2XCCA

Crystal structure of pcrh from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
133
structure length
133
Chain Sequence
LAMLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN PCRH
publication title Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein binding
total genus 56
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xccA00
4XI0A 5EKQD 5HI7A 1NA0A 4GA1A 4B94A 2Y4UA 2LSUA 2C0LA 2XGOA 3AS5A 2XGSA 4BTAA 4G26A 1WM5A 2WPVA 2GW1A 4BT9A 1Y8MA 5D0QD 4N3BA 2VGXB 4J8FA 3OXFA 4AY6A 2HR2A 5G04J 3AS4A 3ZHEA 1HZ4A 3TG5A 4G2VA 3MA5A 2VYIA 2P58C 2Q7FA 4KXKB 4ABNA 5BW8C 5CHEE 2XCBA 2OOEA 4ME2A 3PE3A 3K9IA 5CCLA 3RKVA 3ZN3A 5KJLA 2FI7A 5A7DB 1IYGA 4CDRA 5LCWJ 3RU0A 4AY5A 3GYZA 3PDNA 3CKBA 3NF1A 2I6HA 1ELRA 2VGYA 4G1TA 4J0UA 2DBAA 4WNDA 5LCWC 3MV2B 2KATA 5BT1A 4KBQA 2C0MA 1QQEA 1ZU2A 4JHRA 3LCAA 2VSYA 2NC9A 4GYOA 3LKUA 3KS2A 4N2QA 2UY1B 4G24A 4HOTA 5ARFA 1YA0A 5EX3A 4GZ3A 2J9QA 4BT8A 4UI9J 2AVPA 4IN3B 3Q5MA 4BTBA 4HOUA 3FWVA 1OUVA 4UI9C 4U0ZA 4I2WA 5KJNA 3MKRA 3RIBA 3ZFWA 2E2EA 1HXIA 2KCKA 2JLBA 2V5FA 3ASHA 1P5QA 2KCVA 4YVQC 4A1SA 3N71A 4H7YA 3GZ1A 3U4TA 3CKCA 4O6FA 3S7FA 2HO1A 5DIZA 4AIFA 1TJCA 5JJ6A 2MHKA 3JYSA 4LEUA 5DBKA 1IHGA 4BWRA 5JJTA 2BUGA 4J8DA 4JA7A 3ASFA 3KAEA 4UQYA 2PL2A 4I1AA 4GZ5A 3U3WA 3O48A 5EX0A 5KJMA 4GZ6A 2YQ8A 5FTPA 1QZ2A 3HYMB 5HQ8A 4GYYA 4NQ0A 4XIFA 4HORA 2XPIA 3RJVA 2HYZA 1KLXA 3CVNA 2PQNA 2Y4TA 1KT0A 3CVLA 3E4BA 3CK7A 2XCCA 3BEEA 4WUYA 3VTXA 1FCHA 4G23A 3ASDA 3S7BA 3Q15A 4Y6CA 2VGXA 3CVQA 3LYAA 2LSVA 4I9EA 4JL0A 3IEGA 3LY7A 4NRHB 5CCMA 5A6CA 3LY8A 4RG9A 1B89A 3QKYA 1KT1A 5ARGA 4U0UA 1WAO1 3QWPA 2UWJG 1A17A 2FBNA 3SZ7A 5M72A 3VTYA 1ZBPA 2FF4A 3QWVA 3CV0A 4U0SA 4YVOA 4UQZA 4N3AA 3S7DA 2C2LA 5FT9A 5FZQA 2XEVA 2PZIA 3Q47B 1E96B 4GA2A 3LPZA 4WNEA 3ZGQA 3RO2A 3PE4A 4I9CA 2IFUA 1NA3A 1XNFA 3ZHEB 3QOUA 5G05C 2UY1A 3ESKA 3UUXA 4APOA 3CK9A 4I2ZA 4UQXA 2QFCA 2L6JA 3FFLA 2PQRA 4I17A 3CVPA 3ULQA 4HOQA 3UQ3A 5KJKA 4N5CA 4W9RA 4GYWA 2KCLA 4G25A 3TGOA 2WQHA 4XI9A 3Q4AB 3Q49B 1ELWA 4EQFA 3OXGA 4WNFA 4H7XA 3KD7A 4GCNA 2XGMA 2FO7A 3R9AB 3CEQA 4Y6WA 5G04C 4N39A 4U04A 3MV3B 4N2SA 2FEZA 4AM9A 1HH8A 4JA9A 3TG4A 2VQ2A 3GZ2A 3ZPJA 3FP3A 1W3BA 4GCOA 3QWWA 1NZNA 5D0OD 2YHCA 4N3CA 3OXLA 3LY9A 4GPKA 4WNGA 3AS8A 4GA0A 4CGWA 2VSNA 4CGVA 4F3VA 4UI9K 3CK8A 4RG6A 3UPVA 3WXXA 1PC2A 3EDTB 2ONDA 3SF4A 5C1DA 5BNWA 3TAXA 3URZA 2LNIA 2R5SA 5FZSA 4YNDA 2IF4A 3RO3A 4U07A 3GW4A 3MEKA 5G05J 5FZRA 4HOSA 2KC7A 4J8EA 5JJ7A 4KYOB 5AYWD 3QDNA 3ASGA 5FJYA 3S7JA
chains in the Genus database with same CATH superfamily
3HXFA 3DXKG 2ZGGA 3MGBA 4HI9A 5AJDA 4PS8A 1NA0A 3E34A 4TXRA 1FT2A 2C0LA 1OWMA 4OVVA 2F37A 4HS2A 3SNXA 2WPVA 2GW1A 2VGEA 3AJIA 2RG8A 4OAVB 2GRPB 2WQ7A 4PUCA 4Q96A 4K5CA 2EINE 2HR2A 2V8SE 3SD5A 5G04J 3AS4A 3EHMA 5KNHD 2XZTG 1UN8A 4G2VA 2VYIA 3FH8A 2P58C 3B95A 3EJNA 4CYMD 3PE3A 4PDXA 2F8YA 4FLBA 4ANUA 3ZN3A 4ACKA 2FI7A 1IYGA 1EYHA 4TUUA 4AY5A 5CBNA 3NF1A 3HDXA 2I6HA 1U2VG 3C98A 3MV2B 2KATA 3R7RA 3UINC 1QQEA 3CSTA 5EILA 1ZU2A 3OTNA 1JCRA 1IQRA 2GROB 3SI5A 3Q73A 2NC9A 3I4RB 3KS2A 3JUEA 3PZ2A 1YA0A 5EX3A 3FTVA 3QAQA 3G2VA 1E7UA 2AVPA 4IN3B 4HOUA 4KVOA 1XGWA 1OUVA 2WXKA 2HM8A 2OEVA 3CHMA 2GRLA 3FTZA 4HBDA 5KNGA 4CT0A 1OCCE 3RIBA 3CHOA 4NURA 3B7TA 2E2EA 2M63A 1P5QA 3SFYA 3V30A 4K5BA 3N71A 2B0OE 3V79K 2OCCE 5EIDA 3W9GA 3CKCA 2HO1A 1TEZA 2R03A 4G8LA 5AENA 3L17A 2EIJE 1AP7A 4K03A 5ENNA 3PS6A 3ZEFA 1DC2A 4I1MA 4URKA 3CVXA 3CR3A 5HRYA 4I1AA 4GZ5A 3ZKJA 1TN8A 2ZISA 2P9SG 2YQ8A 1HE8A 2LO6A 1K8KG 2FULA 2GRRB 2XPIA 3RJVA 1WY6A 4BX9A 2XRZA 4NIKA 1KLXA 2PQNA 3T8KA 3MYVA 2LAIA 3VTXA 4HRMB 4J7WA 5AQBA 4YDEA 3FU0A 3ASDA 4Y6CA 4TRQA 3LYAA 3CLJA 4J8YA 1E8WA 2PM7A 3LY7A 4GTTA 2QYUA 5A6CA 1Q2ZA 4HXIA 1B89A 5ARGA 4MKTA 3D9NA 3UT7A 2FBNA 3SY2A 4JD2G 2KBXA 3B13A 3CV0A 4IRUA 4YVOA 3S7DA 3T5VA 3DBSA 2C2LA 1EF1C 1E8YA 2XEVA 2OVFA 1E96B 3C3RA 3FEXA 3C72A 4A3VA 4GA2A 3ZGQA 1IQUA 3SFXA 3PE4A 2IFUA 5BUZA 2A5EA 1N4PA 3JQ0A 3QOUA 5G05C 5CRUA 3R9MA 1TNZA 4FP7A 4RSYA 2WXOA 4U8HA 2EILE 1YMPA 4HB5A 2IO2C 2QFCA 5D66A 3FUNA 4YDWA 3FH5A 3TWWA 4AXHA 5IY5E 4I17A 3CVPA 3DPDA 3CSFA 3IXEA 4GTPA 4W9RA 5CEAA 1OWOA 1Y6IA 4G25A 3TGOA 2WQHA 3FY4A 3FUFA 3ZW3A 2DZOA 3OXGA 5ITZF 4CDNA 3NZUA 1NFIE 4WNFA 3MJWA 4ANXA 4FU3A 3ENEA 2DVWA 3E33A 1SA5A 4JA9A 1OCRE 1HU3A 3FP3A 1Z6TA 3ZXPA 4DX1A 4ILHB 4E6HA 4GCOA 5LOZA 4MLPA 4ATZD 3D9PA 3APCA 4CCAA 4ILGA 1OY3D 5D0OD 4N3CA 3V2OA 4GPKA 3AS8A 1O1TA 2WB2A 3C5RA 3GZSA 3UIPC 2VTBB 3LJNA 2KZTA 4TV3A 3L13A 1S70B 4G8KA 2P9NG 1HO8A 3G2UA 2LNIA 2R5SA 3NZSA 4HNAD 4YNDA 2IF4A 3LVRE 3RO3A 3Q9NC 1QYMA 1KPSB 3CHQA 3NOGD 3MEKA 4BSXA 4J8EA 5JJ7A 5AQAA 5ENPD 1RW2A 4ATGA 3ASGA 3S7JA 3AG2E 2ETBA 3FUHA 2EIME 3MKQA 3ISMC 1E7VA 5EKQD 1LD8A 4MRUA 4GA1A 1UJKA 1MHQA 3LEWA 2Y4UA 2IOSA 3UM2A 2LSUA 3ML8A 5E76A 3PZ4A 2XGSA 4G26A 1HG5A 2HE0A 4DX5D 2X6HA 4EPZA 2P9IG 1UW4B 4JHKA 4A63B 5BPPA 1O1RA 4FHKA 4ANWA 3EHRA 4J8FA 2IQCA 2CHZA 5T3RA 4HLLA 4U96D 1HZ4A 3FULA 3ZYLA 2YINA 3FDHA 4LG6A 4E85A 1K1AA 1X81A 4KXKB 5BW8C 2OOEA 4ME2A 3NB2A 5BXUA 4LNGA 2BKGA 4U7EB 4M7CA 1TNYA 3K9IA 5CCLA 4LNUD 3C3QA 1NP7A 1V55E 1MX6A 4HVBA 5A7DB 2JEKA 5G2NA 3B7SA 3KEAA 3RU0A 3TJPA 3TWUA 1N9AA 3GYZA 3PDNA 3CKBA 5T8IA 1DCEA 4KBQA 1INZA 3LS8A 5B1BE 3SHFA 4JHRA 2J4DA 4KT6B 1GW6A 2KXPC 3CVYA 1BLXB 4RLYA 1NL4A 4F6RD 5KWDA 1N0QA 2I1KA 4N2QA 4K5AB 2UY1B 4EZJA 3SQVA 3ABLE 