2XCCA

Crystal structure of pcrh from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
133
structure length
133
Chain Sequence
LAMLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords REGULATORY PROTEIN PCRH
publication title Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 56
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xccA00
2PQRA 4N5CA 1Y8MA 4JL0A 2MHKA 2XGSA 2FO7A 4AM9A 2HYZA 3CVLA 5C1DA 4G2VA 3NF1A 3ZHEB 2E2EA 2FI7A 4N39A 2KATA 4U0SA 4HOUA 4G24A 1NA0A 3OXFA 4AY6A 3LCAA 5FZQA 4N2SA 4GYOA 4UI9J 2PQNA 4J0UA 4AY5A 1HH8A 4UI9C 5G05J 3CVNA 3R9AB 3CK8A 3S7JA 5G05C 4B94A 4J8EA 1ZBPA 3ASHA 4GA0A 1ELRA 1ELWA 2KCLA 2XEVA 4UQXA 4BT9A 3FP3A 2VQ2A 1IHGA 2C0LA 4GZ3A 5CCMA 2FF4A 3ASDA 4HORA 3QWWA 3OXGA 5KJMA 4HOQA 3K9IA 2C0MA 4U0UA 2JLBA 2LSUA 3RU0A 4HOTA 4XI0A 3Q4AB 1PC2A 5LCWJ 5LCWC 3ZGQA 4YVQC 2HR2A 3PDNA 3S7FA 3U4TA 3Q49B 4I1AA 3LY8A 4ABNA 4NRHB 3MKRA 4EQFA 3KAEA 4G1TA 5D0QD 3QWPA 5JJTA 2GW1A 2UY1A 3TG4A 4GCOA 2C2LA 4BTAA 4N3AA 4HOSA 3S7DA 3O48A 4N2QA 5CHEE 4GA2A 2Q7FA 5DIZA 4W9RA 5JJ6A 4F3VA 4NQ0A 2UY1B 2UWJG 4ME2A 3IEGA 2WQHA 4GCNA 3ASGA 3SF4A 3TG5A 1WM5A 4G26A 3ASFA 4J8DA 5FZSA 4N3CA 4YVOA 3RKVA 2LNIA 5ARFA 3FFLA 3ZFWA 2PL2A 3MA5A 3E4BA 2XGMA 5FJYA 3WXXA 5HQ8A 4BTBA 2XGOA 4U07A 3TGOA 3CEQA 1FCHA 3VTYA 4I2WA 4KYOB 1P5QA 1A17A 2WPVA 4GA1A 1E96B 3Q15A 4GYWA 1QQEA 3QWVA 1IYGA 4A1SA 5D0OD 3RO2A 1KT0A 4GYYA 5ARGA 2BUGA 5BW8C 5EX0A 4RG9A 3URZA 2KCVA 4I17A 2V5FA 3QOUA 4XI9A 2KC7A 3ZPJA 2NC9A 5G04J 4UQZA 1NZNA 3GYZA 1B89A 4Y6CA 5G04C 5AYWD 3FWVA 3S7BA 1WAO1 4O6FA 4IN3B 2IFUA 1ZU2A 4GPKA 3QDNA 3KS2A 3CK7A 2XCBA 3PE4A 3CKBA 2VYIA 2LSVA 2DBAA 3CV0A 3ULQA 4H7YA 5DBKA 2HO1A 5HI7A 4UQYA 5KJLA 3LY7A 4J8FA 4WNGA 4KXKB 4CGVA 5M72A 4XIFA 1HXIA 3AS4A 3SZ7A 3ZN3A 4WUYA 4Y6WA 2FBNA 3CVQA 2Y4TA 1NA3A 4JA7A 1YA0A 4CDRA 3LPZA 2VSYA 4WNEA 1OUVA 4GZ5A 2I6HA 4BT8A 3HYMB 4BWRA 2OOEA 3CK9A 3MV2B 4YNDA 3Q47B 3GZ2A 3UUXA 5EX3A 5FTPA 3Q5MA 5JJ7A 2YQ8A 5CCLA 4G25A 1XNFA 1KT1A 3QKYA 2IF4A 3RJVA 3N71A 3AS5A 5FZRA 2P58C 4KBQA 5KJKA 3LKUA 4I2ZA 2L6JA 3OXLA 2VGXA 4I9EA 4H7XA 3ESKA 2XCCA 3UPVA 4WNDA 2AVPA 5BT1A 3RIBA 2YHCA 2J9QA 3BEEA 5KJNA 4N3BA 2VGYA 5BNWA 1KLXA 3LYAA 4LEUA 2VGXB 3GW4A 2FEZA 2QFCA 2ONDA 4I9CA 4AIFA 1HZ4A 3MV3B 3KD7A 4WNFA 4U04A 3JYSA 3CKCA 5A6CA 5A7DB 4U0ZA 3VTXA 2R5SA 4RG6A 1QZ2A 3MEKA 1TJCA 3EDTB 4APOA 3PE3A 3GZ1A 1W3BA 3TAXA 2XPIA 3LY9A 2KCKA 4CGWA 4G23A 3UQ3A 3AS8A 5FT9A 3ZHEA 3U3WA 3RO3A 4JA9A 3CVPA 5EKQD 2VSNA 4GZ6A 2PZIA 4JHRA 4UI9K 2Y4UA
chains in the Genus database with same CATH superfamily
2Y0BG 1D8DA 2FO7A 3W9FA 4B93B 3ZHEB 2FI7A 3IKOB 4J6IA 4L1BA 5JHBA 5KCMA 2KATA 2XHEA 4DI3A 4ATZD 3DSTA 2QYUA 3HDXA 3PUKA 4EECA 4GYOA 2WXIA 1K1BA 4HBDA 4UI9C 5G05J 3R9AB 3B7RL 2J49A 3LEWA 4U8VD 4PDXA 3V30A 2BKGA 4I1OB 3KEZA 5E76A 4J8EA 2OVFA 2RKKA 3FH7A 1SW6A 3ASHA 3SHFA 4FJYA 3JXIA 2XEVA 3JXJA 4UQXA 3FHEA 3FP3A 2VQ2A 4K5BA 4HI8A 4PS3A 4BESA 3ZYQA 2GRQB 3ASDA 1QNFA 4HOQA 4YDYA 4G8LA 5BV0A 1BI7B 4U0UA 4E85A 2EIKE 4XZ4A 4HOTA 3Q4AB 2E0IA 2P9PG 5EYLA 1FT1A 4OYSA 3S7FA 3DPYA 3Q49B 3D9HA 3MKRA 3CSFA 1Y6IA 2KM4A 4G1TA 1D8EA 3TWRA 2XQ0A 2UY1A 3R9MA 3V2XA 3JQ1A 4N3AA 2EIME 4EBAA 3VLFA 1H0AA 5ITZF 3J5PA 4ACKA 4GTMA 4L2YA 1FT2A 2AXVA 3DPDA 2L9BA 1OCOE 1Z5SC 2PM6A 2OEVA 1WDYA 3HG0D 1N9AA 1WM5A 4ANXA 1G3NB 3S2AA 4DUIA 5T8IA 3RKVA 5CECB 3ZFWA 1Z6TA 3ONKA 3D9NA 3E4BA 2OEWA 3BG1B 2LUHA 3E33A 4ANUA 2EQXA 2DCPA 5JMND 3UM1A 2GRPB 3VLDA 1HFAA 5G55A 4K5AB 4JC8A 4KYOB 3G2WA 3CHPA 2L6BA 4GTQA 2AXUA 2PNNA 4BFRA 1E96B 4DJAA 3Q15A 2GROB 1OCRE 1IYGA 1ELKA 2YHEA 3C5RA 5ARGA 3D9IA 1FVFA 5EX0A 3URZA 2Y1LE 2KCVA 4FADA 3RK6A 3ABLE 4I17A 4JVSA 2V5FA 2A5UA 4DI4A 4X8QA 3TWVA 1DC2A 5AYWD 4ZHBA 3S7BA 1WAO1 4O6FA 3PEUB 1JUQA 1ZU2A 4L2LA 2MOWA 3AU4A 4QFVA 4URKA 3F6QA 4O1PA 2HE0A 4UWKA 2FO1E 2VYIA 4LNGA 1IQUA 4WWPA 3UIOC 3SO8A 1U2VG 4HNAD 5HI7A 4UQYA 1HF8A 2ETAA 3W9GA 2GRMA 4C0MA 4AXHA 4KZ0A 4XIFA 3ZU7B 3SZ7A 3ZN3A 3D9PA 3APDA 2AJAA 4OAUC 3L9TA 3HRAA 4JA7A 4F1SA 2VSYA 3MKQA 4BWRA 1HG2A 3CK9A 3CLJA 3MV2B 4YNDA 3GZ2A 3APFA 1TR4A 3Q5MA 5JJ7A 1N94A 2FULA 4B0ZA 2CFZA 2WMOA 4DK5A 1XNFA 4HLLA 4JW1A 2VGEA 3L08A 3MJWA 2IF4A 3RJVA 2HM8A 3N71A 3NAWA 2P58C 4M3OA 1AWCB 3LVRE 3E37A 5EYPF 4CT0A 2WXRA 3FTWA 3FTZA 2LXMA 4I9EA 3HHMA 2V8SE 2XCCA 3FUMA 3FH5A 4WNDA 2XRYA 1DNPA 5KBAA 2J9QA 2XZDG 5KJNA 4N3BA 2VGYA 1SVXA 1UW4B 4DLOA 3TL5A 3D9MA 4RLYA 1MJ0A 2VGXB 1YMPA 3AG1E 3SGHA 1HZ4A 1FPPA 2VSOE 4GAAA 3GZSA 3JYSA 2WXQA 3FUNA 5FQ8A 1N4PA 4FA6A 3GZ1A 1TJFA 3TAXA 1K3ZD 3LY9A 4NACA 5FT9A 3SFYA 5ANLA 2VTBB 4UWHA 3PRZA 3ABME 1N11A 2F8XK 2Y4UA 1Y8MA 2WVIA 3P1UA 3QB2A 2Y69E 3EIJA 3PZ3A 4LNBA 4G2VA 3NF1A 4GB9A 3SFXA 2KZTA 2CHXA 4HOUA 4G24A 3LS8A 3ASNE 4Q69A 3DXMG 4AP2A 3FDHA 2EINE 1DCEA 3CHMA 4MKTA 4NURA 4UWFA 3E30A 3Q79A 4AY5A 4FJZA 3E32A 1Z3YA 3L82A 3EU9A 3NZUA 4MRUA 5T3RA 2LXLA 3ZYLA 2V0PA 3ASOE 4JXTA 3ZNGA 3BQOA 3CHSA 4JPSA 2KCLA 3IBEA 4BT9A 3TWQA 1LTXA 1UJJA 4HXIA 4GU5A 4HORA 1N0RA 1MZCA 3OXGA 2R02A 4I6JA 4MBGA 2C0MA 2JLBA 3L22A 4L9PA 5FWQA 3TWTA 1PC2A 2P9LG 1TYQG 2DIWA 1SZ9A 5HKPA 2X3MA 5LCWC 3DSUA 4YVQC 2DZNA 2HR2A 3T5VA 3DEOA 2X6IA 3PREA 4BEPA 4NRHB 5J90A 5KNGA 3HIZA 3FUJA 3SBTB 2ZXWE 5AIJA 3CHOA 4IYPA 4BSZB 3BG0B 3O4ZA 5IY5E 3SY2A 5CHEE 2Q7FA 3T8MA 2DZOA 2R59A 3C3OA 1BPOA 5T4YA 3X2QE 3SD5A 3L6AA 2UY1B 4KMOA 1VDYA 3IEGA 4GCNA 3SF4A 3FY4A 3V31A 4YDEA 