2H6GA

W102t protein farnesyltransferase mutant complexed with a geranylgeranylated ddptasacvls peptide product at 1.85a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6gA00
2ZIRA 3HXFA 3DSXA 4GTOA 4YDEA 2R2LA 3SFXA 1LD7A 2H6GA 1D8EA 3DPYA 1NI1A 2ZISA 3Q75A 3E34A 3SFYA 1TN7A 4GTVA 1N9AA 1FPPA 1TNBA 3PZ2A 1O1TA 3Q78A 3EUVA 3HXCA 3PZ4A 1N4SA 3KSLA 1MZCA 1N94A 1TN8A 3HXEA 3DSSA 1S64A 3E37A 3KSQA 3C72A 4YDOA 1JCRA 1D8DA 1O1RA 1LTXA 1N4RA 3DSVA 1S63A 4GTMA 1N4QA 3PZ1A 1SA5A 3E30A 1LD8A 1TNZA 4GTSA 1KZOA 1QBQA 2H6FA 3DSTA 2BEDA 1JCSA 1SA4A 1FT2A 4GTPA 1O1SA 3DRAA 3Q73A 1DCEA 3Q7AA 3HXBA 4L9PA 1O5MA 3PZ3A 1TNOA 3Q7FA 2H6IA 3E32A 2H6HA 2IEJA 4GTQA 3DSUA 4GTTA 4LNBA 1N95A 2F0YA 3HXDA 3Q79A 1FT1A 1KZPA 1N4PA 4EHMA 1NL4A 3DSWA 1TNYA 4LNGA 1TN6A 3E33A 1TNUA 4MBGA 3EU5A 1X81A 1JCQA 4GTRA
chains in the Genus database with same CATH superfamily
4YDEA 1NFIE 4DLOA 1S0PA 4AP2A 5EIBE 3FTSA 4U07A 2YNQA 2XRZA 2YHCA 3CR3A 3FUNA 2L6BA 5LFAA 4O1OA 3SFYA 3UMVA 3ZU7B 4J6IA 3ASGA 3UQ3A 3D9PA 3HDXA 1OWPA 3FTUA 3HXCA 3VLDA 4BTBA 2ZU6B 4FU3A 2ETBA 3TWSA 3EU9A 3L9TA 2J49A 5JMND 3RRUA 2IJGX 1MYOA 3CHPA 3UI2A 3Q5MA 2WXKA 2HR2A 4RLYA 3QARA 1H6OA 4GMRA 2YINA 5CMWA 3UM0A 5HRYA 1SA4A 3ZNGA 3PVLA 3FTXA 4DJAA 4I9CA 4G23A 4WNDA 3SBTB 4RG6A 4ME2A 3FUDA 3QB2A 4XKBA 5FWQA 4U0SA 3HVEB 2DYSE 4N39A 4EZKA 3ONKA 2C0MA 5C1DA 3NBNB 4PDXA 2KCLA 4ANWA 3ASHA 5G05J 4O6FA 2PQNA 4OYSA 4G25A 4Q96A 4HORA 2XPZA 4UWGA 4MBGA 3CHOA 3W9FA 2OV8A 2AJAA 3FFLA 3CVXA 1Q2ZA 3KD7A 3RRNB 2LSUA 2XEVA 2R05A 2HM8A 2ZIRA 3LKUA 3AJIA 3NB2A 3VTYA 2Y3AA 2CG2A 2FF4A 4GZ5A 3EIJA 1YMPA 2LUHA 4HBDA 2F8XK 4B89A 3HHMA 2P9LG 3AU5A 4DX6D 2R5SA 2YHEA 1LTXA 4NQ0A 4WWOA 1QZ2A 1E8XA 4I9EA 4XI9A 4K0RA 4TXPA 1HXIA 4I2WA 2L0IA 1E7VA 2WXPA 4F6RD 1HG2A 5CECB 2A5EA 4TXRA 3E32A 1H0AA 2CFZA 3PS6A 5G04J 2VQ2A 3CHMA 1U2VG 3ULQA 3CKCA 3B7BA 3R9AB 4C0MA 4GPMA 1ZU2A 4BFRA 1HE8A 1IQUA 3DWLG 3IV0A 4CDNA 3V2OA 2BUGA 4J8YA 5CERB 2H6GA 3L54A 4WWNA 1EDUA 2VSOE 2BF0X 5G05C 3UUXA 3N71A 5FINA 5FQ4A 3BUAA 3ZVVA 2NXPA 2V0PA 4BY6A 2JLBA 3PUJA 4WWPA 4Z68A 4DK5A 3Q49B 4U8VD 3DSSA 4EQFA 3E37A 3UTMA 3SFZA 4UWKA 1DC2A 1N4QA 3ENEA 1L5JA 1HZ4A 1IYGA 4B8CB 4N5CA 3CLJA 2BEDA 1KPSB 4A55A 4A63B 5AQAA 3CQCB 3P1UA 3PEVB 5JHAA 3BG1B 1IQRA 3L6AA 2WXNA 4Y6CA 5BXUA 2H6IA 1H19A 3ZFWA 3L08A 1OCCE 2J07A 4EZLA 3E4BA 4DX5D 4I43A 1YA0A 4FHJA 3C3RA 3LVQE 4EECA 1WAO1 3LS8A 3SBSA 3HIZA 3D9NA 5ENTD 4KZ0A 3LEWA 3L22A 4LCTA 3PEUB 3FDHA 2ETCA 5T3RA 1D8EA 4J8FA 1S70B 5G04C 2NC9A 5ENOD 4YNDA 4L7TA 4UQXA 2OVFA 1DCQA 5ARFA 3CSFA 2P2CP 2P58C 5KJLA 3MEKA 1KLXA 1D8DA 2Y1LE 3RO3A 3FTWA 3TJPA 1YYHA 1UG3A 2LXMA 2CFUA 5FZRA 3QAQA 1LD8A 1HH8A 3CGHA 3CHSA 5H7PA 2QY7A 4OAUC 5AN8A 3SY2A 4N2SA 2V4LA 4G11A 5E75A 3UT7A 4UQZA 4PS8A 2I6HA 2XGSA 5AQBA 3ZYQA 4J8DA 3U9WA 4A1GA 4IRUA 1V55E 4ATZD 4YDYA 4LRZA 3ESKA 1FT1A 1AP7A 2RFMA 2XS8A 3L17A 3MJWA 4G2VA 2V5QC 4OVVA 3B7UX 1ELRA 2GRQB 2A5UA 4FJZA 1WDYA 4IN3B 1IHGA 3DEPA 1BD8A 4JA7A 4U96D 4CGVA 5EDSA 3SGHA 3C3OA 2DWZA 1NI1A 5JJTA 2ZISA 3ZYLA 4WNFA 1QNFA 1FPPA 1LF8A 4KT6B 2KZTB 3CK7A 5AIJA 1XNFA 2DCPA 1Z3XA 4TUMA 4U7EB 3FULA 1A17A 4XEIG 4E85A 4J8SA 5CEDB 4V3IA 1OWOA 4LG6A 5EYPF 1Z6TA 4F1PA 3IBEA 4BERA 1HU3A 