1QQEA

Crystal structure of the vesicular transport protein sec17
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
290
structure length
281
Chain Sequence
ISDPVELLKRAEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSESNFLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VESICULAR TRANSPORT PROTEIN SEC17
publication title Crystal structure of the vesicular transport protein Sec17: implications for SNAP function in SNARE complex disassembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 122
structure length 281
sequence length 290
ec nomenclature
pdb deposition date 1999-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1qqeA00
3ASDA 3UQ3A 2KATA 1HH8A 3TGOA 2XCBA 4CGVA 4J8DA 3PE4A 4JA7A 2VGXB 4I2ZA 5JJTA 2YQ8A 1E96B 1YA0A 5DBKA 2WQHA 4NQ0A 5KJLA 1ELRA 4KXKB 4Y6CA 3MV3B 3ZN3A 2UY1B 2C2LA 1NZNA 2PQNA 3CVQA 3LCAA 4U0ZA 3R9AB 4KYOB 3RIBA 2LSVA 3CK8A 2WPVA 2PL2A 2PZIA 4HORA 3S7DA 2VGYA 4O6FA 2LNIA 3SF4A 3ZHEB 3Q15A 5BNWA 4G23A 1KT1A 3Q49B 5JJ7A 2FO7A 3U3WA 5FZRA 2XGSA 5CHEE 4EQFA 4YVQC 1WM5A 5D0OD 4Y6WA 4AY5A 3IEGA 4WUYA 2L6JA 3ASHA 5FTPA 4U0SA 4RG9A 4GZ6A 1B89A 4I1AA 2GW1A 5KJKA 3OXGA 2VSYA 3QOUA 3EDTB 1WAO1 3CVLA 4G2VA 3QDNA 3MEKA 2NC9A 4GA0A 2V5FA 2HR2A 2DBAA 4AY6A 2XGOA 4JA9A 3TG4A 1HXIA 3U4TA 2KCKA 4GYOA 3UUXA 2KCLA 3RU0A 4I9CA 4UQZA 3KAEA 4YVOA 5G04C 4UI9C 5FT9A 4KBQA 3KS2A 4GCNA 3N71A 2J9QA 3CVNA 3OXLA 2C0LA 3E4BA 4GCOA 3VTYA 4GZ5A 5BT1A 3JYSA 3O48A 4CGWA 5JJ6A 5AYWD 2KC7A 3QWPA 4GYWA 2FF4A 3GYZA 1ZBPA 4A1SA 2XCCA 3LY7A 2Y4UA 4XI0A 4GA1A 4XIFA 5KJNA 4HOTA 1OUVA 5G05C 4G24A 2BUGA 4H7YA 3MV2B 2QFCA 4BWRA 3QKYA 4GA2A 1KLXA 3ULQA 4F3VA 3ASGA 3URZA 4JHRA 2PQRA 4GPKA 2Y4TA 1NA0A 3AS4A 4N3AA 3LPZA 5KJMA 3AS5A 4N2QA 3TAXA 3S7BA 4N3CA 4U0UA 1HZ4A 2C0MA 3MKRA 3Q4AB 4G26A 3CVPA 3LY9A 3MA5A 3KD7A 3CK9A 4ME2A 5HQ8A 1W3BA 2FI7A 2JLBA 4GZ3A 4N3BA 4I2WA 5G04J 4UI9J 3LY8A 3GW4A 3AS8A 2IF4A 4HOQA 2ONDA 4BTAA 1IHGA 2IFUA 4J8EA 3SZ7A 4GYYA 4I17A 3UPVA 4BTBA 3WXXA 4UQXA 4UI9K 4U04A 3RJVA 4ABNA 4APOA 1ZU2A 3Q47B 5DIZA 3LYAA 3CKCA 2I6HA 2YHCA 4B94A 4N5CA 4WNFA 3K9IA 2Q7FA 4XI9A 5G05J 3S7FA 5EX0A 3ESKA 3S7JA 3CEQA 2VQ2A 5FZQA 5CCMA 4N39A 4JL0A 4N2SA 1A17A 3RO3A 2VGXA 3CKBA 4W9RA 4U07A 2OOEA 4CDRA 3ZPJA 5LCWC 2HYZA 2P58C 4UQYA 1TJCA 3LKUA 3RKVA 3FFLA 3FWVA 2UY1A 1Y8MA 5CCLA 3NF1A 4H7XA 1QZ2A 5EKQD 4J0UA 5M72A 3PE3A 4IN3B 3ASFA 5FJYA 4J8FA 1XNFA 4LEUA 3FP3A 4I9EA 2XPIA 4RG6A 2LSUA 2HO1A 3TG5A 4BT8A 5BW8C 5C1DA 4WNEA 2VSNA 3BEEA 3ZHEA 1QQEA 1ELWA 5ARFA 2MHKA 3OXFA 2AVPA 2XGMA 5A6CA 3QWVA 1FCHA 4AIFA 5ARGA 2VYIA 3QWWA 5HI7A 4G1TA 3ZGQA 2UWJG 3CV0A 4YNDA 4WNDA 2XEVA 2KCVA 4NRHB 1NA3A 3GZ1A 4HOUA 3VTXA 4HOSA 1IYGA 3CK7A 4BT9A 2FBNA 1PC2A 1KT0A 2R5SA 2FEZA 3PDNA 5EX3A 5FZSA 3ZFWA 4G25A 2E2EA 3Q5MA 1P5QA 4WNGA 5A7DB 3GZ2A 5LCWJ 5D0QD 4AM9A 3HYMB 3RO2A
chains in the Genus database with same CATH superfamily
3ASDA 3IHYA 1MX6A 3IHVA 1HH8A 3E33A 2F8YA 3FEXA 1INZA 4JA7A 1UOHA 5ENOD 5KNGA 5LP0A 3KSQA 1YA0A 5DBKA 4I1MA 2WQHA 1JUQA 4TXQA 4NQ0A 5KJLA 2KZTA 1HE8A 3AG4E 5AENA 3FUNA 2PNNA 3SO8A 2XEHA 1NZNA 5EN5D 3CHSA 2X3MA 1ELKA 2L6BA 3ONLA 3ZVVA 3SBTB 4NACA 4JD2G 2Y69E 2LSVA 5JMND 4UWLA 2PL2A 1SVXA 2PZIA 2WXMA 1QBQA 4KT6B 4OYSA 1N11A 3CHQA 2ZGDA 3UKRG 4D10C 1N54A 3Q49B 3FTXA 3PNTB 1FVHA 4CCAA 4JHKA 3G2TA 3U3WA 5BV0A 2XS1A 1EYHA 3DPDA 3FTUA 3TJPA 1OT8A 5E76A 3NOCD 1LD7A 1UJJA 4YVQC 1K8KG 1WM5A 1O1RA 3Q79A 4HB5A 3ZYKA 2YNQA 2L6JA 3JXJA 3PUKA 3ASHA 3G2UA 5FTPA 2Y1LE 2J4DA 5FQ6A 2XS8A 2OVFA 1B89A 4WAFA 3DSSA 2GW1A 1BI8B 5HRYA 3PZ1A 1TYQG 1H6PA 1WAO1 3MEKA 5KWDA 4LNBA 5AARA 3V2XA 2F37A 5AJDA 1K1AA 2XGOA 5HKPA 4YDWA 2KCKA 4GAAA 2WXHA 1H6OA 5JHAA 2KCLA 3ISMC 1JCSA 4UQZA 4GTVA 5FT9A 1SA5A 1NL4A 3KEAA 4GCNA 3DSUA 3G2WA 3OXLA 2C0LA 1H2VC 4GCOA 1DVPA 3D3MA 5BT1A 3O48A 4AV7A 3AG3E 5JJ6A 3JUIA 2LO6A 1E90A 3GYZA 4MS6A 3EHRA 1N0QA 2Y4UA 2J09A 4GU5A 3ZIMA 2EIKE 5EYPF 4APFA 3MV2B 3E34A 2WXNA 3EIJA 3NB2A 3ULQA 2J07A 3URZA 1LF8A 2PQRA 1L5JA 2R02A 2Y4TA 4QFVA 4M3OA 3AS4A 3W9GA 1MQSA 1K1BA 3PZDA 1OWPA 3ZYMA 3FEYA 3WG7E 2IOSA 1TNZA 3ZEFA 5FQ8A 3FULA 3LY9A 3MA5A 3DWLG 4L2YA 5J08A 2L0IA 1EF1C 3ZW3A 4HXIA 4O1OA 3LDZA 3QJZA 4U8YD 5G04J 3SNXA 3MJWA 1MX4A 4RLYA 4E85A 2H6GA 3J5PA 2RG8A 4GTMA 2ONDA 4B93B 3AU4A 1FT1A 3SZ7A 3JXIA 1RW2A 4GYYA 4I17A 4BTBA 3WXXA 5EIDA 4TXPA 1Z3YA 1FVFA 4ABNA 5J90A 3NBNB 4IULA 3APCA 3L17A 3ZXPA 3K9IA 4UWFA 3ESKA 3CEQA 5FZQA 3JQ1A 4JB8P 5CCMA 4JL0A 4DLQA 2DIWA 3CR3A 2VGXA 3R7RA 5JHBA 2OVBA 3D9NA 2AXZA 2BKGA 3HXBA 4U07A 5FIOA 3V31A 4CDRA 2EQXA 1OWMA 1Y6IA 3HHMA 4UQYA 4JVSA 3FFLA 3FWVA 3O4ZA 1Y8MA 3DEOA 4HQDA 4O1PA 3PH0C 3UT4A 4IN3B 4OAUC 2XPIA 2CG2A 3SGHA 1Z5SC 1U3CA 3I5PA 2WXFA 2OEWA 5BW8C 2B6CA 3DSWA 5H7PA 1SZ9A 1E7UA 3PNLB 4J8SA 2EIJE 1VDYA 3SBSA 2NYJA 3B13A 2XGMA 3VLDA 2P9PG 5AIJA 4JXTA 1NP7A 1FCHA 4LUNU 1Z6TA 5ARGA 3UT8A 4LRZA 4JHJA 3EHMA 4G1TA 3T9KA 4I6GA 2B0OE 4EHMA 2WB2A 2RKKA 4YNDA 4WNDA 2XEVA 4YDYA 4BERA 4NRHB 2KM4A 2EINE 1JCRA 1NA3A 3Q7AA 4HOUA 2V0PA 1IYGA 3CK7A 4BT9A 2FBNA 3QC1A 3CHRA 3PS6A 1KPSB 4UUCA 3AG2E 1G3NB 2AXUA 3DSXA 5LCWJ 4JEUA 3RO2A 3UQ3A 5AJLA 3NAWA 1WG0A 4XEIG 1OWOA 1E96B 3L9TA 1AWCB 2F8XK 4KXKB 4PS3A 4PS8A 3BQOA 5ENTD 2ZGGA 4HI8A 4CT0A 5ITZF 2I1JA 3C3RA 2PQNA 5ENQD 4KVOA 5D66A 3LCAA 2XENA 5CEAA 4U0ZA 2PM6A 3L13A 3RIBA 3FUEA 3CK8A 3C5RA 5FQ7A 3FTVA 4F53A 3ASOE 2V4LA 3B7UX 2EILE 4O6FA 2ZIRA 3VLFA 4C0MA 2LNIA 3FTYA 3SF4A 