3B95A 4G26A 2WXFA 3KSQA 1YCSB 2LNIA 3FFLA 2PL2A 4UWLA 4PUCA 3D9JA 4K5CA 1KPSB 4XKBA 1UOHA 3SQVA 4U07A 4KT6B 3CEQA 1H19A 1FCHA 2IONA 1MX2A 4GZCA 4I2WA 4JEUA 4P29A 3J5QB 4IULA 5AQ9A 3APCA 5CEDB 1UJKA 4GA1A 1TNYA 2IOLA 4GYWA 3QWVA 4DX2A 4A1SA 3FUKA 2IO2C 5AJDA 5D0OD 3RO2A 4YDWA 1KT0A 5AQBA 5BW8C 3PVLA 3Q75A 3EIQC 2V5QC 3R7QA 3VLEA 4XI9A 5LOZA 3ZPJA 5G04J 3ML8A 3T5XA 3GYZA 1B89A 5CMWA 3FUDA 5ENOD 4Y6CA 3WG7E 1BD8A 3IHYA 1TN6A 2DWZA 3LVQE 1SA4A 4APFA 3JQ0A 4ILIA 2J08A 1JPLA 3CVVA 3LJ3A 4U95D 2XCBA 1JWGA 1JCRA 3CKBA 5E75A 2OV8A 3PNLB 3QAQA 1O1SA 2X6HA 3G2VA 5FQ6A 5DBKA 3TWUA 5KJLA 3FTXA 3QK0A 4HVBA 3TJPA 4JZYA 4KXKB 1V54E 3FUIA 5M72A 4G8KA 1H6OA 4WUYA 4FP7A 4L7TA 4F6RD 1V55E 1NA3A 4B89A 4CDRA 3LPZA 1OUVA 2R2LA 1N0QA 2QYJA 3Q47B 3I5PA 2RG8A 3UX4A 4DX6D 3ENEA 2YQ8A 2NSZA 1RZ4A 3Q7AA 1E8WA 4GTOA 4UWGA 1HX8A 2CG3A 3AU5A 4J8YA 2J8SD 5FZRA 1HO8A 3MKQB 2AXZA 1EDUA 3FU6A 5KJKA 3FEXA 1HG5A 3LKUA 2L6JA 2LAIA 1UN9A 1OWNA 5ENPD 5LX8A 3C3RA 1HS6A 2A5EA 2NXPA 3PH0C 4Z68A 1QBQA 3CGHA 3Q9UC 2GGFA 4K03A 4AOFA 3BEEA 1S64A 3NBNB 1E8ZA 1E7UA 4EZLA 2IOSA 5AENA 4LEUA 4V3IA 1A5EA 3EUVA 3ZYMA 4DLQA 2FEZA 5EIBE 2ONDA 3JUEA 2M63A 1L5JA 4ANWA 1IHBA 3MV3B 3LXUX 5FQ7A 4ILHB 1EF1C 4WWNA 3KD7A 4WNFA 4U04A 1LD8A 5A6CA 5A7DB 4U0ZA 5ENNA 4HRLA 1NL4A 3ABKE 1QZ2A 3HVEA 3DWLG 3MEKA 4EHMA 2GRNB 3B7TA 2ZISA 3IHVA 4APOA 3PE3A 4F7AA 3DSVA 4G23A 2CHWA 5EIDA 3U3WA 1OWLA 3ZEFA 1S0PA 5EKQD 4J7WA 4YDOA 4JHRA 2VSXE 2XZTG 2KXPC 4UUCA 4UI9K 2RFMA 2P9SG 2DVWA 4N5CA 4JL0A 2IJGX 5A23A 1RW2A 2LAHA 4HFGA 4A55A 5B1BE 4GZDA 4XE0A 4HLEA 1TN8A 1MYOA 3FU0A 4TRQA 1JCSA 3P2BA 2E2EA 2PM7A 3I4RB 4U0SA 3HXEA 4OVUA 3OXFA 4AY6A 2ZU6B 5EDSA 3D3MA 3D9LA 4UI9J 5CRUA 1LD7A 1BLXB 5ENQD 3UXGA 5KNHD 2ETCA 4CCAA 1GW6A 4AV7A 3FU5A 5G05C 2KZTB 3B7BA 2J4BA 2XPYA 1TEZA 3EHRA 2BTDA 3ZW3A 3PUJA 4EZJA 2MRIA 3C3QA 1H2VC 4D10C 1E90A 2C0LA 4EBAG 1LF8A 4DRXE 2R03A 3G2SA 3K9IA 1H2TC 3RU0A 2WXJA 3DSSA 4TXQA 4XI0A 3ML9A 3ESLA 4AJWA 4GMRA 4JHJA 3PDNA 5LFAA 4LNUD 2F8YA 3MGBA 2EILE 4EQFA 2R05A 2V4LA 5D0QD 3RAUA 3QWPA 3CVYA 4I1MA 2WM9A 4HOSA 1OY3D 4WWOA 2OVBA 3O48A 3S7DA 3Q73A 2WMNA 5KWDA 1AP7A 3CIAA 1E8YA 2H6HA 3HXFA 4FHKA 4DPRA 4F3VA 4CDMA 4R7LA 4A3VA 4BX8A 2UWJG 4ME2A 4BETA 3ASGA 3TWSA 1U3CA 3TG5A 5BUZA 3DBSA 5FZSA 2CHZA 4N3CA 3PS6A 5LP0A 2V4HC 2GRRB 2ZIRA 4N5QA 3QARA 1X81A 1S63A 2OCCE 3WXXA 4ZFHA 4PS7A 5HQ8A 4BTBA 3L16A 2XGOA 3TGOA 3ULEG 1O5MA 4I6EA 2XS8A 2WXLA 1INZA 2XRZA 3L17A 2L0TB 1P5QA 1A17A 1Q2ZA 1OWMA 2WPVA 3QC1A 2ILRA 2ZGGA 2ZGDA 3LJNA 4GYYA 2QY7A 2BUGA 4A3TA 1E7VA 3FTVA 3ZUVB 1FVHA 4BERA 3T8KA 3UT8A 4F53A 2KC7A 5AQ7A 1OWPA 4EZKA 3ZVVA 4GTVA 3FWVA 4IN3B 5D66A 4FULA 2IFUA 3D9OA 4FHJA 2I1KA 4GPKA 3QDNA 3CK7A 4DX5D 5JHAA 2X38A 3FUHA 2AW6A 2YNQA 4BX9A 3I4GA 3B7UX 4EPZA 3EHQA 2WXHA 3AAAC 3B7SA 4M7CA 3TWWA 4B8AA 2H6IA 3QNKA 2CFUA 2IEJA 2KBXA 3CR3A 1N95A 5G2NA 1HXIA 4CZ2D 3TXMA 5FINA 3SI5A 3ZXSA 1N52A 1IKND 3ZIMA 4RQIA 5HS0A 4TXPA 2L0IA 2Y4TA 5BV1A 3PZDA 4GZ5A 2I6HA 4TV3A 3HYMB 4BT8A 2H6GA 4ACLA 4IRUA 5EX3A 5CEAA 5FTPA 3PEVB 3NZSA 1K1AA 1TN7A 2P9KG 3ONLA 4LSZE 4RSYA 4U8HA 4AVXA 2ETBA 3FEYA 5D2MC 2I9CA 4TUMA 1E8XA 1KT1A 3QKYA 4OAVB 2BKKB 3AS5A 4O1OA 3RRMB 2XENA 4XX5A 4KBQA 3Q9NC 2R17C 4I2ZA 4E6HA 3OXLA 3U64A 3HXBA 5CRVA 1K8KG 3BUAA 3G2TA 4H7XA 3ESKA 1MX4A 3TWXA 3UPVA 1XGWA 3B13A 2AVPA 5BT1A 3IXEA 2YHCA 1IQRA 5C2YA 3DEPA 4PH4B 5BNWA 3SNXA 2X6KA 3UKRG 3LYAA 1PAQA 4ATGA 2VJ8A 1TNZA 3T9KA 1OXJA 4C48B 1MQSA 3CQCB 1OWOA 4AIFA 3FTSA 5AAOA 3OTNA 4GMLA 1H2UA 2P2CP 4TUUA 2XS1A 4ILGA 3U9WA 3KEAA 3EU5A 3VTXA 2R5SA 3C98A 5EILA 4RG6A 1TJCA 3EDTB 1SA5A 1W3BA 3MCXA 4KZCA 2KCKA 4CGWA 1TNUA 3UQ3A 5AARA 3AS8A 3ZHEA 3RO3A 5CBOA 3MYVA 3SFZA 2VSNA 4GTSA 4GZ6A 1H6PA 2PQRA 4JHKA 2MHKA 3HVEB 4DX7D 3JCKC 2XGSA 3EHNA 3G2UA 4AM9A 3RRNB 2HYZA 3LDZA 3CVLA 5C1DA 2AWIA 3FTYA 4NIKA 5HRYA 4N39A 1N4QA 3SBSA 4FLHA 4FU3A 4ANVA 1BI8B 1NA0A 2QZAA 3LCAA 2YINA 3NB2A 3UTMA 5FZQA 4N2SA 3RRUA 4TXRA 3CVUA 3UM2A 2PQNA 3FH8A 4J0UA 4CYMD 1HH8A 2J09A 2WXOA 1EYHA 4O60A 5ENRD 3CVNA 3DRAA 3CK8A 3PZ1A 3S7JA 4B94A 5AQAA 2WQ6A 1O1RA 1ZBPA 1JWFA 1N54A 3HXDA 4GA0A 1ELRA 1ELWA 1H6KA 5JA4D 4GMJA 1IHGA 3FU3A 3NOGD 2EIJE 4DX1A 3PZ4A 4BY6A 1Z3XA 4GZ3A 5CCMA 2FF4A 3QWWA 5KJMA 1S70B 1SQMA 3UM0A 2CG2A 2LSUA 1OCZE 4HRNA 3Q78A 1BU9A 3AG4E 5B1AE 5LCWJ 3FTUA 5BPPA 4QQIA 4A1GA 3ZGQA 3ISMC 3U4TA 4I1AA 3LY8A 4ABNA 1DCQA 3KAEA 3EJNA 3U66A 5JJTA 5ANRA 4CRWA 3ZYKA 2GW1A 5CMYA 3TG4A 2I1JA 4GCOA 1X5BA 2C2LA 3UKUG 3RSEG 4BTAA 3UIPC 2J4DA 4JB8P 2F0YA 2IU1A 3DSWA 3ULYA 3E34A 4N2QA 5H7PA 3ZRHA 1O1TA 2WXKA 3V79K 4GA2A 2JABA 2B0OE 5DIZA 4W9RA 5JJ6A 3QJZA 3UT4A 4HQDA 4NQ0A 3MX3A 4U8YD 1N4RA 2H6FA 1D9SA 3DXKG 2WQHA 4L23A 4JEHA 3CQGB 1HE8A 4HS2A 3FULA 3ASFA 4J8DA 4YVOA 2X6JA 5ARFA 5EN5D 3MA5A 2JEKA 3UM3A 2XGMA 1UG3A 4MLPA 4Q94A 5B3SE 4K0RA 2MYOA 3CSTA 5FJYA 4OVVA 5BXOA 4F1PA 2RFAA 1U3DA 1PY1A 4MS6A 3VTYA 2WQ7A 1NI1A 5AJLA 1UN8A 2X6FA 2WXGA 3CHRA 2BF0X 4GTRA 1QQEA 3CHQA 2XPZA 4KVOA 4XKCA 1MX6A 5ENTD 4RG9A 3ZXPA 4CDNA 4LCTA 4RVBA 4LUNU 3QOUA 3FUEA 3JUIA 2NC9A 3NOCD 3UT7A 2J07A 4UQZA 3CVXA 1NZNA 5CERB 5G04C 3HXCA 1EPUA 3FUFA 5J08A 4HRMB 2WXNA 1DVPA 3KS2A 4GTTA 3UINC 3PE4A 5ENSD 2NYJA 2P9UG 3TXNA 2LSVA 4C0EA 1JCQA 2DBAA 3CV0A 3EHMA 3ULQA 4H7YA 3DSXA 2IQCA 3L13A 3D9KA 2HO1A 4B8CB 3LY7A 4J8FA 4WNGA 2XEHA 4CGVA 3AS4A 4Y6WA 3BU8A 2I2OA 1YYHA 2FBNA 1WY6A 3CVQA 2A4ZA 1NFIE 3Q7FA 3I3NA 1YA0A 3PNTB 4LG6A 4WNEA 4KVMA 4WAFA 2OOEA 1QYMA 4HB5A 4FLBA 3AG2E 4U7EB 3ZKJA 3UUXA 4JD2G 1SZAA 2XEEA 5CCLA 4G25A 2IY0C 3CVWA 4GPMA 1KZOA 1NP7A 2F37A 4J8SA 3PZ2A 3V2OA 5AN8A 4PS8A 4XEIG 3UMVA 1HU3A 1KZPA 1MHQA 2WXPA 3AG3E 4CT4A 1WG0A 2VGXA 4G11A 4GTPA 4I6GA 4A63B 4I43A 4HI9A 3R7RA 3RIBA 3IV0A 4CEMA 2DYRE 3OAWA 1OCCE 4AEZC 1KLXA 5BXUA 4FC8A 2QC9A 3GW4A 2QFCA 4I9CA 2Y3AA 3KSLA 2VTBA 1IXVA 2DYSE 5FIOA 4C9BB 3UI2A 3CKCA 1TNBA 1TNOA 2WXMA 4Q96A 2GRLA 3NQPA 5CBNA 2WB2A 2XPIA 4U96D 1ZB1A 3L54A 1OT8A 2LO6A 4JA9A 4U63A 5FQ4A 3CVPA 2B6CA 3MZLB 4LERA 2BEDA 2PZIA 2P9IG 3C72A 4LRZA 2P9NG 2RD0A 3AJIA 2IO3C 1N4SA 4BSXA