1MX2A 3BEEA 3CVLA 4PS3A 3TWUA 3ULYA 3HG0D 2I1KA 1FVHA 3CSTA 3MCXA 1OUVA 3ISMC 2F37A 1H2VC 2BKKB 4GPKA 3CK8A 3CKBA 1HG5A 1OCZE 3DSUA 4GYWA 2ZGGA 4KXKB 3BG0B 3VLFA 4JHRA 1N11A 4GCNA 2X6IA 1K1AA 4K5CA 3Q79A 1TJCA 3QOUA 3MZLB 1N4PA 2WXLA 2VGXB 3AS5A 3E33A 1TNUA 4O60A 3EU5A 5CHEE 3FTZA 2VSYA 3V79K 3HXFA 3IHVA 3FEXA 2XPYA 4HS2A 2WXJA 3B7RL 3HVEA 4HOTA 3PE4A 3CIAA 4WUYA 1MQSA 4I6GA 5CCMA 5BV1A 4XE0A 3RRMB 3Q9NC 3B7SA 1TN7A 2FI7A 3TGOA 3Q78A 3QKYA 3LDZA 5G2NA 3ZEFA 5HKPA 3CEQA 5AYWD 3ZUVB 4UUCA 3TAXA 1NZNA 3FUMA 2GRNB 3DSVA 4GTMA 2R03A 1TNZA 3UKRG 4GZCA 5E76A 4F53A 4N3BA 1H2TC 3RAUA 5FQ8A 4L23A 4L9PA 3JUIA 3UKUG 3IXEA 3UM3A 1SQMA 3LY7A 5KBAA 4L2LA 2ZGDA 1U3DA 2IEJA 1N54A 4LERA 4GA1A 3D9MA 3HRAA 3GZSA 2F0YA 2JEKA 4FADA 2WB2A 2QC9A 4ILGA 4EHMA 2P9SG 1K1BA 4I2ZA 5ENPD 4UWLA 5HI7A 2J4BA 1X81A 2CG3A 2J09A 1X5BA 2Q7FA 4CRWA 3R7QA 5A7DB 4H7XA 3DSXA 2PL2A 2GRLA 3G2WA 3KEAA 3WXXA 4DX2A 3ULEG 2IO2C 2DYRE 2IOSA 3JYSA 3FUHA 2R02A 3KS2A 1UOHA 2IFUA 5CMYA 4KYOB 3EJNA 3PZ2A 2PNNA 3EHMA 1V54E 2FO7A 2UWJG 4ANVA 4BT8A 5LOZA 3JQ1A 1MZCA 2DIWA 5EX3A 2FBNA 2JABA 1DNPA 1FVFA 2WVIA 3P2BA 4GZ6A 5AQ9A 4U8HA 3RK6A 4A3TA 1MHQA 3G2TA 3PZ1A 2IQCA 1SZ9A 3DSTA 1WG0A 2FULA 3SD5A 2KBXA 4KVMA 3Q47B 3Q73A 2OVBA 2X6KA 3KEZA 3ZYMA 2GRMA 2Y0BG 3PZDA 5KNGA 1XGWA 3V30A 1N0RA 4NRHB 1OCRE 3T8MA 3TXNA 5A23A 2VTBB 2KM4A 4N2QA 1KZPA 3FH8A 2I9CA 4FP7A 4JB8P 5CCLA 3FH7A 4YVOA 4NURA 4CDMA 3OXFA 2VGYA 5HS0A 4RSYA 2J08A 4KZCA 3RIBA 3MYVA 4GTOA 2ILRA 2AXZA 1MX6A 4JL0A 2J8SD 1BLXB 1K8KG 2WMNA 3ASOE 3OTNA 3V2XA 3E34A 5BNWA 4W9RA 5LX8A 1N9AA 4FLHA 3GYZA 2L0TB 2EQXA 3J5PA 3DEOA 3I5PA 4APFA 4FA6A 2DVWA 1TN8A 1FCHA 1KT0A 5LP0A 4ACKA 5FJYA 3QWVA 2I2OA 3FU3A 4HQDA 4AY6A 3MX3A 5M72A 2VSNA 4U63A 2AXUA 4XZ4A 2VGEA 3J5QB 4GYYA 3PUKA 4DRXE 3DRAA 3FWVA 5D2MC 1OY3D 3PZ3A 2GROB 1TNOA 2BKGA 3FU6A 3Q7FA 3QC1A 5JA4D 2Y4TA 2PM7A 1E8ZA 4RG9A 3PE3A 2OCCE 3BQOA 5D66A 5AENA 4LNGA 3D9IA 1ELWA 4O1PA 1N52A 4U0UA 5JJ7A 1E7UA 3AS8A 4HXIA 4FHKA 2VYIA 3LPZA 3ZHEB 3SI5A 3C3QA 2XZDG 3L82A 4G24A 1KT1A 4ANXA 3QWPA 2UY1B 1TJFA 1A5EA 2R17C 1HFAA 5AAOA 1JUQA 4K03A 3UT4A 5EILA 3CVPA 1E96B 3OAWA 3D9KA 2CHXA 1O1TA 2EIME 2R59A 4HRNA 3EUVA 3TWRA 5EX0A 3SZ7A 2LSVA 3NOGD 4AIFA 3S7DA 3MKQB 3T5XA 2MOWA 2IY0C 3LY8A 1S63A 1ZBPA 2RG8A 3T9KA 2KZTA 4GZ3A 4ACLA 3CVNA 2X3MA 4YDWA 3CV0A 1FT2A 1OWLA 2WXOA 3IKOB 2WPVA 2LAIA 1DCEA 2QZAA 3QNKA 1OT8A 3HXBA 4PUCA 3FTVA 4RVBA 2XENA 4AEZC 3TWWA 3KAEA 1DVPA 4HI8A 2WXGA 1NP7A 3W9GA 4GTQA 4I1AA 4Y6WA 4CZ2D 5FT9A 3RSEG 3EHNA 1JWFA 2XCCA 3FP3A 3L13A 3U66A 4KMOA 5EIDA 5FZSA 1TN6A 3APDA 4URKA 2MRIA 3EHQA 3Q15A 3UM1A 2WM9A 3ZW3A 4FC8A 3Q75A 2IO3C 3NZUA 2AXVA 1G3NB 2VGXA 5ITZF 5B1BE 3JQ0A 3GZ2A 4GAAA 4HI9A 4BSZB 3UIPC 3T5VA 2WXIA 3AG1E 2X6FA 4HNAD 3UT8A 1ZB1A 1TEZA 4IYPA 4HLEA 3L16A 1SA5A 4JC8A 4N3CA 1OWMA 2EIKE 3JXIA 4BT9A 3U64A 1NA0A 2KC7A 2FEZA 5BUZA 3JXJA 3Q9UC 1JPLA 4MS6A 3CVUA 2H6HA 4B93B 2E2EA 2WQHA 4CDRA 1HS6A 1W3BA 4LNBA 3AG4E 3SQVA 2WQ6A 3D9JA 2EILE 4P29A 2LAHA 3MA5A 3TWTA 3NOCD 4I6JA 4ILIA 4AJWA 4C9BB 3TWXA 3AG3E 4AVXA 4BWRA 3QJZA 4DI3A 4DUIA 2YQ8A 3FH5A 3ABKE 1E90A 1OWNA 2BTDA 2WXHA 4KBQA 4ANUA 2R2LA 2XCBA 3SFXA 3S7JA 4CT0A 3SNXA 5ENSD 5J90A 3ZXSA 4WNGA 2J9QA 4G8LA 