4DX7D 3V2XA 5EIBE 1DCQA 2XHEA 3HXCA 1FT1A 4BSZB 2BF0X 1TR4A 3BU8A 2ILRA 2EIKE 2AXVA 3MCXA 4KMOA 1AWCB 4WWOA 2V5FA 2CFUA 2KCVA 3J5PA 5FQ4A 3Q78A 4U95D 1OXJA 1H2VC 4YVQC 3AU4A 4BETA 2F0YA 1OWLA 4A1SA 5KBAA 3ONLA 4H7YA 1SA4A 3I3NA 4GAAA 1NI1A 3IHYA 5D2MC 4HI8A 4U63A 2Y1LE 3UM1A 3JYSA 5DBKA 2L6BA 4PS3A 2OV8A 3PUKA 3D9IA 5JJTA 2ETAA 2ETCA 4ILIA 4UQYA 3JXJA 4DI4A 1IXVA 5HKPA 1KZOA 3ZIMA 3BG0B 1HG2A 4C0EA 5EX0A 4J6IA 2WMNA 3ONKA 4GZ6A 5FTPA 3QB2A 3HYMB 3JCKC 3AG4E 1YCSB 3BQOA 4HORA 3D9KA 4JB8P 3LDZA 2XRYA 3CK7A 3CVLA 3E4BA 2XCCA 3DSTA 5AN8A 5ANLA 2MOWA 4C48B 4GTMA 4G23A 2L0IA 3S7BA 3DSWA 3CVQA 3G2WA 4XX5A 4UWLA 1TYQG 4YDYA 4JL0A 3IEGA 1N0RA 2LUHA 3DSVA 4RG9A 4HRNA 3CHPA 4U0UA 5AAOA 2XENA 3QK0A 3UX4A 5C2YA 5FWQA 3SZ7A 4GZDA 5M72A 3VTYA 1N52A 3VLDA 1FVHA 4UWKA 3FUEA 4LNBA 3ESLA 2IOLA 2XQ0A 2LXLA 3L16A 4UUCA 2H6GA 3QJZA 3Q47B 4XKBA 4LERA 4HRLA 3J5QB 3LPZA 1TNBA 4F1SA 2OVBA 5B1AE 4I43A 1NA3A 3D9LA 3U66A 2P9KG 3ZHEB 4JW1A 3JQ1A 3RRUA 3B7UX 4EBAG 3ESKA 3UUXA 4APOA 4UQXA 1OWNA 3FFLA 3MX3A 2PQRA 5CBOA 2WXLA 1U3CA 4PS7A 5KJKA 4GYWA 4GZCA 3Q7AA 3HHMA 5EN5D 3V31A 4H7XA 3UXGA 3KD7A 4A55A 5EDSA 2AXZA 4K0RA 3EIJA 1SZ9A 2XGMA 3R9AB 2GGFA 1Z3YA 3MV3B 1SVXA 4AJWA 3FUDA 3FTSA 4GTOA 4CDMA 4IULA 5FIOA 3VLEA 2Y69E 1QNFA 1WG0A 1D9SA 2L0TB 2MYOA 3PUJA 3QWWA 1H6KA 3D9OA 3LY9A 3S2AA 5JA4D 2XEEA 4GA0A 3ABKE 4BERA 3QC1A 1IKND 4F53A 5CRVA 3ASOE 1PC2A 1JCSA 3SF4A 5AQ9A 1UG3A 4L2LA 4QQIA 4KVMA 5BNWA 3URZA 5FZSA 3DRAA 2RFMA 4DJAA 2R2LA 2ZU6B 2AXUA 5FZRA 5G05J 4PH4B 4EHMA 1O1SA 1MYOA 3QDNA 3I5PA 1DVPA 3O4ZA 2E0IA 1K1BA 3HXEA 1EPUA 3Q79A 3SGHA 4RVBA 3LVQE 2XGOA 4L1BA 4FHJA 4DX6D 3U64A 4I6EA 2I9CA 3JUIA 3CHSA 5FQ6A 4JC8A 3D3MA 5D0QD 2VGXB 5BV1A 3OXFA 4GTVA 1JUQA 4IYPA 1UOHA 1ELKA 2J08A 3UTMA 3TG5A 3P2BA 5BV0A 3MA5A 2H6IA 3L82A 1N54A 5CHEE 3PNLB 3FTYA 2YNQA 2J09A 1L5JA 2J4BA 4EZKA 3RKVA 4ZFHA 1UJJA 3NOCD 2WXIA 5KJLA 1HFAA 2J8SD 4CDRA 2X6IA 1HX8A 3DPYA 3APDA 2VGYA 4G1TA 2J49A 4WNDA 2ZIRA 5BT1A 4JXTA 2C0MA 3SBSA 4OAUC 3RK6A 4BESA 3LCAA 4GTRA 1N95A 2VSYA 3G2TA 1PY1A 4GYOA 1VDYA 4GB9A 4AEZC 1TJFA 1E8ZA 1YYHA 4WAFA 4BEPA 4R7LA 2XPZA 4G24A 1LF8A 4HOTA 5ARFA 4GZ3A 2J9QA 3VLFA 4BT8A 2H6FA 4B93B 5E75A 4UI9J 4BTBA 2I1JA 1H6OA 2B6CA 4UI9C 1LD7A 2KM4A 3ZFWA 3HVEB 5JHBA 5CMWA 4B8AA 3ABME 2I2OA 4FJZA 3FUIA 2VTBA 2CG3A 3NAWA 3GZ1A 1EDUA 5ENTD 2L9BA 4NACA 3AU5A 3S7FA 4X8QA 1N4QA 5DIZA 4DI3A 3D9MA 4AIFA 1TJCA 5H7PA 2MHKA 3NBNB 4WWPA 4XKCA 4D10C 3MZLB 1OWPA 2WXMA 1MJ0A 3TWRA 4J8DA 3FH7A 4JA7A 3BUAA 3KAEA 3PVLA 3LJ3A 2PL2A 4TUMA 3HIZA 3TL5A 4A1GA 1OT8A 3U3WA 3IHVA 3T5XA 3O48A 3EUVA 2NXPA 5KJMA 1S64A 1QZ2A 5HQ8A 4GYYA 4NQ0A 3ASNE 1N4SA 1X5BA 4U8YD 2WXNA 3QNKA 5EYLA 3CVNA 3PZ1A 5ENOD 3T8MA 1KT0A 4QFVA 3BEEA 4LUNU 2QZAA 3Q75A 1N11A 3FU3A 4MBGA 3P1UA 1IHBA 1SZAA 2DIWA 4AP2A 1MX2A 2LSVA 4I9EA 1JPLA 3UM3A 1HS6A 4NRHB 3HXBA 3LY8A 1KT1A 3FU5A 3Q7FA 5LP0A 2R17C 3KEZA 4L7TA 3KSQA 3IBEA 2P9UG 3QARA 1ZBPA 3QWVA 4CT4A 2OEWA 4C0MA 2BTDA 4I6GA 4UQZA 4LRZA 2H6HA 1MZCA 2ZXWE 2RD0A 1TNOA 5FT9A 3RAUA 4WNEA 3ZNGA 2DYSE 3AG3E 4I9CA 3E32A 1TNUA 3PREA 4BY6A 3CVVA 4O1OA 1XNFA 2AJAA 2PM6A 2UY1A 3UKUG 4DRXE 3ZYQA 3PEUB 1PAQA 1HF8A 3W9FA 4I2ZA 2L6JA 4OYSA 5JMND 2Y0BG 3U9WA 2CFZA 4HOQA 2X3MA 2P9PG 5CEDB 4N5CA 2KCLA 4XI9A 2JABA 3Q49B 1OCOE 1TN6A 1ELWA 3SBTB 4EQFA 4AVXA 4DUIA 3CQGB 2AW6A 4FJYA 2R59A 4B89A 3X2QE 4GCNA 3UI2A 4FADA 4U8VD 5KCMA 3CEQA 4Y6WA 5G04C 2WXFA 4N39A 4U04A 2XEHA 4CRWA 3TG4A 2VQ2A 4GMJA 3ZPJA 4P29A 3HRAA 5G55A 5J08A 5A23A 3UMVA 1K3ZD 2WXGA 2CG2A 3UIOC 3PH0C 4L9PA 2YHCA 2IO3C 1Z3XA 2RKKA 2EQXA 4WNGA 2BKKB 2VSNA 3C3OA 5ENRD 5LX8A 4UI9K 3CK8A 3UPVA 3HG0D 2GRNB 3RRNB 4CZ2D 4YDOA 3EDTB 4Q94A 2ONDA 4HQDA 3L08A 2R05A 5C1DA 4KZCA 4J8SA 3R7QA 1DNPA 2MRIA 3DEPA 1D8EA 4TXPA 5J90A 1JCQA 1OCZE 4U07A 4JPSA 2KC7A 2WMOA 4KYOB 5FINA 5AYWD 5FJYA 3L9TA 3ZYMA 4XI0A 2LAHA 1U3DA 4F1PA 2IY0C 3TWXA 2V5QC 5HI7A 5LFAA 4V3IA 5AQ7A 4B94A 1ZB1A 4DK5A 1QBQA 3RRMB 4EECA 2R02A 2NYJA 1S63A 3FTUA 2WXPA 3Q9UC 2X38A 3AS5A 2AWIA 4BTAA 1WM5A 4GMLA 4GPMA 4BT9A 1Y8MA 1V54E 3PRZA 4N3BA 5BXOA 1SQMA 4AY6A 3D9HA 4ANVA 4F7AA 2ZGDA 3ZHEA 4MS6A 2WM9A 3CHRA 5B3SE 2Q7FA 4ABNA 4B0ZA 1N4RA 2XCBA 3CVUA 3UM0A 3PZ3A 2V0PA 1D8DA 2RFAA 4FLHA 2WVIA 4WWNA 3FUJA 2XS8A 5LCWJ 2IONA 3FUMA 2XS1A 3FTWA 1ELRA 3ZUVB 4J0UA 2DBAA 5LCWC 2X6FA 2YHEA 3ULYA 1UN9A 1BD8A 1JWFA 3CVWA 3LKUA 4FA6A 1O5MA 3DWLG 2WXJA 4DPRA 3FU6A 1BI8B 4UWGA 4GMRA 3IV0A 4JVSA 3Q5MA 1WDYA 2QC9A 1BI7B 3FEYA 3DSSA 3FWVA 4A3TA 1G3NB 2Y3AA 4U0ZA 5AARA 4I2WA 2P9LG 5KJNA 3MKRA 1E8XA 1HXIA 2KCKA 2JLBA 3TWQA 3ASHA 2GRQB 3FTXA 5ENSD 5T4YA 2VSOE 2VSXE 2V4LA 3WG7E 3U4TA 2QY7A 4O6FA 4I6JA 3CIAA 3TWSA 2BEDA 5JJ6A 2P2CP 1MQSA 4LEUA 3TWVA 4Z68A 2GRMA 4O60A 1IHGA 4BWRA 1MX4A 4FULA 2X6KA 2BUGA 3AAAC 2WXRA 4Q69A 3ASFA 3EHNA 4JZYA 1SW6A 4BX8A 5CECB 4O1PA 3ZYKA 1S0PA 1H2UA 3ZVVA 4FC8A 1FPPA 2FO1E 4XIFA 2WXHA 3LXUX 3OAWA 4AOFA 2HYZA 2KZTB 1JWGA 4DLQA 2NSZA 3E37A 2DWZA 3DSXA 2Y4TA 3DXMG 2F8XK 4EBAA 3TXMA 4WUYA 1FCHA 3ZRHA 4XEIG 4CEMA 1A5EA 4XE0A 3Q15A 2VGXA 3F6QA 3PZDA 3IKOB 2DCPA 1KZPA 5CCMA 2XZDG 4OVUA 4HLEA 3QKYA 3HXDA 3MKQB 1WAO1 3QWPA 2UWJG 1H19A 1A17A 4KZ0A 2WQ6A 4DX2A 1E90A 4AV7A 4TXQA 1RZ4A 2FF4A 4UWHA 3EU5A 2DZNA 4U0SA 4N3AA 5AIJA 5FZQA 3G2SA 3UT4A 2PZIA 3CGHA 3EIQC 4GTSA 2WXQA 3RO2A 3KSLA 4APFA 3BG1B 3APFA 5FQ7A 1H6PA 5EYPF 4JHJA 3UKRG 3CK9A 1TN7A 5CERB 3PNTB 1BPOA 1N94A 1FVFA 5CMYA 3TXNA 3JXIA 4RQIA 3ULQA 3UQ3A 4L23A 1H2TC 3HVEA 1Z5SC 5HS0A 4ZHBA 3Q4AB 4I1OB 1BU9A 4HFGA 3ZXSA 3DEOA 2CHWA 2CHXA 2VJ8A 5ANRA 4N5QA 4GTQA 4JEUA 3ML9A 1LTXA 4UWFA 2FO7A 4EZLA 3T9KA 3RSEG 4N2SA 2FEZA 4AM9A 1HH8A 3GZ2A 2V4HC 3EU9A 3L6AA 4L2YA 1W3BA 3D9JA 4XZ4A 3NQPA 3SFZA 4C9BB 1NZNA 2A5UA 2PNNA 2J07A 3L22A 2DYRE 3OXLA 3FHEA 3CQCB 4DLOA 2IEJA 2A4ZA 2IJGX 4BFRA 4CGWA 4G11A 4CGVA 2XPYA 4F3VA 4M3OA 1H0AA 3FUKA 4RG6A 5JHAA 3WXXA 3EHQA 3L54A 3PEVB 3DSUA 3AG1E 3UT8A 4B8CB 3TAXA 3E30A 4ACLA 2QYJA 4GU5A 3GW4A 4LCTA 4JEHA 3SO8A 3I4GA 2X6JA 4LSZE 2LXMA 5ENQD 3ZU7B 5FQ8A 4HOSA 3TWTA 5AJLA 3B7BA 3ULEG 2IU1A 3B7RL
