1QQEA

Crystal structure of the vesicular transport protein sec17
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
290
structure length
281
Chain Sequence
b'ISDPVELLKRAEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSESNFLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQEDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VESICULAR TRANSPORT PROTEIN SEC17
publication title Crystal structure of the vesicular transport protein Sec17: implications for SNAP function in SNARE complex disassembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 122
structure length 281
sequence length 290
ec nomenclature
pdb deposition date 1999-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1qqeA00
5HQ8A 2VGYA 1PC2A 3KD7A 5ARGA 4N3BA 3LY8A 2OOEA 4BWRA 3LKUA 3Q47B 3UPVA 5JJTA 3RIBA 2LSUA 4O6FA 3LYAA 2KCKA 4HOQA 4GZ3A 5LCWJ 4YNDA 4U04A 2UY1B 3S7JA 1Y8MA 4N2SA 2DBAA 2UWJG 2Y4TA 2E2EA 4GYOA 4KBQA 5FZQA 5A7DB 3MEKA 3JYSA 4JA7A 3Q15A 3VTYA 2I6HA 1B89A 3LCAA 1XNFA 4EQFA 2FBNA 3QDNA 3RU0A 3Q5MA 4GCNA 1WAO1 2VGXA 4GA0A 5FTPA 3FWVA 3CKCA 3ZPJA 4U0UA 2XGMA 2KCVA 5KJKA 2YQ8A 3URZA 3CEQA 4I2WA 4G25A 1NA0A 4GZ6A 3EDTB 2XGOA 4BTBA 3MA5A 5JJ6A 2FO7A 3CVQA 4HOSA 2NC9A 3NF1A 1W3BA 1HH8A 4H7YA 4G26A 5M72A 4J8EA 3N71A 1WM5A 3MV3B 3IEGA 2Q7FA 3ZGQA 4N3AA 5A6CA 4HOTA 4UI9J 3VTXA 3RJVA 1QQEA 4I2ZA 3TAXA 2LNIA 4I1AA 4YVOA 4RG6A 2KATA 3ASGA 3KS2A 3S7BA 3CV0A 5DBKA 4N39A 4GZ5A 1KLXA 3AS5A 2YHCA 4IN3B 3K9IA 2C0LA 4UQYA 3CVPA 4UI9C 1HXIA 5KJMA 3GYZA 4GCOA 4KYOB 1QZ2A 5G05J 4BT8A 2WPVA 4HOUA 1ZBPA 2VQ2A 5AYWD 4G23A 5FT9A 3LY9A 4GYWA 3ZHEA 4UQZA 4J8DA 3OXGA 4CGWA 2C2LA 4AM9A 3RKVA 2BUGA 3MKRA 3GZ1A 2KC7A 1FCHA 2FI7A 5G05C 4APOA 2R5SA 3QKYA 4UQXA 5D0QD 3SZ7A 2LSVA 3FFLA 4XI9A 2V5FA 3AS4A 1IHGA 1KT1A 3ZN3A 3MV2B 2P58C 4WNGA 2IFUA 3ZFWA 1P5QA 4I9CA 2XEVA 2XCCA 4N2QA 3RO2A 1NA3A 4N5CA 4XIFA 2HR2A 1ELWA 3OXFA 3KAEA 2Y4UA 2C0MA 4J0UA 3GW4A 4GA2A 4UI9K 5EX3A 4ABNA 4HORA 1ZU2A 3Q4AB 3TGOA 4KXKB 3R9AB 4CDRA 2JLBA 2AVPA 4G24A 1OUVA 4Y6WA 2VSYA 3S7FA 3PE4A 3CK7A 5EX0A 3QWVA 3U4TA 5C1DA 2XCBA 2XGSA 3QWPA 3PDNA 5KJLA 4G2VA 4A1SA 3ASDA 4J8FA 4BT9A 3HYMB 5ARFA 4AY5A 3BEEA 3UUXA 4W9RA 5FJYA 3O48A 2VGXB 3ASHA 5KJNA 3TG5A 2PQRA 2IF4A 2PL2A 3CKBA 2VSNA 3CVNA 3ULQA 3AS8A 5CCLA 2L6JA 4GPKA 2MHKA 5FZSA 4N3CA 4WUYA 4H7XA 4U07A 1TJCA 2XPIA 2HO1A 3S7DA 4GYYA 4B94A 5FZRA 4I9EA 4RG9A 5G04J 4AY6A 4WNEA 2KCLA 3CVLA 4CGVA 2WQHA 5DIZA 3CK8A 4G1TA 4JHRA 3LPZA 3RO3A 2FF4A 2HYZA 5JJ7A 5LCWC 4YVQC 5CCMA 4WNDA 1YA0A 3WXXA 5G04C 4XI0A 4NQ0A 2UY1A 5EKQD 3ASFA 3U3WA 4U0SA 1A17A 3Q49B 4JL0A 3GZ2A 3CK9A 3E4BA 3FP3A 5D0OD 4F3VA 5HI7A 4GA1A 3QWWA 3ZHEB 2FEZA 4AIFA 5CHEE 1ELRA 2QFCA 3OXLA 1HZ4A 5BNWA 3UQ3A 1IYGA 2PZIA 1E96B 4WNFA 1KT0A 3SF4A 3PE3A 4ME2A 2J9QA 4U0ZA 5BW8C 3ESKA 2VYIA 4LEUA 4I17A 4JA9A 3QOUA 4BTAA 3LY7A 3TG4A 4NRHB 1NZNA 2PQNA 4Y6CA 5BT1A 2ONDA 2GW1A
chains in the Genus database with same CATH superfamily
3TJPA 3MCXA 3ABKE 5HQ8A 4LUNU 5BV0A 4GTSA 1PC2A 1N95A 3ISMC 4LRZA 3HXFA 3UPVA 3FUMA 4HXIA 2WQ7A 3UKUG 5G55A 1PAQA 4O6FA 4RLYA 3UKRG 3CVUA 4HOQA 4CT0A 3KEAA 4C0EA 2B6CA 4EZKA 1Y6IA 3ZW3A 3PZ3A 4DX2A 3ULYA 3FHEA 2E2EA 5A7DB 3ULEG 3ZYLA 4JA7A 4UUCA 1DCEA 1MHQA 4JHKA 1B89A 2I6HA 1NP7A 2P9NG 3D9NA 3FEXA 4B8CB 3RU0A 1OXJA 3Q7FA 1WAO1 2DIWA 2YHEA 3FWVA 1SA4A 1WDYA 2XGMA 4BEPA 3JCKC 4L2LA 3URZA 4K03A 4F1SA 5CRUA 3EDTB 2XGOA 2FO7A 3CVQA 4L9PA 2WXFA 3D9KA 4J8EA 3ZYMA 3T5XA 4EZLA 5BXOA 3IEGA 2Q7FA 4F7AA 3ZGQA 5A6CA 4GMLA 4FJYA 4UI9J 5AJLA 3LJNA 2J08A 1NI1A 3HVEA 3NZSA 1QQEA 4I2ZA 2GRNB 2ZISA 3HXEA 5ANRA 4ILIA 2WXQA 4YDEA 3CVYA 3KS2A 3FTXA 3S7BA 3J5QB 4BX9A 4N39A 1KZOA 3AS5A 3PUJA 4IN3B 2X6KA 3TWXA 4TXPA 4ATGA 1HXIA 4KYOB 2GRQB 4BT8A 1H2VC 4B0ZA 2CG3A 3UT7A 3JXIA 5FT9A 4NACA 3ZHEA 4HLLA 3UTMA 1TNOA 4UQZA 2FULA 4HFGA 4RVBA 4KZ0A 4Z68A 4C48B 4CGWA 3B7RL 3J5PA 3DPDA 3LS8A 1H19A 4DRXE 1DC2A 3RRNB 2R5SA 3BUAA 4DUIA 3W9GA 4UQXA 4HBDA 4PS3A 3FTVA 3UT8A 2CHXA 3DSSA 4OVUA 2V5FA 3L54A 2V0PA 1E90A 4XKBA 1TN6A 3ASOE 4DX5D 3AU4A 4DI4A 1EF1C 3ZFWA 1K8KG 4FU3A 1TEZA 1OWPA 1E8YA 4N5CA 2MYOA 2J07A 2AXUA 3SBSA 2R17C 2I9CA 3FH5A 2ETCA 2X6IA 3VLDA 2WMNA 3MKQB 3Q73A 3PRZA 2FO1E 1ZU2A 2XRZA 2DCPA 5JHBA 3TGOA 3EU5A 4CDRA 3NZUA 1SVXA 1YMPA 4FULA 3C5RA 2ZGDA 2WXMA 3CK7A 4O1PA 2P9PG 3CQGB 2XCBA 2XGSA 3QWPA 2LAHA 5KJLA 4ACLA 2R03A 1MQSA 4JC8A 4HVBA 2A5UA 5ENRD 5FJYA 3LVRE 2DWZA 2VGXB 5KCMA 5KNGA 3UT4A 2NSZA 4LCTA 3CVNA 3KSQA 5FZSA 1NFIE 4I6JA 3RAUA 2H6HA 5IY5E 3SO8A 2XPIA 2HO1A 2GRMA 2OEWA 2WMOA 3Q9UC 3AAAC 4B94A 1ZB1A 5FZRA 3FUKA 3T9KA 4AY6A 4WNEA 1MX6A 4YDWA 4BSZB 1RZ4A 2IO3C 5ENNA 3ABLE 3DPYA 3LPZA 3G2TA 3ZUVB 4HI8A 3PS6A 1TNYA 2BTDA 4B8AA 4JPSA 4ILHB 4GPMA 1YA0A 3R7QA 2J49A 4XI0A 2EQXA 1SW6A 4NQ0A 2I2OA 2LUHA 3R7RA 4DPRA 2UY1A 3SFZA 4OAVB 3U3WA 3EIQC 3ZYKA 2ZGGA 4JL0A 2XS8A 4CCAA 2ETAA 1UOHA 2V8SE 3IKOB 3ZEFA 5D0OD 4F3VA 5CHEE 3S2AA 2QFCA 3QK0A 3G2WA 2KZTB 1V55E 3FY4A 4GZCA 1IYGA 2LO6A 2WM9A 1E96B 3FTWA 4ANXA 1D8EA 4I1OB 3X2QE 1SZAA 4ME2A 2J9QA 3V2XA 4YDOA 5ITZF 4ZHBA 4I17A 3AJIA 3FU0A 3ML8A 1MX4A 3QOUA 1IQRA 4BTAA 1YCSB 1NZNA 2XQ0A 4L7TA 4HLEA 3FTSA 3UIPC 4FHKA 5ARGA 4UWLA 1QNFA 3NQPA 4X8QA 1HO8A 3LKUA 5JJTA 3RIBA 2LSUA 3RK6A 1BU9A 4A63B 3LYAA 5CEDB 4C9BB 1AWCB 3PEVB 2F0YA 3NOGD 5LCWJ 3AG2E 4YNDA 4U04A 5FIOA 3S7JA 4M7CA 4N2SA 4QFVA 2I1JA 5JHAA 4KBQA 1BI7B 3ENEA 4L1BA 5FZQA 4WWNA 3MEKA 4TUUA 1V54E 3Q15A 1BI8B 4XE0A 