1QQEA

Crystal structure of the vesicular transport protein sec17
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
290
structure length
281
Chain Sequence
ISDPVELLKRAEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSESNFLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords VESICULAR TRANSPORT PROTEIN SEC17
publication title Crystal structure of the vesicular transport protein Sec17: implications for SNAP function in SNARE complex disassembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 122
structure length 281
sequence length 290
ec nomenclature
pdb deposition date 1999-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1qqeA00
3CV0A 4N3AA 2HO1A 3BEEA 5AYWD 4BT8A 4Y6CA 4GCNA 4WNFA 3CKCA 4G24A 3LYAA 5JJ6A 2VYIA 3ZN3A 4UQXA 1QQEA 4HOUA 5JJ7A 4WNDA 4U04A 3R9AB 5A6CA 5LCWJ 2GW1A 5KJNA 2KCVA 4GZ6A 3QKYA 3TG4A 4JHRA 3PDNA 3UQ3A 3QWWA 3RIBA 2XGSA 4N3CA 2XCCA 4KYOB 4GYWA 4W9RA 3TG5A 3VTXA 2YQ8A 4N39A 5HI7A 4GYYA 1IHGA 5FJYA 3CVQA 3IEGA 4ME2A 5G04C 3RJVA 4I2WA 4XI9A 3GYZA 3RKVA 2UY1B 3GZ1A 4I17A 4A1SA 1HXIA 3QDNA 3OXLA 1FCHA 4WUYA 2KATA 4H7XA 4AIFA 5C1DA 1ZU2A 1A17A 2JLBA 2R5SA 4WNGA 4NRHB 4N2QA 2E2EA 3ZHEA 2LSUA 3LCAA 3Q49B 3AS4A 3OXFA 3S7JA 3CK9A 2ONDA 1TJCA 4F3VA 4N2SA 3MKRA 1E96B 4U0UA 4JL0A 3GZ2A 2PL2A 3ASGA 4RG9A 1HH8A 3LY9A 4U0SA 3HYMB 4G25A 5A7DB 5ARGA 3WXXA 3VTYA 4G23A 5EKQD 5DBKA 4J8EA 4J8FA 4I9CA 3S7FA 3Q15A 5EX0A 3FP3A 4EQFA 2FF4A 4JA9A 2VSYA 4B94A 2KCKA 5ARFA 3ZGQA 1NA3A 4CDRA 4I9EA 3KS2A 1QZ2A 3CVPA 5BT1A 3AS8A 3ZHEB 4HOQA 2VSNA 2NC9A 2YHCA 2FEZA 5FZQA 5G05J 2VGXB 3ASFA 5FZRA 3AS5A 3CK8A 2XGMA 3MV2B 4AY6A 4UI9J 4APOA 4J8DA 4Y6WA 2DBAA 5LCWC 2PQNA 3RO3A 1NA0A 2C0MA 2PZIA 3LY7A 5KJLA 4JA7A 1XNFA 3RO2A 2IFUA 3FWVA 3U4TA 1W3BA 4IN3B 5G04J 5CCLA 3QWPA 3FFLA 2QFCA 3TAXA 1WAO1 3MV3B 3PE4A 4J0UA 2BUGA 2KC7A 5BNWA 4BWRA 4G2VA 1IYGA 5KJKA 4G26A 4N5CA 3Q4AB 5BW8C 3MA5A 2XGOA 1PC2A 3MEKA 4HOSA 4HOTA 4YVQC 1ZBPA 1P5QA 3CEQA 2VGYA 3Q5MA 2C2LA 3Q47B 4GA1A 2Q7FA 4LEUA 4ABNA 2OOEA 2XEVA 3EDTB 3S7DA 4YNDA 5FZSA 5FT9A 4WNEA 3U3WA 2PQRA 3SZ7A 4U07A 3E4BA 5M72A 4I2ZA 2MHKA 2KCLA 1HZ4A 2UWJG 4BTBA 1Y8MA 3ULQA 4NQ0A 3O48A 3OXGA 3KAEA 5CHEE 2WQHA 3ASHA 2FO7A 4UQYA 3UPVA 2I6HA 3ZFWA 4AY5A 3GW4A 2AVPA 1KLXA 4KBQA 3CK7A 4UI9K 5G05C 4BT9A 3QOUA 1NZNA 3ESKA 3UUXA 4I1AA 5KJMA 4UI9C 3QWVA 4HORA 2XCBA 4AM9A 1YA0A 3JYSA 4UQZA 2Y4TA 5FTPA 5D0QD 2P58C 5EX3A 3CKBA 4GCOA 1ELRA 2C0LA 3NF1A 3LKUA 5JJTA 4H7YA 5D0OD 1ELWA 4GZ5A 2L6JA 4XI0A 4CGWA 3PE3A 2VQ2A 4GA0A 2WPVA 1KT1A 2FI7A 4GYOA 3ZPJA 3N71A 3CVNA 4CGVA 3KD7A 4RG6A 1WM5A 2IF4A 5HQ8A 2VGXA 1OUVA 2Y4UA 2FBNA 3ASDA 4KXKB 3LY8A 4XIFA 1B89A 3S7BA 4N3BA 4YVOA 2LNIA 3TGOA 2XPIA 4G1TA 4BTAA 2V5FA 4U0ZA 4O6FA 5CCMA 3CVLA 5DIZA 2UY1A 3SF4A 3LPZA 1KT0A 2J9QA 3URZA 4GPKA 3RU0A 4GZ3A 2LSVA 4GA2A 2HYZA 2HR2A 3K9IA
chains in the Genus database with same CATH superfamily
5ENPD 3FTSA 2HO1A 4HI8A 4FULA 4HXIA 1E8XA 2OVFA 4OAVB 3PEVB 3LYAA 5JJ6A 4WWPA 3BG0B 4HOUA 4WNDA 3R9AB 4G11A 5JHBA 4AOFA 3EU9A 2GW1A 3UMVA 3QKYA 2L9BA 5AQBA 4UWHA 1ELKA 4YDOA 3RIBA 3SD5A 2WXKA 4DK5A 3IKOB 3TG5A 3DBSA 2FO1E 3IXEA 1K8KG 5HI7A 3CVQA 1HF8A 4O1OA 1SVXA 2BKKB 3EIJA 2UY1B 3UT8A 4GMLA 4I17A 1HXIA 3LJ3A 3QDNA 2WQ6A 2GGFA 2IEJA 1MX2A 3NQPA 1IQUA 2FULA 1ZU2A 1KPSB 4A55A 4AV7A 4ILHB 2B0OE 1OCRE 5CECB 3R7QA 3SQVA 4N2QA 1DCEA 1TNUA 4FC8A 3KEZA 3PH0C 1FT2A 3CGHA 3ZYKA 3S7JA 3CK9A 1EPUA 2J49A 3UM1A 1IKND 3APCA 3AG3E 3MKRA 2WXRA 4RG9A 2IOSA 1N54A 3PREA 1TN8A 3FTXA 4F1SA 4KVOA 3UM0A 1AP7A 3FUEA 2ILRA 4BSZB 3TWVA 4XZ4A 3VTYA 5DBKA 4FU3A 2Y0BG 3DSVA 4MS6A 2H6GA 2ZGDA 4GPMA 2FF4A 4JW1A 1WG0A 4BX9A 2KZTB 2GRNB 3ZGQA 3ZYLA 1WDYA 1OWOA 3CVUA 2EIME 1IQRA 4RQIA 2QYUA 2F37A 3DWLG 1JPLA 3AAAC 3F6QA 3KS2A 3CHPA 4UWFA 3PVLA 1OWLA 2AXZA 2NC9A 2BTDA 4A1GA 2IO2C 1TNZA 3ZXSA 2WXIA 4CDNA 3PS6A 1SA4A 2VGXB 3ASFA 3SI5A 4LNGA 3PEUB 2WXHA 1N4SA 3CVXA 3T5XA 1FVFA 4AY6A 1N4RA 5LCWC 3D9HA 1JCSA 3C98A 3RO3A 3FH8A 4I1MA 4JEHA 4TXPA 2C0MA 5KJLA 5AAOA 3FUHA 5BPPA 4TXRA 1OWMA 3U4TA 1W3BA 4HRNA 2IJGX 5G04J 1DC2A 5AQ9A 5CCLA 2WXLA 4XX5A 3B13A 2WXGA 1Z6TA 4ACLA 2XS8A 4ATGA 2ETBA 2R59A 3FUMA 2BUGA 3EHRA 4A63B 3JQ0A 4BWRA 4G2VA 2GRRB 3ZRHA 3CHOA 2P9LG 3Q4AB 1UJKA 2NSZA 3G2VA 3KSQA 3ZUVB 1HS6A 4GMJA 4YVQC 2GRQB 5B1BE 3CEQA 3LEWA 3Q5MA 1MX6A 2C2LA 4FHKA 3D9NA 3E37A 4F53A 2LAIA 5FINA 4MBGA 3BUAA 3JXJA 3QJZA 1VDYA 4NACA 1E90A 1K3ZD 3CQGB 2PQRA 2NXPA 4U07A 3NBNB 3QK0A 4I2ZA 2MHKA 5ENRD 1HG5A 5B1AE 3SO8A 1HZ4A 2UWJG 2EIKE 5ANRA 4JVSA 2X6KA 4U63A 3PZ4A 3Q7AA 3OXGA 5CHEE 2WQHA 4EZLA 3DPYA 3ASHA 4OYSA 4Q96A 3HXCA 4AY5A 2DIWA 5CBNA 3DEPA 4I1OB 5LFAA 5AQ7A 2XPYA 4GAAA 4KBQA 2DZOA 5G05C 4BT9A 1NZNA 5EDSA 4C0MA 5KJMA 3E33A 4HORA 2XQ0A 4EBAA 3RK6A 2XCBA 3IHVA 2P58C 3PRZA 3NZSA 3ABKE 5ITZF 1RW2A 2R02A 3UINC 4ATZD 3FU3A 3PUJA 3ENEA 4H7YA 2MYOA 1ELWA 2P9PG 2I1KA 2L6JA 2WMOA 4CGWA 3TL5A 1KZPA 4GA0A 4CDMA 1KT1A 4A3TA 4LNBA 3DSTA 2WVIA 3FY4A 3ZPJA 3N71A 5FWQA 4Q94A 3CVNA 5H7PA 3UIPC 3AU5A 4RG6A 2IF4A 4KXKB 1E8ZA 3LY8A 4YDYA 1B89A 4N3BA 2QYJA 1IXVA 2XPIA 4EHMA 2KBXA 3FH5A 2F8YA 3CVLA 5DIZA 3EIQC 5LOZA 2UY1A 4PH4B 2J9QA 1KT0A 1OWPA 3URZA 3RU0A 1HX8A 4GZ3A 2LSVA 5ENTD 3MZLB 2M63A 2X38A 3C3RA 3MCXA 4F7AA 4FA6A 2HR2A 3UM3A 3BG1B 4N3AA 5AYWD 4HLEA 4HB5A 4Y6CA 2DCPA 4WNFA 4BERA 3TWXA 5FQ8A 3IBEA 3ZN3A 2WM9A 3SGHA 4CEMA 3UKUG 2PNNA 5HRYA 5A6CA 5LCWJ 5KJNA 4DX6D 1BI8B 4E85A 5HS0A 4L23A 2LUHA 