chains in the Genus database with same CATH topology
3O4ZA 3FUHA 3ZYMA 4XI0A 3MGBA 2E0IA 2LAHA 1U3DA 3MKQA 1E7VA 5EKQD 5AJDA 4PS8A 4MRUA 1NA0A 4GA1A 4V3IA 5HI7A 5LFAA 1UJKA 1EPUA 4B94A 4DK5A 1MHQA 3RRMB 3LEWA 4EECA 2Y4UA 3SGHA 2IOSA 2LSUA 4RVBA 2C0LA 3ML8A 1OWMA 3LVQE 5E76A 3FTUA 2XGOA 4OVVA 2WXPA 2X38A 4HS2A 3AS5A 2XGSA 4L1BA 2AWIA 4BTAA 4FHJA 4G26A 3SNXA 1WM5A 2WPVA 1HG5A 4GMLA 4I6EA 3U64A 2GW1A 2I9CA 2X6HA 4EPZA 3JUIA 3CHSA 1UW4B 4BT9A 5FQ6A 4JHKA 2RG8A 4JC8A 2WQ7A 5BPPA 1Y8MA 3PRZA 4PUCA 3D3MA 4FHKA 4ANWA 5D0QD 4N3BA 2VGXB 1SQMA 4J8FA 5BV1A 3OXFA 4AY6A 2IQCA 2CHZA 1JUQA 4Q96A 5T3RA 4ANVA 4F7AA 4IYPA 2HR2A 2V8SE 3SD5A 5G04J 3AS4A 3ZHEA 1ELKA 1HZ4A 2J08A 3EHMA 3FULA 2YINA 3ZYLA 3FDHA 3TG5A 1UN8A 4MS6A 2WM9A 3P2BA 4G2VA 5BV0A 3MA5A 3CHRA 4E85A 2VYIA 3FH8A 2P58C 2Q7FA 4KXKB 4ABNA 5BW8C 1N54A 4B0ZA 5CHEE 3EJNA 2XCBA 2OOEA 4ME2A 3PE3A 3PNLB 4PDXA 3CVUA 3FTYA 2YNQA 2J09A 2V0PA 3K9IA 4FLBA 1L5JA 4FLHA 4ANUA 5CCLA 2J4BA 4EZKA 3RKVA 2WVIA 1NP7A 1UJJA 3ZN3A 2WXIA 4WWNA 4ACKA 5KJLA 2FI7A 1HFAA 4HVBA 5A7DB 1IYGA 3FUJA 4CDRA 2JEKA 1EYHA 2X6IA 5G2NA 3B7SA 4TUUA 3TJPA 3RU0A 5LCWJ 4AY5A 2IONA 3GYZA 3PDNA 3FUMA 1HX8A 3CKBA 3HDXA 3NF1A 3APDA 3FTWA 2I6HA 1ELRA 2VGYA 4G1TA 4J0UA 3C98A 2J49A 2DBAA 4WNDA 5LCWC 5T8IA 2X6FA 3MV2B 2KATA 2YHEA 4JXTA 3R7RA 5FJYA 4KBQA 2C0MA 5BT1A 1INZA 1QQEA 1UN9A 3CSTA 3LS8A 3RK6A 3SBSA 3SHFA 1ZU2A 4JHRA 2J4DA 3OTNA 4KT6B 1IQRA 1GW6A 3LCAA 3SI5A 3CVYA 2VSYA 3G2TA 1PY1A 2NC9A 1JWFA 1VDYA 4GYOA 4GB9A 4AEZC 1TJFA 1E8ZA 2I1KA 3CVWA 3LKUA 3I4RB 3KS2A 4N2QA 4FA6A 4WAFA 2UY1B 4R7LA 2XPZA 4G24A 1LF8A 2WXJA 4DPRA 4EZJA 5ARFA 4HOTA 3FU6A 1YA0A 5EX3A 3FTVA 2J9QA 4GZ3A 3QAQA 4UWGA 3VLFA 4BT8A 2XHEA 3G2VA 1E7UA 5E75A 4UI9J 2AVPA 4IN3B 3IV0A 4JVSA 3Q5MA 3S7JA 4BTBA 4HOUA 2I1JA 3FEYA 3FWVA 1XGWA 1OUVA 2WXKA 4KVOA 2HM8A 4A3TA 3CHMA 4UI9C 2GRLA 2BF0X 3FTZA 2Y3AA 2ILRA 4U0ZA 2AXVA 4CT0A 4I2WA 5KJNA 3MKRA 3MCXA 4KMOA 3RIBA 2KM4A 3ZFWA 3HVEB 4WWOA 5JHBA 5CMWA 4B8AA 3CHOA 4NURA 3B7TA 2E2EA 2M63A 1E8XA 1HXIA 2KCKA 2JLBA 2V5FA 3ASHA 1P5QA 2CFUA 2KCVA 3FTXA 2I2OA 5FQ4A 5T4YA 1H2VC 4YVQC 4FJZA 2VSOE 2VSXE 3AU4A 3FUIA 2VTBA 2V4LA 1OWLA 4A1SA 3N71A 2CG3A 3ONLA 4H7YA 3GZ1A 3U4TA 1EDUA 2QY7A 3I3NA 2L9BA 4GAAA 4NACA 3CKCA 3AU5A 4O6FA 3S7FA 3IHYA 4I6JA 2HO1A 1TEZA 3CIAA 5AENA 5DIZA 4DI3A 3D9MA 4AIFA 4U63A 1TJCA 3L17A 5JJ6A 1MQSA 2MHKA 3JYSA 4K03A 4LEUA 5ENNA 5DBKA 2GRMA 3PS6A 1IHGA 4BWRA 4WWPA 4PS3A 4XKCA 3ZEFA 2OV8A 4D10C 3PUKA 3MZLB 4FULA 1OWPA 2WXMA 3D9IA 5JJTA 2X6KA 2BUGA 4I1MA 4J8DA 2WXRA 3FH7A 4ILIA 4JA7A 4Q69A 4URKA 3CVXA 3ASFA 3CR3A 3EHNA 3KAEA 3PVLA 4JZYA 4UQYA 4DI4A 3LJ3A 4BX8A 2PL2A 4I1AA 3ZYKA 3HIZA 4GZ5A 1S0PA 1H2UA 3BG0B 3TL5A 4A1GA 3ZIMA 3ZVVA 3U3WA 1HG2A 3IHVA 3T5XA 4FC8A 3O48A 4C0EA 2NXPA 5EX0A 4J6IA 2WMNA 3ONKA 5KJMA 4GZ6A 2YQ8A 1HE8A 2LO6A 5FTPA 1QZ2A 3QB2A 3HYMB 2FULA 5HQ8A 4GYYA 3JCKC 4NQ0A 4XIFA 4HORA 2XPIA 3RJVA 1X5BA 2WXHA 1WY6A 3D9KA 3LXUX 3OAWA 4BX9A 2WXNA 2HYZA 2KZTB 1JWGA 3QNKA 4AOFA 4DLQA 2XRZA 1KLXA 2NSZA 3LDZA 3CVNA 2PQNA 2XRYA 2Y4TA 3T8MA 3MYVA 2LAIA 1KT0A 3CK7A 3CVLA 3E4BA 4QFVA 2XCCA 4EBAA 3BEEA 3TXMA 4WUYA 3VTXA 1FCHA 4LUNU 5ANLA 2MOWA 3ZRHA 4CEMA 3FU3A 3FU0A 4G23A 3ASDA 4XE0A 2L0IA 3S7BA 3P1UA 3Q15A 4Y6CA 2VGXA 4TRQA 3CVQA 3LYAA 1SZAA 2DIWA 4AP2A 3CLJA 2LSVA 3G2WA 4I9EA 1JPLA 1E8WA 4UWLA 4XX5A 3PZDA 2PM7A 4JL0A 3IEGA 1HS6A 3LY7A 4NRHB 3IKOB 2DCPA 5CCMA 4OVUA 5A6CA 3LY8A 4RG9A 4HXIA 4HLEA 1B89A 3QKYA 1KT1A 3FU5A 5ARGA 4MKTA 3CHPA 3MKQB 1WAO1 3D9NA 3QWPA 2UWJG 4U0UA 3QK0A 1H19A 1A17A 4KZ0A 3UT7A 2R17C 3UX4A 2WQ6A 2FBNA 5C2YA 5FWQA 3KEZA 1E90A 3SZ7A 4L7TA 4GZDA 4AV7A 5M72A 3VTYA 1N52A 3IBEA 3QARA 1ZBPA 3VLDA 2FF4A 3QWVA 4CT4A 4UWHA 1FVHA 4UWKA 3B13A 4C0MA 3FUEA 2BTDA 4I6GA 3CV0A 4IRUA 4U0SA 4YVOA 4UQZA 3ESLA 4LRZA 2IOLA 4N3AA 3S7DA 3T5VA 3DBSA 5AIJA 2C2LA 2XQ0A 2RD0A 1EF1C 5FT9A 5FZQA 1E8YA 2XEVA 2OVFA 3G2SA 3L16A 3UT4A 2PZIA 3CGHA 3QJZA 3Q47B 4XKBA 1E96B 3FEXA 3EIQC 4LERA 4A3VA 4GA2A 2WXQA 3LPZA 4WNEA 3RO2A 3ZGQA 1IQUA 4F1SA 4APFA 2OVBA 3BG1B 3PE4A 4I9CA 2IFUA 4I43A 1NA3A 5BUZA 3PREA 4BY6A 3CVVA 3D9LA 1XNFA 3JQ0A 3U66A 3APFA 3ZHEB 3QOUA 4JW1A 3JQ1A 5G05C 5FQ7A 3RRUA 3B7UX 4EBAG 4JHJA 2PM6A 2UY1A 4FP7A 3ESKA 3UUXA 4APOA 4RSYA 2WXOA 3CK9A 3ZYQA 3PEUB 1PAQA 4U8HA 1HF8A 4I2ZA 3PNTB 1BPOA 4UQXA 5LP0A 1OWNA 1FVFA 2QFCA 2L6JA 3FFLA 3FH5A 3FUNA 4OYSA 4AXHA 5CMYA 3MX3A 3TXNA 2PQRA 4I17A 3CVPA 3DPDA 3ULQA 3U9WA 2CFZA 2WXLA 4HOQA 3UQ3A 2X3MA 3CSFA 1U3CA 4PS7A 5KJKA 4N5CA 4W9RA 1OWOA 4GYWA 1Y6IA 4GZCA 1H2TC 4L23A 2KCLA 4G25A 3HVEA 3TGOA 2WQHA 4XI9A 3HHMA 3FY4A 3Q4AB 3FUFA 3ZW3A 3Q49B 4I1OB 4HFGA 3ZXSA 1ELWA 3SBTB 4EQFA 3OXGA 4AVXA 3NZUA 4CDNA 4WNFA 2CHWA 2CHXA 2VJ8A 