1QQEA

Crystal structure of the vesicular transport protein sec17
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
290
structure length
281
Chain Sequence
ISDPVELLKRAEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSESNFLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the vesicular transport protein Sec17: implications for SNAP function in SNARE complex disassembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords VESICULAR TRANSPORT PROTEIN SEC17
total genus 122
structure length 281
sequence length 290
ec nomenclature
pdb deposition date 1999-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1qqeA00
4KXKB 3ASGA 3GW4A 2XCCA 4I1AA 4I9CA 5ARGA 4HOTA 1Y8MA 3PE4A 3ASDA 2QFCA 3QWVA 1ZU2A 3RO2A 2GW1A 1B89A 3CK7A 3E4BA 3FWVA 3LKUA 4GYOA 4G2VA 4UQXA 1QQEA 1ZBPA 2XEVA 3ESKA 5KJLA 4LEUA 1HZ4A 2XGMA 3CK9A 4YNDA 2P58C 5BW8C 3EDTB 3GZ1A 3MA5A 5DBKA 5JJTA 5G04C 4N2QA 3RO3A 2BUGA 3CVLA 3KAEA 3WXXA 2PL2A 5FZRA 4CGVA 4J8DA 1OUVA 1HXIA 3O48A 5AYWD 4I9EA 5C1DA 5FTPA 3JYSA 3PDNA 2UY1B 2KCLA 4GYYA 3CVPA 3ZFWA 4B94A 4F3VA 3LY7A 5BNWA 2XPIA 4N39A 4YVOA 3ZN3A 2WPVA 4JHRA 3K9IA 3Q15A 1IHGA 4GZ5A 3NF1A 1HH8A 4UI9C 5CHEE 4AY6A 3MEKA 3OXGA 4GA0A 4WUYA 4IN3B 4GCNA 2YQ8A 4N3AA 4U07A 5D0QD 1NA3A 4KBQA 4WNDA 5D0OD 5G05C 2KATA 5HI7A 2PZIA 3CKBA 5FJYA 1E96B 3LY9A 2DBAA 3OXFA 4RG6A 3GZ2A 3SZ7A 4CDRA 3LPZA 4AIFA 1NA0A 1PC2A 2AVPA 3MV3B 5FZQA 4GA2A 4H7YA 4U0UA 4XIFA 3ZHEA 3UUXA 2V5FA 2VSYA 2IFUA 3IEGA 2KCVA 4I17A 4XI0A 2VGYA 4GYWA 4U0ZA 2HR2A 3FP3A 3CKCA 3KS2A 4H7XA 2KC7A 4UI9K 2VGXA 2I6HA 5FZSA 4HORA 5JJ6A 2KCKA 3AS8A 3Q5MA 4JA9A 3LY8A 4UQZA 4J8FA 4BWRA 2YHCA 3CV0A 3LYAA 3Q49B 3CVQA 2FBNA 3FFLA 2HO1A 5G04J 4BT9A 4U04A 3R9AB 3LCAA 5BT1A 3ZPJA 2VSNA 3S7FA 2VGXB 3PE3A 4G23A 1W3BA 3VTYA 1TJCA 2XCBA 4G26A 2FEZA 3GYZA 5FT9A 3Q4AB 5M72A 4J0UA 4GA1A 4I2ZA 2XGOA 5LCWJ 4EQFA 1KT1A 4HOQA 3ZHEB 2Y4UA 4UQYA 5KJNA 3QWWA 3TAXA 3U4TA 4I2WA 1QZ2A 3QDNA 1WAO1 1KT0A 4G24A 4N3CA 4UI9J 4YVQC 5EX0A 1IYGA 4JA7A 4WNEA 2JLBA 5A7DB 3ZGQA 3AS5A 3QOUA 4GPKA 1FCHA 4BTAA 5KJMA 2C2LA 2UWJG 2J9QA 2L6JA 2HYZA 2PQRA 3RKVA 4ABNA 3UPVA 5A6CA 4JL0A 4AY5A 2C0MA 5JJ7A 3MKRA 2FF4A 3MV2B 4RG9A 3U3WA 2OOEA 3TGOA 4HOUA 5EX3A 1NZNA 4W9RA 3RU0A 2Y4TA 1P5QA 5G05J 1YA0A 2E2EA 3UQ3A 4A1SA 3N71A 4GZ3A 3ASHA 3TG4A 3CEQA 3OXLA 2C0LA 2WQHA 2XGSA 3ULQA 1WM5A 3ASFA 4GCOA 3TG5A 1A17A 5HQ8A 4N2SA 3HYMB 2ONDA 4G1TA 3AS4A 4O6FA 3RJVA 4N3BA 5ARFA 4Y6CA 2NC9A 2UY1A 4AM9A 3KD7A 4HOSA 4NRHB 3S7BA 2VYIA 3S7DA 4CGWA 4U0SA 3URZA 5KJKA 2R5SA 5LCWC 4WNFA 3CK8A 1XNFA 4APOA 4NQ0A 2LSVA 2PQNA 3Q47B 3RIBA 2LSUA 2LNIA 4WNGA 1ELRA 4Y6WA 1KLXA 2MHKA 4BTBA 4BT8A 4ME2A 2VQ2A 3VTXA 4N5CA 4XI9A 5CCLA 4GZ6A 5DIZA 5EKQD 4G25A 3S7JA 2Q7FA 3SF4A 4J8EA 5CCMA 1ELWA 3CVNA 2IF4A 4KYOB 3BEEA 3QKYA 2FI7A 2FO7A 3QWPA
chains in the Genus database with same CATH superfamily
5ENOD 3ASGA 2J09A 5LOZA 4BETA 1ZBPA 4LNBA 3CVLA 3CIAA 3V30A 5C1DA 3FY4A 1K1AA 2X38A 3OAWA 5EYLA 4DI4A 4F3VA 2RD0A 4B89A 3ZN3A 2DYSE 2I9CA 3I3NA 3PVLA 4GCNA 1Z3YA 4KBQA 4TXRA 4EBAG 4F7AA 2VGYA 5JJ6A 4UQZA 4WWOA 2XS1A 1E8XA 3G2TA 1W3BA 5EYPF 2WXHA 1KT1A 3ZHEB 5HRYA 4HLLA 2IONA 4XKCA 4R7LA 5EIDA 2VTBA 3MKRA 3U3WA 2MYOA 4JPSA 4HOUA 2L6BA 3S2AA 3UM3A 5IY5E 1P5QA 2E2EA 2CFUA 4FHKA 2XGSA 2F8YA 4GTVA 3B13A 1FVHA 4AM9A 2QYJA 2CHWA 2OEVA 3URZA 3CVVA 3DEPA 4JHJA 4C0EA 4QQIA 4GPMA 4K5AB 4XI9A 3TXNA 3NOCD 3S7JA 5KNGA 4KXKB 2PM6A 4RSYA 4YDWA 3JCKC 5AJDA 1MX2A 4I6EA 3FU0A 1TJFA 3L6AA 3B7RL 1K1BA 3G2VA 5ITZF 4FJYA 2P9SG 2IO3C 4JB8P 1SW6A 1SZ9A 5EDSA 4WWPA 3BG0B 4WWNA 4CCAA 1O1TA 4A63B 5HS0A 3FP3A 3B95A 1YMPA 2YHCA 3Q49B 2H6IA 4K5CA 3UX4A 1E8ZA 4BT9A 5BT1A 2ZIRA 3J5PA 4G26A 5LCWJ 1BLXB 2L6JA 3L9TA 4F1PA 3IKOB 3D9HA 4GTMA 3PZ1A 3ULEG 2XENA 3RRUA 2LO6A 3LDZA 3QNKA 3DSVA 5ARFA 1H19A 5JHAA 3VLEA 3UMVA 5LCWC 2LSVA 2PQNA 3MKQA 2LNIA 4WNGA 4Y6WA 4Q96A 4U7EB 2L9BA 4HVBA 2PNNA 3T8KA 4U95D 3UM0A 3NQPA 3RO2A 4ILGA 3ESKA 2WXFA 1O1RA 1OCRE 3KEZA 2X3MA 3O48A 4PS3A 4CT0A 1OWNA 3CVPA 3CQGB 1LF8A 1OCZE 5ANRA 2XPIA 4C48B 4JHRA 2LXLA 3Q78A 3FEYA 3SY2A 3FUIA 1N54A 3MZLB 1E96B 3I4GA 5B1AE 5LP0A 2VGXA 3CSTA 4L23A 2RFAA 2ZGDA 3DSTA 4B8AA 4ANWA 1FT1A 5KJNA 2GROB 3AJIA 3EHRA 3ML8A 4N5QA 2J9QA 3NBNB 3F6QA 4LCTA 3UTMA 3MV2B 3V79K 4A3TA 4U8YD 3ASHA 1PAQA 3AG2E 3ZNGA 2WQHA 3LJ3A 3HXDA 1FT2A 4U96D 4GAAA 3C3QA 2P2CP 2WXQA 4APOA 3ULYA 3RIBA 4BX9A 4GTPA 1E90A 3L22A 1N94A 2X6KA 1XGWA 2P9NG 3JUIA 3SF4A 3CVNA 3FTVA 5J08A 1UG3A 2QYUA 3GW4A 3QB2A 5BW8C 2IOLA 5FQ8A 3U9WA 4I6JA 4GYYA 3LY7A 1G3NB 4FHJA 1IHGA 3D9OA 3D9MA 3SBTB 3SQVA 4JHKA 2H6GA 2WM9A 4AIFA 1H6KA 3FU3A 4F6RD 4H7YA 3TWSA 1D8EA 1Z5SC 2HR2A 4DK5A 4HORA 2XS8A 4E85A 1S0PA 2FBNA 4U04A 2WXPA 4AV7A 3R7RA 3S7FA 1TNUA 4I1OB 3TL5A 1DC2A 5BXUA 2P9PG 4WNEA 4GTOA 3QOUA 1MHQA 1FCHA 3QJZA 3HXEA 1MQSA 4AJWA 2NSZA 3AAAC 3R9MA 3AG1E 4G1TA 3D9LA 2LAIA 4PDXA 2DIWA 3HVEA 4APFA 4U0SA 4AOFA 2GRNB 2LSUA 3ZVVA 1IQUA 1INZA 3Q7AA 3U66A 4PS8A 3FTXA 3Q7FA 2AXUA 5A23A 1V55E 4HRMB 3QWVA 4EECA 3LKUA 4ILIA 3EDTB 3MA5A 1Z3XA 4JZYA 1TN8A 3ZXSA 3G2SA 1EF1C 5B1BE 4CT4A 4RVBA 5FWQA 5CRUA 5BNWA 2WPVA 4LUNU 2F8XK 3C5RA 4K03A 1OT8A 4J6IA 5FJYA 1TNYA 1KPSB 3SZ7A 4EHMA 2WXKA 3MV3B 3DEOA 2V5FA 1MJ0A 3ZUVB 1N4RA 1HG2A 3R9AB 1TN6A 3UPVA 5CRVA 4GB9A 3HRAA 4I2ZA 2YINA 5H7PA 3SBSA 4Q94A 3HHMA 4GPKA 2R17C 4MBGA 5ANLA 3UKUG 1LTXA 4ABNA 1UN9A 4HS2A 3TGOA 4DLQA 1DCQA 2ZXWE 2NYJA 1IXVA 2WQ6A 1SVXA 