2AWIA 4EZJA 5E76A 4DI4A 5T8IA 3QWWA 5B3SE 2XZTG 2LXMA 2XCCA 4KYOB 3FEYA 4GYWA 3FTYA 1SA5A 4AXHA 4W9RA 3SFXA 3VTXA 1TN7A 2P9SG 3C3QA 2CFZA 5G04C 1N0QA 3T5VA 5HKPA 2KATA 4AIFA 2PM7A 3Q9UC 4GB9A 3SBTB 2JLBA 4GMRA 4ANUA 3LDZA 3OAWA 4CT4A 1HFAA 4IRUA 3FEXA 3NZUA 2L0IA 2LSUA 3GZSA 1N0RA 3FTWA 3NAWA 3Q49B 5ENOD 3BU8A 4AP2A 1N95A 1X81A 2ONDA 4GTSA 1TJCA 2EINE 3CHMA 4N2SA 3EUVA 4M7CA 1E96B 4U0UA 3ASGA 1LTXA 1UW4B 1HH8A 3Q7FA 4GZDA 4FLHA 4WWOA 4G23A 2V4LA 5EKQD 2MRIA 1IHBA 3S7FA 3Q15A 3I4GA 3ASNE 1UN8A 5FIOA 2KCKA 4JXTA 1NA3A 2B6CA 1X5BA 3PZ2A 4I9EA 3L82A 1D8DA 2EQXA 4GTQA 3ZHEB 2YHCA 5JHAA 3D9IA 3JUIA 2XRZA 3D9JA 5AENA 2V8SE 2J07A 1UOHA 5G05J 3FU6A 1NI1A 3AS5A 4BETA 2XGMA 2XS1A 2OEWA 5ENQD 4J8DA 4Y6WA 1SZ9A 4EBAG 4LUNU 3SY2A 1H2TC 5J08A 2BKGA 1NA0A 2EILE 3U66A 3DEOA 2EIJE 4F1PA 1LD8A 4JA7A 1L5JA 1XNFA 3JQ1A 3RRNB 4BX8A 5KNHD 3E30A 5AARA 4DI3A 2XRYA 4I43A 3QWPA 5AQAA 3DSSA 1DCQA 1E7UA 3ONLA 2CG2A 3FFLA 2WB2A 2RD0A 4Q69A 1UG3A 3SFYA 4DJAA 3HXEA 3OTNA 3L16A 2BF0X 4DX2A 1FVHA 2H6IA 1U2VG 1N94A 1O1TA 2QY7A 3MJWA 5KJKA 1TNYA 2LAHA 1OCCE 3P1UA 3C72A 2XGOA 1PC2A 3QARA 3LS8A 3MGBA 4LNUD 4C9BB 3MEKA 4G8KA 4RVBA 1ZBPA 3L9TA 3Q47B 3TXNA 4LEUA 1MX4A 4ABNA 3L22A 4U95D 3HVEA 5ENSD 3EDTB 1N4QA 2PM6A 4NURA 4YNDA 5FZSA 2OEVA 5FT9A 5D2MC 3SZ7A 2WQ7A 1OCZE 5JMND 5M72A 2GROB 5EN5D 2XENA 3FUKA 5BUZA 3ABME 1MJ0A 4NQ0A 3ZIMA 1S63A 2FO7A 3HXDA 5KWDA 4OVVA 2I6HA 3CHSA 5CRUA 3GW4A 5EYLA 4CZ2D 3J5QB 2XHEA 4TRQA 1DNPA 4N5QA 3FTZA 2P9UG 4PUCA 3QWVA 4AM9A 1N9AA 4FP7A 1YA0A 3D3MA 4RSYA 2IONA 4UQZA 5T4YA 3EHMA 3CKBA 3EJNA 1ELRA 3O4ZA 5EYPF 4EECA 4WAFA 4AEZC 4B93B 4JZYA 2C0LA 5FQ4A 2XEEA 1S0PA 4GU5A 4L2LA 1E8WA 3TJPA 2E0IA 3FUIA 1S64A 3TXMA 3MYVA 1K1AA 1Z3XA 3KSLA 1H6KA 4JD2G 3VLEA 4U8HA 3CSTA 2KXPC 4ZHBA 4TUUA 3HXBA 3CVWA 4CGVA 3T8MA 5D66A 1NP7A 4B8AA 2ZISA 1LD7A 5CMYA 4YDWA 1N4PA 4O60A 4BFRA 4HNAD 4XIFA 2LNIA 3CSFA 1FPPA 3TGOA 1BI7B 4G1TA 4J7WA 4XE0A 1MQSA 3BQOA 3T8KA 3PZDA 5CCMA 4HS2A 2OCCE 1HU3A 3LPZA 4GPKA 1OWNA 3LVQE 2J4DA 1RZ4A 4K03A 4U7EB 3HDXA 2VJ8A 4BESA 2HYZA 1BD8A 4LG6A 4HI9A 1H19A 4APFA 4KZ0A 3CV0A 2F8XK 3CLJA 3BEEA 5CERB 3ESLA 4GCNA 1BU9A 1YYHA 3CKCA 3UX4A 2HM8A 2L0TB 2NYJA 1UJJA 4UQXA 4PDXA 1QQEA 4U04A 3APDA 4K5BA 2KCVA 4GZ6A 3TG4A 5KNGA 3PDNA 3UQ3A 2P2CP 4MRUA 3HVEB 4ILIA 2YQ8A 2ETAA 4OVUA 4ME2A 4IYPA 3RJVA 3RKVA 2ZXWE 3B95A 3Q9NC 4I6GA 4H7XA 5G2NA 1U3DA 3ZXPA 1E8YA 2DVWA 4QFVA 1OY3D 3TWSA 4R7LA 1JWGA 2E2EA 3ZHEA 3NOGD 1XGWA 3UI2A 3W9GA 3TWTA 3FUDA 2IOLA 4HFGA 3AS4A 1TNBA 3OXFA 4LERA 4XKCA 3UXGA 3ZYQA 5ENNA 1BLXB 3DXKG 3GZ2A 2PL2A 3CVYA 1G3NB 3T9KA 4BSXA 3LY9A 1N52A 4U0SA 1NFIE 3WXXA 5ARGA 4FJZA 2MOWA 2WXQA 4PS8A 4JHJA 3QNKA 3RAUA 3S2AA 1A5EA 4I9CA 3TWQA 4OAUC 4UWKA 5EX0A 3RSEG 3FP3A 2J8SD 3ML9A 4JA9A 5E75A 2JABA 1TN6A 3ONKA 2J09A 2AW6A 3FDHA 3G2SA 5CRVA 1JUQA 1S70B 3LVRE 3MX3A 3UTMA 2OVBA 3CVPA 1WY6A 3AS8A 4G8LA 2WMNA 5FZQA 2XZDG 1MHQA 4TV3A 3B7SA 3JUEA 3MV2B 2X3MA 2R03A 1Z3YA 2VSXE 3PNTB 3DPDA 4LCTA 4PS3A 3LY7A 2AXVA 1OCOE 2WXPA 1DVPA 2P9IG 2IFUA 3FWVA 3PNLB 3LXUX 2H6HA 1Q2ZA 4IN3B 1TNOA 3AG4E 3B7TA 2L6BA 2ETCA 2QFCA 3TAXA 1WAO1 4J0UA 3JXIA 3NB2A 2WXNA 4XEIG 2I1JA 3UT4A 4G26A 3CVVA 4D10C 2IU1A 4FHJA 4DX7D 4A3VA 4HOSA 4HOTA 4K5CA 4HBDA 3ML8A 2JEKA 1QNFA 4J8SA 1TYQG 4DX1A 2VGYA 4GA1A 1EF1C 4DPRA 2OOEA 5A23A 4HRLA 1QBQA 4O1PA 3FHEA 1BPOA 3S7DA 4UWLA 3R9MA 4WNEA 1U3CA 3U3WA 3V2XA 5CBOA 4LRZA 3FUFA 3Q79A 2VTBA 3B7BA 2XPZA 4L7TA 5C2YA 3O48A 1Y6IA 2YNQA 4HLLA 4DX5D 4UQYA 3UPVA 3C5RA 3ZFWA 4ANWA 3EHQA 4FADA 5BV1A 5CMWA 3EHNA 1QYMA 2QC9A 2KM4A 3CK7A 4UI9K 4JC8A 3QOUA 5FQ6A 3ESKA 4I1AA 5BXOA 1EDUA 2R2LA 4UI9C 4EPZA 3FULA 3E34A 5AJDA 3SNXA 2Y1LE 3HIZA 3JYSA 4HQDA 4P29A 5FTPA 5D0QD 3HG0D 5EX3A 1D9SA 2YINA 2HE0A 4TUMA 3I3NA 1LF8A 1HG2A 3LKUA 1V55E 3HXFA 4F6RD 3FU5A 1H6OA 3J5PA 4GZ5A 3PZ3A 3D9OA 4DUIA 1H0AA 2GRPB 5CEAA 4B0ZA 3ULYA 3PE3A 2VQ2A 2WPVA 4CT0A 3CQCB 1YCSB 3KD7A 4JB8P 5G55A 3RRUA 4AJWA 2GRLA 1WM5A 3CR3A 2WXJA 1TJFA 5HQ8A 4C48B 4JHKA 2DYRE 2Y4UA 2AJAA 3ASDA 3B7UX 3FTVA 4YDEA 3S7BA 3JCKC 4YVOA 4MLPA 4ILGA 3CHRA 2LO6A 1OT8A 1YMPA 2X6FA 2IQCA 3FU0A 1TEZA 3I5PA 4HRMB 5JA4D 3PZ1A 2CG3A 5AJLA 2J4BA 3L08A 4GA2A 3K9IA 3SBSA 3CIAA 4ANVA 2ZGGA 3FUNA 1HE8A 4BT8A 1INZA 2Y3AA 2WXOA 4G24A 2VYIA 3TWRA 5JJ7A 5J90A 1PAQA 5LP0A 3EU5A 4URKA 1MZCA 3Q73A 3V30A 2RKKA 4JHRA 4GTMA 5AIJA 2IY0C 3D9MA 4FJYA 2I9CA 3G2WA 2CFUA 2XGSA 3DSWA 2LXLA 4N3CA 4N39A 4ACKA 4GYYA 1IHGA 5FJYA 3IEGA 3VLFA 4I2WA 4XI9A 3GYZA 4FLBA 2ZU6B 4GTVA 4DLQA 3GZ1A 4A1SA 3UT7A 3ULEG 3OXLA 3QAQA 1FCHA 4WUYA 5C1DA 2VTBB 3MKQA 2CHZA 1A17A 1SW6A 2DWZA 2R5SA 4WNGA 4Z68A 3FUJA 3B7RL 4U96D 4PS7A 4KT6B 4L2YA 4NRHB 2A4ZA 3ZNGA 3ASOE 2V5QC 3AU4A 2CHXA 3LCAA 2X6IA 3HRAA 3C3OA 5IY5E 4TXQA 1GW6A 4F3VA 2QZAA 3ZVVA 4JL0A 2BEDA 3UIOC 3DXMG 2I2OA 4IULA 3Q75A 3HYMB 4G25A 2P9KG 5A7DB 4ZFHA 4CRWA 4GZCA 5EIBE 3P2BA 5KCMA 4J8EA 4J8FA 3AG1E 4CYMD 4AVXA 4EQFA 4X8QA 1JCRA 2VSYA 5T3RA 4B94A 5ARFA 3SFZA 2X6JA 3ABLE 3D9KA 4HVBA 3IV0A 4JPSA 3ZU7B 3QC1A 4XKBA 1O1SA 4CDRA 1TR4A 2VSOE 3L13A 4U8VD 3V2OA 3Q78A 3QB2A 2P9NG 1QZ2A 5BT1A 4HOQA 2VSNA 4I6JA 3ZEFA 2FEZA 3AJIA 3UM2A 2OV8A 5FZRA 3NOCD 2F0YA 3CK8A 3RRMB 1AWCB 4UI9J 4APOA 2DBAA 1K1BA 2PQNA 2IO3C 4GTTA 4GTOA 1ZB1A 3W9FA 4QQIA 2PZIA 1E7VA 4L9PA 3RO2A 2H6FA 3V31A 4L1BA 4RLYA 2DYSE 3R7RA 2XEHA 1KZOA 5EILA 1FT1A 2RFMA 3FH7A 3MV3B 4BY6A 3PE4A 3ZW3A 2KC7A 4JEUA 5BNWA 1EYHA 3E32A 3HHMA 3LJNA 