3MJWA 5ANRA 3CQGB 2AW6A 4FJYA 2R59A 4H7XA 4B89A 4ANXA 3KD7A 4JEUA 3ML9A 4GCNA 4FU3A 4UWFA 4A55A 4FADA 2AXZA 5EDSA 4K0RA 3ENEA 3EIJA 1SZ9A 2XGMA 2FO7A 5KCMA 3R9AB 4EZLA 3CEQA 4Y6WA 5G04C 2GGFA 2WXFA 4N39A 1Z3YA 3MV3B 4U04A 4AJWA 3FUDA 4N2SA 2FEZA 4AM9A 4CRWA 1HH8A 3FTSA 4JA9A 3TG4A 4CDMA 2VQ2A 3GZ2A 4GMJA 3ZPJA 1HU3A 3L6AA 4IULA 4P29A 5G55A 3FP3A 1W3BA 1Z6TA 4L2YA 5J08A 4ILHB 3D9JA 4XZ4A 3VLEA 5A23A 1QNFA 4GCOA 5LOZA 3UMVA 4E6HA 4MLPA 3NQPA 2WXGA 2CG2A 3PH0C 3D9PA 2L0TB 3APCA 3PUJA 3QWWA 3SFZA 4ILGA 4C9BB 4CCAA 1NZNA 5D0OD 2YHCA 2A5UA 1Z3XA 2J07A 1H6KA 3D9OA 3L22A 4N3CA 3OXLA 2EQXA 3LY9A 3S2AA 4GPKA 4WNGA 3FHEA 3AS8A 3CQCB 4GA0A 4DLOA 2A4ZA 2IJGX 4BFRA 4CGWA 2VSNA 2WB2A 3QC1A 4G11A 4CGVA 2XPYA 4F3VA 5LX8A 4UI9K 3GZSA 4M3OA 2VTBB 1H0AA 3FUKA 3CK8A 4RG6A 4F53A 3UPVA 3RRNB 5JHAA 2KZTA 3WXXA 3I5PA 4TV3A 1PC2A 3EDTB 3L13A 3L54A 3PEVB 4Q94A 2ONDA 3L08A 3SF4A 1UG3A 4L2LA 3UT8A 4B8CB 5C1DA 4KZCA 4KVMA 5BNWA 3TAXA 4J8SA 1HO8A 3G2UA 2LNIA 1DNPA 2MRIA 3R7QA 3URZA 2R5SA 3NZSA 5FZSA 4ACLA 4YNDA 2IF4A 3LVRE 3RO3A 5J90A 4GU5A 4U07A 3GW4A 4LCTA 4JEHA 4JPSA 3CHQA 4DJAA 3I4GA 2X6JA 2ZU6B 2AXUA 3MEKA 5FZRA 4PH4B 5G05J 4BSXA 5FQ8A 4HOSA 2KC7A 4J8EA 5JJ7A 5AJLA 2WMOA 4KYOB 5AYWD 4ATGA 3QDNA 3ASGA 2IU1A 3B7RL 1DVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI0 A;  5EKQ D;  5HI7 A;  1NA0 A;  4GA1 A;  4B94 A;  2Y4U A;  2LSU A;  2C0L A;  2XGO A;  3AS5 A;  2XGS A;  4BTA A;  4G26 A;  1WM5 A;  2WPV A;  2GW1 A;  4BT9 A;  1Y8M A;  5D0Q D;  4N3B A;  2VGX B;  4J8F A;  3OXF A;  4AY6 A;  2HR2 A;  5G04 J;  3AS4 A;  3ZHE A;  1HZ4 A;  3TG5 A;  4G2V A;  3MA5 A;  2VYI A;  2P58 C;  2Q7F A;  4KXK B;  4ABN A;  5BW8 C;  5CHE E;  2XCB A;  2OOE A;  4ME2 A;  3PE3 A;  3K9I A;  5CCL A;  3RKV A;  3ZN3 A;  5KJL A;  2FI7 A;  5A7D B;  1IYG A;  4CDR A;  5LCW J;  3RU0 A;  4AY5 A;  3GYZ A;  3PDN A;  3CKB A;  3NF1 A;  2I6H A;  1ELR A;  2VGY A;  4G1T A;  4J0U A;  2DBA A;  4WND A;  5LCW C;  3MV2 B;  2KAT A;  5BT1 A;  4KBQ A;  2C0M A;  1QQE A;  1ZU2 A;  4JHR A;  3LCA A;  2VSY A;  2NC9 A;  4GYO A;  3LKU A;  3KS2 A;  4N2Q A;  2UY1 B;  4G24 A;  4HOT A;  5ARF A;  1YA0 A;  5EX3 A;  4GZ3 A;  2J9Q A;  4BT8 A;  4UI9 J;  2AVP A;  4IN3 B;  3Q5M A;  4BTB A;  4HOU A;  3FWV A;  1OUV A;  4UI9 C;  4U0Z A;  4I2W A;  5KJN A;  3MKR A;  3RIB A;  3ZFW A;  2E2E A;  1HXI A;  2KCK A;  2JLB A;  2V5F A;  3ASH A;  1P5Q A;  2KCV A;  4YVQ C;  4A1S A;  3N71 A;  4H7Y A;  3GZ1 A;  3U4T A;  3CKC A;  4O6F A;  3S7F A;  2HO1 A;  5DIZ A;  4AIF A;  1TJC A;  5JJ6 A;  2MHK A;  3JYS A;  4LEU A;  5DBK A;  1IHG A;  4BWR A;  5JJT A;  2BUG A;  4J8D A;  4JA7 A;  3ASF A;  3KAE A;  4UQY A;  2PL2 A;  4I1A A;  4GZ5 A;  3U3W A;  3O48 A;  5EX0 A;  5KJM A;  4GZ6 A;  2YQ8 A;  5FTP A;  1QZ2 A;  3HYM B;  5HQ8 A;  4GYY A;  4NQ0 A;  4XIF A;  4HOR A;  2XPI A;  3RJV A;  2HYZ A;  1KLX A;  3CVN A;  2PQN A;  2Y4T A;  1KT0 A;  3CVL A;  3E4B A;  3CK7 A;  2XCC A;  3BEE A;  4WUY A;  3VTX A;  1FCH A;  4G23 A;  3ASD A;  3S7B A;  3Q15 A;  4Y6C A;  2VGX A;  3CVQ A;  3LYA A;  2LSV A;  4I9E A;  4JL0 A;  3IEG A;  3LY7 A;  4NRH B;  5CCM A;  5A6C A;  3LY8 A;  4RG9 A;  1B89 A;  3QKY A;  1KT1 A;  5ARG A;  4U0U A;  1WAO 1;  3QWP A;  2UWJ G;  1A17 A;  2FBN A;  3SZ7 A;  5M72 A;  3VTY A;  1ZBP A;  2FF4 A;  3QWV A;  3CV0 A;  4U0S A;  4YVO A;  4UQZ A;  4N3A A;  3S7D A;  2C2L A;  5FT9 A;  5FZQ A;  2XEV A;  2PZI A;  3Q47 B;  1E96 B;  4GA2 A;  3LPZ A;  4WNE A;  3ZGQ A;  3RO2 A;  3PE4 A;  4I9C A;  2IFU A;  1NA3 A;  1XNF A;  3ZHE B;  3QOU A;  5G05 C;  2UY1 A;  3ESK A;  3UUX A;  4APO A;  3CK9 A;  4I2Z A;  4UQX A;  2QFC A;  2L6J A;  3FFL A;  2PQR A;  4I17 A;  3CVP A;  3ULQ A;  4HOQ A;  3UQ3 A;  5KJK A;  4N5C A;  4W9R A;  4GYW A;  2KCL A;  4G25 A;  3TGO A;  2WQH A;  4XI9 A;  3Q4A B;  3Q49 B;  1ELW A;  4EQF A;  3OXG A;  4WNF A;  4H7X A;  3KD7 A;  4GCN A;  2XGM A;  2FO7 A;  3R9A B;  3CEQ A;  4Y6W A;  5G04 C;  4N39 A;  4U04 A;  3MV3 B;  4N2S A;  2FEZ A;  4AM9 A;  1HH8 A;  4JA9 A;  3TG4 A;  2VQ2 A;  3GZ2 A;  3ZPJ A;  3FP3 A;  1W3B A;  4GCO A;  3QWW A;  1NZN A;  5D0O D;  2YHC A;  4N3C A;  3OXL A;  3LY9 A;  4GPK A;  4WNG A;  3AS8 A;  4GA0 A;  4CGW A;  2VSN A;  4CGV A;  4F3V A;  4UI9 K;  3CK8 A;  4RG6 A;  3UPV A;  3WXX A;  1PC2 A;  3EDT B;  2OND A;  3SF4 A;  5C1D A;  5BNW A;  3TAX A;  3URZ A;  2LNI A;  2R5S A;  5FZS A;  4YND A;  2IF4 A;  3RO3 A;  4U07 A;  3GW4 A;  3MEK A;  5G05 J;  5FZR A;  4HOS A;  2KC7 A;  4J8E A;  5JJ7 A;  4KYO B;  5AYW D;  3QDN A;  3ASG A;  5FJY A;  3S7J A; 
#chains in the Genus database with same CATH topology
