2H6GA

W102t protein farnesyltransferase mutant complexed with a geranylgeranylated ddptasacvls peptide product at 1.85a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6gA00
2IEJA 3PZ3A 3DPYA 1D8DA 2F0YA 1S64A 1S63A 3KSLA 1MZCA 1NL4A 3Q73A 1KZPA 1JCQA 4GTSA 4L9PA 1N95A 4GTTA 3C72A 1O5MA 1SA4A 2ZIRA 3PZ1A 3DSXA 3E34A 3DSTA 3PZ2A 2ZISA 3DSSA 4LNBA 3DSUA 1TN6A 1LD8A 3E37A 3DSVA 3PZ4A 1FT2A 4MBGA 1DCEA 3E30A 3HXEA 3SFYA 1N94A 1TNBA 4GTMA 3Q78A 1FT1A 3E33A 3KSQA 4YDEA 1N4SA 1FPPA 3Q7AA 1N9AA 4YDOA 1TNUA 1KZOA 1X81A 4GTVA 1QBQA 3HXDA 3E32A 3EU5A 4GTRA 1LD7A 1JCRA 4GTQA 4GTPA 4EHMA 2H6IA 3Q75A 1D8EA 4GTOA 2H6GA 3DSWA 3HXBA 3DRAA 2H6HA 1O1RA 1NI1A 3EUVA 1N4RA 1LTXA 1N4PA 2BEDA 1TNYA 1TN8A 1SA5A 2R2LA 1TN7A 3HXFA 1O1SA 1JCSA 3Q79A 1O1TA 1TNOA 3HXCA 1TNZA 4LNGA 2H6FA 3SFXA 3Q7FA 1N4QA
chains in the Genus database with same CATH superfamily
4JA7A 3ZFWA 2IO2C 3CLJA 4ILGA 3TWXA 3FUNA 1IHBA 4YDWA 3FH8A 2XPZA 1S63A 3QWWA 3LJNA 4EZKA 4ILIA 1SZAA 4HFGA 2I1JA 2XEVA 5LX8A 4GYWA 1Z5SC 4CRWA 3DSTA 3PZ2A 3DSSA 4LNBA 4HOTA 2X6KA 2UY1A 4O1OA 3PZ4A 3UMVA 5G55A 3CKBA 1TNBA 4G8LA 3ZKJA 3PDNA 3OTNA 1ELKA 4GB9A 3B7UX 3CK9A 3MX3A 2I9CA 1RW2A 4MS6A 3PE3A 4FA6A 1EYHA 4H7XA 4BTAA 4F1SA 3E32A 2P9PG 3VTXA 4EHMA 2P2CP 2IQCA 3EHMA 2PM7A 4GA2A 1N0RA 3LS8A 4J8YA 3MCXA 4ANVA 3B7BA 3MZLB 4GA0A 3AG3E 3UT4A 1O1TA 3HVEB 1TNZA 5A7DB 5CHEE 3MV3B 1A17A 2RFAA 3ULYA 5AIJA 3G2SA 1OXJA 1U2VG 5JMND 1D9SA 4JD2G 4R7LA 1WAO1 2PL2A 2WXHA 3UT8A 3U9WA 4GAAA 4N39A 4I2WA 4O60A 4L9PA 4LCTA 3S7FA 1WDYA 2ZISA 2A4ZA 2RKKA 4N2QA 5EYLA 3CVWA 1YMPA 4CDMA 2KCKA 4BFRA 5HI7A 3CVLA 3L54A 2A5UA 2I6HA 1N4SA 2CHWA 3ONKA 2VGYA 2AXZA 4A3TA 2L6BA 3MKQB 4G25A 3UIOC 1OCZE 3APDA 1EF1C 4F7AA 2E2EA 3RKVA 1HS6A 3HXBA 3DRAA 3DXMG 2XPIA 4EBAG 3UINC 1IQRA 3L17A 3SI5A 1TN8A 3B7RL 4JVSA 4DX5D 3ZN3A 3X2QE 3KEZA 1B89A 2WXRA 3IHYA 4V3IA 2KM4A 3MV2B 1S70B 3HDXA 4XIFA 3FH7A 3SF4A 3EHRA 3SFXA 3F6QA 2DBAA 3Q7FA 2GRQB 3LKUA 3UM2A 3MKQA 3U4TA 3HIZA 4GU5A 4HOSA 4EBAA 2FO7A 1ELRA 1HG2A 3ESKA 3LY9A 5ENOD 3RAUA 1AP7A 1JCQA 4J8SA 2QC9A 4GTTA 1E8ZA 3SZ7A 3SGHA 3QDNA 3UM0A 3E4BA 2Y4UA 4Z68A 3CHOA 5ENNA 3PUJA 3PEVB 5FZSA 2IO3C 1N94A 2C0LA 3L9TA 3P2BA 3Q15A 1FPPA 1IQUA 4PS7A 3LEWA 3L13A 1H6PA 3NQPA 1MQSA 2ILRA 5JJTA 1BU9A 3DEOA 2OVFA 5BT1A 3LVRE 5FZRA 3N71A 2P9NG 5FZQA 3AS8A 1UN9A 1MYOA 3ULEG 4ME2A 2FEZA 5G04J 5E75A 3B95A 4G8KA 3UI2A 4ZHBA 3CHQA 4OYSA 3TXNA 4LUNU 4J0UA 2B6CA 4K5BA 2C2LA 4XE0A 4APOA 2L6JA 3QOUA 3UIPC 2H6FA 1TEZA 1OY3D 4I6GA 2MOWA 4J6IA 2WM9A 3PEUB 2F0YA 3FTXA 4KZCA 2V0PA 2KCVA 4WNGA 4FLHA 3VLFA 3JQ0A 3HYMB 3D3MA 1YA0A 2OCCE 1WY6A 3LCAA 4HRNA 2J49A 4EZJA 3JUIA 4ACLA 2DWZA 2XS8A 1FT2A 3NZUA 4UWLA 1E8XA 3EHQA 1Z3XA 3ASHA 5CERB 2J4BA 4UQYA 3FU3A 3C3OA 2HE0A 3Q47B 3EU9A 3JYSA 3ML8A 5CCLA 2HM8A 2WXNA 4GTVA 4LEUA 3RRMB 1XNFA 2PZIA 3AAAC 4U04A 4ANUA 4U63A 4DLOA 3GYZA 3D9JA 4XEIG 1NFIE 4JHRA 5G2NA 3MYVA 4ANXA 4F1PA 2X6IA 2GGFA 2ZGDA 2YHEA 1H2TC 3JXJA 4HB5A 4PDXA 4J8EA 5FTPA 3L22A 4FHJA 2CG3A 4BERA 3TG5A 4G24A 4BESA 3FUMA 3LYAA 1E96B 4GA1A 4GZ6A 2P9LG 2PQRA 1N54A 3SNXA 3PRZA 4XI0A 4XZ4A 3KSLA 3RO3A 1KZPA 3QAQA 4I43A 4JA9A 3CV0A 3TWRA 2AJAA 4B94A 2NXPA 5ANLA 3CVPA 4KMOA 3DSVA 2MYOA 3FTYA 