3D9PA 5CEDB 3APFA 3CHQA 3KEAA 3G2TA 1SQMA 1IYGA 2WXMA 2AXUA 1MYOA 4N5CA 5BW8C 1O5MA 4J8YA 3MA5A 2DZNA 2YHEA 4NIKA 4I6EA 1P5QA 4KZCA 3TWWA 3AG2E 2Q7FA 5KBAA 2XEVA 3V79K 5LX8A 4K0RA 4KMOA 3I4RB 5BXUA 1JWFA 3E4BA 3MKQB 1Z5SC 3VLDA 2KCLA 2A5UA 2V4HC 5EIDA 2ZIRA 3WG7E 4BTBA 1V54E 1Y8MA 3ULQA 3KAEA 4V3IA 3DSUA 4LSZE 4B8CB 3FTUA 3TWUA 2AVPA 1KLXA 1N11A 4MKTA 3UUXA 2V0PA 3ZKJA 4U8YD 1SZAA 4GTPA 1HO8A 2WXFA 2Y4TA 1O1RA 4GCOA 3L6AA 4CCAA 2J08A 1UN9A 4GTRA 3NF1A 4KVMA 4B89A 5JJTA 5D0OD 4DRXE 3ISMC 2A5EA 4XI0A 1H6PA 4ANXA 2KZTA 4K5AB 1PY1A 1H2UA 3G2UA 2FI7A 4GYOA 4M3OA 4DLOA 4UWGA 2VGEA 2GRMA 3UKRG 3D9LA 2R17C 1H2VC 4UUCA 4C0EA 3X2QE 2VGXA 3IHYA 1OUVA 2FBNA 4E6HA 1OXJA 2CHWA 3L17A 5ANLA 4BTAA 2V5FA 4U0ZA 1JCQA 4WWNA 4O6FA 5AN8A 2RG8A 4BEPA 3U9WA 2R05A 4EZKA 1D8EA 5BV0A 3ZYMA 3U64A 3SF4A 3L54A 2RFAA 2X6HA 2Y69E 3PUKA 3DSXA 1NL4A 3DRAA 5FQ7A 3SHFA 4J6IA
chains in the Genus database with same CATH topology
1H19A 4APFA 3BG1B 4KZ0A 3CIAA 3CV0A 3CLJA 4ANVA 3FTSA 3FUNA 2HO1A 3BEEA 4N3AA 5AYWD 4HLEA 3ESLA 4FULA 1HE8A 4BT8A 4HXIA 4Y6CA 1INZA 2DCPA 2Y3AA 4GCNA 4WNFA 2WXOA 1E8XA 2OVFA 3CKCA 4G24A 3UX4A 5FQ8A 3PEVB 3LYAA 5JJ6A 2VYIA 3IBEA 3ZN3A 2WM9A 3SGHA 2HM8A 2L0TB 1UJJA 4UQXA 4PDXA 4WWPA 1QQEA 3BG0B 4HOUA 5JJ7A 5J90A 4WNDA 4CEMA 4U04A 1PAQA 5LP0A 3R9AB 4G11A 5JHBA 3APDA 4AOFA 5A6CA 5LCWJ 2GW1A 3UMVA 5KJNA 4E85A 4URKA 4L23A 2KCVA 4GZ6A 3QKYA 3TG4A 4JHRA 3PDNA 5AIJA 3D9MA 2L9BA 2AWIA 4EZJA 4FJYA 2I9CA 4UWHA 5E76A 4DI4A 5T8IA 3G2WA 3UQ3A 3QWWA 1ELKA 2CFUA 3SD5A 3RIBA 2XGSA 2WXKA 4MRUA 4N3CA 4DK5A 2XCCA 4KYOB 3FEYA 4GYWA 3FTYA 3IKOB 3HVEB 4ILIA 4AXHA 4W9RA 3TG5A 3VTXA 3DBSA 2YQ8A 4N39A 5HI7A 4ACKA 4GYYA 1IHGA 5FJYA 4OVUA 3CVQA 1HF8A 3IEGA 4IYPA 2CFZA 4ME2A 5G04C 3RJVA 3VLFA 4I2WA 4XI9A 3GYZA 3RKVA 3EIJA 4FLBA 2UY1B 2ZU6B 4DLQA 3GZ1A 3UT8A 4GMLA 4I17A 4A1SA 1HXIA 3UT7A 3T5VA 3LJ3A 3QDNA 2WQ6A 3OXLA 2GGFA 3QAQA 1FCHA 4WUYA 2KATA 4I6GA 4H7XA 5G2NA 1U3DA 4AIFA 5C1DA 2VTBB 3NQPA 1IQUA 2FULA 2PM7A 3MKQA 1ZU2A 1E8YA 4GB9A 3SBTB 4QFVA 2CHZA 4A55A 1A17A 2JLBA 2R5SA 4AV7A 4WNGA 4ILHB 4ANUA 3FUJA 3LDZA 3OAWA 4R7LA 1HFAA 1JWGA 3B7RL 3R7QA 4CT4A 4PS7A 4KT6B 4L2YA 4NRHB 4N2QA 2A4ZA 4IRUA 2E2EA 3FEXA 3ZHEA 3NZUA 4FC8A 3KEZA 2L0IA 2LSUA 1XGWA 3GZSA 3FUDA 3PH0C 3AU4A 2CHXA 3LCAA 2X6IA 3FTWA 3Q49B 2IOLA 4HFGA 3AS4A 3CGHA 3OXFA 4AP2A 3ZYKA 3S7JA 3CK9A 1EPUA 4LERA 2J49A 1GW6A 4XKCA 2ONDA 3ZYQA 1TJCA 4F3VA 5ENNA 3CHMA 3APCA 4N2SA 3MKRA 3ZVVA 1E96B 4U0UA 4JL0A 3GZ2A 2PL2A 2WXRA 3ASGA 4RG9A 2IOSA 3CVYA 1N54A 3PREA 1UW4B 2I2OA 4IULA 4BSXA 1HH8A 3FTXA 3LY9A 4F1SA 1N52A 4U0SA 4KVOA 3HYMB 4G25A 4GZDA 5A7DB 3FUEA 2ILRA 4FJZA 2MOWA 5ARGA 3WXXA 2WXQA 4FLHA 4WWOA 4XZ4A 3VTYA 4G23A 2V4LA 4GZCA 4CRWA 5EKQD 4PS8A 3P2BA 2MRIA 4JHJA 3QNKA 5KCMA 5DBKA 4FU3A 3S2AA 4J8EA 4J8FA 4I9CA 3S7FA 3Q15A 4MS6A 4UWKA 5EX0A 4AVXA 3I4GA 3FP3A 4EQFA 3ML9A 2FF4A 1UN8A 4JA9A 2VSYA 4JW1A 5E75A 5T3RA 4B94A 4BX9A 2KZTB 2KCKA 5ARFA 3ZGQA 3ZYLA 4JXTA 3SFZA 3ZHEB 2X6JA 3D9KA 4HVBA 1NA3A 1OWOA 3ONKA 3IV0A 4JPSA 2J09A 2AW6A 3FDHA 3CVUA 3QC1A 4XKBA 1X5BA 1IQRA 3G2SA 4CDRA 2VSOE 3L13A 4I9EA 1JUQA 1JPLA 3QB2A 2EQXA 3LVRE 3MX3A 3KS2A 1QZ2A 2OVBA 3CVPA 3CHPA 1WY6A 3AS8A 3PVLA 1OWLA 2AXZA 2VSNA 4HOQA 2NC9A 2BTDA 2YHCA 4I6JA 3D9IA 3ZEFA 4A1GA 5JHAA 3JUIA 2XRZA 3D9JA 3ZXSA 5AENA 2WMNA 2WXIA 2V8SE 4CDNA 2J07A 2FEZA 3PS6A 5FZQA 5G05J 2VGXB 3ASFA 3SI5A 2OV8A 3FU6A 1MHQA 5FZRA 3AS5A 3PEUB 2WXHA 4TV3A 3CK8A 3B7SA 2XGMA 3MV2B 2X3MA 3RRMB 3T5XA 3CVXA 1FVFA 1Z3YA 4AY6A 4UI9J 4J8DA 4Y6WA 4APOA 1SZ9A 2DBAA 2VSXE 4EBAG 3PNTB 5LCWC 4LUNU 3DPDA 2PQNA 3C98A 1H2TC 3RO3A 4LCTA 5J08A 3FH8A 1NA0A 4I1MA 4JEHA 3U66A 2C0MA 2PZIA 4PS3A 3LY7A 5KJLA 2AXVA 4JA7A 3FUHA 1L5JA 2WXPA 1E7VA 5BPPA 1XNFA 1DVPA 3JQ1A 3RO2A 3RRNB 2IFUA 4BX8A 1OWMA 3FWVA 3PNLB 3LXUX 3U4TA 4L1BA 1W3BA 4IN3B 2IJGX 5G04J 4DI3A 2XRYA 4I43A 5CCLA 2WXLA 3QWPA 4XX5A 3R7RA 3B7TA 1E7UA 3ONLA 3B13A 2CG2A 2WXGA 3FFLA 2WB2A 2RD0A 4Q69A 2QFCA 3TAXA 1Z6TA 1UG3A 1WAO1 4ACLA 3FH7A 3MV3B 4DJAA 4BY6A 4ATGA 3PE4A 2R59A 3OTNA 3FUMA 3L16A 3ZW3A 4J0UA 2BF0X 2BUGA 1FVHA 2KC7A 4JEUA 5BNWA 3JQ0A 1EYHA 3HHMA 4G2VA 4BWRA 3D9PA 3APFA 3CHQA 2WXNA 2QY7A 3G2TA 1SQMA 3CHOA 3ZRHA 1IYGA 3MJWA 2I1JA 2WXMA 2AXUA 3UT4A 5KJKA 4G26A 4N5CA 4UWFA 3Q4AB 1UJKA 2LAHA 3CVVA 3P1UA 4D10C 5BW8C 2IU1A 2NSZA 4FHJA 3G2VA 3MA5A 2XGOA 1PC2A 3QARA 3LS8A 3MGBA 4C9BB 3MEKA 4A3VA 2YHEA 4HOSA 4HOTA 1HS6A 4GMJA 4YVQC 3ML8A 4RVBA 4I6EA 1QNFA 2JEKA 1ZBPA 1P5QA 3CEQA 4J8SA 3LEWA 4KZCA 2VGYA 3Q5MA 2C2LA 3Q47B 3TXNA 4FHKA 4GA1A 3D9NA 2Q7FA 4LEUA 1EF1C 4ABNA 4F53A 2LAIA 4DPRA 2OOEA 5A23A 3L22A 2XEVA 3HVEA 3EDTB 3FHEA 2PM6A 3QJZA 4NURA 1VDYA 4NACA 1BPOA 1E90A 3S7DA 4YNDA 4K0RA 4KMOA 5LX8A 4UWLA 5FZSA 5FT9A 3I4RB 4WNEA 1U3CA 3CQGB 3U3WA 2PQRA 3SZ7A 2NXPA 2WQ7A 4LRZA 4U07A 1JWFA 3E4BA 3MKQB 5M72A 3QK0A 4I2ZA 2MHKA 3VLDA 3FUKA 1HG5A 3FUFA 2KCLA 1HZ4A 2UWJG 2A5UA 5ANRA 5BUZA 4BTBA 2VTBA 2XPZA 2X6KA 4JVSA 4L7TA 5C2YA 4U63A 1Y8MA 3ULQA 4NQ0A 3ZIMA 3O48A 1Y6IA 2YNQA 3OXGA 3KAEA 4V3IA 5CHEE 2WQHA 4EZLA 3ASHA 2FO7A 4OYSA 4UQYA 4B8CB 4Q96A 3UPVA 4OVVA 2I6HA 3FTUA 3ZFWA 4ANWA 2DIWA 3CHSA 4AY5A 4FADA 4I1OB 5LFAA 3GW4A 5BV1A 5CMWA 2XPYA 2AVPA 3EHNA 4GAAA 2XHEA 1KLXA 4KBQA 2KM4A 4TRQA 3CK7A 4UI9K 5G05C 1DNPA 4JC8A 4BT9A 4MKTA 3QOUA 5FQ6A 1NZNA 3ESKA 5EDSA 3FTZA 3UUXA 4I1AA 4C0MA 2V0PA 1EDUA 4PUCA 5KJMA 1SZAA 4UI9C 3QWVA 2XQ0A 4EBAA 4EPZA 4HORA 