3B95A 2ZISA 5LOZA 3Q15A 3ZKJA 1KT1A 2FO7A 2DYSE 3LVRE 2OEVA 4HRMB 2AXVA 4Q94A 5BV1A 4FJZA 3I3NA 1S0PA 2OCCE 5D0OD 2CHZA 4A63B 2OV8A 2A4ZA 1O1SA 4I6JA 4U0SA 2WQ7A 2LXLA 2P9NG 4I1AA 1V54E 2J8SD 1TNYA 4MKTA 3ZUVB 2LAHA 2CHXA 2NC9A 4GA0A 4XZ4A 2HR2A 2XZDG 3Q9UC 5AAOA 4UWGA 4I43A 3TG4A 1HO8A 1HXIA 5AQ9A 4GYOA 3UUXA 3ESLA 3UM3A 1KZPA 3SFYA 2CFZA 3KAEA 4YVOA 5G04C 5KBAA 3FU6A 5ENPD 2KZTB 3LVQE 3N71A 1DC2A 2A5EA 2LUHA 4GZDA 3UMVA 1HFAA 4Q69A 4GZ5A 3JYSA 4GMLA 4F6RD 1TNUA 4V3IA 3W9FA 2WXPA 4YDEA 3NOGD 4GYWA 4ILGA 1WDYA 2XCCA 2RFAA 3MGBA 3LY7A 2P9IG 1N4PA 4XI0A 4XIFA 5KJNA 2MRIA 4GMRA 3CQGB 4R7LA 3CHPA 2MYOA 3FH7A 4H7YA 5ENNA 1TNBA 4BWRA 1N52A 4F3VA 3FU0A 3ASNE 3VLEA 4ANWA 3U64A 4ANVA 3SQVA 4GPKA 1X5BA 3MZLB 3APFA 4FULA 4L2LA 4N3AA 4X8QA 4N2QA 5FWQA 3TAXA 5G2NA 4N3CA 4CEMA 4PDXA 4U0UA 2C0MA 4G26A 5CEDB 5ANRA 3KD7A 3CK9A 3ULEG 5HQ8A 2KBXA 3TWSA 1PY1A 4GZ3A 3R9MA 3MYVA 3CSTA 1H0AA 2VGEA 3GW4A 1N4RA 3SD5A 4P29A 4I1OB 4BTAA 3AU5A 2IFUA 3HXFA 4WWOA 4GTSA 2FO1E 1JCQA 1OWNA 2X6IA 3RJVA 1IQUA 4G11A 3CKCA 1NI1A 3TWRA 5T4YA 5ANLA 5JA4D 4N5CA 2L0TB 1TN7A 3EU9A 2Q7FA 3FTSA 5G05J 3RRUA 4DX7D 3MX3A 3S7JA 2WVIA 4N39A 4IRUA 4TRQA 5C2YA 2IONA 4HFGA 4FHJA 5EILA 2JABA 2KXPC 3ZPJA 5LCWC 3AG1E 4U63A 2P58C 3MKQA 1TJCA 3LKUA 5FQ4A 3D9MA 3D9JA 2UY1A 1QYMA 1D8DA 4BEPA 3NF1A 5ENSD 4JPSA 1QZ2A 4O60A 3UIPC 3UM2A 3T5VA 2WXJA 4U8VD 4MLPA 5CERB 4J6IA 2JEKA 3HVEA 4JW1A 1XNFA 4LEUA 3T8MA 2LSUA 3JCKC 4PH4B 4BT8A 3I4RB 2P9SG 1FT2A 2X38A 4K0RA 2BKKB 4WNEA 2QYJA 3PZ4A 5AQAA 3E37A 2VSNA 1N94A 3CVWA 3ZHEA 1QQEA 2GRMA 3ZU7B 3CLJA 4XE0A 1OWLA 2AVPA 4HS2A 3D9LA 3B7TA 5A6CA 3QWWA 4HI9A 2H6IA 1UW4B 3ZGQA 2UWJG 3CV0A 1U2VG 3AJIA 4A1GA 2X6KA 4AVXA 4HOSA 3ZNGA 2ETCA 1KT0A 3PDNA 3C3OA 5BXOA 3ZFWA 2YINA 2IOLA 3E30A 2E2EA 2WXLA 4ATZD 3LEWA 3GZ2A 2QY7A 2WQ6A 4AP2A 3Q9NC 3HYMB 3FUIA 1TNOA 3UKUG 3MCXA 2KATA 2XCBA 3T8KA 3PE4A 2VGXB 4I2ZA 5JJTA 2IEJA 1D9SA 2I1KA 4C0EA 4ANUA 4E6HA 4K5BA 1ELRA 5B1BE 3DSTA 3PREA 4MRUA 2DWZA 3ZN3A 4DI4A 4HRNA 3CVQA 4GTOA 2VTBA 4L23A 3SI5A 3UI2A 4B8CB 2VSXE 4QQIA 4PUCA 2BF0X 2X6FA 5HS0A 4HORA 4BSZB 1H6KA 4ACKA 4G23A 3PZ3A 5BPPA 4K5AB 5FZRA 3D9HA 2J49A 2XGSA 2ETAA 4ATGA 3CHOA 1DCEA 5EYLA 4BFRA 4EQFA 3HXEA 4TUMA 1BLXB 2X6HA 2GGFA 3TWWA 2IY0C 4CZ2D 3ENEA 4G8KA 3SY2A 2RD0A 3G2SA 3GZSA 3FTWA 4B8AA 4JZYA 4DX6D 3CQCB 2MOWA 4J8YA 1WY6A 1S64A 2DCPA 3CVLA 3EDTB 4G2VA 3QDNA 5LFAA 4XKCA 4GB9A 4AY6A 4Q96A 4JA9A 3DEPA 5IY5E 4DUIA 2LAIA 4FLHA 3RU0A 4I9CA 4FC8A 4LG6A 3CGHA 3LXUX 3HXCA 2IQCA 2J9QA 3CVNA 3EIQC 4FJYA 2CG3A 3PEVB 4UWKA 3E4BA 4L1BA 3AAAC 3VTYA 1KZOA 4JEHA 3RAUA 3D9PA 2HE0A 5AYWD 5E75A 3RK6A 2DVWA 2FF4A 2ZU6B 4TUUA 1E8ZA 2PM7A 2Y0BG 4A1SA 1H2TC 4CYMD 2WMOA 3B7BA 1OUVA 4C48B 2EIME 4BX9A 5G05C 4LNUD 2I2OA 4FADA 3QKYA 1KLXA 4F1PA 4HLEA 1UN8A 3JQ0A 1TEZA 4EBAG 2GROB 4L9PA 1JPLA 1HS6A 2AJAA 3TWUA 4EBAA 3BUAA 4A55A 3S7BA 3L22A 2P9UG 5AQ7A 4HRLA 3MKRA 3Q4AB 3SFXA 1UJKA 3HIZA 4DJAA 4ANXA 3R7QA 3EHQA 4ZHBA 1W3BA 2FI7A 3UIOC 3FY4A 4N3BA 4I6EA 4DK5A 4I2WA 4ILHB 4UI9J 3G2VA 3CSFA 1N4QA 3DSVA 5AQBA 2J08A 5G55A 3L54A 4HOQA 4RQIA 1IHGA 1UN9A 3TXNA 3BU8A 4UQXA 4UI9K 3RSEG 1AP7A 2XPYA 4APOA 5DIZA 4DI3A 3CVYA 4WWNA 4AOFA 4GTRA 2X6JA 4Z68A 3RRNB 3UT7A 4KMOA 5D2MC 4HBDA 2GRNB 3L82A 3BG1B 5EX0A 2M63A 1O1TA 1A17A 2WXKA 2A5UA 4KZCA 3E32A 3CKBA 4W9RA 3IBEA 2HYZA 3BG0B 5KNHD 3LJ3A 1HX8A 4KZ0A 3CHMA 5CMYA 1E8WA 1UG3A 4HLLA 2DZOA 3FU5A 1YYHA 1IXVA 5CCLA 2BTDA 3TWXA 4H7XA 1JWFA 3HG0D 5EKQD 4GMJA 1E8YA 5M72A 3SHFA 3ASFA 1H2UA 1N4SA 3FP3A 4HNAD 4EZLA 2XZTG 1S70B 2HO1A 3FUDA 3TG5A 1HF8A 4DX2A 1N95A 2XRZA 4L7TA 3BEEA 1X81A 1ELWA 3FUFA 2MHKA 3OXFA 4JC8A 1OCZE 3P2BA 4A3TA 1BI7B 1YMPA 1SW6A 4A3VA 4CDNA 5HI7A 1DCQA 2P9LG 3P1UA 2R5SA 2FEZA 3DPYA 5EX3A 5FZSA 2XQ0A 3U66A 4G25A 3SFZA 2XPZA 2R03A 3Q5MA 5CMWA 4OAVB 3ZYQA 1HU3A 4WNGA 3FUJA 4BESA 3NZUA 3Q7FA 4UWHA 3UX4A 5D0QD 3PUJA 4LNGA 3EHNA 2E0IA 3ABME 5CBNA 2P9KG 2VSOE 3TGOA 3PRZA 3QK0A 3UXGA 2VJ8A 2Y3AA 4CGVA 3TWVA 4J8DA 3V30A 3C3QA 3ULYA 2YQ8A 3I4GA 1K3ZD 3U9WA 5EDSA 3ONKA 2DYRE 2FULA 5B3SE 4KVMA 1E8XA 4U8HA 4M7CA 3UTMA 4N5QA 3C98A 4Y6CA 3FH8A 3MKQB 1HG5A 3MV3B 2R17C 2UY1B 4BSXA 2GRQB 2C2LA 3Q75A 1OY3D 2R2LA 4CDMA 2AWIA 4TXRA 3IXEA 2QC9A 2RFMA 4J7WA 3HXDA 5CBOA 3R9AB 4KYOB 3DXMG 1XGWA 4GZCA 3HVEB 4FA6A 4CRWA 2WPVA 3UINC 3CVUA 2NSZA 3S7DA 2VGYA 4EECA 4F7AA 5LX8A 3ZHEB 2H6HA 5BNWA 5JJ7A 5BXUA 5CHEE 3TL5A 4OVUA 3EUVA 2WXQA 1U3DA 4C9BB 2F0YA 4GTTA 3F6QA 4Y6WA 4AY5A 3IEGA 4WUYA 4K5CA 4GTPA 4U95D 2YHEA 3B7RL 2L9BA 5CRUA 4RG9A 4GZ6A 4BY6A 5KJKA 2J4BA 1YCSB 3OXGA 4K03A 2R59A 2VSYA 3S2AA 3QOUA 4B0ZA 2V5FA 4BETA 2DBAA 1LD8A 3QB2A 4U96D 3L16A 4DLOA 3U4TA 1O5MA 5CECB 2V4HC 3FUMA 1IQRA 1TN8A 2V5QC 5EIBE 4AJWA 3CVXA 3APDA 4UI9C 1Q2ZA 3L08A 4KBQA 3KS2A 2ZXWE 1MHQA 5B1AE 3EU5A 3D9KA 4BX8A 1TN6A 1N0RA 2GRLA 3HDXA 5ENRD 4CGWA 2KC7A 3QWPA 4ZFHA 2VTBB 2WXIA 1FPPA 1ZBPA 3UM0A 4ACLA 1LTXA 1NFIE 3Q78A 5T8IA 1HG2A 4GA1A 4HOTA 3QNKA 2WMNA 5FINA 3FUHA 4GPMA 2IJGX 2BUGA 4G24A 1E7VA 2QFCA 3DRAA 4FHKA 3IKOB 4GA2A 3ASGA 4JHRA 4DRXE 1DNPA 4OVVA 3D9OA 2I9CA 4RSYA 4DX1A 3FUKA 1NA0A 3RRMB 3LPZA 2R05A 1OCCE 5KJMA 4MBGA 3AS5A 4AXHA 4DPRA 4U7EB 5T3RA 4FU3A 2XEEA 1HZ4A 3FTZA 2HM8A 2V8SE 3CVPA 3TWQA 1D8EA 2WXOA 4PS7A 4ME2A 3Q73A 4F1SA 2XHEA 2JLBA 5CRVA 1BPOA 2WM9A 3KEZA 3LY8A 4LCTA 1MZCA 3FH5A 3DXKG 3PZ2A 4EPZA 4FP7A 1IHBA 4LSZE 2BEDA 3ZYLA 3AS8A 3CIAA 2IF4A 3EJNA 1OXJA 4G8LA 4J8EA 3UPVA 