chains in the Genus database with same CATH topology
2PQRA 4JHKA 4N5CA 1Y8MA 4JL0A 2IJGX 2MHKA 5A23A 3HVEB 2WVIA 3JCKC 3P1UA 2LAHA 3QB2A 4HFGA 2XGSA 4A55A 2FO7A 3EHNA 4GZDA 3G2UA 4AM9A 4XE0A 3RRNB 2HYZA 3EIJA 3LDZA 4HLEA 3CVLA 5C1DA 4G2VA 2AWIA 3FTYA 3NF1A 3FU0A 4GB9A 4TRQA 3ZHEB 3P2BA 2E2EA 2FI7A 2PM7A 3IKOB 4J6IA 4L1BA 5JHBA 4N39A 5KCMA 3SBSA 2KZTA 2KATA 2XHEA 4FU3A 4FLHA 3I4RB 4U0SA 2CHXA 4ANVA 4DI3A 4HOUA 4G24A 1NA0A 4OVUA 3OXFA 4AY6A 2ZU6B 3LCAA 3D3MA 5EDSA 2YINA 3LS8A 4Q69A 4AP2A 3FDHA 3D9LA 3HDXA 3CHMA 3PUKA 5FZQA 4EECA 4MKTA 4NURA 3RRUA 4N2SA 4GYOA 4UWFA 2WXIA 4UI9J 5J90A 3CVUA 2PQNA 3FH8A 4J0UA 4AY5A 1HH8A 4FJZA 1Z3YA 4UI9C 4CCAA 2J09A 5G05J 2WXOA 1EYHA 3CVNA 3R9AB 3B7RL 1GW6A 4AV7A 2J49A 3CK8A 3FU5A 3LEWA 3S7JA 3NZUA 5G05C 4PDXA 2KZTB 2J4BA 2XPYA 1TEZA 4MRUA 2BTDA 4B94A 4I1OB 3KEZA 5T3RA 5E76A 4J8EA 2OVFA 2WQ6A 3FH7A 1ZBPA 1JWFA 3ZW3A 3ZYLA 2V0PA 3PUJA 4JXTA 3ASHA 3SHFA 4EZJA 2MRIA 1N54A 1H2VC 3CHSA 4JPSA 4D10C 4GA0A 1ELRA 1ELWA 1H6KA 4FJYA 1E90A 2KCLA 2XEVA 4UQXA 3IBEA 3FHEA 3FP3A 4BT9A 4GMJA 2VQ2A 4PS3A 1IHGA 3FU3A 3ZYQA 2C0LA 1UJJA 4HXIA 4BY6A 1Z3XA 4EBAG 4GZ3A 5CCMA 2FF4A 3ASDA 4GU5A 4HORA 1LF8A 3QWWA 3OXGA 4I6JA 5KJMA 1SQMA 3G2SA 1QNFA 4HOQA 2CG2A 3K9IA 2C0MA 5BV0A 2JLBA 2LSUA 4U0UA 1H2TC 3L22A 3RU0A 5FWQA 4E85A 4XZ4A 2WXJA 4HOTA 4XI0A 3Q4AB 1PC2A 3ML9A 5LCWJ 3FTUA 2E0IA 2DIWA 5BPPA 1SZ9A 3ESLA 2X3MA 4AJWA 5LCWC 4A1GA 4OYSA 3ZGQA 4YVQC 2HR2A 4JHJA 3PDNA 5LFAA 3S7FA 3U4TA 3Q49B 4I1AA 2X6IA 3LY8A 3MGBA 3PREA 4NRHB 3MKRA 4ABNA 3T5VA 3CSFA 1Y6IA 4EQFA 2V4LA 3KAEA 3HIZA 2KM4A 4G1TA 3EJNA 5D0QD 3QWPA 3FUJA 3U66A 5JJTA 4I1MA 5ANRA 2XQ0A 3ZYKA 4CRWA 3CVYA 2GW1A 2UY1A 5CMYA 3SBTB 2I1JA 3TG4A 4GCOA 5AIJA 1X5BA 2C2LA 2WM9A 3JQ1A 4BTAA 3CHOA 4IYPA 2J4DA 4N3AA 4HOSA 3BG0B 3O4ZA 4WWOA 2OVBA 3O48A 3S7DA 4EBAA 2IU1A 3VLFA 2WMNA 1H0AA 4N2QA 5CHEE 3ZRHA 2WXKA 4GA2A 2Q7FA 3T8MA 5DIZA 2R59A 3CIAA 4W9RA 1BPOA 3QJZA 1E8YA 5JJ6A 4FHKA 5T4YA 4L2YA 4ACKA 3SD5A 4DPRA 2AXVA 3DPDA 3UT4A 4CDMA 4R7LA 3L6AA 4NQ0A 2UY1B 3MX3A 4A3VA 4BX8A 2UWJG 4KMOA 4ME2A 2L9BA 1VDYA 3IEGA 2WQHA 4GCNA 2PM6A 3ASGA 3SF4A 3FY4A 1U3CA 4L23A 4JEHA 1WM5A 3CQGB 3TG5A 5BUZA 3DBSA 4ANXA 3S2AA 1HE8A 4G26A 2WXFA 4HS2A 3FULA 3ASFA 4J8DA 5FZSA 2CHZA 4N3CA 5T8IA 3PS6A 4YVOA 5LP0A 3RKVA 2X6JA 2LNIA 5ARFA 3FFLA 3ZFWA 1Z6TA 2PL2A 3MA5A 4UWLA 3ONKA 2JEKA 4PUCA 3D9JA 3D9NA 3E4BA 3QARA 2XGMA 4XKBA 1UG3A 4MLPA 3BG1B 4Q94A 4K0RA 4ANUA 3CSTA 5FJYA 4OVVA 3WXXA 4PS7A 2EQXA 2DCPA 4BTBA 5HQ8A 3L16A 2XGOA 4U07A 3TGOA 4KT6B 3CEQA 1U3DA 1H19A 1FCHA 3VLDA 2IONA 1PY1A 1HFAA 4MS6A 5G55A 4I6EA 2WXLA 1INZA 3VTYA 4GZCA 2XRZA 4I2WA 4JC8A 4JEUA 2WQ7A 4P29A 4KYOB 3L17A 2L0TB 1P5QA 1A17A 1OWMA 4IULA 2WPVA 3G2WA 3QC1A 5AJLA 3CHPA 3APCA 1UN8A 2X6FA 2ILRA 2AXUA 2WXGA 3CHRA 1UJKA 2BF0X 4GA1A 1E96B 4BFRA 4DJAA 3Q15A 2IOLA 4GYWA 1QQEA 3CHQA 3QWVA 1IYGA 2XPZA 4KVOA 4A1SA 3FUKA 4XKCA 5AJDA 5D0OD 1ELKA 3RO2A 1KT0A 4GYYA 2QY7A 2YHEA 4F3VA 5ARGA 2BUGA 5BW8C 3D9IA 4A3TA 3PVLA 1FVFA 1E7VA 5EX0A 4RG9A 3URZA 3FTVA 3EIQC 2KCVA 1FVHA 3RK6A 4CDNA 4FADA 4LCTA 3UT8A 4I17A 4RVBA 3R7QA 4JVSA 4LUNU 2V5FA 3QOUA 4XI9A 5LOZA 2A5UA 3VLEA 4F53A 2KC7A 3FUEA 4DI4A 3ZPJA 3JUIA 2NC9A 1OWPA 5G04J 3ML8A 3UT7A 3ZVVA 4EZKA 2J07A 3T5XA 4UQZA 3CVXA 1NZNA 3GYZA 1B89A 5CMWA 3FUDA 4Y6CA 5G04C 3IHYA 3LVQE 5AYWD 3FWVA 1EPUA 3FUFA 3S7BA 1WAO1 4O6FA 4IN3B 5J08A 4FULA 3PEUB 2IFUA 4APFA 1JUQA 2WXNA 3D9OA 4FHJA 1ZU2A 2I1KA 3JQ0A 3QDNA 4L2LA 1DVPA 2MOWA 3CK7A 3KS2A 2J08A 4ILIA 3AU4A 1JPLA 5JHAA 2X38A 4QFVA 3FUHA 2AW6A 4URKA 3CVVA 3LJ3A 2YNQA 4BX9A 2XCBA 1JWGA 3PE4A 3I4GA 3B7UX 4EPZA 3CKBA 5E75A 4UWKA 2OV8A 2WXHA 2VYIA 4C0EA 3PNLB 2LSVA 3TXNA 3QAQA 3B7SA 1IQUA 4WWPA 2DBAA 3CV0A 2X6HA 3G2VA 5FQ6A 3EHMA 3ULQA 4H7YA 4GPKA 4B8AA 5DBKA 2IQCA 3QNKA 2CFUA 3L13A 3D9KA 2HO1A 5HI7A 4UQYA 1HF8A 5KJLA 3FTXA 3QK0A 4HVBA 2GRMA 4B8CB 3LY7A 3CR3A 4J8FA 4WNGA 3TJPA 4JZYA 4C0MA 4AXHA 4KXKB 4KZ0A 4CGVA 3FUIA 5M72A 4XIFA 5G2NA 1HXIA 3AS4A 3SZ7A 3ZN3A 3D9PA 3TXMA 4WUYA 4Y6WA 4FP7A 3SI5A 3ZXSA 3APDA 1N52A 2I2OA 4L7TA 2FBNA 3ZIMA 1WY6A 3CVQA 2A4ZA 2L0IA 3ZEFA 3I3NA 2Y4TA 1NA3A 4JA7A 3PZDA 5BV1A 1YA0A 4B89A 3PNTB 4CDRA 4F1SA 3LPZA 2VSYA 4WNEA 1OUVA 4GZ5A 2I6HA 4KVMA 3HYMB 4TV3A 3MKQA 4BT8A 4BWRA 4WAFA 1HG2A 2OOEA 3CK9A 4ACLA 3CLJA 3MV2B 4FLBA 4YNDA 3Q47B 3GZ2A 3UUXA 3APFA 4IRUA 5EX3A 3I5PA 2RG8A 5FTPA 3UX4A 3PEVB 3Q5MA 3ENEA 5JJ7A 2YQ8A 3NZSA 2FULA 4B0ZA 2CFZA 2NSZA 1SZAA 3ONLA 1E8WA 4RSYA 5CCLA 2WMOA 4G25A 4U8HA 4AVXA 3FEYA 2I9CA 4UWGA 4DK5A 1HX8A 1XNFA 1E8XA 3CVWA 1KT1A 3QKYA 4JW1A 2CG3A 3L08A 3MJWA 2IF4A 1NP7A 3RJVA 4J8SA 2HM8A 3AU5A 3AS5A 3N71A 5FZRA 1HO8A 3MKQB 3RRMB 2P58C 4M3OA 3LVRE 2AXZA 1EDUA 4CT0A 3FU6A 