU A;  1WAO 1;  3TAX A;  3ZGQ A;  3RO3 A;  3ZPJ A;  5ARF A;  1NA0 A;  3KAE A;  5KJM A;  2UWJ G;  2VSY A;  4GA0 A;  4U04 A;  4UI9 C;  5G05 C;  3R9A B;  4N39 A;  5CCL A;  4LEU A;  3FFL A;  3TG5 A;  3EDT B;  3FP3 A;  4HOQ A;  4U0S A;  2FBN A;  1WM5 A;  2FI7 A;  3E4B A;  3AS8 A;  3AS4 A;  3OXL A;  4B94 A;  4XI0 A;  1XNF A;  5BNW A;  4ABN A;  1KT0 A;  3NF1 A;  4GA1 A;  3HYM B;  3QWP A;  5FZS A;  3S7B A;  3TGO A;  2LSV A;  1IYG A;  1YA0 A;  2PL2 A;  4I9E A;  4YND A;  5LCW C;  3PE3 A;  4NRH B;  4YVO A;  4O6F A;  2JLB A; 
#chains in the Genus database with same CATH topology
 2R02 A;  5T3R A;  1PC2 A;  4GAA A;  2VYI A;  3RIB A;  4FP7 A;  3ISM C;  2IEJ A;  4GMR A;  3CVN A;  3QOU A;  1EYH A;  4P29 A;  3LY7 A;  3QK0 A;  3IEG A;  5KCM A;  5CRV A;  3U4T A;  4EEC A;  3DSS A;  3T9K A;  4ANU A;  3PDN A;  3CVP A;  1MX2 A;  1ELR A;  4WWP A;  5EIL A;  4RG6 A;  2WQH A;  4HRN A;  3CVL A;  4PS7 A;  2RFM A;  3ZEF A;  1ZU2 A;  2PZI A;  5B1A E;  5KWD A;  4BSZ B;  1HO8 A;  1QNF A;  3UUX A;  2RFA A;  3HXB A;  1TN8 A;  4GTR A;  3G2S A;  2KAT A;  4DJA A;  4AJW A;  2E0I A;  4JHJ A;  3DST A;  4B89 A;  2V5F A;  3CHS A;  2A5E A;  2WXJ A;  4FUL A;  3DSV A;  3LS8 A;  1TJF A;  1H6O A;  4DI3 A;  4H7X A;  3KSL A;  4RG9 A;  3MKR A;  2OND A;  4GTO A;  2VGY A;  4BET A;  3UT4 A;  3LJN A;  4HNA D;  3IHY A;  2A4Z A;  5ARF A;  4LNU D;  1N52 A;  4DX7 D;  1HG2 A;  3FFL A;  4HI9 A;  2FBN A;  2FI7 A;  3AS8 A;  4JVS A;  1PY1 A;  5FIN A;  4O6F A;  4U63 A;  3X2Q E;  3ZYQ A;  2QY7 A;  3ZHE B;  3J5Q B;  1QBQ A;  1MQS A;  5AYW D;  4TUM A;  2R5S A;  4PS3 A;  5CER B;  4JC8 A;  3HVE A;  3FH7 A;  2ILR A;  3MZL B;  4V3I A;  3SBS A;  1Z3Y A;  3TWX A;  5ITZ F;  2XRY A;  2P9I G;  2WXH A;  1MX4 A;  2VQ2 A;  2L0I A;  1A5E A;  3JUI A;  3Q9N C;  4J8S A;  4ZFH A;  2XGM A;  3GZS A;  3BQO A;  3LY9 A;  4DI4 A;  4U8H A;  1JCR A;  4XKC A;  3CK8 A;  3TXN A;  4I1A A;  2MOW A;  2DZO A;  3Q9U C;  4J8D A;  2DCP A;  2CHX A;  3G2W A;  3ZIM A;  4HVB A;  1TNU A;  1DC2 A;  3LVR E;  3ULY A;  5JA4 D;  3FUH A;  4TRQ A;  2VTB A;  3IKO B;  4FLB A;  1JWF A;  2DWZ A;  2J08 A;  2YHC A;  4K5C A;  2XGO A;  3ABL E;  4K0R A;  2ZU6 B;  1MJ0 A;  3HXF A;  4ACL A;  4WND A;  3JXJ A;  1WG0 A;  3BEE A;  1D8E A;  1FCH A;  3VLD A;  4XI9 A;  4N2S A;  3PZ1 A;  3R9M A;  4EZK A;  2V8S E;  5ENP D;  3RK6 A;  3PEV B;  1SVX A;  4GA0 A;  5CCL A;  4U8Y D;  4ATG A;  4B8C B;  3EUV A;  3V2O A;  1WM5 A;  3CVX A;  2P9K G;  2HE0 A;  4GTS A;  2I1K A;  3ABK E;  1IYG A;  5FQ6 A;  3L17 A;  3LPZ A;  3UXG A;  4GZ3 A;  3HG0 D;  3Q78 A;  2WXI A;  3TJP A;  3SZ7 A;  3SGH A;  4JXT A;  4OVU A;  4BER A;  2ZIR A;  2WXP A;  4BY6 A;  3GW4 A;  3CR3 A;  3UKU G;  2H6G A;  3MGB A;  1Q2Z A;  3CHM A;  3CEQ A;  3FUE A;  1DCE A;  4Q94 A;  4ANV A;  5CED B;  4HRM B;  2PNN A;  1KZP A;  3QAQ A;  