2BTDA 5FQ6A 5JJ7A 4U7EB 2VJ8A 4I1AA 5EYPF 2FI7A 5EN5D 4U07A 3FU0A 4TUMA 1OUVA 2LAHA 3ML9A 4RLYA 3PREA 1UG3A 1V54E 1PC2A 3G2TA 3L16A 1V55E 2VSYA 2CFUA 4NURA 3HXDA 3NOCD 3SBTB 2XCBA 2J8SD 5DBKA 1D8EA 2LAIA 1MHQA 4GTOA 5LP0A 3ULQA 2PQNA 2LXLA 3KEAA 4YVOA 2BEDA 1SW6A 5AQAA 5J08A 2R2LA 1QNFA 4LRZA 3RU0A 4AV7A 3HXCA 3DPDA 1BPOA 4DJAA 2VGXB 4DX7D 5KBAA 4GYOA 1FCHA 2EQXA 5KJLA 4DPRA 1EPUA 4HI8A 3J5QB 3FEYA 2X6HA 1E8WA 5ENTD 2WMNA 4HLEA 3CHSA 1JPLA 4TXRA 5JHBA 1NA3A 2PM6A 5ITZF 2XEEA 3PZ1A 3DSXA 1SQMA 3UKUG 2VSXE 3ZHEB 3EDTB 4AEZC 1HH8A 5A6CA 4GTMA 3Q78A 3CK8A 4DLQA 2IOLA 3UPVA 3Q7AA 3CHPA 1KZOA 4UI9J 2Q7FA 1OWPA 2QYUA 4F3VA 1X81A 3TWUA 3ZU7B 3UT7A 4I9CA 4WAFA 2NC9A 1L5JA 1NP7A 4UQXA 1JCRA 2DIWA 4HBDA 5CEDB 5C2YA 2H6HA 3ESLA 3UUXA 1O1RA 4DX1A 1ZU2A 3BQOA 5J90A 3CIAA 3HXFA 2VTBB 4AOFA 1ZB1A 3Q79A 1TNOA 2V5QC 3NBNB 3B7TA 3SD5A 3D9HA 4E6HA 2P9KG 4UUCA 3MA5A 4ACKA 2XCCA 3L08A 1K1BA 5FIOA 4A1GA 1D8DA 4KZ0A 4JC8A 4CCAA 3VLDA 2WXGA 2R17C 3ZPJA 3V2XA 2HO1A 5BUZA 2KZTB 3NF1A 4K0RA 4AM9A 1RZ4A 3AG1E 5AYWD 3ZHEA 2QYJA 2VYIA 2XGOA 3DSUA 5FINA 4N3CA 1UJKA 4G1TA 4RG6A 1E7UA 3E33A 2Y3AA 2WXFA 4E85A 3KS2A 1OWNA 5EIDA 2OV8A 4EPZA 4OAUC 5ENPD 1OWOA 2RD0A 1H0AA 1LD7A 3ASOE 5KNGA 3T5VA 4I1OB 2KZTA 2EIME 3SO8A 1OWMA 4JEHA 3RIBA 4BETA 1W3BA 2R02A 4NQ0A 5CCMA 4TXPA 3IHVA 1DCQA 3ENEA 3GZ1A 3TXMA 1N0QA 3TWVA 4D10C 5BV1A 2KBXA 2GRNB 4L23A 1N4QA 3QC1A 2CFZA 3GZ2A 2V5FA 3ABLE 3MEKA 1HU3A 4Y6WA 3HG0D 3HVEA 3TJPA 3TWWA 5HKPA 1UN8A 3FUFA 3TWTA 4P29A 4FP7A 2IONA 3EHNA 1O5MA 2CHZA 2ZIRA 4IULA 4TXQA 3AS4A 2Y1LE 1KT0A 2OOEA 3LPZA 1BD8A 3OXFA 3U66A 3ZUVB 1Z3YA 3SFYA 1H2UA 3IXEA 3UXGA 5G05C 3UTMA 4YDOA 5AQBA 4JEUA 4PH4B 1NA0A 4WNFA 1S0PA 2R05A 1Q2ZA 3ASDA 4L1BA 4RSYA 3ASFA 3LVQE 1QBQA 3CVUA 2XEHA 1HG5A 4GTRA 5EIBE 4CT4A 1UOHA 4GMLA 4ATGA 3CVYA 1UW4B 3UM3A 4CYMD 5B3SE 2P9UG 3QB2A 3RRNB 4L2YA 3UKRG 3QJZA 4U0SA 3EIQC 3PUKA 4KT6B 2X6JA 1DC2A 1E7VA 4UWFA 2LO6A 3CR3A 2UWJG 5ARFA 5JA4D 1K8KG 1OWLA 4GZDA 4GPMA 5ENRD 4N3BA 3ZIMA 3TG4A 2LSVA 3S7JA 3FTVA 3CEQA 2R03A 4DRXE 4FLBA 4I6EA 3PZ3A 2CHXA 3FUKA 5EDSA 3DEPA 1U3DA 1NL4A 2UY1B 5LOZA 1TR4A 4GTSA 2BKGA 4GZ5A 3AU5A 4OAVB 3W9FA 1ZBPA 4XKBA 2DCPA 3UM1A 4JB8P 4Q94A 1TN6A 3SBSA 3FUEA 3KD7A 2DZNA 2GRRB 3FUDA 3O4ZA 4MBGA 1DCEA 1SZ9A 2GRMA 1IYGA 3CGHA 3ZYLA 2WXLA 3RO2A 5FT9A 1PAQA 4UI9K 4I9EA 3Q4AB 1G3NB 4BT8A 3L82A 1DVPA 3JXIA 4BEPA 5CBOA 4Y6CA 2WQHA 3LDZA 3JCKC 5BPPA 4GTQA 2WXMA 3R7QA 4C0EA 2FULA 4LERA 5EX3A 4GZCA 5FJYA 4KBQA 4EZLA 2XHEA 1N11A 2DYSE 3B7SA 3LY8A 3R7RA 1BLXB 3FUJA 3AJIA 2I1KA 5CMWA 1K1AA 4OVVA 3AG4E 3URZA 2HYZA 5KJKA 1HFAA 1H6KA 4GMJA 2YQ8A 3ZGQA 1PY1A 3ZVVA 1MZCA 2P58C 3PE4A 3OXGA 4HOUA 2VGEA 4LNUD 3IBEA 4WWNA 3IEGA 4BWRA 3C72A 4I6JA 4O1PA 4RQIA 5G05J 1GW6A 2V8SE 3L6AA 3MJWA 1MX4A 2XQ0A 3C98A 2KC7A 3NB2A 2FO1E 5BW8C 4K5AB 2X6FA 4WNDA 3GZSA 4DI3A 2R59A 3APCA 2YHCA 3FHEA 3S7BA 3ZNGA 3LXUX 4UQZA 2MRIA 2XENA 4I1MA 1H6OA 2E0IA 4I17A 4KVMA 3FDHA 2EIKE 3V30A 3CSTA 3TWSA 3VTYA 5T4YA 2XGSA 5BXOA 3DWLG 3ABKE 2KXPC 3VLEA 1Z6TA 1JCSA 4KXKB 2WXIA 2Y0BG 5CEAA 3B13A 2ETCA 1Y8MA 3T5XA 3ZRHA 4GZ3A 2C0MA 3AS5A 2ONDA 3ZYQA 2WVIA 4L7TA 2RFMA 3D9KA 4C0MA 2MHKA 3BG1B 2ZXWE 1S64A 1KLXA 1XGWA 5H7PA 4KYOB 2WB2A 3C3RA 