2H6GA

W102t protein farnesyltransferase mutant complexed with a geranylgeranylated ddptasacvls peptide product at 1.85a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6gA00
3PZ4A 3DSXA 4YDEA 1SA5A 3DSVA 1MZCA 3SFXA 1NI1A 3E32A 3Q78A 3EU5A 2ZISA 1O1SA 1S64A 3HXBA 2H6FA 3E33A 4YDOA 1S63A 3DSUA 1KZOA 1TNUA 1NL4A 2BEDA 1FT1A 1D8EA 4GTPA 2F0YA 4GTOA 1QBQA 3Q79A 4MBGA 1O1TA 1FPPA 1TNYA 3HXDA 2ZIRA 1TNOA 1LD7A 1N9AA 1KZPA 2H6IA 1JCRA 1LTXA 1TNBA 2IEJA 1N4SA 4GTMA 2R2LA 4LNBA 1TN8A 1N94A 3DSWA 4L9PA 3HXFA 3KSLA 1N4RA 3Q75A 4GTSA 2H6HA 1TNZA 3DPYA 1N95A 1FT2A 1O1RA 1TN6A 1SA4A 1N4PA 3HXCA 4GTVA 3E34A 1X81A 4GTTA 3PZ2A 1DCEA 3Q7AA 3Q73A 3SFYA 1O5MA 1TN7A 3KSQA 1JCSA 3PZ3A 4GTRA 4LNGA 4EHMA 3HXEA 3PZ1A 3Q7FA 3DSSA 3DRAA 1LD8A 2H6GA 1N4QA 3E37A 4GTQA 3E30A 1JCQA 3EUVA 3DSTA 3C72A 1D8DA
chains in the Genus database with same CATH superfamily
1HX8A 3C3OA 2AXUA 4GA0A 3EHNA 5KJKA 3HIZA 3AJIA 1NI1A 4JHRA 1H6KA 4AV7A 4FHKA 2Y4UA 3PS6A 4BT8A 3FP3A 5JHAA 5G2NA 4ANXA 3EJNA 1E8WA 4CRWA 2CG2A 3B7BA 3L22A 4H7YA 1N9AA 1NA3A 3FULA 1IYGA 1TNBA 2WMOA 4RQIA 3JXJA 2IU1A 2OV8A 2PM6A 4L2LA 3BQOA 1H2TC 3ZFWA 4K5BA 3EHRA 5ENNA 4FADA 2XRYA 5LP0A 4BERA 4WNEA 3PZDA 3NZSA 2R17C 3W9GA 5BXUA 2RFAA 1U2VG 2A5UA 5FJYA 3PUJA 2LNIA 2JLBA 4M7CA 3Q7AA 4TXRA 5AYWD 3SGHA 3PNTB 4Q69A 4HOTA 2VSOE 4DRXE 3IXEA 2P9NG 4XKBA 3EHQA 5FQ4A 3MGBA 1SZAA 2XPZA 3UI2A 1OCCE 2XS8A 2F8YA 1PAQA 4YDEA 4ATGA 4AY6A 2NXPA 1SW6A 2VGXB 4RSYA 1MZCA 3E32A 4N3CA 2V0PA 2ETBA 2ZISA 2H6FA 1HXIA 3ZN3A 4GA2A 1OCZE 1D8EA 2FO1E 2X3MA 2J49A 4L23A 3TWWA 2YHEA 2L6JA 2XGMA 3FH7A 4C0MA 2H6IA 4RG9A 5LX8A 3ASDA 3CHPA 3CQCB 4H7XA 2KZTB 4FJYA 3ZYQA 4FA6A 3CHSA 3C3RA 3AG3E 1NZNA 2MHKA 3IEGA 3CVUA 3V79K 3T5XA 1FVHA 3L82A 