4NRHB 3FH5A 2KZTA 1SZAA 1N0QA 1JCQA 3TWWA 2DZNA 1KLXA 4HRLA 3DXKG 5FQ6A 2GRPB 2MOWA 1WDYA 2J4DA 5ARGA 2XCCA 1H2TC 3B7SA 4FULA 2GW1A 3FWVA 4HBDA 1OCOE 1RZ4A 2XEVA 2XGMA 5G2NA 1E8YA 2OVFA 1OUVA 5BXOA 2KCLA 3J5QB 4N39A 5KBAA 4OAVB 3MEKA 4GA0A 3T5VA 4A55A 3D9PA 2BF0X 1VDYA 4U8VD 3ABME 1NA0A 3CHOA 2IOSA 2BTDA 3IEGA 4XI0A 1OWOA 4PUCA 3AS8A 3LY8A 4LSZE 3CSFA 4TXQA 4UUCA 2VGXB 3JXIA 3C72A 2XCBA 4J0UA 2XGOA 4EQFA 3PEVB 4A1GA 4JA7A 3ZGQA 1N4PA 4KZCA 4EBAA 3UM1A 3CVYA 3AG3E 4HRNA 4TUMA 3O4ZA 4XEIG 2J08A 1A17A 2I1JA 5KWDA 1N4QA 3CGHA 2CHXA 4BTBA 2I1KA 4N5CA 1EPUA 2X6FA 4GZ6A 3WG7E 1IHBA 1K3ZD 2ETAA 3MX3A 4BESA 1N9AA 3MKQB 2QFCA 3E30A 3SFZA 4G2VA 5KJLA 2P58C 4J8DA 4I9EA 4TRQA 3FUHA 3IXEA 3PDNA 2V0PA 3SI5A 3KSLA 3BU8A 3T8MA 1OCCE 3JQ1A 5D0OD 2BKGA 4LERA 3CKBA 3GZ2A 3Q9NC 1N0RA 2FULA 4U0ZA 3FTSA 3CVXA 4H7XA 2KC7A 4JA9A 4BWRA 3CV0A 3PEUB 5G04J 3D3MA 4NURA 5BV1A 4HLEA 3SFXA 3OTNA 3U4TA 4I2WA 2R59A 5BPPA 1IYGA 4OYSA 3QK0A 3P2BA 5KJMA 3Q79A 1TNBA 2L0IA 3AU4A 4BSXA 3FEXA 1UW4B 4JEUA 3RK6A 5AJLA 1DNPA 1Z6TA 3ASFA 4HI9A 4N2SA 1O1SA 4Y6CA 2UY1A 1SA4A 3Q47B 4J7WA 1U3CA 3RRNB 3X2QE 5ENSD 4CEMA 4TUUA 5KCMA 3HXFA 4ACKA 2IF4A 3EU9A 3ZKJA 5J90A 3PE4A 3V31A 2XEEA 3IBEA 3CK7A 1B89A 2ZGGA 3C3RA 4LEUA 3MYVA 2BUGA 2DCPA 1HFAA 3P1UA 2H6HA 4KMOA 4WAFA 1OWPA 3JYSA 4HNAD 4XX5A 1H6OA 1HU3A 3CVUA 4UI9C 4GMLA 1QBQA 3E37A 1ELKA 3PZDA 1E7VA 4GTTA 5D0QD 3HIZA 2PZIA 5JHBA 2EIJE 3LPZA 4EZJA 3ZHEA 4L2YA 3UUXA 1BI7B 4MKTA 5AARA 1TNOA 1WY6A 3GZSA 5AAOA 1DCEA 4F53A 3L16A 3SHFA 2GRMA 4GA1A 3FUNA 4KT6B 3UT8A 1TNZA 4U63A 4NIKA 3LEWA 1KT0A 4ILHB 4JEHA 3ZIMA 1TN7A 4JL0A 2P9LG 2J8SD 3Q9UC 5LX8A 2P9IG 4OAUC 2C0LA 3PUKA 3UIPC 2DZOA 2XRYA 3ZYKA 4DX7D 2GRRB 4GZCA 3BQOA 4CGWA 3C3OA 1X81A 5ENNA 3BUAA 3UKRG 4HXIA 3FUDA 3FUKA 3VTXA 2KBXA 3ABKE 1IKND 5KNHD 5D2MC 4ANUA 2LAHA 3QWPA 2GRLA 3VLDA 1S63A 1ZU2A 4AEZC 4JC8A 4DPRA 2JEKA 5T4YA 5FTPA 2UY1B 3D9JA 3ZFWA 5D66A 1DVPA 3ZYQA 4GZ5A 3E32A 3W9GA 4D10C 3LS8A 5G05C 3OXFA 4LNGA 3ONKA 4GYWA 3KS2A 3T9KA 2CG2A 3FH7A 3ZRHA 3CHPA 2WVIA 4UWHA 1QYMA 4TXPA 5M72A 1WAO1 4G24A 3PZ2A 4DJAA 2C2LA 2KZTB 5EILA 2C0MA 4FADA 1ZB1A 4A1SA 2WB2A 2XEHA 3V2OA 5HQ8A 1NP7A 2WXMA 4FP7A 4ACLA 3DSSA 2AXVA 5CERB 5CBOA 2J49A 5CMYA 4B93B 2AW6A 2CFZA 3TWRA 4IYPA 4RQIA 3AG4E 3JUEA 4BY6A 4YNDA 5DBKA 4N2QA 3RO3A 3Q73A 5FZRA 5B3SE 5AYWD 1OY3D 5T3RA 3CHRA 1AWCB 3QAQA 4FLBA 4X8QA 1HH8A 3EHMA 4HI8A 3OXGA 3ZXPA 1H2VC 4CDNA 1NA3A 2A4ZA 3LY9A 1HS6A 4L9PA 2ETBA 5FZQA 3UT7A 3UI2A 2XZDG 3TG4A 2X6JA 3HDXA 2I6HA 2XHEA 2J4BA 3LCAA 1H2UA 3Q4AB 2V4LA 1JCSA 3QWWA 2WMNA 4YVQC 5EX0A 5A7DB 4ANVA 4BTAA 4FC8A 2PQRA 3RKVA 2HYZA 2RG8A 3B7BA 3FU5A 4CRWA 2VTBB 3UXGA 3D9NA 2Y4TA 1YA0A 4HB5A 1N4SA 2ONDA 3RJVA 3ASNE 1Q2ZA 4HOSA 3FUFA 4FU3A 4WNFA 1WG0A 1UOHA 4CYMD 1JUQA 4BT8A 3G2WA 3JQ0A 3V2XA 4DRXE 1E8WA 4EZKA 1JWGA 4KYOB 2F37A 2FO7A 2VSXE 1JCRA 4GZDA 4DUIA 1OWMA 4K0RA 4GYOA 3TJPA 2WMOA 1HZ4A 3SO8A 2PL2A 4AVXA 3T5XA 3APDA 4YVOA 2L0TB 4FLHA 4WUYA 2YQ8A 4IRUA 4ATGA 1U3DA 3DPDA 4JXTA 3UIOC 3PNLB 2VSYA 1FVFA 2KCVA 4I17A 4UI9K 5CECB 1TR4A 4O1OA 3CVQA 3RAUA 5JMND 3VTYA 1JWFA 5ENTD 3PRZA 4UI9J 4BSZB 2YNQA 2VJ8A 2BKKB 2LUHA 5E75A 2V4HC 5A6CA 4O60A 3DSWA 4EPZA 1TYQG 5AQBA 3JXJA 3RU0A 5EX3A 3UQ3A 3N71A 3CEQA 3L82A 3ZU7B 1TEZA 1HG5A 4N3BA 2R02A 3KD7A 3SNXA 4ZFHA 4BX8A 1XNFA 2RKKA 2WQ7A 3PUJA 2P9UG 4ME2A 3FDHA 4JD2G 5CCMA 4DX1A 2AXZA 1UJJA 4B0ZA 1H6PA 3EUVA 4I9CA 2WXRA 2RFMA 1Y8MA 5G55A 3D9KA 4C0MA 5BV0A 1LD7A 2JABA 2LXMA 4G8KA 5JJTA 2VGEA 1JPLA 4RLYA 3HVEB 1NI1A 5FQ4A 2V8SE 4B94A 3VLFA 2OEWA 3K9IA 3Q15A 1YYHA 2A5EA 4FJZA 3FH8A 3EHQA 3LJNA 1KZOA 3NAWA 2WXOA 2AVPA 4GA2A 4Z68A 5C2YA 3E33A 1EYHA 4HFGA 1HF8A 2WXJA 1BPOA 3TWUA 3FTUA 4EZLA 1BU9A 4DX2A 2KXPC 2A5UA 4G23A 1UN8A 2R03A 3KEAA 3QDNA 3IHYA 4N3CA 3EIJA 2JLBA 2Y69E 5ENQD 2NXPA 5ENRD 2XPZA 1IQRA 3EIQC 3FHEA 3L54A 4YDOA 3CHMA 2I2OA 3OXLA 2X6IA 4GCOA 3HYMB 1D9SA 4DI3A 3NB2A 4A3VA 5FINA 1SQMA 3DSXA 2XRZA 4DLOA 3B7UX 3ABLE 2B0OE 4BFRA 2EINE 3ZW3A 3TWTA 2ETCA 5CCLA 2Q7FA 1HX8A 3PS6A 3Q75A 4UWGA 5AENA 4M7CA 4URKA 2B6CA 3C98A 4I1MA 4FA6A 3ASDA 5AQ7A 3ML9A 1V54E 4UQXA 3L13A 2X6HA 3GZ1A 4PS7A 2GGFA 3ZEFA 3WXXA 4GTQA 1HXIA 2DWZA 2YHEA 5AQ9A 2HE0A 1D8DA 3DWLG 4NACA 3FUEA 4XZ4A 5CHEE 3NF1A 4AXHA 4IN3B 5HI7A 2KATA 2BEDA 2Y1LE 4RG6A 2DBAA 4CDRA 5HKPA 2FO1E 4Q69A 4XIFA 4PH4B 5FZSA 3CKCA 4B8CB 2KCKA 3EJNA 4J8FA 3LYAA 4XKBA 1RW2A 2R05A 3DSUA 4GMJA 3MJWA 3ZPJA 3FUMA 4I6GA 1N52A 1QZ2A 1FPPA 4G8LA 3AS5A 2AJAA 2WXNA 3HXBA 5JJ7A 2OOEA 4CDMA 1NZNA 4GZ3A 1HO8A 4O1PA 3NZSA 4O6FA 4U8HA 4L7TA 4ZHBA 2IJGX 4NQ0A 5FIOA 3PNTB 1ELRA 3B7TA 2VQ2A 3I5PA 5CEAA 1BD8A 4J8EA 1ELWA 3L08A 3BEEA 2XZTG 4I1AA 2WXGA 3PZ4A 1E7UA 2ZISA 2J07A 4OVVA 2QZAA 4MLPA 4QFVA 1A5EA 2Y0BG 1GW6A 3PZ3A 3BG1B 3UT4A 4AY6A 4KVOA 3MCXA 3DPYA 2XPYA 1OWLA 4IULA 4U07A 5CBNA 2R2LA 2ZU6B 5EN5D 4G11A 3TWVA 3HG0D 3DXMG 3FFLA 2HO1A 3ENEA 3RSEG 1MZCA 1TJCA 5FT9A 3TAXA 1U2VG 2HM8A 2UWJG 1MX4A 3SGHA 5AIJA 3R7QA 4W9RA 2KM4A 4LRZA 2H6FA 3LXUX 2E0IA 4MRUA 1WM5A 4E6HA 3UM2A 4CZ2D 3AS4A 3G2UA 3APCA 3EU5A 4L1BA 3S7BA 3KSQA 4MS6A 5KJKA 2R5SA 3APFA 4UWLA 1HE8A 1NFIE 3ONLA 4AP2A 3LVQE 1O5MA 3QKYA 3HXCA 4LG6A 3UINC 4HOTA 4JVSA 2IEJA 3E4BA 4XE0A 2IU1A 4I43A 3CK9A 2DVWA 5E76A 3KAEA 3IHVA 4KZ0A 4ATZD 4CGVA 4P29A 4DX6D 3W9FA 2CG3A 1NL4A 5AQAA 3FTWA 4OVUA 1LD8A 4J8YA 4U0UA 4DX5D 2F0YA 4GTRA 4YDEA 5FQ7A 5BUZA 2WXLA 1N95A 1UJKA 2IQCA 2VSNA 1QNFA 4TV3A 3EHNA 3D9IA 5JA4D 4BERA 3NZUA 4UQYA 1BI8B 1KZPA 2VSOE 3PREA 4JW1A 2GRQB 3DBSA 2EQXA 1Y6IA 2ILRA 1H0AA 2EIME 2EILE 3E34A 4RG9A 4V3IA 4YDYA 1PY1A 3U64A 4UWFA 3L17A 2NC9A 4F1SA 2VYIA 3S7DA 3MGBA 5CMWA 3ESLA 1SA5A 3ASOE 4J8SA 3NOGD 3TWQA 3CQCB 5EKQD 1N11A 4G25A 1YCSB 1X5BA 3FU6A 1OXJA 1S64A 3I4RB 3ISMC 3CLJA 2CHZA 1QQEA 5AN8A 5G04C 4HQDA 3RRMB 2OVBA 3TWXA 3PH0C 2WXIA 1MYOA 1EDUA 5ENPD 4L2LA 4C9BB 2M63A 3FTYA 3TXMA 4BEPA 1L5JA 4N3AA 4WNDA 3SD5A 1PC2A 2XQ0A 2OV8A 3CHQA 4GTSA 2IY0C 2IFUA 3FTZA 2AWIA 3Q5MA 3AU5A 3DRAA 3FUJA 3LVRE 4UWKA 3FULA 3PE3A 2FEZA 3GYZA 5EIBE 4HOQA 2Y4UA 4KVMA 1S70B 2QY7A 4M3OA 3SFYA 5LFAA 3CR3A 1MX6A 2Y3AA 2PM7A 2P9KG 4AY5A 3ZYLA 2FF4A 3QARA 5T8IA 4GU5A 5G05J 2OCCE 3QC1A 5CEDB 3ULQA 3IV0A 3TG5A 1K8KG 4GMRA 2EIKE 3ZYMA 4K5BA 3CK8A 3CHSA 2DYRE 3CVWA 2MRIA 2MHKA 2QC9A 5DIZA 2IO2C 1AP7A 4LNUD 2FI7A 2V5QC 4ANXA
chains in the Genus database with same CATH topology
2GRLA 3ASGA 3C98A 3VLDA 4I1MA 2J09A 4FA6A 3ASDA 3QWVA 1ZU2A 3ML9A 4EECA 4AEZC 3LKUA 4ILIA 5LOZA 4JC8A 4UQXA 1ZBPA 3L13A 4DPRA 2X6HA 3EDTB 3GZ1A 3MA5A 4PS7A 2GGFA 1Z3XA 3WXXA 3CVLA 3ZEFA 3CIAA 4JZYA 2JEKA 1HXIA 5T4YA 2YHEA 5C1DA 5FTPA 3ZXSA 2UY1B 3D9JA 3G2SA 1EF1C 3FY4A 2X38A 3OAWA 4RVBA 5FWQA 1DVPA 3ZFWA 4CT4A 4DI4A 2RD0A 3ZYQA 4B89A 4F3VA 5BNWA 4NACA 3ZN3A 2WPVA 3FUEA 4GZ5A 4LUNU 5CHEE 4XZ4A 3NF1A 2I9CA 4AXHA 3I3NA 3PVLA 4IN3B 4GCNA 4K03A 4D10C 1Z3YA 4KBQA 3LS8A 4J6IA 2KATA 5G05C 5HI7A 5FJYA 4RG6A 2DBAA 3OXFA 3SZ7A 4CDRA 2WXKA 3MV3B 4Q69A 4XIFA 2V5FA 4EBAG 4F7AA 3ONKA 2VGYA 4GYWA 4PH4B 5FZSA 3CKCA 3KS2A 4B8CB 2CG2A 3FH7A 5JJ6A 2KCKA 1HG2A 3EJNA 4J8FA 4UQZA 3LYAA 4XKBA 3ZRHA 3CHPA 2WVIA 4WWOA 4GMJA 4UWHA 3R9AB 1E8XA 3MJWA 3ZPJA 3G2TA 1W3BA 3FUMA 3UPVA 4GB9A 5M72A 2WXHA 4I6GA 4I2ZA 1KT1A 2YINA 3ZHEB 1N52A 1QZ2A 1WAO1 3SBSA 4G24A 4Q94A 3HHMA 2IONA 4GPKA 3AS5A 2R17C 4XKCA 4DJAA 2C2LA 5ANLA 2WXNA 4ABNA 2KZTB 4R7LA 2VTBA 2C0MA 1UN9A 3MKRA 5JJ7A 4HS2A 3U3WA 2OOEA 4JPSA 3TGOA 4HOUA 3S2AA 1NZNA 4CDMA 4FADA 1P5QA 2E2EA 4A1SA 4DLQA 4GZ3A 2WB2A 2CFUA 4FHKA 2XGSA 1HO8A 5HQ8A 1NP7A 3B13A 3NZSA 2WQ6A 1FVHA 4O6FA 4AM9A 2WXMA 4FP7A 2CHWA 4NRHB 4U8HA 3FH5A 4L7TA 4ACLA 2KZTA 1SZAA 3URZA 3CVVA 2IJGX 2AXVA 4NQ0A 4JHJA 4C0EA 2J49A 3PNTB 1ELRA 5CMYA 3B7TA 1KLXA 2AW6A 2CFZA 2VQ2A 3I5PA 5FQ6A 4XI9A 4EZJA 3TXNA 3S7JA 4J8EA 1ELWA 3L08A 3BEEA 2MOWA 2J4DA 4KXKB 4I1AA 5ARGA 2XCCA 2PM6A 1H2TC 2WXGA 1E7UA 3B7SA 4FULA 2J07A 4IYPA 2GW1A 4RSYA 3FWVA 4OVVA 2XEVA 5AJDA 3JCKC 2XGMA 4BY6A 4YNDA 4MLPA 5DBKA 4I6EA 4N2QA 5G2NA 1E8YA 4QFVA 3RO3A 5FZRA 2OVFA 3FU0A 1OUVA 1TJFA 3L6AA 5AYWD 5T3RA 3CHRA 1GW6A 3B7RL 3QAQA 2KCLA 3BG1B 3G2VA 4N39A 4FJYA 4FLBA 3UT4A 1HH8A 3EHMA 4AY6A 4KVOA 3MCXA 3MEKA 3OXGA 4GA0A 2XPYA 3T5VA 1OWLA 4IULA 4A55A 1H2VC 4U07A 4CDNA 1NA3A 3D9PA 2A4ZA 2BF0X 1SZ9A 3LY9A 4WWPA 5EDSA 1VDYA 3BG0B 4WWNA 4CCAA 2ZU6B 1HS6A 1NA0A 5FZQA 3CHOA 2IOSA 2BTDA 3UT7A 4G11A 3IEGA 4XI0A 3TG4A 3FP3A 1OWOA 2X6JA 3HDXA 2I6HA 4PUCA 3AS8A 3LY8A 2YHCA 3Q49B 3UX4A 3FFLA 1E8ZA 2HO1A 3CSFA 3ENEA 4BT9A 2XHEA 2J4BA 3LCAA 5BT1A 1H2UA 2VGXB 1TJCA 2XCBA 4G26A 5FT9A 3Q4AB 2V4LA 4J0UA 2XGOA 5LCWJ 4EQFA 3PEVB 3QWWA 3TAXA 2WMNA 4YVQC 5EX0A 4A1GA 4JA7A 5A7DB 4ANVA 3ZGQA 4BTAA 4FC8A 2HM8A 2PQRA 2UWJG 2L6JA 2HYZA 4KZCA 3RKVA 4EBAA 2RG8A 3CVYA 3SGHA 5AIJA 3FU5A 3R7QA 4CRWA 3IKOB 2VTBB 2KM4A 3D9NA 2Y4TA 4LRZA 3O4ZA 1YA0A 3LXUX 4W9RA 2J08A 2E0IA 4MRUA 1WM5A 3RRUA 2LO6A 4E6HA 3LDZA 1A17A 3QNKA 2ONDA 3AS4A 3RJVA 3G2UA 5ARFA 3APCA 2I1JA 4L1BA 1H19A 4HOSA 3FUFA 3S7BA 5JHAA 4MS6A 3VLEA 3UMVA 5KJKA 2R5SA 4FU3A 4WNFA 5LCWC 3APFA 4UWLA 2LSVA 2PQNA 3CGHA 1HE8A 3MKQA 2LNIA 4WNGA 4Y6WA 4Q96A 2CHXA 4BTBA 1JUQA 4BT8A 3ONLA 4AP2A 3LVQE 2I1KA 3G2WA 3JQ0A 4N5CA 1EPUA 2L9BA 2X6FA 4GZ6A 1E8WA 4EZKA 1JWGA 4KYOB 3QKYA 2FO7A 2VSXE 4HVBA 3MX3A 4GZDA 4HOTA 3MKQB 4JVSA 1OWMA 2QFCA 3NQPA 3RO2A 3E4BA 4ILGA 4XE0A 4K0RA 3SFZA 4GYOA 4G2VA 3TJPA 2IU1A 4I43A 3ESKA 5KJLA 2WMOA 1HZ4A 2WXFA 3CK9A 2P58C 5E76A 3KAEA 3KEZA 2PL2A 3IHVA 4KZ0A 4CGVA 4J8DA 2X3MA 4AVXA 4P29A 3O48A 4I9EA 4TRQA 4PS3A 3FUHA 3PDNA 2V0PA 3SI5A 3T5XA 4CT0A 1OWNA 3CVPA 3CQGB 3APDA 1LF8A 5ANRA 2XPIA 4YVOA 4JHRA 2L0TB 4FLHA 3FEYA 3T8MA 4WUYA 3FUIA 2CG3A 1N54A 2YQ8A 3JQ1A 3MZLB 4IRUA 5D0OD 4LERA 3CKBA 1E96B 4ATGA 3FTWA 1U3DA 4OVUA 3GZ2A 3DPDA 3I4GA 4JXTA 3PNLB 4U0UA 5LP0A 2VSYA 1FVFA 2FULA 2KCVA 4I17A 4U0ZA 3FTSA 3CVXA 4H7XA 4UI9K 2KC7A 2VGXA 3CSTA 4JA9A 5FQ7A 4BWRA 3CV0A 3PEUB 3CVQA 5G04J 5BUZA 4L23A 3D3MA 4NURA 2WXLA 1UJKA 2IQCA 5BV1A 2VSNA 1QNFA 4TV3A 4HLEA 3EHNA 3D9IA 3VTYA 4B8AA 1JWFA 4ANWA 3PRZA 3OTNA 3NZUA 4UQYA 5KJNA 3U4TA 4I2WA 2VSOE 2R59A 4UI9J 5BPPA 3PREA 4JW1A 1IYGA 2YNQA 3DBSA 2VJ8A 4OYSA 3QK0A 3P2BA 3ML8A 5E75A 5KJMA 2J9QA 2EQXA 5A6CA 2L0IA 1Y6IA 3AU4A 2ILRA 4BSXA 4EPZA 1H0AA 4LCTA 3MV2B 4RG9A 3FEXA 4V3IA 1PY1A 5EX3A 1UW4B 3RU0A 3UQ3A 4A3TA 4JEUA 3RK6A 3N71A 3ASHA 5AJLA 1PAQA 3CEQA 2WQHA 1DNPA 3LJ3A 4ANUA 1Z6TA 3U64A 1TEZA 3ASFA 4UWFA 4N2SA 3L17A 1HG5A 4N3BA 4Y6CA 2NC9A 2UY1A 3KD7A 4F1SA 2VYIA 4GAAA 3S7DA 3SNXA 4BX8A 3MGBA 1XNFA 2WXQA 4APOA 5CMWA 2WQ7A 3PUJA 3ESLA 3Q47B 3RIBA 1U3CA 3RRNB 4BX9A 1E90A 4ME2A 4CEMA 3L22A 4J8SA 2X6KA 4TUUA 1XGWA 3CQCB 3FDHA 5EKQD 5KCMA 4G25A 3JUIA 3SF4A 4ACKA 5CCMA 3CVNA 2IF4A 2AXZA 1UJJA 1X5BA 3FU6A 3FTVA 5J08A 1UG3A 4B0ZA 4I9CA 3GW4A 2WXRA 5J90A 1Y8MA 3PE4A 3QB2A 3I4RB 3IBEA 3CLJA 1B89A 2CHZA 3CK7A 3D9KA 5G55A 4C0MA 5BV0A 1QQEA 4LEUA 