4YDOA 3TXMA 1A5EA 4U04A 3ZRHA 1ZU2A 3Q47B 3V2OA 3LYAA 2I6HA 2YHCA 3B7SA 4TV3A 3ML9A 4HVBA 4B94A 4WNFA 2DZNA 4DX5D 3PVLA 2WXGA 3TWTA 4XI9A 3FHEA 3S7FA 1PAQA 2VQ2A 4NURA 1MYOA 1H19A 4N2SA 3QARA 3RO3A 4B89A 1N9AA 3ZXSA 1SZAA 3OAWA 2OOEA 3FDHA 1SA4A 3IV0A 3DBSA 1MX2A 1Z3XA 3ML8A 3LJNA 1OCRE 4FLBA 4LERA 2IU1A 3RKVA 3ABKE 2H6FA 4AEZC 1MJ0A 3KSLA 4J0UA 2XRYA 3HRAA 3J5QB 3PE3A 3QAQA 5FJYA 4J8FA 4I9EA 1ZB1A 1S63A 4RG6A 3X2QE 1TJFA 3NZSA 4RVBA 5C1DA 3D9IA 2IO3C 1RZ4A 3CVVA 5ARFA 5KCMA 4XX5A 2GRRB 1SQMA 1JWGA 4EZJA 4XKBA 2WXRA 3T5XA 5A23A 1BD8A 3QWVA 4AIFA 1BU9A 3V79K 2VYIA 2CFUA 5AN8A 4CT4A 1QNFA 2IO2C 4GTQA 4ILIA 1GW6A 2KCVA 2QYUA 2P2CP 2ETBA 2ILRA 4URKA 3GZ1A 3VTXA 3C72A 3JUEA 3PEUB 3UM1A 1PC2A 2LXMA 3NQPA 1IKND 3ABLE 4EZKA 4WWPA 1OCOE 2NXPA 3LS8A 3FU3A 1TR4A 1V55E 2GRPB 4IYPA 2QZAA 1P5QA 1EDUA 5BUZA 5A7DB 2AW6A 2CHWA 3L6AA 1EPUA 4NIKA 4AM9A 3OTNA
chains in the Genus database with same CATH topology
3ASDA 3IHYA 3MCXA 3IHVA 3UQ3A 2KATA 2VSOE 1HH8A 3TGOA 3PRZA 3QK0A 2XCBA 2VJ8A 5AJLA 2Y3AA 4CGVA 3FEXA 4J8DA 1INZA 3PE4A 4JA7A 2VGXB 4I2ZA 5JJTA 2I1KA 2YQ8A 3I4GA 4C0EA 3U9WA 4ANUA 1OWOA 5EDSA 3ONKA 5LP0A 1E96B 1YA0A 5DBKA 2FULA 4I1MA 4KVMA 1E8XA 1JUQA 2WQHA 4NQ0A 4U8HA 4E6HA 5KJLA 2KZTA 1ELRA 3C98A 1HE8A 4KXKB 4Y6CA 3PREA 3FH8A 3MKQB 4PS3A 1HG5A 3MV3B 4PS8A 4MRUA 2R17C 3ZN3A 5AENA 3FUNA 4DI4A 2UY1B 4BSXA 4CT0A 2I1JA 2C2LA 1NZNA 2PQNA 3CVQA 4KVOA 4CDMA 2VTBA 3CHSA 4L23A 2X3MA 3SI5A 2AWIA 3LCAA 1ELKA 4B8CB 3ONLA 4U0ZA 2PM6A 3ZVVA 3SBTB 4NACA 3L13A 3R9AB 4KYOB 3RIBA 1XGWA 2LSVA 2VSXE 4GZCA 3HVEB 3FUEA 4FA6A 4UWLA 4CRWA 3CK8A 4PUCA 2BF0X 2WPVA 2PL2A 2PZIA 2WXMA 5FQ7A 3CVUA 2NSZA 3FTVA 4KT6B 2X6FA 4F53A 2V4LA 4HORA 4OYSA 3B7UX 2VGYA 3S7DA 3CHQA 4O6FA 4C0MA 3VLFA 4EECA 2LNIA 3FTYA 3SF4A 4D10C 4F7AA 5LX8A 1N54A 3ZHEB 5LOZA 3Q15A 1H6KA 4ACKA 4G23A 5BNWA 1KT1A 3FTXA 3Q49B 3PNTB 5BPPA 1FVHA 4CCAA 4JHKA 5JJ7A 3G2TA 2FO7A 3U3WA 5FZRA 5BV0A 2J49A 2XGSA 4ATGA 3CHOA 3LVRE 1EYHA 5CHEE 3DPDA 3TL5A 3FTUA 2AXVA 4OVUA 3TJPA 4Q94A 5E76A 5BV1A 4FJZA 4BFRA 4EQFA 2WXQA 1UJJA 1U3DA 3I3NA 4YVQC 4C9BB 1WM5A 1S0PA 5D0OD 2CHZA 4Y6WA 4AY5A 3IEGA 4WUYA 3ZYKA 2OV8A 2A4ZA 2YNQA 2X6HA 2L6JA 2YHEA 2GGFA 3ENEA 3B7RL 3PUKA 4I6JA 3ASHA 3G2UA 5FTPA 2RD0A 2J4DA 2L9BA 5FQ6A 4U0SA 4RG9A 2WQ7A 2OVFA 1B89A 4GZ6A 3G2SA 4WAFA 3GZSA 4I1AA 3FTWA 4B8AA 4BY6A 2GW1A 4JZYA 5KJKA 2J4BA 3CQCB 3OXGA 2MOWA 4K03A 2R59A 2VSYA 1WY6A 4MKTA 2LAHA 3S2AA 3QOUA 2CHXA 2DCPA 1WAO1 3CVLA 3EDTB 4G2VA 3QDNA 4B0ZA 3MEKA 5LFAA 2NC9A 4GA0A 2V5FA 4XKCA 4GB9A 4XZ4A 2HR2A 3HYMB 2DBAA 4AY6A 3QB2A 4Q96A 5AJDA 2XGOA 4UWGA 4I43A 4JA9A 3TG4A 1HO8A 3L16A 4DLOA 1HXIA 3U4TA 2KCKA 4GAAA 2WXHA 4GYOA 3UUXA 2LAIA 3FUMA 4FLHA 2KCLA 3RU0A 5JHAA 4I9CA 1IQRA 4FC8A 4AJWA 3ESLA 3CVXA 3APDA 2CFZA 4UQZA 3KAEA 3CGHA 4YVOA 5G04C 4UI9C 5FT9A 3FU6A 3L08A 3LXUX 4KBQA 2KZTB 3KS2A 3LVQE 3N71A 4GCNA 2IQCA 3G2WA 2J9QA 3CVNA 3EIQC 2C0LA 3OXLA 4FJYA 1H2VC 2CG3A 3PEVB 1MHQA 4GZDA 4UWKA 3E4BA 3UMVA 1HFAA 4L1BA 4Q69A 4GCOA 1DVPA 3VTYA 4GZ5A 3D3MA 3D9KA 4BX8A 5BT1A 2GRLA 3JYSA 4JEHA 3HDXA 4JEUA 4GMLA 3O48A 4AV7A 3D9PA 4V3IA 4CGWA 5JJ6A 2WXPA 5AYWD 3JUIA 5E75A 2KC7A 3QWPA 4GYWA 3RK6A 2FF4A 2VTBB 2LO6A 2ZU6B 2WXIA 4TUUA 1E90A 3GYZA 4MS6A 1ZBPA 4ILGA 1E8ZA 2PM7A 4A1SA 4ACLA 2XCCA 3MGBA 3LY7A 1H2TC 2Y4UA 2WMOA 4XI0A 1HG2A 2J09A 5T8IA 4GA1A 4GU5A 4XIFA 5KJNA 4HOTA 2MRIA 3QNKA 1OUVA 2WMNA 4BX9A 3CQGB 5G05C 4R7LA 3CHPA 3FUHA 3ZIMA 2IJGX 2BUGA 3FH7A 4G24A 1E7VA 4H7YA 5ENNA 4APFA 2I2OA 3MV2B 2QFCA 4BWRA 4FHKA 4FADA 3IKOB 3QKYA 1N52A 2WXNA 1KLXA 3EIJA 4GA2A 3ULQA 4HLEA 4F3VA 3ASGA 2J07A 3FU0A 1UN8A 3JQ0A 3URZA 3VLEA 4JHRA 4ANWA 1DNPA 1LF8A 4OVVA 2PQRA 1L5JA 3U64A 4EBAG 4ANVA 1TEZA 4GPKA 3D9OA 2Y4TA 1X5BA 4QFVA 2I9CA 3MZLB 4RSYA 3APFA 1JPLA 3FUKA 4M3OA 1NA0A 3AS4A 1HS6A 4FULA 1MQSA 4L2LA 4N3AA 3RRMB 3LPZA 4EBAA 3PZDA 1OWPA 3ZYMA 3FEYA 5KJMA 3AS5A 4N2QA 4A55A 5FWQA 3TAXA 4AXHA 4DPRA 5T3RA 2IOSA 5G2NA 3S7BA 4N3CA 3ZEFA 3L22A 4CEMA 4FU3A 4PDXA 4U0UA 3FTZA 1HZ4A 2C0MA 2HM8A 2V8SE 3MKRA 3Q4AB 4G26A 5FQ8A 3CVPA 3FULA 3LY9A 3MA5A 4L2YA 5ANRA 3KD7A 3CK9A 1UJKA 2WXOA 3HIZA 4DJAA 5J08A 4ANXA 2L0IA 4ME2A 4PS7A 3R7QA 1EF1C 3ZW3A 5HQ8A 4HXIA 4F1SA 1W3BA 2FI7A 1PY1A 2XHEA 2JLBA 4GZ3A 3FY4A 3LDZA 4N3BA 3QJZA 4I6EA 1BPOA 3MYVA 2WM9A 4DK5A 3KEZA 4I2WA 4ILHB 5G04J 3CSTA 1H0AA 3G2VA 4UI9J 3SNXA 3LY8A 3CSFA 3GW4A 3FH5A 3MJWA 4LCTA 4EPZA 4FP7A 3ZYLA 2J08A 5G55A 3L54A 4E85A 3AS8A 3CIAA 3SD5A 2IF4A 4P29A 3EJNA 4HOQA 2RG8A 4I1OB 2ONDA 4BTAA 1IHGA 3AU4A 3AU5A 2IFUA 4J8EA 1UN9A 3SZ7A 3TXNA 4GYYA 4I17A 4WWOA 3UPVA 4BTBA 3WXXA 3TXMA 4UQXA 4UI9K 1Z3YA 4U04A 3ZRHA 1FVFA 1OWNA 2X6IA 2XPYA 3RJVA 4ABNA 4APOA 1ZU2A 3Q47B 1IQUA 5DIZA 5J90A 3LYAA 4G11A 3CKCA 2I6HA 4DI3A 4IULA 5T4YA 3CVYA 2YHCA 3APCA 3B7SA 4WWNA 4TV3A 5ANLA 4AOFA 2X6JA 3ML9A 4HVBA 3RRNB 4B94A 4N5CA 2L0TB 3UT7A 3L17A 4WNFA 4KMOA 3K9IA 2Q7FA 3PVLA 3BG1B 2WXGA 3FTSA 4UWFA 3FHEA 4XI9A 5G05J 3RRUA 3S7FA 5EX0A 2M63A 1PAQA 3ESKA 3MX3A 3S7JA 3CEQA 2VQ2A 4NURA 5FZQA 3JQ1A 2WVIA 5CCMA 1H19A 4N39A 4JL0A 4N2SA 1A17A 4IRUA 4DLQA 2DIWA 3CR3A 3QARA 2VGXA 2WXKA 4TRQA 2A5UA 3R7RA 3RO3A 4B89A 5C2YA 5JHBA 3ZXSA 2OVBA 3D9NA 4KZCA 1SZAA 2AXZA 2IONA 4HFGA 3CKBA 4FHJA 4W9RA 3OAWA 4U07A 2OOEA 3FDHA 4CDRA 3IV0A 3DBSA 3ZPJA 3IBEA 5LCWC 2HYZA 3BG0B 4U63A 2P58C 2EQXA 1Z3XA 3ML8A 3MKQA 1OWMA 3LJ3A 1Y6IA 1HX8A 3HHMA 4FLBA 4LERA 4KZ0A 1TJCA 4UQYA 3CHMA 