3FULA 3RK6A 2XCBA 4AM9A 4FP7A 1YA0A 5AJDA 3SNXA 3HIZA 3D3MA 3JYSA 4RSYA 2IONA 4UQZA 3IHVA 4P29A 1HO8A 2WXFA 2Y4TA 5FTPA 5D0QD 5T4YA 2P58C 3PRZA 5EX3A 3EHMA 3CKBA 4GCOA 3EJNA 3L6AA 1ELRA 3O4ZA 3NZSA 4EECA 2YINA 4WAFA 4AEZC 4CCAA 2J08A 1UN9A 4JZYA 2C0LA 3I3NA 1LF8A 1HG2A 3LKUA 3NF1A 3FU3A 3PUJA 4KVMA 4B89A 5FQ4A 1S0PA 3ENEA 4GU5A 4H7YA 4L2LA 5D0OD 3FU5A 5JJTA 1ELWA 1E8WA 4GZ5A 3TJPA 2E0IA 2I1KA 3FUIA 3D9OA 2L6JA 4XI0A 2WMOA 4ANXA 1H0AA 3TXMA 2KZTA 4B0ZA 3MYVA 4CGWA 3PE3A 3TL5A 2VQ2A 1Z3XA 4GA0A 2WPVA 4CDMA 1H6KA 1KT1A 1PY1A 4A3TA 4CT0A 1H2UA 3G2UA 2FI7A 4GYOA 3VLEA 2WVIA 4M3OA 3FY4A 3ZPJA 3N71A 4U8HA 5FWQA 3CSTA 4DLOA 4Q94A 4TUUA 4UWGA 3CVWA 3CVNA 2GRMA 3CQCB 4CGVA 3KD7A 3AU5A 3T8MA 5G55A 1NP7A 3RRUA 4RG6A 4AJWA 2GRLA 1WM5A 4B8AA 3D9LA 2R17C 5BT1A 3CR3A 1H2VC 4C0EA 2WXJA 1TJFA 2IF4A 5HQ8A 5CMYA 4JHKA 2VGXA 3IHYA 1OUVA 2Y4UA 2FBNA 3ASDA 4KXKB 3B7UX 1E8ZA 4E6HA 3LY8A 3FTVA 4BFRA 4XIFA 2CHWA 1B89A 3S7BA 3JCKC 4N3BA 4YVOA 2LNIA 3CSFA 4MLPA 3TGOA 4ILGA 3CHRA 3L17A 2XPIA 4G1TA 5ANLA 4BTAA 2LO6A 2V5FA 4U0ZA 4WWNA 4XE0A 4O6FA 1MQSA 3FH5A 2RG8A 3PZDA 2X6FA 2IQCA 3U9WA 5CCMA 4EZKA 3CVLA 5DIZA 3EIQC 5BV0A 5LOZA 3ZYMA 4HS2A 3U64A 2UY1A 3SF4A 4PH4B 1HU3A 3FU0A 3LPZA 1KT0A 2J9QA 1OWPA 1TEZA 3URZA 4GPKA 1OWNA 3I5PA 3L54A 2X6HA 3PUKA 3RU0A 1HX8A 4GZ3A 2LSVA 2CG3A 3LVQE 2J4DA 5AJLA 2J4BA 3L08A 4K03A 5FQ7A 3MZLB 2M63A 3HDXA 2VJ8A 4GA2A 3SHFA 2X38A 3MCXA 4J6IA 4F7AA 2HYZA 2HR2A 3K9IA 4FA6A 3SBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CV0 A;  4N3A A;  2HO1 A;  3BEE A;  5AYW D;  4BT8 A;  4Y6C A;  4GCN A;  4WNF A;  3CKC A;  4G24 A;  3LYA A;  5JJ6 A;  2VYI A;  3ZN3 A;  4UQX A;  1QQE A;  4HOU A;  5JJ7 A;  4WND A;  4U04 A;  3R9A B;  5A6C A;  5LCW J;  2GW1 A;  5KJN A;  2KCV A;  4GZ6 A;  3QKY A;  3TG4 A;  4JHR A;  3PDN A;  3UQ3 A;  3QWW A;  3RIB A;  2XGS A;  4N3C A;  2XCC A;  4KYO B;  4GYW A;  4W9R A;  3TG5 A;  3VTX A;  2YQ8 A;  4N39 A;  5HI7 A;  4GYY A;  1IHG A;  5FJY A;  3CVQ A;  3IEG A;  4ME2 A;  5G04 C;  3RJV A;  4I2W A;  4XI9 A;  3GYZ A;  3RKV A;  2UY1 B;  3GZ1 A;  4I17 A;  4A1S A;  1HXI A;  3QDN A;  3OXL A;  1FCH A;  4WUY A;  2KAT A;  4H7X A;  4AIF A;  5C1D A;  1ZU2 A;  1A17 A;  2JLB A;  2R5S A;  4WNG A;  4NRH B;  4N2Q A;  2E2E A;  3ZHE A;  2LSU A;  3LCA A;  3Q49 B;  3AS4 A;  3OXF A;  3S7J A;  3CK9 A;  2OND A;  1TJC A;  4F3V A;  4N2S A;  3MKR A;  1E96 B;  4U0U A;  4JL0 A;  3GZ2 A;  2PL2 A;  3ASG A;  4RG9 A;  1HH8 A;  3LY9 A;  4U0S A;  3HYM B;  4G25 A;  5A7D B;  5ARG A;  3WXX A;  3VTY A;  4G23 A;  5EKQ D;  5DBK A;  4J8E A;  4J8F A;  4I9C A;  3S7F A;  3Q15 A;  5EX0 A;  3FP3 A;  4EQF A;  2FF4 A;  4JA9 A;  2VSY A;  4B94 A;  2KCK A;  5ARF A;  3ZGQ A;  1NA3 A;  4CDR A;  4I9E A;  3KS2 A;  1QZ2 A;  3CVP A;  5BT1 A;  3AS8 A;  3ZHE B;  4HOQ A;  2VSN A;  2NC9 A;  2YHC A;  2FEZ A;  5FZQ A;  5G05 J;  2VGX B;  3ASF A;  5FZR A;  3AS5 A;  3CK8 A;  2XGM A;  3MV2 B;  4AY6 A;  4UI9 J;  4APO A;  4J8D A;  4Y6W A;  2DBA A;  5LCW C;  2PQN A;  3RO3 A;  1NA0 A;  2C0M A;  2PZI A;  3LY7 A;  5KJL A;  4JA7 A;  1XNF A;  3RO2 A;  2IFU A;  3FWV A;  3U4T A;  1W3B A;  4IN3 B;  5G04 J;  5CCL A;  3QWP A;  3FFL A;  2QFC A;  3TAX A;  1WAO 1;  3MV3 B;  3PE4 A;  4J0U A;  2BUG A;  2KC7 A;  5BNW A;  4BWR A;  4G2V A;  1IYG A;  5KJK A;  4G26 A;  4N5C A;  3Q4A B;  5BW8 C;  3MA5 A;  2XGO A;  1PC2 A;  3MEK A;  4HOS A;  4HOT A;  4YVQ C;  1ZBP A;  1P5Q A;  3CEQ A;  2VGY A;  3Q5M A;  2C2L A;  3Q47 B;  4GA1 A;  2Q7F A;  4LEU A;  4ABN A;  2OOE A;  2XEV A;  3EDT B;  3S7D A;  4YND A;  5FZS A;  5FT9 A;  4WNE A;  3U3W A;  2PQR A;  3SZ7 A;  4U07 A;  3E4B A;  5M72 A;  4I2Z A;  2MHK A;  2KCL A;  1HZ4 A;  2UWJ G;  4BTB A;  1Y8M A;  3ULQ A;  4NQ0 A;  3O48 A;  3OXG A;  3KAE A;  5CHE E;  2WQH A;  3ASH A;  2FO7 A;  4UQY A;  3UPV A;  2I6H A;  3ZFW A;  4AY5 A;  3GW4 A;  2AVP A;  1KLX A;  4KBQ A;  3CK7 A;  4UI9 K;  5G05 C;  4BT9 A;  3QOU A;  1NZN A;  3ESK A;  3UUX A;  4I1A A;  5KJM A;  4UI9 C;  3QWV A;  4HOR A;  2XCB A;  4AM9 A;  1YA0 A;  3JYS A;  4UQZ A;  2Y4T A;  5FTP A;  5D0Q D;  2P58 C;  5EX3 A;  3CKB A;  4GCO A;  1ELR A;  2C0L A;  3NF1 A;  3LKU A;  5JJT A;  4H7Y A;  5D0O D;  1ELW A;  4GZ5 A;  2L6J A;  4XI0 A;  4CGW A;  3PE3 A;  2VQ2 A;  4GA0 A;  2WPV A;  1KT1 A;  2FI7 A;  4GYO A;  3ZPJ A;  3N71 A;  3CVN A;  4CGV A;  3KD7 A;  4RG6 A;  1WM5 A;  2IF4 A;  5HQ8 A;  2VGX A;  1OUV A;  2Y4U A;  2FBN A;  3ASD A;  4KXK B;  3LY8 A;  4XIF A;  1B89 A;  3S7B A;  4N3B A;  4YVO A;  2LNI A;  3TGO A;  2XPI A;  4G1T A;  4BTA A;  2V5F A;  4U0Z A;  4O6F A;  5CCM A;  3CVL A;  5DIZ A;  2UY1 A;  3SF4 A;  3LPZ A;  1KT0 A;  2J9Q A;  3URZ A;  4GPK A;  3RU0 A;  4GZ3 A;  2LSV A;  4GA2 A;  2HYZ A;  2HR2 A;  3K9I A; 
#chains in the Genus database with same CATH topology