4XX5A 2WXRA 4KBQA 5KJKA 3FEXA 4PS8A 3UMVA 1HU3A 1MHQA 2R17C 2WXPA 4CT4A 1HG5A 3LKUA 4I2ZA 2L6JA 3FTWA 3FTZA 2LAIA 1UN9A 4E6HA 1OWNA 3OXLA 3U64A 2VGXA 4G11A 4I9EA 5LX8A 3HHMA 1HS6A 2NXPA 3G2TA 4H7XA 4I6GA 2V8SE 3ESKA 3PH0C 4I43A 2XCCA 3FUMA 3UPVA 3FH5A 4WNDA 3CGHA 3R7RA 1XGWA 2XRYA 3B13A 2AVPA 2GGFA 5BT1A 3RIBA 4K03A 1DNPA 2YHCA 4AOFA 3IV0A 4CEMA 2J9QA 3BEEA 1IQRA 5KJNA 4N3BA 3OAWA 2VGYA 5C2YA 4PH4B 4AEZC 5BNWA 3SNXA 1KLXA 1UW4B 2X6KA 1E8ZA 1E7UA 1PAQA 3D9MA 3LYAA 3TL5A 4ATGA 2IOSA 4FC8A 4DLOA 4EZLA 4LEUA 2VJ8A 2VGXB 4V3IA 5AENA 3GW4A 3ZYMA 4DLQA 2FEZA 2QFCA 2ONDA 1MQSA 3SGHA 3CQCB 2M63A 1L5JA 4ANWA 4I9CA 1OWOA 2Y3AA 4AIFA 3FTSA 1HZ4A 2VTBA 2VSOE 4GAAA 3MV3B 3GZSA 3LXUX 5FQ7A 4ILHB 3OTNA 4GMLA 1EF1C 4WWNA 1H2UA 4TUUA 4ILGA 3KD7A 4WNFA 4C9BB 4U04A 3JYSA 3CKCA 5A6CA 5A7DB 4U0ZA 5ENNA 3U9WA 2WXQA 3FUNA 5FQ8A 3VTXA 2WXMA 3C98A 2R5SA 2GRLA 4Q96A 3NQPA 4RG6A 1QZ2A 4FA6A 3HVEA 3MEKA 1TJCA 3B7TA 2WB2A 3IHVA 3EDTB 4APOA 3PE3A 3GZ1A 1TJFA 1W3BA 3MCXA 3TAXA 2XPIA 4F7AA 4KZCA 3LY9A 2KCKA 4CGWA 3L54A 2CHWA 4G23A 3UQ3A 3AS8A 4NACA 5FT9A 3ZHEA 3U3WA 5ANLA 2LO6A 3RO3A 4JA9A 2VTBB 4U63A 5FQ4A 3MYVA 1OWLA 1S0PA 3CVPA 4UWHA 3MZLB 3PRZA 4LERA 2VSNA 4GZ6A 5EKQD 3SFZA 2PZIA 4LRZA 4JHRA 2VSXE 2RD0A 4UI9K 4BSXA 2Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQR A;  4N5C A;  1Y8M A;  4JL0 A;  2MHK A;  2XGS A;  2FO7 A;  4AM9 A;  2HYZ A;  3CVL A;  5C1D A;  4G2V A;  3NF1 A;  3ZHE B;  2E2E A;  2FI7 A;  4N39 A;  2KAT A;  4U0S A;  4HOU A;  4G24 A;  1NA0 A;  3OXF A;  4AY6 A;  3LCA A;  5FZQ A;  4N2S A;  4GYO A;  4UI9 J;  2PQN A;  4J0U A;  4AY5 A;  1HH8 A;  4UI9 C;  5G05 J;  3CVN A;  3R9A B;  3CK8 A;  3S7J A;  5G05 C;  4B94 A;  4J8E A;  1ZBP A;  3ASH A;  4GA0 A;  1ELR A;  1ELW A;  2KCL A;  2XEV A;  4UQX A;  4BT9 A;  3FP3 A;  2VQ2 A;  1IHG A;  2C0L A;  4GZ3 A;  5CCM A;  2FF4 A;  3ASD A;  4HOR A;  3QWW A;  3OXG A;  5KJM A;  4HOQ A;  3K9I A;  2C0M A;  4U0U A;  2JLB A;  2LSU A;  3RU0 A;  4HOT A;  4XI0 A;  3Q4A B;  1PC2 A;  5LCW J;  5LCW C;  3ZGQ A;  4YVQ C;  2HR2 A;  3PDN A;  3S7F A;  3U4T A;  3Q49 B;  4I1A A;  3LY8 A;  4ABN A;  4NRH B;  3MKR A;  4EQF A;  3KAE A;  4G1T A;  5D0Q D;  3QWP A;  5JJT A;  2GW1 A;  2UY1 A;  3TG4 A;  4GCO A;  2C2L A;  4BTA A;  4N3A A;  4HOS A;  3S7D A;  3O48 A;  4N2Q A;  5CHE E;  4GA2 A;  2Q7F A;  5DIZ A;  4W9R A;  5JJ6 A;  4F3V A;  4NQ0 A;  2UY1 B;  2UWJ G;  4ME2 A;  3IEG A;  2WQH A;  4GCN A;  3ASG A;  3SF4 A;  3TG5 A;  1WM5 A;  4G26 A;  3ASF A;  4J8D A;  5FZS A;  4N3C A;  4YVO A;  3RKV A;  2LNI A;  5ARF A;  3FFL A;  3ZFW A;  2PL2 A;  3MA5 A;  3E4B A;  2XGM A;  5FJY A;  3WXX A;  5HQ8 A;  4BTB A;  2XGO A;  4U07 A;  3TGO A;  3CEQ A;  1FCH A;  3VTY A;  4I2W A;  4KYO B;  1P5Q A;  1A17 A;  2WPV A;  4GA1 A;  1E96 B;  3Q15 A;  4GYW A;  1QQE A;  3QWV A;  1IYG A;  4A1S A;  5D0O D;  3RO2 A;  1KT0 A;  4GYY A;  5ARG A;  2BUG A;  5BW8 C;  5EX0 A;  4RG9 A;  3URZ A;  2KCV A;  4I17 A;  2V5F A;  3QOU A;  4XI9 A;  2KC7 A;  3ZPJ A;  2NC9 A;  5G04 J;  4UQZ A;  1NZN A;  3GYZ A;  1B89 A;  4Y6C A;  5G04 C;  5AYW D;  3FWV A;  3S7B A;  1WAO 1;  4O6F A;  4IN3 B;  2IFU A;  1ZU2 A;  4GPK A;  3QDN A;  3KS2 A;  3CK7 A;  2XCB A;  3PE4 A;  3CKB A;  2VYI A;  2LSV A;  2DBA A;  3CV0 A;  3ULQ A;  4H7Y A;  5DBK A;  2HO1 A;  5HI7 A;  4UQY A;  5KJL A;  3LY7 A;  4J8F A;  4WNG A;  4KXK B;  4CGV A;  5M72 A;  4XIF A;  1HXI A;  3AS4 A;  3SZ7 A;  3ZN3 A;  4WUY A;  4Y6W A;  2FBN A;  3CVQ A;  2Y4T A;  1NA3 A;  4JA7 A;  1YA0 A;  4CDR A;  3LPZ A;  2VSY A;  4WNE A;  1OUV A;  4GZ5 A;  2I6H A;  4BT8 A;  3HYM B;  4BWR A;  2OOE A;  3CK9 A;  3MV2 B;  4YND A;  3Q47 B;  3GZ2 A;  3UUX A;  5EX3 A;  5FTP A;  3Q5M A;  5JJ7 A;  2YQ8 A;  5CCL A;  4G25 A;  1XNF A;  1KT1 A;  3QKY A;  2IF4 A;  3RJV A;  3N71 A;  3AS5 A;  5FZR A;  2P58 C;  4KBQ A;  5KJK A;  3LKU A;  4I2Z A;  2L6J A;  3OXL A;  2VGX A;  4I9E A;  4H7X A;  3ESK A;  2XCC A;  3UPV A;  4WND A;  2AVP A;  5BT1 A;  3RIB A;  2YHC A;  2J9Q A;  3BEE A;  5KJN A;  4N3B A;  2VGY A;  5BNW A;  1KLX A;  3LYA A;  4LEU A;  2VGX B;  3GW4 A;  2FEZ A;  2QFC A;  2OND A;  4I9C A;  4AIF A;  1HZ4 A;  3MV3 B;  3KD7 A;  4WNF A;  4U04 A;  3JYS A;  3CKC A;  5A6C A;  5A7D B;  4U0Z A;  3VTX A;  2R5S A;  4RG6 A;  1QZ2 A;  3MEK A;  1TJC A;  3EDT B;  4APO A;  3PE3 A;  3GZ1 A;  1W3B A;  3TAX A;  2XPI A;  3LY9 A;  2KCK A;  4CGW A;  4G23 A;  3UQ3 A;  3AS8 A;  5FT9 A;  3ZHE A;  3U3W A;  3RO3 A;  4JA9 A;  3CVP A;  5EKQ D;  2VSN A;  4GZ6 A;  2PZI A;  4JHR A;  4UI9 K;  2Y4U A; 
#chains in the Genus database with same CATH topology