5CMYA 1E8WA 3LKUA 2IU1A 5FQ4A 3RKVA 4JVSA 1UG3A 3FFLA 3D9MA 3FU5A 3FWVA 3O4ZA 3D9JA 2UY1A 1Y8MA 5CCLA 4AEZC 3NF1A 2BTDA 3PH0C 4JPSA 4H7XA 1QZ2A 1JWFA 5EKQD 3UT4A 4J0UA 2XRYA 4GMJA 1E8YA 3QAQA 3PE3A 5M72A 2WXJA 4IN3B 3SHFA 3T5VA 4MLPA 3ASFA 5FJYA 1H2UA 4J8FA 4J6IA 2JEKA 3HVEA 4JW1A 1XNFA 4LEUA 3FP3A 4I9EA 3T8MA 4EZLA 2XPIA 2CG2A 4RG6A 3SGHA 2LSUA 2HO1A 3FUDA 3JCKC 4PH4B 3TG5A 1HF8A 1TJFA 4BT8A 1U3CA 3I4RB 3I5PA 3NZSA 2WXFA 4RVBA 2X38A 5BW8C 4K0RA 5C1DA 4WNEA 1SZ9A 2XRZA 3D9IA 4L7TA 2VSNA 3BEEA 1E7UA 3PNLB 3CVWA 3ZHEA 1QQEA 2GRMA 4J8SA 1ELWA 3CVVA 5ARFA 1VDYA 3CLJA 5KCMA 3SBSA 4XX5A 3FUFA 4XE0A 1OWLA 1SQMA 2MHKA 3OXFA 4JC8A 1JWGA 2AVPA 3B13A 4EZJA 2XGMA 4XKBA 3VLDA 4HS2A 2WXRA 3T5XA 4JXTA 1NP7A 5A23A 5AIJA 3D9LA 3B7TA 3P2BA 5A6CA 3QWVA 1FCHA 4LUNU 4AIFA 1Z6TA 4A3TA 5ARGA 3UT8A 4LRZA 2VYIA 4JHJA 2CFUA 3QWWA 4A3VA 4CDNA 5HI7A 4CT4A 3EHMA 1UW4B 4G1TA 3ZGQA 4I6GA 2UWJG 2WB2A 1QNFA 3CV0A 3P1UA 4YNDA 4WNDA 2XEVA 4ILIA 4A1GA 1GW6A 2KCVA 2X6KA 4NRHB 2KM4A 2ILRA 4URKA 4AVXA 1NA3A 3GZ1A 4HOUA 3VTXA 4HOSA 2V0PA 1IYGA 3CK7A 3PEUB 4BT9A 2FBNA 1PC2A 1KT0A 2R5SA 2FEZA 3PDNA 3QC1A 3NQPA 5EX3A 5FZSA 2XQ0A 3CHRA 3PS6A 3ZFWA 2YINA 2IOLA 4EZKA 3U66A 4WWPA 2NXPA 4G25A 2E2EA 3LS8A 3FU3A 3SFZA 2XPZA 4IYPA 2WXLA 3Q5MA 5CMWA 1P5QA 1EDUA 3ZYQA 1HU3A 4WNGA 3LEWA 5BUZA 5A7DB 2AW6A 2AXUA 3FUJA 3GZ2A 2CHWA 5LCWJ 2QY7A 3NZUA 2WQ6A 3L6AA 1EPUA 4UWHA 3UX4A 5D0QD 4AP2A 3PUJA 4AM9A 3EHNA 3FUIA 3RO2A 2E0IA 3OTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASD A;  3UQ3 A;  2KAT A;  1HH8 A;  3TGO A;  2XCB A;  4CGV A;  4J8D A;  3PE4 A;  4JA7 A;  2VGX B;  4I2Z A;  5JJT A;  2YQ8 A;  1E96 B;  1YA0 A;  5DBK A;  2WQH A;  4NQ0 A;  5KJL A;  1ELR A;  4KXK B;  4Y6C A;  3MV3 B;  3ZN3 A;  2UY1 B;  2C2L A;  1NZN A;  2PQN A;  3CVQ A;  3LCA A;  4U0Z A;  3R9A B;  4KYO B;  3RIB A;  2LSV A;  3CK8 A;  2WPV A;  2PL2 A;  2PZI A;  4HOR A;  3S7D A;  2VGY A;  4O6F A;  2LNI A;  3SF4 A;  3ZHE B;  3Q15 A;  5BNW A;  4G23 A;  1KT1 A;  3Q49 B;  5JJ7 A;  2FO7 A;  3U3W A;  5FZR A;  2XGS A;  5CHE E;  4EQF A;  4YVQ C;  1WM5 A;  5D0O D;  4Y6W A;  4AY5 A;  3IEG A;  4WUY A;  2L6J A;  3ASH A;  5FTP A;  4U0S A;  4RG9 A;  4GZ6 A;  1B89 A;  4I1A A;  2GW1 A;  5KJK A;  3OXG A;  2VSY A;  3QOU A;  3EDT B;  1WAO 1;  3CVL A;  4G2V A;  3QDN A;  3MEK A;  2NC9 A;  4GA0 A;  2V5F A;  2HR2 A;  2DBA A;  4AY6 A;  2XGO A;  4JA9 A;  3TG4 A;  1HXI A;  3U4T A;  2KCK A;  4GYO A;  3UUX A;  2KCL A;  3RU0 A;  4I9C A;  4UQZ A;  3KAE A;  4YVO A;  5G04 C;  4UI9 C;  5FT9 A;  4KBQ A;  3KS2 A;  4GCN A;  3N71 A;  2J9Q A;  3CVN A;  3OXL A;  2C0L A;  3E4B A;  4GCO A;  3VTY A;  4GZ5 A;  5BT1 A;  3JYS A;  3O48 A;  4CGW A;  5JJ6 A;  5AYW D;  2KC7 A;  3QWP A;  4GYW A;  2FF4 A;  3GYZ A;  1ZBP A;  4A1S A;  2XCC A;  3LY7 A;  2Y4U A;  4XI0 A;  4GA1 A;  4XIF A;  5KJN A;  4HOT A;  1OUV A;  5G05 C;  4G24 A;  2BUG A;  4H7Y A;  3MV2 B;  2QFC A;  4BWR A;  3QKY A;  4GA2 A;  1KLX A;  3ULQ A;  4F3V A;  3ASG A;  3URZ A;  4JHR A;  2PQR A;  4GPK A;  2Y4T A;  1NA0 A;  3AS4 A;  4N3A A;  3LPZ A;  5KJM A;  3AS5 A;  4N2Q A;  3TAX A;  3S7B A;  4N3C A;  4U0U A;  1HZ4 A;  2C0M A;  3MKR A;  3Q4A B;  4G26 A;  3CVP A;  3LY9 A;  3MA5 A;  3KD7 A;  3CK9 A;  4ME2 A;  5HQ8 A;  1W3B A;  2FI7 A;  2JLB A;  4GZ3 A;  4N3B A;  4I2W A;  5G04 J;  4UI9 J;  3LY8 A;  3GW4 A;  3AS8 A;  2IF4 A;  4HOQ A;  2OND A;  4BTA A;  1IHG A;  2IFU A;  4J8E A;  3SZ7 A;  4GYY A;  4I17 A;  3UPV A;  4BTB A;  3WXX A;  4UQX A;  4UI9 K;  4U04 A;  3RJV A;  4ABN A;  4APO A;  1ZU2 A;  3Q47 B;  5DIZ A;  3LYA A;  3CKC A;  2I6H A;  2YHC A;  4B94 A;  4N5C A;  4WNF A;  3K9I A;  2Q7F A;  4XI9 A;  5G05 J;  3S7F A;  5EX0 A;  3ESK A;  3S7J A;  3CEQ A;  2VQ2 A;  5FZQ A;  5CCM A;  4N39 A;  4JL0 A;  4N2S A;  1A17 A;  3RO3 A;  2VGX A;  3CKB A;  4W9R A;  4U07 A;  2OOE A;  4CDR A;  3ZPJ A;  5LCW C;  2HYZ A;  2P58 C;  4UQY A;  1TJC A;  3LKU A;  3RKV A;  3FFL A;  3FWV A;  2UY1 A;  1Y8M A;  5CCL A;  3NF1 A;  4H7X A;  1QZ2 A;  5EKQ D;  4J0U A;  5M72 A;  3PE3 A;  4IN3 B;  3ASF A;  5FJY A;  4J8F A;  1XNF A;  4LEU A;  3FP3 A;  4I9E A;  2XPI A;  4RG6 A;  2LSU A;  2HO1 A;  3TG5 A;  4BT8 A;  5BW8 C;  5C1D A;  4WNE A;  2VSN A;  3BEE A;  3ZHE A;  1QQE A;  1ELW A;  5ARF A;  2MHK A;  3OXF A;  2AVP A;  2XGM A;  5A6C A;  3QWV A;  1FCH A;  4AIF A;  5ARG A;  2VYI A;  3QWW A;  5HI7 A;  4G1T A;  3ZGQ A;  2UWJ G;  3CV0 A;  4YND A;  4WND A;  2XEV A;  2KCV A;  4NRH B;  1NA3 A;  3GZ1 A;  4HOU A;  3VTX A;  4HOS A;  1IYG A;  3CK7 A;  4BT9 A;  2FBN A;  1PC2 A;  1KT0 A;  2R5S A;  2FEZ A;  3PDN A;  5EX3 A;  5FZS A;  3ZFW A;  4G25 A;  2E2E A;  3Q5M A;  1P5Q A;  4WNG A;  5A7D B;  3GZ2 A;  5LCW J;  5D0Q D;  4AM9 A;  3HYM B;  3RO2 A; 
#chains in the Genus database with same CATH topology