2DYRE 4PS8A 2ZIRA 4XEIG 4EQFA 4G8LA 1E8XA 3QDNA 4APFA 4GCNA 3CIAA 5FTPA 3CKCA 3ZPJA 3SY2A 1E7UA 2XHEA 2J4DA 4I2WA 1KZPA 3TWQA 2PM6A 4I43A 1NA0A 2YINA 4BTBA 3CLJA 5B3SE 1OCCE 3NF1A 1W3BA 3SGHA 4IYPA 3DSTA 5AN8A 4TUMA 1OWLA 3ONKA 4N5QA 1KPSB 4N3AA 3TWUA 3VTXA 4BERA 3QJZA 2LNIA 3D3MA 2WXHA 4HRLA 4RG6A 3HXCA 1S0PA 3CV0A 3D9IA 5DBKA 4EZJA 2X6HA 5KNHD 1KLXA 1OCRE 3ML9A 4WWOA 4FA6A 3CVXA 1HX8A 4UQYA 3CVPA 2GRRB 3EJNA 3HXDA 2X6FA 1DNPA 3C3RA 5KJMA 2EIKE 4JW1A 3ZU7B 5G05J 2RFMA 2VQ2A 4DX1A 4A1GA 2IEJA 3UM3A 2J4BA 2IU1A 2EIJE 4RQIA 4HI9A 3QB2A 3HG0D 1G3NB 3OXGA 4AM9A 3AG1E 4GMRA 3PZ1A 2BUGA 1HFAA 3MKRA 1AP7A 2KC7A 2P9IG 4OYSA 3L82A 3ASNE 4DX6D 3TWWA 3WG7E 5D0QD 2QC9A 3SZ7A 4HB5A 2LSVA 3P1UA 3FFLA 1JPLA 3AS4A 3HRAA 5ENPD 2VSXE 5FQ6A 3MV2B 4FC8A 3MGBA 1K1BA 2R59A 2GRLA 2WVIA 4I9CA 2XEVA 1WG0A 4KVMA 3G2UA 4GZDA 1NA3A 2XPZA 3DSXA 4K5AB 2VJ8A 1HG5A 3PZ2A 3KAEA 2DYSE 2Y4UA 4J0UA 3GW4A 4UI9K 3C72A 1PY1A 1LF8A 3TWTA 3NBNB 1HF8A 4AXHA 4ABNA 4HRNA 4Q69A 1N4QA 4KXKB 3B95A 2JLBA 3SFXA 2VSYA 2AWIA 4F1PA 3PE4A 3U4TA 3QWVA 5AQ9A 3PDNA 1JCSA 3HXBA 4G2VA 5AIJA 4A1SA 3LXUX 4J8FA 1UW4B 4ILGA 4U8HA 3BEEA 3MZLB 1O1SA 4R7LA 1TN8A 5KJNA 2WXLA 3UIOC 4TRQA 2PQRA 1UN8A 3AS8A 3FUEA 3PZDA 2JABA 1X81A 4JHJA 4G11A 3V31A 3VLFA 3BG0B 4H7XA 1TJCA 2WQ6A 2J09A 2ZU6B 4LSZE 3UM2A 4LNBA 3V30A 2WXOA 1JUQA 3L16A 5G04J 2KCLA 3MYVA 1NL4A 3CVLA 5LX8A 4G1TA 3D9LA 5LP0A 3D9JA 3L17A 3SNXA 2FF4A 5LCWC 5CCMA 3FTZA 4WNDA 3D9OA 5G2NA 4JEUA 3OTNA 3DEPA 1S64A 2L9BA 2F8YA 3ASFA 4U0SA 3UM0A 3FU5A 2MOWA 3Q49B 3CK9A 1H6KA 1D9SA 5HI7A 2H6FA 2FEZA 4AIFA 3OXLA 3PREA 3EHNA 2PZIA 4BSXA 4Q94A 3EU9A 1H2TC 2HM8A 5KWDA 4ANUA 4U0ZA 5BW8C 2WXIA 2VYIA 4LEUA 5EIBE 3P2BA 5T4YA 3I4RB 5ENQD 4NRHB 3Q78A 1LTXA 2PQNA 1HU3A 1XGWA 2XZDG 1N94A 2ONDA 2GW1A 4AOFA 2IY0C 2VGYA 1E7VA 2P9SG 4N3BA 3LY8A 4B93B 1FPPA 2LXLA 5FQ7A 3JQ0A 4JD2G 2EIME 5BXUA 4GTOA 4YDYA 3APDA 4U8VD 1N4SA 5FWQA 2UY1B 4BY6A 4C0MA 4BETA 4A3TA 3FUHA 1K3ZD 1E8WA 2X6JA 3JYSA 4U7EB 3VTYA 1XNFA 3MJWA 2FBNA 4QQIA 3Q5MA 4UWGA 2VGXA 4GA0A 1YYHA 4LNUD 3E33A 2KCVA 5KJKA 1H6OA 3U9WA 1ELKA 2OV8A 2VTBB 1EDUA 2IOSA 3Q79A 4G25A 4GZ6A 2R2LA 4O1OA 4HS2A 5D66A 2IOLA 2NC9A 3EIJA 4J8SA 1DVPA 1HH8A 3CHRA 4UWKA 1MZCA 4H7YA 5CECB 4MKTA 4G26A 3NAWA 3DXKG 3MV3B 1EYHA 4HOTA 1OCOE 1BLXB 3RJVA 3TAXA 3SI5A 4OAUC 4GU5A 3ASGA 3F6QA 1OWMA 2RFAA 1TNZA 3DBSA 2V5QC 2YHCA 3C3OA 2Y69E 3K9IA 3QAQA 4GTVA 3IV0A 3JUEA 1WY6A 4V3IA 4UI9C 3E32A 1N52A 4AV7A 2LXMA 4HOUA 1RW2A 3DWLG 5CBNA 3GZSA 2L0TB 3IHYA 3DXMG 4G23A 1MX2A 3LY9A 4F53A 4GYWA 4ATZD 3MX3A 3SQVA 4ZFHA 5B1BE 2KZTA 3BU8A 3BQOA 5E75A 2RG8A 3CHPA 3V2OA 3JQ1A 3DSUA 3CSFA 3DEOA 3PH0C 4BX8A 1HG2A 2OCCE 2ILRA 1O5MA 2H6GA 1IHGA 3ZNGA 3PUKA 2BKGA 3UXGA 4KT6B 3ZN3A 3D9PA 2IFUA 3CVVA 1LD8A 3IBEA 4CDMA 3NOCD 1Z5SC 3CVWA 3FULA 4N2QA 3RO2A 2ETBA 1A5EA 4XIFA 2HR2A 3SBTB 1ELWA 4KVOA 3TWVA 4WAFA 2WXNA 5A23A 3CSTA 4GA2A 4CEMA 4JZYA 1UJJA 5EX3A 1U2VG 5CMWA 4K5BA 3Q4AB 4LG6A 3R9AB 2CG2A 3UINC 2DVWA 3FUNA 3FUIA 4Y6WA 2QYJA 4HRMB 5FQ4A 3VLEA 4UWFA 5AQ7A 2OEVA 2P9LG 3TXNA 2J8SD 2QZAA 2VGEA 3ASDA 1VDYA 4BT9A 3SD5A 3T8MA 3HYMB 1N9AA 1OY3D 3O48A 3ASHA 3RSEG 2IF4A 2PL2A 3ULQA 2BF0X 2L6JA 2MHKA 4N3CA 2PM7A 3ZIMA 5EYLA 3ZXSA 3ZVVA 1TYQG 4JXTA 3T8KA 5HS0A 3QNKA 3ZXPA 4U07A 4J8YA 1Z6TA 2P9KG 4MS6A 3S7DA 3APCA 4LNGA 5ENOD 5T3RA 3G2VA 5EIDA 1IHBA 4GYYA 4I9EA 3IXEA 4RG9A 5CEAA 4GTRA 2I1KA 2KXPC 3SHFA 4DLQA 4PH4B 3HVEB 1O1RA 3LDZA 2X38A 3B7BA 3KEZA 4LERA 3NB2A 3PZ4A 5JJ7A 3PNTB 4YVQC 4GTMA 4FADA 4J7WA 4AVXA 1N4RA 3WXXA 3ESLA 5LOZA 2AJAA 2GRPB 4GMJA 3RRMB 5EKQD 3CHQA 3I5PA 5EYPF 1A17A 5AENA 4I6GA 2JEKA 3LJ3A 3E4BA 2IJGX 3QWWA 3ZHEB 2NXPA 1ELRA 4URKA 3CR3A 1EPUA 5FQ8A 2L0IA 4F6RD 3SF4A 5CRVA 3G2SA 4G8KA 4A55A 1SQMA 5JMND 4RSYA 1H0AA 1LD7A 1S63A 2PNNA 1JWFA 3E37A 1H6PA 4ANWA 3FUDA 4JA9A 3CHMA 4B89A 2YNQA 4EBAA 4IRUA 3DSWA 5AJDA 4Y6CA 4NIKA 2EINE 1IXVA 2IQCA 3CGHA 2OVFA 2F8XK 1N11A 3KD7A 4CZ2D 2CHZA 4DJAA 2AW6A 3QARA 2OOEA 5D2MC 2XPYA 3O4ZA 2P2CP 2HE0A 4U63A 3D9HA 4BWRA 3Q47B 4MLPA 5BPPA 3FH7A 2ZXWE 4O60A 3B13A 2KCKA 4GZ3A 3KSLA 5EDSA 5AAOA 4J6IA 3C3QA 1Y8MA 2WXPA 4PS7A 5LFAA 2DBAA 3CQCB 2UWJG 3FDHA 2Y4TA 4EECA 4GYOA 3ZRHA 1MYOA 5B1AE 1N0RA 2LAIA 3AU5A 3LCAA 4U96D 3FU6A 5HRYA 1HE8A 4JVSA 4GAAA 2A5EA 3UI2A 4FLBA 1TR4A 1FT1A 4U0UA 2CHWA 3ZKJA 2NYJA 5C2YA 2YQ8A 4XKCA 3CEQA 4A3VA 2Y1LE 1E8ZA 4L2YA 1JWGA 3LVQE 5CERB 2E0IA 1OT8A 4AP2A 3MA5A 5JJ6A 3IHVA 4HOSA 4EBAG 1INZA 3ONLA 4AJWA 4I1MA 1QBQA 5M72A 2DZOA 3N71A 2IONA 1WM5A 3L13A 3FU3A 4FJZA 4CRWA 2WB2A 3TXMA 1UG3A 2P9UG 2BKKB 3B7UX 3CHSA 4I1AA 2WXRA 5E76A 4YVOA 2QY7A 3EUVA 1FT2A 2KATA 2R05A 4DI3A 2XENA 5ANLA 4M3OA 4KZCA 4GZ5A 4BFRA 1OWOA 2C0LA 4CT4A 4EPZA 3GYZA 5CBOA 4GCOA 4K5CA 3HDXA 2DZNA 3I3NA 4UWHA 4JEHA 1QZ2A 3PNLB 3D9MA 4DK5A 3T5VA 2WPVA 3MKQA 4HNAD 3L9TA 1ZBPA 5AYWD 3OAWA 4J8DA 4TXRA 4D10C 4TXQA 4DLOA 4KMOA 2C2LA 2B0OE 5HKPA 3RKVA 5CMYA 3FUJA 2KBXA 4FP7A 2RKKA 3GZ1A 4FLHA 1UN9A 1FCHA 1N54A 2FI7A 3QC1A 5G05C 3U66A 4APOA 4GTPA 3APFA 4ANVA 3QKYA 4E85A 4FHJA 2X3MA 3Q75A 4HQDA 4BESA 5J08A 1OWNA 5BUZA 3EHRA 4XI9A 3Q7AA 3EHQA 1H2UA 4PDXA 4GTQA 1KT1A 1U3DA 3EHMA 2P58C 4WNGA 2AXVA 3TWRA 1N0QA 1P5QA 2Y3AA 3LEWA 3B7TA 2XCCA 1K1AA 3OXFA 5JA4D 4XZ4A 2VSOE 2XEHA 3BG1B 4U8YD 1UJKA 3FTYA 5KBAA 3I4GA 4TV3A 1Q2ZA 3B7SA 2C0MA 1JCRA 4ACKA 3L6AA 4K0RA 4EHMA 4HORA 5H7PA 1TJFA 3E34A 3DRAA 3HHMA 1TNBA 2BEDA 5EN5D 4GTTA 2AVPA 2XEEA 4G24A 1OUVA 