2H6GA

W102t protein farnesyltransferase mutant complexed with a geranylgeranylated ddptasacvls peptide product at 1.85a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6gA00
1MZCA 1KZOA 3Q7AA 3DSUA 3PZ1A 3PZ2A 3E32A 1JCQA 1TNUA 3PZ4A 1N4RA 3Q78A 4YDEA 2H6FA 3Q75A 1DCEA 1JCSA 2H6HA 2ZISA 3DSWA 3DSSA 4YDOA 2F0YA 1O1RA 1LTXA 3Q7FA 1O1TA 3C72A 1O5MA 4GTRA 3E37A 1LD8A 3HXBA 3SFXA 3EU5A 1N4SA 4GTQA 1LD7A 1O1SA 3E33A 4EHMA 1N9AA 3EUVA 4GTOA 1SA4A 3PZ3A 3HXEA 1FT2A 3HXCA 3DSVA 4L9PA 2BEDA 3Q73A 1NI1A 3KSLA 1N4QA 4GTSA 1D8EA 1TNBA 4GTTA 2R2LA 1S63A 2H6IA 4MBGA 3SFYA 1TNOA 1FPPA 1S64A 3DSXA 1D8DA 3E34A 3DSTA 1TN6A 1SA5A 2H6GA 3Q79A 1N4PA 3E30A 3DPYA 2ZIRA 3KSQA 1N95A 1TNYA 1TN8A 4GTPA 1TN7A 4LNBA 1JCRA 2IEJA 1TNZA 4LNGA 3HXFA 3HXDA 4GTMA 1KZPA 4GTVA 1NL4A 1QBQA 1FT1A 1N94A 1X81A 3DRAA
chains in the Genus database with same CATH superfamily
4RG9A 3LY8A 3CQCB 4HI8A 3RO2A 3V2OA 1JPLA 3SO8A 1FVFA 4UI9J 5CHEE 3AG1E 2CG2A 3TWTA 1N0RA 2PL2A 5LOZA 3CHMA 1WG0A 4J6IA 4DK5A 1DC2A 3CHSA 1INZA 2FO7A 2UWJG 2KZTB 2WPVA 3CHQA 5ENNA 4BTAA 5LCWC 4HS2A 3U64A 3CV0A 3DPDA 2YINA 4YVOA 3CVXA 3P2BA 4UI9K 4JC8A 3ASGA 5ENSD 4FJZA 4F6RD 5HQ8A 3NB2A 1OWPA 4WUYA 3KS2A 1MJ0A 3FFLA 2GRNB 1QYMA 2WXRA 2BKKB 5G04C 4CGVA 4Z68A 4KBQA 2UY1A 4HORA 3ZW3A 4U8YD 3Q79A 4G1TA 5CECB 4F3VA 4GCNA 2NSZA 4GPKA 1MQSA 3DBSA 4FA6A 1OCZE 4KMOA 3C3OA 3FUEA 4NIKA 4WWNA 2X6JA 5KJNA 2ILRA 3FTSA 3UT7A 1TNUA 4LERA 3D9HA 3FH7A 4H7XA 4JA9A 4ATGA 3PZDA 3LJNA 3CR3A 3JXJA 1BPOA 1HS6A 2J4DA 3DSWA 4WWPA 1Z6TA 4BT8A 2DWZA 4BTBA 3UIPC 3JQ1A 3EHMA 4K5BA 3V30A 2L6BA 5CMYA 1ZBPA 3UKRG 2F8YA 1IYGA 4CCAA 3FDHA 2IU1A 5J90A 4HRLA 3T5XA 5LCWJ 2P9SG 5BV0A 3E33A 3AAAC 1SVXA 3G2UA 4P29A 1BI7B 4FHJA 4LNUD 5FQ7A 3OTNA 5AAOA 3ZHEA 1NA3A 3NZSA 3AU5A 3IHYA 1U2VG 5CRVA 2V5QC 5LP0A 3NAWA 3L54A 4U8VD 4XI0A 3D9JA 3CHRA 1S64A 4UWFA 1E90A 3SF4A 5G04J 4EBAG 2H6GA 2P9KG 4N2QA 5FQ8A 3D9NA 4HI9A 4JHJA 2P9UG 3DEPA 2Y4UA 3NZUA 1JWFA 4WNGA 3QWWA 3UM0A 2R03A 4JZYA 3L82A 1E7VA 2EQXA 1BLXB 2E0IA 3FU3A 3AG2E 5CEAA 3PZ1A 4GZDA 2OVFA 4BEPA 1N4RA 4YDEA 2VTBB 3T9KA 4GAAA 1ELRA 4C0MA 3ZXPA 4E85A 2Y3AA 4J8YA 1H6PA 2R02A 5AYWD 2WQ7A 1EDUA 4DI4A 1UJKA 5ENOD 3TL5A 2PM7A 3SBTB 4NURA 3QARA 3RSEG 2AVPA 3RKVA 2KATA 2WXOA 3PNTB 3AG4E 1WM5A 4Q69A 3RRNB 3CVQA 4N3BA 3BU8A 4I17A 3L9TA 2P9LG 2R05A 5JJTA 4B8CB 5C1DA 3ASFA 3ZKJA 3WXXA 4OVVA 2OCCE 3HVEB 3D9IA 2I9CA 2A5UA 5EIDA 2J8SD 4BX8A 1TNYA 1TN8A 4O1PA 4G11A 5CBNA 4UQZA 5H7PA 3NBNB 1QBQA 4DLQA 2VSYA 3FUKA 5AARA 5BXUA 3EU9A 1MZCA 2MOWA 3LVRE 3DSUA 3CSFA 2Q7FA 4GPMA 2J4BA 4GYYA 2XS8A 2P58C 3CQGB 5T3RA 3ZVVA 3L6AA 2NC9A 4FULA 3DSSA 3ML8A 3R9MA 2WMOA 5ARFA 3UM1A 2DIWA 3FTXA 2VGXA 1NA0A 4HLLA 4UWHA 4I6GA 3HIZA 3GYZA 1YA0A 1BD8A 1NFIE 3V2XA 4C0EA 2B0OE 3ZYKA 3SNXA 1Z3XA 3LKUA 5JHBA 2P9IG 3UM3A 2E2EA 1JWGA 4X8QA 3F6QA 1AP7A 4UWGA 3SGHA 3Q73A 3KSLA 2VQ2A 3Q49B 3TJPA 3APFA 3ZGQA 2AJAA 4I2WA 3DWLG 4J8DA 5JA4D 1IHBA 2JEKA 4TRQA 4XEIG 3ABLE 3FUDA 2EIJE 3IXEA 5BV1A 5CBOA 1SQMA 3DXMG 1ELWA 2DZOA 2IEJA 5FWQA 4JB8P 2XPIA 5BXOA 5KNHD 3D9OA 3TXMA 5FQ4A 1IKND 4URKA 4FLHA 2IO3C 3G2VA 3MX3A 1TJFA 5CERB 2UY1B 2XHEA 3PZ4A 3V79K 1KT0A 2WB2A 3LEWA 5ENRD 4H7YA 2KCVA 2OVBA 2BTDA 2LSVA 4XE0A 