 5ENP D;  3FTS A;  2HO1 A;  4HI8 A;  4FUL A;  4HXI A;  1E8X A;  2OVF A;  4OAV B;  3PEV B;  3LYA A;  5JJ6 A;  4WWP A;  3BG0 B;  4HOU A;  4WND A;  3R9A B;  4G11 A;  5JHB A;  4AOF A;  3EU9 A;  2GW1 A;  3UMV A;  3QKY A;  2L9B A;  5AQB A;  4UWH A;  1ELK A;  4YDO A;  3RIB A;  3SD5 A;  2WXK A;  4DK5 A;  3IKO B;  3TG5 A;  3DBS A;  2FO1 E;  3IXE A;  1K8K G;  5HI7 A;  3CVQ A;  1HF8 A;  4O1O A;  1SVX A;  2BKK B;  3EIJ A;  2UY1 B;  3UT8 A;  4GML A;  4I17 A;  1HXI A;  3LJ3 A;  3QDN A;  2WQ6 A;  2GGF A;  2IEJ A;  1MX2 A;  3NQP A;  1IQU A;  2FUL A;  1ZU2 A;  1KPS B;  4A55 A;  4AV7 A;  4ILH B;  2B0O E;  1OCR E;  5CEC B;  3R7Q A;  3SQV A;  4N2Q A;  1DCE A;  1TNU A;  4FC8 A;  3KEZ A;  3PH0 C;  1FT2 A;  3CGH A;  3ZYK A;  3S7J A;  3CK9 A;  1EPU A;  2J49 A;  3UM1 A;  1IKN D;  3APC A;  3AG3 E;  3MKR A;  2WXR A;  4RG9 A;  2IOS A;  1N54 A;  3PRE A;  1TN8 A;  3FTX A;  4F1S A;  4KVO A;  3UM0 A;  1AP7 A;  3FUE A;  2ILR A;  4BSZ B;  3TWV A;  4XZ4 A;  3VTY A;  5DBK A;  4FU3 A;  2Y0B G;  3DSV A;  4MS6 A;  2H6G A;  2ZGD A;  4GPM A;  2FF4 A;  4JW1 A;  1WG0 A;  4BX9 A;  2KZT B;  2GRN B;  3ZGQ A;  3ZYL A;  1WDY A;  1OWO A;  3CVU A;  2EIM E;  1IQR A;  4RQI A;  2QYU A;  2F37 A;  3DWL G;  1JPL A;  3AAA C;  3F6Q A;  3KS2 A;  3CHP A;  4UWF A;  3PVL A;  1OWL A;  2AXZ A;  2NC9 A;  2BTD A;  4A1G A;  2IO2 C;  1TNZ A;  3ZXS A;  2WXI A;  4CDN A;  3PS6 A;  1SA4 A;  2VGX B;  3ASF A;  3SI5 A;  4LNG A;  3PEU B;  2WXH A;  1N4S A;  3CVX A;  3T5X A;  1FVF A;  4AY6 A;  1N4R A;  5LCW C;  3D9H A;  1JCS A;  3C98 A;  3RO3 A;  3FH8 A;  4I1M A;  4JEH A;  4TXP A;  2C0M A;  5KJL A;  5AAO A;  3FUH A;  5BPP A;  4TXR A;  1OWM A;  3U4T A;  1W3B A;  4HRN A;  2IJG X;  5G04 J;  1DC2 A;  5AQ9 A;  5CCL A;  2WXL A;  4XX5 A;  3B13 A;  2WXG A;  1Z6T A;  4ACL A;  2XS8 A;  4ATG A;  2ETB A;  2R59 A;  3FUM A;  2BUG A;  3EHR A;  4A63 B;  3JQ0 A;  4BWR A;  4G2V A;  2GRR B;  3ZRH A;  3CHO A;  2P9L G;  3Q4A B;  1UJK A;  2NSZ A;  3G2V A;  3KSQ A;  3ZUV B;  1HS6 A;  4GMJ A;  4YVQ C;  2GRQ B;  5B1B E;  3CEQ A;  3LEW A;  3Q5M A;  1MX6 A;  2C2L A;  4FHK A;  3D9N A;  3E37 A;  4F53 A;  2LAI A;  5FIN A;  4MBG A;  3BUA A;  3JXJ A;  3QJZ A;  1VDY A;  4NAC A;  1E90 A;  1K3Z D;  3CQG B;  2PQR A;  2NXP A;  4U07 A;  3NBN B;  3QK0 A;  4I2Z A;  2MHK A;  5ENR D;  1HG5 A;  5B1A E;  3SO8 A;  1HZ4 A;  2UWJ G;  2EIK E;  5ANR A;  4JVS A;  2X6K A;  4U63 A;  3PZ4 A;  3Q7A A;  3OXG A;  5CHE E;  2WQH A;  4EZL A;  3DPY A;  3ASH A;  4OYS A;  4Q96 A;  3HXC A;  4AY5 A;  2DIW A;  5CBN A;  3DEP A;  4I1O B;  5LFA A;  5AQ7 A;  2XPY A;  4GAA A;  4KBQ A;  2DZO A;  5G05 C;  4BT9 A;  1NZN A;  5EDS A;  4C0M A;  5KJM A;  3E33 A;  4HOR A;  2XQ0 A;  4EBA A;  3RK6 A;  2XCB A;  3IHV A;  2P58 C;  3PRZ A;  3NZS A;  3ABK E;  5ITZ F;  1RW2 A;  2R02 A;  3UIN C;  4ATZ D;  3FU3 A;  3PUJ A;  3ENE A;  4H7Y A;  2MYO A;  1ELW A;  2P9P G;  2I1K A;  2L6J A;  2WMO A;  4CGW A;  3TL5 A;  1KZP A;  4GA0 A;  4CDM A;  1KT1 A;  4A3T A;  4LNB A;  3DST A;  2WVI A;  3FY4 A;  3ZPJ A;  3N71 A;  5FWQ A;  4Q94 A;  3CVN A;  5H7P A;  3UIP C;  3AU5 A;  4RG6 A;  2IF4 A;  4KXK B;  1E8Z A;  3LY8 A;  4YDY A;  1B89 A;  4N3B A;  2QYJ A;  1IXV A;  2XPI A;  4EHM A;  2KBX A;  3FH5 A;  2F8Y A;  3CVL A;  5DIZ A;  3EIQ C;  5LOZ A;  2UY1 A;  4PH4 B;  2J9Q A;  1KT0 A;  1OWP A;  3URZ A;  3RU0 A;  1HX8 A;  4GZ3 A;  2LSV A;  5ENT D;  3MZL B;  2M63 A;  2X38 A;  3C3R A;  3MCX A;  4F7A A;  4FA6 A;  2HR2 A;  3UM3 A;  3BG1 B;  4N3A A;  5AYW D;  4HLE A;  4HB5 A;  4Y6C A;  2DCP A;  4WNF A;  4BER A;  3TWX A;  5FQ8 A;  3IBE A;  3ZN3 A;  2WM9 A;  3SGH A;  4CEM A;  3UKU G;  2PNN A;  5HRY A;  5A6C A;  5LCW J;  5KJN A;  4DX6 D;  1BI8 B;  4E85 A;  5HS0 A;  4L23 A;  2LUH A;  2AWI A;  4EZJ A;  5E76 A;  4DI4 A;  5T8I A;  3QWW A;  5B3S E;  2XZT G;  2LXM A;  2XCC A;  4KYO B;  3FEY A;  4GYW A;  3FTY A;  1SA5 A;  4AXH A;  4W9R A;  3SFX A;  3VTX A;  1TN7 A;  2P9S G;  3C3Q A;  2CFZ A;  5G04 C;  1N0Q A;  3T5V A;  5HKP A;  2KAT A;  4AIF A;  2PM7 A;  3Q9U C;  4GB9 A;  3SBT B;  2JLB A;  4GMR A;  4ANU A;  3LDZ A;  3OAW A;  4CT4 A;  1HFA A;  4IRU A;  3FEX A;  3NZU A;  2L0I A;  2LSU A;  3GZS A;  1N0R A;  3FTW A;  3NAW A;  3Q49 B;  5ENO D;  3BU8 A;  4AP2 A;  1N95 A;  1X81 A;  2OND A;  4GTS A;  1TJC A;  2EIN E;  3CHM A;  4N2S A;  3EUV A;  4M7C A;  1E96 B;  4U0U A;  3ASG A;  1LTX A;  1UW4 B;  1HH8 A;  3Q7F A;  4GZD A;  4FLH A;  4WWO A;  4G23 A;  2V4L A;  5EKQ D;  2MRI A;  1IHB A;  3S7F A;  3Q15 A;  3I4G A;  3ASN E;  1UN8 A;  5FIO A;  2KCK A;  4JXT A;  1NA3 A;  2B6C A;  1X5B A;  3PZ2 A;  4I9E A;  3L82 A;  1D8D A;  2EQX A;  4GTQ A;  3ZHE B;  2YHC A;  5JHA A;  3D9I A;  3JUI A;  2XRZ A;  3D9J A;  5AEN A;  2V8S E;  2J07 A;  1UOH A;  5G05 J;  3FU6 A;  1NI1 A;  3AS5 A;  4BET A;  2XGM A;  2XS1 A;  2OEW A;  5ENQ D;  4J8D A;  4Y6W A;  1SZ9 A;  4EBA G;  4LUN U;  3SY2 A;  1H2T C;  5J08 A;  2BKG A;  1NA0 A;  2EIL E;  3U66 A;  3DEO A;  2EIJ E;  4F1P A;  1LD8 A;  4JA7 A;  1L5J A;  1XNF A;  3JQ1 A;  3RRN B;  4BX8 A;  5KNH D;  3E30 A;  5AAR A;  4DI3 A;  2XRY A;  4I43 A;  3QWP A;  5AQA A;  3DSS A;  1DCQ A;  1E7U A;  3ONL A;  2CG2 A;  3FFL A;  2WB2 A;  2RD0 A;  4Q69 A;  1UG3 A;  3SFY A;  4DJA A;  3HXE A;  3OTN A;  3L16 A;  2BF0 X;  4DX2 A;  1FVH A;  2H6I A;  1U2V G;  1N94 A;  1O1T A;  2QY7 A;  3MJW A;  5KJK A;  1TNY A;  2LAH A;  1OCC E;  3P1U A;  3C72 A;  2XGO A;  1PC2 A;  3QAR A;  3LS8 A;  3MGB A;  4LNU D;  4C9B B;  3MEK A;  4G8K A;  4RVB A;  1ZBP A;  3L9T A;  3Q47 B;  3TXN A;  4LEU A;  1MX4 A;  4ABN A;  3L22 A;  4U95 D;  3HVE A;  5ENS D;  3EDT B;  1N4Q A;  2PM6 A;  4NUR A;  4YND A;  5FZS A;  2OEV A;  5FT9 A;  5D2M C;  3SZ7 A;  2WQ7 A;  1OCZ E;  5JMN D;  5M72 A;  2GRO B;  5EN5 D;  2XEN A;  3FUK A;  5BUZ A;  3ABM E;  1MJ0 A;  4NQ0 A;  3ZIM A;  1S63 A;  2FO7 A;  3HXD A;  5KWD A;  4OVV A;  2I6H A;  3CHS A;  5CRU A;  3GW4 A;  5EYL A;  4CZ2 D;  3J5Q B;  2XHE A;  4TRQ A;  1DNP A;  4N5Q A;  3FTZ A;  