4ATZD 4HOQA 1OT8A 3DBSA 4ABNA 4JHJA 4KVOA 3ZW3A 2RG8A 2VQ2A 4A63B 3KSQA 4BX8A 4F6RD 5ENQD 5AARA 3I4GA 4NACA 2WXPA 3WXXA 4DI4A 2J09A 5CBNA 4BX9A 2DZOA 4WWPA 4FJYA 1QZ2A 5KWDA 5ENSD 3JQ1A 4IRUA 4U8VD 2VTBA 4ILHB 2QFCA 1IXVA 5AQ9A 1HZ4A 4U0ZA 4ANWA 1LTXA 2DVWA 1N4PA 2FBNA 4K03A 5B1BE 5LCWJ 3MGBA 1TN7A 4DX6D 4JHKA 4U95D 5EKQD 4FJZA 5BNWA 3I5PA 3D9NA 3ONLA 4G11A 3CSFA 3UQ3A 3NAWA 4AJWA 3G2UA 4CGVA 4EECA 1JWGA 4PUCA 3U3WA 4AVXA 3Q9UC 3FTSA 2Y4TA 3TL5A 2YNQA 2WXQA 1TJFA 2NSZA 4GPKA 4EQFA 5AN8A 5HS0A 2DYRE 5C1DA 3FTUA 4B8CB 3CHRA 3E37A 2VSNA 4CGWA 1FVFA 4YDYA 2QY7A 3T9KA 3E30A 3HXEA 2EIJE 3FH5A 5KJMA 4DUIA 4U96D 3G2VA 2QZAA 4YVQC 3IKOB 3V2OA 2L0IA 2WXOA 3I4RB 2JABA 2XPYA 4I2ZA 3ABME 5FQ7A 4G26A 3FP3A 3PH0C 4BSZB 4M7CA 1E8YA 5AAOA 3EU5A 2GRPB 3AG2E 1K3ZD 1H19A 3Q75A 3FWVA 1U3CA 3DSWA 3FU5A 2KATA 1YCSB 2P9SG 1NI1A 3C3QA 5AJLA 5FQ8A 3ZEFA 4Q96A 3CVXA 4HORA 3WG7E 3BG0B 2J07A 5KNHD 1MX6A 5FWQA 4J8DA 2LXMA 2WPVA 5T3RA 3Q9NC 4A3VA 3FTWA 3AU4A 2WQ7A 3S2AA 2IJGX 2IEJA 2OEWA 3SQVA 4AXHA 1WG0A 4FHKA 3NOGD 3P1UA 2F8XK 4U8YD 2I2OA 3D9PA 4CEMA 1SVXA 5D0OD 1MJ0A 1MX2A 5DIZA 3Q73A 3JUEA 4FULA 5D0QD 1SA4A 4N3AA 2X38A 4DX2A 4HI9A 5BV0A 2M63A 5LFAA 1LD8A 3PZDA 3EJNA 3PNLB 5G04C 1WM5A 2ZU6B 5CMYA 4U8HA 2VSOE 1FT1A 3K9IA 5HQ8A 2LUHA 4AP2A 5B1AE 4J8FA 4FC8A 4GYYA 4HQDA 3R9MA 3FUIA 4MKTA 1AWCB 4JW1A 1DNPA 4MRUA 3CHMA 2WQ6A 1KPSB 2IY0C 3FULA 5EX0A 2HR2A 4DK5A 1HF8A 1KT1A 5AENA 3Q5MA 5AQ7A 1JWFA 4B8AA 1HXIA 2AW6A 4YNDA 4UWGA 3CK7A 3V79K 4PS3A 4URKA 2EINE 4C48B 2GROB 2XZTG 3QK0A 4AIFA 2LSUA 3ZYMA 2IU1A 3PS6A 1NZNA 4IYPA 1TYQG 2XRYA 3FEXA 1QQEA 5T8IA 3HHMA 1OCRE 1FVHA 2XS1A 1N95A 3LY7A 2Y69E 1IKND 4HNAD 4RVBA 3SHFA 4QFVA 4AY6A 5BXUA 4N2SA 4CDNA 4JXTA 3BUAA 4YDEA 3I3NA 2ZGGA 3ZXPA 3SFZA 3CKCA 4HS2A 2J08A 3G2WA 2P9IG 5A23A 5D2MC 1BI7B 2J9QA 4BSXA 4MLPA 4B93B 5LCWC 3LJ3A 4BY6A 4QQIA 3ZYKA 3PVLA 5CRVA 4X8QA 4ZFHA 1TJCA 2OVBA 3EUVA 3QWPA 4RG9A 3QKYA 5KJNA 5CECB 4JZYA 3BU8A 4H7YA 3OXLA 4A55A 4GMRA 2XRZA 3CVQA 3V31A 4GCOA 4B89A 3T8KA 2GW1A 1EDUA 4JPSA 4N5QA 5ANRA 2L0TB 4A1SA 4U0UA 4UWKA 3DPYA 2PNNA 4J7WA 1E90A 3EIJA 2V4LA 4APFA 1QYMA 3APFA 4LG6A 2AXUA 3MKRA 4OVUA 2R5SA 2FF4A 3HRAA 3E34A 1LF8A 2ETAA 3KAEA 3QNKA 3W9GA 4FADA 1H2VC 2A5EA 4CZ2D 3GW4A 5AJDA 3SY2A 3CVVA 2AWIA 4M3OA 1A5EA 4O6FA 2WMOA 3QWVA 4F53A 2WXJA 5IY5E 2F8YA 4CT0A 3FU6A 2J4DA 3RJVA 4XKCA 3D9LA 1X5BA 4HRMB 5FQ4A 1OCCE 4BTBA 5HRYA 3IV0A 3CVNA 2H6GA 3R9AB 1ELWA 3FUHA 3FFLA 2WXKA 3FTZA 3RK6A 4AY5A 1TNYA 1Y6IA 2YINA 1HE8A 1SA5A 2CG2A 4HXIA 2GRLA 4PS8A 1O1SA 3OAWA 3D9OA 4GCNA 1N52A 2F37A 4XI9A 2XZDG 3CQCB 5KCMA 2EILE 5JHAA 4LSZE 2KCLA 4K5CA 4IN3B 4NRHB 2V4HC 3ISMC 2IOSA 4Q69A 2AXVA 1INZA 1UJJA 3CQGB 4HLLA 3C5RA 4L2LA 3O48A 4TRQA 2BKKB 3T8MA 3NZSA 3ASGA 3FY4A 1BI8B 4TUUA 2IFUA 4N5CA 4WWOA 4HRLA 3RSEG 2JLBA 3TGOA 1HO8A 3D9IA 2NYJA 4JL0A 1VDYA 2IF4A 4WNEA 3D9MA 4B0ZA 3Q49B 2BF0X 1HX8A 2BUGA 2B0OE 3RRUA 1OCOE 4G23A 3ZXSA 3BEEA 5EILA 1N9AA 4G2VA 1TNUA 3TAXA 4W9RA 4TV3A 4HVBA 1IHGA 2X3MA 1P5QA 3PNTB 2OEVA 2ETBA 4GTPA 2H6IA 3U64A 5JJ6A 4BT9A 4UWHA 2LNIA 1N4RA 3ASNE 4WUYA 2L9BA 1JUQA 4C9BB 5ARGA 3J5PA 2JEKA 3DXKG 4XX5A 4NIKA 5M72A 5D66A 5E76A 2XGMA 3QARA 1YYHA 4FU3A 4LNGA 3S7DA 4UI9C 2AVPA 3TWQA 5CRUA 3UX4A 4CDRA 2VGXA