2LUHA 5BNWA 3TG5A 4HQDA 4RQIA 3QB2A 3P1UA 3S7BA 1MHQA 2XRYA 4UQYA 3E4BA 1O5MA 4HRNA 4FJYA 4J8EA 4B93B 3FEYA 5JHAA 4EHMA 4ME2A 2GRMA 2QY7A 3G2WA 4GZ6A 3FUJA 4GA1A 4ATZD 3CVUA 3FTUA 4KZCA 5HRYA 2KBXA 2QC9A 4AP2A 5EN5D 4K0RA 4U8HA 4BT9A 3ZUVB 2XPYA 1YCSB 2Y69E 2HE0A 3WG7E 2XGSA 3D3MA 2DZNA 2F8XK 1OCRE 4I6EA 2IY0C 3ZHEB 4LNGA 3HXFA 2X3MA 3PE4A 5JJ6A 3T5VA 2DBAA 3B7UX 2C0LA 3LDZA 3TAXA 4ILIA 2QYUA 5FTPA 3ESKA 3Q7AA 4L2YA 3VTYA 1OWOA 2ETCA 1K8KG 2IOSA 2KXPC 2H6FA 3FU0A 3R9AB 3D9LA 4BERA 4DX6D 4UQXA 2CHZA 3ZNGA 1OWLA 4ACLA 3B7BA 2DVWA 4YDOA 2F0YA 2CHXA 3JCKC 3KD7A 4QQIA 4XKBA 2GRRB 3ABKE 3IBEA 4G23A 4KT6B 4GTRA 3SFZA 3JYSA 3S7DA 4HOQA 2XRZA 2R17C 4U95D 4ANVA 2PZIA 4KZ0A 4IULA 1BI8B 1N0QA 2LO6A 3Q15A 1NI1A 4UWLA 4DX5D 2MYOA 3B95A 4GMLA 3L16A 1FPPA 1KLXA 2PQNA 4A55A 3LY9A 4G25A 4GMJA 4GA0A 5KJLA 3I4GA 4JVSA 3G2SA 2FBNA 4YDYA 3FHEA 2XGOA 4JPSA 2L0TB 4APOA 1IHGA 1Q2ZA 4DX1A 3SHFA 1H6KA 2JLBA 2KCLA 3CK7A 3D9KA 3AJIA 3AS8A 1YMPA 3VLDA 2EIKE 2VGYA 1QZ2A 4GZCA 4CRWA 3PDNA 1K1BA 4O6FA 1MX2A 2KCKA 4LSZE 3QOUA 5BW8C 2J07A 2OV8A 2V4LA 5IY5E 3UXGA 5ENTD 3EHNA 5CEDB 2CFZA 4NACA 3C72A 3UI2A 4L23A 1U3DA 2P9NG 1QNFA 4GTQA 4XI9A 5E75A 4JW1A 3TWRA 4EZKA 1E8WA 3PZ3A 4CDNA 3ULYA 2IQCA 2L6JA 2P9PG 3EDTB 3PVLA 5D66A 2WMNA 2QZAA 2X6IA 3CVYA 3L13A 3MEKA 2B6CA 4U04A 1N54A 3CVPA 3B7TA 2VGXB 4OAUC 5AQAA 1V54E 1D8DA 4I6JA 2ZU6B 4F1PA 2XQ0A 2C0MA 4F53A 3TWVA 2WM9A 2RFAA 3B7SA 3SBSA 2ETBA 4HVBA 2P2CP 4IYPA 4FC8A 4ZFHA 3O4ZA 1HF8A 4MKTA 1TYQG 2FEZA 3EHQA 1DNPA 3S7FA 3FWVA 4HOTA 3E32A 3B7RL 3Q75A 2VSOE 5FT9A 2XEHA 2VSNA 2HR2A 4CEMA 5T8IA 5FZSA 3UIOC 1H19A 3SQVA 5ENPD 2R5SA 3ZRHA 3MYVA 2X6KA 3E37A 2AXUA 1BU9A 3UX4A 1ZB1A 3ONLA 1N4SA 4TUMA 3TGOA 3JXIA 3EUVA 4GTOA 1S70B 4FU3A 1IXVA 3DEOA 5EIBE 5FJYA 3FU5A 5HS0A 3SY2A 1Z5SC 2M63A 3ABME 4B8AA 3MKQA 3IKOB 3S2AA 4EPZA 4HOUA 1TNOA 3SFYA 4I1MA 4GU5A 4GYWA 4F7AA 2KZTA 1E8YA 4KYOB 3ZU7B 5LX8A 4OVUA 3BQOA 5EILA 4B0ZA 4L7TA 3BEEA 3ASNE 5E76A 4ANWA 3CHPA 1JCRA 3IHVA 1OY3D 3HXDA 4AV7A 1KZPA 1P5QA 4B94A 5CRUA 4WNDA 2LXMA 3TWQA 2LAHA 3PUJA 2C2LA 3MV3B 2FI7A 3QKYA 4GYOA 2WXHA 5ITZF 2ZGDA 3UPVA 5G05C 3UT8A 2FO1E 2ZXWE 2V0PA 3RO3A 4JD2G 2YHCA 4B89A 1IQUA 4N39A 5KNGA 2KM4A 2A5EA 2AXZA 3UMVA 5EYLA 3SFXA 4ZHBA 4WAFA 3FUFA 4KVOA 4BWRA 3QDNA 5CMWA 3R7QA 4U07A 3MZLB 3FH8A 1SA4A 1FT2A 4R7LA 2XS1A 4L9PA 5AJDA 1NP7A 1ZU2A 4LCTA 4FADA 5FINA 2H6IA 3I4RB 4MBGA 4I9CA 4N2SA 2XEVA 2IO2C 3HHMA 4LRZA 4G8LA 4J0UA 3AS5A 3BG0B 3CKBA 4N5QA 3CKCA 3ZYLA 1TR4A 1XNFA 4EBAA 3I5PA 4DUIA 4FHKA 2BKGA 3MKRA 2V8SE 2CFUA 5EKQD 4UWKA 3AU4A 4PUCA 3PE3A 4AY6A 1OCOE 1HG5A 3TG4A 4PS8A 4WNEA 2YQ8A 3EIQC 2XZTG 3PRZA 3OAWA 4ANXA 4C48B 1DCEA 1JCSA 3LCAA 4UUCA 4AIFA 4A3VA 3UM2A 4BFRA 4QFVA 1O1RA 4HFGA 3UKUG 1NZNA 1O1TA 5KJKA 4HOSA 1OUVA 3EU5A 1E96B 4CDMA 4NQ0A 1LD7A 4EECA 3CVWA 1N9AA 5FIOA 2ETAA 2VTBA 4Q96A 4K5AB 1YYHA 2J9QA 3NOGD 2BEDA 2I1JA 5BUZA 1H0AA 1ELKA 1S63A 4JHKA 1RZ4A 4J7WA 4GA2A 2XGMA 3ZN3A 3L22A 2L9BA 5EX3A 3FH5A 1SA5A 1FCHA 2IONA 4Q94A 3C3QA 3BUAA 1UN9A 4CT4A 3UT4A 2A4ZA 3RRUA 1EYHA 5FZQA 3FUMA 5G2NA 4CZ2D 1EF1C 3ZYMA 4G2VA 3FP3A 4BESA 1KZOA 3PZ2A 1PY1A 1OWNA 2X6FA 3Q78A 2WXJA 4YVQC 3LYAA 4IN3B 4TXQA 3B13A 2FF4A 3RU0A 5J08A 2I1KA 4LUNU 