2ZXWE 1OCRE 2IO2C 4CDRA 3IHYA 1HG2A 3OTNA 1HO8A 2KM4A 5EIDA 4AEZC 5CECB 3HXEA 3CK8A 4MRUA 4U0UA 3TWVA 3AS5A 3MKQB 2WXRA 3OXGA 1SVXA 4LERA 5EYLA 3LPZA 3FU6A 3U9WA 1U3DA 3DWLG 5B1AE 3SI5A 1N0RA 1DCQA 3CVXA 1ZB1A 3KEAA 4F6RD 3IKOB 2WXLA 4J8FA 2DWZA 3DBSA 4NURA 4JB8P 2CHZA 1W3BA 1N0QA 5LCWC 1MQSA 4WNFA 3BU8A 3FTVA 4ILHB 3Q49B 4XZ4A 3MA5A 2HYZA 3D9JA 3HVEA 1JCRA 3LVRE 3FUIA 3V31A 4I2ZA 4BX9A 3DEPA 5BV0A 1TN8A 4KZ0A 1QYMA 1IHBA 3LJ3A 3FU0A 1N4RA 1WG0A 1E7VA 4J8DA 2WM9A 3P1UA 1H6PA 5G55A 4JW1A 4APFA 1X81A 4EQFA 5T8IA 2XPYA 4ATZD 2GW1A 1UW4B 3PDNA 4DX2A 2GRNB 1OUVA 4G1TA 3FH5A 4PS7A 3JYSA 3SNXA 3L9TA 3CEQA 4BSZB 1JCQA 4WNDA 1Y6IA 4B8AA 2JEKA 1S0PA 3CHMA 4BETA 3R7RA 4BY6A 3BG0B 4CDNA 2XHEA 4UWGA 5CEAA 3ZUVB 1E8YA 3ABME 5G05C 4KYOB 3J5PA 4AXHA 5AN8A 5D66A 1E8ZA 2IF4A 4NRHB 1UN8A 4WWPA 3PUKA 3B7UX 2KC7A 4X8QA 4LRZA 2DYRE 4JPSA 1HU3A 3D9IA 4N3AA 3PRZA 4HB5A 3UXGA 1NFIE 4Y6CA 3GZSA 2EIKE 4UQZA 3ZHEA 1N52A 3S7JA 5KNHD 3FUJA 2LO6A 1JUQA 3APCA 1BLXB 3PEUB 2EQXA 5E76A 2FULA 4U8HA 3D9MA 3Q4AB 4JD2G 4FHJA 3BUAA 3CHOA 3QARA 3NB2A 4B8CB 3PZ3A 4HFGA 2DVWA 3LCAA 3DRAA 4DJAA 4UI9K 2H6GA 3LY7A 1KPSB 1KT0A 2X38A 2CG3A 2EILE 3G2WA 2LXLA 2MRIA 4L7TA 3QOUA 5FZRA 3VLFA 3RRMB 3QDNA 1OWNA 3D3MA 3FUFA 4UWHA 4I1MA 4TV3A 3PE4A 3PEVB 1PY1A 2PL2A 3DXMG 3RRNB 2XEHA 5G04C 4MBGA 4C0EA 2ZIRA 4A1GA 3CR3A 3HG0D 5T3RA 5FQ6A 4HVBA 3PNLB 2IFUA 3SQVA 3ZPJA 3HVEB 3I3NA 4I6JA 4DX5D 2OVBA 2IQCA 1OCOE 3V30A 1AWCB 2LAHA 4RLYA 3FEYA 3L6AA 3MV3B 1DVPA 3HXCA 4ANUA 1UG3A 1TR4A 3EHMA 2WXJA 3KS2A 2PM7A 2J4BA 1YA0A 2WXPA 1HH8A 4O1OA 2DZNA 3MKRA 1DC2A 2NC9A 3ESLA 4HI8A 2WQ7A 1N4QA 3L13A 4NACA 4HQDA 2NYJA 5CRUA 1TEZA 4IRUA 5BV1A 1EDUA 3F6QA 4GB9A 3VTYA 1QNFA 2RFMA 2P9UG 4WAFA 3AG1E 4R7LA 4GCNA 