5FQ8 A;  4G24 A;  2Y4U A;  3Q73 A;  3Q7F A;  5G04 C;  1IQR A;  4I1O B;  2KCK A;  5G2N A;  3RJV A;  2ETA A;  2RG8 A;  2MHK A;  4LCT A;  4ME2 A;  3JUE A;  2IOS A;  3Q79 A;  5AN8 A;  2DVW A;  3PNT B;  1N0R A;  1UN8 A;  3QAR A;  3CK7 A;  2GRP B;  2VGX A;  2XHE A;  4UWL A;  2FO1 E;  2IO3 C;  4WNF A;  1HFA A;  1UN9 A;  4B0Z A;  3ASG A;  2XPY A;  3ZYK A;  3ULE G;  1OCC E;  1SA4 A;  1N4R A;  2DYR E;  3HXC A;  3PRZ A;  5BXO A;  1NFI E;  4AV7 A;  4L7T A;  5JHB A;  3R7Q A;  4CT0 A;  3L16 A;  1IKN D;  1BI7 B;  4DUI A;  3SNX A;  3EIQ C;  5EKQ D;  4M3O A;  3CKB A;  4G2V A;  4M7C A;  3Q7A A;  2QC9 A;  5AEN A;  3R7R A;  4YVQ C;  4F53 A;  1HXI A;  3PZD A;  4GTQ A;  4FHJ A;  1FT1 A;  3ML8 A;  2GRO B;  2GRN B;  2FUL A;  3TWR A;  3MKQ A;  1H6P A;  4GYO A;  4JB8 P;  1NP7 A;  1P5Q A;  3ULQ A;  4O1P A;  2E2E A;  4I6J A;  3KD7 A;  3NZS A;  3QNK A;  5AQA A;  4KBQ A;  3J5P A;  5ENN A;  1E7V A;  3ONK A;  2B0O E;  3JYS A;  4HOT A;  4F1P A;  3NOC D;  3ZXP A;  5B1B E;  2J09 A;  3DEP A;  1OWN A;  3ZNG A;  3FTX A;  2GGF A;  1Y6I A;  4U7E B;  3FH8 A;  3PE4 A;  5BPP A;  5FQ7 A;  1K3Z D;  1RZ4 A;  4GYY A;  5FT9 A;  2QFC A;  4EQF A;  2QZA A;  1QZ2 A;  5FJY A;  4L23 A;  1HH8 A;  3C3Q A;  2BED A;  5G05 C;  3OAW A;  3L08 A;  4WWO A;  2BF0 X;  1XNF A;  4IRU A;  4B93 B;  4K5A B;  3HYM B;  3EHQ A;  1KPS B;  2Y0B G;  1JPL A;  3ZKJ A;  4AY6 A;  3SD5 A;  1O1T A;  3NBN B;  4HLL A;  3I3N A;  2BUG A;  4KT6 B;  4AXH A;  2WXR A;  3AG3 E;  3LDZ A;  4OAU C;  1TYQ G;  4N3C A;  3JQ1 A;  3AG1 E;  5D0Q D;  1H6K A;  1OWL A;  3Q5M A;  3DSX A;  3RKV A;  4L9P A;  2LO6 A;  1BLX B;  4OVV A;  3Q4A B;  4TV3 A;  4NUR A;  3E34 A;  3TG4 A;  1OCZ E;  3MCX A;  5ENO D;  4UWF A;  1N4S A;  1NL4 A;  4K03 A;  1ZBP A;  2I2O A;  1YYH A;  4FC8 A;  1TNZ A;  2PQR A;  3TWV A;  3MX3 A;  2RD0 A;  5KNG A;  1BD8 A;  3CQC B;  4XIF A;  4UWK A;  3UIP C;  1KLX A;  4APF A;  2LAH A;  4BT8 A;  5AQ9 A;  3D3M A;  1V55 E;  4G8K A;  1E8Z A;  1OY3 D;  3UPV A;  3B7T A;  4OAV B;  5CEC B;  4C0E A;  4DX2 A;  5LFA A;  3S7D A;  4KVM A;  4BES A;  2MYO A;  3P1U A;  3NOG D;  2CHW A;  2RKK A;  1E7U A;  5ANL A;  1H0A A;  3SI5 A;  3ENE A;  4LRZ A;  2J07 A;  4ILI A;  1O1S A;  1FPP A;  2X6H A;  3DWL G;  2WXQ A;  5J08 A;  1TEZ A;  4GTV A;  1IXV A;  4TUU A;  2BTD A;  1UJJ A;  5DIZ A;  3UIO C;  4MS6 A;  3AAA C;  3LJ3 A;  2WXK A;  3E33 A;  5CHE E;  2PM6 A;  2C0M A;  5IY5 E;  4U0Z A;  5E75 A;  3U64 A;  3L22 A;  3UM2 A;  2OEV A;  3SFZ A;  1HX8 A;  4J8Y A;  4GCN A;  3Q15 A;  3G2U A;  4KMO A;  4WAF A;  3SO8 A;  3IBE A;  4CYM D;  5FWQ A;  1OT8 A;  1TN7 A;  3B95 A;  4BX9 A;  1VDY A;  2V4L A;  3L6A A;  4N5Q A;  1N94 A;  3MYV A;  4XKB A;  4LNB A;  5BXU A;  1EPU A;  3QDN A;  5AAR A;  1LF8 A;  3C3O A;  3FUF A;  3ZVV A;  4J6I A;  3HHM A;  3D9N A;  3S7F A;  2VSX E;  4FLH A;  2CFZ A;  2AJA A;  3N71 A;  2XCC A;  2CFU A;  4BSX A;  4BFR A;  2IU1 A;  4HXI A;  3EIJ A;  5EX3 A;  3D9I A;  4EBA G;  5BT1 A;  4K5B A;  4UI9 K;  1LD8 A;  4QQI A;  4YDE A;  3ZGQ A;  1NA0 A;  2UWJ G;  3FP3 A;  4U8V D;  4O60 A;  4A3T A;  3APC A;  4F7A A;  3QJZ A;  2PL2 A;  4AP2 A;  4E6H A;  4UUC A;  4YDW A;  5DBK A;  5EYP F;  4TXR A;  5JJ7 A;  3ZHE A;  5ENS D;  2HM8 A;  3Q75 A;  3O4Z A;  3UIN C;  2P9L G;  1JUQ A;  3BG0 B;  4W9R A;  3VTY A;  3FEY A;  5A23 A;  5FZR A;  4J7W A;  5JJ6 A;  2PQN A;  1LD7 A;  3NAW A;  5EID A;  2ZGG A;  2L6B A;  3B7B A;  3HIZ A;  2P2C P;  3DXK G;  3ZW3 A;  4BEP A;  1N11 A;  4GA2 A;  3KEZ A;  4PUC A;  2VJ8 A;  1YCS B;  2YIN A;  3KS2 A;  4XE0 A;  3W9F A;  4RQI A;  1BPO A;  3CHP A;  2X3M A;  5CRU A;  2VTB B;  4HOU A;  5D0O D;  3PH0 C;  4NAC A;  4TXP A;  1MZC A;  4LER A;  3ZN3 A;  3CVQ A;  2IFU A;  4G1T A;  5G55 A;  2OEW A;  2Y3A A;  3V2X A;  1K1B A;  2IY0 C;  4UI9 C;  3R9A B;  5T8I A;  3CLJ A;  3E4B A;  3APD A;  2L9B A;  4PDX A;  5FZS A;  1DVP A;  5G05 J;  2JLB A;  1WY6 A;  3QWW A;  5CCM A;  3PUJ A;  4EHM A;  4YDY A;  1INZ A;  3PS6 A;  1TR4 A;  4AY5 A;  4JD2 G;  5CBN A;  4DLO A;  1FVH A;  4LNG A;  4JPS A;  3OXF A;  1E90 A;  3JXI A;  3SF4 A;  2NXP A;  4BTA A;  4DPR A;  4DK5 A;  1XGW A;  2WB2 A;  1EF1 C;  5HQ8 A;  2IQC A;  3PEU B;  1MHQ A;  4EZL A;  3Q49 B;  2LNI A;  5A7D B;  2XGS A;  5KJL A;  3LKU A;  4GTP A;  1HZ4 A;  2KXP C;  5KBA A;  2PM7 A;  4LG6 A;  2HR2 A;  3FTU A;  1OWM A;  2C0L A;  3KEA A;  2VGX B;  3ZRH A;  2WXM A;  2XS1 A;  4CCA A;  3UT7 A;  3CIA A;  3IXE A;  1HE8 A;  3W9G A;  3CST A;  2IOL A;  4ACK A;  2LAI A;  2F8Y A;  1U3D A;  2QYJ A;  2X6K A;  4GPM A;  3ZYM A;  2EIJ E;  3TWW A;  4U0S A;  3E32 A;  3AS4 A;  1KT0 A;  3DPY A;  4I6E A;  3EU5 A;  3HRA A;  1IQU A;  3UM1 A;  1W3B A;  3PUK A;  4NQ0 A;  4DLQ A;  2Y4T A;  2DYS E;  3ZFW A;  2JAB A;  2P58 C;  1LTX A;  3D9M A;  1DCQ A;  2WXG A;  2EIL E;  5EDS A;  3FEX A;  3CVY A;  3GZ2 A;  1JCQ A;  4KYO B;  2WPV A;  3MKQ B;  3KSQ A;  2QYU A;  3ZU7 B;  5LCW J;  4CDM A;  1JWG A;  1K1A A;  2KZT A;  5E76 A;  3FY4 A;  4ZHB A;  3PRE A;  2V0P A;  5BUZ A;  1OXJ A;  1TN6 A;  3PNL B;  1OUV A;  4GML A;  4HOS A;  2J4D A;  4DRX E;  2GRR B;  4GMJ A;  4I1M A;  4HBD A;  4JHK A;  2ETC A;  1DNP A;  3LVQ E;  3WXX A;  4C9B B;  1OWO A;  3CHR A;  4GYW A;  3L82 A;  4YDO A;  4PH4 B;  3LY8 A;  2DIW A;  3OTN A;  3LYA A;  4G23 A;  4RVB A;  2XCB A;  1MX6 A;  3T8M A;  2JEK A;  3CVU A;  3FUL A;  5KNH D;  2GRM A;  2AW6 A;  1WAO 1;  3FTW A;  4ILH B;  5KJM A;  5CEA A;  2VSY A;  4ANW A;  4NIK A;  3EDT B;  5J90 A;  4ABN A;  2MRI A;  4LSZ E;  4PS8 A;  3PE3 A;  5AQB A;  3RSE G;  2Y1L E;  1AWC B;  2VSO E;  3EJN A;  4FU3 A;  5EYL A;  4GB9 A;  4A1S A;  1Z5S C;  3CSF A;  5JHA A;  3NZU A;  4MBG A;  4CT4 A;  1QQE A;  3B13 A;  4E85 