5BW8C 2IOLA 5JJTA 5FQ8A 5G04C 3MYVA 2BUGA 1JPLA 2DCPA 3RRMB 1HFAA 3P1UA 4KMOA 2OVBA 3U9WA 3HVEB 3PH0C 4WAFA 1OWPA 3JYSA 4I6JA 5FQ4A 2WXIA 4GYYA 4XX5A 2V8SE 4B94A 3VLFA 1EDUA 3LY7A 4L2LA 4C9BB 2M63A 4FHJA 1HU3A 3FTYA 3K9IA 1IHGA 3D9OA 3Q15A 4UI9C 3TXMA 3CVUA 3D9MA 1L5JA 4FJZA 3SBTB 4GMLA 3FH8A 1ELKA 3PZDA 4N3AA 4JHKA 1E7VA 5D0QD 2WM9A 4WNDA 3HIZA 2PZIA 5JHBA 4URKA 3LPZA 3SD5A 1H6KA 2WXOA 3FU3A 4AIFA 1PC2A 2AVPA 2OV8A 2XQ0A 4GA2A 4H7YA 3ZHEA 4L2YA 3CHQA 3UUXA 2IFUA 3FTZA 2HR2A 4DK5A 4HORA 5C2YA 1EYHA 2AWIA 3Q5MA 4MKTA 4HFGA 1HF8A 4E85A 2WXJA 1BPOA 1S0PA 2FBNA 3AU5A 3FTUA 1WY6A 4U04A 2WXPA 4AV7A 4EZLA 3FUJA 2A5UA 3LVRE 4UWKA 3R7RA 3FULA 3GZSA 3PE3A 4G23A 3S7FA 4F53A 2FEZA 3GYZA 3L16A 4I1OB 2GRMA 3SHFA 4GA1A 3FUNA 4KT6B 3UT8A 1UN8A 3TL5A 4U63A 4HOQA 2Y4UA 3LEWA 4KVMA 3QDNA 2QY7A 1KT0A 3IHYA 4ILHB 4M3OA 4N3CA 3EIJA 5LFAA 4JEHA 2JLBA 4WNEA 3CR3A 3QOUA 1MHQA 1FCHA 3QJZA 2NXPA 3ZIMA 2XPZA 1IQRA 2Y3AA 2PM7A 4JL0A 4AY5A 3EIQC 1MQSA 3ZYLA 2FF4A 3QARA 3FHEA 3L54A 5T8IA 5LX8A 4AJWA 4GU5A 5G05J 3CHMA 2NSZA 3QC1A 2I2OA 3OXLA 2C0LA 3PUKA 3ULQA 2XRYA 2X6IA 3ZYKA 3IV0A 4GCOA 3TG5A 3HYMB 4G1TA 3D9LA 2LAIA 4DI3A 4PDXA 2DIWA 4GZCA 3HVEA 4A3VA 4CGWA 3ZYMA 4U0SA 4APFA 4AOFA 1SQMA 3CK8A 5ENNA 3CHSA 3CVWA 2XRZA 4DLOA 2LSUA 3B7UX 2MRIA 3ZVVA 4HXIA 3FUDA 1IQUA 2MHKA 3FUKA 1INZA 4BFRA 3U66A 3VTXA 3ZW3A 5CCLA 5DIZA 2Q7FA 4PS8A 3FTXA 2AXUA 1HX8A 2FI7A 3PS6A 5A23A 4UWGA 5AENA 4ANXA 2LAHA 3QWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KXK B;  3ASG A;  3GW4 A;  2XCC A;  4I1A A;  4I9C A;  5ARG A;  4HOT A;  1Y8M A;  3PE4 A;  3ASD A;  2QFC A;  3QWV A;  1ZU2 A;  3RO2 A;  2GW1 A;  1B89 A;  3CK7 A;  3E4B A;  3FWV A;  3LKU A;  4GYO A;  4G2V A;  4UQX A;  1QQE A;  1ZBP A;  2XEV A;  3ESK A;  5KJL A;  4LEU A;  1HZ4 A;  2XGM A;  3CK9 A;  4YND A;  2P58 C;  5BW8 C;  3EDT B;  3GZ1 A;  3MA5 A;  5DBK A;  5JJT A;  5G04 C;  4N2Q A;  3RO3 A;  2BUG A;  3CVL A;  3KAE A;  3WXX A;  2PL2 A;  5FZR A;  4CGV A;  4J8D A;  1OUV A;  1HXI A;  3O48 A;  5AYW D;  4I9E A;  5C1D A;  5FTP A;  3JYS A;  3PDN A;  2UY1 B;  2KCL A;  4GYY A;  3CVP A;  3ZFW A;  4B94 A;  4F3V A;  3LY7 A;  5BNW A;  2XPI A;  4N39 A;  4YVO A;  3ZN3 A;  2WPV A;  4JHR A;  3K9I A;  3Q15 A;  1IHG A;  4GZ5 A;  3NF1 A;  1HH8 A;  4UI9 C;  5CHE E;  4AY6 A;  3MEK A;  3OXG A;  4GA0 A;  4WUY A;  4IN3 B;  4GCN A;  2YQ8 A;  4N3A A;  4U07 A;  5D0Q D;  1NA3 A;  4KBQ A;  4WND A;  5D0O D;  5G05 C;  2KAT A;  5HI7 A;  2PZI A;  3CKB A;  5FJY A;  1E96 B;  3LY9 A;  2DBA A;  3OXF A;  4RG6 A;  3GZ2 A;  3SZ7 A;  4CDR A;  3LPZ A;  4AIF A;  1NA0 A;  1PC2 A;  2AVP A;  3MV3 B;  5FZQ A;  4GA2 A;  4H7Y A;  4U0U A;  4XIF A;  3ZHE A;  3UUX A;  2V5F A;  2VSY A;  2IFU A;  3IEG A;  2KCV A;  4I17 A;  4XI0 A;  2VGY A;  4GYW A;  4U0Z A;  2HR2 A;  3FP3 A;  3CKC A;  3KS2 A;  4H7X A;  2KC7 A;  4UI9 K;  2VGX A;  2I6H A;  5FZS A;  4HOR A;  5JJ6 A;  2KCK A;  3AS8 A;  3Q5M A;  4JA9 A;  3LY8 A;  4UQZ A;  4J8F A;  4BWR A;  2YHC A;  3CV0 A;  3LYA A;  3Q49 B;  3CVQ A;  2FBN A;  3FFL A;  2HO1 A;  5G04 J;  4BT9 A;  4U04 A;  3R9A B;  3LCA A;  5BT1 A;  3ZPJ A;  2VSN A;  3S7F A;  2VGX B;  3PE3 A;  4G23 A;  1W3B A;  3VTY A;  1TJC A;  2XCB A;  4G26 A;  2FEZ A;  3GYZ A;  5FT9 A;  3Q4A B;  5M72 A;  4J0U A;  4GA1 A;  4I2Z A;  2XGO A;  5LCW J;  4EQF A;  1KT1 A;  4HOQ A;  3ZHE B;  2Y4U A;  4UQY A;  5KJN A;  3QWW A;  3TAX A;  3U4T A;  4I2W A;  1QZ2 A;  3QDN A;  1WAO 1;  1KT0 A;  4G24 A;  4N3C A;  4UI9 J;  4YVQ C;  5EX0 A;  1IYG A;  4JA7 A;  4WNE A;  2JLB A;  5A7D B;  3ZGQ A;  3AS5 A;  3QOU A;  4GPK A;  1FCH A;  4BTA A;  5KJM A;  2C2L A;  2UWJ G;  2J9Q A;  2L6J A;  2HYZ A;  2PQR A;  3RKV A;  4ABN A;  3UPV A;  5A6C A;  4JL0 A;  4AY5 A;  2C0M A;  5JJ7 A;  3MKR A;  2FF4 A;  3MV2 B;  4RG9 A;  3U3W A;  2OOE A;  3TGO A;  4HOU A;  5EX3 A;  1NZN A;  4W9R A;  3RU0 A;  2Y4T A;  1P5Q A;  5G05 J;  1YA0 A;  2E2E A;  3UQ3 A;  4A1S A;  3N71 A;  4GZ3 A;  3ASH A;  3TG4 A;  3CEQ A;  3OXL A;  2C0L A;  2WQH A;  2XGS A;  3ULQ A;  1WM5 A;  3ASF A;  4GCO A;  3TG5 A;  1A17 A;  5HQ8 A;  4N2S A;  3HYM B;  2OND A;  4G1T A;  3AS4 A;  4O6F A;  3RJV A;  4N3B A;  5ARF A;  4Y6C A;  2NC9 A;  2UY1 A;  4AM9 A;  3KD7 A;  4HOS A;  4NRH B;  3S7B A;  2VYI A;  3S7D A;  4CGW A;  4U0S A;  3URZ A;  5KJK A;  2R5S A;  5LCW C;  4WNF A;  3CK8 A;  1XNF A;  4APO A;  4NQ0 A;  2LSV A;  2PQN A;  3Q47 B;  3RIB A;  2LSU A;  2LNI A;  4WNG A;  1ELR A;  4Y6W A;  1KLX A;  2MHK A;  4BTB A;  4BT8 A;  4ME2 A;  2VQ2 A;  3VTX A;  4N5C A;  4XI9 A;  5CCL A;  4GZ6 A;  5DIZ A;  5EKQ D;  4G25 A;  3S7J A;  2Q7F A;  3SF4 A;  4J8E A;  5CCM A;  1ELW A;  3CVN A;  2IF4 A;  4KYO B;  3BEE A;  3QKY A;  2FI7 A;  2FO7 A;  3QWP A; 
#chains in the Genus database with same CATH topology