3RIBA 4MS6A 3EU5A 1OXJA 4APOA 3DSUA 4UI9C 3ZRHA 2EIJE 4HXIA 3UM2A 5HRYA 4A3TA 4BESA 2C0MA 3D9HA 3HYMB 3TWSA 2CHWA 3L17A 1BU9A 3I4RB 3TWUA 4IN3B 1JWFA 4JEHA 3WG7E 3L54A 4JXTA 4DI3A 3FU3A 5ARFA 4JHJA 1TYQG 5FIOA 5KNGA 3TXMA 4DLQA 4HRMB 2WXQA 2L0TB 4I6GA 1K1AA 3UKUG 2P58C 3ULYA 4JA9A 4LEUA 3PVLA 1N4PA 2R59A 3ZIMA 3CHRA 1DCEA 2DCPA 2J9QA 1O5MA 2VTBB 2XGOA 4ZHBA 3IBEA 5CRVA 3IV0A 4DX6D 3DXKG 1WAO1 5EN5D 4HS2A 3L16A 3K9IA 1LD8A 4TRQA 2DZOA 3TG5A 2GRQB 3E37A 3U64A 4XI9A 3FTYA 4U07A 4U0SA 3UINC 5ENOD 4AVXA 3VTXA 4I1AA 4N3BA 5CBOA 3CSFA 4N5CA 4HNAD 4G23A 1MX6A 2GRPB 1QZ2A 1S70B 5ANRA 4AJWA 2IOLA 2AXVA 4GTPA 5FZSA 2Y69E 1YYHA 1E7UA 3Q79A 4TUUA 1O1TA 1ELWA 3FTZA 5KCMA 3B7SA 3GZ1A 3D9KA 1OWLA 2XGSA 2KCKA 4G8LA 4N39A 1MHQA 5JJ7A 4WNGA 3UX4A 4ANWA 2AXZA 3T9KA 1Z3XA 5AARA 5JHBA 3JUIA 2WQHA 4WWNA 2R5SA 3PREA 3LVQE 2AWIA 1FT2A 2OVFA 3FDHA 1X5BA 2VGYA 3CVPA 4GTVA 2NSZA 4EBAG 1ELRA 4CEMA 4GU5A 4PDXA 4TXPA 4LSZE 4YVOA 1WDYA 5LFAA 5BUZA 4N5QA 2Y4TA 1BPOA 1IXVA 2YINA 4G11A 1E8XA 4UWLA 3VLDA 3ZU7B 2JABA 4E6HA 1TJFA 1DNPA 3B7TA 3ABKE 4YNDA 4GMLA 3NOCD 3RU0A 3DSTA 2ILRA 3S2AA 2QYUA 5KJMA 3NQPA 3VLEA 4XEIG 1B89A 3QNKA 4I1OB 1H0AA 3LDZA 3ASFA 5CCLA 4I9CA 4DX1A 1K3ZD 4EECA 2A5EA 3ULEG 3NZUA 3LS8A 3C98A 2J8SD 3SBSA 4B93B 1TNUA 1NL4A 3SHFA 4RG6A 2BTDA 3FTXA 2BKKB 1QBQA 3MCXA 4BTAA 5AIJA 4UQXA 1AP7A 4JZYA 5BW8C 3UQ3A 3WXXA 3ASNE 1LTXA 1TJCA 1N4SA 3J5QB 4A1SA 4UQYA 4BSXA 2R2LA 3FHEA 3LEWA 2UY1A 4FP7A 2HM8A 4F3VA 3OXFA 4XIFA 5BXOA 3RO2A 3TAXA 1HZ4A 4GZ3A 2KXPC 4HRLA 3TXNA 2QYJA 2I6HA 5JJTA 4U7EB 3OAWA 2I1KA 3ZXSA 3SZ7A 2LUHA 3E34A 3Q73A 3BG1B 4HOUA 4HLLA 4GTRA 3Q7FA 4PUCA 3C5RA 4IYPA 2P2CP 4QFVA 3R9AB 5D0QD 5EYPF 4CCAA 3ML9A 4ACLA 4O1PA 3RJVA 2KCVA 5CCMA 3C72A 5AQBA 