chains in the Genus database with same CATH topology
2IEJA 3PZ3A 3DPYA 1D8DA 2F0YA 1S64A 1S63A 3KSLA 1MZCA 1NL4A 3Q73A 1KZPA 1JCQA 4GTSA 4L9PA 1N95A 4GTTA 3C72A 1O5MA 1SA4A 2ZIRA 3PZ1A 3DSXA 3E34A 3DSTA 3PZ2A 2ZISA 3DSSA 4LNBA 3DSUA 1TN6A 1LD8A 3E37A 3DSVA 3PZ4A 1FT2A 4MBGA 1DCEA 3E30A 3HXEA 3SFYA 1N94A 1TNBA 4GTMA 3Q78A 1FT1A 3E33A 3KSQA 4YDEA 1N4SA 1FPPA 3Q7AA 1N9AA 4YDOA 1TNUA 1KZOA 1X81A 4GTVA 1QBQA 3HXDA 3E32A 3EU5A 4GTRA 1LD7A 1JCRA 4GTQA 4GTPA 4EHMA 2H6IA 3Q75A 1D8EA 4GTOA 2H6GA 3DSWA 3HXBA 3DRAA 2H6HA 1O1RA 1NI1A 3EUVA 1N4RA 1LTXA 1N4PA 2BEDA 1TNYA 1TN8A 1SA5A 2R2LA 1TN7A 3HXFA 1O1SA 1JCSA 3Q79A 1O1TA 1TNOA 3HXCA 1TNZA 4LNGA 2H6FA 3SFXA 3Q7FA 1N4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IEJ A;  3PZ3 A;  3DPY A;  1D8D A;  2F0Y A;  1S64 A;  1S63 A;  3KSL A;  1MZC A;  1NL4 A;  3Q73 A;  1KZP A;  1JCQ A;  4GTS A;  4L9P A;  1N95 A;  4GTT A;  3C72 A;  1O5M A;  1SA4 A;  2ZIR A;  3PZ1 A;  3DSX A;  3E34 A;  3DST A;  3PZ2 A;  2ZIS A;  3DSS A;  4LNB A;  3DSU A;  1TN6 A;  1LD8 A;  3E37 A;  3DSV A;  3PZ4 A;  1FT2 A;  4MBG A;  1DCE A;  3E30 A;  3HXE A;  3SFY A;  1N94 A;  1TNB A;  4GTM A;  3Q78 A;  1FT1 A;  3E33 A;  3KSQ A;  4YDE A;  1N4S A;  1FPP A;  3Q7A A;  1N9A A;  4YDO A;  1TNU A;  1KZO A;  1X81 A;  4GTV A;  1QBQ A;  3HXD A;  3E32 A;  3EU5 A;  4GTR A;  1LD7 A;  1JCR A;  4GTQ A;  4GTP A;  4EHM A;  2H6I A;  3Q75 A;  1D8E A;  4GTO A;  2H6G A;  3DSW A;  3HXB A;  3DRA A;  2H6H A;  1O1R A;  1NI1 A;  3EUV A;  1N4R A;  1LTX A;  1N4P A;  2BED A;  1TNY A;  1TN8 A;  1SA5 A;  2R2L A;  1TN7 A;  3HXF A;  1O1S A;  1JCS A;  3Q79 A;  1O1T A;  1TNO A;  3HXC A;  1TNZ A;  4LNG A;  2H6F A;  3SFX A;  3Q7F A;  1N4Q A; 
#chains in the Genus database with same CATH topology
 4JA7 A;  3ZFW A;  2IO2 C;  3CLJ A;  4ILG A;  3TWX A;  3FUN A;  1IHB A;  4YDW A;  3FH8 A;  2XPZ A;  1S63 A;  3QWW A;  3LJN A;  4EZK A;  4ILI A;  1SZA A;  4HFG A;  2I1J A;  2XEV A;  5LX8 A;  4GYW A;  1Z5S C;  4CRW A;  3DST A;  3PZ2 A;  3DSS A;  4LNB A;  4HOT A;  2X6K A;  2UY1 A;  4O1O A;  3PZ4 A;  3UMV A;  5G55 A;  3CKB A;  1TNB A;  4G8L A;  3ZKJ A;  3PDN A;  3OTN A;  1ELK A;  4GB9 A;  3B7U X;  3CK9 A;  3MX3 A;  2I9C A;  1RW2 A;  4MS6 A;  3PE3 A;  4FA6 A;  1EYH A;  4H7X A;  4BTA A;  4F1S A;  3E32 A;  2P9P G;  3VTX A;  4EHM A;  2P2C P;  2IQC A;  3EHM A;  2PM7 A;  4GA2 A;  1N0R A;  3LS8 A;  4J8Y A;  3MCX A;  4ANV A;  3B7B A;  3MZL B;  4GA0 A;  3AG3 E;  3UT4 A;  1O1T A;  3HVE B;  1TNZ A;  5A7D B;  5CHE E;  3MV3 B;  1A17 A;  2RFA A;  3ULY A;  5AIJ A;  3G2S A;  1OXJ A;  1U2V G;  5JMN D;  1D9S A;  4JD2 G;  4R7L A;  1WAO 1;  2PL2 A;  2WXH A;  3UT8 A;  3U9W A;  4GAA A;  4N39 A;  4I2W A;  4O60 A;  4L9P A;  4LCT A;  3S7F A;  1WDY A;  2ZIS A;  2A4Z A;  2RKK A;  4N2Q A;  5EYL A;  3CVW A;  1YMP A;  4CDM A;  2KCK A;  4BFR A;  5HI7 A;  3CVL A;  3L54 A;  2A5U A;  2I6H A;  1N4S A;  2CHW A;  3ONK A;  2VGY A;  2AXZ A;  4A3T A;  2L6B A;  3MKQ B;  4G25 A;  3UIO C;  1OCZ E;  3APD A;  1EF1 C;  4F7A A;  2E2E A;  3RKV A;  1HS6 A;  3HXB A;  3DRA A;  3DXM G;  2XPI A;  4EBA G;  3UIN C;  1IQR A;  3L17 A;  3SI5 A;  1TN8 A;  3B7R L;  4JVS