 5ENO D;  3ASG A;  2J09 A;  5LOZ A;  4BET A;  1ZBP A;  4LNB A;  3CVL A;  3CIA A;  3V30 A;  5C1D A;  3FY4 A;  1K1A A;  2X38 A;  3OAW A;  5EYL A;  4DI4 A;  4F3V A;  2RD0 A;  4B89 A;  3ZN3 A;  2DYS E;  2I9C A;  3I3N A;  3PVL A;  4GCN A;  1Z3Y A;  4KBQ A;  4TXR A;  4EBA G;  4F7A A;  2VGY A;  5JJ6 A;  4UQZ A;  4WWO A;  2XS1 A;  1E8X A;  3G2T A;  1W3B A;  5EYP F;  2WXH A;  1KT1 A;  3ZHE B;  5HRY A;  4HLL A;  2ION A;  4XKC A;  4R7L A;  5EID A;  2VTB A;  3MKR A;  3U3W A;  2MYO A;  4JPS A;  4HOU A;  2L6B A;  3S2A A;  3UM3 A;  5IY5 E;  1P5Q A;  2E2E A;  2CFU A;  4FHK A;  2XGS A;  2F8Y A;  4GTV A;  3B13 A;  1FVH A;  4AM9 A;  2QYJ A;  2CHW A;  2OEV A;  3URZ A;  3CVV A;  3DEP A;  4JHJ A;  4C0E A;  4QQI A;  4GPM A;  4K5A B;  4XI9 A;  3TXN A;  3NOC D;  3S7J A;  5KNG A;  4KXK B;  2PM6 A;  4RSY A;  4YDW A;  3JCK C;  5AJD A;  1MX2 A;  4I6E A;  3FU0 A;  1TJF A;  3L6A A;  3B7R L;  1K1B A;  3G2V A;  5ITZ F;  4FJY A;  2P9S G;  2IO3 C;  4JB8 P;  1SW6 A;  1SZ9 A;  5EDS A;  4WWP A;  3BG0 B;  4WWN A;  4CCA A;  1O1T A;  4A63 B;  5HS0 A;  3FP3 A;  3B95 A;  1YMP A;  2YHC A;  3Q49 B;  2H6I A;  4K5C A;  3UX4 A;  1E8Z A;  4BT9 A;  5BT1 A;  2ZIR A;  3J5P A;  4G26 A;  5LCW J;  1BLX B;  2L6J A;  3L9T A;  4F1P A;  3IKO B;  3D9H A;  4GTM A;  3PZ1 A;  3ULE G;  2XEN A;  3RRU A;  2LO6 A;  3LDZ A;  3QNK A;  3DSV A;  5ARF A;  1H19 A;  5JHA A;  3VLE A;  3UMV A;  5LCW C;  2LSV A;  2PQN A;  3MKQ A;  2LNI A;  4WNG A;  4Y6W A;  4Q96 A;  4U7E B;  2L9B A;  4HVB A;  2PNN A;  3T8K A;  4U95 D;  3UM0 A;  3NQP A;  3RO2 A;  4ILG A;  3ESK A;  2WXF A;  1O1R A;  1OCR E;  3KEZ A;  2X3M A;  3O48 A;  4PS3 A;  4CT0 A;  1OWN A;  3CVP A;  3CQG B;  1LF8 A;  1OCZ E;  5ANR A;  2XPI A;  4C48 B;  4JHR A;  2LXL A;  3Q78 A;  3FEY A;  3SY2 A;  3FUI A;  1N54 A;  3MZL B;  1E96 B;  3I4G A;  5B1A E;  5LP0 A;  2VGX A;  3CST A;  4L23 A;  2RFA A;  2ZGD A;  3DST A;  4B8A A;  4ANW A;  1FT1 A;  5KJN A;  2GRO B;  3AJI A;  3EHR A;  3ML8 A;  4N5Q A;  2J9Q A;  3NBN B;  3F6Q A;  4LCT A;  3UTM A;  3MV2 B;  3V79 K;  4A3T A;  4U8Y D;  3ASH A;  1PAQ A;  3AG2 E;  3ZNG A;  2WQH A;  3LJ3 A;  3HXD A;  1FT2 A;  4U96 D;  4GAA A;  3C3Q A;  2P2C P;  2WXQ A;  4APO A;  3ULY A;  3RIB A;  4BX9 A;  4GTP A;  1E90 A;  3L22 A;  1N94 A;  2X6K A;  1XGW A;  2P9N G;  3JUI A;  3SF4 A;  3CVN A;  3FTV A;  5J08 A;  1UG3 A;  2QYU A;  3GW4 A;  3QB2 A;  5BW8 C;  2IOL A;  5FQ8 A;  3U9W A;  4I6J A;  4GYY A;  3LY7 A;  1G3N B;  4FHJ A;  1IHG A;  3D9O A;  3D9M A;  3SBT B;  3SQV A;  4JHK A;  2H6G A;  2WM9 A;  4AIF A;  1H6K A;  3FU3 A;  4F6R D;  4H7Y A;  3TWS A;  1D8E A;  1Z5S C;  2HR2 A;  4DK5 A;  4HOR A;  2XS8 A;  4E85 A;  1S0P A;  2FBN A;  4U04 A;  2WXP A;  4AV7 A;  3R7R A;  3S7F A;  1TNU A;  4I1O B;  3TL5 A;  1DC2 A;  5BXU A;  2P9P G;  4WNE A;  4GTO A;  3QOU A;  1MHQ A;  1FCH A;  3QJZ A;  3HXE A;  1MQS A;  4AJW A;  2NSZ A;  3AAA C;  3R9M A;  3AG1 E;  4G1T A;  3D9L A;  2LAI A;  4PDX A;  2DIW A;  3HVE A;  4APF A;  4U0S A;  4AOF A;  2GRN B;  2LSU A;  3ZVV A;  1IQU A;  1INZ A;  3Q7A A;  3U66 A;  4PS8 A;  3FTX A;  3Q7F A;  2AXU A;  5A23 A;  1V55 E;  4HRM B;  3QWV A;  4EEC A;  3LKU A;  4ILI A;  3EDT B;  3MA5 A;  1Z3X A;  4JZY A;  1TN8 A;  3ZXS A;  3G2S A;  1EF1 C;  5B1B E;  4CT4 A;  4RVB A;  5FWQ A;  5CRU A;  5BNW A;  2WPV A;  4LUN U;  2F8X K;  3C5R A;  4K03 A;  1OT8 A;  4J6I A;  5FJY A;  1TNY A;  1KPS B;  3SZ7 A;  4EHM A;  2WXK A;  3MV3 B;  3DEO A;  2V5F A;  1MJ0 A;  3ZUV B;  1N4R A;  1HG2 A;  3R9A B;  1TN6 A;  3UPV A;  5CRV A;  4GB9 A;  3HRA A;  4I2Z A;  2YIN A;  5H7P A;  3SBS A;  4Q94 A;  3HHM A;  4GPK A;  2R17 C;  4MBG A;  5ANL A;  3UKU G;  1LTX A;  4ABN A;  1UN9 A;  4HS2 A;  3TGO A;  4DLQ A;  1DCQ A;  2ZXW E;  2NYJ A;  1IXV A;  2WQ6 A;  1SVX A;  4NRH B;  3FH5 A;  2KZT A;  1SZA A;  1N0Q A;  1JCQ A;  3TWW A;  2DZN A;  1KLX A;  4HRL A;  3DXK G;  5FQ6 A;  2GRP B;  2MOW A;  1WDY A;  2J4D A;  5ARG A;  2XCC A;  1H2T C;  3B7S A;  4FUL A;  2GW1 A;  3FWV A;  4HBD A;  1OCO E;  1RZ4 A;  2XEV A;  2XGM A;  5G2N A;  1E8Y A;  2OVF A;  1OUV A;  5BXO A;  2KCL A;  3J5Q B;  4N39 A;  5KBA A;  4OAV B;  3MEK A;  4GA0 A;  3T5V A;  4A55 A;  3D9P A;  2BF0 X;  1VDY A;  4U8V D;  3ABM E;  1NA0 A;  3CHO A;  2IOS A;  2BTD A;  3IEG A;  4XI0 A;  1OWO A;  4PUC A;  3AS8 A;  3LY8 A;  4LSZ E;  3CSF A;  4TXQ A;  4UUC A;  2VGX B;  3JXI A;  3C72 A;  2XCB A;  4J0U A;  2XGO A;  4EQF A;  3PEV B;  4A1G A;  4JA7 A;  3ZGQ A;  1N4P A;  4KZC A;  4EBA A;  3UM1 A;  3CVY A;  3AG3 E;  4HRN A;  4TUM A;  3O4Z A;  4XEI G;  2J08 A;  1A17 A;  2I1J A;  5KWD A;  1N4Q A;  3CGH A;  2CHX A;  4BTB A;  2I1K A;  4N5C A;  1EPU A;  2X6F A;  4GZ6 A;  3WG7 E;  1IHB A;  1K3Z D;  2ETA A;  3MX3 A;  4BES A;  1N9A A;  3MKQ B;  2QFC A;  3E30 A;  3SFZ A;  4G2V A;  5KJL A;  2P58 C;  4J8D A;  4I9E A;  4TRQ A;  3FUH A;  3IXE A;  3PDN A;  2V0P A;  3SI5 A;  3KSL A;  3BU8 A;  3T8M A;  1OCC E;  3JQ1 A;  5D0O D;  2BKG A;  4LER A;  3CKB A;  3GZ2 A;  3Q9N C;  1N0R A;  2FUL A;  4U0Z A;  3FTS A;  3CVX A;  4H7X A;  2KC7 A;  4JA9 A;  4BWR A;  3CV0 A;  3PEU B;  5G04 J;  3D3M A;  4NUR A;  5BV1 A;  4HLE A;  3SFX A;  3OTN A;  3U4T A;  4I2W A;  2R59 A;  5BPP A;  1IYG A;  4OYS A;  3QK0 A;  3P2B A;  5KJM A;  3Q79 A;  1TNB A;  2L0I A;  3AU4 A;  4BSX A;  3FEX A;  1UW4 B;  4JEU A;  3RK6 A;  5AJL A;  1DNP A;  1Z6T A;  3ASF A;  4HI9 A;  4N2S A;  1O1S A;  4Y6C A;  2UY1 A;  1SA4 A;  3Q47 B;  4J7W A;  1U3C A;  3RRN B;  3X2Q E;  5ENS D;  4CEM A;  4TUU A;  5KCM A;  3HXF A;  4ACK A;  2IF4 A;  3EU9 A;  3ZKJ A;  5J90 A;  3PE4 A;  3V31 A;  2XEE A;  3IBE A;  3CK7 A;  1B89 A;  2ZGG A;  3C3R A;  4LEU A;  3MYV A;  2BUG A;  2DCP A;  1HFA A;  3P1U A;  2H6H A;  4KMO A;  4WAF A;  1OWP A;  3JYS A;  4HNA D;  4XX5 A;  1H6O A;  1HU3 A;  3CVU A;  4UI9 C;  4GML A;  1QBQ A;  3E37 A;  1ELK A;  3PZD A;  1E7V A;  4GTT A;  5D0Q D;  3HIZ A;  2PZI A;  5JHB A;  2EIJ E;  3LPZ A;  4EZJ A;  3ZHE A;  4L2Y A;  3UUX A;  1BI7 B;  4MKT A;  