4L1BA 1SA5A 3FY4A 3AU4A 3CVLA 4U63A 4CZ2D 3QWVA 2J07A 3CKBA 1UJJA 1G3NB 3SFXA 4JC8A 4HRNA 5ITZF 2PZIA 1S64A 3V2XA 2P9IG 1FT1A 3T8KA 1RZ4A 3D9OA 2IO3C 2P9LG 1SQMA 3FWVA 4QQIA 2B6CA 5J08A 4GPKA 2HO1A 1IQUA 1FPPA 3AS8A 5ENTD 3EDTB 4GMRA 1V54E 3FTUA 3FTSA 1BI7B 1N94A 3RRUA 1SZ9A 4GZ5A 3RO3A 4KT6B 4TUMA 4XE0A 5AENA 3S7DA 4GTSA 2FI7A 5HS0A 3ZYKA 2VJ8A 1OWMA 1TNZA 2IJGX 2F37A 3ZGQA 2WB2A 4I9EA 4AOFA 1U3CA 3ZYMA 3LY9A 1MYOA 4I2WA 2RD0A 4DI4A 1MX2A 1INZA 2VQ2A 4XI0A 3UTMA 2E0IA 1Z6TA 3BEEA 4LNGA 2VTBA 5DBKA 1WY6A 2VSNA 5AQ9A 3UIPC 1OY3D 4OVVA 2XPIA 2WXOA 2LSVA 3AG2E 5G04J 2P9SG 3Q9NC 1Y8MA 2E2EA 3QB2A 4I17A 4U8YD 3U66A 4K5AB 1GW6A 4GZDA 2Q7FA 2XZDG 3HDXA 5AJDA 4GPMA 4MKTA 3UT7A 4WUYA 5EILA 3TWXA 1XNFA 4JVSA 4YDYA 2VYIA 4AIFA 2FF4A 2J09A 3RK6A 1LD7A 4B0ZA 2R03A 3CVVA 3G2TA 3SD5A 1JPLA 1V55E 4EZKA 4L2YA 3U3WA 4TXQA 4GYYA 1E96B 2V5QC 4WWOA 2CFZA 3DSWA 5ENQD 3ML8A 3DPDA 2B0OE 3GYZA 2EINE 4BT9A 1O1RA 5CMYA 3LY8A 4UUCA 4G8KA 4KVMA 3LJNA 2WXKA 2A4ZA 2ZU6B 4G26A 4J8SA 4Q96A 4BFRA 1OWOA 4N2QA 1KT1A 3JQ1A 3CQGB 4EPZA 1IKND 4XKCA 3DSXA 3I5PA 2YNQA 3DSVA 2J4DA 3AS4A 3ZYLA 1K8KG 3G2SA 5DIZA 3GZ2A 2X6JA 3TG4A 4BTBA 4DLOA 3UM3A 2QFCA 3ZKJA 3UUXA 4GZ6A 4J8YA 3JUEA 5C1DA 4NIKA 4BEPA 2I2OA 2GROB 1KZPA 4PS8A 2XQ0A 3B95A 2V4LA 3SF4A 3QWPA 4K0RA 3SY2A 2IONA 3CK9A 3Q75A 3Q5MA 3FUHA 3SFZA 2H6HA 5KJNA 5IY5E 4JA7A 2WXGA 3V2OA 5D0OD 2R02A 1TN6A 2M63A 1VDYA 3FUKA 3KAEA 4JL0A 4KXKB 2V4HC 4V3IA 2YQ8A 3FUDA 4Y6WA 1N11A 4K5CA 1K1BA 4UI9J 2OEWA 3DSSA 4PS3A 3ZW3A 4F53A 2XRZA 3APDA 1MJ0A 3MX3A 2OCCE 4EBAA 3CVWA 4CGVA 4A63B 5J90A 1D8DA 3TGOA 1WM5A 4F1PA 4Q94A 3S7FA 3TWTA 3Q78A 4URKA 2KCLA 2VSYA 3EIQC 1O1SA 2BKGA 4DK5A 2LAIA 3FUEA 4O60A 2WXMA 3B13A 1KLXA 1LF8A 3MZLB 2F0YA 4GTOA 