A;  4DX5 D;  3ZN3 A;  3X2Q E;  3KEZ A;  1B89 A;  2WXR A;  3IHY A;  4V3I A;  2KM4 A;  3MV2 B;  1S70 B;  3HDX A;  4XIF A;  3FH7 A;  3SF4 A;  3EHR A;  3SFX A;  3F6Q A;  2DBA A;  3Q7F A;  2GRQ B;  3LKU A;  3UM2 A;  3MKQ A;  3U4T A;  3HIZ A;  4GU5 A;  4HOS A;  4EBA A;  2FO7 A;  1ELR A;  1HG2 A;  3ESK A;  3LY9 A;  5ENO D;  3RAU A;  1AP7 A;  1JCQ A;  4J8S A;  2QC9 A;  4GTT A;  1E8Z A;  3SZ7 A;  3SGH A;  3QDN A;  3UM0 A;  3E4B A;  2Y4U A;  4Z68 A;  3CHO A;  5ENN A;  3PUJ A;  3PEV B;  5FZS A;  2IO3 C;  1N94 A;  2C0L A;  3L9T A;  3P2B A;  3Q15 A;  1FPP A;  1IQU A;  4PS7 A;  3LEW A;  3L13 A;  1H6P A;  3NQP A;  1MQS A;  2ILR A;  5JJT A;  1BU9 A;  3DEO A;  2OVF A;  5BT1 A;  3LVR E;  5FZR A;  3N71 A;  2P9N G;  5FZQ A;  3AS8 A;  1UN9 A;  1MYO A;  3ULE G;  4ME2 A;  2FEZ A;  5G04 J;  5E75 A;  3B95 A;  4G8K A;  3UI2 A;  4ZHB A;  3CHQ A;  4OYS A;  3TXN A;  4LUN U;  4J0U A;  2B6C A;  4K5B A;  2C2L A;  4XE0 A;  4APO A;  2L6J A;  3QOU A;  3UIP C;  2H6F A;  1TEZ A;  1OY3 D;  4I6G A;  2MOW A;  4J6I A;  2WM9 A;  3PEU B;  2F0Y A;  3FTX A;  4KZC A;  2V0P A;  2KCV A;  4WNG A;  4FLH A;  3VLF A;  3JQ0 A;  3HYM B;  3D3M A;  1YA0 A;  2OCC E;  1WY6 A;  3LCA A;  4HRN A;  2J49 A;  4EZJ A;  3JUI A;  4ACL A;  2DWZ A;  2XS8 A;  1FT2 A;  3NZU A;  4UWL A;  1E8X A;  3EHQ A;  1Z3X A;  3ASH A;  5CER B;  2J4B A;  4UQY A;  3FU3 A;  3C3O A;  2HE0 A;  3Q47 B;  3EU9 A;  3JYS A;  3ML8 A;  5CCL A;  2HM8 A;  2WXN A;  4GTV A;  4LEU A;  3RRM B;  1XNF A;  2PZI A;  3AAA C;  4U04 A;  4ANU A;  4U63 A;  4DLO A;  3GYZ A;  3D9J A;  4XEI G;  1NFI E;  4JHR A;  5G2N A;  3MYV A;  4ANX A;  4F1P A;  2X6I A;  2GGF A;  2ZGD A;  2YHE A;  1H2T C;  3JXJ A;  4HB5 A;  4PDX A;  4J8E A;  5FTP A;  3L22 A;  4FHJ A;  2CG3 A;  4BER A;  3TG5 A;  4G24 A;  4BES A;  3FUM A;  3LYA A;  1E96 B;  4GA1 A;  4GZ6 A;  2P9L G;  2PQR A;  1N54 A;  3SNX A;  3PRZ A;  4XI0 A;  4XZ4 A;  3KSL A;  3RO3 A;  1KZP A;  3QAQ A;  4I43 A;  4JA9 A;  3CV0 A;  3TWR A;  2AJA A;  4B94 A;  2NXP A;  5ANL A;  3CVP A;  4KMO A;  3DSV A;  2MYO A;  3FTY A;  2BTD A;  5FQ6 A;  5JJ7 A;  4U7E B;  2VJ8 A;  4I1A A;  5EYP F;  2FI7 A;  5EN5 D;  4U07 A;  3FU0 A;  4TUM A;  1OUV A;  2LAH A;  3ML9 A;  4RLY A;  3PRE A;  1UG3 A;  1V54 E;  1PC2 A;  3G2T A;  3L16 A;  1V55 E;  2VSY A;  2CFU A;  4NUR A;  3HXD A;  3NOC D;  3SBT B;  2XCB A;  2J8S D;  5DBK A;  1D8E A;  2LAI A;  1MHQ A;  4GTO A;  5LP0 A;  3ULQ A;  2PQN A;  2LXL A;  3KEA A;  4YVO A;  2BED A;  1SW6 A;  5AQA A;  5J08 A;  2R2L A;  1QNF A;  4LRZ A;  3RU0 A;  4AV7 A;  3HXC A;  3DPD A;  1BPO A;  4DJA A;  2VGX B;  4DX7 D;  5KBA A;  4GYO A;  1FCH A;  2EQX A;  5KJL A;  4DPR A;  1EPU A;  4HI8 A;  3J5Q B;  3FEY A;  2X6H A;  1E8W A;  5ENT D;  2WMN A;  4HLE A;  3CHS A;  1JPL A;  4TXR A;  5JHB A;  1NA3 A;  2PM6 A;  5ITZ F;  2XEE A;  3PZ1 A;  3DSX A;  1SQM A;  3UKU G;  2VSX E;  3ZHE B;  3EDT B;  4AEZ C;  1HH8 A;  5A6C A;  4GTM A;  3Q78 A;  3CK8 A;  4DLQ A;  2IOL A;  3UPV A;  3Q7A A;  3CHP A;  1KZO A;  4UI9 J;  2Q7F A;  1OWP A;  2QYU A;  4F3V A;  1X81 A;  3TWU A;  3ZU7 B;  3UT7 A;  4I9C A;  4WAF A;  2NC9 A;  1L5J A;  1NP7 A;  4UQX A;  1JCR A;  2DIW A;  4HBD A;  5CED B;  5C2Y A;  2H6H