 3ASD A;  3IHY A;  1MX6 A;  3IHV A;  1HH8 A;  3E33 A;  2F8Y A;  3FEX A;  1INZ A;  4JA7 A;  1UOH A;  5ENO D;  5KNG A;  5LP0 A;  3KSQ A;  1YA0 A;  5DBK A;  4I1M A;  2WQH A;  1JUQ A;  4TXQ A;  4NQ0 A;  5KJL A;  2KZT A;  1HE8 A;  3AG4 E;  5AEN A;  3FUN A;  2PNN A;  3SO8 A;  2XEH A;  1NZN A;  5EN5 D;  3CHS A;  2X3M A;  1ELK A;  2L6B A;  3ONL A;  3ZVV A;  3SBT B;  4NAC A;  4JD2 G;  2Y69 E;  2LSV A;  5JMN D;  4UWL A;  2PL2 A;  1SVX A;  2PZI A;  2WXM A;  1QBQ A;  4KT6 B;  4OYS A;  1N11 A;  3CHQ A;  2ZGD A;  3UKR G;  4D10 C;  1N54 A;  3Q49 B;  3FTX A;  3PNT B;  1FVH A;  4CCA A;  4JHK A;  3G2T A;  3U3W A;  5BV0 A;  2XS1 A;  1EYH A;  3DPD A;  3FTU A;  3TJP A;  1OT8 A;  5E76 A;  3NOC D;  1LD7 A;  1UJJ A;  4YVQ C;  1K8K G;  1WM5 A;  1O1R A;  3Q79 A;  4HB5 A;  3ZYK A;  2YNQ A;  2L6J A;  3JXJ A;  3PUK A;  3ASH A;  3G2U A;  5FTP A;  2Y1L E;  2J4D A;  5FQ6 A;  2XS8 A;  2OVF A;  1B89 A;  4WAF A;  3DSS A;  2GW1 A;  1BI8 B;  5HRY A;  3PZ1 A;  1TYQ G;  1H6P A;  1WAO 1;  3MEK A;  5KWD A;  4LNB A;  5AAR A;  3V2X A;  2F37 A;  5AJD A;  1K1A A;  2XGO A;  5HKP A;  4YDW A;  2KCK A;  4GAA A;  2WXH A;  1H6O A;  5JHA A;  2KCL A;  3ISM C;  1JCS A;  4UQZ A;  4GTV A;  5FT9 A;  1SA5 A;  1NL4 A;  3KEA A;  4GCN A;  3DSU A;  3G2W A;  3OXL A;  2C0L A;  1H2V C;  4GCO A;  1DVP A;  3D3M A;  5BT1 A;  3O48 A;  4AV7 A;  3AG3 E;  5JJ6 A;  3JUI A;  2LO6 A;  1E90 A;  3GYZ A;  4MS6 A;  3EHR A;  1N0Q A;  2Y4U A;  2J09 A;  4GU5 A;  3ZIM A;  2EIK E;  5EYP F;  4APF A;  3MV2 B;  3E34 A;  2WXN A;  3EIJ A;  3NB2 A;  3ULQ A;  2J07 A;  3URZ A;  1LF8 A;  2PQR A;  1L5J A;  2R02 A;  2Y4T A;  4QFV A;  4M3O A;  3AS4 A;  3W9G A;  1MQS A;  1K1B A;  3PZD A;  1OWP A;  3ZYM A;  3FEY A;  3WG7 E;  2IOS A;  1TNZ A;  3ZEF A;  5FQ8 A;  3FUL A;  3LY9 A;  3MA5 A;  3DWL G;  4L2Y A;  5J08 A;  2L0I A;  1EF1 C;  3ZW3 A;  4HXI A;  4O1O A;  3LDZ A;  3QJZ A;  4U8Y D;  5G04 J;  3SNX A;  3MJW A;  1MX4 A;  4RLY A;  4E85 A;  2H6G A;  3J5P A;  2RG8 A;  4GTM A;  2OND A;  4B93 B;  3AU4 A;  1FT1 A;  3SZ7 A;  3JXI A;  1RW2 A;  4GYY A;  4I17 A;  4BTB A;  3WXX A;  5EID A;  4TXP A;  1Z3Y A;  1FVF A;  4ABN A;  5J90 A;  3NBN B;  4IUL A;  3APC A;  3L17 A;  3ZXP A;  3K9I A;  4UWF A;  3ESK A;  3CEQ A;  5FZQ A;  3JQ1 A;  4JB8 P;  5CCM A;  4JL0 A;  4DLQ A;  2DIW A;  3CR3 A;  2VGX A;  3R7R A;  5JHB A;  2OVB A;  3D9N A;  2AXZ A;  2BKG A;  3HXB A;  4U07 A;  5FIO A;  3V31 A;  4CDR A;  2EQX A;  1OWM A;  1Y6I A;  3HHM A;  4UQY A;  4JVS A;  3FFL A;  3FWV A;  3O4Z A;  1Y8M A;  3DEO A;  4HQD A;  4O1P A;  3PH0 C;  3UT4 A;  4IN3 B;  4OAU C;  2XPI A;  2CG2 A;  3SGH A;  1Z5S C;  1U3C A;  3I5P A;  2WXF A;  2OEW A;  5BW8 C;  2B6C A;  3DSW A;  5H7P A;  1SZ9 A;  1E7U A;  3PNL B;  4J8S A;  2EIJ E;  1VDY A;  3SBS A;  2NYJ A;  3B13 A;  2XGM A;  3VLD A;  2P9P G;  5AIJ A;  4JXT A;  1NP7 A;  1FCH A;  4LUN U;  1Z6T A;  5ARG A;  3UT8 A;  4LRZ A;  4JHJ A;  3EHM A;  4G1T A;  3T9K A;  4I6G A;  2B0O E;  4EHM A;  2WB2 A;  2RKK A;  4YND A;  4WND A;  2XEV A;  4YDY A;  4BER A;  4NRH B;  2KM4 A;  2EIN E;  1JCR A;  1NA3 A;  3Q7A A;  4HOU A;  2V0P A;  1IYG A;  3CK7 A;  4BT9 A;  2FBN A;  3QC1 A;  3CHR A;  3PS6 A;  1KPS B;  4UUC A;  3AG2 E;  1G3N B;  2AXU A;  3DSX A;  5LCW J;  4JEU A;  3RO2 A;  3UQ3 A;  5AJL A;  3NAW A;  1WG0 A;  4XEI G;  1OWO A;  1E96 B;  3L9T A;  1AWC B;  2F8X K;  4KXK B;  4PS3 A;  4PS8 A;  3BQO A;  5ENT D;  2ZGG A;  4HI8 A;  4CT0 A;  5ITZ F;  2I1J A;  3C3R A;  2PQN A;  5ENQ D;  4KVO A;  5D66 A;  3LCA A;  2XEN A;  5CEA A;  4U0Z A;  2PM6 A;  3L13 A;  3RIB A;  3FUE A;  3CK8 A;  3C5R A;  5FQ7 A;  3FTV A;  4F53 A;  3ASO E;  2V4L A;  3B7U X;  2EIL E;  4O6F A;  2ZIR A;  3VLF A;  4C0M A;  2LNI A;  3FTY A;  3SF4 A;  3B95 A;  2ZIS A;  5LOZ A;  3Q15 A;  3ZKJ A;  1KT1 A;  2FO7 A;  2DYS E;  3LVR E;  2OEV A;  4HRM B;  2AXV A;  4Q94 A;  5BV1 A;  4FJZ A;  3I3N A;  1S0P A;  2OCC E;  5D0O D;  2CHZ A;  4A63 B;  2OV8 A;  2A4Z A;  1O1S A;  4I6J A;  4U0S A;  2WQ7 A;  2LXL A;  2P9N G;  4I1A A;  1V54 E;  2J8S D;  1TNY A;  4MKT A;  3ZUV B;  2LAH A;  2CHX A;  2NC9 A;  4GA0 A;  4XZ4 A;  2HR2 A;  2XZD G;  3Q9U C;  5AAO A;  4UWG A;  4I43 A;  3TG4 A;  1HO8 A;  1HXI A;  5AQ9 A;  4GYO A;  3UUX A;  3ESL A;  3UM3 A;  1KZP A;  3SFY A;  2CFZ A;  3KAE A;  4YVO A;  5G04 C;  5KBA A;  3FU6 A;  5ENP D;  2KZT B;  3LVQ E;  3N71 A;  1DC2 A;  2A5E A;  2LUH A;  4GZD A;  3UMV A;  1HFA A;  4Q69 A;  4GZ5 A;  3JYS A;  4GML A;  4F6R D;  1TNU A;  4V3I A;  3W9F A;  2WXP A;  4YDE A;  3NOG D;  4GYW A;  4ILG A;  1WDY A;  2XCC A;  2RFA A;  3MGB A;  3LY7 A;  2P9I G;  1N4P A;  4XI0 A;  4XIF A;  5KJN A;  2MRI A;  4GMR A;  3CQG B;  4R7L A;  3CHP A;  2MYO A;  3FH7 A;  4H7Y A;  5ENN A;  1TNB A;  4BWR A;  1N52 A;  4F3V A;  3FU0 A;  3ASN E;  3VLE A;  4ANW A;  3U64 A;  4ANV A;  3SQV A;  4GPK A;  1X5B A;  3MZL B;  3APF A;  4FUL A;  4L2L A;  4N3A A;  4X8Q A;  4N2Q A;  5FWQ A;  3TAX A;  5G2N A;  4N3C A;  4CEM A;  4PDX A;  4U0U A;  2C0M A;  4G26 A;  5CED B;  5ANR A;  3KD7 A;  3CK9 A;  3ULE G;  5HQ8 A;  2KBX A;  3TWS A;  1PY1 A;  4GZ3 A;  3R9M A;  3MYV A;  3CST A;  1H0A A;  2VGE A;  3GW4 A;  1N4R A;  3SD5 A;  4P29 A;  4I1O B;  4BTA A;  3AU5 A;  2IFU A;  3HXF A;  4WWO A;  4GTS A;  2FO1 E;  1JCQ A;  1OWN A;  2X6I A;  3RJV A;  1IQU A;  4G11 A;  3CKC A;  1NI1 A;  3TWR A;  5T4Y A;  5ANL A;  5JA4 D;  4N5C A;  2L0T B;  1TN7 A;  3EU9 A;  2Q7F A;  3FTS A;  5G05 J;  3RRU A;  4DX7 D;  3MX3 A;  3S7J A;  2WVI A;  4N39 A;  4IRU A;  4TRQ A;  5C2Y A;  2ION A;  4HFG A;  4FHJ A;  5EIL A;  2JAB A;  2KXP C;  3ZPJ A;  5LCW C;  3AG1 E;  4U63 A;  2P58 C;  3MKQ A;  1TJC A;  3LKU A;  5FQ4 A;  3D9M A;  3D9J A;  2UY1 A;  1QYM A;  1D8D A;  4BEP A;  3NF1 A;  5ENS D;  4JPS A;  1QZ2 A;  4O60 A;  3UIP C;  3UM2 A;  3T5V A;  2WXJ A;  4U8V D;  4MLP A;  5CER B;  4J6I A;  2JEK A;  3HVE A;  4JW1 A;  1XNF A;  4LEU A;  3T8M A;  2LSU A;  3JCK C;  4PH4 B;  4BT8 A;  3I4R B;  2P9S G;  1FT2 A;  2X38 A;  