 2Y0B G;  1D8D A;  2FO7 A;  3W9F A;  4B93 B;  3ZHE B;  2FI7 A;  3IKO B;  4J6I A;  4L1B A;  5JHB A;  5KCM A;  2KAT A;  2XHE A;  4DI3 A;  4ATZ D;  3DST A;  2QYU A;  3HDX A;  3PUK A;  4EEC A;  4GYO A;  2WXI A;  1K1B A;  4HBD A;  4UI9 C;  5G05 J;  3R9A B;  3B7R L;  2J49 A;  3LEW A;  4U8V D;  4PDX A;  3V30 A;  2BKG A;  4I1O B;  3KEZ A;  5E76 A;  4J8E A;  2OVF A;  2RKK A;  3FH7 A;  1SW6 A;  3ASH A;  3SHF A;  4FJY A;  3JXI A;  2XEV A;  3JXJ A;  4UQX A;  3FHE A;  3FP3 A;  2VQ2 A;  4K5B A;  4HI8 A;  4PS3 A;  4BES A;  3ZYQ A;  2GRQ B;  3ASD A;  1QNF A;  4HOQ A;  4YDY A;  4G8L A;  5BV0 A;  1BI7 B;  4U0U A;  4E85 A;  2EIK E;  4XZ4 A;  4HOT A;  3Q4A B;  2E0I A;  2P9P G;  5EYL A;  1FT1 A;  4OYS A;  3S7F A;  3DPY A;  3Q49 B;  3D9H A;  3MKR A;  3CSF A;  1Y6I A;  2KM4 A;  4G1T A;  1D8E A;  3TWR A;  2XQ0 A;  2UY1 A;  3R9M A;  3V2X A;  3JQ1 A;  4N3A A;  2EIM E;  4EBA A;  3VLF A;  1H0A A;  5ITZ F;  3J5P A;  4ACK A;  4GTM A;  4L2Y A;  1FT2 A;  2AXV A;  3DPD A;  2L9B A;  1OCO E;  1Z5S C;  2PM6 A;  2OEV A;  1WDY A;  3HG0 D;  1N9A A;  1WM5 A;  4ANX A;  1G3N B;  3S2A A;  4DUI A;  5T8I A;  3RKV A;  5CEC B;  3ZFW A;  1Z6T A;  3ONK A;  3D9N A;  3E4B A;  2OEW A;  3BG1 B;  2LUH A;  3E33 A;  4ANU A;  2EQX A;  2DCP A;  5JMN D;  3UM1 A;  2GRP B;  3VLD A;  1HFA A;  5G55 A;  4K5A B;  4JC8 A;  4KYO B;  3G2W A;  3CHP A;  2L6B A;  4GTQ A;  2AXU A;  2PNN A;  4BFR A;  1E96 B;  4DJA A;  3Q15 A;  2GRO B;  1OCR E;  1IYG A;  1ELK A;  2YHE A;  3C5R A;  5ARG A;  3D9I A;  1FVF A;  5EX0 A;  3URZ A;  2Y1L E;  2KCV A;  4FAD A;  3RK6 A;  3ABL E;  4I17 A;  4JVS A;  2V5F A;  2A5U A;  4DI4 A;  4X8Q A;  3TWV A;  1DC2 A;  5AYW D;  4ZHB A;  3S7B A;  1WAO 1;  4O6F A;  3PEU B;  1JUQ A;  1ZU2 A;  4L2L A;  2MOW A;  3AU4 A;  4QFV A;  4URK A;  3F6Q A;  4O1P A;  2HE0 A;  4UWK A;  2FO1 E;  2VYI A;  4LNG A;  1IQU A;  4WWP A;  3UIO C;  3SO8 A;  1U2V G;  4HNA D;  5HI7 A;  4UQY A;  1HF8 A;  2ETA A;  3W9G A;  2GRM A;  4C0M A;  4AXH A;  4KZ0 A;  4XIF A;  3ZU7 B;  3SZ7 A;  3ZN3 A;  3D9P A;  3APD A;  2AJA A;  4OAU C;  3L9T A;  3HRA A;  4JA7 A;  4F1S A;  2VSY A;  3MKQ A;  4BWR A;  1HG2 A;  3CK9 A;  3CLJ A;  3MV2 B;  4YND A;  3GZ2 A;  3APF A;  1TR4 A;  3Q5M A;  5JJ7 A;  1N94 A;  2FUL A;  4B0Z A;  2CFZ A;  2WMO A;  4DK5 A;  1XNF A;  4HLL A;  4JW1 A;  2VGE A;  3L08 A;  3MJW A;  2IF4 A;  3RJV A;  2HM8 A;  3N71 A;  3NAW A;  2P58 C;  4M3O A;  1AWC B;  3LVR E;  3E37 A;  5EYP F;  4CT0 A;  2WXR A;  3FTW A;  3FTZ A;  2LXM A;  4I9E A;  3HHM A;  2V8S E;  2XCC A;  3FUM A;  3FH5 A;  4WND A;  2XRY A;  1DNP A;  5KBA A;  2J9Q A;  2XZD G;  5KJN A;  4N3B A;  2VGY A;  1SVX A;  1UW4 B;  4DLO A;  3TL5 A;  3D9M A;  4RLY A;  1MJ0 A;  2VGX B;  1YMP A;  3AG1 E;  3SGH A;  1HZ4 A;  1FPP A;  2VSO E;  4GAA A;  3GZS A;  3JYS A;  2WXQ A;  3FUN A;  5FQ8 A;  1N4P A;  4FA6 A;  3GZ1 A;  1TJF A;  3TAX A;  1K3Z D;  3LY9 A;  4NAC A;  5FT9 A;  3SFY A;  5ANL A;  2VTB B;  4UWH A;  3PRZ A;  3ABM E;  1N11 A;  2F8X K;  2Y4U A;  1Y8M A;  2WVI A;  3P1U A;  3QB2 A;  2Y69 E;  3EIJ A;  3PZ3 A;  4LNB A;  4G2V A;  3NF1 A;  4GB9 A;  3SFX A;  2KZT A;  2CHX A;  4HOU A;  4G24 A;  3LS8 A;  3ASN E;  4Q69 A;  3DXM G;  4AP2 A;  3FDH A;  2EIN E;  1DCE A;  3CHM A;  4MKT A;  4NUR A;  4UWF A;  3E30 A;  3Q79 A;  4AY5 A;  4FJZ A;  3E32 A;  1Z3Y A;  3L82 A;  3EU9 A;  3NZU A;  4MRU A;  5T3R A;  2LXL A;  3ZYL A;  2V0P A;  3ASO E;  4JXT A;  3ZNG A;  3BQO A;  3CHS A;  4JPS A;  2KCL A;  3IBE A;  4BT9 A;  3TWQ A;  1LTX A;  1UJJ A;  4HXI A;  4GU5 A;  4HOR A;  1N0R A;  1MZC A;  3OXG A;  2R02 A;  4I6J A;  4MBG A;  2C0M A;  2JLB A;  3L22 A;  4L9P A;  5FWQ A;  3TWT A;  1PC2 A;  2P9L G;  1TYQ G;  2DIW A;  1SZ9 A;  5HKP A;  2X3M A;  5LCW C;  3DSU A;  4YVQ C;  2DZN A;  2HR2 A;  3T5V A;  3DEO A;  2X6I A;  3PRE A;  4BEP A;  4NRH B;  5J90 A;  5KNG A;  3HIZ A;  3FUJ A;  3SBT B;  2ZXW E;  5AIJ A;  3CHO A;  4IYP A;  4BSZ B;  3BG0 B;  3O4Z A;  5IY5 E;  3SY2 A;  5CHE E;  2Q7F A;  3T8M A;  2DZO A;  2R59 A;  3C3O A;  1BPO A;  5T4Y A;  3X2Q E;  3SD5 A;  3L6A A;  2UY1 B;  4KMO A;  1VDY A;  3IEG A;  4GCN A;  3SF4 A;  3FY4 A;  3V31 A;  4YDE A;  3B95 A;  4G26 A;  2WXF A;  3KSQ A;  1YCS B;  2LNI A;  3FFL A;  2PL2 A;  4UWL A;  4PUC A;  3D9J A;  4K5C A;  1KPS B;  4XKB A;  1UOH A;  3SQV A;  4U07 A;  4KT6 B;  3CEQ A;  1H19 A;  1FCH A;  2ION A;  1MX2 A;  4GZC A;  4I2W A;  4JEU A;  4P29 A;  3J5Q B;  4IUL A;  5AQ9 A;  3APC A;  5CED B;  1UJK A;  4GA1 A;  1TNY A;  2IOL A;  4GYW A;  3QWV A;  4DX2 A;  4A1S A;  3FUK A;  2IO2 C;  5AJD A;  5D0O D;  3RO2 A;  4YDW A;  1KT0 A;  5AQB A;  5BW8 C;  3PVL A;  3Q75 A;  3EIQ C;  2V5Q C;  3R7Q A;  3VLE A;  4XI9 A;  5LOZ A;  3ZPJ A;  5G04 J;  3ML8 A;  3T5X A;  3GYZ A;  1B89 A;  5CMW A;  3FUD A;  5ENO D;  4Y6C A;  3WG7 E;  1BD8 A;  3IHY A;  1TN6 A;  2DWZ A;  3LVQ E;  1SA4 A;  4APF A;  3JQ0 A;  4ILI A;  2J08 A;  1JPL A;  3CVV A;  3LJ3 A;  4U95 D;  2XCB A;  1JWG A;  1JCR A;  3CKB A;  5E75 A;  2OV8 A;  3PNL B;  3QAQ A;  1O1S A;  2X6H A;  3G2V A;  5FQ6 A;  5DBK A;  3TWU A;  5KJL A;  3FTX A;  3QK0 A;  4HVB A;  3TJP A;  4JZY A;  4KXK B;  1V54 E;  3FUI A;  5M72 A;  4G8K A;  1H6O A;  4WUY A;  4FP7 A;  4L7T A;  4F6R D;  1V55 E;  1NA3 A;  4B89 A;  4CDR A;  3LPZ A;  1OUV A;  2R2L A;  1N0Q A;  2QYJ A;  3Q47 B;  3I5P A;  2RG8 A;  3UX4 A;  4DX6 D;  3ENE A;  2YQ8 A;  2NSZ A;  1RZ4 A;  3Q7A A;  1E8W A;  4GTO A;  4UWG A;  1HX8 A;  2CG3 A;  3AU5 A;  4J8Y A;  2J8S D;  5FZR A;  1HO8 A;  3MKQ B;  2AXZ A;  1EDU A;  3FU6 A;  5KJK A;  3FEX A;  1HG5 A;  3LKU A;  2L6J A;  2LAI A;  1UN9 A;  1OWN A;  5ENP D;  5LX8 A;  3C3R A;  1HS6 A;  2A5E A;  2NXP A;  3PH0 C;  4Z68 A;  1QBQ A;  3CGH A;  3Q9U C;  2GGF A;  4K03 A;  4AOF A;  3BEE A;  1S64 A;  3NBN B;  1E8Z A;  1E7U A;  4EZL A;  2IOS A;  5AEN A;  4LEU A;  4V3I A;  1A5E A;  3EUV A;  3ZYM A;  4DLQ A;  2FEZ A;  5EIB E;  2OND A;  3JUE A;  2M63 A;  1L5J A;  4ANW A;  1IHB A;  3MV3 B;  3LXU X;  5FQ7 A;  4ILH B;  1EF1 C;  4WWN A;  3KD7 A;  4WNF A;  4U04 A;  1LD8 A;  5A6C A;  5A7D B;  4U0Z A;  5ENN A;  4HRL A;  1NL4 