5AAR A;  1TNO A;  1WY6 A;  3GZS A;  5AAO A;  1DCE A;  4F53 A;  3L16 A;  3SHF A;  2GRM A;  4GA1 A;  3FUN A;  4KT6 B;  3UT8 A;  1TNZ A;  4U63 A;  4NIK A;  3LEW A;  1KT0 A;  4ILH B;  4JEH A;  3ZIM A;  1TN7 A;  4JL0 A;  2P9L G;  2J8S D;  3Q9U C;  5LX8 A;  2P9I G;  4OAU C;  2C0L A;  3PUK A;  3UIP C;  2DZO A;  2XRY A;  3ZYK A;  4DX7 D;  2GRR B;  4GZC A;  3BQO A;  4CGW A;  3C3O A;  1X81 A;  5ENN A;  3BUA A;  3UKR G;  4HXI A;  3FUD A;  3FUK A;  3VTX A;  2KBX A;  3ABK E;  1IKN D;  5KNH D;  5D2M C;  4ANU A;  2LAH A;  3QWP A;  2GRL A;  3VLD A;  1S63 A;  1ZU2 A;  4AEZ C;  4JC8 A;  4DPR A;  2JEK A;  5T4Y A;  5FTP A;  2UY1 B;  3D9J A;  3ZFW A;  5D66 A;  1DVP A;  3ZYQ A;  4GZ5 A;  3E32 A;  3W9G A;  4D10 C;  3LS8 A;  5G05 C;  3OXF A;  4LNG A;  3ONK A;  4GYW A;  3KS2 A;  3T9K A;  2CG2 A;  3FH7 A;  3ZRH A;  3CHP A;  2WVI A;  4UWH A;  1QYM A;  4TXP A;  5M72 A;  1WAO 1;  4G24 A;  3PZ2 A;  4DJA A;  2C2L A;  2KZT B;  5EIL A;  2C0M A;  4FAD A;  1ZB1 A;  4A1S A;  2WB2 A;  2XEH A;  3V2O A;  5HQ8 A;  1NP7 A;  2WXM A;  4FP7 A;  4ACL A;  3DSS A;  2AXV A;  5CER B;  5CBO A;  2J49 A;  5CMY A;  4B93 B;  2AW6 A;  2CFZ A;  3TWR A;  4IYP A;  4RQI A;  3AG4 E;  3JUE A;  4BY6 A;  4YND A;  5DBK A;  4N2Q A;  3RO3 A;  3Q73 A;  5FZR A;  5B3S E;  5AYW D;  1OY3 D;  5T3R A;  3CHR A;  1AWC B;  3QAQ A;  4FLB A;  4X8Q A;  1HH8 A;  3EHM A;  4HI8 A;  3OXG A;  3ZXP A;  1H2V C;  4CDN A;  1NA3 A;  2A4Z A;  3LY9 A;  1HS6 A;  4L9P A;  2ETB A;  5FZQ A;  3UT7 A;  3UI2 A;  2XZD G;  3TG4 A;  2X6J A;  3HDX A;  2I6H A;  2XHE A;  2J4B A;  3LCA A;  1H2U A;  3Q4A B;  2V4L A;  1JCS A;  3QWW A;  2WMN A;  4YVQ C;  5EX0 A;  5A7D B;  4ANV A;  4BTA A;  4FC8 A;  2PQR A;  3RKV A;  2HYZ A;  2RG8 A;  3B7B A;  3FU5 A;  4CRW A;  2VTB B;  3UXG A;  3D9N A;  2Y4T A;  1YA0 A;  4HB5 A;  1N4S A;  2OND A;  3RJV A;  3ASN E;  1Q2Z A;  4HOS A;  3FUF A;  4FU3 A;  4WNF A;  1WG0 A;  1UOH A;  4CYM D;  1JUQ A;  4BT8 A;  3G2W A;  3JQ0 A;  3V2X A;  4DRX E;  1E8W A;  4EZK A;  1JWG A;  4KYO B;  2F37 A;  2FO7 A;  2VSX E;  1JCR A;  4GZD A;  4DUI A;  1OWM A;  4K0R A;  4GYO A;  3TJP A;  2WMO A;  1HZ4 A;  3SO8 A;  2PL2 A;  4AVX A;  3T5X A;  3APD A;  4YVO A;  2L0T B;  4FLH A;  4WUY A;  2YQ8 A;  4IRU A;  4ATG A;  1U3D A;  3DPD A;  4JXT A;  3UIO C;  3PNL B;  2VSY A;  1FVF A;  2KCV A;  4I17 A;  4UI9 K;  5CEC B;  1TR4 A;  4O1O A;  3CVQ A;  3RAU A;  5JMN D;  3VTY A;  1JWF A;  5ENT D;  3PRZ A;  4UI9 J;  4BSZ B;  2YNQ A;  2VJ8 A;  2BKK B;  2LUH A;  5E75 A;  2V4H C;  5A6C A;  4O60 A;  3DSW A;  4EPZ A;  1TYQ G;  5AQB A;  3JXJ A;  3RU0 A;  5EX3 A;  3UQ3 A;  3N71 A;  3CEQ A;  3L82 A;  3ZU7 B;  1TEZ A;  1HG5 A;  4N3B A;  2R02 A;  3KD7 A;  3SNX A;  4ZFH A;  4BX8 A;  1XNF A;  2RKK A;  2WQ7 A;  3PUJ A;  2P9U G;  4ME2 A;  3FDH A;  4JD2 G;  5CCM A;  4DX1 A;  2AXZ A;  1UJJ A;  4B0Z A;  1H6P A;  3EUV A;  4I9C A;  2WXR A;  2RFM A;  1Y8M A;  5G55 A;  3D9K A;  4C0M A;  5BV0 A;  1LD7 A;  2JAB A;  2LXM A;  4G8K A;  5JJT A;  2VGE A;  1JPL A;  4RLY A;  3HVE B;  1NI1 A;  5FQ4 A;  2V8S E;  4B94 A;  3VLF A;  2OEW A;  3K9I A;  3Q15 A;  1YYH A;  2A5E A;  4FJZ A;  3FH8 A;  3EHQ A;  3LJN A;  1KZO A;  3NAW A;  2WXO A;  2AVP A;  4GA2 A;  4Z68 A;  5C2Y A;  3E33 A;  1EYH A;  4HFG A;  1HF8 A;  2WXJ A;  1BPO A;  3TWU A;  3FTU A;  4EZL A;  1BU9 A;  4DX2 A;  2KXP C;  2A5U A;  4G23 A;  1UN8 A;  2R03 A;  3KEA A;  3QDN A;  3IHY A;  4N3C A;  3EIJ A;  2JLB A;  2Y69 E;  5ENQ D;  2NXP A;  5ENR D;  2XPZ A;  1IQR A;  3EIQ C;  3FHE A;  3L54 A;  4YDO A;  3CHM A;  2I2O A;  3OXL A;  2X6I A;  4GCO A;  3HYM B;  1D9S A;  4DI3 A;  3NB2 A;  4A3V A;  5FIN A;  1SQM A;  3DSX A;  2XRZ A;  4DLO A;  3B7U X;  3ABL E;  2B0O E;  4BFR A;  2EIN E;  3ZW3 A;  3TWT A;  2ETC A;  5CCL A;  2Q7F A;  1HX8 A;  3PS6 A;  3Q75 A;  4UWG A;  5AEN A;  4M7C A;  4URK A;  2B6C A;  3C98 A;  4I1M A;  4FA6 A;  3ASD A;  5AQ7 A;  3ML9 A;  1V54 E;  4UQX A;  3L13 A;  2X6H A;  3GZ1 A;  4PS7 A;  2GGF A;  3ZEF A;  3WXX A;  4GTQ A;  1HXI A;  2DWZ A;  2YHE A;  5AQ9 A;  2HE0 A;  1D8D A;  3DWL G;  4NAC A;  3FUE A;  4XZ4 A;  5CHE E;  3NF1 A;  4AXH A;  4IN3 B;  5HI7 A;  2KAT A;  2BED A;  2Y1L E;  4RG6 A;  2DBA A;  4CDR A;  5HKP A;  2FO1 E;  4Q69 A;  4XIF A;  4PH4 B;  5FZS A;  3CKC A;  4B8C B;  2KCK A;  3EJN A;  4J8F A;  3LYA A;  4XKB A;  1RW2 A;  2R05 A;  3DSU A;  4GMJ A;  3MJW A;  3ZPJ A;  3FUM A;  4I6G A;  1N52 A;  1QZ2 A;  1FPP A;  4G8L A;  3AS5 A;  2AJA A;  2WXN A;  3HXB A;  5JJ7 A;  2OOE A;  4CDM A;  1NZN A;  4GZ3 A;  1HO8 A;  4O1P A;  3NZS A;  4O6F A;  4U8H A;  4L7T A;  4ZHB A;  2IJG X;  4NQ0 A;  5FIO A;  3PNT B;  1ELR A;  3B7T A;  2VQ2 A;  3I5P A;  5CEA A;  1BD8 A;  4J8E A;  1ELW A;  3L08 A;  3BEE A;  2XZT G;  4I1A A;  2WXG A;  3PZ4 A;  1E7U A;  2ZIS A;  2J07 A;  4OVV A;  2QZA A;  4MLP A;  4QFV A;  1A5E A;  2Y0B G;  1GW6 A;  3PZ3 A;  3BG1 B;  3UT4 A;  4AY6 A;  4KVO A;  3MCX A;  3DPY A;  2XPY A;  1OWL A;  4IUL A;  4U07 A;  5CBN A;  2R2L A;  2ZU6 B;  5EN5 D;  4G11 A;  3TWV A;  3HG0 D;  3DXM G;  3FFL A;  2HO1 A;  3ENE A;  3RSE G;  1MZC A;  1TJC A;  5FT9 A;  3TAX A;  1U2V G;  2HM8 A;  2UWJ G;  1MX4 A;  3SGH A;  5AIJ A;  3R7Q A;  4W9R A;  2KM4 A;  4LRZ A;  2H6F A;  3LXU X;  2E0I A;  4MRU A;  1WM5 A;  4E6H A;  3UM2 A;  4CZ2 D;  3AS4 A;  3G2U A;  3APC A;  3EU5 A;  4L1B A;  3S7B A;  3KSQ A;  4MS6 A;  5KJK A;  2R5S A;  3APF