4K0R A;  2BKK B;  4WNE A;  2QYJ A;  3PZ4 A;  5AQA A;  3E37 A;  2VSN A;  1N94 A;  3CVW A;  3ZHE A;  1QQE A;  2GRM A;  3ZU7 B;  3CLJ A;  4XE0 A;  1OWL A;  2AVP A;  4HS2 A;  3D9L A;  3B7T A;  5A6C A;  3QWW A;  4HI9 A;  2H6I A;  1UW4 B;  3ZGQ A;  2UWJ G;  3CV0 A;  1U2V G;  3AJI A;  4A1G A;  2X6K A;  4AVX A;  4HOS A;  3ZNG A;  2ETC A;  1KT0 A;  3PDN A;  3C3O A;  5BXO A;  3ZFW A;  2YIN A;  2IOL A;  3E30 A;  2E2E A;  2WXL A;  4ATZ D;  3LEW A;  3GZ2 A;  2QY7 A;  2WQ6 A;  4AP2 A;  3Q9N C;  3HYM B;  3FUI A;  1TNO A;  3UKU G;  3MCX A;  2KAT A;  2XCB A;  3T8K A;  3PE4 A;  2VGX B;  4I2Z A;  5JJT A;  2IEJ A;  1D9S A;  2I1K A;  4C0E A;  4ANU A;  4E6H A;  4K5B A;  1ELR A;  5B1B E;  3DST A;  3PRE A;  4MRU A;  2DWZ A;  3ZN3 A;  4DI4 A;  4HRN A;  3CVQ A;  4GTO A;  2VTB A;  4L23 A;  3SI5 A;  3UI2 A;  4B8C B;  2VSX E;  4QQI A;  4PUC A;  2BF0 X;  2X6F A;  5HS0 A;  4HOR A;  4BSZ B;  1H6K A;  4ACK A;  4G23 A;  3PZ3 A;  5BPP A;  4K5A B;  5FZR A;  3D9H A;  2J49 A;  2XGS A;  2ETA A;  4ATG A;  3CHO A;  1DCE A;  5EYL A;  4BFR A;  4EQF A;  3HXE A;  4TUM A;  1BLX B;  2X6H A;  2GGF A;  3TWW A;  2IY0 C;  4CZ2 D;  3ENE A;  4G8K A;  3SY2 A;  2RD0 A;  3G2S A;  3GZS A;  3FTW A;  4B8A A;  4JZY A;  4DX6 D;  3CQC B;  2MOW A;  4J8Y A;  1WY6 A;  1S64 A;  2DCP A;  3CVL A;  3EDT B;  4G2V A;  3QDN A;  5LFA A;  4XKC A;  4GB9 A;  4AY6 A;  4Q96 A;  4JA9 A;  3DEP A;  5IY5 E;  4DUI A;  2LAI A;  4FLH A;  3RU0 A;  4I9C A;  4FC8 A;  4LG6 A;  3CGH A;  3LXU X;  3HXC A;  2IQC A;  2J9Q A;  3CVN A;  3EIQ C;  4FJY A;  2CG3 A;  3PEV B;  4UWK A;  3E4B A;  4L1B A;  3AAA C;  3VTY A;  1KZO A;  4JEH A;  3RAU A;  3D9P A;  2HE0 A;  5AYW D;  5E75 A;  3RK6 A;  2DVW A;  2FF4 A;  2ZU6 B;  4TUU A;  1E8Z A;  2PM7 A;  2Y0B G;  4A1S A;  1H2T C;  4CYM D;  2WMO A;  3B7B A;  1OUV A;  4C48 B;  2EIM E;  4BX9 A;  5G05 C;  4LNU D;  2I2O A;  4FAD A;  3QKY A;  1KLX A;  4F1P A;  4HLE A;  1UN8 A;  3JQ0 A;  1TEZ A;  4EBA G;  2GRO B;  4L9P A;  1JPL A;  1HS6 A;  2AJA A;  3TWU A;  4EBA A;  3BUA A;  4A55 A;  3S7B A;  3L22 A;  2P9U G;  5AQ7 A;  4HRL A;  3MKR A;  3Q4A B;  3SFX A;  1UJK A;  3HIZ A;  4DJA A;  4ANX A;  3R7Q A;  3EHQ A;  4ZHB A;  1W3B A;  2FI7 A;  3UIO C;  3FY4 A;  4N3B A;  4I6E A;  4DK5 A;  4I2W A;  4ILH B;  4UI9 J;  3G2V A;  3CSF A;  1N4Q A;  3DSV A;  5AQB A;  2J08 A;  5G55 A;  3L54 A;  4HOQ A;  4RQI A;  1IHG A;  1UN9 A;  3TXN A;  3BU8 A;  4UQX A;  4UI9 K;  3RSE G;  1AP7 A;  2XPY A;  4APO A;  5DIZ A;  4DI3 A;  3CVY A;  4WWN A;  4AOF A;  4GTR A;  2X6J A;  4Z68 A;  3RRN B;  3UT7 A;  4KMO A;  5D2M C;  4HBD A;  2GRN B;  3L82 A;  3BG1 B;  5EX0 A;  2M63 A;  1O1T A;  1A17 A;  2WXK A;  2A5U A;  4KZC A;  3E32 A;  3CKB A;  4W9R A;  3IBE A;  2HYZ A;  3BG0 B;  5KNH D;  3LJ3 A;  1HX8 A;  4KZ0 A;  3CHM A;  5CMY A;  1E8W A;  1UG3 A;  4HLL A;  2DZO A;  3FU5 A;  1YYH A;  1IXV A;  5CCL A;  2BTD A;  3TWX A;  4H7X A;  1JWF A;  3HG0 D;  5EKQ D;  4GMJ A;  1E8Y A;  5M72 A;  3SHF A;  3ASF A;  1H2U A;  1N4S A;  3FP3 A;  4HNA D;  4EZL A;  2XZT G;  1S70 B;  2HO1 A;  3FUD A;  3TG5 A;  1HF8 A;  4DX2 A;  1N95 A;  2XRZ A;  4L7T A;  3BEE A;  1X81 A;  1ELW A;  3FUF A;  2MHK A;  3OXF A;  4JC8 A;  1OCZ E;  3P2B A;  4A3T A;  1BI7 B;  1YMP A;  1SW6 A;  4A3V A;  4CDN A;  5HI7 A;  1DCQ A;  2P9L G;  3P1U A;  2R5S A;  2FEZ A;  3DPY A;  5EX3 A;  5FZS A;  2XQ0 A;  3U66 A;  4G25 A;  3SFZ A;  2XPZ A;  2R03 A;  3Q5M A;  5CMW A;  4OAV B;  3ZYQ A;  1HU3 A;  4WNG A;  3FUJ A;  4BES A;  3NZU A;  3Q7F A;  4UWH A;  3UX4 A;  5D0Q D;  3PUJ A;  4LNG A;  3EHN A;  2E0I A;  3ABM E;  5CBN A;  2P9K G;  2VSO E;  3TGO A;  3PRZ A;  3QK0 A;  3UXG A;  2VJ8 A;  2Y3A A;  4CGV A;  3TWV A;  4J8D A;  3V30 A;  3C3Q A;  3ULY A;  2YQ8 A;  3I4G A;  1K3Z D;  3U9W A;  5EDS A;  3ONK A;  2DYR E;  2FUL A;  5B3S E;  4KVM A;  1E8X A;  4U8H A;  4M7C A;  3UTM A;  4N5Q A;  3C98 A;  4Y6C A;  3FH8 A;  3MKQ B;  1HG5 A;  3MV3 B;  2R17 C;  2UY1 B;  4BSX A;  2GRQ B;  2C2L A;  3Q75 A;  1OY3 D;  2R2L A;  4CDM A;  2AWI A;  4TXR A;  3IXE A;  2QC9 A;  2RFM A;  4J7W A;  3HXD A;  5CBO A;  3R9A B;  4KYO B;  3DXM G;  1XGW A;  4GZC A;  3HVE B;  4FA6 A;  4CRW A;  2WPV A;  3UIN C;  3CVU A;  2NSZ A;  3S7D A;  2VGY A;  4EEC A;  4F7A A;  5LX8 A;  3ZHE B;  2H6H A;  5BNW A;  5JJ7 A;  5BXU A;  5CHE E;  3TL5 A;  4OVU A;  3EUV A;  2WXQ A;  1U3D A;  4C9B B;  2F0Y A;  4GTT A;  3F6Q A;  4Y6W A;  4AY5 A;  3IEG A;  4WUY A;  4K5C A;  4GTP A;  4U95 D;  2YHE A;  3B7R L;  2L9B A;  5CRU A;  4RG9 A;  4GZ6 A;  4BY6 A;  5KJK A;  2J4B A;  1YCS B;  3OXG A;  4K03 A;  2R59 A;  2VSY A;  3S2A A;  3QOU A;  4B0Z A;  2V5F A;  4BET A;  2DBA A;  1LD8 A;  3QB2 A;  4U96 D;  3L16 A;  4DLO A;  3U4T A;  1O5M A;  5CEC B;  2V4H C;  3FUM A;  1IQR A;  1TN8 A;  2V5Q C;  5EIB E;  4AJW A;  3CVX A;  3APD A;  4UI9 C;  1Q2Z A;  3L08 A;  4KBQ A;  3KS2 A;  2ZXW E;  1MHQ A;  5B1A E;  3EU5 A;  3D9K A;  4BX8 A;  1TN6 A;  1N0R A;  2GRL A;  3HDX A;  5ENR D;  4CGW A;  2KC7 A;  3QWP A;  4ZFH A;  2VTB B;  2WXI A;  1FPP A;  1ZBP A;  3UM0 A;  4ACL A;  1LTX A;  1NFI E;  3Q78 A;  5T8I A;  1HG2 A;  4GA1 A;  4HOT A;  3QNK A;  2WMN A;  5FIN A;  3FUH A;  4GPM A;  2IJG X;  2BUG A;  4G24 A;  1E7V A;  2QFC A;  3DRA A;  4FHK A;  3IKO B;  4GA2 A;  3ASG A;  4JHR A;  4DRX E;  1DNP A;  4OVV A;  3D9O A;  2I9C A;  4RSY A;  4DX1 A;  3FUK A;  1NA0 A;  3RRM B;  3LPZ A;  2R05 