4NACA 4G1TA 4PS7A 2V5FA 1PAQA 5CBOA 3ABME 5CEAA 3IHYA 4JEUA 3FU0A 4HVBA 2X6JA 3JUEA 3D9LA 3PZ4A 5FZQA 4B0ZA 3RJVA 3OXLA 3KSQA 5CBNA 3B13A 4CGWA 2FO1E 2XEHA 5T4YA 1IXVA 3S2AA 1RW2A 3NZSA 5T8IA 2AWIA 4LNUD 4F1SA 2VSXE 4M3OA 4UI9K 2VJ8A 4MLPA 5D0QD 5ENNA 4JW1A 3ML9A 4UQYA 3NAWA 4J7WA 3RO2A 4H7YA 2XHEA 4AM9A 4B8AA 4K5AB 3K9IA 3CQGB 4BESA 4ILHB 4A3VA 1UJJA 4GU5A 2V4HC 3ASNE 4DPRA 3CHRA 3UINC 5BPPA 1Z3YA 3VLEA 3G2VA 3DSWA 2LO6A 5EKQD 2KCKA 2HO1A 2OOEA 4GB9A 2MYOA 2NSZA 4YVQC 4DX1A 4J0UA 4GMLA 5ARGA 3DXKG 3FUEA 2X6HA 3TG5A 3URZA 5FTPA 2VTBA 2EINE 4UWHA 1U3CA 4R7LA 3FUJA 4GMJA 5KCMA 3KSLA 4A1SA 3C5RA 1N94A 4HOQA 3ZYKA 5B3SE 2Y69E 4Q94A 1JCRA 3SO8A 2B6CA 2E0IA 4EBAA 5G55A 3V31A 3E30A 3MGBA 3G2UA 1QYMA 1OXJA 4ZHBA 4GTSA 4BSXA 3ESLA 3G2SA 4HFGA 1IHBA 1UW4B 4U04A 1WM5A 4JHKA 5BXOA 3EHRA 3Q7AA 2KXPC 3FUFA 1O5MA 3TL5A 3DBSA 4LEUA 4WAFA 3ZN3A 5B1AE 3R7RA 3FTYA 3FUIA 1E8YA 2WMOA 3EDTB 2I1JA 1RZ4A 4FULA 2MHKA 3UM2A 4E6HA 2QYUA 2GGFA 1Y8MA 1Y6IA 1WY6A 3FHEA 1TNYA 2J4DA 3PDNA 2WQ7A 3HYMB 2DBAA 1N0QA 4C48B 2ZXWE 5CRVA 2GW1A 4B94A 1SVXA 3DPYA 3CVYA 3FY4A 1D9SA 4RQIA 1BPOA 4GTVA 1TNBA 3RKVA 5J08A 2XPIA 3SF4A 3LYAA 4I1MA 5KJKA 3GW4A 3CHQA 3FEYA 3B95A 2L9BA 4U0ZA 2KCVA 3ONLA 2F8YA 4U8YD 4JA9A 4OAVB 3ZHEA 3C72A 4BX9A 4J8EA 2UY1A 4DX7D 3LVRE 3ZIMA 1P5QA 1BU9A 4M7CA 2XQ0A 4LUNU 1QBQA 4HOUA 5AJDA 4GCOA 2GRRB 3CVWA 1O1SA 3PNLB 3UPVA 1EYHA 4DI4A 2L6JA 2OEVA 2RFAA 3MKQA 3S7FA 3JCKC 1SZAA 1UJKA 4JZYA 5FQ7A 2P9PG 4HOSA 4XIFA 3UIOC 3FU5A 1EF1C 3X2QE 5AJLA 4N5QA 5C2YA 4I17A 2AVPA 1B89A 2B0OE 3DPDA 4G8KA 3S7BA 3VTXA 4TXQA 1ELKA 4CCAA 1JCQA 3C98A 4I1OB 4APOA 1LD7A 2EIJE 5D0OD 4X8QA 3LXUX 4EBAG 3TG4A 1PC2A 4GZDA 1UN8A 4QFVA 4MRUA 3APFA 1YCSB 2KATA 4TUUA 3RU0A 5IY5E 5KJNA 2QYJA 1Z5SC 4MKTA 4BX8A 2PM6A 3PREA 3I3NA 5DBKA 3UXGA 4CT4A 3B7TA 4GYOA 2P9KG 2LXLA 3MV3B 4TRQA 2XZTG 4XI0A 3ZPJA 1BI7B 1HO8A 2P9IG 3TWVA 2IF4A 2Y4UA 4XX5A 2RKKA 4EPZA 2IONA 1KZOA 2H6FA 4IULA 4XKCA 2ONDA 4FJYA 5FQ6A 5BV0A 3D3MA 2DZNA 4GTPA 5FIOA 4BTAA 1JWGA 3SHFA 3ZXPA 4TV3A 1OCOE 2P9NG 2M63A 3AAAC 2A4ZA 1H6PA 2P9UG 4HRLA 4GTTA 1H2UA 3CK9A 1N95A 2XEEA 3DXMG 4CYMD 2C0LA 3ZKJA 1HX8A 3CVVA 5HQ8A 4AXHA 2IU1A 4JPSA 1H6KA 4NIKA 4BETA 3I4RB 2XRYA 3Q4AB 1PY1A 4BEPA 3T8KA 1HF8A 3CVQA 5KJMA 4F3VA 1VDYA 1GW6A 3ASFA 3U4TA 1MX4A 3ZRHA 5LCWJ 2NYJA 4K5BA 4AV7A 4EZJA 3D9OA 3HXEA 2C2LA 3NF1A 5EN5D 4YDOA 4DLQA 5CRUA 1IKND 4CEMA 5KWDA 5ENRD 1QQEA 4UWFA 4ABNA 3LJ3A 1MJ0A 2AW6A 4U95D 4FLBA 4N3AA 4UI9J 3GZ1A 4GA2A 3R9MA 5JJ6A 3O48A 2X38A 2XS1A 3WG7E 5ENQD 5BW8C 5DIZA 1AWCB 3AS4A 4AOFA 3UX4A 4JXTA 3HXDA 3ZGQA 3ASDA 1NA3A 3PH0C 3MV2B 1TYQG 1TR4A 4WNEA 5JHBA 4I6EA 3FUKA 4HLLA 3I4GA 4LSZE 4JEHA 4C0EA 5A6CA 4JHJA 3PRZA 4L1BA 3O4ZA 4GTRA 2XGOA 1INZA 2QFCA 3QWWA 4G26A 3LCAA 4ATGA 4PH4B 4HRMB 4KVOA 2WXFA 2LNIA 3D9HA 5EYLA 4Q69A 2ETAA 3F6QA 2IOLA 4HB5A 2XGMA 1N4SA 3MKRA 1EPUA 2HYZA 2PQRA 3QDNA 1S64A 1O1RA 4AY5A 4JD2G 1N4RA 3QK0A 4D10C 5KNHD 2PZIA 4ZFHA 1K3ZD 3AU4A 2HE0A 5ANLA 3LY9A 3LJNA 3AG2E 3NQPA 1JCSA 5LCWC 4JVSA 2RD0A 3TXMA 3ML8A 3BU8A 4QQIA 5BT1A 2OEWA 2V8SE 3OXGA 4F7AA 2CHWA 5AQ7A 2WXMA 5ANRA 2WXQA 3APCA 1UN9A 3EIQC 2DZOA 2WXRA 1E8WA 4L2YA 1NL4A 3IEGA 3PNTB 4UI9C 2CHZA 4OVUA 3ABLE 5AARA 1BI8B 1SW6A 3TWQA 2GRPB 3U3WA 4GA0A