A;  3ESL A;  3UUX A;  1O1R A;  4DX1 A;  1ZU2 A;  3BQO A;  5J90 A;  3CIA A;  3HXF A;  2VTB B;  4AOF A;  1ZB1 A;  3Q79 A;  1TNO A;  2V5Q C;  3NBN B;  3B7T A;  3SD5 A;  3D9H A;  4E6H A;  2P9K G;  4UUC A;  3MA5 A;  4ACK A;  2XCC A;  3L08 A;  1K1B A;  5FIO A;  4A1G A;  1D8D A;  4KZ0 A;  4JC8 A;  4CCA A;  3VLD A;  2WXG A;  2R17 C;  3ZPJ A;  3V2X A;  2HO1 A;  5BUZ A;  2KZT B;  3NF1 A;  4K0R A;  4AM9 A;  1RZ4 A;  3AG1 E;  5AYW D;  3ZHE A;  2QYJ A;  2VYI A;  2XGO A;  3DSU A;  5FIN A;  4N3C A;  1UJK A;  4G1T A;  4RG6 A;  1E7U A;  3E33 A;  2Y3A A;  2WXF A;  4E85 A;  3KS2 A;  1OWN A;  5EID A;  2OV8 A;  4EPZ A;  4OAU C;  5ENP D;  1OWO A;  2RD0 A;  1H0A A;  1LD7 A;  3ASO E;  5KNG A;  3T5V A;  4I1O B;  2KZT A;  2EIM E;  3SO8 A;  1OWM A;  4JEH A;  3RIB A;  4BET A;  1W3B A;  2R02 A;  4NQ0 A;  5CCM A;  4TXP A;  3IHV A;  1DCQ A;  3ENE A;  3GZ1 A;  3TXM A;  1N0Q A;  3TWV A;  4D10 C;  5BV1 A;  2KBX A;  2GRN B;  4L23 A;  1N4Q A;  3QC1 A;  2CFZ A;  3GZ2 A;  2V5F A;  3ABL E;  3MEK A;  1HU3 A;  4Y6W A;  3HG0 D;  3HVE A;  3TJP A;  3TWW A;  5HKP A;  1UN8 A;  3FUF A;  3TWT A;  4P29 A;  4FP7 A;  2ION A;  3EHN A;  1O5M A;  2CHZ A;  2ZIR A;  4IUL A;  4TXQ A;  3AS4 A;  2Y1L E;  1KT0 A;  2OOE A;  3LPZ A;  1BD8 A;  3OXF A;  3U66 A;  3ZUV B;  1Z3Y A;  3SFY A;  1H2U A;  3IXE A;  3UXG A;  5G05 C;  3UTM A;  4YDO A;  5AQB A;  4JEU A;  4PH4 B;  1NA0 A;  4WNF A;  1S0P A;  2R05 A;  1Q2Z A;  3ASD A;  4L1B A;  4RSY A;  3ASF A;  3LVQ E;  1QBQ A;  3CVU A;  2XEH A;  1HG5 A;  4GTR A;  5EIB E;  4CT4 A;  1UOH A;  4GML A;  4ATG A;  3CVY A;  1UW4 B;  3UM3 A;  4CYM D;  5B3S E;  2P9U G;  3QB2 A;  3RRN B;  4L2Y A;  3UKR G;  3QJZ A;  4U0S A;  3EIQ C;  3PUK A;  4KT6 B;  2X6J A;  1DC2 A;  1E7V A;  4UWF A;  2LO6 A;  3CR3 A;  2UWJ G;  5ARF A;  5JA4 D;  1K8K G;  1OWL A;  4GZD A;  4GPM A;  5ENR D;  4N3B A;  3ZIM A;  3TG4 A;  2LSV A;  3S7J A;  3FTV A;  3CEQ A;  2R03 A;  4DRX E;  4FLB A;  4I6E A;  3PZ3 A;  2CHX A;  3FUK A;  5EDS A;  3DEP A;  1U3D A;  1NL4 A;  2UY1 B;  5LOZ A;  1TR4 A;  4GTS A;  2BKG A;  4GZ5 A;  3AU5 A;  4OAV B;  3W9F A;  1ZBP A;  4XKB A;  2DCP A;  3UM1 A;  4JB8 P;  4Q94 A;  1TN6 A;  3SBS A;  3FUE A;  3KD7 A;  2DZN A;  2GRR B;  3FUD A;  3O4Z A;  4MBG A;  1DCE A;  1SZ9 A;  2GRM A;  1IYG A;  3CGH A;  3ZYL A;  2WXL A;  3RO2 A;  5FT9 A;  1PAQ A;  4UI9 K;  4I9E A;  3Q4A B;  1G3N B;  4BT8 A;  3L82 A;  1DVP A;  3JXI A;  4BEP A;  5CBO A;  4Y6C A;  2WQH A;  3LDZ A;  3JCK C;  5BPP A;  4GTQ A;  2WXM A;  3R7Q A;  4C0E A;  2FUL A;  4LER A;  5EX3 A;  4GZC A;  5FJY A;  4KBQ A;  4EZL A;  2XHE A;  1N11 A;  2DYS E;  3B7S A;  3LY8 A;  3R7R A;  1BLX B;  3FUJ A;  3AJI A;  2I1K A;  5CMW A;  1K1A A;  4OVV A;  3AG4 E;  3URZ A;  2HYZ A;  5KJK A;  1HFA A;  1H6K A;  4GMJ A;  2YQ8 A;  3ZGQ A;  1PY1 A;  3ZVV A;  1MZC A;  2P58 C;  3PE4 A;  3OXG A;  4HOU A;  2VGE A;  4LNU D;  3IBE A;  4WWN A;  3IEG A;  4BWR A;  3C72 A;  4I6J A;  4O1P A;  4RQI A;  5G05 J;  1GW6 A;  2V8S E;  3L6A A;  3MJW A;  1MX4 A;  2XQ0 A;  3C98 A;  2KC7 A;  3NB2 A;  2FO1 E;  5BW8 C;  4K5A B;  2X6F A;  4WND A;  3GZS A;  4DI3 A;  2R59 A;  3APC A;  2YHC A;  3FHE A;  3S7B A;  3ZNG A;  3LXU X;  4UQZ A;  2MRI