A;  5ENQ D;  3RU0 A;  4IUL A;  3PZ3 A;  3TXM A;  1TNY A;  2ION A;  4JW1 A;  2I1J A;  5AJD A;  5KJN A;  1E8X A;  1U3C A;  2A5U A;  2OVB A;  2R03 A;  3FUD A;  4IYP A;  4CGW A;  4JA9 A;  2WMN A;  3ZUV B;  4MLP A;  4MRU A;  2XRZ A;  3DEO A;  5D2M C;  2V4H C;  3MJW A;  4D10 C;  2XPI A;  3FU6 A;  5B3S E;  3ASF A;  4U0U A;  2X38 A;  4UI9 J;  3ASO E;  3CVV A;  3LCA A;  2P9U G;  3D9J A;  2NC9 A;  5CMY A;  3FHE A;  3TAX A;  4UWG A;  3G2V A;  4B94 A;  4XI0 A;  4HS2 A;  4GA1 A;  3QWP A;  3B7S A;  5LCW C;  2YQ8 A;  2UY1 B;  4BX8 A;  2CG2 A;  4WNG A;  2OV8 A;  2FEZ A;  3U9W A;  4UQY A;  4HLE A;  1MYO A;  3I4R B;  3CK9 A;  4XX5 A;  4IN3 B;  1BU9 A;  2I9C A;  5HI7 A;  4CEM A;  3QWV A;  2WM9 A;  3F6Q A;  4L1B A;  2HO1 A;  2ZIS A;  4B8A A;  1O5M A;  4FHK A;  4BWR A;  2ETB A;  1E8Y A;  2L0T B;  5C2Y A;  4I6G A;  4GZ5 A;  1UG3 A;  4N5C A;  4EBA A;  1L5J A;  4CZ2 D;  4U96 D;  4KZC A;  4I2W A;  4KVO A;  3RRM B;  4O1O A;  2H6I A;  4GZ6 A;  2F0Y A;  4AIF A;  3D9K A;  1YMP A;  4N3B A;  4FJY A;  3D9O A;  2XEE A;  4C0M A;  4G26 A;  3CQG B;  3ESL A;  1EDU A;  3UQ3 A;  4RSY A;  4EPZ A;  3KAE A;  2P9S G;  2EIM E;  4LEU A;  5EIB E;  3FUI A;  2R2L A;  4Q69 A;  2F37 A;  1YA0 A;  4YVO A;  5HS0 A;  3K9I A;  3DSU A;  3S7J A;  3DPD A;  5CBO A;  3UX4 A;  3CV0 A;  3IHV A;  4GTT A;  1S0P A;  2FO7 A;  2KBX A;  4GCO A;  3VLE A;  4AEZ C;  1E96 B;  1FVF A;  4CDR A;  2XS8 A;  1Y8M A;  3C72 A;  1G3N B;  1TJC A;  2P9N G;  2I6H A;  3UM0 A;  3UT8 A;  3FWV A;  4Z68 A;  1HS6 A;  2X6I A;  4U07 A;  4CRW A;  1GW6 A;  3JQ0 A;  4FJZ A;  2FF4 A;  3VLF A;  1H19 A;  1Z6T A;  2DBA A;  2KC7 A;  3FUK A;  2J9Q A;  2LXM A;  4I2Z A;  4N3A A;  1PAQ A;  4KXK B;  4FAD A;  3C98 A;  3L54 A;  3L13 A;  1IHB A;  1S64 A;  3GYZ A;  1N4Q A;  1A17 A;  3D9L A;  2H6H A;  2VSN A;  5FTP A;  1AP7 A;  4I9C A;  4HQD A;  4GZD A;  3ASH A;  2WXL A;  1KZO A;  4LUN U;  2AVP A;  4BT9 A;  3AS5 A;  2WQ6 A;  1NA3 A;  3SQV A;  2IF4 A;  2BKG A;  4F6R D;  4GTM A;  2X6F A;  3APF A;  4RLY A;  1ELK A;  3VTX A;  2AXU A;  3UKR G;  2C2L A;  3JCK C;  4A3V A;  2KCL A;  1X5B A;  2P9P G;  2R05 A;  2H6F A;  3UMV A;  4U04 A;  3E37 A;  3WG7 E;  2F8X K;  4Q96 A;  3FTV A;  5AAO A;  4HOQ A;  3OXL A;  1ZB1 A;  4AOF A;  3PZ2 A;  2WMO A;  4GZC A;  4G8L A;  3LEW A;  3O48 A;  3HVE B;  4J8E A;  4TXQ A;  4JZY A;  2NYJ A;  4XEI G;  3FUJ A;  4DX6 D;  3TL5 A;  4G25 A;  2WXF A;  2XEH A;  4WNE A;  5HRY A;  1V54 E;  3CGH A;  2OOE A;  2NSZ A;  2CHZ A;  3ESK A;  4HFG A;  3FU5 A;  1N54 A;  3ZXS A;  3ABM E;  2BKK B;  1HF8 A;  3CKC A;  3DBS A;  3ASD A;  4I43 A;  2VGE A;  3SY2 A;  4UWH A;  5T4Y A;  4F1S A;  4XZ4 A;  4JHR A;  3NB2 A;  2AXV A;  2GW1 A;  2WXO A;  1U2V G;  4JA7 A;  4I17 A;  3V31 A;  1NZN A;  2CG3 A;  3V79 K;  5LP0 A;  4C48 B;  3GZ1 A;  4G11 A;  5AQ7 A;  3RAU A;  3QB2 