 3HXF A;  3DXK G;  2ZGG A;  3MGB A;  4HI9 A;  5AJD A;  4PS8 A;  1NA0 A;  3E34 A;  4TXR A;  1FT2 A;  2C0L A;  1OWM A;  4OVV A;  2F37 A;  4HS2 A;  3SNX A;  2WPV A;  2GW1 A;  2VGE A;  3AJI A;  2RG8 A;  4OAV B;  2GRP B;  2WQ7 A;  4PUC A;  4Q96 A;  4K5C A;  2EIN E;  2HR2 A;  2V8S E;  3SD5 A;  5G04 J;  3AS4 A;  3EHM A;  5KNH D;  2XZT G;  1UN8 A;  4G2V A;  2VYI A;  3FH8 A;  2P58 C;  3B95 A;  3EJN A;  4CYM D;  3PE3 A;  4PDX A;  2F8Y A;  4FLB A;  4ANU A;  3ZN3 A;  4ACK A;  2FI7 A;  1IYG A;  1EYH A;  4TUU A;  4AY5 A;  5CBN A;  3NF1 A;  3HDX A;  2I6H A;  1U2V G;  3C98 A;  3MV2 B;  2KAT A;  3R7R A;  3UIN C;  1QQE A;  3CST A;  5EIL A;  1ZU2 A;  3OTN A;  1JCR A;  1IQR A;  2GRO B;  3SI5 A;  3Q73 A;  2NC9 A;  3I4R B;  3KS2 A;  3JUE A;  3PZ2 A;  1YA0 A;  5EX3 A;  3FTV A;  3QAQ A;  3G2V A;  1E7U A;  2AVP A;  4IN3 B;  4HOU A;  4KVO A;  1XGW A;  1OUV A;  2WXK A;  2HM8 A;  2OEV A;  3CHM A;  2GRL A;  3FTZ A;  4HBD A;  5KNG A;  4CT0 A;  1OCC E;  3RIB A;  3CHO A;  4NUR A;  3B7T A;  2E2E A;  2M63 A;  1P5Q A;  3SFY A;  3V30 A;  4K5B A;  3N71 A;  2B0O E;  3V79 K;  2OCC E;  5EID A;  3W9G A;  3CKC A;  2HO1 A;  1TEZ A;  2R03 A;  4G8L A;  5AEN A;  3L17 A;  2EIJ E;  1AP7 A;  4K03 A;  5ENN A;  3PS6 A;  3ZEF A;  1DC2 A;  4I1M A;  4URK A;  3CVX A;  3CR3 A;  5HRY A;  4I1A A;  4GZ5 A;  3ZKJ A;  1TN8 A;  2ZIS A;  2P9S G;  2YQ8 A;  1HE8 A;  2LO6 A;  1K8K G;  2FUL A;  2GRR B;  2XPI A;  3RJV A;  1WY6 A;  4BX9 A;  2XRZ A;  4NIK A;  1KLX A;  2PQN A;  3T8K A;  3MYV A;  2LAI A;  3VTX A;  4HRM B;  4J7W A;  5AQB A;  4YDE A;  3FU0 A;  3ASD A;  4Y6C A;  4TRQ A;  3LYA A;  3CLJ A;  4J8Y A;  1E8W A;  2PM7 A;  3LY7 A;  4GTT A;  2QYU A;  5A6C A;  1Q2Z A;  4HXI A;  1B89 A;  5ARG A;  4MKT A;  3D9N A;  3UT7 A;  2FBN A;  3SY2 A;  4JD2 G;  2KBX A;  3B13 A;  3CV0 A;  4IRU A;  4YVO A;  3S7D A;  3T5V A;  3DBS A;  2C2L A;  1EF1 C;  1E8Y A;  2XEV A;  2OVF A;  1E96 B;  3C3R A;  3FEX A;  3C72 A;  4A3V A;  4GA2 A;  3ZGQ A;  1IQU A;  3SFX A;  3PE4 A;  2IFU A;  5BUZ A;  2A5E A;  1N4P A;  3JQ0 A;  3QOU A;  5G05 C;  5CRU A;  3R9M A;  1TNZ A;  4FP7 A;  4RSY A;  2WXO A;  4U8H A;  2EIL E;  1YMP A;  4HB5 A;  2IO2 C;  2QFC A;  5D66 A;  3FUN A;  4YDW A;  3FH5 A;  3TWW A;  4AXH A;  5IY5 E;  4I17 A;  3CVP A;  3DPD A;  3CSF A;  3IXE A;  4GTP A;  4W9R A;  5CEA A;  1OWO A;  1Y6I A;  4G25 A;  3TGO A;  2WQH A;  3FY4 A;  3FUF A;  3ZW3 A;  2DZO A;  3OXG A;  5ITZ F;  4CDN A;  3NZU A;  1NFI E;  4WNF A;  3MJW A;  4ANX A;  4FU3 A;  3ENE A;  2DVW A;  3E33 A;  1SA5 A;  4JA9 A;  1OCR E;  1HU3 A;  3FP3 A;  1Z6T A;  3ZXP A;  4DX1 A;  4ILH B;  4E6H A;  4GCO A;  5LOZ A;  4MLP A;  4ATZ D;  3D9P A;  3APC A;  4CCA A;  4ILG A;  1OY3 D;  5D0O D;  4N3C A;  3V2O A;  4GPK A;  3AS8 A;  1O1T A;  2WB2 A;  3C5R A;  3GZS A;  3UIP C;  2VTB B;  3LJN A;  2KZT A;  4TV3 A;  3L13 A;  1S70 B;  4G8K A;  2P9N G;  1HO8 A;  3G2U A;  2LNI A;  2R5S A;  3NZS A;  4HNA D;  4YND A;  2IF4 A;  3LVR E;  3RO3 A;  3Q9N C;  1QYM A;  1KPS B;  3CHQ A;  3NOG D;  3MEK A;  4BSX A;  4J8E A;  5JJ7 A;  5AQA A;  5ENP D;  1RW2 A;  4ATG A;  3ASG A;  3S7J A;  3AG2 E;  2ETB A;  3FUH A;  2EIM E;  3MKQ A;  3ISM C;  1E7V A;  5EKQ D;  1LD8 A;  4MRU A;  4GA1 A;  1UJK A;  1MHQ A;  3LEW A;  2Y4U A;  2IOS A;  3UM2 A;  2LSU A;  3ML8 A;  5E76 A;  3PZ4 A;  2XGS A;  4G26 A;  1HG5 A;  2HE0 A;  4DX5 D;  2X6H A;  4EPZ A;  2P9I G;  1UW4 B;  4JHK A;  4A63 B;  5BPP A;  1O1R A;  4FHK A;  4ANW A;  3EHR A;  4J8F A;  2IQC A;  2CHZ A;  5T3R A;  4HLL A;  4U96 D;  1HZ4 A;  3FUL A;  3ZYL A;  2YIN A;  3FDH A;  4LG6 A;  4E85 A;  1K1A A;  1X81 A;  4KXK B;  5BW8 C;  2OOE A;  4ME2 A;  3NB2 A;  5BXU A;  4LNG A;  2BKG A;  4U7E B;  4M7C A;  1TNY A;  3K9I A;  5CCL A;  4LNU D;  3C3Q A;  1NP7 A;  1V55 E;  1MX6 A;  4HVB A;  5A7D B;  2JEK A;  5G2N A;  3B7S A;  3KEA A;  3RU0 A;  3TJP A;  3TWU A;  1N9A A;  3GYZ A;  3PDN A;  3CKB A;  5T8I A;  1DCE A;  4KBQ A;  1INZ A;  3LS8 A;  5B1B E;  3SHF A;  4JHR A;  2J4D A;  4KT6 B;  1GW6 A;  2KXP C;  3CVY A;  1BLX B;  4RLY A;  1NL4 A;  4F6R D;  5KWD A;  1N0Q A;  2I1K A;  4N2Q A;  4K5A B;  2UY1 B;  4EZJ A;  3SQV A;  3ABL E;  4DX7 D;  3V2X A;  5EIB E;  1DCQ A;  2XHE A;  3HXC A;  1FT1 A;  4BSZ B;  2BF0 X;  1TR4 A;  3BU8 A;  2ILR A;  2EIK E;  2AXV A;  3MCX A;  4KMO A;  1AWC B;  4WWO A;  2V5F A;  2CFU A;  2KCV A;  3J5P A;  5FQ4 A;  3Q78 A;  4U95 D;  1OXJ A;  1H2V C;  4YVQ C;  3AU4 A;  4BET A;  2F0Y A;  1OWL A;  4A1S A;  5KBA A;  3ONL A;  4H7Y A;  1SA4 A;  3I3N A;  4GAA A;  1NI1 A;  3IHY A;  5D2M C;  4HI8 A;  4U63 A;  2Y1L E;  3UM1 A;  3JYS A;  5DBK A;  2L6B A;  4PS3 A;  2OV8 A;  3PUK A;  3D9I A;  5JJT A;  2ETA A;  2ETC A;  4ILI A;  4UQY A;  3JXJ A;  4DI4 A;  1IXV A;  5HKP A;  1KZO A;  3ZIM A;  3BG0 B;  1HG2 A;  4C0E A;  5EX0 A;  4J6I A;  2WMN A;  3ONK A;  4GZ6 A;  5FTP A;  3QB2 A;  3HYM B;  3JCK C;  3AG4 E;  1YCS B;  3BQO A;  4HOR A;  3D9K A;  4JB8 P;  3LDZ A;  2XRY A;  3CK7 A;  3CVL A;  3E4B A;  2XCC A;  3DST A;  5AN8 A;  5ANL A;  2MOW A;  4C48 B;  4GTM A;  4G23 A;  2L0I A;  3S7B A;  3DSW A;  3CVQ A;  3G2W A;  4XX5 A;  4UWL A;  1TYQ G;  4YDY A;  4JL0 A;  3IEG A;  1N0R A;  2LUH A;  3DSV A;  4RG9 A;  4HRN A;  3CHP A;  4U0U A;  5AAO A;  2XEN A;  3QK0 A;  3UX4 A;  5C2Y A;  5FWQ A;  3SZ7 A;  4GZD A;  5M72 A;  3VTY A;  1N52 A;  3VLD A;  1FVH A;  4UWK A;  3FUE A;  4LNB A;  3ESL A;  2IOL A;  2XQ0 A;  2LXL A;  3L16 A;  4UUC A;  2H6G A;  3QJZ A;  3Q47 B;  4XKB A;  4LER A;  4HRL A;  3J5Q B;  3LPZ A;  1TNB A;  4F1S A;  2OVB A;  5B1A E;  4I43 A;  1NA3 A;  3D9L A;  3U66 A;  2P9K G;  3ZHE B;  4JW1 A;  3JQ1 A;  3RRU A;  3B7U X;  4EBA G;  3ESK A;  3UUX A;  4APO A;  4UQX A;  1OWN A;  3FFL A;  3MX3 A;  2PQR A;  5CBO A;  2WXL A;  1U3C A;  4PS7 A;  5KJK A;  4GYW A;  4GZC A;  3Q7A A;  3HHM A;  5EN5 D;  3V31 A;  4H7X A;  3UXG A;  3KD7 A;  4A55 A;  5EDS A;  2AXZ A;  4K0R A;  3EIJ A;  1SZ9 A;  2XGM A;  3R9A B;  2GGF A;  1Z3Y A;  3MV3 B;  1SVX A;  4AJW A;  3FUD A;  3FTS A;  4GTO A;  4CDM A;  4IUL A;  5FIO A;  3VLE A;  2Y69 E;  1QNF A;  1WG0 A;  1D9S A;  2L0T B;  