chains in the Genus database with same CATH topology
2ZIRA 3HXFA 3DSXA 4GTOA 4YDEA 2R2LA 3SFXA 1LD7A 2H6GA 1D8EA 3DPYA 1NI1A 2ZISA 3Q75A 3E34A 3SFYA 1TN7A 4GTVA 1N9AA 1FPPA 1TNBA 3PZ2A 1O1TA 3Q78A 3EUVA 3HXCA 3PZ4A 1N4SA 3KSLA 1MZCA 1N94A 1TN8A 3HXEA 3DSSA 1S64A 3E37A 3KSQA 3C72A 4YDOA 1JCRA 1D8DA 1O1RA 1LTXA 1N4RA 3DSVA 1S63A 4GTMA 1N4QA 3PZ1A 1SA5A 3E30A 1LD8A 1TNZA 4GTSA 1KZOA 1QBQA 2H6FA 3DSTA 2BEDA 1JCSA 1SA4A 1FT2A 4GTPA 1O1SA 3DRAA 3Q73A 1DCEA 3Q7AA 3HXBA 4L9PA 1O5MA 3PZ3A 1TNOA 3Q7FA 2H6IA 3E32A 2H6HA 2IEJA 4GTQA 3DSUA 4GTTA 4LNBA 1N95A 2F0YA 3HXDA 3Q79A 1FT1A 1KZPA 1N4PA 4EHMA 1NL4A 3DSWA 1TNYA 4LNGA 1TN6A 3E33A 1TNUA 4MBGA 3EU5A 1X81A 1JCQA 4GTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIR A;  3HXF A;  3DSX A;  4GTO A;  4YDE A;  2R2L A;  3SFX A;  1LD7 A;  2H6G A;  1D8E A;  3DPY A;  1NI1 A;  2ZIS A;  3Q75 A;  3E34 A;  3SFY A;  1TN7 A;  4GTV A;  1N9A A;  1FPP A;  1TNB A;  3PZ2 A;  1O1T A;  3Q78 A;  3EUV A;  3HXC A;  3PZ4 A;  1N4S A;  3KSL A;  1MZC A;  1N94 A;  1TN8 A;  3HXE A;  3DSS A;  1S64 A;  3E37 A;  3KSQ A;  3C72 A;  4YDO A;  1JCR A;  1D8D A;  1O1R A;  1LTX A;  1N4R A;  3DSV A;  1S63 A;  4GTM A;  1N4Q A;  3PZ1 A;  1SA5 A;  3E30 A;  1LD8 A;  1TNZ A;  4GTS A;  1KZO A;  1QBQ A;  2H6F A;  3DST A;  2BED A;  1JCS A;  1SA4 A;  1FT2 A;  4GTP A;  1O1S A;  3DRA A;  3Q73 A;  1DCE A;  3Q7A A;  3HXB A;  4L9P A;  1O5M A;  3PZ3 A;  1TNO A;  3Q7F A;  2H6I A;  3E32 A;  2H6H A;  2IEJ A;  4GTQ A;  3DSU A;  4GTT A;  4LNB A;  1N95 A;  2F0Y A;  3HXD A;  3Q79 A;  1FT1 A;  1KZP A;  1N4P A;  4EHM A;  1NL4 A;  3DSW A;  1TNY A;  4LNG A;  1TN6 A;  3E33 A;  1TNU A;  4MBG A;  3EU5 A;  1X81 A;  1JCQ A;  4GTR A; 
#chains in the Genus database with same CATH topology
 4YDE A;  1NFI E;  4DLO A;  1S0P A;  4AP2 A;  5EIB E;  3FTS A;  4U07 A;  2YNQ A;  2XRZ A;  2YHC A;  3CR3 A;  3FUN A;  2L6B A;  5LFA A;  4O1O A;  3SFY A;  3UMV A;  3ZU7 B;  4J6I A;  3ASG A;  3UQ3 A;  3D9P A;  3HDX A;  1OWP A;  3FTU A;  3HXC A;  3VLD A;  4BTB A;  2ZU6 B;  4FU3 A;  2ETB A;  3TWS A;  3EU9 A;  3L9T A;  2J49 A;  5JMN D;  3RRU A;  2IJG X;  1MYO A;  3CHP A;  3UI2 A;  3Q5M A;  2WXK A;  2HR2 A;  4RLY A;  3QAR A;  1H6O A;  4GMR A;  2YIN A;  5CMW A;  3UM0 A;  5HRY A;  1SA4 A;  3ZNG A;  3PVL A;  3FTX A;  4DJA A;  4I9C A;  4G23 A;  4WND A;  3SBT B;  4RG6 A;  4ME2 A;  3FUD A;  3QB2 A;  4XKB A;  5FWQ A;  4U0S A;  3HVE B;  2DYS E;  4N39 A;  4EZK A;  3ONK A;  2C0M A;  5C1D A;  3NBN B;  4PDX A;  2KCL A;  4ANW A;  3ASH A;  5G05 J;  4O6F A;  2PQN A;  4OYS A;  4G25 A;  4Q96 A;  4HOR A;  2XPZ A;  4UWG A;  4MBG A;  3CHO A;  3W9F A;  2OV8 A;  2AJA A;  3FFL A;  3CVX A;  1Q2Z A;  3KD7 A;  3RRN B;  2LSU A;  2XEV A;  2R05 A;  2HM8 A;  2ZIR A;  3LKU A;  3AJI A;  3NB2 A;  3VTY A;  2Y3A A;  2CG2 A;  2FF4 A;  4GZ5 A;  3EIJ A;  1YMP A;  2LUH A;  4HBD A;  2F8X K;  4B89 A;  3HHM A;  2P9L G;  3AU5 A;  4DX6 D;  2R5S A;  2YHE A;  1LTX A;  4NQ0 A;  4WWO A;  1QZ2 A;  1E8X A;  4I9E A;  4XI9 A;  4K0R A;  4TXP A;  1HXI A;  4I2W A;  2L0I A;  1E7V A;  2WXP A;  4F6R D;  1HG2 A;  5CEC B;  2A5E A;  4TXR A;  3E32 A;  1H0A A;  2CFZ A;  3PS6 