A;  3FUM A;  5EX0 A;  2L6J A;  1OWP A;  5AIJ A;  4AVX A;  4Y6C A;  5BV0 A;  1TNO A;  2EIK E;  4WWN A;  2GRL A;  2YNQ A;  4CDN A;  1OCR E;  3HXE A;  3SBT B;  3DSW A;  1H2U A;  2M63 A;  4GPK A;  2ZGD A;  3AU4 A;  1E8W A;  3FUN A;  1HG5 A;  2WXN A;  3MV2 B;  2WQ7 A;  2KCV A;  4FA6 A;  3RO2 A;  4HI8 A;  2AXZ A;  2KZT B;  5FQ4 A;  1RW2 A;  2J8S D;  2HYZ A;  1S63 A;  2IJG X;  5EN5 D;  4L2Y A;  3TWU A;  4ATZ D;  4DX5 D;  2WVI A;  4AM9 A;  4Y6W A;  1IHG A;  3FU0 A;  1JCS A;  2OCC E;  5C1D A;  5G04 J;  4A55 A;  4CGV A;  3BUA A;  3T5X A;  4HOR A;  3UTM A;  4N2Q A;  4BTB A;  5M72 A;  4ANX A;  2XQ0 A;  5D66 A;  3L9T A;  4GU5 A;  4QFV A;  1N0Q A;  5CMW A;  3FH5 A;  3V30 A;  1UJK A;  1H2V C;  3U3W A;  3ZPJ A;  2YHE A;  3BU8 A;  2LXL A;  4N39 A;  2X6J A;  4U95 D;  3TG5 A;  5BNW A;  3HXD A;  3SHF A;  4A63 B;  2LSV A;  4I9E A;  4YND A;  3PZ4 A;  3C3R A;  4DX1 A;  3D9H A;  3MV3 B;  3AJI A;  3OXG A;  2J4B A;  3SFY A;  4H7Y A;  2Q7F A;  2B6C A;  3IV0 A;  1WDY A;  4MKT A;  4L2L A;  3QC1 A;  5ENT D;  1B89 A;  4WUY A;  3AG2 E;  2Y69 E;  3MA5 A;  3SFX A;  5JJT A;  3T8K A;  4HB5 A;  4JEH A;  2J49 A;  3FTY A;  5AJL A;  4APO A;  2R59 A;  1N4P A;  3I5P A;  3G2T A;  3AU5 A;  3PVL A;  1Z3X A;  3TWS A;  3EHR A;  1UOH A;  1ELW A;  3ZYL A;  3D9P A;  1SZ9 A;  2DZN A;  4R7L A;  1KT1 A;  3TWQ A;  3BG1 B;  5KJK A;  1UW4 B;  1O1R A;  4HRL A;  2GRQ B;  1FT2 A;  3FTZ A;  1SQM A;  2LUH A;  3QKY A;  3FDH A;  1BI8 B;  4JL0 A;  3MEK A;  4UQZ A;  2LSU A;  3RO3 A;  3C5R A;  3EHN A;  1D8D A;  3LXU X;  3CHQ A;  3NQP A;  1SA5 A;  3NF1 A;  3TGO A;  3UM3 A;  2R17 C;  4NRH B;  2UY1 A;  3CHO A;  4J0U A;  3DRA A;  3HDX A;  3E30 A;  5ENR D;  2KM4 A;  1OCO E;  3RRN B;  3EHM A;  3UI2 A;  1X81 A;  4OYS A;  3S2A A;  3AG4 E;  2EIN E;  2XZT G;  3RRU A;  1QYM A;  2V5Q C;  3I4G A;  5BV1 A;  1SW6 A;  1HU3 A;  1K8K G;  2XEN A;  1TNB A;  2IO2 C;  3Q47 B;  2AWI A;  3P2B A;  5FZQ A;  1NI1 A;  3URZ A;  4URK A;  3B7R L;  1SZA A;  3ONL A;  4F3V A;  2XEV A;  5A6C A;  3B7U X;  3DXM G;  4A1G A;  2OVF A;  5ARG A;  4X8Q A;  5BW8 C;  5LX8 A;  5HKP A;  3FTS A;  4J8F A;  4UQX A;  1N9A A;  3T5V A;  5ANR A;  2XPZ A;  2XZD G;  1S70 B;  1D9S A;  5JMN D;  2EQX A;  3FU3 A;  1H2T C;  4JEU A;  3CVW A;  3U66 A;  3ASN E;  4KZ0 A;  3TWT A;  4ILG A;  5FIO A;  3EU9 A;  1N95 A;  5LOZ A;  3S7B A;  3ML9 A;  4EZJ A;  5H7P A;  2ZXW E; 
#chains in the Genus database with same CATH homology