2P9U G;  4PUC A;  3QWV A;  4AM9 A;  1N9A A;  4FP7 A;  1YA0 A;  3D3M A;  4RSY A;  2ION A;  4UQZ A;  5T4Y A;  3EHM A;  3CKB A;  3EJN A;  1ELR A;  3O4Z A;  5EYP F;  4EEC A;  4WAF A;  4AEZ C;  4B93 B;  4JZY A;  2C0L A;  5FQ4 A;  2XEE A;  1S0P A;  4GU5 A;  4L2L A;  1E8W A;  3TJP A;  2E0I A;  3FUI A;  1S64 A;  3TXM A;  3MYV A;  1K1A A;  1Z3X A;  3KSL A;  1H6K A;  4JD2 G;  3VLE A;  4U8H A;  3CST A;  2KXP C;  4ZHB A;  4TUU A;  3HXB A;  3CVW A;  4CGV A;  3T8M A;  5D66 A;  1NP7 A;  4B8A A;  2ZIS A;  1LD7 A;  5CMY A;  4YDW A;  1N4P A;  4O60 A;  4BFR A;  4HNA D;  4XIF A;  2LNI A;  3CSF A;  1FPP A;  3TGO A;  1BI7 B;  4G1T A;  4J7W A;  4XE0 A;  1MQS A;  3BQO A;  3T8K A;  3PZD A;  5CCM A;  4HS2 A;  2OCC E;  1HU3 A;  3LPZ A;  4GPK A;  1OWN A;  3LVQ E;  2J4D A;  1RZ4 A;  4K03 A;  4U7E B;  3HDX A;  2VJ8 A;  4BES A;  2HYZ A;  1BD8 A;  4LG6 A;  4HI9 A;  1H19 A;  4APF A;  4KZ0 A;  3CV0 A;  2F8X K;  3CLJ A;  3BEE A;  5CER B;  3ESL A;  4GCN A;  1BU9 A;  1YYH A;  3CKC A;  3UX4 A;  2HM8 A;  2L0T B;  2NYJ A;  1UJJ A;  4UQX A;  4PDX A;  1QQE A;  4U04 A;  3APD A;  4K5B A;  2KCV A;  4GZ6 A;  3TG4 A;  5KNG A;  3PDN A;  3UQ3 A;  2P2C P;  4MRU A;  3HVE B;  4ILI A;  2YQ8 A;  2ETA A;  4OVU A;  4ME2 A;  4IYP A;  3RJV A;  3RKV A;  2ZXW E;  3B95 A;  3Q9N C;  4I6G A;  4H7X A;  5G2N A;  1U3D A;  3ZXP A;  1E8Y A;  2DVW A;  4QFV A;  1OY3 D;  3TWS A;  4R7L A;  1JWG A;  2E2E A;  3ZHE A;  3NOG D;  1XGW A;  3UI2 A;  3W9G A;  3TWT A;  3FUD A;  2IOL A;  4HFG A;  3AS4 A;  1TNB A;  3OXF A;  4LER A;  4XKC A;  3UXG A;  3ZYQ A;  5ENN A;  1BLX B;  3DXK G;  3GZ2 A;  2PL2 A;  3CVY A;  1G3N B;  3T9K A;  4BSX A;  3LY9 A;  1N52 A;  4U0S A;  1NFI E;  3WXX A;  5ARG A;  4FJZ A;  2MOW A;  2WXQ A;  4PS8 A;  4JHJ A;  3QNK A;  3RAU A;  3S2A A;  1A5E A;  4I9C A;  3TWQ A;  4OAU C;  4UWK A;  5EX0 A;  3RSE G;  3FP3 A;  2J8S D;  3ML9 A;  4JA9 A;  5E75 A;  2JAB A;  1TN6 A;  3ONK A;  2J09 A;  2AW6 A;  3FDH A;  3G2S A;  5CRV A;  1JUQ A;  1S70 B;  3LVR E;  3MX3 A;  3UTM A;  2OVB A;  3CVP A;  1WY6 A;  3AS8 A;  4G8L A;  2WMN A;  5FZQ A;  2XZD G;  1MHQ A;  4TV3 A;  3B7S A;  3JUE A;  3MV2 B;  2X3M A;  2R03 A;  1Z3Y A;  2VSX E;  3PNT B;  3DPD A;  4LCT A;  4PS3 A;  3LY7 A;  2AXV A;  1OCO E;  2WXP A;  1DVP A;  2P9I G;  2IFU A;  3FWV A;  3PNL B;  3LXU X;  2H6H A;  1Q2Z A;  4IN3 B;  1TNO A;  3AG4 E;  3B7T A;  2L6B A;  2ETC A;  2QFC A;  3TAX A;  1WAO 1;  4J0U A;  3JXI A;  3NB2 A;  2WXN A;  4XEI G;  2I1J A;  3UT4 A;  4G26 A;  3CVV A;  4D10 C;  2IU1 A;  4FHJ A;  4DX7 D;  4A3V A;  4HOS A;  4HOT A;  4K5C A;  4HBD A;  3ML8 A;  2JEK A;  1QNF A;  4J8S A;  1TYQ G;  4DX1 A;  2VGY A;  4GA1 A;  1EF1 C;  4DPR A;  2OOE A;  5A23 A;  4HRL A;  1QBQ A;  4O1P A;  3FHE A;  1BPO A;  3S7D A;  4UWL A;  3R9M A;  4WNE A;  1U3C A;  3U3W A;  3V2X A;  5CBO A;  4LRZ A;  3FUF A;  3Q79 A;  2VTB A;  3B7B A;  2XPZ A;  4L7T A;  5C2Y A;  3O48 A;  1Y6I A;  2YNQ A;  4HLL A;  4DX5 D;  4UQY A;  3UPV A;  3C5R A;  3ZFW A;  4ANW A;  3EHQ A;  4FAD A;  5BV1 A;  5CMW A;  3EHN A;  1QYM A;  2QC9 A;  2KM4 A;  3CK7 A;  4UI9 K;  4JC8 A;  3QOU A;  5FQ6 A;  3ESK A;  4I1A A;  5BXO A;  1EDU A;  2R2L A;  4UI9 C;  4EPZ A;  3FUL A;  3E34 A;  5AJD A;  3SNX A;  2Y1L E;  3HIZ A;  3JYS A;  4HQD A;  4P29 A;  5FTP A;  5D0Q D;  3HG0 D;  5EX3 A;  1D9S A;  2YIN A;  2HE0 A;  4TUM A;  3I3N A;  1LF8 A;  1HG2 A;  3LKU A;  1V55 E;  3HXF A;  4F6R D;  3FU5 A;  1H6O A;  3J5P A;  4GZ5 A;  3PZ3 A;  3D9O A;  4DUI A;  1H0A A;  2GRP B;  5CEA A;  4B0Z A;  3ULY A;  3PE3 A;  2VQ2 A;  2WPV A;  4CT0 A;  3CQC B;  1YCS B;  3KD7 A;  4JB8 P;  5G55 A;  3RRU A;  4AJW A;  2GRL A;  1WM5 A;  3CR3 A;  2WXJ A;  1TJF A;  5HQ8 A;  4C48 B;  4JHK A;  2DYR E;  2Y4U A;  2AJA A;  3ASD A;  3B7U X;  3FTV A;  4YDE A;  3S7B A;  3JCK C;  4YVO A;  4MLP A;  4ILG A;  3CHR A;  2LO6 A;  1OT8 A;  1YMP A;  2X6F A;  2IQC A;  3FU0 A;  1TEZ A;  3I5P A;  4HRM B;  5JA4 D;  3PZ1 A;  2CG3 A;  5AJL A;  2J4B A;  3L08 A;  4GA2 A;  3K9I A;  3SBS A;  3CIA A;  4ANV A;  2ZGG A;  3FUN A;  1HE8 A;  4BT8 A;  1INZ A;  2Y3A A;  2WXO A;  4G24 A;  2VYI A;  3TWR A;  5JJ7 A;  5J90 A;  1PAQ A;  5LP0 A;  3EU5 A;  4URK A;  1MZC A;  3Q73 A;  3V30 A;  2RKK A;  4JHR A;  4GTM A;  5AIJ A;  2IY0 C;  3D9M A;  4FJY A;  2I9C A;  3G2W A;  2CFU A;  2XGS A;  3DSW A;  2LXL A;  4N3C A;  4N39 A;  4ACK A;  4GYY A;  1IHG A;  5FJY A;  3IEG A;  3VLF A;  4I2W A;  4XI9 A;  3GYZ A;  4FLB A;  2ZU6 B;  4GTV A;  4DLQ A;  3GZ1 A;  4A1S A;  3UT7 A;  3ULE G;  3OXL A;  3QAQ A;  1FCH A;  4WUY A;  5C1D A;  2VTB B;  3MKQ A;  2CHZ A;  1A17 A;  1SW6 A;  2DWZ A;  2R5S A;  4WNG A;  4Z68 A;  3FUJ A;  3B7R L;  4U96 D;  4PS7 A;  4KT6 B;  4L2Y A;  4NRH B;  2A4Z A;  3ZNG A;  3ASO E;  2V5Q C;  3AU4 A;  2CHX A;  3LCA A;  2X6I A;  3HRA A;  3C3O A;  5IY5 E;  4TXQ A;  1GW6 A;  4F3V A;  2QZA A;  3ZVV A;  4JL0 A;  2BED A;  3UIO C;  3DXM G;  2I2O A;  4IUL A;  3Q75 A;  3HYM B;  4G25 A;  2P9K G;  5A7D B;  4ZFH A;  4CRW A;  4GZC A;  5EIB E;  3P2B A;  5KCM A;  4J8E A;  4J8F A;  3AG1 E;  4CYM D;  4AVX A;  4EQF A;  4X8Q A;  1JCR A;  2VSY A;  5T3R A;  4B94 A;  5ARF A;  3SFZ A;  2X6J A;  3ABL E;  3D9K A;  4HVB A;  3IV0 A;  4JPS A;  3ZU7 B;  3QC1 A;  4XKB A;  1O1S A;  4CDR A;  1TR4 A;  2VSO E;  3L13 A;  4U8V D;  3V2O A;  3Q78 A;  3QB2 A;  2P9N G;  1QZ2 A;  5BT1 A;  4HOQ A;  2VSN A;  4I6J A;  3ZEF