A;  5G04 J;  2VQ2 A;  3CHM A;  1U2V G;  3ULQ A;  3CKC A;  3B7B A;  3R9A B;  4C0M A;  4GPM A;  1ZU2 A;  4BFR A;  1HE8 A;  1IQU A;  3DWL G;  3IV0 A;  4CDN A;  3V2O A;  2BUG A;  4J8Y A;  5CER B;  2H6G A;  3L54 A;  4WWN A;  1EDU A;  2VSO E;  2BF0 X;  5G05 C;  3UUX A;  3N71 A;  5FIN A;  5FQ4 A;  3BUA A;  3ZVV A;  2NXP A;  2V0P A;  4BY6 A;  2JLB A;  3PUJ A;  4WWP A;  4Z68 A;  4DK5 A;  3Q49 B;  4U8V D;  3DSS A;  4EQF A;  3E37 A;  3UTM A;  3SFZ A;  4UWK A;  1DC2 A;  1N4Q A;  3ENE A;  1L5J A;  1HZ4 A;  1IYG A;  4B8C B;  4N5C A;  3CLJ A;  2BED A;  1KPS B;  4A55 A;  4A63 B;  5AQA A;  3CQC B;  3P1U A;  3PEV B;  5JHA A;  3BG1 B;  1IQR A;  3L6A A;  2WXN A;  4Y6C A;  5BXU A;  2H6I A;  1H19 A;  3ZFW A;  3L08 A;  1OCC E;  2J07 A;  4EZL A;  3E4B A;  4DX5 D;  4I43 A;  1YA0 A;  4FHJ A;  3C3R A;  3LVQ E;  4EEC A;  1WAO 1;  3LS8 A;  3SBS A;  3HIZ A;  3D9N A;  5ENT D;  4KZ0 A;  3LEW A;  3L22 A;  4LCT A;  3PEU B;  3FDH A;  2ETC A;  5T3R A;  1D8E A;  4J8F A;  1S70 B;  5G04 C;  2NC9 A;  5ENO D;  4YND A;  4L7T A;  4UQX A;  2OVF A;  1DCQ A;  5ARF A;  3CSF A;  2P2C P;  2P58 C;  5KJL A;  3MEK A;  1KLX A;  1D8D A;  2Y1L E;  3RO3 A;  3FTW A;  3TJP A;  1YYH A;  1UG3 A;  2LXM A;  2CFU A;  5FZR A;  3QAQ A;  1LD8 A;  1HH8 A;  3CGH A;  3CHS A;  5H7P A;  2QY7 A;  4OAU C;  5AN8 A;  3SY2 A;  4N2S A;  2V4L A;  4G11 A;  5E75 A;  3UT7 A;  4UQZ A;  4PS8 A;  2I6H A;  2XGS A;  5AQB A;  3ZYQ A;  4J8D A;  3U9W A;  4A1G A;  4IRU A;  1V55 E;  4ATZ D;  4YDY A;  4LRZ A;  3ESK A;  1FT1 A;  1AP7 A;  2RFM A;  2XS8 A;  3L17 A;  3MJW A;  4G2V A;  2V5Q C;  4OVV A;  3B7U X;  1ELR A;  2GRQ B;  2A5U A;  4FJZ A;  1WDY A;  4IN3 B;  1IHG A;  3DEP A;  1BD8 A;  4JA7 A;  4U96 D;  4CGV A;  5EDS A;  3SGH A;  3C3O A;  2DWZ A;  1NI1 A;  5JJT A;  2ZIS A;  3ZYL A;  4WNF A;  1QNF A;  1FPP A;  1LF8 A;  4KT6 B;  2KZT B;  3CK7 A;  5AIJ A;  1XNF A;  2DCP A;  1Z3X A;  4TUM A;  4U7E B;  3FUL A;  1A17 A;  4XEI G;  4E85 A;  4J8S A;  5CED B;  4V3I A;  1OWO A;  4LG6 A;  5EYP F;  1Z6T A;  4F1P A;  3IBE A;  4BER A;  1HU3 A;  1MX2 A;  3BEE A;  3CVL A;  4PS3 A;  3TWU A;  3ULY A;  3HG0 D;  2I1K A;  1FVH A;  3CST A;  3MCX A;  1OUV A;  3ISM C;  2F37 A;  1H2V C;  2BKK B;  4GPK A;  3CK8 A;  3CKB A;  1HG5 A;  1OCZ E;  3DSU A;  4GYW A;  2ZGG A;  4KXK B;  3BG0 B;  3VLF A;  4JHR A;  1N11 A;  4GCN A;  2X6I A;  1K1A A;  4K5C A;  3Q79 A;  1TJC A;  3QOU A;  3MZL B;  1N4P A;  2WXL A;  2VGX B;  3AS5 A;  3E33 A;  1TNU A;  4O60 A;  3EU5 A;  5CHE E;  3FTZ A;  2VSY A;  3V79 K;  3HXF A;  3IHV A;  3FEX A;  2XPY A;  4HS2 A;  2WXJ A;  3B7R L;  3HVE A;  4HOT A;  3PE4 A;  3CIA A;  4WUY A;  1MQS A;  4I6G A;  5CCM A;  5BV1 A;  4XE0 A;  3RRM B;  3Q9N C;  3B7S A;  1TN7 A;  2FI7 A;  3TGO A;  3Q78 A;  3QKY A;  3LDZ A;  5G2N A;  3ZEF A;  5HKP A;  3CEQ A;  5AYW D;  3ZUV B;  4UUC A;  3TAX A;  1NZN A;  3FUM A;  2GRN B;  3DSV A;  4GTM A;  2R03 A;  1TNZ A;  3UKR G;  4GZC A;  5E76 A;  4F53 A;  4N3B A;  1H2T C;  3RAU A;  5FQ8 A;  4L23 A;  4L9P A;  3JUI A;  3UKU G;  3IXE A;  3UM3 A;  1SQM A;  3LY7 A;  5KBA A;  4L2L A;  2ZGD A;  1U3D A;  2IEJ A;  1N54 A;  4LER A;  4GA1 A;  3D9M A;  3HRA A;  3GZS A;  2F0Y A;  2JEK A;  4FAD