5HKPA 3ULEG 5KBAA 3RJVA 3DXKG 1KT1A 4I9EA 3MCXA 4XZ4A 2WQ6A 1LD8A 5B1BE 4GCOA 1K1AA 4WWOA 2V4HC 4I43A 4FP7A 4LG6A 5ENQD 5AENA 3HXEA 4I1OB 2NYJA 4M7CA 3Q4AB 2LXLA 2MRIA 3TWWA 3DSVA 3FTVA 1N11A 1EPUA 1N4QA 3SZ7A 1E7UA 4ILHB 1OWMA 1W3BA 4U0UA 5T4YA 4U96D 5AQ7A 3E34A 3CK8A 5D2MC 3CEQA 3J5QB 3SD5A 1UJJA 1N52A 1N4PA 3CSTA 3E30A 4RG6A 3G2TA 3JUIA 4BETA 4GZ5A 1HE8A 1Z3YA 2CHWA 3CVNA 2GRQB 2EIME 5EX0A 4YNDA 4C9BB 4EQFA 4GTMA 2X38A 4GTVA 4AVXA 4BSZB 4BSXA 3ASDA 3DRAA 3MKQB 2RG8A 3PEUB 3ZEFA 4W9RA 3LPZA 3W9GA 3QWPA 3C5RA 4GMRA 3ULQA 4MS6A 1B89A 2OOEA 3ONKA 4ABNA 1JUQA 1SZ9A 2CG3A 2PM6A 5FZRA 3ZYQA 1LTXA 2L0IA 4ILGA 2VSXE 3UQ3A 4IRUA 3KAEA 3QJZA 3HXBA 5JMND 3ASHA 4JL0A 3OXLA 1HZ4A 1OXJA 3L17A 4RVBA 1UOHA 4DX2A 3VTXA 4PH4B 3MA5A 4HNAD 3UTMA 3C98A 1TJCA 2R2LA 4A1SA 4HBDA 3ZPJA 4A1GA 1TN6A 3CIAA 4MRUA 3BG1B 5C2YA 3FUNA 5AIJA 2WVIA 2LSUA 3CVVA 2DCPA 4U7EB 1FVHA 3RK6A 3QAQA 2R59A 2WQHA 5BT1A 4EZJA 3JUEA 5B3SE 4AY5A 2IF4A 1TNZA 2GROB 3URZA 2VJ8A 3HDXA 4G8KA 4O60A 1X81A 2FULA 4AXHA 3EJNA 1VDYA 3Q9NC 3S7JA 3ZIMA 2WXKA 1H6OA 4HXIA 4HLEA 4ACKA 3GZ1A 3TWUA 1AWCB 4V3IA 4AM9A 3CVLA 1Y6IA 3CGHA 1UG3A 3K9IA 5ANLA 3GZ2A 5ANRA 2PNNA 5DBKA 4U0ZA 4YDWA 3LVQE 3U3WA 1WY6A 4GZ3A 3GW4A 2F37A 4DX7D 2HM8A 5CCLA 1MYOA 2J09A 2IFUA 2JABA 4JEUA 5HI7A 1OCCE 1A5EA 4GTSA 4G24A 3PREA 1TNBA 2AWIA 3FULA 1HG2A 2AW6A 3IEGA 3LXUX 4JEHA 4J8FA 3SI5A 2GW1A 3D9MA 3OXGA 4WNFA 4HRMB 3TWSA 1IQRA 1WDYA 4OYSA 5EDSA 5ARGA 1XGWA 1U3CA 3KSQA 3I3NA 1N95A 4AJWA 1LF8A 1L5JA 3NF1A 4MLPA 3APCA 4GTPA 2BF0X 1HU3A 2Y0BG 2HO1A 4CYMD 4I1AA 1K3ZD 1E8XA 1N94A 3W9FA 1HX8A 2XCBA 2XZDG 2WXIA 4AEZC 1SZAA 4I2ZA 3RAUA 3Q47B 2NXPA 2OEWA 3VLEA 3CLJA 3CHOA 4TXPA 5DIZA 3QWVA 4K5CA 3ASOE 4TXRA 5D0QD 3U9WA 2ZGGA 3UINC 2WXLA 5A6CA 3T8KA 4N5CA 4DPRA 5BPPA 4BY6A 3U4TA 2EILE 3T8MA 3MJWA 4RSYA 3FU6A 3FEXA 5G55A 2VYIA 3ENEA 2HYZA 3Q5MA 4JXTA 3IV0A 3APDA 4XKCA 1HO8A 4BX9A 1PC2A 3FY4A 2J49A 1HH8A 4GTTA 3FTWA 4TV3A 5CCMA 2WXPA 3PUKA 3QNKA 3N71A 2V5FA 2YHEA 4AOFA 2YNQA 2ZIRA 2ONDA 1TEZA 3MGBA 3QC1A 2Y4TA 4GB9A 3RIBA 4U63A 1MX6A 2RD0A 2QYJA 3LY7A 2WXMA 3EHRA 4DI3A 3J5PA 2XPZA 3PS6A 1Y8MA 2WXFA 3ISMC 1JCQA 2PQRA 3LS8A 2J08A 5AJLA 3HG0D 2H6HA 3OXFA 5KCMA 3UUXA 2IJGX 2LAIA 4APFA 1GW6A 3FUIA 4CDRA 1E8ZA 5JJ7A 2XEEA 3U66A 2DYSE 3ZFWA 1V55E 3V31A 1X5BA 5LFAA 3PNLB 3FTYA 3ESLA 3L08A 2VGEA 2XCCA 3VLFA 4FLBA 1O1SA 5G05J 2RFMA 4DLOA 3X2QE 5EYPF 4LEUA 1H2TC 1UN8A 3Q9UC 4M3OA 3CK9A 3QK0A 1D8EA 1DVPA 2OEVA 5A7DB 5B1AE 2AXVA 4ANUA 3LJ3A 5A23A 5FQ6A 4KXKB 3DSXA 3R7RA 3JQ0A 3EIJA 4PS7A 4Y6CA 1MX4A 1RW2A 3FTZA 3PEVB 4A63B 2MHKA 5AN8A 4A3TA 2I6HA 1HFAA 5KJMA 1H2VC 4G26A 3KEAA 1NL4A 4PS3A 1FT1A 1A17A 4XIFA 2WXGA 1UW4B 2QFCA 3AS4A 4O1OA 4CT0A 4UI9C 1H2UA 1SW6A 3GZSA 2ZISA 3O48A 2BUGA 1PAQA 4JA7A 1OT8A 3HRAA 4L2LA 4D10C 4XX5A 1G3NB 4N3CA 4DRXE 5M72A 3MV2B 4K03A 3TWXA 3Q7FA 2IOLA 4DJAA 4PDXA 2EINE 3TXNA 1S0PA 3HVEA 1DCQA 3ZXSA 2WXQA 2Y1LE 3NOCD 5KWDA 3RRMB 2XENA 3HXCA 4F1SA 2X6HA 2DYRE 3ML9A 4U0SA 5AQ9A 4EZLA 4Y6WA 2KC7A 3NQPA 4TUUA 5D0OD 3HYMB 3D9PA 4NRHB 2GRPB 5AQBA 3C3RA 4N3AA 1QQEA 2I2OA 3FUHA 4RLYA 4E6HA 4KVMA 3DSTA 1HXIA 3AG3E 1D9SA 2LNIA 3KEZA 4L1BA 2RKKA 3DPYA 4J8SA 4HB5A 3PH0C 1TN7A 4LNBA 2GRLA 2GGFA 4JHRA 4OAVB 2WXNA 1KPSB 1WAO1 4CGWA