 3PUK A;  5T3R A;  4NQ0 A;  4DLQ A;  1JPL A;  1PC2 A;  2WMO A;  4GZC A;  4AY6 A;  2Y4T A;  3SD5 A;  4GAA A;  2VYI A;  3ZFW A;  3RIB A;  3I3N A;  2BUG A;  4FP7 A;  4KT6 B;  4AXH A;  2WXR A;  2P58 C;  3D9M A;  3LDZ A;  3LEW A;  3O48 A;  2WXG A;  3CVN A;  3JQ1 A;  3QOU A;  4N3C A;  3HVE B;  5D0Q D;  4J8E A;  4JZY A;  5EDS A;  1EYH A;  3FEX A;  3CVY A;  4P29 A;  3FUJ A;  3GZ2 A;  3LY7 A;  1H6K A;  3QK0 A;  4G25 A;  1OWL A;  3TL5 A;  3Q5M A;  3IEG A;  4KYO B;  2WPV A;  2WXF A;  3MKQ B;  3RKV A;  5KCM A;  4WNE A;  3CGH A;  3U4T A;  4EEC A;  2LO6 A;  4OVV A;  5LCW J;  2OOE A;  4ANU A;  4CDM A;  2NSZ A;  1JWG A;  2CHZ A;  2KZT A;  3PDN A;  5E76 A;  3CVP A;  3ESK A;  3Q4A B;  4HFG A;  4NUR A;  4TV3 A;  3FU5 A;  1ELR A;  3FY4 A;  4WWP A;  3TG4 A;  3PRE A;  4RG6 A;  2WQH A;  2V0P A;  1N54 A;  3CVL A;  3MCX A;  4PS7 A;  4UWF A;  1HF8 A;  3CKC A;  3ZXS A;  5BUZ A;  3DBS A;  3PNL B;  3ASD A;  4I43 A;  4K03 A;  3ZEF A;  1OUV A;  4GML A;  4HOS A;  1ZU2 A;  1ZBP A;  2I2O A;  4UWH A;  2PZI A;  5T4Y A;  4F1S A;  4FC8 A;  1HO8 A;  1QNF A;  2PQR A;  3UUX A;  2J4D A;  4XZ4 A;  3G2S A;  4JHR A;  2KAT A;  3MX3 A;  4GMJ A;  2RD0 A;  4DJA A;  2AXV A;  2GW1 A;  4I1M A;  4AJW A;  2WXO A;  2E0I A;  3CQC B;  4XIF A;  4UWK A;  4JA7 A;  4JHJ A;  4JHK A;  4B89 A;  2V5F A;  4I17 A;  1NZN A;  2CG3 A;  1KLX A;  5LP0 A;  3CHS A;  1DNP A;  3GZ1 A;  3LVQ E;  2WXJ A;  4G11 A;  4FUL A;  3LS8 A;  3WXX A;  1TJF A;  4C9B B;  3QB2 A;  1OWO A;  4DI3 A;  3CHR A;  4GYW A;  4APF A;  4H7X A;  3LY8 A;  4PH4 B;  2DIW A;  2LAH A;  4RG9 A;  4BT8 A;  3MKR A;  3OTN A;  3LYA A;  3D3M A;  3FUM A;  4G23 A;  1E8Z A;  2OND A;  5EX0 A;  2L6J A;  2VGY A;  1OWP A;  4RVB A;  5AIJ A;  4AVX A;  3UPV A;  2XCB A;  4Y6C A;  3B7T A;  3T8M A;  2JEK A;  5BV0 A;  3UT4 A;  4C0E A;  3IHY A;  5LFA A;  3CVU A;  3FUL A;  2GRM A;  3S7D A;  2AW6 A;  4KVM A;  4WWN A;  2GRL A;  1WAO 1;  2A4Z A;  3FTW A;  3P1U A;  4ILH B;  5ARF A;  1N52 A;  5KJM A;  2CHW A;  2VSY A;  1E7U A;  5ANL A;  2YNQ A;  1HG2 A;  4ANW A;  1H0A A;  3SI5 A;  3FFL A;  3EDT B;  3ENE A;  5J90 A;  4LRZ A;  2FBN A;  2FI7 A;  2J07 A;  3AS8 A;  4ILI A;  4ABN A;  2X6H A;  4JVS A;  1PY1 A;  2MRI A;  2WXQ A;  4CDN A;  5J08 A;  1TEZ A;  4PS8 A;  4TUU A;  3SBT B;  3PE3 A;  2BTD A;  1UJJ A;  4O6F A;  5DIZ A;  1H2U A;  4U63 A;  4MS6 A;  2M63 A;  4GPK A;  3ZYQ A;  3LJ3 A;  2WXK A;  2QY7 A;  2VSO E;  3EJN A;  4FU3 A;  3ZHE B;  5CHE E;  2PM6 A;  1MQS A;  4GB9 A;  4A1S A;  5AYW D;  2C0M A;  3AU4 A;  3CSF A;  2R5S A;  1E8W A;  4PS3 A;  4JC8 A;  4U0Z A;  5JHA A;  3FUN A;  3HVE A;  3FH7 A;  2ILR A;  3MZL B;  3NZU A;  1HG5 A;  4V3I A;  4CT4 A;  1QQE A;  3SBS A;  1Z3Y A;  5E75 A;  2WXN A;  3U64 A;  3B13 A;  2XRY A;  3MV2 B;  3L22 A;  2WQ7 A;  2WXH A;  2VQ2 A;  2KCV A;  2L0I A;  3SFZ A;  4E85 A;  4FA6 A;  3RU0 A;  1HX8 A;  4IUL A;  4GCN A;  3RO2 A;  3Q15 A;  3JUI A;  3G2U A;  4KMO A;  3TXM A;  4WAF A;  2AXZ A;  2KZT B;  4J8S A;  5FQ4 A;  2ION A;  2HYZ A;  3IBE A;  2IJG X;  4JW1 A;  5FWQ A;  2I1J A;  5AJD A;  2XGM A;  1VDY A;  4BX9 A;  5KJN A;  2V4L A;  4L2Y A;  3GZS A;  3LY9 A;  4DI4 A;  1E8X A;  3L6A A;  4U8H A;  3MYV A;  1U3C A;  4XKB A;  4XKC