4JHKA 4LNUD 4U04A 4LCTA 5CERB 2RG8A 1EYHA 4DPRA 2WPVA 5EX0A 3HHMA 2QZAA 2HR2A 3SBTB 1Q2ZA 4HOQA 2IEJA 4Z68A 4J8EA 5HI7A 4O6FA 4MLPA 2X6KA 4L9PA 2IOSA 1BI8B 4ZFHA 2DBAA 2I1JA 2C0LA 3B7RL 4YVQC 1UJKA 2XS1A 1UN9A 1N95A 3ABLE 4UWFA 2Y1LE 1N54A 4EZLA 2BUGA 4LUNU 4F1SA 3EIJA 4CGWA 4BX8A 3EU9A 2XENA 3CVQA 3QC1A 2VSXE 4YDWA 4OVUA 3RSEG 5AQ7A 2ETAA 3D9NA 3JQ0A 3HRAA 5CHEE 3FU5A 3Q9UC 2I9CA 3E30A 2KATA 3EUVA 5ARGA 2RKKA 5ANLA 4F7AA 4U96D 5ENSD 2FEZA 4DUIA 5JJ6A 4N2SA 3UT4A 4GCOA 2FBNA 3T8MA 5FQ8A 4M3OA 5AAOA 5E75A 3MJWA 3QJZA 3HXDA 3L08A 3S7BA 5AQAA 2L0IA 2ZGDA 1P5QA 2AW6A 2XCCA 4ABNA 5A6CA 3AU5A 3NAWA 5ENPD 2R05A 3FTWA 2OOEA 2GGFA 5BT1A 2LXMA 1YMPA 3HXFA 3KSLA 3URZA 2HE0A 2X6FA 5H7PA 5EKQD 1Z5SC 3CLJA 3UT8A 3DPYA 1Z3YA 4ANVA 3CSTA 3D9PA 5A7DB 2UWJG 2V5FA 1IHGA 2XCBA 3MKQA 1XGWA 4BWRA 3TWQA 3RAUA 4AP2A 1ZBPA 1OT8A 4OAVB 3G2UA 2DYSE 2L9BA 5LOZA 1A5EA 1JCSA 2GRMA 3Q47B 2AJAA 1UOHA 1H19A 1D9SA 3KEZA 5HKPA 4K03A 4W9RA 3TWRA 2XEVA 2L6BA 2PNNA 4ACKA 2EIME 4I43A 3JXIA 4FLHA 4C48B 3O4ZA 4FJZA 1H2VC 4P29A 1FVFA 3RKVA 2ETCA 3MYVA 4J6IA 2KZTA 4OYSA 2X6HA 3ENEA 1S63A 4HBDA 3CGHA 3NBNB 2BEDA 1NP7A 1FCHA 3ZVVA 5FT9A 3TL5A 5FWQA 5KBAA 1TNYA 2MOWA 5CMWA 1NA0A 4FC8A 4PH4B 3O48A 4J7WA 3QAQA 3AG4E 4HORA 3W9FA 1HS6A 4GYWA 4LNBA 4JEUA 1L5JA 1HE8A 5FZQA 1QQEA 2VGXA 4KBQA 5BPPA 2Y0BG 2WVIA 3ASGA 3LYAA 2WXHA 2DIWA 4OAUC 5CBNA 1SA4A 2Y3AA 2KBXA 4GTTA 3PZ2A 3UIOC 3SFYA 5G05J 2WXIA 5AJLA 2X6IA 5C2YA 3KSQA 3PH0C 5EX3A 3PZ1A 2WXFA 2YHCA 3JCKC 4G24A 3OXLA 2OEVA 1HFAA 1IQRA 3UMVA 2MYOA 4GTQA 4U8VD 1H2UA 3ISMC 4UWKA 3ULQA 4DX7D 2WQ6A 2LSUA 2AVPA 3ESKA 3ASHA 5T4YA 2F8XK 3CVNA 5B3SE 2ONDA 3PZ4A 2FO7A 2QY7A 4U95D 4KMOA 3FFLA 2CHXA 5FINA 3CK7A 3TJPA 4FU3A 3HXBA 4G25A 4YDOA 5BNWA 