chains in the Genus database with same CATH topology
1MZCA 1KZOA 3Q7AA 3DSUA 3PZ1A 3PZ2A 3E32A 1JCQA 1TNUA 3PZ4A 1N4RA 3Q78A 4YDEA 2H6FA 3Q75A 1DCEA 1JCSA 2H6HA 2ZISA 3DSWA 3DSSA 4YDOA 2F0YA 1O1RA 1LTXA 3Q7FA 1O1TA 3C72A 1O5MA 4GTRA 3E37A 1LD8A 3HXBA 3SFXA 3EU5A 1N4SA 4GTQA 1LD7A 1O1SA 3E33A 4EHMA 1N9AA 3EUVA 4GTOA 1SA4A 3PZ3A 3HXEA 1FT2A 3HXCA 3DSVA 4L9PA 2BEDA 3Q73A 1NI1A 3KSLA 1N4QA 4GTSA 1D8EA 1TNBA 4GTTA 2R2LA 1S63A 2H6IA 4MBGA 3SFYA 1TNOA 1FPPA 1S64A 3DSXA 1D8DA 3E34A 3DSTA 1TN6A 1SA5A 2H6GA 3Q79A 1N4PA 3E30A 3DPYA 2ZIRA 3KSQA 1N95A 1TNYA 1TN8A 4GTPA 1TN7A 4LNBA 1JCRA 2IEJA 1TNZA 4LNGA 3HXFA 3HXDA 4GTMA 1KZPA 4GTVA 1NL4A 1QBQA 1FT1A 1N94A 1X81A 3DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZC A;  1KZO A;  3Q7A A;  3DSU A;  3PZ1 A;  3PZ2 A;  3E32 A;  1JCQ A;  1TNU A;  3PZ4 A;  1N4R A;  3Q78 A;  4YDE A;  2H6F A;  3Q75 A;  1DCE A;  1JCS A;  2H6H A;  2ZIS A;  3DSW A;  3DSS A;  4YDO A;  2F0Y A;  1O1R A;  1LTX A;  3Q7F A;  1O1T A;  3C72 A;  1O5M A;  4GTR A;  3E37 A;  1LD8 A;  3HXB A;  3SFX A;  3EU5 A;  1N4S A;  4GTQ A;  1LD7 A;  1O1S A;  3E33 A;  4EHM A;  1N9A A;  3EUV A;  4GTO A;  1SA4 A;  3PZ3 A;  3HXE A;  1FT2 A;  3HXC A;  3DSV A;  4L9P A;  2BED A;  3Q73 A;  1NI1 A;  3KSL A;  1N4Q A;  4GTS A;  1D8E A;  1TNB A;  4GTT A;  2R2L A;  1S63 A;  2H6I A;  4MBG A;  3SFY A;  1TNO A;  1FPP A;  1S64 A;  3DSX A;  1D8D A;  3E34 A;  3DST A;  1TN6 A;  1SA5 A;  2H6G A;  3Q79 A;  1N4P A;  3E30 A;  3DPY A;  2ZIR A;  3KSQ A;  1N95 A;  1TNY A;  1TN8 A;  4GTP A;  1TN7 A;  4LNB A;  1JCR A;  2IEJ A;  1TNZ A;  4LNG A;  3HXF A;  3HXD A;  4GTM A;  1KZP A;  4GTV A;  1NL4 A;  1QBQ A;  1FT1 A;  1N94 A;  1X81 A;  3DRA A; 
#chains in the Genus database with same CATH topology
 4RG9 A;  3LY8 A;  3CQC B;  4HI8 A;  3RO2 A;  3V2O A;  1JPL A;  3SO8 A;  1FVF A;  4UI9 J;  5CHE E;  3AG1 E;  2CG2 A;  3TWT A;  1N0R A;  2PL2 A;  5LOZ A;  3CHM A;  1WG0 A;  4J6I A;  4DK5 A;  1DC2 A;  3CHS A;  1INZ A;  2FO7 A;  2UWJ G;  2KZT B;  2WPV A;  3CHQ A;  5ENN A;  4BTA A;  5LCW C;  4HS2 A;  3U64 A;  3CV0 A;  3DPD A;  2YIN A;  4YVO A;  3CVX A;  3P2B A;  4UI9 K;  4JC8 A;  3ASG A;  5ENS D;  4FJZ A;  4F6R D;  5HQ8 A;  3NB2 A;  1OWP A;  4WUY A;  3KS2 A;  1MJ0 A;  3FFL A;  2GRN B;  1QYM A;  2WXR A;  2BKK B;  5G04 C;  4CGV A;  4Z68 A;  4KBQ A;  2UY1 A;  4HOR A;  3ZW3 A;  4U8Y D;  3Q79 A;  4G1T A;  5CEC B;  4F3V A;  4GCN A;  2NSZ A;  4GPK A;  1MQS A;  3DBS A;  4FA6 A;  1OCZ E;  4KMO A;  3C3O A;  3FUE A;  4NIK A;  4WWN A;  2X6J A;  5KJN A;  2ILR A;  3FTS A;  3UT7 A;  1TNU A;  4LER A;  3D9H A;  3FH7 A;  4H7X A;  4JA9 A;  4ATG A;  3PZD A;  3LJN A;  3CR3 A;  3JXJ A;  1BPO A;  1HS6 A;  2J4D A;  3DSW A;  4WWP A;  1Z6T A;  4BT8 A;  2DWZ A;  4BTB A;  3UIP C;  3JQ1 A;  3EHM A;  4K5B A;  3V30 A;  2L6B A;  5CMY A;  1ZBP A;  3UKR G;  2F8Y A;  1IYG A;  4CCA A;  3FDH A;  2IU1 A;  5J90 A;  4HRL A;  3T5X A;  5LCW J;  2P9S G;  5BV0 A;  3E33 A;  3AAA C;  1SVX A;  3G2U A;  4P29 A;  1BI7 B;  4FHJ A;  4LNU D;  5FQ7 A;  3OTN A;  5AAO A;  3ZHE A;  1NA3 A;  3NZS A;  3AU5 A;  3IHY A;  1U2V G;  5CRV A;  2V5Q C;  5LP0 A;  3NAW A;  3L54 