3SFYA 1IQUA 4WWPA 4MBGA 3FH8A 3S7FA 5EX0A 5C1DA 2M63A 4U95D 3PVLA 1Z3YA 3PEUB 1Z3XA 1GW6A 4OVVA 5ENTD 2AXZA 1HS6A 2R02A 2V4LA 2VTBA 1JCQA 5ARFA 4AY5A 2A4ZA 2Y0BG 3UM1A 3AG4E 4CYMD 3UUXA 4W9RA 3UX4A 3TG5A 4L23A 4XX5A 2MRIA 3CKBA 2VSNA 5CCLA 4GPKA 4NURA 4WUYA 4IULA 4JB8P 3ABME 1TN7A 1N4PA 2L6BA 3R9MA 2XRYA 3C98A 1SA5A 2WXGA 3FEYA 2XZTG 2GROB 1DCQA 1BPOA 2H6IA 5FINA 4GB9A 3V79K 2CFZA 3JUIA 4CGVA 2WQHA 5DIZA 3CK8A 5AQBA 2CFUA 4JHRA 1FVHA 3RO3A 2OVBA 5T8IA 2HYZA 2GGFA 2KM4A 3CHOA 5G04C 5J90A 1SZ9A 2XS1A 1S70B 1U3CA 2V4HC 1BD8A 4I6EA 3HIZA 3UMVA 2IO2C 3RRUA 5EILA 3Q9NC 1TNUA 5ENSD 2F37A 3GZ2A 1MJ0A 3DSVA 1X5BA 2RD0A 4P29A 3TWSA 4AEZC 1IKND 3FP3A 2WXKA 1QYMA 4GA1A 3L22A 2WXJA 3FUFA 3ZYQA 2EILE 3FTUA 1HZ4A 1O1TA 5BNWA 4PUCA 4Q96A 1FVFA 3UQ3A 3W9FA 1OCZE 3TL5A 4E6HA 4WNFA 5BV1A 5AARA 1KT0A 3E30A 3L08A 5AQAA 3PE3A 3JXJA 3AG3E 1L5JA 3ESKA 3U64A 4MRUA 2QYUA 3LY7A 3TG4A 1D8DA 5BT1A 4DX7D 4CDNA
chains in the Genus database with same CATH topology
2OVFA 3TJPA 3MCXA 4AOFA 5HQ8A 4LUNU 5BV0A 4FHKA 2VGYA 1PC2A 1E7VA 3KD7A 5ARGA 4UWLA 2CHZA 1QNFA 4N3BA 4DJAA 2AW6A 3LY8A 3QARA 2OOEA 2XPYA 3O4ZA 3NQPA 4LRZA 4U63A 1HO8A 4BWRA 3LKUA 3Q47B 4MLPA 3UPVA 5FQ7A 3FUMA 5BPPA 4HXIA 5JJTA 3RIBA 3JQ0A 3FH7A 2LSUA 2WQ7A 3RK6A 5G55A 1PAQA 4O6FA 3LYAA 4C9BB 3B13A 3PEVB 3APDA 2KCKA 3CVUA 4HOQA 4CT0A 4GZ3A 5LCWJ 4YNDA 5FWQA 5EDSA 4U04A 2UY1B 4J6IA 4C0EA 3S7JA 1Y8MA 2WXPA 4EZKA 4N2SA 4BY6A 1Y6IA 4PS7A 3ZW3A 5LFAA 2DBAA 3CQCB 2UWJG 3FDHA 4QFVA 2I1JA 5JHAA 2Y4TA 4EECA 3FHEA 2E2EA 4C0MA 4GYOA 4KBQA 3ENEA 4A3TA 3FUHA 4L1BA 5FZQA 3ZRHA 1E8WA 5A7DB 2X6JA 4WWNA 3MEKA 3ZYLA 3JYSA 4JA7A 2LAIA 3AU5A 4TUUA 3Q15A 1MHQA 3VTYA 4JHKA 1B89A 2I6HA 3LCAA 1NP7A 4XE0A 1XNFA 3FU6A 4PS8A 1HE8A 3D9NA 3MJWA 4GAAA 4JVSA 4FLBA 4EQFA 3FEXA 4B8CB 1E8XA 2FBNA 3QDNA 3RU0A 4APFA 3Q5MA 4UWGA 4GCNA 1WAO1 2VGXA 4GA0A 2DIWA 3CIAA 2YHEA 5FTPA 3FWVA 3CKCA 3ZPJA 4U0UA 2XGMA 2CHWA 2KCVA 5KJKA 3JCKC 1E7UA 2XHEA 3U9WA 1ELKA 5C2YA 2OV8A 4L2LA 2VTBB 2YQ8A 4XKCA 2J4DA 3URZA 3CEQA 4I2WA 1EDUA 2PM6A 4A3VA 1E8ZA 4K03A 2IOSA 4I43A 4L2YA 1JWGA 3LVQE 2E0IA 4G25A 1NA0A 4F1SA 4GZ6A 2YINA 3EDTB 2XGOA 4HS2A 3MA5A 5JJ6A 3IHVA 3CLJA 4AP2A 2IOLA 4BTBA 2FO7A 3CVQA 4HOSA 2NC9A 3EIJA 3NF1A 4J8SA 1W3BA 4EBAG 1INZA 3ONLA 1DVPA 1HH8A 3CHRA 4AJWA 4I1MA 4IYPA 4UWKA 3SGHA 4H7YA 2WXFA 4MKTA 4G26A 3D9KA 5M72A 4J8EA 3N71A 1OWLA 3ONKA 3ZYMA 3T5XA 4EZLA 2IONA 1WM5A 3MV3B 3IEGA 3FU3A 3L13A 2Q7FA 4FJZA 4CRWA 3ZGQA 1EYHA 4N3AA 4F7AA 2WB2A 5A6CA 4GMLA 4HOTA 4FJYA 4UI9J 5AJLA 3NZSA 2J08A 3VTXA 3HVEA 3RJVA 3TXMA 1QQEA 1UG3A 4I2ZA 5ANRA 3TAXA 4ILIA 3SI5A 3B7UX 4HLEA 2WXQA 3CHSA 2LNIA 3QJZA 4I1AA 3D3MA 2WXRA 2WXHA 5E76A 4YVOA 2QY7A 4GU5A 4RG6A 2KATA 3CVYA 3ASGA 4DI3A 1OWMA 3KS2A 1S0PA 3CV0A 3FTXA 3D9IA 4M3OA 5ANLA 3S7BA 5DBKA 4EZJA 4BX9A 4N39A 4KZCA 2X6HA 3DBSA 4GZ5A 1KLXA 3ML9A 3AS5A 2YHCA 3PUJA 4BFRA 4WWOA 4IN3B 1OWOA 3K9IA 4FA6A 3CVXA 2C0LA 3QAQA 4CT4A 2X6KA 1HX8A 4UQYA 3CVPA 3EJNA 3IV0A 4EPZA 1WY6A 4V3IA 4UI9C 4ATGA 1HXIA 2X6FA 1DNPA 5KJMA 3GYZA 4GCOA 1N52A 4JW1A 3HDXA 4KYOB 4AV7A 3I3NA 4UWHA 4JEHA 1QZ2A 3PNLB 3D9MA 5G05J 4BT8A 1H2VC 4DK5A 3T5VA 2WPVA 3MKQA 4HOUA 4B0ZA 2CG3A 1ZBPA 2VQ2A 5AYWD 3UT7A 3GZSA 2L0TB 3IHYA 4G23A 5FT9A 4A1GA 3LY9A 4F53A 4GYWA 2J4BA 2IU1A 3MX3A 4NACA 3ZHEA 3OAWA 4UQZA 3QB2A 4J8DA 4D10C 2FULA 4HFGA 4RVBA 2KZTA 4KZ0A 4KMOA 4DLOA 3OXGA 4CGWA 2C2LA 4AM9A 5E75A 3B7RL 2RG8A 3RKVA 5CMYA 3FUJA 2BUGA 1HFAA 3MKRA 4FP7A 3GZ1A 3DPDA 3LS8A 4FLHA 1UN9A 2KC7A 1H19A 1FCHA 1N54A 4OYSA 3CHPA 2FI7A 3QC1A 5G05C 3RRNB 4APOA 3U66A 2R5SA 3APFA 4ANVA 3JQ1A 3CSFA 3QKYA 4UQXA 5D0QD 4E85A 3PH0C 4FHJA 2X3MA 3SZ7A 5J08A 4PS3A 1OWNA 4BX8A 1HG2A 3FTVA 5BUZA 2LSVA 3UT8A 2CHXA 3P1UA 3FFLA 1JPLA 2ILRA 4XI9A 4OVUA 2V5FA 3AS4A 3L54A 2V0PA 1E90A 1IHGA 2VSXE 1H2UA 4XKBA 4PDXA 3PUKA 4KT6B 5FQ6A 1KT1A 1U3DA 3ZN3A 3MV2B 3EHMA 2P58C 3AU4A 2AXVA 4FC8A 3D9PA 4WNGA 4DI4A 3MGBA 2IFUA 3CVVA 1EF1C 2R59A 2GRLA 3IBEA 4CDMA 3ZFWA 1P5QA 2WVIA 4I9CA 2XEVA 2Y3AA 4KVMA 3LEWA 3B7TA 3G2UA 4GZDA 3CVWA 2XCCA 3FULA 4FU3A 1TEZA 3RO2A 4N2QA 1NA3A 1OWPA 2XPZA 1E8YA 4N5CA 4XIFA 2HR2A 2AXUA 2J07A 3SBTB 1ELWA 4KVOA 2R17C 3OXFA 3SBSA 4XZ4A 2VSOE 3BG1B 2VJ8A 1UJKA 3FTYA 1HG5A 3KAEA 4WAFA 3I4GA 4TV3A 2WXNA 2I9CA 3B7SA 2Y4UA 2C0MA 4J0UA 3GW4A 3CSTA 4GA2A 3FH5A 4UI9K 4CEMA 5A23A 2X6IA 1PY1A 1LF8A 4JZYA 1HF8A 1UJJA 2WMNA 3L6AA 4K0RA 3MKQB 5EX3A 3VLDA 4ACKA 4AXHA 4ABNA 4Q69A 4HORA 5CMWA 3PRZA 1TJFA 1ZU2A 3Q4AB 2XRZA 3HHMA 2DCPA 5JHBA 3TGOA 4KXKB 3R9AB 4CDRA 3NZUA 2CG2A 2JLBA 2AVPA 3FUNA 3FUIA 4G24A 1OUVA 4FULA 4Y6WA 2VSYA 2AWIA 1IQUA 5FQ4A 3VLEA 4WWPA 2WXMA 4UWFA 3FH8A 3S7FA 3PE4A 3CK7A 5EX0A 3QWVA 3U4TA 5C1DA 3CQGB 2XCBA 2M63A 2XGSA 3TXNA 3QWPA 3PVLA 1Z3YA 3PEUB 3PDNA 2LAHA 1Z3XA 1GW6A 4ACLA 5KJLA 4OVVA 4G2VA 5AIJA 4A1SA 3ASDA 3LXUX 1VDYA 4J8FA 1MQSA 2AXZA 4BT9A 3SD5A 1HS6A 4JC8A 3T8MA 1UW4B 2V4LA 4ILGA 4HVBA 2VTBA 4U8HA 3HYMB 5ARFA 2A5UA 4AY5A 2A4ZA 3BEEA 3UUXA 4W9RA 3MZLB 4R7LA 5FJYA 3O48A 3LVRE 3UX4A 2VGXB 5KCMA 3ASHA 5KJNA 2WXLA 3TG5A 4L23A 4XX5A 3UT4A 2NSZA 2PQRA 4TRQA 2MRIA 2IF4A 2PL2A 3CKBA 2VSNA 1UN8A 3CVNA 4LCTA 3ULQA 3AS8A 3FUEA 2BF0X 2L6JA 3PZDA 4JHJA 5CCLA 2MHKA 4GPKA 4NURA 5FZSA 4G11A 3VLFA 4N3CA 2PM7A 3ZIMA 4WUYA 4I6JA 4IULA 3ZXSA 3ZVVA 3BG0B 4JXTA 3QNKA 4H7XA 4U07A 1TJCA 1Z6TA 2XRYA 2XPIA 2HO1A 2WQ6A 4MS6A 2J09A 2GRMA 3S7DA 2ZU6B 3APCA 2WMOA 3C98A 5T3RA 3G2VA 2WXGA 3FEYA 