2MYO A;  3PUJ A;  3QWW A;  1H6K A;  3D9O A;  3LY9 A;  3S2A A;  5JA4 D;  2XEE A;  4GA0 A;  3ABK E;  4BER A;  3QC1 A;  1IKN D;  4F53 A;  5CRV A;  3ASO E;  1PC2 A;  1JCS A;  3SF4 A;  5AQ9 A;  1UG3 A;  4L2L A;  4QQI A;  4KVM A;  5BNW A;  3URZ A;  5FZS A;  3DRA A;  2RFM A;  4DJA A;  2R2L A;  2ZU6 B;  2AXU A;  5FZR A;  5G05 J;  4PH4 B;  4EHM A;  1O1S A;  1MYO A;  3QDN A;  3I5P A;  1DVP A;  3O4Z A;  2E0I A;  1K1B A;  3HXE A;  1EPU A;  3Q79 A;  3SGH A;  4RVB A;  3LVQ E;  2XGO A;  4L1B A;  4FHJ A;  4DX6 D;  3U64 A;  4I6E A;  2I9C A;  3JUI A;  3CHS A;  5FQ6 A;  4JC8 A;  3D3M A;  5D0Q D;  2VGX B;  5BV1 A;  3OXF A;  4GTV A;  1JUQ A;  4IYP A;  1UOH A;  1ELK A;  2J08 A;  3UTM A;  3TG5 A;  3P2B A;  5BV0 A;  3MA5 A;  2H6I A;  3L82 A;  1N54 A;  5CHE E;  3PNL B;  3FTY A;  2YNQ A;  2J09 A;  1L5J A;  2J4B A;  4EZK A;  3RKV A;  4ZFH A;  1UJJ A;  3NOC D;  2WXI A;  5KJL A;  1HFA A;  2J8S D;  4CDR A;  2X6I A;  1HX8 A;  3DPY A;  3APD A;  2VGY A;  4G1T A;  2J49 A;  4WND A;  2ZIR A;  5BT1 A;  4JXT A;  2C0M A;  3SBS A;  4OAU C;  3RK6 A;  4BES A;  3LCA A;  4GTR A;  1N95 A;  2VSY A;  3G2T A;  1PY1 A;  4GYO A;  1VDY A;  4GB9 A;  4AEZ C;  1TJF A;  1E8Z A;  1YYH A;  4WAF A;  4BEP A;  4R7L A;  2XPZ A;  4G24 A;  1LF8 A;  4HOT A;  5ARF A;  4GZ3 A;  2J9Q A;  3VLF A;  4BT8 A;  2H6F A;  4B93 B;  5E75 A;  4UI9 J;  4BTB A;  2I1J A;  1H6O A;  2B6C A;  4UI9 C;  1LD7 A;  2KM4 A;  3ZFW A;  3HVE B;  5JHB A;  5CMW A;  4B8A A;  3ABM E;  2I2O A;  4FJZ A;  3FUI A;  2VTB A;  2CG3 A;  3NAW A;  3GZ1 A;  1EDU A;  5ENT D;  2L9B A;  4NAC A;  3AU5 A;  3S7F A;  4X8Q A;  1N4Q A;  5DIZ A;  4DI3 A;  3D9M A;  4AIF A;  1TJC A;  5H7P A;  2MHK A;  3NBN B;  4WWP A;  4XKC A;  4D10 C;  3MZL B;  1OWP A;  2WXM A;  1MJ0 A;  3TWR A;  4J8D A;  3FH7 A;  4JA7 A;  3BUA A;  3KAE A;  3PVL A;  3LJ3 A;  2PL2 A;  4TUM A;  3HIZ A;  3TL5 A;  4A1G A;  1OT8 A;  3U3W A;  3IHV A;  3T5X A;  3O48 A;  3EUV A;  2NXP A;  5KJM A;  1S64 A;  1QZ2 A;  5HQ8 A;  4GYY A;  4NQ0 A;  3ASN E;  1N4S A;  1X5B A;  4U8Y D;  2WXN A;  3QNK A;  5EYL A;  3CVN A;  3PZ1 A;  5ENO D;  3T8M A;  1KT0 A;  4QFV A;  3BEE A;  4LUN U;  2QZA A;  3Q75 A;  1N11 A;  3FU3 A;  4MBG A;  3P1U A;  1IHB A;  1SZA A;  2DIW A;  4AP2 A;  1MX2 A;  2LSV A;  4I9E A;  1JPL A;  3UM3 A;  1HS6 A;  4NRH B;  3HXB A;  3LY8 A;  1KT1 A;  3FU5 A;  3Q7F A;  5LP0 A;  2R17 C;  3KEZ A;  4L7T A;  3KSQ A;  3IBE A;  2P9U G;  3QAR A;  1ZBP A;  3QWV A;  4CT4 A;  2OEW A;  4C0M A;  2BTD A;  4I6G A;  4UQZ A;  4LRZ A;  2H6H A;  1MZC A;  2ZXW E;  2RD0 A;  1TNO A;  5FT9 A;  3RAU A;  4WNE A;  3ZNG A;  2DYS E;  3AG3 E;  4I9C A;  3E32 A;  1TNU A;  3PRE A;  4BY6 A;  3CVV A;  4O1O A;  1XNF A;  2AJA A;  2PM6 A;  2UY1 A;  3UKU G;  4DRX E;  3ZYQ A;  3PEU B;  1PAQ A;  1HF8 A;  3W9F A;  4I2Z A;  2L6J A;  4OYS A;  5JMN D;  2Y0B G;  3U9W A;  2CFZ A;  4HOQ A;  2X3M A;  2P9P G;  5CED B;  4N5C A;  2KCL A;  4XI9 A;  2JAB A;  3Q49 B;  1OCO E;  1TN6 A;  1ELW A;  3SBT B;  4EQF A;  4AVX A;  4DUI A;  3CQG B;  2AW6 A;  4FJY A;  2R59 A;  4B89 A;  3X2Q E;  4GCN A;  3UI2 A;  4FAD A;  4U8V D;  5KCM A;  3CEQ A;  4Y6W A;  5G04 C;  2WXF A;  4N39 A;  4U04 A;  2XEH A;  4CRW A;  3TG4 A;  2VQ2 A;  4GMJ A;  3ZPJ A;  4P29 A;  3HRA A;  5G55 A;  5J08 A;  5A23 A;  3UMV A;  1K3Z D;  2WXG A;  2CG2 A;  3UIO C;  3PH0 C;  4L9P A;  2YHC A;  2IO3 C;  1Z3X A;  2RKK A;  2EQX A;  4WNG A;  2BKK B;  2VSN A;  3C3O A;  5ENR D;  5LX8 A;  4UI9 K;  3CK8 A;  3UPV A;  3HG0 D;  2GRN B;  3RRN B;  4CZ2 D;  4YDO A;  3EDT B;  4Q94 A;  2OND A;  4HQD A;  3L08 A;  2R05 A;  5C1D A;  4KZC A;  4J8S A;  3R7Q A;  1DNP A;  2MRI A;  3DEP A;  1D8E A;  4TXP A;  5J90 A;  1JCQ A;  1OCZ E;  4U07 A;  4JPS A;  2KC7 A;  2WMO A;  4KYO B;  5FIN A;  5AYW D;  5FJY A;  3L9T A;  3ZYM A;  4XI0 A;  2LAH A;  1U3D A;  4F1P A;  2IY0 C;  3TWX A;  2V5Q C;  5HI7 A;  5LFA A;  4V3I A;  5AQ7 A;  4B94 A;  1ZB1 A;  4DK5 A;  1QBQ A;  3RRM B;  4EEC A;  2R02 A;  2NYJ A;  1S63 A;  3FTU A;  2WXP A;  3Q9U C;  2X38 A;  3AS5 A;  2AWI A;  4BTA A;  1WM5 A;  4GML A;  4GPM A;  4BT9 A;  1Y8M A;  1V54 E;  3PRZ A;  4N3B A;  5BXO A;  1SQM A;  4AY6 A;  3D9H A;  4ANV A;  4F7A A;  2ZGD A;  3ZHE A;  4MS6 A;  2WM9 A;  3CHR A;  5B3S E;  2Q7F A;  4ABN A;  4B0Z A;  1N4R A;  2XCB A;  3CVU A;  3UM0 A;  3PZ3 A;  2V0P A;  1D8D A;  2RFA A;  4FLH A;  2WVI A;  4WWN A;  3FUJ A;  2XS8 A;  5LCW J;  2ION A;  3FUM A;  2XS1 A;  3FTW A;  1ELR A;  3ZUV B;  4J0U A;  2DBA A;  5LCW C;  2X6F A;  2YHE A;  3ULY A;  1UN9 A;  1BD8 A;  1JWF A;  3CVW A;  3LKU A;  4FA6 A;  1O5M A;  3DWL G;  2WXJ A;  4DPR A;  3FU6 A;  1BI8 B;  4UWG A;  4GMR A;  3IV0 A;  4JVS A;  3Q5M A;  1WDY A;  2QC9 A;  1BI7 B;  3FEY A;  3DSS A;  3FWV A;  4A3T A;  1G3N B;  2Y3A A;  4U0Z A;  5AAR A;  4I2W A;  2P9L G;  5KJN A;  3MKR A;  1E8X A;  1HXI A;  2KCK A;  2JLB A;  3TWQ A;  3ASH A;  2GRQ B;  3FTX A;  5ENS D;  5T4Y A;  2VSO E;  2VSX E;  2V4L A;  3WG7 E;  3U4T A;  2QY7 A;  4O6F A;  4I6J A;  3CIA A;  3TWS A;  2BED A;  5JJ6 A;  2P2C P;  1MQS A;  4LEU A;  3TWV A;  4Z68 A;  2GRM A;  4O60 A;  1IHG A;  4BWR A;  1MX4 A;  4FUL A;  2X6K A;  2BUG A;  3AAA C;  2WXR A;  4Q69 A;  3ASF A;  3EHN A;  4JZY A;  1SW6 A;  4BX8 A;  5CEC B;  4O1P A;  3ZYK A;  1S0P A;  1H2U A;  3ZVV A;  4FC8 A;  1FPP A;  2FO1 E;  4XIF A;  2WXH A;  3LXU X;  