A;  4U8V D;  4XI0 A;  3D9J A;  3CHR A;  1S64 A;  4UWF A;  1E90 A;  3SF4 A;  5G04 J;  4EBA G;  2H6G A;  2P9K G;  4N2Q A;  5FQ8 A;  3D9N A;  4HI9 A;  4JHJ A;  2P9U G;  3DEP A;  2Y4U A;  3NZU A;  1JWF A;  4WNG A;  3QWW A;  3UM0 A;  2R03 A;  4JZY A;  3L82 A;  1E7V A;  2EQX A;  1BLX B;  2E0I A;  3FU3 A;  3AG2 E;  5CEA A;  3PZ1 A;  4GZD A;  2OVF A;  4BEP A;  1N4R A;  4YDE A;  2VTB B;  3T9K A;  4GAA A;  1ELR A;  4C0M A;  3ZXP A;  4E85 A;  2Y3A A;  4J8Y A;  1H6P A;  2R02 A;  5AYW D;  2WQ7 A;  1EDU A;  4DI4 A;  1UJK A;  5ENO D;  3TL5 A;  2PM7 A;  3SBT B;  4NUR A;  3QAR A;  3RSE G;  2AVP A;  3RKV A;  2KAT A;  2WXO A;  3PNT B;  3AG4 E;  1WM5 A;  4Q69 A;  3RRN B;  3CVQ A;  4N3B A;  3BU8 A;  4I17 A;  3L9T A;  2P9L G;  2R05 A;  5JJT A;  4B8C B;  5C1D A;  3ASF A;  3ZKJ A;  3WXX A;  4OVV A;  2OCC E;  3HVE B;  3D9I A;  2I9C A;  2A5U A;  5EID A;  2J8S D;  4BX8 A;  1TNY A;  1TN8 A;  4O1P A;  4G11 A;  5CBN A;  4UQZ A;  5H7P A;  3NBN B;  1QBQ A;  4DLQ A;  2VSY A;  3FUK A;  5AAR A;  5BXU A;  3EU9 A;  1MZC A;  2MOW A;  3LVR E;  3DSU A;  3CSF A;  2Q7F A;  4GPM A;  2J4B A;  4GYY A;  2XS8 A;  2P58 C;  3CQG B;  5T3R A;  3ZVV A;  3L6A A;  2NC9 A;  4FUL A;  3DSS A;  3ML8 A;  3R9M A;  2WMO A;  5ARF A;  3UM1 A;  2DIW A;  3FTX A;  2VGX A;  1NA0 A;  4HLL A;  4UWH A;  4I6G A;  3HIZ A;  3GYZ A;  1YA0 A;  1BD8 A;  1NFI E;  3V2X A;  4C0E A;  2B0O E;  3ZYK A;  3SNX A;  1Z3X A;  3LKU A;  5JHB A;  2P9I G;  3UM3 A;  2E2E A;  1JWG A;  4X8Q A;  3F6Q A;  1AP7 A;  4UWG A;  3SGH A;  3Q73 A;  3KSL A;  2VQ2 A;  3Q49 B;  3TJP A;  3APF A;  3ZGQ A;  2AJA A;  4I2W A;  3DWL G;  4J8D A;  5JA4 D;  1IHB A;  2JEK A;  4TRQ A;  4XEI G;  3ABL E;  3FUD A;  2EIJ E;  3IXE A;  5BV1 A;  5CBO A;  1SQM A;  3DXM G;  1ELW A;  2DZO A;  2IEJ A;  5FWQ A;  4JB8 P;  2XPI A;  5BXO A;  5KNH D;  3D9O A;  3TXM A;  5FQ4 A;  1IKN D;  4URK A;  4FLH A;  2IO3 C;  3G2V A;  3MX3 A;  1TJF A;  5CER B;  2UY1 B;  2XHE A;  3PZ4 A;  3V79 K;  1KT0 A;  2WB2 A;  3LEW A;  5ENR D;  4H7Y A;  2KCV A;  2OVB A;  2BTD A;  2LSV A;  4XE0 A;  2LUH A;  5BNW A;  3TG5 A;  4HQD A;  4RQI A;  3QB2 A;  3P1U A;  3S7B A;  1MHQ A;  2XRY A;  4UQY A;  3E4B A;  1O5M A;  4HRN A;  4FJY A;  4J8E A;  4B93 B;  3FEY A;  5JHA A;  4EHM A;  4ME2 A;  2GRM A;  2QY7 A;  3G2W A;  4GZ6 A;  3FUJ A;  4GA1 A;  4ATZ D;  3CVU A;  3FTU A;  4KZC A;  5HRY A;  2KBX A;  2QC9 A;  4AP2 A;  5EN5 D;  4K0R A;  4U8H A;  4BT9 A;  3ZUV B;  2XPY A;  1YCS B;  2Y69 E;  2HE0 A;  3WG7 E;  2XGS A;  3D3M A;  2DZN A;  2F8X K;  1OCR E;  4I6E A;  2IY0 C;  3ZHE B;  4LNG A;  3HXF A;  2X3M A;  3PE4 A;  5JJ6 A;  3T5V A;  2DBA A;  3B7U X;  2C0L A;  3LDZ A;  3TAX A;  4ILI A;  2QYU A;  5FTP A;  3ESK A;  3Q7A A;  4L2Y A;  3VTY A;  1OWO A;  2ETC A;  1K8K G;  2IOS A;  2KXP C;  2H6F A;  3FU0 A;  3R9A B;  3D9L A;  4BER A;  4DX6 D;  4UQX A;  2CHZ A;  3ZNG A;  1OWL A;  4ACL A;  3B7B A;  2DVW A;  4YDO A;  2F0Y A;  2CHX A;  3JCK C;  3KD7 A;  4QQI A;  4XKB A;  2GRR B;  3ABK E;  3IBE A;  4G23 A;  4KT6 B;  4GTR A;  3SFZ A;  3JYS A;  3S7D A;  4HOQ A;  2XRZ A;  2R17 C;  4U95 D;  4ANV A;  2PZI A;  4KZ0 A;  4IUL A;  1BI8 B;  1N0Q A;  2LO6 A;  3Q15 A;  1NI1 A;  4UWL A;  4DX5 