A;  2WB2 A;  2QC9 A;  4ILG A;  4EHM A;  2P9S G;  1K1B A;  4I2Z A;  5ENP D;  4UWL A;  5HI7 A;  2J4B A;  1X81 A;  2CG3 A;  2J09 A;  1X5B A;  2Q7F A;  4CRW A;  3R7Q A;  5A7D B;  4H7X A;  3DSX A;  2PL2 A;  2GRL A;  3G2W A;  3KEA A;  3WXX A;  4DX2 A;  3ULE G;  2IO2 C;  2DYR E;  2IOS A;  3JYS A;  3FUH A;  2R02 A;  3KS2 A;  1UOH A;  2IFU A;  5CMY A;  4KYO B;  3EJN A;  3PZ2 A;  2PNN A;  3EHM A;  1V54 E;  2FO7 A;  2UWJ G;  4ANV A;  4BT8 A;  5LOZ A;  3JQ1 A;  1MZC A;  2DIW A;  5EX3 A;  2FBN A;  2JAB A;  1DNP A;  1FVF A;  2WVI A;  3P2B A;  4GZ6 A;  5AQ9 A;  4U8H A;  3RK6 A;  4A3T A;  1MHQ A;  3G2T A;  3PZ1 A;  2IQC A;  1SZ9 A;  3DST A;  1WG0 A;  2FUL A;  3SD5 A;  2KBX A;  4KVM A;  3Q47 B;  3Q73 A;  2OVB A;  2X6K A;  3KEZ A;  3ZYM A;  2GRM A;  2Y0B G;  3PZD A;  5KNG A;  1XGW A;  3V30 A;  1N0R A;  4NRH B;  1OCR E;  3T8M A;  3TXN A;  5A23 A;  2VTB B;  2KM4 A;  4N2Q A;  1KZP A;  3FH8 A;  2I9C A;  4FP7 A;  4JB8 P;  5CCL A;  3FH7 A;  4YVO A;  4NUR A;  4CDM A;  3OXF A;  2VGY A;  5HS0 A;  4RSY A;  2J08 A;  4KZC A;  3RIB A;  3MYV A;  4GTO A;  2ILR A;  2AXZ A;  1MX6 A;  4JL0 A;  2J8S D;  1BLX B;  1K8K G;  2WMN A;  3ASO E;  3OTN A;  3V2X A;  3E34 A;  5BNW A;  4W9R A;  5LX8 A;  1N9A A;  4FLH A;  3GYZ A;  2L0T B;  2EQX A;  3J5P A;  3DEO A;  3I5P A;  4APF A;  4FA6 A;  2DVW A;  1TN8 A;  1FCH A;  1KT0 A;  5LP0 A;  4ACK A;  5FJY A;  3QWV A;  2I2O A;  3FU3 A;  4HQD A;  4AY6 A;  3MX3 A;  5M72 A;  2VSN A;  4U63 A;  2AXU A;  4XZ4 A;  2VGE A;  3J5Q B;  4GYY A;  3PUK A;  4DRX E;  3DRA A;  3FWV A;  5D2M C;  1OY3 D;  3PZ3 A;  2GRO B;  1TNO A;  2BKG A;  3FU6 A;  3Q7F A;  3QC1 A;  5JA4 D;  2Y4T A;  2PM7 A;  1E8Z A;  4RG9 A;  3PE3 A;  2OCC E;  3BQO A;  5D66 A;  5AEN A;  4LNG A;  3D9I A;  1ELW A;  4O1P A;  1N52 A;  4U0U A;  5JJ7 A;  1E7U A;  3AS8 A;  4HXI A;  4FHK A;  2VYI A;  3LPZ A;  3ZHE B;  3SI5 A;  3C3Q A;  2XZD G;  3L82 A;  4G24 A;  1KT1 A;  4ANX A;  3QWP A;  2UY1 B;  1TJF A;  1A5E A;  2R17 C;  1HFA A;  5AAO A;  1JUQ A;  4K03 A;  3UT4 A;  5EIL A;  3CVP A;  1E96 B;  3OAW A;  3D9K A;  2CHX A;  1O1T A;  2EIM E;  2R59 A;  4HRN A;  3EUV A;  3TWR A;  5EX0 A;  3SZ7 A;  2LSV A;  3NOG D;  4AIF A;  3S7D A;  3MKQ B;  3T5X A;  2MOW A;  2IY0 C;  3LY8 A;  1S63 A;  1ZBP A;  2RG8 A;  3T9K A;  2KZT A;  4GZ3 A;  4ACL A;  3CVN A;  2X3M A;  4YDW A;  3CV0 A;  1FT2 A;  1OWL A;  2WXO A;  3IKO B;  2WPV A;  2LAI A;  1DCE A;  2QZA A;  3QNK A;  1OT8 A;  3HXB A;  4PUC A;  3FTV A;  4RVB A;  2XEN A;  4AEZ C;  3TWW A;  3KAE A;  1DVP A;  4HI8 A;  2WXG A;  1NP7 A;  3W9G A;  4GTQ A;  4I1A A;  4Y6W A;  4CZ2 D;  5FT9 A;  3RSE G;  3EHN A;  1JWF A;  2XCC A;  3FP3 A;  3L13 A;  3U66 A;  4KMO A;  5EID A;  5FZS A;  1TN6 A;  3APD A;  4URK A;  2MRI A;  3EHQ A;  3Q15 A;  3UM1 A;  2WM9 A;  3ZW3 A;  4FC8 A;  3Q75 A;  2IO3 C;  3NZU A;  2AXV A;  1G3N B;  2VGX A;  5ITZ F;  5B1B E;  3JQ0 A;  3GZ2 A;  4GAA A;  4HI9 A;  4BSZ B;  3UIP C;  3T5V A;  2WXI A;  3AG1 E;  2X6F A;  4HNA D;  3UT8 A;  1ZB1 A;  1TEZ A;  4IYP A;  4HLE A;  3L16 A;  1SA5 A;  4JC8 A;  4N3C A;  1OWM A;  2EIK E;  3JXI A;  4BT9 A;  3U64 A;  1NA0 A;  2KC7 A;  2FEZ A;  5BUZ A;  3JXJ A;  3Q9U C;  1JPL A;  4MS6 A;  3CVU