3OAW A;  4AOF A;  2HYZ A;  2KZT B;  1JWG A;  4DLQ A;  2NSZ A;  3E37 A;  2DWZ A;  3DSX A;  2Y4T A;  3DXM G;  2F8X K;  4EBA A;  3TXM A;  4WUY A;  1FCH A;  3ZRH A;  4XEI G;  4CEM A;  1A5E A;  4XE0 A;  3Q15 A;  2VGX A;  3F6Q A;  3PZD A;  3IKO B;  2DCP A;  1KZP A;  5CCM A;  2XZD G;  4OVU A;  4HLE A;  3QKY A;  3HXD A;  3MKQ B;  1WAO 1;  3QWP A;  2UWJ G;  1H19 A;  1A17 A;  4KZ0 A;  2WQ6 A;  4DX2 A;  1E90 A;  4AV7 A;  4TXQ A;  1RZ4 A;  2FF4 A;  4UWH A;  3EU5 A;  2DZN A;  4U0S A;  4N3A A;  5AIJ A;  5FZQ A;  3G2S A;  3UT4 A;  2PZI A;  3CGH A;  3EIQ C;  4GTS A;  2WXQ A;  3RO2 A;  3KSL A;  4APF A;  3BG1 B;  3APF A;  5FQ7 A;  1H6P A;  5EYP F;  4JHJ A;  3UKR G;  3CK9 A;  1TN7 A;  5CER B;  3PNT B;  1BPO A;  1N94 A;  1FVF A;  5CMY A;  3TXN A;  3JXI A;  4RQI A;  3ULQ A;  3UQ3 A;  4L23 A;  1H2T C;  3HVE A;  1Z5S C;  5HS0 A;  4ZHB A;  3Q4A B;  4I1O B;  1BU9 A;  4HFG A;  3ZXS A;  3DEO A;  2CHW A;  2CHX A;  2VJ8 A;  5ANR A;  4N5Q A;  4GTQ A;  4JEU A;  3ML9 A;  1LTX A;  4UWF A;  2FO7 A;  4EZL A;  3T9K A;  3RSE G;  4N2S A;  2FEZ A;  4AM9 A;  1HH8 A;  3GZ2 A;  2V4H C;  3EU9 A;  3L6A A;  4L2Y A;  1W3B A;  3D9J A;  4XZ4 A;  3NQP A;  3SFZ A;  4C9B B;  1NZN A;  2A5U A;  2PNN A;  2J07 A;  3L22 A;  2DYR E;  3OXL A;  3FHE A;  3CQC B;  4DLO A;  2IEJ A;  2A4Z A;  2IJG X;  4BFR A;  4CGW A;  4G11 A;  4CGV A;  2XPY A;  4F3V A;  4M3O A;  1H0A A;  3FUK A;  4RG6 A;  5JHA A;  3WXX A;  3EHQ A;  3L54 A;  3PEV B;  3DSU A;  3AG1 E;  3UT8 A;  4B8C B;  3TAX A;  3E30 A;  4ACL A;  2QYJ A;  4GU5 A;  3GW4 A;  4LCT A;  4JEH A;  3SO8 A;  3I4G A;  2X6J A;  4LSZ E;  2LXM A;  5ENQ D;  3ZU7 B;  5FQ8 A;  4HOS A;  3TWT A;  5AJL A;  3B7B A;  3ULE G;  2IU1 A;  3B7R L; 
#chains in the Genus database with same CATH homology
 3O4Z A;  3FUH A;  3ZYM A;  4XI0 A;  3MGB A;  2E0I A;  2LAH A;  1U3D A;  3MKQ A;  1E7V A;  5EKQ D;  5AJD A;  4PS8 A;  4MRU A;  1NA0 A;  4GA1 A;  4V3I A;  5HI7 A;  5LFA A;  1UJK A;  1EPU A;  4B94 A;  4DK5 A;  1MHQ A;  3RRM B;  3LEW A;  4EEC A;  2Y4U A;  3SGH A;  2IOS A;  2LSU A;  4RVB A;  2C0L A;  3ML8 A;  1OWM A;  3LVQ E;  5E76 A;  3FTU A;  2XGO A;  4OVV A;  2WXP A;  2X38 A;  4HS2 A;  3AS5 A;  2XGS A;  4L1B A;  2AWI A;  4BTA A;  4FHJ A;  4G26 A;  3SNX A;  1WM5 A;  2WPV A;  1HG5 A;  4GML A;  4I6E A;  3U64 A;  2GW1 A;  2I9C A;  2X6H A;  4EPZ A;  3JUI A;  3CHS A;  1UW4 B;  4BT9 A;  5FQ6 A;  4JHK A;  2RG8 A;  4JC8 A;  2WQ7 A;  5BPP A;  1Y8M A;  3PRZ A;  4PUC A;  3D3M A;  4FHK A;  4ANW A;  5D0Q D;  4N3B A;  2VGX B;  1SQM A;  4J8F A;  5BV1 A;  3OXF A;  4AY6 A;  2IQC A;  2CHZ A;  1JUQ A;  4Q96 A;  5T3R A;  4ANV A;  4F7A A;  4IYP A;  2HR2 A;  2V8S E;  3SD5 A;  5G04 J;  3AS4 A;  3ZHE A;  1ELK A;  1HZ4 A;  2J08 A;  3EHM A;  3FUL A;  2YIN A;  3ZYL A;  3FDH A;  3TG5 A;  1UN8 A;  4MS6 A;  2WM9 A;  3P2B A;  4G2V A;  5BV0 A;  3MA5 A;  3CHR A;  4E85 A;  2VYI A;  3FH8 A;  2P58 C;  2Q7F A;  4KXK B;  4ABN A;  5BW8 C;  1N54 A;  4B0Z A;  5CHE E;  3EJN A;  2XCB A;  2OOE A;  4ME2 A;  3PE3 A;  3PNL B;  4PDX A;  3CVU A;  3FTY A;  2YNQ A;  2J09 A;  2V0P A;  3K9I A;  4FLB A;  1L5J A;  4FLH A;  4ANU A;  5CCL A;  2J4B A;  4EZK A;  3RKV A;  2WVI A;  1NP7 A;  1UJJ A;  3ZN3 A;  2WXI A;  4WWN A;  4ACK A;  5KJL A;  2FI7 A;  1HFA A;  4HVB A;  5A7D B;  1IYG A;  3FUJ A;  4CDR A;  2JEK A;  1EYH A;  2X6I A;  5G2N A;  3B7S A;  4TUU A;  3TJP A;  3RU0 A;  5LCW J;  4AY5 A;  2ION A;  3GYZ A;  3PDN A;  3FUM A;  1HX8 A;  3CKB A;  3HDX A;  3NF1 A;  3APD A;  3FTW A;  2I6H A;  1ELR A;  2VGY A;  4G1T A;  4J0U A;  3C98 A;  2J49 A;  2DBA A;  4WND A;  5LCW C;  5T8I A;  2X6F A;  3MV2 B;  2KAT A;  2YHE A;  4JXT A;  3R7R A;  5FJY A;  4KBQ A;  2C0M A;  5BT1 A;  1INZ A;  1QQE A;  1UN9 A;  3CST A;  3LS8 A;  3RK6 A;  3SBS A;  3SHF A;  1ZU2 A;  4JHR A;  2J4D A;  3OTN A;  4KT6 B;  1IQR A;  1GW6 A;  3LCA A;  3SI5 A;  3CVY A;  2VSY A;  3G2T A;  1PY1 A;  2NC9 A;  1JWF A;  1VDY A;  4GYO A;  4GB9 A;  4AEZ C;  1TJF A;  1E8Z A;  2I1K A;  3CVW A;  3LKU A;  3I4R B;  3KS2 A;  4N2Q A;  4FA6 A;  4WAF A;  2UY1 B;  4R7L A;  2XPZ A;  4G24 A;  1LF8 A;  2WXJ A;  4DPR A;  4EZJ A;  5ARF A;  4HOT A;  3FU6 A;  1YA0 A;  5EX3 A;  3FTV A;  2J9Q A;  4GZ3 A;  3QAQ A;  4UWG A;  3VLF A;  4BT8 A;  2XHE A;  3G2V A;  1E7U A;  5E75 A;  4UI9 J;  2AVP A;  4IN3 B;  3IV0 A;  4JVS A;  3Q5M A;  3S7J A;  4BTB A;  4HOU A;  2I1J A;  3FEY A;  3FWV A;  1XGW A;  1OUV A;  2WXK A;  4KVO A;  2HM8 A;  4A3T A;  3CHM A;  4UI9 C;  2GRL A;  2BF0 X;  3FTZ A;  2Y3A A;  2ILR A;  4U0Z A;  2AXV A;  4CT0 A;  4I2W A;  5KJN A;  3MKR A;  3MCX A;  4KMO A;  3RIB A;  2KM4 A;  3ZFW A;  3HVE B;  4WWO A;  5JHB A;  5CMW A;  4B8A A;  3CHO A;  4NUR A;  3B7T A;  2E2E A;  2M63 A;  1E8X A;  1HXI A;  2KCK A;  2JLB A;  2V5F A;  3ASH A;  1P5Q A;  2CFU A;  2KCV A;  3FTX A;  2I2O A;  5FQ4 A;  5T4Y A;  1H2V C;  4YVQ C;  4FJZ A;  2VSO E;  2VSX E;  3AU4 A;  3FUI A;  2VTB A;  2V4L A;  1OWL A;  4A1S A;  3N71 A;  2CG3 A;  3ONL A;  4H7Y A;  3GZ1 A;  3U4T A;  1EDU A;  2QY7 A;  3I3N A;  2L9B A;  4GAA A;  4NAC A;  3CKC A;  3AU5 A;  4O6F A;  3S7F A;  3IHY A;  4I6J A;  2HO1 A;  1TEZ A;  3CIA A;  5AEN A;  5DIZ A;  4DI3 A;  3D9M A;  4AIF A;  4U63 A;  1TJC A;  3L17 A;  5JJ6 A;  1MQS A;  2MHK A;  3JYS A;  4K03 A;  4LEU A;  5ENN A;  5DBK A;  2GRM A;  3PS6 A;  1IHG A;  4BWR A;  