D;  2MYO A;  3B95 A;  4GML A;  3L16 A;  1FPP A;  1KLX A;  2PQN A;  4A55 A;  3LY9 A;  4G25 A;  4GMJ A;  4GA0 A;  5KJL A;  3I4G A;  4JVS A;  3G2S A;  2FBN A;  4YDY A;  3FHE A;  2XGO A;  4JPS A;  2L0T B;  4APO A;  1IHG A;  1Q2Z A;  4DX1 A;  3SHF A;  1H6K A;  2JLB A;  2KCL A;  3CK7 A;  3D9K A;  3AJI A;  3AS8 A;  1YMP A;  3VLD A;  2EIK E;  2VGY A;  1QZ2 A;  4GZC A;  4CRW A;  3PDN A;  1K1B A;  4O6F A;  1MX2 A;  2KCK A;  4LSZ E;  3QOU A;  5BW8 C;  2J07 A;  2OV8 A;  2V4L A;  5IY5 E;  3UXG A;  5ENT D;  3EHN A;  5CED B;  2CFZ A;  4NAC A;  3C72 A;  3UI2 A;  4L23 A;  1U3D A;  2P9N G;  1QNF A;  4GTQ A;  4XI9 A;  5E75 A;  4JW1 A;  3TWR A;  4EZK A;  1E8W A;  3PZ3 A;  4CDN A;  3ULY A;  2IQC A;  2L6J A;  2P9P G;  3EDT B;  3PVL A;  5D66 A;  2WMN A;  2QZA A;  2X6I A;  3CVY A;  3L13 A;  3MEK A;  2B6C A;  4U04 A;  1N54 A;  3CVP A;  3B7T A;  2VGX B;  4OAU C;  5AQA A;  1V54 E;  1D8D A;  4I6J A;  2ZU6 B;  4F1P A;  2XQ0 A;  2C0M A;  4F53 A;  3TWV A;  2WM9 A;  2RFA A;  3B7S A;  3SBS A;  2ETB A;  4HVB A;  2P2C P;  4IYP A;  4FC8 A;  4ZFH A;  3O4Z A;  1HF8 A;  4MKT A;  1TYQ G;  2FEZ A;  3EHQ A;  1DNP A;  3S7F A;  3FWV A;  4HOT A;  3E32 A;  3B7R L;  3Q75 A;  2VSO E;  5FT9 A;  2XEH A;  2VSN A;  2HR2 A;  4CEM A;  5T8I A;  5FZS A;  3UIO C;  1H19 A;  3SQV A;  5ENP D;  2R5S A;  3ZRH A;  3MYV A;  2X6K A;  3E37 A;  2AXU A;  1BU9 A;  3UX4 A;  1ZB1 A;  3ONL A;  1N4S A;  4TUM A;  3TGO A;  3JXI A;  3EUV A;  4GTO A;  1S70 B;  4FU3 A;  1IXV A;  3DEO A;  5EIB E;  5FJY A;  3FU5 A;  5HS0 A;  3SY2 A;  1Z5S C;  2M63 A;  3ABM E;  4B8A A;  3MKQ A;  3IKO B;  3S2A A;  4EPZ A;  4HOU A;  1TNO A;  3SFY A;  4I1M A;  4GU5 A;  4GYW A;  4F7A A;  2KZT A;  1E8Y A;  4KYO B;  3ZU7 B;  5LX8 A;  4OVU A;  3BQO A;  5EIL A;  4B0Z A;  4L7T A;  3BEE A;  3ASN E;  5E76 A;  4ANW A;  3CHP A;  1JCR A;  3IHV A;  1OY3 D;  3HXD A;  4AV7 A;  1KZP A;  1P5Q A;  4B94 A;  5CRU A;  4WND A;  2LXM A;  3TWQ A;  2LAH A;  3PUJ A;  2C2L A;  3MV3 B;  2FI7 A;  3QKY A;  4GYO A;  2WXH A;  5ITZ F;  2ZGD A;  3UPV A;  5G05 C;  3UT8 A;  2FO1 E;  2ZXW E;  2V0P A;  3RO3 A;  4JD2 G;  2YHC A;  4B89 A;  1IQU A;  4N39 A;  5KNG A;  2KM4 A;  2A5E A;  2AXZ A;  3UMV A;  5EYL A;  3SFX A;  4ZHB A;  4WAF A;  3FUF A;  4KVO A;  4BWR A;  3QDN A;  5CMW A;  3R7Q A;  4U07 A;  3MZL B;  3FH8 A;  1SA4 A;  1FT2 A;  4R7L A;  2XS1 A;  4L9P A;  5AJD A;  1NP7 A;  1ZU2 A;  4LCT A;  4FAD A;  5FIN A;  2H6I A;  3I4R B;  4MBG A;  4I9C A;  4N2S A;  2XEV A;  2IO2 C;  3HHM A;  4LRZ A;  4G8L A;  4J0U A;  3AS5 A;  3BG0 B;  3CKB A;  4N5Q A;  3CKC A;  3ZYL A;  1TR4 A;  1XNF A;  4EBA A;  3I5P A;  4DUI A;  4FHK A;  2BKG A;  3MKR A;  2V8S E;  2CFU A;  5EKQ D;  4UWK A;  3AU4 A;  4PUC A;  3PE3 A;  4AY6 A;  1OCO E;  1HG5 A;  3TG4 A;  4PS8 A;  4WNE A;  2YQ8 A;  3EIQ C;  2XZT G;  3PRZ A;  3OAW A;  4ANX A;  4C48 B;  1DCE A;  1JCS A;  3LCA A;  4UUC A;  4AIF A;  4A3V A;  3UM2 A;  4BFR A;  4QFV A;  1O1R A;  4HFG A;  3UKU G;  1NZN A;  1O1T A;  5KJK A;  4HOS A;  1OUV A;  3EU5 A;  1E96 B;  4CDM A;  4NQ0 A;  1LD7 A;  4EEC A;  3CVW A;  1N9A A;  5FIO A;  2ETA A;  2VTB A;  4Q96 A;  4K5A B;  1YYH A;  2J9Q A;  3NOG D;  2BED A;  2I1J A;  5BUZ A;  1H0A