A;  2XEN A;  4I1M A;  1H6O A;  2E0I A;  4I17 A;  4KVM A;  3FDH A;  2EIK E;  3V30 A;  3CST A;  3TWS A;  3VTY A;  5T4Y A;  2XGS A;  5BXO A;  3DWL G;  3ABK E;  2KXP C;  3VLE A;  1Z6T A;  1JCS A;  4KXK B;  2WXI A;  2Y0B G;  5CEA A;  3B13 A;  2ETC A;  1Y8M A;  3T5X A;  3ZRH A;  4GZ3 A;  2C0M A;  3AS5 A;  2OND A;  3ZYQ A;  2WVI A;  4L7T A;  2RFM A;  3D9K A;  4C0M A;  2MHK A;  3BG1 B;  2ZXW E;  1S64 A;  1KLX A;  1XGW A;  5H7P A;  4KYO B;  2WB2 A;  3C3R A;  4ATZ D;  4HOQ A;  1OT8 A;  3DBS A;  4ABN A;  4JHJ A;  4KVO A;  3ZW3 A;  2RG8 A;  2VQ2 A;  4A63 B;  3KSQ A;  4BX8 A;  4F6R D;  5ENQ D;  5AAR A;  3I4G A;  4NAC A;  2WXP A;  3WXX A;  4DI4 A;  2J09 A;  5CBN A;  4BX9 A;  2DZO A;  4WWP A;  4FJY A;  1QZ2 A;  5KWD A;  5ENS D;  3JQ1 A;  4IRU A;  4U8V D;  2VTB A;  4ILH B;  2QFC A;  1IXV A;  5AQ9 A;  1HZ4 A;  4U0Z A;  4ANW A;  1LTX A;  2DVW A;  1N4P A;  2FBN A;  4K03 A;  5B1B E;  5LCW J;  3MGB A;  1TN7 A;  4DX6 D;  4JHK A;  4U95 D;  5EKQ D;  4FJZ A;  5BNW A;  3I5P A;  3D9N A;  3ONL A;  4G11 A;  3CSF A;  3UQ3 A;  3NAW A;  4AJW A;  3G2U A;  4CGV A;  4EEC A;  1JWG A;  4PUC A;  3U3W A;  4AVX A;  3Q9U C;  3FTS A;  2Y4T A;  3TL5 A;  2YNQ A;  2WXQ A;  1TJF A;  2NSZ A;  4GPK A;  4EQF A;  5AN8 A;  5HS0 A;  2DYR E;  5C1D A;  3FTU A;  4B8C B;  3CHR A;  3E37 A;  2VSN A;  4CGW A;  1FVF A;  4YDY A;  2QY7 A;  3T9K A;  3E30 A;  3HXE A;  2EIJ E;  3FH5 A;  5KJM A;  4DUI A;  4U96 D;  3G2V A;  2QZA A;  4YVQ C;  3IKO B;  3V2O A;  2L0I A;  2WXO A;  3I4R B;  2JAB A;  2XPY A;  4I2Z A;  3ABM E;  5FQ7 A;  4G26 A;  3FP3 A;  3PH0 C;  4BSZ B;  4M7C A;  1E8Y A;  5AAO A;  3EU5 A;  2GRP B;  3AG2 E;  1K3Z D;  1H19 A;  3Q75 A;  3FWV A;  1U3C A;  3DSW A;  3FU5 A;  2KAT A;  1YCS B;  2P9S G;  1NI1 A;  3C3Q A;  5AJL A;  5FQ8 A;  3ZEF A;  4Q96 A;  3CVX A;  4HOR A;  3WG7 E;  3BG0 B;  2J07 A;  5KNH D;  1MX6 A;  5FWQ A;  4J8D A;  2LXM A;  2WPV A;  5T3R A;  3Q9N C;  4A3V A;  3FTW A;  3AU4 A;  2WQ7 A;  3S2A A;  2IJG X;  2IEJ A;  2OEW A;  3SQV A;  4AXH A;  1WG0 A;  4FHK A;  3NOG D;  3P1U A;  2F8X K;  4U8Y D;  2I2O A;  3D9P A;  4CEM A;  1SVX A;  5D0O D;  1MJ0 A;  1MX2 A;  5DIZ A;  3Q73 A;  3JUE A;  4FUL A;  5D0Q D;  1SA4 A;  4N3A A;  2X38 A;  4DX2 A;  4HI9 A;  5BV0 A;  2M63 A;  5LFA A;  1LD8 A;  3PZD A;  3EJN A;  3PNL B;  5G04 C;  1WM5 A;  2ZU6 B;  5CMY A;  4U8H A;  2VSO E;  1FT1 A;  3K9I A;  5HQ8 A;  2LUH A;  4AP2 A;  5B1A E;  4J8F A;  4FC8 A;  4GYY A;  4HQD A;  3R9M A;  3FUI A;  4MKT A;  1AWC B;  4JW1 A;  1DNP A;  4MRU A;  3CHM A;  2WQ6 A;  1KPS B;  2IY0 C;  3FUL A;  5EX0 A;  2HR2 A;  4DK5 A;  1HF8 A;  1KT1 A;  5AEN A;  3Q5M A;  5AQ7 A;  1JWF A;  4B8A A;  1HXI A;  2AW6 A;  4YND A;  4UWG A;  3CK7 A;  3V79 K;  4PS3 A;  4URK A;  2EIN E;  4C48 B;  2GRO B;  2XZT G;  3QK0 A;  4AIF A;  2LSU A;  3ZYM A;  2IU1 A;  3PS6 A;  1NZN A;  4IYP A;  1TYQ G;  2XRY A;  3FEX A;  1QQE A;  5T8I A;  3HHM A;  1OCR E;  1FVH A;  2XS1 A;  1N95 A;  3LY7 A;  2Y69 E;  1IKN D;  4HNA D;  4RVB A;  3SHF A;  4QFV A;  4AY6 A;  5BXU A;  4N2S A;  4CDN A;  4JXT A;  3BUA A;  4YDE A;  3I3N A;  2ZGG A;  3ZXP A;  3SFZ A;  3CKC A;  4HS2 A;  2J08 A;  3G2W A;  2P9I G;  5A23 A;  5D2M C;  1BI7 B;  2J9Q