4WWP A;  4PS3 A;  4XKC A;  3ZEF A;  2OV8 A;  4D10 C;  3PUK A;  3MZL B;  4FUL A;  1OWP A;  2WXM A;  3D9I A;  5JJT A;  2X6K A;  2BUG A;  4I1M A;  4J8D A;  2WXR A;  3FH7 A;  4ILI A;  4JA7 A;  4Q69 A;  4URK A;  3CVX A;  3ASF A;  3CR3 A;  3EHN A;  3KAE A;  3PVL A;  4JZY A;  4UQY A;  4DI4 A;  3LJ3 A;  4BX8 A;  2PL2 A;  4I1A A;  3ZYK A;  3HIZ A;  4GZ5 A;  1S0P A;  1H2U A;  3BG0 B;  3TL5 A;  4A1G A;  3ZIM A;  3ZVV A;  3U3W A;  1HG2 A;  3IHV A;  3T5X A;  4FC8 A;  3O48 A;  4C0E A;  2NXP A;  5EX0 A;  4J6I A;  2WMN A;  3ONK A;  5KJM A;  4GZ6 A;  2YQ8 A;  1HE8 A;  2LO6 A;  5FTP A;  1QZ2 A;  3QB2 A;  3HYM B;  2FUL A;  5HQ8 A;  4GYY A;  3JCK C;  4NQ0 A;  4XIF A;  4HOR A;  2XPI A;  3RJV A;  1X5B A;  2WXH A;  1WY6 A;  3D9K A;  3LXU X;  3OAW A;  4BX9 A;  2WXN A;  2HYZ A;  2KZT B;  1JWG A;  3QNK A;  4AOF A;  4DLQ A;  2XRZ A;  1KLX A;  2NSZ A;  3LDZ A;  3CVN A;  2PQN A;  2XRY A;  2Y4T A;  3T8M A;  3MYV A;  2LAI A;  1KT0 A;  3CK7 A;  3CVL A;  3E4B A;  4QFV A;  2XCC A;  4EBA A;  3BEE A;  3TXM A;  4WUY A;  3VTX A;  1FCH A;  4LUN U;  5ANL A;  2MOW A;  3ZRH A;  4CEM A;  3FU3 A;  3FU0 A;  4G23 A;  3ASD A;  4XE0 A;  2L0I A;  3S7B A;  3P1U A;  3Q15 A;  4Y6C A;  2VGX A;  4TRQ A;  3CVQ A;  3LYA A;  1SZA A;  2DIW A;  4AP2 A;  3CLJ A;  2LSV A;  3G2W A;  4I9E A;  1JPL A;  1E8W A;  4UWL A;  4XX5 A;  3PZD A;  2PM7 A;  4JL0 A;  3IEG A;  1HS6 A;  3LY7 A;  4NRH B;  3IKO B;  2DCP A;  5CCM A;  4OVU A;  5A6C A;  3LY8 A;  4RG9 A;  4HXI A;  4HLE A;  1B89 A;  3QKY A;  1KT1 A;  3FU5 A;  5ARG A;  4MKT A;  3CHP A;  3MKQ B;  1WAO 1;  3D9N A;  3QWP A;  2UWJ G;  4U0U A;  3QK0 A;  1H19 A;  1A17 A;  4KZ0 A;  3UT7 A;  2R17 C;  3UX4 A;  2WQ6 A;  2FBN A;  5C2Y A;  5FWQ A;  3KEZ A;  1E90 A;  3SZ7 A;  4L7T A;  4GZD A;  4AV7 A;  5M72 A;  3VTY A;  1N52 A;  3IBE A;  3QAR A;  1ZBP A;  3VLD A;  2FF4 A;  3QWV A;  4CT4 A;  4UWH A;  1FVH A;  4UWK A;  3B13 A;  4C0M A;  3FUE A;  2BTD A;  4I6G A;  3CV0 A;  4IRU A;  4U0S A;  4YVO A;  4UQZ A;  3ESL A;  4LRZ A;  2IOL A;  4N3A A;  3S7D A;  3T5V A;  3DBS A;  5AIJ A;  2C2L A;  2XQ0 A;  2RD0 A;  1EF1 C;  5FT9 A;  5FZQ A;  1E8Y A;  2XEV A;  2OVF A;  3G2S A;  3L16 A;  3UT4 A;  2PZI A;  3CGH A;  3QJZ A;  3Q47 B;  4XKB A;  1E96 B;  3FEX A;  3EIQ C;  4LER A;  4A3V A;  4GA2 A;  2WXQ A;  3LPZ A;  4WNE A;  3RO2 A;  3ZGQ A;  1IQU A;  4F1S A;  4APF A;  2OVB A;  3BG1 B;  3PE4 A;  4I9C A;  2IFU A;  4I43 A;  1NA3 A;  5BUZ A;  3PRE A;  4BY6 A;  3CVV A;  3D9L A;  1XNF A;  3JQ0 A;  3U66 A;  3APF A;  3ZHE B;  3QOU A;  4JW1 A;  3JQ1 A;  5G05 C;  5FQ7 A;  3RRU A;  3B7U X;  4EBA G;  4JHJ A;  2PM6 A;  2UY1 A;  4FP7 A;  3ESK A;  3UUX A;  4APO A;  4RSY A;  2WXO A;  3CK9 A;  3ZYQ A;  3PEU B;  1PAQ A;  4U8H A;  1HF8 A;  4I2Z A;  3PNT B;  1BPO A;  4UQX A;  5LP0 A;  1OWN A;  1FVF A;  2QFC A;  2L6J A;  3FFL A;  3FH5 A;  3FUN A;  4OYS A;  4AXH A;  5CMY A;  3MX3 A;  3TXN A;  2PQR A;  4I17 A;  3CVP A;  3DPD A;  3ULQ A;  3U9W A;  2CFZ A;  2WXL A;  4HOQ A;  3UQ3 A;  2X3M A;  3CSF A;  1U3C A;  4PS7 A;  5KJK A;  4N5C A;  4W9R A;  1OWO A;  4GYW A;  1Y6I A;  4GZC A;  1H2T C;  4L23 A;  2KCL A;  4G25 A;  3HVE A;  3TGO A;  2WQH A;  4XI9 A;  3HHM A;  3FY4 A;  3Q4A B;  3FUF A;  3ZW3 A;  3Q49 B;  4I1O B;  4HFG A;  3ZXS A;  1ELW A;  3SBT B;  4EQF A;  3OXG A;  4AVX A;  3NZU A;  4CDN A;  4WNF A;  2CHW A;  2CHX A;  2VJ8 A;  3MJW A;  5ANR A;  3CQG B;  2AW6 A;  4FJY A;  2R59 A;  4H7X A;  4B89 A;  4ANX A;  3KD7 A;  4JEU A;  3ML9 A;  4GCN A;  4FU3 A;  4UWF A;  4A55 A;  4FAD A;  2AXZ A;  5EDS A;  4K0R A;  3ENE A;  3EIJ A;  1SZ9 A;  2XGM A;  2FO7 A;  5KCM A;  3R9A B;  4EZL A;  3CEQ A;  4Y6W A;  5G04 C;  2GGF A;  2WXF A;  4N39 A;  1Z3Y A;  3MV3 B;  4U04 A;  4AJW A;  3FUD A;  4N2S A;  2FEZ A;  4AM9 A;  4CRW A;  1HH8 A;  3FTS A;  4JA9 A;  3TG4 A;  4CDM A;  2VQ2 A;  3GZ2 A;  4GMJ A;  3ZPJ A;  1HU3 A;  3L6A A;  4IUL A;  4P29 A;  5G55 A;  3FP3 A;  1W3B A;  1Z6T A;  4L2Y A;  5J08 A;  4ILH B;  3D9J A;  4XZ4 A;  3VLE A;  5A23 A;  1QNF A;  4GCO A;  5LOZ A;  3UMV A;  4E6H A;  4MLP A;  3NQP A;  2WXG A;  2CG2 A;  3PH0 C;  3D9P A;  2L0T B;  3APC A;  3PUJ A;  3QWW A;  3SFZ A;  4ILG A;  4C9B B;  4CCA A;  1NZN A;  5D0O D;  2YHC A;  2A5U A;  1Z3X A;  2J07 A;  1H6K A;  3D9O A;  3L22 A;  4N3C A;  3OXL A;  2EQX A;  3LY9 A;  3S2A A;  4GPK A;  4WNG A;  3FHE A;  3AS8 A;  3CQC B;  4GA0 A;  4DLO A;  2A4Z A;  2IJG X;  4BFR A;  4CGW A;  2VSN A;  2WB2 A;  3QC1 A;  4G11 A;  4CGV A;  2XPY A;  4F3V A;  5LX8 A;  4UI9 K;  3GZS A;  4M3O A;  2VTB B;  1H0A A;  3FUK A;  3CK8 A;  4RG6 A;  4F53 A;  3UPV A;  3RRN B;  5JHA A;  2KZT A;  3WXX A;  3I5P A;  4TV3 A;  1PC2 A;  3EDT B;  3L13 A;  3L54 A;  3PEV B;  4Q94 A;  2OND A;  3L08 A;  3SF4 A;  1UG3 A;  4L2L A;  3UT8 A;  4B8C B;  5C1D A;  4KZC A;  4KVM A;  5BNW A;  3TAX A;  4J8S A;  1HO8 A;  3G2U A;  2LNI A;  1DNP A;  2MRI A;  3R7Q A;  3URZ A;  2R5S A;  3NZS A;  5FZS A;  4ACL A;  4YND A;  2IF4 A;  3LVR E;  3RO3 A;  5J90 A;  4GU5 A;  4U07 A;  3GW4 A;  4LCT A;  4JEH A;  4JPS A;  3CHQ A;  4DJA A;  3I4G A;  2X6J A;  2ZU6 B;  2AXU A;  3MEK A;  5FZR A;  4PH4 B;  5G05 J;  4BSX A;  5FQ8 A;  4HOS A;  2KC7 A;  4J8E A;  5JJ7 A;  5AJL A;  2WMO A;  4KYO B;  5AYW D;  4ATG A;  3QDN A;  3ASG A;  2IU1 A;  3B7R L;  1DVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...