A;  1OCC E;  5KJM A;  4MBG A;  3AS5 A;  4AXH A;  4DPR A;  4U7E B;  5T3R A;  4FU3 A;  2XEE A;  1HZ4 A;  3FTZ A;  2HM8 A;  2V8S E;  3CVP A;  3TWQ A;  1D8E A;  2WXO A;  4PS7 A;  4ME2 A;  3Q73 A;  4F1S A;  2XHE A;  2JLB A;  5CRV A;  1BPO A;  2WM9 A;  3KEZ A;  3LY8 A;  4LCT A;  1MZC A;  3FH5 A;  3DXK G;  3PZ2 A;  4EPZ A;  4FP7 A;  1IHB A;  4LSZ E;  2BED A;  3ZYL A;  3AS8 A;  3CIA A;  2IF4 A;  3EJN A;  1OXJ A;  4G8L A;  4J8E A;  3UPV A;  4YDO A;  3TXM A;  1A5E A;  4U04 A;  3ZRH A;  1ZU2 A;  3Q47 B;  3V2O A;  3LYA A;  2I6H A;  2YHC A;  3B7S A;  4TV3 A;  3ML9 A;  4HVB A;  4B94 A;  4WNF A;  2DZN A;  4DX5 D;  3PVL A;  2WXG A;  3TWT A;  4XI9 A;  3FHE A;  3S7F A;  1PAQ A;  2VQ2 A;  4NUR A;  1MYO A;  1H19 A;  4N2S A;  3QAR A;  3RO3 A;  4B89 A;  1N9A A;  3ZXS A;  1SZA A;  3OAW A;  2OOE A;  3FDH A;  1SA4 A;  3IV0 A;  3DBS A;  1MX2 A;  1Z3X A;  3ML8 A;  3LJN A;  1OCR E;  4FLB A;  4LER A;  2IU1 A;  3RKV A;  3ABK E;  2H6F A;  4AEZ C;  1MJ0 A;  3KSL A;  4J0U A;  2XRY A;  3HRA A;  3J5Q B;  3PE3 A;  3QAQ A;  5FJY A;  4J8F A;  4I9E A;  1ZB1 A;  1S63 A;  4RG6 A;  3X2Q E;  1TJF A;  3NZS A;  4RVB A;  5C1D A;  3D9I A;  2IO3 C;  1RZ4 A;  3CVV A;  5ARF A;  5KCM A;  4XX5 A;  2GRR B;  1SQM A;  1JWG A;  4EZJ A;  4XKB A;  2WXR A;  3T5X A;  5A23 A;  1BD8 A;  3QWV A;  4AIF A;  1BU9 A;  3V79 K;  2VYI A;  2CFU A;  5AN8 A;  4CT4 A;  1QNF A;  2IO2 C;  4GTQ A;  4ILI A;  1GW6 A;  2KCV A;  2QYU A;  2P2C P;  2ETB A;  2ILR A;  4URK A;  3GZ1 A;  3VTX A;  3C72 A;  3JUE A;  3PEU B;  3UM1 A;  1PC2 A;  2LXM A;  3NQP A;  1IKN D;  3ABL E;  4EZK A;  4WWP A;  1OCO E;  2NXP A;  3LS8 A;  3FU3 A;  1TR4 A;  1V55 E;  2GRP B;  4IYP A;  2QZA A;  1P5Q A;  1EDU A;  5BUZ A;  5A7D B;  2AW6 A;  2CHW A;  3L6A A;  1EPU A;  4NIK A;  4AM9 A;  3OTN A; 
#chains in the Genus database with same CATH homology
 3ASD A;  3IHY A;  3MCX A;  3IHV A;  3UQ3 A;  2KAT A;  2VSO E;  1HH8 A;  3TGO A;  3PRZ A;  3QK0 A;  2XCB A;  2VJ8 A;  5AJL A;  2Y3A A;  4CGV A;  3FEX A;  4J8D A;  1INZ A;  3PE4 A;  4JA7 A;  2VGX B;  4I2Z A;  5JJT A;  2I1K A;  2YQ8 A;  3I4G A;  4C0E A;  3U9W A;  4ANU A;  1OWO A;  5EDS A;  3ONK A;  5LP0 A;  1E96 B;  1YA0 A;  5DBK A;  2FUL A;  4I1M A;  4KVM A;  1E8X A;  1JUQ A;  2WQH A;  4NQ0 A;  4U8H A;  4E6H A;  5KJL A;  2KZT A;  1ELR A;  3C98 A;  1HE8 A;  4KXK B;  4Y6C A;  3PRE A;  3FH8 A;  3MKQ B;  4PS3 A;  1HG5 A;  3MV3 B;  4PS8 A;  4MRU A;  2R17 C;  3ZN3 A;  5AEN A;  3FUN A;  4DI4 A;  2UY1 B;  4BSX A;  4CT0 A;  2I1J A;  2C2L A;  1NZN A;  2PQN A;  3CVQ A;  4KVO A;  4CDM A;  2VTB A;  3CHS A;  4L23 A;  2X3M A;  3SI5 A;  2AWI A;  3LCA A;  1ELK A;  4B8C B;  3ONL A;  4U0Z A;  2PM6 A;  3ZVV A;  3SBT B;  4NAC A;  3L13 A;  3R9A B;  4KYO B;  3RIB A;  1XGW A;  2LSV A;  2VSX E;  4GZC A;  3HVE B;  3FUE A;  4FA6 A;  4UWL A;  4CRW A;  3CK8 A;  4PUC A;  2BF0 X;  2WPV A;  2PL2 A;  2PZI A;  2WXM A;  5FQ7 A;  3CVU A;  2NSZ A;  3FTV A;  4KT6 B;  2X6F A;  4F53 A;  2V4L A;  4HOR A;  4OYS A;  3B7U X;  2VGY A;  3S7D A;  3CHQ A;  4O6F A;  4C0M A;  3VLF A;  4EEC A;  2LNI A;  3FTY A;  3SF4 A;  4D10 C;  4F7A A;  5LX8 A;  1N54 A;  3ZHE B;  5LOZ A;  3Q15 A;  1H6K A;  4ACK A;  4G23 A;  5BNW A;  1KT1 A;  3FTX A;  3Q49 B;  3PNT B;  5BPP A;  1FVH A;  4CCA A;  4JHK A;  5JJ7 A;  3G2T A;  2FO7 A;  3U3W A;  5FZR A;  5BV0 A;  2J49 A;  2XGS A;  4ATG A;  3CHO A;  3LVR E;  1EYH A;  5CHE E;  3DPD A;  3TL5 A;  3FTU A;  2AXV A;  4OVU A;  3TJP A;  4Q94 A;  5E76 A;  5BV1 A;  4FJZ A;  4BFR A;  4EQF A;  2WXQ A;  1UJJ A;  1U3D A;  3I3N A;  4YVQ C;  4C9B B;  1WM5 A;  1S0P A;  5D0O D;  2CHZ A;  4Y6W A;  4AY5 A;  3IEG A;  4WUY A;  3ZYK A;  2OV8 A;  2A4Z A;  2YNQ A;  2X6H A;  2L6J A;  2YHE A;  2GGF A;  3ENE A;  3B7R L;  3PUK A;  4I6J A;  3ASH A;  3G2U A;  5FTP A;  2RD0 A;  2J4D A;  2L9B A;  5FQ6 A;  4U0S A;  4RG9 A;  2WQ7 A;  2OVF A;  1B89 A;  4GZ6 A;  3G2S A;  4WAF A;  3GZS A;  4I1A A;  3FTW A;  4B8A A;  4BY6 A;  2GW1 A;  4JZY A;  5KJK A;  2J4B A;  3CQC B;  3OXG A;  2MOW A;  4K03 A;  2R59 A;  2VSY A;  1WY6 A;  4MKT A;  2LAH A;  3S2A A;  3QOU A;  2CHX A;  2DCP A;  1WAO 1;  3CVL A;  3EDT B;  4G2V A;  3QDN A;  4B0Z A;  3MEK A;  5LFA A;  2NC9 A;  4GA0 A;  2V5F A;  4XKC A;  4GB9 A;  4XZ4 A;  2HR2 A;  3HYM B;  2DBA A;  4AY6 A;  3QB2 A;  4Q96 A;  5AJD A;  2XGO A;  4UWG A;  4I43 A;  4JA9 A;  3TG4 A;  1HO8 A;  3L16 A;  4DLO A;  1HXI A;  3U4T A;  2KCK A;  4GAA A;  2WXH A;  4GYO A;  3UUX A;  2LAI A;  3FUM A;  4FLH A;  2KCL A;  3RU0 A;  5JHA A;  4I9C A;  1IQR A;  4FC8 A;  4AJW A;  3ESL A;  3CVX A;  3APD A;  2CFZ A;  4UQZ A;  3KAE A;  3CGH A;  4YVO A;  5G04 C;  4UI9 C;  5FT9 A;  3FU6 A;  3L08 A;  3LXU X;  4KBQ A;  2KZT B;  3KS2 A;  3LVQ E;  3N71 A;  4GCN A;  2IQC A;  3G2W A;  2J9Q A;  3CVN A;  3EIQ C;  2C0L A;  3OXL A;  4FJY A;  1H2V C;  2CG3 A;  3PEV B;  1MHQ A;  4GZD A;  4UWK A;  3E4B A;  3UMV A;  1HFA A;  4L1B A;  4Q69 A;  4GCO A;  1DVP A;  3VTY A;  4GZ5 A;  3D3M A;  3D9K A;  4BX8 A;  5BT1 A;  2GRL A;  3JYS A;  4JEH A;  3HDX A;  4JEU A;  4GML A;  3O48 A;  4AV7 A;  3D9P A;  4V3I A;  4CGW A;  5JJ6 A;  2WXP A;  5AYW D;  3JUI A;  5E75 A;  2KC7 A;  3QWP A;  4GYW A;  3RK6 A;  2FF4 A;  2VTB B;  2LO6 A;  2ZU6 B;  2WXI A;  4TUU A;  1E90 A;  3GYZ A;  4MS6 A;  1ZBP A;  4ILG A;  1E8Z A;  2PM7 A;  4A1S A;  4ACL A;  2XCC A;  3MGB A;  3LY7 A;  1H2T C;  2Y4U A;  