A;  4UWL A;  1HE8 A;  1NFI E;  3ONL A;  4AP2 A;  3LVQ E;  1O5M A;  3QKY A;  3HXC A;  4LG6 A;  3UIN C;  4HOT A;  4JVS A;  2IEJ A;  3E4B A;  4XE0 A;  2IU1 A;  4I43 A;  3CK9 A;  2DVW A;  5E76 A;  3KAE A;  3IHV A;  4KZ0 A;  4ATZ D;  4CGV A;  4P29 A;  4DX6 D;  3W9F A;  2CG3 A;  1NL4 A;  5AQA A;  3FTW A;  4OVU A;  1LD8 A;  4J8Y A;  4U0U A;  4DX5 D;  2F0Y A;  4GTR A;  4YDE A;  5FQ7 A;  5BUZ A;  2WXL A;  1N95 A;  1UJK A;  2IQC A;  2VSN A;  1QNF A;  4TV3 A;  3EHN A;  3D9I A;  5JA4 D;  4BER A;  3NZU A;  4UQY A;  1BI8 B;  1KZP A;  2VSO E;  3PRE A;  4JW1 A;  2GRQ B;  3DBS A;  2EQX A;  1Y6I A;  2ILR A;  1H0A A;  2EIM E;  2EIL E;  3E34 A;  4RG9 A;  4V3I A;  4YDY A;  1PY1 A;  3U64 A;  4UWF A;  3L17 A;  2NC9 A;  4F1S A;  2VYI A;  3S7D A;  3MGB A;  5CMW A;  3ESL A;  1SA5 A;  3ASO E;  4J8S A;  3NOG D;  3TWQ A;  3CQC B;  5EKQ D;  1N11 A;  4G25 A;  1YCS B;  1X5B A;  3FU6 A;  1OXJ A;  1S64 A;  3I4R B;  3ISM C;  3CLJ A;  2CHZ A;  1QQE A;  5AN8 A;  5G04 C;  4HQD A;  3RRM B;  2OVB A;  3TWX A;  3PH0 C;  2WXI A;  1MYO A;  1EDU A;  5ENP D;  4L2L A;  4C9B B;  2M63 A;  3FTY A;  3TXM A;  4BEP A;  1L5J A;  4N3A A;  4WND A;  3SD5 A;  1PC2 A;  2XQ0 A;  2OV8 A;  3CHQ A;  4GTS A;  2IY0 C;  2IFU A;  3FTZ A;  2AWI A;  3Q5M A;  3AU5 A;  3DRA A;  3FUJ A;  3LVR E;  4UWK A;  3FUL A;  3PE3 A;  2FEZ A;  3GYZ A;  5EIB E;  4HOQ A;  2Y4U A;  4KVM A;  1S70 B;  2QY7 A;  4M3O A;  3SFY A;  5LFA A;  3CR3 A;  1MX6 A;  2Y3A A;  2PM7 A;  2P9K G;  4AY5 A;  3ZYL A;  2FF4 A;  3QAR A;  5T8I A;  4GU5 A;  5G05 J;  2OCC E;  3QC1 A;  5CED B;  3ULQ A;  3IV0 A;  3TG5 A;  1K8K G;  4GMR A;  2EIK E;  3ZYM A;  4K5B A;  3CK8 A;  3CHS A;  2DYR E;  3CVW A;  2MRI A;  2MHK A;  2QC9 A;  5DIZ A;  2IO2 C;  1AP7 A;  4LNU D;  2FI7 A;  2V5Q C;  4ANX A; 
#chains in the Genus database with same CATH homology
 2GRL A;  3ASG A;  3C98 A;  3VLD A;  4I1M A;  2J09 A;  4FA6 A;  3ASD A;  3QWV A;  1ZU2 A;  3ML9 A;  4EEC A;  4AEZ C;  3LKU A;  4ILI A;  5LOZ A;  4JC8 A;  4UQX A;  1ZBP A;  3L13 A;  4DPR A;  2X6H A;  3EDT B;  3GZ1 A;  3MA5 A;  4PS7 A;  2GGF A;  1Z3X A;  3WXX A;  3CVL A;  3ZEF A;  3CIA A;  4JZY A;  2JEK A;  1HXI A;  5T4Y A;  2YHE A;  5C1D A;  5FTP A;  3ZXS A;  2UY1 B;  3D9J A;  3G2S A;  1EF1 C;  3FY4 A;  2X38 A;  3OAW A;  4RVB A;  5FWQ A;  1DVP A;  3ZFW A;  4CT4 A;  4DI4 A;  2RD0 A;  3ZYQ A;  4B89 A;  4F3V A;  5BNW A;  4NAC A;  3ZN3 A;  2WPV A;  3FUE A;  4GZ5 A;  4LUN U;  5CHE E;  4XZ4 A;  3NF1 A;  2I9C A;  4AXH A;  3I3N A;  3PVL A;  4IN3 B;  4GCN A;  4K03 A;  4D10 C;  1Z3Y A;  4KBQ A;  3LS8 A;  4J6I A;  2KAT A;  5G05 C;  5HI7 A;  5FJY A;  4RG6 A;  2DBA A;  3OXF A;  3SZ7 A;  4CDR A;  2WXK A;  3MV3 B;  4Q69 A;  4XIF A;  2V5F A;  4EBA G;  4F7A A;  3ONK A;  2VGY A;  4GYW A;  4PH4 B;  5FZS A;  3CKC A;  3KS2 A;  4B8C B;  2CG2 A;  3FH7 A;  5JJ6 A;  2KCK A;  1HG2 A;  3EJN A;  4J8F A;  4UQZ A;  3LYA A;  4XKB A;  3ZRH A;  3CHP A;  2WVI A;  4WWO A;  4GMJ A;  4UWH A;  3R9A B;  1E8X A;  3MJW A;  3ZPJ A;  3G2T A;  1W3B A;  3FUM A;  3UPV A;  4GB9 A;  5M72 A;  2WXH A;  4I6G A;  4I2Z A;  1KT1 A;  2YIN A;  3ZHE B;  1N52 A;  1QZ2 A;  1WAO 1;  3SBS A;  4G24 A;  4Q94 A;  3HHM A;  2ION A;  4GPK A;  3AS5 A;  2R17 C;  4XKC A;  4DJA A;  2C2L A;  5ANL A;  2WXN A;  4ABN A;  2KZT B;  4R7L A;  2VTB A;  2C0M A;  1UN9 A;  3MKR A;  5JJ7 A;  4HS2 A;  3U3W A;  2OOE A;  4JPS A;  3TGO A;  4HOU A;  3S2A A;  1NZN A;  4CDM A;  4FAD A;  1P5Q A;  2E2E A;  4A1S A;  4DLQ A;  4GZ3 A;  2WB2 A;  2CFU A;  4FHK A;  2XGS A;  1HO8 A;  5HQ8 A;  1NP7 A;  3B13 A;  3NZS A;  2WQ6 A;  1FVH A;  4O6F A;  4AM9 A;  2WXM A;  4FP7 A;  2CHW A;  4NRH B;  4U8H A;  3FH5 A;  4L7T A;  4ACL A;  2KZT A;  1SZA A;  3URZ A;  3CVV A;  2IJG X;  2AXV A;  4NQ0 A;  4JHJ A;  4C0E A;  2J49 A;  3PNT B;  1ELR A;  5CMY A;  3B7T A;  1KLX A;  2AW6 A;  2CFZ A;  2VQ2 A;  3I5P A;  5FQ6 A;  4XI9 A;  4EZJ A;  3TXN A;  3S7J A;  4J8E A;  1ELW A;  3L08 A;  3BEE A;  2MOW A;  2J4D A;  4KXK B;  4I1A A;  5ARG A;  2XCC A;  2PM6 A;  1H2T C;  2WXG A;  1E7U A;  3B7S A;  4FUL A;  2J07 A;  4IYP A;  2GW1 A;  4RSY A;  3FWV A;  4OVV A;  2XEV A;  5AJD A;  3JCK C;  2XGM A;  4BY6 A;  4YND A;  4MLP A;  5DBK A;  4I6E A;  4N2Q A;  5G2N A;  1E8Y A;  4QFV A;  3RO3 A;  5FZR A;  2OVF A;  3FU0 A;  1OUV A;  1TJF A;  3L6A A;  5AYW D;  5T3R A;  3CHR A;  1GW6 A;  3B7R L;  3QAQ A;  2KCL A;  3BG1 B;  3G2V A;  4N39 A;  4FJY A;  4FLB A;  3UT4 A;  1HH8 A;  3EHM A;  4AY6 A;  4KVO A;  3MCX A;  3MEK A;  3OXG A;  4GA0 A;  2XPY A;  3T5V A;  1OWL A;  4IUL A;  4A55 A;  1H2V C;  4U07 A;  4CDN A;  1NA3 A;  3D9P A;  2A4Z A;  2BF0 X;  1SZ9 A;  3LY9 A;  4WWP A;  5EDS A;  1VDY A;  3BG0 B;  4WWN A;  4CCA A;  2ZU6 B;  1HS6 A;  1NA0 A;  5FZQ A;  3CHO A;  2IOS A;  2BTD A;  3UT7 A;  4G11 A;  3IEG A;  4XI0 A;  3TG4 A;  3FP3 A;  1OWO A;  2X6J A;  3HDX A;  2I6H A;  4PUC A;  3AS8 A;  3LY8 A;  2YHC A;  3Q49 B;  3UX4 A;  3FFL A;  1E8Z A;  2HO1 A;  3CSF A;  3ENE A;  4BT9 A;  2XHE A;  2J4B A;  3LCA A;  5BT1 A;  1H2U A;  2VGX B;  1TJC A;  2XCB A;  4G26 A;  5FT9 A;  3Q4A B;  2V4L A;  4J0U A;  2XGO A;  5LCW J;  4EQF A;  3PEV B;  3QWW A;  3TAX A;  2WMN A;  4YVQ C;  5EX0 A;  4A1G A;  4JA7 A;  5A7D B;  4ANV A;  3ZGQ A;  4BTA A;  4FC8 A;  2HM8 A;  2PQR A;  2UWJ G;  2L6J A;  2HYZ A;  4KZC A;  3RKV A;  4EBA A;  2RG8 A;  3CVY A;  3SGH A;  5AIJ A;  3FU5 