A;  2A5U A;  2WVI A;  2OVB A;  3CK8 A;  4AM9 A;  4Y6W A;  3FUD A;  1EPU A;  1IHG A;  3FU0 A;  4IYP A;  3QDN A;  4CGW A;  3TXN A;  4JA9 A;  2WMN A;  1LF8 A;  3FUF A;  4I1A A;  2MOW A;  3ZVV A;  4J6I A;  4MLP A;  5C1D A;  4J8D A;  5G04 J;  4A55 A;  2DCP A;  4CGV A;  3T5X A;  3HHM A;  4HOR A;  2CHX A;  3D9N A;  3G2W A;  3ZIM A;  3S7F A;  4N2Q A;  2VSX E;  4FLH A;  4BTB A;  4MRU A;  4HVB A;  5M72 A;  2XRZ A;  4ANX A;  3LVR E;  2CFZ A;  3FUH A;  3MJW A;  4TRQ A;  2XQ0 A;  2VTB A;  3IKO B;  4FLB A;  1JWF A;  4D10 C;  2J08 A;  3N71 A;  2XCC A;  2XPI A;  2YHC A;  4K0R A;  2XGO A;  3FU6 A;  2ZU6 B;  2CFU A;  4GU5 A;  4QFV A;  4ACL A;  2IU1 A;  4BSX A;  4BFR A;  5CMW A;  3ASF A;  4HXI A;  2X38 A;  3FH5 A;  4U0U A;  4UI9 J;  3EIJ A;  4WND A;  3BEE A;  5EX3 A;  1FCH A;  3D9I A;  3VLD A;  4EBA G;  4XI9 A;  5BT1 A;  4N2S A;  4EZK A;  2V8S E;  3CVV A;  3LCA A;  1UJK A;  1H2V C;  3U3W A;  3D9J A;  2NC9 A;  4UI9 K;  5CMY A;  3FHE A;  3TAX A;  3ZGQ A;  3RK6 A;  3PEV B;  3ZPJ A;  1NA0 A;  4UWG A;  2YHE A;  2UWJ G;  4GA0 A;  5CCL A;  4N39 A;  4ATG A;  3G2V A;  2X6J A;  3TG5 A;  3FP3 A;  4B8C B;  1WM5 A;  5BNW A;  4B94 A;  3SHF A;  4XI0 A;  4A3T A;  3CVX A;  4HS2 A;  2I1K A;  4GA1 A;  3APC A;  3QWP A;  4F7A A;  3QJZ A;  2LSV A;  3B7S A;  1IYG A;  2PL2 A;  4AP2 A;  4I9E A;  4YND A;  4E6H A;  5LCW C;  5FQ6 A;  3L17 A;  2YQ8 A;  2UY1 B;  5DBK A;  4BX8 A;  5JJ7 A;  3LPZ A;  3ZHE A;  2HM8 A;  2CG2 A;  4WNG A;  3MV3 B;  4GZ3 A;  3O4Z A;  2OV8 A;  2FEZ A;  3U9W A;  2WXI A;  3TJP A;  1JUQ A;  3SZ7 A;  3OXG A;  3SGH A;  4JXT A;  2J4B A;  3BG0 B;  4OVU A;  4UQY A;  2WXP A;  4W9R A;  3VTY A;  4BY6 A;  3GW4 A;  3CR3 A;  4HLE A;  3FEY A;  3I4R B;  4H7Y A;  5A23 A;  2Q7F A;  3CK9 A;  3MGB A;  5FZR A;  3IV0 A;  4XX5 A;  4MKT A;  4IN3 B;  3CHM A;  4L2L A;  5JJ6 A;  2PQN A;  2I9C A;  3CEQ A;  3FUE A;  4Q94 A;  4ANV A;  3QC1 A;  5HI7 A;  4CEM A;  3QWV A;  2WM9 A;  1B89 A;  4WUY A;  3QAQ A;  4L1B A;  3HIZ A;  2HO1 A;  3MA5 A;  5FQ8 A;  4B8A A;  4G24 A;  5JJT A;  2Y4U A;  4FHK A;  4JEH A;  4BWR A;  2J49 A;  3FTY A;  5AJL A;  4APO A;  3ZW3 A;  1E8Y A;  2L0T B;  5C2Y A;  2R59 A;  3I5P A;  3G2T A;  4GA2 A;  3KEZ A;  1IQR A;  5G04 C;  4PUC A;  4I6G A;  4I1O B;  4GZ5 A;  2VJ8 A;  3AU5 A;  3PVL A;  2KCK A;  1Z3X A;  5G2N A;  3RJV A;  2RG8 A;  1UG3 A;  4N5C A;  4EBA A;  2MHK A;  1L5J A;  4LCT A;  4ME2 A;  2YIN A;  4KZC A;  1ELW A;  3ZYL A;  3KS2 A;  4XE0 A;  4I2W A;  4KVO A;  3RRM B;  2IOS A;  1BPO A;  3D9P A;  1SZ9 A;  3CHP A;  4GZ6 A;  3PNT B;  1UN8 A;  3QAR A;  2X3M A;  4R7L A;  1KT1 A;  4AIF A;  3CK7 A;  2XHE A;  2VGX A;  3BG1 B;  3D9K A;  4UWL A;  2VTB B;  5KJK A;  4N3B A;  1UW4 B;  4FJY A;  4WNF A;  1HFA A;  4HOU A;  1UN9 A;  5D0O D;  3PH0 C;  4NAC A;  4B0Z A;  3ASG A;  3FTZ A;  2XPY A;  1SQM