A;  2H6H A;  4B93 B;  2E2E A;  2WQH A;  4CDR A;  1HS6 A;  1W3B A;  4LNB A;  3AG4 E;  3SQV A;  2WQ6 A;  3D9J A;  2EIL E;  4P29 A;  2LAH A;  3MA5 A;  3TWT A;  3NOC D;  4I6J A;  4ILI A;  4AJW A;  4C9B B;  3TWX A;  3AG3 E;  4AVX A;  4BWR A;  3QJZ A;  4DI3 A;  4DUI A;  2YQ8 A;  3FH5 A;  3ABK E;  1E90 A;  1OWN A;  2BTD A;  2WXH A;  4KBQ A;  4ANU A;  2R2L A;  2XCB A;  3SFX A;  3S7J A;  4CT0 A;  3SNX A;  5ENS D;  5J90 A;  3ZXS A;  4WNG A;  2J9Q A;  4G8L A;  4NAC A;  4G1T A;  4PS7 A;  2V5F A;  1PAQ A;  5CBO A;  3ABM E;  5CEA A;  3IHY A;  4JEU A;  3FU0 A;  4HVB A;  2X6J A;  3JUE A;  3D9L A;  3PZ4 A;  5FZQ A;  4B0Z A;  3RJV A;  3OXL A;  3KSQ A;  5CBN A;  3B13 A;  4CGW A;  2FO1 E;  2XEH A;  5T4Y A;  1IXV A;  3S2A A;  1RW2 A;  3NZS A;  5T8I A;  2AWI A;  4LNU D;  4F1S A;  2VSX E;  4M3O A;  4UI9 K;  2VJ8 A;  4MLP A;  5D0Q D;  5ENN A;  4JW1 A;  3ML9 A;  4UQY A;  3NAW A;  4J7W A;  3RO2 A;  4H7Y A;  2XHE A;  4AM9 A;  4B8A A;  4K5A B;  3K9I A;  3CQG B;  4BES A;  4ILH B;  4A3V A;  1UJJ A;  4GU5 A;  2V4H C;  3ASN E;  4DPR A;  3CHR A;  3UIN C;  5BPP A;  1Z3Y A;  3VLE A;  3G2V A;  3DSW A;  2LO6 A;  5EKQ D;  2KCK A;  2HO1 A;  2OOE A;  4GB9 A;  2MYO A;  2NSZ A;  4YVQ C;  4DX1 A;  4J0U A;  4GML A;  5ARG A;  3DXK G;  3FUE A;  2X6H A;  3TG5 A;  3URZ A;  5FTP A;  2VTB A;  2EIN E;  4UWH A;  1U3C A;  4R7L A;  3FUJ A;  4GMJ A;  5KCM A;  3KSL A;  4A1S A;  3C5R A;  1N94 A;  4HOQ A;  3ZYK A;  5B3S E;  2Y69 E;  4Q94 A;  1JCR A;  3SO8 A;  2B6C A;  2E0I A;  4EBA A;  5G55 A;  3V31 A;  3E30 A;  3MGB A;  3G2U A;  1QYM A;  1OXJ A;  4ZHB A;  4GTS A;  4BSX A;  3ESL A;  3G2S A;  4HFG A;  1IHB A;  1UW4 B;  4U04 A;  1WM5 A;  4JHK A;  5BXO A;  3EHR A;  3Q7A A;  2KXP C;  3FUF A;  1O5M A;  3TL5 A;  3DBS A;  4LEU A;  4WAF A;  3ZN3 A;  5B1A E;  3R7R A;  3FTY A;  3FUI A;  1E8Y A;  2WMO A;  3EDT B;  2I1J A;  1RZ4 A;  4FUL A;  2MHK A;  3UM2 A;  4E6H A;  2QYU A;  2GGF A;  1Y8M A;  1Y6I A;  1WY6 A;  3FHE A;  1TNY A;  2J4D A;  3PDN A;  2WQ7 A;  3HYM B;  2DBA A;  1N0Q A;  4C48 B;  2ZXW E;  5CRV A;  2GW1 A;  4B94 A;  1SVX A;  3DPY A;  3CVY A;  3FY4 A;  1D9S A;  4RQI A;  1BPO A;  4GTV A;  1TNB A;  3RKV A;  5J08 A;  2XPI A;  3SF4 A;  3LYA A;  4I1M A;  5KJK A;  3GW4 A;  3CHQ A;  3FEY A;  3B95 A;  2L9B A;  4U0Z A;  2KCV A;  3ONL A;  2F8Y A;  4U8Y D;  4JA9 A;  4OAV B;  3ZHE A;  3C72 A;  4BX9 A;  4J8E A;  2UY1 A;  4DX7 D;  3LVR E;  3ZIM A;  1P5Q A;  1BU9 A;  4M7C A;  2XQ0 A;  4LUN U;  1QBQ A;  4HOU A;  5AJD A;  4GCO A;  2GRR B;  3CVW A;  1O1S A;  3PNL B;  3UPV A;  1EYH A;  4DI4 A;  2L6J A;  2OEV A;  2RFA A;  3MKQ A;  3S7F A;  3JCK C;  1SZA A;  1UJK A;  4JZY A;  5FQ7 A;  2P9P G;  4HOS A;  4XIF A;  3UIO C;  3FU5 A;  1EF1 C;  3X2Q E;  5AJL A;  4N5Q A;  5C2Y A;  4I17 A;  2AVP A;  1B89 A;  2B0O E;  3DPD A;  4G8K A;  3S7B A;  3VTX A;  4TXQ A;  1ELK A;  4CCA A;  1JCQ A;  3C98 A;  4I1O B;  4APO A;  1LD7 A;  2EIJ E;  5D0O D;  4X8Q A;  3LXU X;  4EBA G;  3TG4 A;  1PC2 A;  4GZD A;  1UN8 A;  4QFV A;  4MRU A;  3APF A;  1YCS B;  2KAT A;  4TUU A;  3RU0 A;  5IY5 E;  5KJN A;  2QYJ A;  1Z5S C;  4MKT A;  4BX8 A;  2PM6 A;  3PRE A;  3I3N A;  5DBK A;  3UXG A;  4CT4 A;  3B7T A;  4GYO