A;  3R7Q A;  4CRW A;  3IKO B;  2VTB B;  2KM4 A;  3D9N A;  2Y4T A;  4LRZ A;  3O4Z A;  1YA0 A;  3LXU X;  4W9R A;  2J08 A;  2E0I A;  4MRU A;  1WM5 A;  3RRU A;  2LO6 A;  4E6H A;  3LDZ A;  1A17 A;  3QNK A;  2OND A;  3AS4 A;  3RJV A;  3G2U A;  5ARF A;  3APC A;  2I1J A;  4L1B A;  1H19 A;  4HOS A;  3FUF A;  3S7B A;  5JHA A;  4MS6 A;  3VLE A;  3UMV A;  5KJK A;  2R5S A;  4FU3 A;  4WNF A;  5LCW C;  3APF A;  4UWL A;  2LSV A;  2PQN A;  3CGH A;  1HE8 A;  3MKQ A;  2LNI A;  4WNG A;  4Y6W A;  4Q96 A;  2CHX A;  4BTB A;  1JUQ A;  4BT8 A;  3ONL A;  4AP2 A;  3LVQ E;  2I1K A;  3G2W A;  3JQ0 A;  4N5C A;  1EPU A;  2L9B A;  2X6F A;  4GZ6 A;  1E8W A;  4EZK A;  1JWG A;  4KYO B;  3QKY A;  2FO7 A;  2VSX E;  4HVB A;  3MX3 A;  4GZD A;  4HOT A;  3MKQ B;  4JVS A;  1OWM A;  2QFC A;  3NQP A;  3RO2 A;  3E4B A;  4ILG A;  4XE0 A;  4K0R A;  3SFZ A;  4GYO A;  4G2V A;  3TJP A;  2IU1 A;  4I43 A;  3ESK A;  5KJL A;  2WMO A;  1HZ4 A;  2WXF A;  3CK9 A;  2P58 C;  5E76 A;  3KAE A;  3KEZ A;  2PL2 A;  3IHV A;  4KZ0 A;  4CGV A;  4J8D A;  2X3M A;  4AVX A;  4P29 A;  3O48 A;  4I9E A;  4TRQ A;  4PS3 A;  3FUH A;  3PDN A;  2V0P A;  3SI5 A;  3T5X A;  4CT0 A;  1OWN A;  3CVP A;  3CQG B;  3APD A;  1LF8 A;  5ANR A;  2XPI A;  4YVO A;  4JHR A;  2L0T B;  4FLH A;  3FEY A;  3T8M A;  4WUY A;  3FUI A;  2CG3 A;  1N54 A;  2YQ8 A;  3JQ1 A;  3MZL B;  4IRU A;  5D0O D;  4LER A;  3CKB A;  1E96 B;  4ATG A;  3FTW A;  1U3D A;  4OVU A;  3GZ2 A;  3DPD A;  3I4G A;  4JXT A;  3PNL B;  4U0U A;  5LP0 A;  2VSY A;  1FVF A;  2FUL A;  2KCV A;  4I17 A;  4U0Z A;  3FTS A;  3CVX A;  4H7X A;  4UI9 K;  2KC7 A;  2VGX A;  3CST A;  4JA9 A;  5FQ7 A;  4BWR A;  3CV0 A;  3PEU B;  3CVQ A;  5G04 J;  5BUZ A;  4L23 A;  3D3M A;  4NUR A;  2WXL A;  1UJK A;  2IQC A;  5BV1 A;  2VSN A;  1QNF A;  4TV3 A;  4HLE A;  3EHN A;  3D9I A;  3VTY A;  4B8A A;  1JWF A;  4ANW A;  3PRZ A;  3OTN A;  3NZU A;  4UQY A;  5KJN A;  3U4T A;  4I2W A;  2VSO E;  2R59 A;  4UI9 J;  5BPP A;  3PRE A;  4JW1 A;  1IYG A;  2YNQ A;  3DBS A;  2VJ8 A;  4OYS A;  3QK0 A;  3P2B A;  3ML8 A;  5E75 A;  5KJM A;  2J9Q A;  2EQX A;  5A6C A;  2L0I A;  1Y6I A;  3AU4 A;  2ILR A;  4BSX A;  4EPZ A;  1H0A A;  4LCT A;  3MV2 B;  4RG9 A;  3FEX A;  4V3I A;  1PY1 A;  5EX3 A;  1UW4 B;  3RU0 A;  3UQ3 A;  4A3T A;  4JEU A;  3RK6 A;  3N71 A;  3ASH A;  5AJL A;  1PAQ A;  3CEQ A;  2WQH A;  1DNP A;  3LJ3 A;  4ANU A;  1Z6T A;  3U64 A;  1TEZ A;  3ASF A;  4UWF A;  4N2S A;  3L17 A;  1HG5 A;  4N3B A;  4Y6C A;  2NC9 A;  2UY1 A;  3KD7 A;  4F1S A;  2VYI A;  4GAA A;  3S7D A;  3SNX A;  4BX8 A;  3MGB A;  1XNF A;  2WXQ A;  4APO A;  5CMW A;  2WQ7 A;  3PUJ A;  3ESL A;  3Q47 B;  3RIB A;  1U3C A;  3RRN B;  4BX9 A;  1E90 A;  4ME2 A;  4CEM A;  3L22 A;  4J8S A;  2X6K A;  4TUU A;  1XGW A;  3CQC B;  3FDH A;  5EKQ D;  5KCM A;  4G25 A;  3JUI A;  3SF4 A;  4ACK A;  5CCM A;  3CVN A;  2IF4 A;  2AXZ A;  1UJJ A;  1X5B A;  3FU6 A;  3FTV A;  5J08 A;  1UG3 A;  4B0Z A;  4I9C A;  3GW4 A;  2WXR A;  5J90 A;  1Y8M A;  3PE4 A;  3QB2 A;  3I4R B;  3IBE A;  3CLJ A;  1B89 A;  2CHZ A;  3CK7 A;  3D9K A;  5G55 A;  4C0M A;  5BV0 A;  1QQE A;  4LEU A;  5BW8 C;  2IOL A;  5JJT A;  5FQ8 A;  5G04 C;  3MYV A;  2BUG A;  1JPL A;  2DCP A;  3RRM B;  1HFA A;  3P1U A;  4KMO A;  2OVB A;  3U9W A;  3HVE B;  3PH0 C;  4WAF A;  1OWP A;  3JYS A;  4I6J A;  5FQ4 A;  2WXI A;  4GYY A;  4XX5 A;  2V8S E;  4B94 A;  3VLF A;  1EDU A;  3LY7 A;  4L2L A;  4C9B B;  2M63 A;  4FHJ A;  1HU3 A;  3FTY A;  3K9I A;  1IHG A;  3D9O A;  3Q15 A;  4UI9 C;  3TXM A;  3CVU A;  3D9M A;  1L5J A;  4FJZ A;  3SBT B;  4GML A;  3FH8 A;  1ELK A;  3PZD A;  4N3A A;  4JHK A;  1E7V A;  5D0Q D;  2WM9 A;  4WND A;  3HIZ A;  2PZI A;  5JHB A;  4URK A;  3LPZ A;  3SD5 A;  1H6K A;  2WXO A;  3FU3 A;  4AIF A;  1PC2 A;  2AVP A;  2OV8 A;  2XQ0 A;  4GA2 A;  4H7Y A;  3ZHE A;  4L2Y A;  3CHQ A;  3UUX A;  2IFU A;  3FTZ A;  2HR2 A;  4DK5 A;  4HOR A;  5C2Y A;  1EYH A;  2AWI A;  3Q5M A;  4MKT A;  4HFG A;  1HF8 A;  4E85 A;  2WXJ A;  1BPO A;  1S0P A;  2FBN A;  3AU5 A;  3FTU A;  1WY6 A;  4U04 A;  2WXP A;  4AV7 A;  4EZL A;  3FUJ A;  2A5U A;  3LVR E;  4UWK A;  3R7R A;  3FUL A;  3GZS A;  3PE3 A;  4G23 A;  3S7F A;  4F53 A;  2FEZ A;  3GYZ A;  3L16 A;  4I1O B;  2GRM A;  3SHF A;  4GA1 A;  3FUN A;  4KT6 B;  3UT8 A;  1UN8 A;  3TL5 A;  4U63 A;  4HOQ A;  2Y4U A;  3LEW A;  4KVM A;  3QDN A;  2QY7 A;  1KT0 A;  3IHY A;  4ILH B;  4M3O A;  4N3C A;  3EIJ A;  5LFA A;  4JEH A;  2JLB A;  4WNE A;  3CR3 A;  3QOU A;  1MHQ A;  1FCH A;  3QJZ A;  2NXP A;  3ZIM A;  2XPZ A;  1IQR A;  2Y3A A;  2PM7 A;  4JL0 A;  4AY5 A;  3EIQ C;  1MQS A;  3ZYL A;  2FF4 A;  3QAR A;  3FHE A;  3L54 A;  5T8I A;  5LX8 A;  4AJW A;  4GU5 A;  5G05 J;  3CHM A;  2NSZ A;  3QC1 A;  2I2O A;  3OXL A;  2C0L A;  3PUK A;  3ULQ A;  2XRY A;  2X6I A;  3ZYK A;  3IV0 A;  4GCO A;  3TG5 A;  3HYM B;  4G1T A;  3D9L A;  2LAI A;  4DI3 A;  4PDX A;  2DIW A;  4GZC A;  3HVE A;  4A3V A;  4CGW A;  3ZYM A;  4U0S A;  4APF A;  4AOF A;  1SQM A;  3CK8 A;  5ENN A;  3CHS A;  3CVW A;  2XRZ A;  4DLO A;  2LSU A;  3B7U X;  2MRI A;  3ZVV A;  4HXI A;  3FUD A;  1IQU A;  2MHK A;  3FUK A;  1INZ A;  4BFR A;  3U66 A;  3VTX A;  3ZW3 A;  5CCL A;  5DIZ A;  2Q7F A;  4PS8 A;  3FTX A;  2AXU A;  1HX8 A;  2FI7 A;  3PS6 A;  5A23 A;  4UWG A;  5AEN A;  4ANX A;  2LAH A;  3QWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...