A;  4BSX A;  4MLP A;  4B93 B;  5LCW C;  3LJ3 A;  4BY6 A;  4QQI A;  3ZYK A;  3PVL A;  5CRV A;  4X8Q A;  4ZFH A;  1TJC A;  2OVB A;  3EUV A;  3QWP A;  4RG9 A;  3QKY A;  5KJN A;  5CEC B;  4JZY A;  3BU8 A;  4H7Y A;  3OXL A;  4A55 A;  4GMR A;  2XRZ A;  3CVQ A;  3V31 A;  4GCO A;  4B89 A;  3T8K A;  2GW1 A;  1EDU A;  4JPS A;  4N5Q A;  5ANR A;  2L0T B;  4A1S A;  4U0U A;  4UWK A;  3DPY A;  2PNN A;  4J7W A;  1E90 A;  3EIJ A;  2V4L A;  4APF A;  1QYM A;  3APF A;  4LG6 A;  2AXU A;  3MKR A;  4OVU A;  2R5S A;  2FF4 A;  3HRA A;  3E34 A;  1LF8 A;  2ETA A;  3KAE A;  3QNK A;  3W9G A;  4FAD A;  1H2V C;  2A5E A;  4CZ2 D;  3GW4 A;  5AJD A;  3SY2 A;  3CVV A;  2AWI A;  4M3O A;  1A5E A;  4O6F A;  2WMO A;  3QWV A;  4F53 A;  2WXJ A;  5IY5 E;  2F8Y A;  4CT0 A;  3FU6 A;  2J4D A;  3RJV A;  4XKC A;  3D9L A;  1X5B A;  4HRM B;  5FQ4 A;  1OCC E;  4BTB A;  5HRY A;  3IV0 A;  3CVN A;  2H6G A;  3R9A B;  1ELW A;  3FUH A;  3FFL A;  2WXK A;  3FTZ A;  3RK6 A;  4AY5 A;  1TNY A;  1Y6I A;  2YIN A;  1HE8 A;  1SA5 A;  2CG2 A;  4HXI A;  2GRL A;  4PS8 A;  1O1S A;  3OAW A;  3D9O A;  4GCN A;  1N52 A;  2F37 A;  4XI9 A;  2XZD G;  3CQC B;  5KCM A;  2EIL E;  5JHA A;  4LSZ E;  2KCL A;  4K5C A;  4IN3 B;  4NRH B;  2V4H C;  3ISM C;  2IOS A;  4Q69 A;  2AXV A;  1INZ A;  1UJJ A;  3CQG B;  4HLL A;  3C5R A;  4L2L A;  3O48 A;  4TRQ A;  2BKK B;  3T8M A;  3NZS A;  3ASG A;  3FY4 A;  1BI8 B;  4TUU A;  2IFU A;  4N5C A;  4WWO A;  4HRL A;  3RSE G;  2JLB A;  3TGO A;  1HO8 A;  3D9I A;  2NYJ A;  4JL0 A;  1VDY A;  2IF4 A;  4WNE A;  3D9M A;  4B0Z A;  3Q49 B;  2BF0 X;  1HX8 A;  2BUG A;  2B0O E;  3RRU A;  1OCO E;  4G23 A;  3ZXS A;  3BEE A;  5EIL A;  1N9A A;  4G2V A;  1TNU A;  3TAX A;  4W9R A;  4TV3 A;  4HVB A;  1IHG A;  2X3M A;  1P5Q A;  3PNT B;  2OEV A;  2ETB A;  4GTP A;  2H6I A;  3U64 A;  5JJ6 A;  4BT9 A;  4UWH A;  2LNI A;  1N4R A;  3ASN E;  4WUY A;  2L9B A;  1JUQ A;  4C9B B;  5ARG A;  3J5P A;  2JEK A;  3DXK G;  4XX5 A;  4NIK A;  5M72 A;  5D66 A;  5E76 A;  2XGM A;  3QAR A;  1YYH A;  4FU3 A;  4LNG A;  3S7D A;  4UI9 C;  2AVP A;  3TWQ A;  5CRU A;  3UX4 A;  4CDR A;  2VGX A; 
#chains in the Genus database with same CATH homology
 2IEJ A;  3PZ3 A;  3DPY A;  1D8D A;  2F0Y A;  1S64 A;  1S63 A;  3KSL A;  1MZC A;  1NL4 A;  3Q73 A;  1KZP A;  1JCQ A;  4GTS A;  4L9P A;  1N95 A;  4GTT A;  3C72 A;  1O5M A;  1SA4 A;  2ZIR A;  3PZ1 A;  3DSX A;  3E34 A;  3DST A;  3PZ2 A;  2ZIS A;  3DSS A;  4LNB A;  3DSU A;  1TN6 A;  1LD8 A;  3E37 A;  3DSV A;  3PZ4 A;  1FT2 A;  4MBG A;  1DCE A;  3E30 A;  3HXE A;  3SFY A;  1N94 A;  1TNB A;  4GTM A;  3Q78 A;  1FT1 A;  3E33 A;  3KSQ A;  4YDE A;  1N4S A;  1FPP A;  3Q7A A;  1N9A A;  4YDO A;  1TNU A;  1KZO A;  1X81 A;  4GTV A;  1QBQ A;  3HXD A;  3E32 A;  3EU5 A;  4GTR A;  1LD7 A;  1JCR A;  4GTQ A;  4GTP A;  4EHM A;  2H6I A;  3Q75 A;  1D8E A;  4GTO A;  2H6G A;  3DSW A;  3HXB A;  3DRA A;  2H6H A;  1O1R A;  1NI1 A;  3EUV A;  1N4R A;  1LTX A;  1N4P A;  2BED A;  1TNY A;  1TN8 A;  1SA5 A;  2R2L A;  1TN7 A;  3HXF A;  1O1S A;  1JCS A;  3Q79 A;  1O1T A;  1TNO A;  3HXC A;  1TNZ A;  4LNG A;  2H6F A;  3SFX A;  3Q7F A;  1N4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...