4GYYA 1BPOA 4B94A 5FZRA 3FUKA 2WXOA 4I9EA 1JUQA 3L16A 4RG9A 5G04J 4AY6A 4WNEA 2KCLA 2I1KA 3MYVA 2CFZA 4GB9A 3JUIA 3SHFA 4DLQA 3CVLA 4PH4B 3HVEB 4CGVA 5LX8A 2WQHA 5ENNA 3LDZA 5DIZA 2X38A 3CK8A 2CFUA 4G1TA 4JHRA 3LPZA 1FVHA 3D9LA 5LP0A 3D9JA 3KEZA 3L17A 3G2TA 3SNXA 3RO3A 4LERA 3PS6A 2OVBA 2BTDA 4B8AA 5T8IA 2FF4A 2HYZA 5JJ7A 5LCWC 4JPSA 2GGFA 2KM4A 3PNTB 4YVQC 4ILHB 4FADA 5CCMA 3FTZA 4WNDA 3CHOA 3D9OA 5G2NA 4JEUA 4AVXA 1YA0A 3R7QA 3WXXA 5G04C 2J49A 3ESLA 3OTNA 4XI0A 1SZ9A 2EQXA 5LOZA 4NQ0A 5J90A 2L9BA 1U3CA 2I2OA 4GMJA 3R7RA 4DPRA 4I6EA 3RRMB 2UY1A 3SFZA 5EKQD 3CHQA 3HIZA 3UMVA 3ASFA 3U3WA 3EIQC 3I5PA 4U0SA 3ZYKA 3RRUA 3FU5A 1A17A 2MOWA 3Q49B 4JL0A 3GZ2A 3CK9A 5AENA 4CCAA 4I6GA 1X5BA 2V8SE 2RD0A 2JEKA 3IKOB 3LJ3A 4P29A 3ZEFA 3E4BA 4AEZC 3FP3A 2WXKA 5D0OD 2IJGX 1H6KA 4F3VA 5HI7A 4GA1A 3L22A 3QWWA 3ZHEB 2NXPA 2FEZA 4AIFA 5CHEE 3S2AA 1ELRA 2QFCA 3OXLA 2WXJA 3FUFA 3PREA 3ZYQA 4URKA 3QK0A 3G2WA 2KZTB 3FTUA 1HZ4A 3CR3A 3FY4A 5BNWA 1EPUA 4PUCA 4Q96A 1FVFA 3EHNA 2LO6A 4GZCA 2WM9A 5FQ8A 3UQ3A 1IYGA 2PZIA 1E96B 3FTWA 2L0IA 3TL5A 4BSXA 4ANXA 4Q94A 4E6HA 4WNFA 1H2TC 5BV1A 4I1OB 1KT0A 1SZAA 3SF4A 3G2SA 2HM8A 3L08A 4A55A 1SQMA 3PE3A 4ME2A 4ANUA 4RSYA 1H0AA 2J9QA 4U0ZA 5BW8C 1L5JA 2WXIA 3ESKA 3U64A 2VYIA 4LEUA 4MRUA 1JWFA 3P2BA 5T4YA 3I4RB 4ANWA 3FUDA 4I17A 4JA9A 3CHMA 3FU0A 3ML8A 3QOUA 1IQRA 3LY7A 2YNQA 3TG4A 4NRHB 4B89A 4BTAA 4CDNA 4IRUA 4EBAA 1NZNA 2XQ0A 5AJDA 2PQNA 4Y6CA 5BT1A 4L7TA 1HU3A 1XGWA 2ONDA 2IQCA 2GW1A 3CGHA 3FTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQ8 A;  2VGY A;  1PC2 A;  3KD7 A;  5ARG A;  4N3B A;  3LY8 A;  2OOE A;  4BWR A;  3LKU A;  3Q47 B;  3UPV A;  5JJT A;  3RIB A;  2LSU A;  4O6F A;  3LYA A;  2KCK A;  4HOQ A;  4GZ3 A;  5LCW J;  4YND A;  4U04 A;  2UY1 B;  3S7J A;  1Y8M A;  4N2S A;  2DBA A;  2UWJ G;  2Y4T A;  2E2E A;  4GYO A;  4KBQ A;  5FZQ A;  5A7D B;  3MEK A;  3JYS A;  4JA7 A;  3Q15 A;  3VTY A;  2I6H A;  1B89 A;  3LCA A;  1XNF A;  4EQF A;  2FBN A;  3QDN A;  3RU0 A;  3Q5M A;  4GCN A;  1WAO 1;  2VGX A;  4GA0 A;  5FTP A;  3FWV A;  3CKC A;  3ZPJ A;  4U0U A;  2XGM A;  2KCV A;  5KJK A;  2YQ8 A;  3URZ A;  3CEQ A;  4I2W A;  4G25 A;  1NA0 A;  4GZ6 A;  3EDT B;  2XGO A;  4BTB A;  3MA5 A;  5JJ6 A;  2FO7 A;  3CVQ A;  4HOS A;  2NC9 A;  3NF1 A;  1W3B A;  1HH8 A;  4H7Y A;  4G26 A;  5M72 A;  4J8E A;  3N71 A;  1WM5 A;  3MV3 B;  3IEG A;  2Q7F A;  3ZGQ A;  4N3A A;  5A6C A;  4HOT A;  4UI9 J;  3VTX A;  3RJV A;  1QQE A;  4I2Z A;  3TAX A;  2LNI A;  4I1A A;  4YVO A;  4RG6 A;  2KAT A;  3ASG A;  3KS2 A;  3S7B A;  3CV0 A;  5DBK A;  4N39 A;  4GZ5 A;  1KLX A;  3AS5 A;  2YHC A;  4IN3 B;  3K9I A;  2C0L A;  4UQY A;  3CVP A;  4UI9 C;  1HXI A;  5KJM A;  3GYZ A;  4GCO A;  4KYO B;  1QZ2 A;  5G05 J;  4BT8 A;  2WPV A;  4HOU A;  1ZBP A;  2VQ2 A;  5AYW D;  4G23 A;  5FT9 A;  3LY9 A;  4GYW A;  3ZHE A;  4UQZ A;  4J8D A;  3OXG A;  4CGW A;  2C2L A;  4AM9 A;  3RKV A;  2BUG A;  3MKR A;  3GZ1 A;  2KC7 A;  1FCH A;  2FI7 A;  5G05 C;  4APO A;  2R5S A;  3QKY A;  4UQX A;  5D0Q D;  3SZ7 A;  2LSV A;  3FFL A;  4XI9 A;  2V5F A;  3AS4 A;  1IHG A;  1KT1 A;  3ZN3 A;  3MV2 B;  2P58 C;  4WNG A;  2IFU A;  3ZFW A;  1P5Q A;  4I9C A;  2XEV A;  2XCC A;  4N2Q A;  3RO2 A;  1NA3 A;  4N5C A;  4XIF A;  2HR2 A;  1ELW A;  3OXF A;  3KAE A;  2Y4U A;  2C0M A;  4J0U A;  3GW4 A;  4GA2 A;  4UI9 K;  5EX3 A;  4ABN A;  4HOR A;  1ZU2 A;  3Q4A B;  3TGO A;  4KXK B;  3R9A B;  4CDR A;  2JLB A;  2AVP A;  4G24 A;  1OUV A;  4Y6W A;  2VSY A;  3S7F A;  3PE4 A;  3CK7 A;  5EX0 A;  3QWV A;  3U4T A;  5C1D A;  2XCB A;  2XGS A;  3QWP A;  3PDN A;  5KJL A;  4G2V A;  4A1S A;  3ASD A;  4J8F A;  4BT9 A;  3HYM B;  5ARF A;  4AY5 A;  3BEE A;  3UUX A;  4W9R A;  5FJY A;  3O48 A;  2VGX B;  3ASH A;  5KJN A;  3TG5 A;  2PQR A;  2IF4 A;  2PL2 A;  3CKB A;  2VSN A;  3CVN A;  3ULQ A;  3AS8 A;  5CCL A;  2L6J A;  4GPK A;  2MHK A;  5FZS A;  4N3C A;  4WUY A;  4H7X A;  4U07 A;  1TJC A;  2XPI A;  2HO1 A;  3S7D A;  4GYY A;  4B94 A;  5FZR A;  4I9E A;  4RG9 A;  5G04 J;  4AY6 A;  4WNE A;  2KCL A;  3CVL A;  4CGV A;  2WQH A;  5DIZ A;  3CK8 A;  4G1T A;  4JHR A;  3LPZ A;  3RO3 A;  2FF4 A;  2HYZ A;  5JJ7 A;  5LCW C;  4YVQ C;  5CCM A;  4WND A;  1YA0 A;  3WXX A;  5G04 C;  4XI0 A;  4NQ0 A;  2UY1 A;  5EKQ D;  3ASF A;  3U3W A;  4U0S A;  1A17 A;  3Q49 B;  4JL0 A;  3GZ2 A;  3CK9 A;  3E4B A;  3FP3 A;  5D0O D;  4F3V A;  5HI7 A;  4GA1 A;  3QWW A;  3ZHE B;  2FEZ A;  4AIF A;  5CHE E;  1ELR A;  2QFC A;  3OXL A;  1HZ4 A;  5BNW A;  3UQ3 A;  1IYG A;  2PZI A;  1E96 B;  4WNF A;  1KT0 A;  3SF4 A;  3PE3 A;  4ME2 A;  2J9Q A;  4U0Z A;  5BW8 C;  3ESK A;  2VYI A;  4LEU A;  4I17 A;  4JA9 A;  3QOU A;  4BTA A;  3LY7 A;  3TG4 A;  4NRH B;  1NZN A;  2PQN A;  4Y6C A;  5BT1 A;  2OND A;  2GW1 A; 
#chains in the Genus database with same CATH topology