A;  3ZYK A;  3D9O A;  3QKY A;  4LER A;  3ZN3 A;  3FDH A;  4G26 A;  4C0M A;  3CQG B;  3CVQ A;  2IFU A;  4G1T A;  5G55 A;  3ESL A;  1EDU A;  4JL0 A;  2Y3A A;  3MEK A;  3UQ3 A;  4RSY A;  2LSU A;  4UQZ A;  3RO3 A;  3EHN A;  4EPZ A;  3KAE A;  3LXU X;  3PRZ A;  3CHQ A;  4UI9 C;  3R9A B;  5T8I A;  4LEU A;  3NQP A;  3CLJ A;  3FUI A;  4AV7 A;  3E4B A;  4L7T A;  3APD A;  5JHB A;  2L9B A;  3R7Q A;  3NF1 A;  4CT0 A;  4PDX A;  5FZS A;  3L16 A;  4Q69 A;  3TGO A;  1DVP A;  1YA0 A;  2R17 C;  4NRH B;  4YVO A;  5G05 J;  2JLB A;  2UY1 A;  3K9I A;  3SNX A;  3EIQ C;  3CHO A;  4J0U A;  5EKQ D;  1WY6 A;  4M3O A;  3S7J A;  3DPD A;  3HDX A;  3CKB A;  4G2V A;  2KM4 A;  3UX4 A;  3RRN B;  3CV0 A;  3QWW A;  3IHV A;  5AEN A;  1S0P A;  2FO7 A;  4YVQ C;  4GCO A;  3R7R A;  3VLE A;  5CCM A;  3EHM A;  4F53 A;  4AEZ C;  3PUJ A;  1HXI A;  4OYS A;  1E96 B;  3S2A A;  3PZD A;  4FHJ A;  1FVF A;  4CDR A;  1INZ A;  3RRU A;  3ML8 A;  3PS6 A;  1Y8M A;  2FUL A;  4AY5 A;  1TJC A;  3MKQ A;  4DLO A;  1FVH A;  3I4G A;  5BV1 A;  4JPS A;  3OXF A;  1HU3 A;  2I6H A;  4GYO A;  3UT8 A;  1NP7 A;  1P5Q A;  1E90 A;  3ULQ A;  3SF4 A;  2NXP A;  3FWV A;  2E2E A;  3Q47 B;  4I6J A;  1HS6 A;  2X6I A;  2AWI A;  3KD7 A;  4U07 A;  3NZS A;  4BTA A;  4CRW A;  3QNK A;  1GW6 A;  3P2B A;  3JQ0 A;  4DPR A;  4FJZ A;  4DK5 A;  2FF4 A;  3VLF A;  5FZQ A;  1XGW A;  1H19 A;  1Z6T A;  2WB2 A;  2DBA A;  1EF1 C;  2KC7 A;  3FUK A;  2IQC A;  3URZ A;  5HQ8 A;  4URK A;  2J9Q A;  3B7R L;  1SZA A;  3PEU B;  4KBQ A;  4I2Z A;  4N3A A;  1PAQ A;  3ONL A;  4KXK B;  5ENN A;  1MHQ A;  4F3V A;  4FAD A;  4EZL A;  2XEV A;  3C98 A;  3L54 A;  5A6C A;  3Q49 B;  1E7V A;  3ONK A;  3B7U X;  3L13 A;  2LNI A;  5A7D B;  2XGS A;  4A1G A;  2OVF A;  3GYZ A;  3JYS A;  4HOT A;  5ARG A;  1A17 A;  3D9L A;  2VSN A;  5FTP A;  5BW8 C;  4I9C A;  5KJL A;  3LKU A;  5LX8 A;  1HZ4 A;  4GZD A;  3ASH A;  3FTS A;  2WXL A;  4J8F A;  4LUN U;  2PM7 A;  4UQX A;  2J09 A;  1OWN A;  3FTX A;  2HR2 A;  2AVP A;  4BT9 A;  3AS5 A;  2WQ6 A;  3FTU A;  1OWM A;  2C0L A;  2GGF A;  3T5V A;  1Y6I A;  3FH8 A;  3PE4 A;  1NA3 A;  5ANR A;  5BPP A;  2IF4 A;  2VGX B;  3ZRH A;  5FQ7 A;  2XPZ A;  2WXM A;  4CCA A;  2X6F A;  3APF A;  3CIA A;  3UT7 A;  4GYY A;  1ELK A;  2EQX A;  2QFC A;  3FU3 A;  5FT9 A;  1HE8 A;  1H2T C;  3VTX A;  3CST A;  4JEU A;  4EQF A;  1QZ2 A;  2AXU A;  2IOL A;  5FJY A;  4ACK A;  3CVW A;  2LAI A;  3U66 A;  4L23 A;  2C2L A;  3JCK C;  1HH8 A;  1U3D A;  4A3V A;  2KCL A;  2X6K A;  1X5B A;  4KZ0 A;  3UMV A;  3ZYM A;  4U04 A;  5G05 C;  3OAW A;  4ILG A;  3L08 A;  4WWO A;  4Q96 A;  3FTV A;  2BF0 X;  4HOQ A;  4U0S A;  3AS4 A;  3OXL A;  1XNF A;  4IRU A;  1KT0 A;  5LOZ A;  3S7B A;  3HYM B;  4I6E A;  3ML9 A;  4AOF A;  4EZJ A;  1IQU A;  1W3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...