4CDMA 3R7QA 3UPVA 5CEDB 4ILIA 4FULA 1TNOA 2WMNA 2PQRA 3ZNGA 2C2LA 3DEOA 5B1BE 5KWDA 4HOSA 4AM9A 4ILGA 4ME2A 2GRLA 5KJLA 4KZCA 3Q15A 4HI9A 4B94A 3QKYA 2IY0C 4GA1A 3SO8A 2P9PG 4E85A 2J08A 3E4BA 2V8SE 3CHQA 3P2BA 3PE3A 3FH8A 3ZEFA 3NOGD 2VGEA 4HLEA 5EIBE 5FQ7A 3FEXA 4LG6A 3FUMA 3MV2B 3CKCA 4KVOA 3LKUA 1E90A 2P9KG 1EF1C 3R9MA 3NF1A 4EHMA 3AAAC 5FTPA 3X2QE 3MEKA 3CVYA 4XX5A 2BF0X 5HQ8A 5M72A 3IHVA 2CFUA 3QK0A 4GAAA 4C9BB 3U4TA 4CT4A 4EZJA 3ONLA 4D10C 4AY5A 3E33A 1HG5A 4GMJA 4A3VA 1KZOA 1RW2A 2QC9A 2ZGGA 2GRRB 4GZCA 3ONKA 3QWWA 4GYOA 1OWPA 5LCWJ 5A23A 4I6EA 1H6OA 4RVBA 1BD8A 5D2MC 2UY1B 3G2VA 4A55A 4GTMA 3ASOE 3I4GA 3CV0A 4IULA 5EDSA 1EPUA 1MX4A 4CT0A 2XEEA 3N71A 5JMND 3T5VA 1YCSB 3GW4A 3LXUX 4NQ0A 1PC2A 3C3QA 3ZHEB 1HF8A 1ZU2A 1A17A 3APFA 4CYMD 3ZXPA 2WXNA 1TN7A 1ELKA 3UM0A 3UM1A 3UKRG 3D9LA 1JWGA 2PQNA 4FLBA 2XZTG 4J0UA 4G2VA 3CIAA 3FUNA 5ENRD 4B89A 5JA4D 4U0ZA 3KD7A
chains in the Genus database with same CATH topology
3PZ4A 3DSXA 4YDEA 1SA5A 3DSVA 1MZCA 3SFXA 1NI1A 3E32A 3Q78A 3EU5A 2ZISA 1O1SA 1S64A 3HXBA 2H6FA 3E33A 4YDOA 1S63A 3DSUA 1KZOA 1TNUA 1NL4A 2BEDA 1FT1A 1D8EA 4GTPA 2F0YA 4GTOA 1QBQA 3Q79A 4MBGA 1O1TA 1FPPA 1TNYA 3HXDA 2ZIRA 1TNOA 1LD7A 1N9AA 1KZPA 2H6IA 1JCRA 1LTXA 1TNBA 2IEJA 1N4SA 4GTMA 2R2LA 4LNBA 1TN8A 1N94A 3DSWA 4L9PA 3HXFA 3KSLA 1N4RA 3Q75A 4GTSA 2H6HA 1TNZA 3DPYA 1N95A 1FT2A 1O1RA 1TN6A 1SA4A 1N4PA 3HXCA 4GTVA 3E34A 1X81A 4GTTA 3PZ2A 1DCEA 3Q7AA 3Q73A 3SFYA 1O5MA 1TN7A 3KSQA 1JCSA 3PZ3A 4GTRA 4LNGA 4EHMA 3HXEA 3PZ1A 3Q7FA 3DSSA 3DRAA 1LD8A 2H6GA 1N4QA 3E37A 4GTQA 3E30A 1JCQA 3EUVA 3DSTA 3C72A 1D8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ4 A;  3DSX A;  4YDE A;  1SA5 A;  3DSV A;  1MZC A;  3SFX A;  1NI1 A;  3E32 