 3TJP A;  3MCX A;  3ABK E;  5HQ8 A;  4LUN U;  5BV0 A;  4GTS A;  1PC2 A;  1N95 A;  3ISM C;  4LRZ A;  3HXF A;  3UPV A;  3FUM A;  4HXI A;  2WQ7 A;  3UKU G;  5G55 A;  1PAQ A;  4O6F A;  4RLY A;  3UKR G;  3CVU A;  4HOQ A;  4CT0 A;  3KEA A;  4C0E A;  2B6C A;  4EZK A;  1Y6I A;  3ZW3 A;  3PZ3 A;  4DX2 A;  3ULY A;  3FHE A;  2E2E A;  5A7D B;  3ULE G;  3ZYL A;  4JA7 A;  4UUC A;  1DCE A;  1MHQ A;  4JHK A;  1B89 A;  2I6H A;  1NP7 A;  2P9N G;  3D9N A;  3FEX A;  4B8C B;  3RU0 A;  1OXJ A;  3Q7F A;  1WAO 1;  2DIW A;  2YHE A;  3FWV A;  1SA4 A;  1WDY A;  2XGM A;  4BEP A;  3JCK C;  4L2L A;  3URZ A;  4K03 A;  4F1S A;  5CRU A;  3EDT B;  2XGO A;  2FO7 A;  3CVQ A;  4L9P A;  2WXF A;  3D9K A;  4J8E A;  3ZYM A;  3T5X A;  4EZL A;  5BXO A;  3IEG A;  2Q7F A;  4F7A A;  3ZGQ A;  5A6C A;  4GML A;  4FJY A;  4UI9 J;  5AJL A;  3LJN A;  2J08 A;  1NI1 A;  3HVE A;  3NZS A;  1QQE A;  4I2Z A;  2GRN B;  2ZIS A;  3HXE A;  5ANR A;  4ILI A;  2WXQ A;  4YDE A;  3CVY A;  3KS2 A;  3FTX A;  3S7B A;  3J5Q B;  4BX9 A;  4N39 A;  1KZO A;  3AS5 A;  3PUJ A;  4IN3 B;  2X6K A;  3TWX A;  4TXP A;  4ATG A;  1HXI A;  4KYO B;  2GRQ B;  4BT8 A;  1H2V C;  4B0Z A;  2CG3 A;  3UT7 A;  3JXI A;  5FT9 A;  4NAC A;  3ZHE A;  4HLL A;  3UTM A;  1TNO A;  4UQZ A;  2FUL A;  4HFG A;  4RVB A;  4KZ0 A;  4Z68 A;  4C48 B;  4CGW A;  3B7R L;  3J5P A;  3DPD A;  3LS8 A;  1H19 A;  4DRX E;  1DC2 A;  3RRN B;  2R5S A;  3BUA A;  4DUI A;  3W9G A;  4UQX A;  4HBD A;  4PS3 A;  3FTV A;  3UT8 A;  2CHX A;  3DSS A;  4OVU A;  2V5F A;  3L54 A;  2V0P A;  1E90 A;  4XKB A;  1TN6 A;  3ASO E;  4DX5 D;  3AU4 A;  4DI4 A;  1EF1 C;  3ZFW A;  1K8K G;  4FU3 A;  1TEZ A;  1OWP A;  1E8Y A;  4N5C A;  2MYO A;  2J07 A;  2AXU A;  3SBS A;  2R17 C;  2I9C A;  3FH5 A;  2ETC A;  2X6I A;  3VLD A;  2WMN A;  3MKQ B;  3Q73 A;  3PRZ A;  2FO1 E;  1ZU2 A;  2XRZ A;  2DCP A;  5JHB A;  3TGO A;  3EU5 A;  4CDR A;  3NZU A;  1SVX A;  1YMP A;  4FUL A;  3C5R A;  2ZGD A;  2WXM A;  3CK7 A;  4O1P A;  2P9P G;  3CQG B;  2XCB A;  2XGS A;  3QWP A;  2LAH A;  5KJL A;  4ACL A;  2R03 A;  1MQS A;  4JC8 A;  4HVB A;  2A5U A;  5ENR D;  5FJY A;  3LVR E;  2DWZ A;  2VGX B;  5KCM A;  5KNG A;  3UT4 A;  2NSZ A;  4LCT A;  3CVN A;  3KSQ A;  5FZS A;  1NFI E;  4I6J A;  3RAU A;  2H6H A;  5IY5 E;  3SO8 A;  2XPI A;  2HO1 A;  2GRM A;  2OEW A;  2WMO A;  3Q9U C;  3AAA C;  4B94 A;  1ZB1 A;  5FZR A;  3FUK A;  3T9K A;  4AY6 A;  4WNE A;  1MX6 A;  4YDW A;  4BSZ B;  1RZ4 A;  2IO3 C;  5ENN A;  3ABL E;  3DPY A;  3LPZ A;  3G2T A;  3ZUV B;  4HI8 A;  3PS6 A;  1TNY A;  2BTD A;  4B8A A;  4JPS A;  4ILH B;  4GPM A;  1YA0 A;  3R7Q A;  2J49 A;  4XI0 A;  2EQX A;  1SW6 A;  4NQ0 A;  2I2O A;  2LUH A;  3R7R A;  4DPR A;  2UY1 A;  3SFZ A;  4OAV B;  3U3W A;  3EIQ C;  3ZYK A;  2ZGG A;  4JL0 A;  2XS8 A;  4CCA A;  2ETA A;  1UOH A;  2V8S E;  3IKO B;  3ZEF A;  5D0O D;  4F3V A;  5CHE E;  3S2A A;  2QFC A;  3QK0 A;  3G2W A;  2KZT B;  1V55 E;  3FY4 A;  4GZC A;  1IYG A;  2LO6 A;  2WM9 A;  1E96 B;  3FTW A;  4ANX A;  1D8E A;  4I1O B;  3X2Q E;  1SZA A;  4ME2 A;  2J9Q A;  3V2X A;  4YDO A;  5ITZ F;  4ZHB A;  4I17 A;  3AJI A;  3FU0 A;  3ML8 A;  1MX4 A;  3QOU A;  1IQR A;  4BTA A;  1YCS B;  1NZN A;  2XQ0 A;  4L7T A;  4HLE A;  3FTS A;  3UIP C;  4FHK A;  5ARG A;  4UWL A;  1QNF A;  3NQP A;  4X8Q A;  1HO8 A;  3LKU A;  5JJT A;  3RIB A;  2LSU A;  3RK6 A;  1BU9 A;  4A63 B;  3LYA A;  5CED B;  4C9B B;  1AWC B;  3PEV B;  2F0Y A;  3NOG D;  5LCW J;  3AG2 E;  4YND A;  4U04 A;  5FIO A;  3S7J A;  4M7C A;  4N2S A;  4QFV A;  2I1J A;  5JHA A;  4KBQ A;  1BI7 B;  3ENE A;  4L1B A;  5FZQ A;  4WWN A;  3MEK A;  4TUU A;  1V54 E;  3Q15 A;  1BI8 B;  4XE0 A;  2DYR E;  4PS8 A;  2ZIR A;  4XEI G;  4EQF A;  4G8L A;  1E8X A;  3QDN A;  4APF A;  4GCN A;  3CIA A;  5FTP A;  3CKC A;  3ZPJ A;  3SY2 A;  1E7U A;  2XHE A;  2J4D A;  4I2W A;  1KZP A;  3TWQ A;  2PM6 A;  4I43 A;  1NA0 A;  2YIN A;  4BTB A;  3CLJ A;  5B3S E;  1OCC E;  3NF1 A;  1W3B A;  3SGH A;  4IYP A;  3DST A;  5AN8 A;  4TUM A;  1OWL A;  3ONK A;  4N5Q A;  1KPS B;  4N3A A;  3TWU A;  3VTX A;  4BER A;  3QJZ A;  2LNI A;  3D3M A;  2WXH A;  4HRL A;  4RG6 A;  3HXC A;  1S0P A;  3CV0 A;  3D9I A;  5DBK A;  4EZJ A;  2X6H A;  5KNH D;  1KLX A;  1OCR E;  3ML9 A;  4WWO A;  4FA6 A;  3CVX A;  1HX8 A;  4UQY A;  3CVP A;  2GRR B;  3EJN A;  3HXD A;  2X6F A;  1DNP A;  3C3R A;  5KJM A;  2EIK E;  4JW1 A;  3ZU7 B;  5G05 J;  2RFM A;  2VQ2 A;  4DX1 A;  4A1G A;  2IEJ A;  3UM3 A;  2J4B A;  2IU1 A;  2EIJ E;  4RQI A;  4HI9 A;  3QB2 A;  3HG0 D;  1G3N B;  3OXG A;  4AM9 A;  3AG1 E;  4GMR A;  3PZ1 A;  2BUG A;  1HFA A;  3MKR A;  1AP7 A;  2KC7 A;  2P9I G;  4OYS A;  3L82 A;  3ASN E;  4DX6 D;  3TWW A;  3WG7 E;  5D0Q D;  2QC9 A;  3SZ7 A;  4HB5 A;  2LSV A;  3P1U A;  3FFL A;  1JPL A;  3AS4 A;  3HRA A;  5ENP D;  2VSX E;  5FQ6 A;  3MV2 B;  4FC8 A;  3MGB A;  1K1B A;  2R59 A;  2GRL A;  2WVI A;  4I9C A;  2XEV A;  1WG0 A;  4KVM A;  3G2U A;  4GZD A;  1NA3 A;  2XPZ A;  3DSX A;  4K5A B;  2VJ8 A;  1HG5 A;  3PZ2 A;  3KAE A;  2DYS E;  2Y4U A;  4J0U A;  3GW4 A;  4UI9 K;  3C72 A;  1PY1 A;  1LF8 A;  3TWT A;  3NBN B;  1HF8 A;  4AXH A;  4ABN A;  4HRN A;  4Q69 A;  1N4Q A;  4KXK B;  3B95 A;  2JLB A;  3SFX A;  2VSY A;  2AWI A;  4F1P A;  3PE4 A;  3U4T A;  3QWV A;  5AQ9 A;  3PDN A;  1JCS A;  3HXB A;  4G2V A;  5AIJ A;  4A1S A;  3LXU X;  4J8F A;  1UW4 B;  4ILG A;  4U8H A;  3BEE A;  3MZL B;  1O1S A;  4R7L A;  1TN8 A;  5KJN A;  2WXL A;  3UIO C;  4TRQ A;  2PQR A;  1UN8 A;  3AS8 A;  3FUE A;  3PZD A;  2JAB A;  1X81 A;  4JHJ A;  4G11 A;  3V31 A;  3VLF A;  3BG0 B;  4H7X A;  1TJC A;  2WQ6 A;  2J09 A;  2ZU6 B;  4LSZ E;  3UM2 A;  4LNB A;  3V30 A;  2WXO A;  1JUQ A;  3L16 A;  5G04 J;  2KCL A;  3MYV A;  1NL4 A;  3CVL A;  5LX8 A;  4G1T A;  3D9L A;  5LP0 A;  3D9J A;  3L17 A;  3SNX A;  2FF4 A;  5LCW C;  5CCM A;  3FTZ A;  4WND A;  3D9O A;  5G2N A;  4JEU A;  3OTN A;  3DEP A;  1S64 A;  2L9B A;  2F8Y A;  3ASF A;  4U0S A;  3UM0 A;  