A;  3ABK E;  1QZ2 A;  3HVE A;  3DWL G;  3MEK A;  4EHM A;  2GRN B;  3B7T A;  2ZIS A;  3IHV A;  4APO A;  3PE3 A;  4F7A A;  3DSV A;  4G23 A;  2CHW A;  5EID A;  3U3W A;  1OWL A;  3ZEF A;  1S0P A;  5EKQ D;  4J7W A;  4YDO A;  4JHR A;  2VSX E;  2XZT G;  2KXP C;  4UUC A;  4UI9 K;  2RFM A;  2P9S G;  2DVW A;  4N5C A;  4JL0 A;  2IJG X;  5A23 A;  1RW2 A;  2LAH A;  4HFG A;  4A55 A;  5B1B E;  4GZD A;  4XE0 A;  4HLE A;  1TN8 A;  1MYO A;  3FU0 A;  4TRQ A;  1JCS A;  3P2B A;  2E2E A;  2PM7 A;  3I4R B;  4U0S A;  3HXE A;  4OVU A;  3OXF A;  4AY6 A;  2ZU6 B;  5EDS A;  3D3M A;  3D9L A;  4UI9 J;  5CRU A;  1LD7 A;  1BLX B;  5ENQ D;  3UXG A;  5KNH D;  2ETC A;  4CCA A;  1GW6 A;  4AV7 A;  3FU5 A;  5G05 C;  2KZT B;  3B7B A;  2J4B A;  2XPY A;  1TEZ A;  3EHR A;  2BTD A;  3ZW3 A;  3PUJ A;  4EZJ A;  2MRI A;  3C3Q A;  1H2V C;  4D10 C;  1E90 A;  2C0L A;  4EBA G;  1LF8 A;  4DRX E;  2R03 A;  3G2S A;  3K9I A;  1H2T C;  3RU0 A;  2WXJ A;  3DSS A;  4TXQ A;  4XI0 A;  3ML9 A;  3ESL A;  4AJW A;  4GMR A;  4JHJ A;  3PDN A;  5LFA A;  4LNU D;  2F8Y A;  3MGB A;  2EIL E;  4EQF A;  2R05 A;  2V4L A;  5D0Q D;  3RAU A;  3QWP A;  3CVY A;  4I1M A;  2WM9 A;  4HOS A;  1OY3 D;  4WWO A;  2OVB A;  3O48 A;  3S7D A;  3Q73 A;  2WMN A;  5KWD A;  1AP7 A;  3CIA A;  1E8Y A;  2H6H A;  3HXF A;  4FHK A;  4DPR A;  4F3V A;  4CDM A;  4R7L A;  4A3V A;  4BX8 A;  2UWJ G;  4ME2 A;  4BET A;  3ASG A;  3TWS A;  1U3C A;  3TG5 A;  5BUZ A;  3DBS A;  5FZS A;  2CHZ A;  4N3C A;  3PS6 A;  5LP0 A;  2V4H C;  2GRR B;  2ZIR A;  4N5Q A;  3QAR A;  1X81 A;  1S63 A;  2OCC E;  3WXX A;  4ZFH A;  4PS7 A;  5HQ8 A;  4BTB A;  3L16 A;  2XGO A;  3TGO A;  3ULE G;  1O5M A;  4I6E A;  2XS8 A;  2WXL A;  1INZ A;  2XRZ A;  3L17 A;  2L0T B;  1P5Q A;  1A17 A;  1Q2Z A;  1OWM A;  2WPV A;  3QC1 A;  2ILR A;  2ZGG A;  2ZGD A;  3LJN A;  4GYY A;  2QY7 A;  2BUG A;  4A3T A;  1E7V A;  3FTV A;  3ZUV B;  1FVH A;  4BER A;  3T8K A;  3UT8 A;  4F53 A;  2KC7 A;  5AQ7 A;  1OWP A;  4EZK A;  3ZVV A;  4GTV A;  3FWV A;  4IN3 B;  5D66 A;  4FUL A;  2IFU A;  3D9O A;  4FHJ A;  2I1K A;  4GPK A;  3QDN A;  3CK7 A;  4DX5 D;  5JHA A;  2X38 A;  3FUH A;  2AW6 A;  2YNQ A;  4BX9 A;  3I4G A;  3B7U X;  4EPZ A;  3EHQ A;  2WXH A;  3AAA C;  3B7S A;  4M7C A;  3TWW A;  4B8A A;  2H6I A;  3QNK A;  2CFU A;  2IEJ A;  2KBX A;  3CR3 A;  1N95 A;  5G2N A;  1HXI A;  4CZ2 D;  3TXM A;  5FIN A;  3SI5 A;  3ZXS A;  1N52 A;  1IKN D;  3ZIM A;  4RQI A;  5HS0 A;  4TXP A;  2L0I A;  2Y4T A;  5BV1 A;  3PZD A;  4GZ5 A;  2I6H A;  4TV3 A;  3HYM B;  4BT8 A;  2H6G A;  4ACL A;  4IRU A;  5EX3 A;  5CEA A;  5FTP A;  3PEV B;  3NZS A;  1K1A A;  1TN7 A;  2P9K G;  3ONL A;  4LSZ E;  4RSY A;  4U8H A;  4AVX A;  2ETB A;  3FEY A;  5D2M C;  2I9C A;  4TUM A;  1E8X A;  1KT1 A;  3QKY A;  4OAV B;  2BKK B;  3AS5 A;  4O1O A;  3RRM B;  2XEN A;  4XX5 A;  4KBQ A;  3Q9N C;  2R17 C;  4I2Z A;  4E6H A;  3OXL A;  3U64 A;  3HXB A;  5CRV A;  1K8K G;  3BUA A;  3G2T A;  4H7X A;  3ESK A;  1MX4 A;  3TWX A;  3UPV A;  1XGW A;  3B13 A;  2AVP A;  5BT1 A;  3IXE A;  2YHC A;  1IQR A;  5C2Y A;  3DEP A;  4PH4 B;  5BNW A;  3SNX A;  2X6K A;  3UKR G;  3LYA A;  1PAQ A;  4ATG A;  2VJ8 A;  1TNZ A;  3T9K A;  1OXJ A;  4C48 B;  1MQS A;  3CQC B;  1OWO A;  4AIF A;  3FTS A;  5AAO A;  3OTN A;  4GML A;  1H2U A;  2P2C P;  4TUU A;  2XS1 A;  4ILG A;  3U9W A;  3KEA A;  3EU5 A;  3VTX A;  2R5S A;  3C98 A;  5EIL A;  4RG6 A;  1TJC A;  3EDT B;  1SA5 A;  1W3B A;  3MCX A;  4KZC A;  2KCK A;  4CGW A;  1TNU A;  3UQ3 A;  5AAR A;  3AS8 A;  3ZHE A;  3RO3 A;  5CBO A;  3MYV A;  3SFZ A;  2VSN A;  4GTS A;  4GZ6 A;  1H6P A;  2PQR A;  4JHK A;  2MHK A;  3HVE B;  4DX7 D;  3JCK C;  2XGS A;  3EHN A;  3G2U A;  4AM9 A;  3RRN B;  2HYZ A;  3LDZ A;  3CVL A;  5C1D A;  2AWI A;  3FTY A;  4NIK A;  5HRY A;  4N39 A;  1N4Q A;  3SBS A;  4FLH A;  4FU3 A;  4ANV A;  1BI8 B;  1NA0 A;  2QZA A;  3LCA A;  2YIN A;  3NB2 A;  3UTM A;  5FZQ A;  4N2S A;  3RRU A;  4TXR A;  3CVU A;  3UM2 A;  2PQN A;  3FH8 A;  4J0U A;  4CYM D;  1HH8 A;  2J09 A;  2WXO A;  1EYH A;  4O60 A;  5ENR D;  3CVN A;  3DRA A;  3CK8 A;  3PZ1 A;  3S7J A;  4B94 A;  5AQA A;  2WQ6 A;  1O1R A;  1ZBP A;  1JWF A;  1N54 A;  3HXD A;  4GA0 A;  1ELR A;  1ELW A;  1H6K A;  5JA4 D;  4GMJ A;  1IHG A;  3FU3 A;  3NOG D;  2EIJ E;  4DX1 A;  3PZ4 A;  4BY6 A;  1Z3X A;  4GZ3 A;  5CCM A;  2FF4 A;  3QWW A;  5KJM A;  1S70 B;  1SQM A;  3UM0 A;  2CG2 A;  2LSU A;  1OCZ E;  4HRN A;  3Q78 A;  1BU9 A;  3AG4 E;  5B1A E;  5LCW J;  3FTU A;  5BPP A;  4QQI A;  4A1G A;  3ZGQ A;  3ISM C;  3U4T A;  4I1A A;  3LY8 A;  4ABN A;  1DCQ A;  3KAE A;  3EJN A;  3U66 A;  5JJT A;  5ANR A;  4CRW A;  3ZYK A;  2GW1 A;  5CMY A;  3TG4 A;  2I1J A;  4GCO A;  1X5B A;  2C2L A;  3UKU G;  3RSE G;  4BTA A;  3UIP C;  2J4D A;  4JB8 P;  2F0Y A;  2IU1 A;  3DSW A;  3ULY A;  3E34 A;  4N2Q A;  5H7P A;  3ZRH A;  1O1T A;  2WXK A;  3V79 K;  4GA2 A;  2JAB A;  2B0O E;  5DIZ A;  4W9R A;  5JJ6 A;  3QJZ A;  3UT4 A;  4HQD A;  4NQ0 A;  3MX3 A;  4U8Y D;  1N4R A;  2H6F A;  1D9S A;  3DXK G;  2WQH A;  4L23 A;  4JEH A;  3CQG B;  1HE8 A;  4HS2 A;  3FUL A;  3ASF A;  4J8D A;  4YVO A;  2X6J A;  5ARF A;  5EN5 D;  3MA5 A;  2JEK A;  3UM3 A;  2XGM A;  1UG3 A;  4MLP A;  4Q94 A;  5B3S E;  4K0R A;  2MYO A;  3CST A;  5FJY A;  4OVV A;  5BXO A;  4F1P A;  2RFA A;  1U3D A;  1PY1 A;  4MS6 A;  3VTY A;  