A;  1ELK A;  1S63 A;  4JHK A;  1RZ4 A;  4J7W A;  4GA2 A;  2XGM A;  3ZN3 A;  3L22 A;  2L9B A;  5EX3 A;  3FH5 A;  1SA5 A;  1FCH A;  2ION A;  4Q94 A;  3C3Q A;  3BUA A;  1UN9 A;  4CT4 A;  3UT4 A;  2A4Z A;  3RRU A;  1EYH A;  5FZQ A;  3FUM A;  5G2N A;  4CZ2 D;  1EF1 C;  3ZYM A;  4G2V A;  3FP3 A;  4BES A;  1KZO A;  3PZ2 A;  1PY1 A;  1OWN A;  2X6F A;  3Q78 A;  2WXJ A;  4YVQ C;  3LYA A;  4IN3 B;  4TXQ A;  3B13 A;  2FF4 A;  3RU0 A;  5J08 A;  2I1K A;  4LUN U;  5HKP A;  3ULE G;  5KBA A;  3RJV A;  3DXK G;  1KT1 A;  4I9E A;  3MCX A;  4XZ4 A;  2WQ6 A;  1LD8 A;  5B1B E;  4GCO A;  1K1A A;  4WWO A;  2V4H C;  4I43 A;  4FP7 A;  4LG6 A;  5ENQ D;  5AEN A;  3HXE A;  4I1O B;  2NYJ A;  4M7C A;  3Q4A B;  2LXL A;  2MRI A;  3TWW A;  3DSV A;  3FTV A;  1N11 A;  1EPU A;  1N4Q A;  3SZ7 A;  1E7U A;  4ILH B;  1OWM A;  1W3B A;  4U0U A;  5T4Y A;  4U96 D;  5AQ7 A;  3E34 A;  3CK8 A;  5D2M C;  3CEQ A;  3J5Q B;  3SD5 A;  1UJJ A;  1N52 A;  1N4P A;  3CST A;  3E30 A;  4RG6 A;  3G2T A;  3JUI A;  4BET A;  4GZ5 A;  1HE8 A;  1Z3Y A;  2CHW A;  3CVN A;  2GRQ B;  2EIM E;  5EX0 A;  4YND A;  4C9B B;  4EQF A;  4GTM A;  2X38 A;  4GTV A;  4AVX A;  4BSZ B;  4BSX A;  3ASD A;  3DRA A;  3MKQ B;  2RG8 A;  3PEU B;  3ZEF A;  4W9R A;  3LPZ A;  3W9G A;  3QWP A;  3C5R A;  4GMR A;  3ULQ A;  4MS6 A;  1B89 A;  2OOE A;  3ONK A;  4ABN A;  1JUQ A;  1SZ9 A;  2CG3 A;  2PM6 A;  5FZR A;  3ZYQ A;  1LTX A;  2L0I A;  4ILG A;  2VSX E;  3UQ3 A;  4IRU A;  3KAE A;  3QJZ A;  3HXB A;  5JMN D;  3ASH A;  4JL0 A;  3OXL A;  1HZ4 A;  1OXJ A;  3L17 A;  4RVB A;  1UOH A;  4DX2 A;  3VTX A;  4PH4 B;  3MA5 A;  4HNA D;  3UTM A;  3C98 A;  1TJC A;  2R2L A;  4A1S A;  4HBD A;  3ZPJ A;  4A1G A;  1TN6 A;  3CIA A;  4MRU A;  3BG1 B;  5C2Y A;  3FUN A;  5AIJ A;  2WVI A;  2LSU A;  3CVV A;  2DCP A;  4U7E B;  1FVH A;  3RK6 A;  3QAQ A;  2R59 A;  2WQH A;  5BT1 A;  4EZJ A;  3JUE A;  5B3S E;  4AY5 A;  2IF4 A;  1TNZ A;  2GRO B;  3URZ A;  2VJ8 A;  3HDX A;  4G8K A;  4O60 A;  1X81 A;  2FUL A;  4AXH A;  3EJN A;  1VDY A;  3Q9N C;  3S7J A;  3ZIM A;  2WXK A;  1H6O A;  4HXI A;  4HLE A;  4ACK A;  3GZ1 A;  3TWU A;  1AWC B;  4V3I A;  4AM9 A;  3CVL A;  1Y6I A;  3CGH A;  1UG3 A;  3K9I A;  5ANL A;  3GZ2 A;  5ANR A;  2PNN A;  5DBK A;  4U0Z A;  4YDW A;  3LVQ E;  3U3W A;  1WY6 A;  4GZ3 A;  3GW4 A;  2F37 A;  4DX7 D;  2HM8 A;  5CCL A;  1MYO A;  2J09 A;  2IFU A;  2JAB A;  4JEU A;  5HI7 A;  1OCC E;  1A5E A;  4GTS A;  4G24 A;  3PRE A;  1TNB A;  2AWI A;  3FUL A;  1HG2 A;  2AW6 A;  3IEG A;  3LXU X;  4JEH A;  4J8F A;  3SI5 A;  2GW1 A;  3D9M A;  3OXG A;  4WNF A;  4HRM B;  3TWS A;  1IQR A;  1WDY A;  4OYS A;  5EDS A;  5ARG A;  1XGW A;  1U3C A;  3KSQ A;  3I3N A;  1N95 A;  4AJW A;  1LF8 A;  1L5J A;  3NF1 A;  4MLP A;  3APC A;  4GTP A;  2BF0 X;  1HU3 A;  2Y0B G;  2HO1 A;  4CYM D;  4I1A A;  1K3Z D;  1E8X A;  1N94 A;  3W9F A;  1HX8 A;  2XCB A;  2XZD G;  2WXI A;  4AEZ C;  1SZA A;  4I2Z A;  3RAU A;  3Q47 B;  2NXP A;  2OEW A;  3VLE A;  3CLJ A;  3CHO A;  4TXP A;  5DIZ A;  3QWV A;  4K5C A;  3ASO E;  4TXR A;  5D0Q D;  3U9W A;  2ZGG A;  3UIN C;  2WXL A;  5A6C A;  3T8K A;  4N5C A;  4DPR A;  5BPP A;  4BY6 A;  3U4T A;  2EIL E;  3T8M A;  3MJW A;  4RSY