3FU5 A;  2MOW A;  3Q49 B;  3CK9 A;  1H6K A;  1D9S A;  5HI7 A;  2H6F A;  2FEZ A;  4AIF A;  3OXL A;  3PRE A;  3EHN A;  2PZI A;  4BSX A;  4Q94 A;  3EU9 A;  1H2T C;  2HM8 A;  5KWD A;  4ANU A;  4U0Z A;  5BW8 C;  2WXI A;  2VYI A;  4LEU A;  5EIB E;  3P2B A;  5T4Y A;  3I4R B;  5ENQ D;  4NRH B;  3Q78 A;  1LTX A;  2PQN A;  1HU3 A;  1XGW A;  2XZD G;  1N94 A;  2OND A;  2GW1 A;  4AOF A;  2IY0 C;  2VGY A;  1E7V A;  2P9S G;  4N3B A;  3LY8 A;  4B93 B;  1FPP A;  2LXL A;  5FQ7 A;  3JQ0 A;  4JD2 G;  2EIM E;  5BXU A;  4GTO A;  4YDY A;  3APD A;  4U8V D;  1N4S A;  5FWQ A;  2UY1 B;  4BY6 A;  4C0M A;  4BET A;  4A3T A;  3FUH A;  1K3Z D;  1E8W A;  2X6J A;  3JYS A;  4U7E B;  3VTY A;  1XNF A;  3MJW A;  2FBN A;  4QQI A;  3Q5M A;  4UWG A;  2VGX A;  4GA0 A;  1YYH A;  4LNU D;  3E33 A;  2KCV A;  5KJK A;  1H6O A;  3U9W A;  1ELK A;  2OV8 A;  2VTB B;  1EDU A;  2IOS A;  3Q79 A;  4G25 A;  4GZ6 A;  2R2L A;  4O1O A;  4HS2 A;  5D66 A;  2IOL A;  2NC9 A;  3EIJ A;  4J8S A;  1DVP A;  1HH8 A;  3CHR A;  4UWK A;  1MZC A;  4H7Y A;  5CEC B;  4MKT A;  4G26 A;  3NAW A;  3DXK G;  3MV3 B;  1EYH A;  4HOT A;  1OCO E;  1BLX B;  3RJV A;  3TAX A;  3SI5 A;  4OAU C;  4GU5 A;  3ASG A;  3F6Q A;  1OWM A;  2RFA A;  1TNZ A;  3DBS A;  2V5Q C;  2YHC A;  3C3O A;  2Y69 E;  3K9I A;  3QAQ A;  4GTV A;  3IV0 A;  3JUE A;  1WY6 A;  4V3I A;  4UI9 C;  3E32 A;  1N52 A;  4AV7 A;  2LXM A;  4HOU A;  1RW2 A;  3DWL G;  5CBN A;  3GZS A;  2L0T B;  3IHY A;  3DXM G;  4G23 A;  1MX2 A;  3LY9 A;  4F53 A;  4GYW A;  4ATZ D;  3MX3 A;  3SQV A;  4ZFH A;  5B1B E;  2KZT A;  3BU8 A;  3BQO A;  5E75 A;  2RG8 A;  3CHP A;  3V2O A;  3JQ1 A;  3DSU A;  3CSF A;  3DEO A;  3PH0 C;  4BX8 A;  1HG2 A;  2OCC E;  2ILR A;  1O5M A;  2H6G A;  1IHG A;  3ZNG A;  3PUK A;  2BKG A;  3UXG A;  4KT6 B;  3ZN3 A;  3D9P A;  2IFU A;  3CVV A;  1LD8 A;  3IBE A;  4CDM A;  3NOC D;  1Z5S C;  3CVW A;  3FUL A;  4N2Q A;  3RO2 A;  2ETB A;  1A5E A;  4XIF A;  2HR2 A;  3SBT B;  1ELW A;  4KVO A;  3TWV A;  4WAF A;  2WXN A;  5A23 A;  3CST A;  4GA2 A;  4CEM A;  4JZY A;  1UJJ A;  5EX3 A;  1U2V G;  5CMW A;  4K5B A;  3Q4A B;  4LG6 A;  3R9A B;  2CG2 A;  3UIN C;  2DVW A;  3FUN A;  3FUI A;  4Y6W A;  2QYJ A;  4HRM B;  5FQ4 A;  3VLE A;  4UWF A;  5AQ7 A;  2OEV A;  2P9L G;  3TXN A;  2J8S D;  2QZA A;  2VGE A;  3ASD A;  1VDY A;  4BT9 A;  3SD5 A;  3T8M A;  3HYM B;  1N9A A;  1OY3 D;  3O48 A;  3ASH A;  3RSE G;  2IF4 A;  2PL2 A;  3ULQ A;  2BF0 X;  2L6J A;  2MHK A;  4N3C A;  2PM7 A;  3ZIM A;  5EYL A;  3ZXS A;  3ZVV A;  1TYQ G;  4JXT A;  3T8K A;  5HS0 A;  3QNK A;  3ZXP A;  4U07 A;  4J8Y A;  1Z6T A;  2P9K G;  4MS6 A;  3S7D A;  3APC A;  4LNG A;  5ENO D;  5T3R A;  3G2V A;  5EID A;  1IHB A;  4GYY A;  4I9E A;  3IXE A;  4RG9 A;  5CEA A;  4GTR A;  2I1K A;  2KXP C;  3SHF A;  4DLQ A;  4PH4 B;  3HVE B;  1O1R A;  3LDZ A;  2X38 A;  3B7B A;  3KEZ A;  4LER A;  3NB2 A;  3PZ4 A;  5JJ7 A;  3PNT B;  4YVQ C;  4GTM A;  4FAD A;  4J7W A;  4AVX A;  1N4R A;  3WXX A;  3ESL A;  5LOZ A;  2AJA A;  2GRP B;  4GMJ A;  3RRM B;  5EKQ D;  3CHQ A;  3I5P A;  5EYP F;  1A17 A;  5AEN A;  4I6G A;  2JEK A;  3LJ3 A;  3E4B A;  2IJG X;  3QWW A;  3ZHE B;  2NXP A;  1ELR A;  4URK A;  3CR3 A;  1EPU A;  5FQ8 A;  2L0I A;  4F6R D;  3SF4 A;  5CRV A;  3G2S A;  4G8K A;  4A55 A;  1SQM A;  5JMN D;  4RSY A;  1H0A A;  1LD7 A;  1S63 A;  2PNN A;  1JWF A;  3E37 A;  1H6P A;  4ANW A;  3FUD A;  4JA9 A;  3CHM A;  4B89 A;  2YNQ A;  4EBA A;  4IRU A;  3DSW A;  5AJD A;  4Y6C A;  4NIK A;  2EIN E;  1IXV A;  2IQC A;  3CGH A;  2OVF A;  2F8X K;  1N11 A;  3KD7 A;  4CZ2 D;  2CHZ A;  4DJA A;  2AW6 A;  3QAR A;  2OOE A;  5D2M C;  2XPY A;  3O4Z A;  2P2C P;  2HE0 A;  4U63 A;  3D9H A;  4BWR A;  3Q47 B;  4MLP A;  5BPP A;  3FH7 A;  2ZXW E;  4O60 A;  3B13 A;  2KCK A;  4GZ3 A;  3KSL A;  5EDS A;  5AAO A;  4J6I A;  3C3Q A;  1Y8M A;  2WXP A;  4PS7 A;  5LFA A;  2DBA A;  3CQC B;  2UWJ G;  3FDH A;  2Y4T A;  4EEC A;  4GYO A;  3ZRH A;  1MYO A;  5B1A E;  1N0R A;  2LAI A;  3AU5 A;  3LCA A;  4U96 D;  3FU6 A;  5HRY A;  1HE8 A;  4JVS A;  4GAA A;  2A5E A;  3UI2 A;  4FLB A;  1TR4 A;  1FT1 A;  4U0U A;  2CHW A;  3ZKJ A;  2NYJ A;  5C2Y A;  2YQ8 A;  4XKC A;  3CEQ A;  4A3V A;  2Y1L E;  1E8Z A;  4L2Y A;  1JWG A;  3LVQ E;  5CER B;  2E0I A;  1OT8 A;  4AP2 A;  3MA5 A;  5JJ6 A;  3IHV A;  4HOS A;  4EBA G;  1INZ A;  3ONL A;  4AJW A;  4I1M A;  1QBQ A;  5M72 A;  2DZO A;  3N71 A;  2ION A;  1WM5 A;  3L13 A;  3FU3 A;  4FJZ A;  4CRW A;  2WB2 A;  3TXM A;  1UG3 A;  2P9U G;  2BKK B;  3B7U X;  3CHS A;  4I1A A;  2WXR A;  5E76 A;  4YVO A;  2QY7 A;  3EUV A;  1FT2 A;  2KAT A;  2R05 A;  4DI3 A;  2XEN A;  5ANL A;  4M3O A;  4KZC A;  4GZ5 A;  4BFR A;  1OWO A;  2C0L A;  4CT4 A;  4EPZ A;  3GYZ A;  5CBO A;  4GCO A;  4K5C A;  3HDX A;  2DZN A;  3I3N A;  4UWH A;  4JEH A;  1QZ2 A;  3PNL B;  3D9M A;  4DK5 A;  3T5V A;  2WPV A;  3MKQ A;  4HNA D;  3L9T A;  1ZBP A;  5AYW D;  3OAW A;  4J8D A;  4TXR A;  4D10 C;  4TXQ A;  4DLO A;  4KMO A;  2C2L A;  2B0O E;  5HKP A;  3RKV A;  5CMY A;  3FUJ A;  2KBX A;  4FP7 A;  2RKK A;  3GZ1 A;  4FLH A;  1UN9 A;  1FCH A;  1N54 A;  2FI7 A;  3QC1 A;  5G05 C;  3U66 A;  4APO A;  4GTP A;  3APF A;  4ANV A;  3QKY A;  4E85 A;  4FHJ A;  2X3M A;  3Q75 A;  4HQD A;  4BES A;  5J08 A;  1OWN A;  5BUZ A;  3EHR A;  4XI9 A;  3Q7A A;  3EHQ A;  1H2U A;  4PDX A;  4GTQ A;  1KT1 A;  1U3D A;  3EHM A;  2P58 C;  4WNG A;  