A;  2FEZ A;  3AJI A;  3UM2 A;  2OV8 A;  5FZR A;  3NOC D;  2F0Y A;  3CK8 A;  3RRM B;  1AWC B;  4UI9 J;  4APO A;  2DBA A;  1K1B A;  2PQN A;  2IO3 C;  4GTT A;  4GTO A;  1ZB1 A;  3W9F A;  4QQI A;  2PZI A;  1E7V A;  4L9P A;  3RO2 A;  2H6F A;  3V31 A;  4L1B A;  4RLY A;  2DYS E;  3R7R A;  2XEH A;  1KZO A;  5EIL A;  1FT1 A;  2RFM A;  3FH7 A;  3MV3 B;  4BY6 A;  3PE4 A;  3ZW3 A;  2KC7 A;  4JEU A;  5BNW A;  1EYH A;  3E32 A;  3HHM A;  3LJN A;  3D9P A;  5CED B;  3APF A;  3CHQ A;  3KEA A;  3G2T A;  1SQM A;  1IYG A;  2WXM A;  2AXU A;  1MYO A;  4N5C A;  5BW8 C;  1O5M A;  4J8Y A;  3MA5 A;  2DZN A;  2YHE A;  4NIK A;  4I6E A;  1P5Q A;  4KZC A;  3TWW A;  3AG2 E;  2Q7F A;  5KBA A;  2XEV A;  3V79 K;  5LX8 A;  4K0R A;  4KMO A;  3I4R B;  5BXU A;  1JWF A;  3E4B A;  3MKQ B;  1Z5S C;  3VLD A;  2KCL A;  2A5U A;  2V4H C;  5EID A;  2ZIR A;  3WG7 E;  4BTB A;  1V54 E;  1Y8M A;  3ULQ A;  3KAE A;  4V3I A;  3DSU A;  4LSZ E;  4B8C B;  3FTU A;  3TWU A;  2AVP A;  1KLX A;  1N11 A;  4MKT A;  3UUX A;  2V0P A;  3ZKJ A;  4U8Y D;  1SZA A;  4GTP A;  1HO8 A;  2WXF A;  2Y4T A;  1O1R A;  4GCO A;  3L6A A;  4CCA A;  2J08 A;  1UN9 A;  4GTR A;  3NF1 A;  4KVM A;  4B89 A;  5JJT A;  5D0O D;  4DRX E;  3ISM C;  2A5E A;  4XI0 A;  1H6P A;  4ANX A;  2KZT A;  4K5A B;  1PY1 A;  1H2U A;  3G2U A;  2FI7 A;  4GYO A;  4M3O A;  4DLO A;  4UWG A;  2VGE A;  2GRM A;  3UKR G;  3D9L A;  2R17 C;  1H2V C;  4UUC A;  4C0E A;  3X2Q E;  2VGX A;  3IHY A;  1OUV A;  2FBN A;  4E6H A;  1OXJ A;  2CHW A;  3L17 A;  5ANL A;  4BTA A;  2V5F A;  4U0Z A;  1JCQ A;  4WWN A;  4O6F A;  5AN8 A;  2RG8 A;  4BEP A;  3U9W A;  2R05 A;  4EZK A;  1D8E A;  5BV0 A;  3ZYM A;  3U64 A;  3SF4 A;  3L54 A;  2RFA A;  2X6H A;  2Y69 E;  3PUK A;  3DSX A;  1NL4 A;  3DRA A;  5FQ7 A;  3SHF A;  4J6I A; 
#chains in the Genus database with same CATH homology
 1H19 A;  4APF A;  3BG1 B;  4KZ0 A;  3CIA A;  3CV0 A;  3CLJ A;  4ANV A;  3FTS A;  3FUN A;  2HO1 A;  3BEE A;  4N3A A;  5AYW D;  4HLE A;  3ESL A;  4FUL A;  1HE8 A;  4BT8 A;  4HXI A;  4Y6C A;  1INZ A;  2DCP A;  2Y3A A;  4GCN A;  4WNF A;  2WXO A;  1E8X A;  2OVF A;  3CKC A;  4G24 A;  3UX4 A;  5FQ8 A;  3PEV B;  3LYA A;  5JJ6 A;  2VYI A;  3IBE A;  3ZN3 A;  2WM9 A;  3SGH A;  2HM8 A;  2L0T B;  1UJJ A;  4UQX A;  4PDX A;  4WWP A;  1QQE A;  3BG0 B;  4HOU A;  5JJ7 A;  5J90 A;  4WND A;  4CEM A;  4U04 A;  1PAQ A;  5LP0 A;  3R9A B;  4G11 A;  5JHB A;  3APD A;  4AOF A;  5A6C A;  5LCW J;  2GW1 A;  3UMV A;  5KJN A;  4E85 A;  4URK A;  4L23 A;  2KCV A;  4GZ6 A;  3QKY A;  3TG4 A;  4JHR A;  3PDN A;  5AIJ A;  3D9M A;  2L9B A;  2AWI A;  4EZJ A;  4FJY A;  2I9C A;  4UWH A;  5E76 A;  4DI4 A;  5T8I A;  3G2W A;  3UQ3 A;  3QWW A;  1ELK A;  2CFU A;  3SD5 A;  3RIB A;  2XGS A;  2WXK A;  4MRU A;  4N3C A;  4DK5 A;  2XCC A;  4KYO B;  3FEY A;  4GYW A;  3FTY A;  3IKO B;  3HVE B;  4ILI A;  4AXH A;  4W9R A;  3TG5 A;  3VTX A;  3DBS A;  2YQ8 A;  4N39 A;  5HI7 A;  4ACK A;  4GYY A;  1IHG A;  5FJY A;  4OVU A;  3CVQ A;  1HF8 A;  3IEG A;  4IYP A;  2CFZ A;  4ME2 A;  5G04 C;  3RJV A;  3VLF A;  4I2W A;  4XI9 A;  3GYZ A;  3RKV A;  3EIJ A;  4FLB A;  2UY1 B;  2ZU6 B;  4DLQ A;  3GZ1 A;  3UT8 A;  4GML A;  4I17 A;  4A1S A;  1HXI A;  3UT7 A;  3T5V A;  3LJ3 A;  3QDN A;  2WQ6 A;  3OXL A;  2GGF A;  3QAQ A;  1FCH A;  4WUY A;  2KAT A;  4I6G A;  4H7X A;  5G2N A;  1U3D A;  4AIF A;  5C1D A;  2VTB B;  3NQP A;  1IQU A;  2FUL A;  2PM7 A;  3MKQ A;  1ZU2 A;  1E8Y A;  4GB9 A;  3SBT B;  4QFV A;  2CHZ A;  4A55 A;  1A17 A;  2JLB A;  2R5S A;  4AV7 A;  4WNG A;  4ILH B;  4ANU A;  3FUJ A;  3LDZ A;  3OAW A;  4R7L A;  1HFA A;  1JWG A;  3B7R L;  3R7Q A;  4CT4 A;  4PS7 A;  4KT6 B;  4L2Y A;  4NRH B;  4N2Q A;  2A4Z A;  4IRU A;  2E2E A;  3FEX A;  3ZHE A;  3NZU A;  4FC8 A;  3KEZ A;  2L0I A;  2LSU A;  1XGW A;  3GZS A;  3FUD A;  3PH0 C;  3AU4 A;  2CHX A;  3LCA A;  2X6I A;  3FTW A;  3Q49 B;  2IOL A;  4HFG A;  3AS4 A;  3CGH A;  3OXF A;  4AP2 A;  3ZYK A;  3S7J A;  3CK9 A;  1EPU A;  4LER A;  2J49 A;  1GW6 A;  4XKC A;  2OND A;  3ZYQ A;  1TJC A;  4F3V A;  5ENN A;  3CHM A;  3APC A;  4N2S A;  3MKR A;  3ZVV A;  1E96 B;  4U0U A;  4JL0 A;  3GZ2 A;  2PL2 A;  2WXR A;  3ASG A;  4RG9 A;  2IOS A;  3CVY A;  1N54 A;  3PRE A;  1UW4 B;  2I2O A;  4IUL A;  4BSX A;  1HH8 A;  3FTX A;  3LY9 A;  4F1S A;  1N52 A;  4U0S A;  4KVO A;  3HYM B;  4G25 A;  4GZD A;  5A7D B;  3FUE A;  2ILR A;  4FJZ A;  2MOW A;  5ARG A;  3WXX A;  2WXQ A;  4FLH A;  4WWO A;  4XZ4 A;  3VTY A;  4G23 A;  2V4L A;  4GZC A;  4CRW A;  5EKQ D;  4PS8 A;  3P2B A;  2MRI A;  4JHJ A;  3QNK A;  5KCM A;  5DBK A;  4FU3 A;  3S2A A;  4J8E A;  4J8F A;  4I9C A;  3S7F A;  3Q15 A;  4MS6 A;  4UWK A;  5EX0 A;  4AVX A;  3I4G A;  3FP3 A;  4EQF A;  3ML9 A;  2FF4 A;  1UN8 A;  4JA9 A;  2VSY A;  4JW1 A;  5E75 A;  5T3R A;  4B94 A;  4BX9 A;  2KZT B;  2KCK A;  5ARF A;  3ZGQ A;  3ZYL A;  4JXT A;  3SFZ A;  3ZHE B;  2X6J A;  3D9K A;  4HVB A;  1NA3 A;  1OWO A;  3ONK A;  3IV0 A;  4JPS A;  2J09 A;  2AW6 A;  3FDH A;  3CVU A;  3QC1 A;  4XKB A;  1X5B A;  1IQR A;  3G2S A;  4CDR A;  2VSO E;  3L13 A;  4I9E A;  1JUQ A;  1JPL A;  3QB2 A;  2EQX A;  3LVR E;  3MX3 A;  3KS2 A;  1QZ2 A;  2OVB A;  3CVP A;  3CHP A;  1WY6 A;  3AS8 A;  3PVL A;  1OWL A;  2AXZ A;  2VSN A;  4HOQ A;  2NC9 A;  2BTD A;  2YHC A;  4I6J A;  3D9I A;  3ZEF A;  4A1G A;  5JHA A;  3JUI A;  2XRZ A;  3D9J A;  3ZXS A;  