A;  3FU6 A;  3FEX A;  5G55 A;  2VYI A;  3ENE A;  2HYZ A;  3Q5M A;  4JXT A;  3IV0 A;  3APD A;  4XKC A;  1HO8 A;  4BX9 A;  1PC2 A;  3FY4 A;  2J49 A;  1HH8 A;  4GTT A;  3FTW A;  4TV3 A;  5CCM A;  2WXP A;  3PUK A;  3QNK A;  3N71 A;  2V5F A;  2YHE A;  4AOF A;  2YNQ A;  2ZIR A;  2OND A;  1TEZ A;  3MGB A;  3QC1 A;  2Y4T A;  4GB9 A;  3RIB A;  4U63 A;  1MX6 A;  2RD0 A;  2QYJ A;  3LY7 A;  2WXM A;  3EHR A;  4DI3 A;  3J5P A;  2XPZ A;  3PS6 A;  1Y8M A;  2WXF A;  3ISM C;  1JCQ A;  2PQR A;  3LS8 A;  2J08 A;  5AJL A;  3HG0 D;  2H6H A;  3OXF A;  5KCM A;  3UUX A;  2IJG X;  2LAI A;  4APF A;  1GW6 A;  3FUI A;  4CDR A;  1E8Z A;  5JJ7 A;  2XEE A;  3U66 A;  2DYS E;  3ZFW A;  1V55 E;  3V31 A;  1X5B A;  5LFA A;  3PNL B;  3FTY A;  3ESL A;  3L08 A;  2VGE A;  2XCC A;  3VLF A;  4FLB A;  1O1S A;  5G05 J;  2RFM A;  4DLO A;  3X2Q E;  5EYP F;  4LEU A;  1H2T C;  1UN8 A;  3Q9U C;  4M3O A;  3CK9 A;  3QK0 A;  1D8E A;  1DVP A;  2OEV A;  5A7D B;  5B1A E;  2AXV A;  4ANU A;  3LJ3 A;  5A23 A;  5FQ6 A;  4KXK B;  3DSX A;  3R7R A;  3JQ0 A;  3EIJ A;  4PS7 A;  4Y6C A;  1MX4 A;  1RW2 A;  3FTZ A;  3PEV B;  4A63 B;  2MHK A;  5AN8 A;  4A3T A;  2I6H A;  1HFA A;  5KJM A;  1H2V C;  4G26 A;  3KEA A;  1NL4 A;  4PS3 A;  1FT1 A;  1A17 A;  4XIF A;  2WXG A;  1UW4 B;  2QFC A;  3AS4 A;  4O1O A;  4CT0 A;  4UI9 C;  1H2U A;  1SW6 A;  3GZS A;  2ZIS A;  3O48 A;  2BUG A;  1PAQ A;  4JA7 A;  1OT8 A;  3HRA A;  4L2L A;  4D10 C;  4XX5 A;  1G3N B;  4N3C A;  4DRX E;  5M72 A;  3MV2 B;  4K03 A;  3TWX A;  3Q7F A;  2IOL A;  4DJA A;  4PDX A;  2EIN E;  3TXN A;  1S0P A;  3HVE A;  1DCQ A;  3ZXS A;  2WXQ A;  2Y1L E;  3NOC D;  5KWD A;  3RRM B;  2XEN A;  3HXC A;  4F1S A;  2X6H A;  2DYR E;  3ML9 A;  4U0S A;  5AQ9 A;  4EZL A;  4Y6W A;  2KC7 A;  3NQP A;  4TUU A;  5D0O D;  3HYM B;  3D9P A;  4NRH B;  2GRP B;  5AQB A;  3C3R A;  4N3A A;  1QQE A;  2I2O A;  3FUH A;  4RLY A;  4E6H A;  4KVM A;  3DST A;  1HXI A;  3AG3 E;  1D9S A;  2LNI A;  3KEZ A;  4L1B A;  2RKK A;  3DPY A;  4J8S A;  4HB5 A;  3PH0 C;  1TN7 A;  4LNB A;  2GRL A;  2GGF A;  4JHR A;  4OAV B;  2WXN A;  1KPS B;  1WAO 1;  4CGW A; 
#chains in the Genus database with same CATH homology
 1MZC A;  1KZO A;  3Q7A A;  3DSU A;  3PZ1 A;  3PZ2 A;  3E32 A;  1JCQ A;  1TNU A;  3PZ4 A;  1N4R A;  3Q78 A;  4YDE A;  2H6F A;  3Q75 A;  1DCE A;  1JCS A;  2H6H A;  2ZIS A;  3DSW A;  3DSS A;  4YDO A;  2F0Y A;  1O1R A;  1LTX A;  3Q7F A;  1O1T A;  3C72 A;  1O5M A;  4GTR A;  3E37 A;  1LD8 A;  3HXB A;  3SFX A;  3EU5 A;  1N4S A;  4GTQ A;  1LD7 A;  1O1S A;  3E33 A;  4EHM A;  1N9A A;  3EUV A;  4GTO A;  1SA4 A;  3PZ3 A;  3HXE A;  1FT2 A;  3HXC A;  3DSV A;  4L9P A;  2BED A;  3Q73 A;  1NI1 A;  3KSL A;  1N4Q A;  4GTS A;  1D8E A;  1TNB A;  4GTT A;  2R2L A;  1S63 A;  2H6I A;  4MBG A;  3SFY A;  1TNO A;  1FPP A;  1S64 A;  3DSX A;  1D8D A;  3E34 A;  3DST A;  1TN6 A;  1SA5 A;  2H6G A;  3Q79 A;  1N4P A;  3E30 A;  3DPY A;  2ZIR A;  3KSQ A;  1N95 A;  1TNY A;  1TN8 A;  4GTP A;  1TN7 A;  4LNB A;  1JCR A;  2IEJ A;  1TNZ A;  4LNG A;  3HXF A;  3HXD A;  4GTM A;  1KZP A;  4GTV A;  1NL4 A;  1QBQ A;  1FT1 A;  1N94 A;  1X81 A;  3DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...