2WMO A;  4XI0 A;  1HG2 A;  2J09 A;  5T8I A;  4GA1 A;  4GU5 A;  4XIF A;  5KJN A;  4HOT A;  2MRI A;  3QNK A;  1OUV A;  2WMN A;  4BX9 A;  3CQG B;  5G05 C;  4R7L A;  3CHP A;  3FUH A;  3ZIM A;  2IJG X;  2BUG A;  3FH7 A;  4G24 A;  1E7V A;  4H7Y A;  5ENN A;  4APF A;  2I2O A;  3MV2 B;  2QFC A;  4BWR A;  4FHK A;  4FAD A;  3IKO B;  3QKY A;  1N52 A;  2WXN A;  1KLX A;  3EIJ A;  4GA2 A;  3ULQ A;  4HLE A;  4F3V A;  3ASG A;  2J07 A;  3FU0 A;  1UN8 A;  3JQ0 A;  3URZ A;  3VLE A;  4JHR A;  4ANW A;  1DNP A;  1LF8 A;  4OVV A;  2PQR A;  1L5J A;  3U64 A;  4EBA G;  4ANV A;  1TEZ A;  4GPK A;  3D9O A;  2Y4T A;  1X5B A;  4QFV A;  2I9C A;  3MZL B;  4RSY A;  3APF A;  1JPL A;  3FUK A;  4M3O A;  1NA0 A;  3AS4 A;  1HS6 A;  4FUL A;  1MQS A;  4L2L A;  4N3A A;  3RRM B;  3LPZ A;  4EBA A;  3PZD A;  1OWP A;  3ZYM A;  3FEY A;  5KJM A;  3AS5 A;  4N2Q A;  4A55 A;  5FWQ A;  3TAX A;  4AXH A;  4DPR A;  5T3R A;  2IOS A;  5G2N A;  3S7B A;  4N3C A;  3ZEF A;  3L22 A;  4CEM A;  4FU3 A;  4PDX A;  4U0U A;  3FTZ A;  1HZ4 A;  2C0M A;  2HM8 A;  2V8S E;  3MKR A;  3Q4A B;  4G26 A;  5FQ8 A;  3CVP A;  3FUL A;  3LY9 A;  3MA5 A;  4L2Y A;  5ANR A;  3KD7 A;  3CK9 A;  1UJK A;  2WXO A;  3HIZ A;  4DJA A;  5J08 A;  4ANX A;  2L0I A;  4ME2 A;  4PS7 A;  3R7Q A;  1EF1 C;  3ZW3 A;  5HQ8 A;  4HXI A;  4F1S A;  1W3B A;  2FI7 A;  1PY1 A;  2XHE A;  2JLB A;  4GZ3 A;  3FY4 A;  3LDZ A;  4N3B A;  3QJZ A;  4I6E A;  1BPO A;  3MYV A;  2WM9 A;  4DK5 A;  3KEZ A;  4I2W A;  4ILH B;  5G04 J;  3CST A;  1H0A A;  3G2V A;  4UI9 J;  3SNX A;  3LY8 A;  3CSF A;  3GW4 A;  3FH5 A;  3MJW A;  4LCT A;  4EPZ A;  4FP7 A;  3ZYL A;  2J08 A;  5G55 A;  3L54 A;  4E85 A;  3AS8 A;  3CIA A;  3SD5 A;  2IF4 A;  4P29 A;  3EJN A;  4HOQ A;  2RG8 A;  4I1O B;  2OND A;  4BTA A;  1IHG A;  3AU4 A;  3AU5 A;  2IFU A;  4J8E A;  1UN9 A;  3SZ7 A;  3TXN A;  4GYY A;  4I17 A;  4WWO A;  3UPV A;  4BTB A;  3WXX A;  3TXM A;  4UQX A;  4UI9 K;  1Z3Y A;  4U04 A;  3ZRH A;  1FVF A;  1OWN A;  2X6I A;  2XPY A;  3RJV A;  4ABN A;  4APO A;  1ZU2 A;  3Q47 B;  1IQU A;  5DIZ A;  5J90 A;  3LYA A;  4G11 A;  3CKC A;  2I6H A;  4DI3 A;  4IUL A;  5T4Y A;  3CVY A;  2YHC A;  3APC A;  3B7S A;  4WWN A;  4TV3 A;  5ANL A;  4AOF A;  2X6J A;  3ML9 A;  4HVB A;  3RRN B;  4B94 A;  4N5C A;  2L0T B;  3UT7 A;  3L17 A;  4WNF A;  4KMO A;  3K9I A;  2Q7F A;  3PVL A;  3BG1 B;  2WXG A;  3FTS A;  4UWF A;  3FHE A;  4XI9 A;  5G05 J;  3RRU A;  3S7F A;  5EX0 A;  2M63 A;  1PAQ A;  3ESK A;  3MX3 A;  3S7J A;  3CEQ A;  2VQ2 A;  4NUR A;  5FZQ A;  3JQ1 A;  2WVI A;  5CCM A;  1H19 A;  4N39 A;  4JL0 A;  4N2S A;  1A17 A;  4IRU A;  4DLQ A;  2DIW A;  3CR3 A;  3QAR A;  2VGX A;  2WXK A;  4TRQ A;  2A5U A;  3R7R A;  3RO3 A;  4B89 A;  5C2Y A;  5JHB A;  3ZXS A;  2OVB A;  3D9N A;  4KZC A;  1SZA A;  2AXZ A;  2ION A;  4HFG A;  3CKB A;  4FHJ A;  4W9R A;  3OAW A;  4U07 A;  2OOE A;  3FDH A;  4CDR A;  3IV0 A;  3DBS A;  3ZPJ A;  3IBE A;  5LCW C;  2HYZ A;  3BG0 B;  4U63 A;  2P58 C;  2EQX A;  1Z3X A;  3ML8 A;  3MKQ A;  1OWM A;  3LJ3 A;  1Y6I A;  1HX8 A;  3HHM A;  4FLB A;  4LER A;  4KZ0 A;  1TJC A;  4UQY A;  3CHM A;  5CMY A;  1E8W A;  3LKU A;  2IU1 A;  5FQ4 A;  3RKV A;  4JVS A;  1UG3 A;  3FFL A;  3D9M A;  3FU5 A;  3FWV A;  3O4Z A;  3D9J A;  2UY1 A;  1Y8M A;  5CCL A;  4AEZ C;  3NF1 A;  2BTD A;  3PH0 C;  4JPS A;  4H7X A;  1QZ2 A;  1JWF A;  5EKQ D;  3UT4 A;  4J0U A;  2XRY A;  4GMJ A;  1E8Y A;  3QAQ A;  3PE3 A;  5M72 A;  2WXJ A;  4IN3 B;  3SHF A;  3T5V A;  4MLP A;  3ASF A;  5FJY A;  1H2U A;  4J8F A;  4J6I A;  2JEK A;  3HVE A;  4JW1 A;  1XNF A;  4LEU A;  3FP3 A;  4I9E A;  3T8M A;  4EZL A;  2XPI A;  2CG2 A;  4RG6 A;  3SGH A;  2LSU A;  2HO1 A;  3FUD A;  3JCK C;  4PH4 B;  3TG5 A;  1HF8 A;  1TJF A;  4BT8 A;  1U3C A;  3I4R B;  3I5P A;  3NZS A;  2WXF A;  4RVB A;  2X38 A;  5BW8 C;  4K0R A;  5C1D A;  4WNE A;  1SZ9 A;  2XRZ A;  3D9I A;  4L7T A;  2VSN A;  3BEE A;  1E7U A;  3PNL B;  3CVW A;  3ZHE A;  1QQE A;  2GRM A;  4J8S A;  1ELW A;  3CVV A;  5ARF A;  1VDY A;  3CLJ A;  5KCM A;  3SBS A;  4XX5 A;  3FUF A;  4XE0 A;  1OWL A;  1SQM A;  2MHK A;  3OXF A;  4JC8 A;  1JWG A;  2AVP A;  3B13 A;  4EZJ A;  2XGM A;  4XKB A;  3VLD A;  4HS2 A;  2WXR A;  3T5X A;  4JXT A;  1NP7 A;  5A23 A;  5AIJ A;  3D9L A;  3B7T A;  3P2B A;  5A6C A;  3QWV A;  1FCH A;  4LUN U;  4AIF A;  1Z6T A;  4A3T A;  5ARG A;  3UT8 A;  4LRZ A;  2VYI A;  4JHJ A;  2CFU A;  3QWW A;  4A3V A;  4CDN A;  5HI7 A;  4CT4 A;  3EHM A;  1UW4 B;  4G1T A;  3ZGQ A;  4I6G A;  2UWJ G;  2WB2 A;  1QNF A;  3CV0 A;  3P1U A;  4YND A;  4WND A;  2XEV A;  4ILI A;  4A1G A;  1GW6 A;  2KCV A;  2X6K A;  4NRH B;  2KM4 A;  2ILR A;  4URK A;  4AVX A;  1NA3 A;  3GZ1 A;  4HOU A;  3VTX A;  4HOS A;  2V0P A;  1IYG A;  3CK7 A;  3PEU B;  4BT9 A;  2FBN A;  1PC2 A;  1KT0 A;  2R5S A;  2FEZ A;  3PDN A;  3QC1 A;  3NQP A;  5EX3 A;  5FZS A;  2XQ0 A;  3CHR A;  3PS6 A;  3ZFW A;  2YIN A;  2IOL A;  4EZK A;  3U66 A;  4WWP A;  2NXP A;  4G25 A;  2E2E A;  3LS8 A;  3FU3 A;  3SFZ A;  2XPZ A;  4IYP A;  2WXL A;  3Q5M A;  5CMW A;  1P5Q A;  1EDU A;  3ZYQ A;  1HU3 A;  4WNG A;  3LEW A;  5BUZ A;  5A7D B;  2AW6 A;  2AXU A;  3FUJ A;  3GZ2 A;  2CHW A;  5LCW J;  2QY7 A;  3NZU A;  2WQ6 A;  3L6A A;  1EPU A;  4UWH A;  3UX4 A;  5D0Q D;  4AP2 A;  3PUJ A;  4AM9 A;  3EHN A;  3FUI A;  3RO2 A;  2E0I A;  3OTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...