5AEN A;  2WMN A;  2WXI A;  2V8S E;  4CDN A;  2J07 A;  2FEZ A;  3PS6 A;  5FZQ A;  5G05 J;  2VGX B;  3ASF A;  3SI5 A;  2OV8 A;  3FU6 A;  1MHQ A;  5FZR A;  3AS5 A;  3PEU B;  2WXH A;  4TV3 A;  3CK8 A;  3B7S A;  2XGM A;  3MV2 B;  2X3M A;  3RRM B;  3T5X A;  3CVX A;  1FVF A;  1Z3Y A;  4AY6 A;  4UI9 J;  4J8D A;  4Y6W A;  4APO A;  1SZ9 A;  2DBA A;  2VSX E;  4EBA G;  3PNT B;  5LCW C;  4LUN U;  3DPD A;  2PQN A;  3C98 A;  1H2T C;  3RO3 A;  4LCT A;  5J08 A;  3FH8 A;  1NA0 A;  4I1M A;  4JEH A;  3U66 A;  2C0M A;  2PZI A;  4PS3 A;  3LY7 A;  5KJL A;  2AXV A;  4JA7 A;  3FUH A;  1L5J A;  2WXP A;  1E7V A;  5BPP A;  1XNF A;  1DVP A;  3JQ1 A;  3RO2 A;  3RRN B;  2IFU A;  4BX8 A;  1OWM A;  3FWV A;  3PNL B;  3LXU X;  3U4T A;  4L1B A;  1W3B A;  4IN3 B;  2IJG X;  5G04 J;  4DI3 A;  2XRY A;  4I43 A;  5CCL A;  2WXL A;  3QWP A;  4XX5 A;  3R7R A;  3B7T A;  1E7U A;  3ONL A;  3B13 A;  2CG2 A;  2WXG A;  3FFL A;  2WB2 A;  2RD0 A;  4Q69 A;  2QFC A;  3TAX A;  1Z6T A;  1UG3 A;  1WAO 1;  4ACL A;  3FH7 A;  3MV3 B;  4DJA A;  4BY6 A;  4ATG A;  3PE4 A;  2R59 A;  3OTN A;  3FUM A;  3L16 A;  3ZW3 A;  4J0U A;  2BF0 X;  2BUG A;  1FVH A;  2KC7 A;  4JEU A;  5BNW A;  3JQ0 A;  1EYH A;  3HHM A;  4G2V A;  4BWR A;  3D9P A;  3APF A;  3CHQ A;  2WXN A;  2QY7 A;  3G2T A;  1SQM A;  3CHO A;  3ZRH A;  1IYG A;  3MJW A;  2I1J A;  2WXM A;  2AXU A;  3UT4 A;  5KJK A;  4G26 A;  4N5C A;  4UWF A;  3Q4A B;  1UJK A;  2LAH A;  3CVV A;  3P1U A;  4D10 C;  5BW8 C;  2IU1 A;  2NSZ A;  4FHJ A;  3G2V A;  3MA5 A;  2XGO A;  1PC2 A;  3QAR A;  3LS8 A;  3MGB A;  4C9B B;  3MEK A;  4A3V A;  2YHE A;  4HOS A;  4HOT A;  1HS6 A;  4GMJ A;  4YVQ C;  3ML8 A;  4RVB A;  4I6E A;  1QNF A;  2JEK A;  1ZBP A;  1P5Q A;  3CEQ A;  4J8S A;  3LEW A;  4KZC A;  2VGY A;  3Q5M A;  2C2L A;  3Q47 B;  3TXN A;  4FHK A;  4GA1 A;  3D9N A;  2Q7F A;  4LEU A;  1EF1 C;  4ABN A;  4F53 A;  2LAI A;  4DPR A;  2OOE A;  5A23 A;  3L22 A;  2XEV A;  3HVE A;  3EDT B;  3FHE A;  2PM6 A;  3QJZ A;  4NUR A;  1VDY A;  4NAC A;  1BPO A;  1E90 A;  3S7D A;  4YND A;  4K0R A;  4KMO A;  5LX8 A;  4UWL A;  5FZS A;  5FT9 A;  3I4R B;  4WNE A;  1U3C A;  3CQG B;  3U3W A;  2PQR A;  3SZ7 A;  2NXP A;  2WQ7 A;  4LRZ A;  4U07 A;  1JWF A;  3E4B A;  3MKQ B;  5M72 A;  3QK0 A;  4I2Z A;  2MHK A;  3VLD A;  3FUK A;  1HG5 A;  3FUF A;  2KCL A;  1HZ4 A;  2UWJ G;  2A5U A;  5ANR A;  5BUZ A;  4BTB A;  2VTB A;  2XPZ A;  2X6K A;  4JVS A;  4L7T A;  5C2Y A;  4U63 A;  1Y8M A;  3ULQ A;  4NQ0 A;  3ZIM A;  3O48 A;  1Y6I A;  2YNQ A;  3OXG A;  3KAE A;  4V3I A;  5CHE E;  2WQH A;  4EZL A;  3ASH A;  2FO7 A;  4OYS A;  4UQY A;  4B8C B;  4Q96 A;  3UPV A;  4OVV A;  2I6H A;  3FTU A;  3ZFW A;  4ANW A;  2DIW A;  3CHS A;  4AY5 A;  4FAD A;  4I1O B;  5LFA A;  3GW4 A;  5BV1 A;  5CMW A;  2XPY A;  2AVP A;  3EHN A;  4GAA A;  2XHE A;  1KLX A;  4KBQ A;  2KM4 A;  4TRQ A;  3CK7 A;  4UI9 K;  5G05 C;  1DNP A;  4JC8 A;  4BT9 A;  4MKT A;  3QOU A;  5FQ6 A;  1NZN A;  3ESK A;  5EDS A;  3FTZ A;  3UUX A;  4I1A A;  4C0M A;  2V0P A;  1EDU A;  4PUC A;  5KJM A;  1SZA A;  4UI9 C;  3QWV A;  2XQ0 A;  4EBA A;  4EPZ A;  4HOR A;  3FUL A;  3RK6 A;  2XCB A;  4AM9 A;  4FP7 A;  1YA0 A;  5AJD A;  3SNX A;  3HIZ A;  3D3M A;  3JYS A;  4RSY A;  2ION A;  4UQZ A;  3IHV A;  4P29 A;  1HO8 A;  2WXF A;  2Y4T A;  5FTP A;  5D0Q D;  5T4Y A;  2P58 C;  3PRZ A;  5EX3 A;  3EHM A;  3CKB A;  4GCO A;  3EJN A;  3L6A A;  1ELR A;  3O4Z A;  3NZS A;  4EEC A;  2YIN A;  4WAF A;  4AEZ C;  4CCA A;  2J08 A;  1UN9 A;  4JZY A;  2C0L A;  3I3N A;  1LF8 A;  1HG2 A;  3LKU A;  3NF1 A;  3FU3 A;  3PUJ A;  4KVM A;  4B89 A;  5FQ4 A;  1S0P A;  3ENE A;  4GU5 A;  4H7Y A;  4L2L A;  5D0O D;  3FU5 A;  5JJT A;  1ELW A;  1E8W A;  4GZ5 A;  3TJP A;  2E0I A;  2I1K A;  3FUI A;  3D9O A;  2L6J A;  4XI0 A;  2WMO A;  4ANX A;  1H0A A;  3TXM A;  2KZT A;  4B0Z A;  3MYV A;  4CGW A;  3PE3 A;  3TL5 A;  2VQ2 A;  1Z3X A;  4GA0 A;  2WPV A;  4CDM A;  1H6K A;  1KT1 A;  1PY1 A;  4A3T A;  4CT0 A;  1H2U A;  3G2U A;  2FI7 A;  4GYO A;  3VLE A;  2WVI A;  4M3O A;  3FY4 A;  3ZPJ A;  3N71 A;  4U8H A;  5FWQ A;  3CST A;  4DLO A;  4Q94 A;  4TUU A;  4UWG A;  3CVW A;  3CVN A;  2GRM A;  3CQC B;  4CGV A;  3KD7 A;  3AU5 A;  3T8M A;  5G55 A;  1NP7 A;  3RRU A;  4RG6 A;  4AJW A;  2GRL A;  1WM5 A;  4B8A A;  3D9L A;  2R17 C;  5BT1 A;  3CR3 A;  1H2V C;  4C0E A;  2WXJ A;  1TJF A;  2IF4 A;  5HQ8 A;  5CMY A;  4JHK A;  2VGX A;  3IHY A;  1OUV A;  2Y4U A;  2FBN A;  3ASD A;  4KXK B;  3B7U X;  1E8Z A;  4E6H A;  3LY8 A;  3FTV A;  4BFR A;  4XIF A;  2CHW A;  1B89 A;  3S7B A;  3JCK C;  4N3B A;  4YVO A;  2LNI A;  3CSF A;  4MLP A;  3TGO A;  4ILG A;  3CHR A;  3L17 A;  2XPI A;  4G1T A;  5ANL A;  4BTA A;  2LO6 A;  2V5F A;  4U0Z A;  4WWN A;  4XE0 A;  4O6F A;  1MQS A;  3FH5 A;  2RG8 A;  3PZD A;  2X6F A;  2IQC A;  3U9W A;  5CCM A;  4EZK A;  3CVL A;  5DIZ A;  3EIQ C;  5BV0 A;  5LOZ A;  3ZYM A;  4HS2 A;  3U64 A;  2UY1 A;  3SF4 A;  4PH4 B;  1HU3 A;  3FU0 A;  3LPZ A;  1KT0 A;  2J9Q A;  1OWP A;  1TEZ A;  3URZ A;  4GPK A;  1OWN A;  3I5P A;  3L54 A;  2X6H A;  3PUK A;  3RU0 A;  1HX8 A;  4GZ3 A;  2LSV A;  2CG3 A;  3LVQ E;  2J4D A;  5AJL A;  2J4B A;  3L08 A;  4K03 A;  5FQ7 A;  3MZL B;  2M63 A;  3HDX A;  2VJ8 A;  4GA2 A;  3SHF A;  2X38 A;  3MCX A;  4J6I A;  4F7A A;  2HYZ A;  2HR2 A;  3K9I A;  4FA6 A;  3SBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...