2WQ7 A;  1NI1 A;  5AJL A;  1UN8 A;  2X6F A;  2WXG A;  3CHR A;  2BF0 X;  4GTR A;  1QQE A;  3CHQ A;  2XPZ A;  4KVO A;  4XKC A;  1MX6 A;  5ENT D;  4RG9 A;  3ZXP A;  4CDN A;  4LCT A;  4RVB A;  4LUN U;  3QOU A;  3FUE A;  3JUI A;  2NC9 A;  3NOC D;  3UT7 A;  2J07 A;  4UQZ A;  3CVX A;  1NZN A;  5CER B;  5G04 C;  3HXC A;  1EPU A;  3FUF A;  5J08 A;  4HRM B;  2WXN A;  1DVP A;  3KS2 A;  4GTT A;  3UIN C;  3PE4 A;  5ENS D;  2NYJ A;  2P9U G;  3TXN A;  2LSV A;  4C0E A;  1JCQ A;  2DBA A;  3CV0 A;  3EHM A;  3ULQ A;  4H7Y A;  3DSX A;  2IQC A;  3L13 A;  3D9K A;  2HO1 A;  4B8C B;  3LY7 A;  4J8F A;  4WNG A;  2XEH A;  4CGV A;  3AS4 A;  4Y6W A;  3BU8 A;  2I2O A;  1YYH A;  2FBN A;  1WY6 A;  3CVQ A;  2A4Z A;  1NFI E;  3Q7F A;  3I3N A;  1YA0 A;  3PNT B;  4LG6 A;  4WNE A;  4KVM A;  4WAF A;  2OOE A;  1QYM A;  4HB5 A;  4FLB A;  3AG2 E;  4U7E B;  3ZKJ A;  3UUX A;  4JD2 G;  1SZA A;  2XEE A;  5CCL A;  4G25 A;  2IY0 C;  3CVW A;  4GPM A;  1KZO A;  1NP7 A;  2F37 A;  4J8S A;  3PZ2 A;  3V2O A;  5AN8 A;  4PS8 A;  4XEI G;  3UMV A;  1HU3 A;  1KZP A;  1MHQ A;  2WXP A;  3AG3 E;  4CT4 A;  1WG0 A;  2VGX A;  4G11 A;  4GTP A;  4I6G A;  4A63 B;  4I43 A;  4HI9 A;  3R7R A;  3RIB A;  3IV0 A;  4CEM A;  2DYR E;  3OAW A;  1OCC E;  4AEZ C;  1KLX A;  5BXU A;  4FC8 A;  2QC9 A;  3GW4 A;  2QFC A;  4I9C A;  2Y3A A;  3KSL A;  2VTB A;  1IXV A;  2DYS E;  5FIO A;  4C9B B;  3UI2 A;  3CKC A;  1TNB A;  1TNO A;  2WXM A;  4Q96 A;  2GRL A;  3NQP A;  5CBN A;  2WB2 A;  2XPI A;  4U96 D;  1ZB1 A;  3L54 A;  1OT8 A;  2LO6 A;  4JA9 A;  4U63 A;  5FQ4 A;  3CVP A;  2B6C A;  3MZL B;  4LER A;  2BED A;  2PZI A;  2P9I G;  3C72 A;  4LRZ A;  2P9N G;  2RD0 A;  3AJI A;  2IO3 C;  1N4S A;  4BSX A; 
#chains in the Genus database with same CATH homology
 2PQR A;  4JHK A;  4N5C A;  1Y8M A;  4JL0 A;  2IJG X;  2MHK A;  5A23 A;  3HVE B;  2WVI A;  3JCK C;  3P1U A;  2LAH A;  3QB2 A;  4HFG A;  2XGS A;  4A55 A;  2FO7 A;  3EHN A;  4GZD A;  3G2U A;  4AM9 A;  4XE0 A;  3RRN B;  2HYZ A;  3EIJ A;  3LDZ A;  4HLE A;  3CVL A;  5C1D A;  4G2V A;  2AWI A;  3FTY A;  3NF1 A;  3FU0 A;  4GB9 A;  4TRQ A;  3ZHE B;  3P2B A;  2E2E A;  2FI7 A;  2PM7 A;  3IKO B;  4J6I A;  4L1B A;  5JHB A;  4N39 A;  5KCM A;  3SBS A;  2KZT A;  2KAT A;  2XHE A;  4FU3 A;  4FLH A;  3I4R B;  4U0S A;  2CHX A;  4ANV A;  4DI3 A;  4HOU A;  4G24 A;  1NA0 A;  4OVU A;  3OXF A;  4AY6 A;  2ZU6 B;  3LCA A;  3D3M A;  5EDS A;  2YIN A;  3LS8 A;  4Q69 A;  4AP2 A;  3FDH A;  3D9L A;  3HDX A;  3CHM A;  3PUK A;  5FZQ A;  4EEC A;  4MKT A;  4NUR A;  3RRU A;  4N2S A;  4GYO A;  4UWF A;  2WXI A;  4UI9 J;  5J90 A;  3CVU A;  2PQN A;  3FH8 A;  4J0U A;  4AY5 A;  1HH8 A;  4FJZ A;  1Z3Y A;  4UI9 C;  4CCA A;  2J09 A;  5G05 J;  2WXO A;  1EYH A;  3CVN A;  3R9A B;  3B7R L;  1GW6 A;  4AV7 A;  2J49 A;  3CK8 A;  3FU5 A;  3LEW A;  3S7J A;  3NZU A;  5G05 C;  4PDX A;  2KZT B;  2J4B A;  2XPY A;  1TEZ A;  4MRU A;  2BTD A;  4B94 A;  4I1O B;  3KEZ A;  5T3R A;  5E76 A;  4J8E A;  2OVF A;  2WQ6 A;  3FH7 A;  1ZBP A;  1JWF A;  3ZW3 A;  3ZYL A;  2V0P A;  3PUJ A;  4JXT A;  3ASH A;  3SHF A;  4EZJ A;  2MRI A;  1N54 A;  1H2V C;  3CHS A;  4JPS A;  4D10 C;  4GA0 A;  1ELR A;  1ELW A;  1H6K A;  4FJY A;  1E90 A;  2KCL A;  2XEV A;  4UQX A;  3IBE A;  3FHE A;  3FP3 A;  4BT9 A;  4GMJ A;  2VQ2 A;  4PS3 A;  1IHG A;  3FU3 A;  3ZYQ A;  2C0L A;  1UJJ A;  4HXI A;  4BY6 A;  1Z3X A;  4EBA G;  4GZ3 A;  5CCM A;  2FF4 A;  3ASD A;  4GU5 A;  4HOR A;  1LF8 A;  3QWW A;  3OXG A;  4I6J A;  5KJM A;  1SQM A;  3G2S A;  1QNF A;  4HOQ A;  2CG2 A;  3K9I A;  2C0M A;  5BV0 A;  2JLB A;  2LSU A;  4U0U A;  1H2T C;  3L22 A;  3RU0 A;  5FWQ A;  4E85 A;  4XZ4 A;  2WXJ A;  4HOT A;  4XI0 A;  3Q4A B;  1PC2 A;  3ML9 A;  5LCW J;  3FTU A;  2E0I A;  2DIW A;  5BPP A;  1SZ9 A;  3ESL A;  2X3M A;  4AJW A;  5LCW C;  4A1G A;  4OYS A;  3ZGQ A;  4YVQ C;  2HR2 A;  4JHJ A;  3PDN A;  5LFA A;  3S7F A;  3U4T A;  3Q49 B;  4I1A A;  2X6I A;  3LY8 A;  3MGB A;  3PRE A;  4NRH B;  3MKR A;  4ABN A;  3T5V A;  3CSF A;  1Y6I A;  4EQF A;  2V4L A;  3KAE A;  3HIZ A;  2KM4 A;  4G1T A;  3EJN A;  5D0Q D;  3QWP A;  3FUJ A;  3U66 A;  5JJT A;  4I1M A;  5ANR A;  2XQ0 A;  3ZYK A;  4CRW A;  3CVY A;  2GW1 A;  2UY1 A;  5CMY A;  3SBT B;  2I1J A;  3TG4 A;  4GCO A;  5AIJ A;  1X5B A;  2C2L A;  2WM9 A;  3JQ1 A;  4BTA A;  3CHO A;  4IYP A;  2J4D A;  4N3A A;  4HOS A;  3BG0 B;  3O4Z A;  4WWO A;  2OVB A;  3O48 A;  3S7D A;  4EBA A;  2IU1 A;  3VLF A;  2WMN A;  1H0A A;  4N2Q A;  5CHE E;  3ZRH A;  2WXK A;  4GA2 A;  2Q7F A;  3T8M A;  5DIZ A;  2R59 A;  3CIA A;  4W9R A;  1BPO A;  3QJZ A;  1E8Y A;  5JJ6 A;  4FHK A;  5T4Y A;  4L2Y A;  4ACK A;  3SD5 A;  4DPR A;  2AXV A;  3DPD A;  3UT4 A;  4CDM A;  4R7L A;  3L6A A;  4NQ0 A;  2UY1 B;  3MX3 A;  4A3V A;  4BX8 A;  2UWJ G;  4KMO A;  4ME2 A;  2L9B A;  1VDY A;  3IEG A;  2WQH A;  4GCN A;  2PM6 A;  3ASG A;  3SF4 A;  3FY4 A;  1U3C A;  4L23 A;  4JEH A;  1WM5 A;  3CQG B;  3TG5 A;  5BUZ A;  3DBS A;  4ANX A;  3S2A A;  1HE8 A;  4G26 A;  2WXF A;  4HS2 A;  3FUL A;  3ASF A;  4J8D A;  5FZS A;  2CHZ A;  4N3C A;  5T8I A;  3PS6 A;  4YVO A;  5LP0 A;  3RKV A;  2X6J A;  2LNI A;  5ARF A;  3FFL A;  3ZFW A;  1Z6T A;  2PL2 A;  3MA5 A;  4UWL A;  3ONK A;  2JEK A;  4PUC A;  3D9J A;  3D9N A;  3E4B A;  3QAR A;  2XGM A;  4XKB A;  1UG3 A;  4MLP A;  3BG1 B;  4Q94 A;  