A;  2P9K G;  2LXL A;  3MV3 B;  4TRQ A;  2XZT G;  4XI0 A;  3ZPJ A;  1BI7 B;  1HO8 A;  2P9I G;  3TWV A;  2IF4 A;  2Y4U A;  4XX5 A;  2RKK A;  4EPZ A;  2ION A;  1KZO A;  2H6F A;  4IUL A;  4XKC A;  2OND A;  4FJY A;  5FQ6 A;  5BV0 A;  3D3M A;  2DZN A;  4GTP A;  5FIO A;  4BTA A;  1JWG A;  3SHF A;  3ZXP A;  4TV3 A;  1OCO E;  2P9N G;  2M63 A;  3AAA C;  2A4Z A;  1H6P A;  2P9U G;  4HRL A;  4GTT A;  1H2U A;  3CK9 A;  1N95 A;  2XEE A;  3DXM G;  4CYM D;  2C0L A;  3ZKJ A;  1HX8 A;  3CVV A;  5HQ8 A;  4AXH A;  2IU1 A;  4JPS A;  1H6K A;  4NIK A;  4BET A;  3I4R B;  2XRY A;  3Q4A B;  1PY1 A;  4BEP A;  3T8K A;  1HF8 A;  3CVQ A;  5KJM A;  4F3V A;  1VDY A;  1GW6 A;  3ASF A;  3U4T A;  1MX4 A;  3ZRH A;  5LCW J;  2NYJ A;  4K5B A;  4AV7 A;  4EZJ A;  3D9O A;  3HXE A;  2C2L A;  3NF1 A;  5EN5 D;  4YDO A;  4DLQ A;  5CRU A;  1IKN D;  4CEM A;  5KWD A;  5ENR D;  1QQE A;  4UWF A;  4ABN A;  3LJ3 A;  1MJ0 A;  2AW6 A;  4U95 D;  4FLB A;  4N3A A;  4UI9 J;  3GZ1 A;  4GA2 A;  3R9M A;  5JJ6 A;  3O48 A;  2X38 A;  2XS1 A;  3WG7 E;  5ENQ D;  5BW8 C;  5DIZ A;  1AWC B;  3AS4 A;  4AOF A;  3UX4 A;  4JXT A;  3HXD A;  3ZGQ A;  3ASD A;  1NA3 A;  3PH0 C;  3MV2 B;  1TYQ G;  1TR4 A;  4WNE A;  5JHB A;  4I6E A;  3FUK A;  4HLL A;  3I4G A;  4LSZ E;  4JEH A;  4C0E A;  5A6C A;  4JHJ A;  3PRZ A;  4L1B A;  3O4Z A;  4GTR A;  2XGO A;  1INZ A;  2QFC A;  3QWW A;  4G26 A;  3LCA A;  4ATG A;  4PH4 B;  4HRM B;  4KVO A;  2WXF A;  2LNI A;  3D9H A;  5EYL A;  4Q69 A;  2ETA A;  3F6Q A;  2IOL A;  4HB5 A;  2XGM A;  1N4S A;  3MKR A;  1EPU A;  2HYZ A;  2PQR A;  3QDN A;  1S64 A;  1O1R A;  4AY5 A;  4JD2 G;  1N4R A;  3QK0 A;  4D10 C;  5KNH D;  2PZI A;  4ZFH A;  1K3Z D;  3AU4 A;  2HE0 A;  5ANL A;  3LY9 A;  3LJN A;  3AG2 E;  3NQP A;  1JCS A;  5LCW C;  4JVS A;  2RD0 A;  3TXM A;  3ML8 A;  3BU8 A;  4QQI A;  5BT1 A;  2OEW A;  2V8S E;  3OXG A;  4F7A A;  2CHW A;  5AQ7 A;  2WXM A;  5ANR A;  2WXQ A;  3APC A;  1UN9 A;  3EIQ C;  2DZO A;  2WXR A;  1E8W A;  4L2Y A;  1NL4 A;  3IEG A;  3PNT B;  4UI9 C;  2CHZ A;  4OVU A;  3ABL E;  5AAR A;  1BI8 B;  1SW6 A;  3TWQ A;  2GRP B;  3U3W A;  4GA0 A; 
#chains in the Genus database with same CATH homology
 2ZIR A;  3HXF A;  3DSX A;  4GTO A;  4YDE A;  2R2L A;  3SFX A;  1LD7 A;  2H6G A;  1D8E A;  3DPY A;  1NI1 A;  2ZIS A;  3Q75 A;  3E34 A;  3SFY A;  1TN7 A;  4GTV A;  1N9A A;  1FPP A;  1TNB A;  3PZ2 A;  1O1T A;  3Q78 A;  3EUV A;  3HXC A;  3PZ4 A;  1N4S A;  3KSL A;  1MZC A;  1N94 A;  1TN8 A;  3HXE A;  3DSS A;  1S64 A;  3E37 A;  3KSQ A;  3C72 A;  4YDO A;  1JCR A;  1D8D A;  1O1R A;  1LTX A;  1N4R A;  3DSV A;  1S63 A;  4GTM A;  1N4Q A;  3PZ1 A;  1SA5 A;  3E30 A;  1LD8 A;  1TNZ A;  4GTS A;  1KZO A;  1QBQ A;  2H6F A;  3DST A;  2BED A;  1JCS A;  1SA4 A;  1FT2 A;  4GTP A;  1O1S A;  3DRA A;  3Q73 A;  1DCE A;  3Q7A A;  3HXB A;  4L9P A;  1O5M A;  3PZ3 A;  1TNO A;  3Q7F A;  2H6I A;  3E32 A;  2H6H A;  2IEJ A;  4GTQ A;  3DSU A;  4GTT A;  4LNB A;  1N95 A;  2F0Y A;  3HXD A;  3Q79 A;  1FT1 A;  1KZP A;  1N4P A;  4EHM A;  1NL4 A;  3DSW A;  1TNY A;  4LNG A;  1TN6 A;  3E33 A;  1TNU A;  4MBG A;  3EU5 A;  1X81 A;  1JCQ A;  4GTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...