2AXV A;  3TWR A;  1N0Q A;  1P5Q A;  2Y3A A;  3LEW A;  3B7T A;  2XCC A;  1K1A A;  3OXF A;  5JA4 D;  4XZ4 A;  2VSO E;  2XEH A;  3BG1 B;  4U8Y D;  1UJK A;  3FTY A;  5KBA A;  3I4G A;  4TV3 A;  1Q2Z A;  3B7S A;  2C0M A;  1JCR A;  4ACK A;  3L6A A;  4K0R A;  4EHM A;  4HOR A;  5H7P A;  1TJF A;  3E34 A;  3DRA A;  3HHM A;  1TNB A;  2BED A;  5EN5 D;  4GTT A;  2AVP A;  2XEE A;  4G24 A;  1OUV A;  3SFY A;  1IQU A;  4WWP A;  4MBG A;  3FH8 A;  3S7F A;  5EX0 A;  5C1D A;  2M63 A;  4U95 D;  3PVL A;  1Z3Y A;  3PEU B;  1Z3X A;  1GW6 A;  4OVV A;  5ENT D;  2AXZ A;  1HS6 A;  2R02 A;  2V4L A;  2VTB A;  1JCQ A;  5ARF A;  4AY5 A;  2A4Z A;  2Y0B G;  3UM1 A;  3AG4 E;  4CYM D;  3UUX A;  4W9R A;  3UX4 A;  3TG5 A;  4L23 A;  4XX5 A;  2MRI A;  3CKB A;  2VSN A;  5CCL A;  4GPK A;  4NUR A;  4WUY A;  4IUL A;  4JB8 P;  3ABM E;  1TN7 A;  1N4P A;  2L6B A;  3R9M A;  2XRY A;  3C98 A;  1SA5 A;  2WXG A;  3FEY A;  2XZT G;  2GRO B;  1DCQ A;  1BPO A;  2H6I A;  5FIN A;  4GB9 A;  3V79 K;  2CFZ A;  3JUI A;  4CGV A;  2WQH A;  5DIZ A;  3CK8 A;  5AQB A;  2CFU A;  4JHR A;  1FVH A;  3RO3 A;  2OVB A;  5T8I A;  2HYZ A;  2GGF A;  2KM4 A;  3CHO A;  5G04 C;  5J90 A;  1SZ9 A;  2XS1 A;  1S70 B;  1U3C A;  2V4H C;  1BD8 A;  4I6E A;  3HIZ A;  3UMV A;  2IO2 C;  3RRU A;  5EIL A;  3Q9N C;  1TNU A;  5ENS D;  2F37 A;  3GZ2 A;  1MJ0 A;  3DSV A;  1X5B A;  2RD0 A;  4P29 A;  3TWS A;  4AEZ C;  1IKN D;  3FP3 A;  2WXK A;  1QYM A;  4GA1 A;  3L22 A;  2WXJ A;  3FUF A;  3ZYQ A;  2EIL E;  3FTU A;  1HZ4 A;  1O1T A;  5BNW A;  4PUC A;  4Q96 A;  1FVF A;  3UQ3 A;  3W9F A;  1OCZ E;  3TL5 A;  4E6H A;  4WNF A;  5BV1 A;  5AAR A;  1KT0 A;  3E30 A;  3L08 A;  5AQA A;  3PE3 A;  3JXJ A;  3AG3 E;  1L5J A;  3ESK A;  3U64 A;  4MRU A;  2QYU A;  3LY7 A;  3TG4 A;  1D8D A;  5BT1 A;  4DX7 D;  4CDN A; 
#chains in the Genus database with same CATH homology
 2OVF A;  3TJP A;  3MCX A;  4AOF A;  5HQ8 A;  4LUN U;  5BV0 A;  4FHK A;  2VGY A;  1PC2 A;  1E7V A;  3KD7 A;  5ARG A;  4UWL A;  2CHZ A;  1QNF A;  4N3B A;  4DJA A;  2AW6 A;  3LY8 A;  3QAR A;  2OOE A;  2XPY A;  3O4Z A;  3NQP A;  4LRZ A;  4U63 A;  1HO8 A;  4BWR A;  3LKU A;  3Q47 B;  4MLP A;  3UPV A;  5FQ7 A;  3FUM A;  5BPP A;  4HXI A;  5JJT A;  3RIB A;  3JQ0 A;  3FH7 A;  2LSU A;  2WQ7 A;  3RK6 A;  5G55 A;  1PAQ A;  4O6F A;  3LYA A;  4C9B B;  3B13 A;  3PEV B;  3APD A;  2KCK A;  3CVU A;  4HOQ A;  4CT0 A;  4GZ3 A;  5LCW J;  4YND A;  5FWQ A;  5EDS A;  4U04 A;  2UY1 B;  4J6I A;  4C0E A;  3S7J A;  1Y8M A;  2WXP A;  4EZK A;  4N2S A;  4BY6 A;  1Y6I A;  4PS7 A;  3ZW3 A;  5LFA A;  2DBA A;  3CQC B;  2UWJ G;  3FDH A;  4QFV A;  2I1J A;  5JHA A;  2Y4T A;  4EEC A;  3FHE A;  2E2E A;  4C0M A;  4GYO A;  4KBQ A;  3ENE A;  4A3T A;  3FUH A;  4L1B A;  5FZQ A;  3ZRH A;  1E8W A;  5A7D B;  2X6J A;  4WWN A;  3MEK A;  3ZYL A;  3JYS A;  4JA7 A;  2LAI A;  3AU5 A;  4TUU A;  3Q15 A;  1MHQ A;  3VTY A;  4JHK A;  1B89 A;  2I6H A;  3LCA A;  1NP7 A;  4XE0 A;  1XNF A;  3FU6 A;  4PS8 A;  1HE8 A;  3D9N A;  3MJW A;  4GAA A;  4JVS A;  4FLB A;  4EQF A;  3FEX A;  4B8C B;  1E8X A;  2FBN A;  3QDN A;  3RU0 A;  4APF A;  3Q5M A;  4UWG A;  4GCN A;  1WAO 1;  2VGX A;  4GA0 A;  2DIW A;  3CIA A;  2YHE A;  5FTP A;  3FWV A;  3CKC A;  3ZPJ A;  4U0U A;  2XGM A;  2CHW A;  2KCV A;  5KJK A;  3JCK C;  1E7U A;  2XHE A;  3U9W A;  1ELK A;  5C2Y A;  2OV8 A;  4L2L A;  2VTB B;  2YQ8 A;  4XKC A;  2J4D A;  3URZ A;  3CEQ A;  4I2W A;  1EDU A;  2PM6 A;  4A3V A;  1E8Z A;  4K03 A;  2IOS A;  4I43 A;  4L2Y A;  1JWG A;  3LVQ E;  2E0I A;  4G25 A;  1NA0 A;  4F1S A;  4GZ6 A;  2YIN A;  3EDT B;  2XGO A;  4HS2 A;  3MA5 A;  5JJ6 A;  3IHV A;  3CLJ A;  4AP2 A;  2IOL A;  4BTB A;  2FO7 A;  3CVQ A;  4HOS A;  2NC9 A;  3EIJ A;  3NF1 A;  4J8S A;  1W3B A;  4EBA G;  1INZ A;  3ONL A;  1DVP A;  1HH8 A;  3CHR A;  4AJW A;  4I1M A;  4IYP A;  4UWK A;  3SGH A;  4H7Y A;  2WXF A;  4MKT A;  4G26 A;  3D9K A;  5M72 A;  4J8E A;  3N71 A;  1OWL A;  3ONK A;  3ZYM A;  3T5X A;  4EZL A;  2ION A;  1WM5 A;  3MV3 B;  3IEG A;  3FU3 A;  3L13 A;  2Q7F A;  4FJZ A;  4CRW A;  3ZGQ A;  1EYH A;  4N3A A;  4F7A A;  2WB2 A;  5A6C A;  4GML A;  4HOT A;  4FJY A;  4UI9 J;  5AJL A;  3NZS A;  2J08 A;  3VTX A;  3HVE A;  3RJV A;  3TXM A;  1QQE A;  1UG3 A;  4I2Z A;  5ANR A;  3TAX A;  4ILI A;  3SI5 A;  3B7U X;  4HLE A;  2WXQ A;  3CHS A;  2LNI A;  3QJZ A;  4I1A A;  3D3M A;  2WXR A;  2WXH A;  5E76 A;  4YVO A;  2QY7 A;  4GU5 A;  4RG6 A;  2KAT A;  3CVY A;  3ASG A;  4DI3 A;  1OWM A;  3KS2 A;  1S0P A;  3CV0 A;  3FTX A;  3D9I A;  4M3O A;  5ANL A;  3S7B A;  5DBK A;  4EZJ A;  4BX9 A;  4N39 A;  4KZC A;  2X6H A;  3DBS A;  4GZ5 A;  1KLX A;  3ML9 A;  3AS5 A;  2YHC A;  3PUJ A;  4BFR A;  4WWO A;  4IN3 B;  1OWO A;  3K9I A;  4FA6 A;  3CVX A;  2C0L A;  3QAQ A;  4CT4 A;  2X6K A;  1HX8 A;  4UQY A;  3CVP A;  3EJN A;  3IV0 A;  4EPZ A;  1WY6 A;  4V3I A;  4UI9 C;  4ATG A;  1HXI A;  2X6F A;  1DNP A;  5KJM A;  3GYZ A;  4GCO A;  1N52 A;  4JW1 A;  3HDX A;  4KYO B;  4AV7 A;  3I3N A;  4UWH A;  4JEH A;  1QZ2 A;  3PNL B;  3D9M A;  5G05 J;  4BT8 A;  1H2V C;  4DK5 A;  3T5V A;  2WPV A;  3MKQ A;  4HOU A;  4B0Z A;  2CG3 A;  1ZBP A;  2VQ2 A;  5AYW D;  3UT7 A;  3GZS A;  2L0T B;  3IHY A;  4G23 A;  5FT9 A;  4A1G A;  3LY9 A;  4F53 A;  4GYW A;  2J4B A;  2IU1 A;  3MX3 A;  4NAC A;  3ZHE A;  3OAW A;  4UQZ A;  3QB2 A;  4J8D A;  4D10 C;  2FUL A;  4HFG A;  4RVB A;  