4K0R A;  4ANU A;  3CST A;  5FJY A;  4OVV A;  3WXX A;  4PS7 A;  2EQX A;  2DCP A;  4BTB A;  5HQ8 A;  3L16 A;  2XGO A;  4U07 A;  3TGO A;  4KT6 B;  3CEQ A;  1U3D A;  1H19 A;  1FCH A;  3VLD A;  2ION A;  1PY1 A;  1HFA A;  4MS6 A;  5G55 A;  4I6E A;  2WXL A;  1INZ A;  3VTY A;  4GZC A;  2XRZ A;  4I2W A;  4JC8 A;  4JEU A;  2WQ7 A;  4P29 A;  4KYO B;  3L17 A;  2L0T B;  1P5Q A;  1A17 A;  1OWM A;  4IUL A;  2WPV A;  3G2W A;  3QC1 A;  5AJL A;  3CHP A;  3APC A;  1UN8 A;  2X6F A;  2ILR A;  2AXU A;  2WXG A;  3CHR A;  1UJK A;  2BF0 X;  4GA1 A;  1E96 B;  4BFR A;  4DJA A;  3Q15 A;  2IOL A;  4GYW A;  1QQE A;  3CHQ A;  3QWV A;  1IYG A;  2XPZ A;  4KVO A;  4A1S A;  3FUK A;  4XKC A;  5AJD A;  5D0O D;  1ELK A;  3RO2 A;  1KT0 A;  4GYY A;  2QY7 A;  2YHE A;  4F3V A;  5ARG A;  2BUG A;  5BW8 C;  3D9I A;  4A3T A;  3PVL A;  1FVF A;  1E7V A;  5EX0 A;  4RG9 A;  3URZ A;  3FTV A;  3EIQ C;  2KCV A;  1FVH A;  3RK6 A;  4CDN A;  4FAD A;  4LCT A;  3UT8 A;  4I17 A;  4RVB A;  3R7Q A;  4JVS A;  4LUN U;  2V5F A;  3QOU A;  4XI9 A;  5LOZ A;  2A5U A;  3VLE A;  4F53 A;  2KC7 A;  3FUE A;  4DI4 A;  3ZPJ A;  3JUI A;  2NC9 A;  1OWP A;  5G04 J;  3ML8 A;  3UT7 A;  3ZVV A;  4EZK A;  2J07 A;  3T5X A;  4UQZ A;  3CVX A;  1NZN A;  3GYZ A;  1B89 A;  5CMW A;  3FUD A;  4Y6C A;  5G04 C;  3IHY A;  3LVQ E;  5AYW D;  3FWV A;  1EPU A;  3FUF A;  3S7B A;  1WAO 1;  4O6F A;  4IN3 B;  5J08 A;  4FUL A;  3PEU B;  2IFU A;  4APF A;  1JUQ A;  2WXN A;  3D9O A;  4FHJ A;  1ZU2 A;  2I1K A;  3JQ0 A;  3QDN A;  4L2L A;  1DVP A;  2MOW A;  3CK7 A;  3KS2 A;  2J08 A;  4ILI A;  3AU4 A;  1JPL A;  5JHA A;  2X38 A;  4QFV A;  3FUH A;  2AW6 A;  4URK A;  3CVV A;  3LJ3 A;  2YNQ A;  4BX9 A;  2XCB A;  1JWG A;  3PE4 A;  3I4G A;  3B7U X;  4EPZ A;  3CKB A;  5E75 A;  4UWK A;  2OV8 A;  2WXH A;  2VYI A;  4C0E A;  3PNL B;  2LSV A;  3TXN A;  3QAQ A;  3B7S A;  1IQU A;  4WWP A;  2DBA A;  3CV0 A;  2X6H A;  3G2V A;  5FQ6 A;  3EHM A;  3ULQ A;  4H7Y A;  4GPK A;  4B8A A;  5DBK A;  2IQC A;  3QNK A;  2CFU A;  3L13 A;  3D9K A;  2HO1 A;  5HI7 A;  4UQY A;  1HF8 A;  5KJL A;  3FTX A;  3QK0 A;  4HVB A;  2GRM A;  4B8C B;  3LY7 A;  3CR3 A;  4J8F A;  4WNG A;  3TJP A;  4JZY A;  4C0M A;  4AXH A;  4KXK B;  4KZ0 A;  4CGV A;  3FUI A;  5M72 A;  4XIF A;  5G2N A;  1HXI A;  3AS4 A;  3SZ7 A;  3ZN3 A;  3D9P A;  3TXM A;  4WUY A;  4Y6W A;  4FP7 A;  3SI5 A;  3ZXS A;  3APD A;  1N52 A;  2I2O A;  4L7T A;  2FBN A;  3ZIM A;  1WY6 A;  3CVQ A;  2A4Z A;  2L0I A;  3ZEF A;  3I3N A;  2Y4T A;  1NA3 A;  4JA7 A;  3PZD A;  5BV1 A;  1YA0 A;  4B89 A;  3PNT B;  4CDR A;  4F1S A;  3LPZ A;  2VSY A;  4WNE A;  1OUV A;  4GZ5 A;  2I6H A;  4KVM A;  3HYM B;  4TV3 A;  3MKQ A;  4BT8 A;  4BWR A;  4WAF A;  1HG2 A;  2OOE A;  3CK9 A;  4ACL A;  3CLJ A;  3MV2 B;  4FLB A;  4YND A;  3Q47 B;  3GZ2 A;  3UUX A;  3APF A;  4IRU A;  5EX3 A;  3I5P A;  2RG8 A;  5FTP A;  3UX4 A;  3PEV B;  3Q5M A;  3ENE A;  5JJ7 A;  2YQ8 A;  3NZS A;  2FUL A;  4B0Z A;  2CFZ A;  2NSZ A;  1SZA A;  3ONL A;  1E8W A;  4RSY A;  5CCL A;  2WMO A;  4G25 A;  4U8H A;  4AVX A;  3FEY A;  2I9C A;  4UWG A;  4DK5 A;  1HX8 A;  1XNF A;  1E8X A;  3CVW A;  1KT1 A;  3QKY A;  4JW1 A;  2CG3 A;  3L08 A;  3MJW A;  2IF4 A;  1NP7 A;  3RJV A;  4J8S A;  2HM8 A;  3AU5 A;  3AS5 A;  3N71 A;  5FZR A;  1HO8 A;  3MKQ B;  3RRM B;  2P58 C;  4M3O A;  3LVR E;  2AXZ A;  1EDU A;  4CT0 A;  3FU6 A;  4XX5 A;  2WXR A;  4KBQ A;  5KJK A;  3FEX A;  4PS8 A;  3UMV A;  1HU3 A;  1MHQ A;  2R17 C;  2WXP A;  4CT4 A;  1HG5 A;  3LKU A;  4I2Z A;  2L6J A;  3FTW A;  3FTZ A;  2LAI A;  1UN9 A;  4E6H A;  1OWN A;  3OXL A;  3U64 A;  2VGX A;  4G11 A;  4I9E A;  5LX8 A;  3HHM A;  1HS6 A;  2NXP A;  3G2T A;  4H7X A;  4I6G A;  2V8S E;  3ESK A;  3PH0 C;  4I43 A;  2XCC A;  3FUM A;  3UPV A;  3FH5 A;  4WND A;  3CGH A;  3R7R A;  1XGW A;  2XRY A;  3B13 A;  2AVP A;  2GGF A;  5BT1 A;  3RIB A;  4K03 A;  1DNP A;  2YHC A;  4AOF A;  3IV0 A;  4CEM A;  2J9Q A;  3BEE A;  1IQR A;  5KJN A;  4N3B A;  3OAW A;  2VGY A;  5C2Y A;  4PH4 B;  4AEZ C;  5BNW A;  3SNX A;  1KLX A;  1UW4 B;  2X6K A;  1E8Z A;  1E7U A;  1PAQ A;  3D9M A;  3LYA A;  3TL5 A;  4ATG A;  2IOS A;  4FC8 A;  4DLO A;  4EZL A;  4LEU A;  2VJ8 A;  2VGX B;  4V3I A;  5AEN A;  3GW4 A;  3ZYM A;  4DLQ A;  2FEZ A;  2QFC A;  2OND A;  1MQS A;  3SGH A;  3CQC B;  2M63 A;  1L5J A;  4ANW A;  4I9C A;  1OWO A;  2Y3A A;  4AIF A;  3FTS A;  1HZ4 A;  2VTB A;  2VSO E;  4GAA A;  3MV3 B;  3GZS A;  3LXU X;  5FQ7 A;  4ILH B;  3OTN A;  4GML A;  1EF1 C;  4WWN A;  1H2U A;  4TUU A;  4ILG A;  3KD7 A;  4WNF A;  4C9B B;  4U04 A;  3JYS A;  3CKC A;  5A6C A;  5A7D B;  4U0Z A;  5ENN A;  3U9W A;  2WXQ A;  3FUN A;  5FQ8 A;  3VTX A;  2WXM A;  3C98 A;  2R5S A;  2GRL A;  4Q96 A;  3NQP A;  4RG6 A;  1QZ2 A;  4FA6 A;  3HVE A;  3MEK A;  1TJC A;  3B7T A;  2WB2 A;  3IHV A;  3EDT B;  4APO A;  3PE3 A;  3GZ1 A;  1TJF A;  1W3B A;  3MCX A;  3TAX A;  2XPI A;  4F7A A;  4KZC A;  3LY9 A;  2KCK A;  4CGW A;  3L54 A;  2CHW A;  4G23 A;  3UQ3 A;  3AS8 A;  4NAC A;  5FT9 A;  3ZHE A;  3U3W A;  5ANL A;  2LO6 A;  3RO3 A;  4JA9 A;  2VTB B;  4U63 A;  5FQ4 A;  3MYV A;  1OWL A;  1S0P A;  3CVP A;  4UWH A;  3MZL B;  3PRZ A;  4LER A;  2VSN A;  4GZ6 A;  5EKQ D;  3SFZ A;  2PZI A;  4LRZ A;  4JHR A;  2VSX E;  2RD0 A;  4UI9 K;  4BSX A;  2Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...