2KZT A;  4KZ0 A;  4KMO A;  4DLO A;  3OXG A;  4CGW A;  2C2L A;  4AM9 A;  5E75 A;  3B7R L;  2RG8 A;  3RKV A;  5CMY A;  3FUJ A;  2BUG A;  1HFA A;  3MKR A;  4FP7 A;  3GZ1 A;  3DPD A;  3LS8 A;  4FLH A;  1UN9 A;  2KC7 A;  1H19 A;  1FCH A;  1N54 A;  4OYS A;  3CHP A;  2FI7 A;  3QC1 A;  5G05 C;  3RRN B;  4APO A;  3U66 A;  2R5S A;  3APF A;  4ANV A;  3JQ1 A;  3CSF A;  3QKY A;  4UQX A;  5D0Q D;  4E85 A;  3PH0 C;  4FHJ A;  2X3M A;  3SZ7 A;  5J08 A;  4PS3 A;  1OWN A;  4BX8 A;  1HG2 A;  3FTV A;  5BUZ A;  2LSV A;  3UT8 A;  2CHX A;  3P1U A;  3FFL A;  1JPL A;  2ILR A;  4XI9 A;  4OVU A;  2V5F A;  3AS4 A;  3L54 A;  2V0P A;  1E90 A;  1IHG A;  2VSX E;  1H2U A;  4XKB A;  4PDX A;  3PUK A;  4KT6 B;  5FQ6 A;  1KT1 A;  1U3D A;  3ZN3 A;  3MV2 B;  3EHM A;  2P58 C;  3AU4 A;  2AXV A;  4FC8 A;  3D9P A;  4WNG A;  4DI4 A;  3MGB A;  2IFU A;  3CVV A;  1EF1 C;  2R59 A;  2GRL A;  3IBE A;  4CDM A;  3ZFW A;  1P5Q A;  2WVI A;  4I9C A;  2XEV A;  2Y3A A;  4KVM A;  3LEW A;  3B7T A;  3G2U A;  4GZD A;  3CVW A;  2XCC A;  3FUL A;  4FU3 A;  1TEZ A;  3RO2 A;  4N2Q A;  1NA3 A;  1OWP A;  2XPZ A;  1E8Y A;  4N5C A;  4XIF A;  2HR2 A;  2AXU A;  2J07 A;  3SBT B;  1ELW A;  4KVO A;  2R17 C;  3OXF A;  3SBS A;  4XZ4 A;  2VSO E;  3BG1 B;  2VJ8 A;  1UJK A;  3FTY A;  1HG5 A;  3KAE A;  4WAF A;  3I4G A;  4TV3 A;  2WXN A;  2I9C A;  3B7S A;  2Y4U A;  2C0M A;  4J0U A;  3GW4 A;  3CST A;  4GA2 A;  3FH5 A;  4UI9 K;  4CEM A;  5A23 A;  2X6I A;  1PY1 A;  1LF8 A;  4JZY A;  1HF8 A;  1UJJ A;  2WMN A;  3L6A A;  4K0R A;  3MKQ B;  5EX3 A;  3VLD A;  4ACK A;  4AXH A;  4ABN A;  4Q69 A;  4HOR A;  5CMW A;  3PRZ A;  1TJF A;  1ZU2 A;  3Q4A B;  2XRZ A;  3HHM A;  2DCP A;  5JHB A;  3TGO A;  4KXK B;  3R9A B;  4CDR A;  3NZU A;  2CG2 A;  2JLB A;  2AVP A;  3FUN A;  3FUI A;  4G24 A;  1OUV A;  4FUL A;  4Y6W A;  2VSY A;  2AWI A;  1IQU A;  5FQ4 A;  3VLE A;  4WWP A;  2WXM A;  4UWF A;  3FH8 A;  3S7F A;  3PE4 A;  3CK7 A;  5EX0 A;  3QWV A;  3U4T A;  5C1D A;  3CQG B;  2XCB A;  2M63 A;  2XGS A;  3TXN A;  3QWP A;  3PVL A;  1Z3Y A;  3PEU B;  3PDN A;  2LAH A;  1Z3X A;  1GW6 A;  4ACL A;  5KJL A;  4OVV A;  4G2V A;  5AIJ A;  4A1S A;  3ASD A;  3LXU X;  1VDY A;  4J8F A;  1MQS A;  2AXZ A;  4BT9 A;  3SD5 A;  1HS6 A;  4JC8 A;  3T8M A;  1UW4 B;  2V4L A;  4ILG A;  4HVB A;  2VTB A;  4U8H A;  3HYM B;  5ARF A;  2A5U A;  4AY5 A;  2A4Z A;  3BEE A;  3UUX A;  4W9R A;  3MZL B;  4R7L A;  5FJY A;  3O48 A;  3LVR E;  3UX4 A;  2VGX B;  5KCM A;  3ASH A;  5KJN A;  2WXL A;  3TG5 A;  4L23 A;  4XX5 A;  3UT4 A;  2NSZ A;  2PQR A;  4TRQ A;  2MRI A;  2IF4 A;  2PL2 A;  3CKB A;  2VSN A;  1UN8 A;  3CVN A;  4LCT A;  3ULQ A;  3AS8 A;  3FUE A;  2BF0 X;  2L6J A;  3PZD A;  4JHJ A;  5CCL A;  2MHK A;  4GPK A;  4NUR A;  5FZS A;  4G11 A;  3VLF A;  4N3C A;  2PM7 A;  3ZIM A;  4WUY A;  4I6J A;  4IUL A;  3ZXS A;  3ZVV A;  3BG0 B;  4JXT A;  3QNK A;  4H7X A;  4U07 A;  1TJC A;  1Z6T A;  2XRY A;  2XPI A;  2HO1 A;  2WQ6 A;  4MS6 A;  2J09 A;  2GRM A;  3S7D A;  2ZU6 B;  3APC A;  2WMO A;  3C98 A;  5T3R A;  3G2V A;  2WXG A;  3FEY A;  4GYY A;  1BPO A;  4B94 A;  5FZR A;  3FUK A;  2WXO A;  4I9E A;  1JUQ A;  3L16 A;  4RG9 A;  5G04 J;  4AY6 A;  4WNE A;  2KCL A;  2I1K A;  3MYV A;  2CFZ A;  4GB9 A;  3JUI A;  3SHF A;  4DLQ A;  3CVL A;  4PH4 B;  3HVE B;  4CGV A;  5LX8 A;  2WQH A;  5ENN A;  3LDZ A;  5DIZ A;  2X38 A;  3CK8 A;  2CFU A;  4G1T A;  4JHR A;  3LPZ A;  1FVH A;  3D9L A;  5LP0 A;  3D9J A;  3KEZ A;  3L17 A;  3G2T A;  3SNX A;  3RO3 A;  4LER A;  3PS6 A;  2OVB A;  2BTD A;  4B8A A;  5T8I A;  2FF4 A;  2HYZ A;  5JJ7 A;  5LCW C;  4JPS A;  2GGF A;  2KM4 A;  3PNT B;  4YVQ C;  4ILH B;  4FAD A;  5CCM A;  3FTZ A;  4WND A;  3CHO A;  3D9O A;  5G2N A;  4JEU A;  4AVX A;  1YA0 A;  3R7Q A;  3WXX A;  5G04 C;  2J49 A;  3ESL A;  3OTN A;  4XI0 A;  1SZ9 A;  2EQX A;  5LOZ A;  4NQ0 A;  5J90 A;  2L9B A;  1U3C A;  2I2O A;  4GMJ A;  3R7R A;  4DPR A;  4I6E A;  3RRM B;  2UY1 A;  3SFZ A;  5EKQ D;  3CHQ A;  3HIZ A;  3UMV A;  3ASF A;  3U3W A;  3EIQ C;  3I5P A;  4U0S A;  3ZYK A;  3RRU A;  3FU5 A;  1A17 A;  2MOW A;  3Q49 B;  4JL0 A;  3GZ2 A;  3CK9 A;  5AEN A;  4CCA A;  4I6G A;  1X5B A;  2V8S E;  2RD0 A;  2JEK A;  3IKO B;  3LJ3 A;  4P29 A;  3ZEF A;  3E4B A;  4AEZ C;  3FP3 A;  2WXK A;  5D0O D;  2IJG X;  1H6K A;  4F3V A;  5HI7 A;  4GA1 A;  3L22 A;  3QWW A;  3ZHE B;  2NXP A;  2FEZ A;  4AIF A;  5CHE E;  3S2A A;  1ELR A;  2QFC A;  3OXL A;  2WXJ A;  3FUF A;  3PRE A;  3ZYQ A;  4URK A;  3QK0 A;  3G2W A;  2KZT B;  3FTU A;  1HZ4 A;  3CR3 A;  3FY4 A;  5BNW A;  1EPU A;  4PUC A;  4Q96 A;  1FVF A;  3EHN A;  2LO6 A;  4GZC A;  2WM9 A;  5FQ8 A;  3UQ3 A;  1IYG A;  2PZI A;  1E96 B;  3FTW A;  2L0I A;  3TL5 A;  4BSX A;  4ANX A;  4Q94 A;  4E6H A;  4WNF A;  1H2T C;  5BV1 A;  4I1O B;  1KT0 A;  1SZA A;  3SF4 A;  3G2S A;  2HM8 A;  3L08 A;  4A55 A;  1SQM A;  3PE3 A;  4ME2 A;  4ANU A;  4RSY A;  1H0A A;  2J9Q A;  4U0Z A;  5BW8 C;  1L5J A;  2WXI A;  3ESK A;  3U64 A;  2VYI A;  4LEU A;  4MRU A;  1JWF A;  3P2B A;  5T4Y A;  3I4R B;  4ANW A;  3FUD A;  4I17 A;  4JA9 A;  3CHM A;  3FU0 A;  3ML8 A;  3QOU A;  1IQR A;  3LY7 A;  2YNQ A;  3TG4 A;  4NRH B;  4B89 A;  4BTA A;  4CDN A;  4IRU A;  4EBA A;  1NZN A;  2XQ0 A;  5AJD A;  2PQN A;  4Y6C A;  5BT1 A;  4L7T A;  1HU3 A;  1XGW A;  2OND A;  2IQC A;  2GW1 A;  3CGH A;  3FTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...