A;  3Q78 A;  3EU5 A;  2ZIS A;  1O1S A;  1S64 A;  3HXB A;  2H6F A;  3E33 A;  4YDO A;  1S63 A;  3DSU A;  1KZO A;  1TNU A;  1NL4 A;  2BED A;  1FT1 A;  1D8E A;  4GTP A;  2F0Y A;  4GTO A;  1QBQ A;  3Q79 A;  4MBG A;  1O1T A;  1FPP A;  1TNY A;  3HXD A;  2ZIR A;  1TNO A;  1LD7 A;  1N9A A;  1KZP A;  2H6I A;  1JCR A;  1LTX A;  1TNB A;  2IEJ A;  1N4S A;  4GTM A;  2R2L A;  4LNB A;  1TN8 A;  1N94 A;  3DSW A;  4L9P A;  3HXF A;  3KSL A;  1N4R A;  3Q75 A;  4GTS A;  2H6H A;  1TNZ A;  3DPY A;  1N95 A;  1FT2 A;  1O1R A;  1TN6 A;  1SA4 A;  1N4P A;  3HXC A;  4GTV A;  3E34 A;  1X81 A;  4GTT A;  3PZ2 A;  1DCE A;  3Q7A A;  3Q73 A;  3SFY A;  1O5M A;  1TN7 A;  3KSQ A;  1JCS A;  3PZ3 A;  4GTR A;  4LNG A;  4EHM A;  3HXE A;  3PZ1 A;  3Q7F A;  3DSS A;  3DRA A;  1LD8 A;  2H6G A;  1N4Q A;  3E37 A;  4GTQ A;  3E30 A;  1JCQ A;  3EUV A;  3DST A;  3C72 A;  1D8D A; 
#chains in the Genus database with same CATH topology
 1HX8 A;  3C3O A;  2AXU A;  4GA0 A;  3EHN A;  5KJK A;  3HIZ A;  3AJI A;  1NI1 A;  4JHR A;  1H6K A;  4AV7 A;  4FHK A;  2Y4U A;  3PS6 A;  4BT8 A;  3FP3 A;  5JHA A;  5G2N A;  4ANX A;  3EJN A;  1E8W A;  4CRW A;  2CG2 A;  3B7B A;  3L22 A;  4H7Y A;  1N9A A;  1NA3 A;  3FUL A;  1IYG A;  1TNB A;  2WMO A;  4RQI A;  3JXJ A;  2IU1 A;  2OV8 A;  2PM6 A;  4L2L A;  3BQO A;  1H2T C;  3ZFW A;  4K5B A;  3EHR A;  5ENN A;  4FAD A;  2XRY A;  5LP0 A;  4BER A;  4WNE A;  3PZD A;  3NZS A;  2R17 C;  3W9G A;  5BXU A;  2RFA A;  1U2V G;  2A5U A;  5FJY A;  3PUJ A;  2LNI A;  2JLB A;  4M7C A;  3Q7A A;  4TXR A;  5AYW D;  3SGH A;  3PNT B;  4Q69 A;  4HOT A;  2VSO E;  4DRX E;  3IXE A;  2P9N G;  4XKB A;  3EHQ A;  5FQ4 A;  3MGB A;  1SZA A;  2XPZ A;  3UI2 A;  1OCC E;  2XS8 A;  2F8Y A;  1PAQ A;  4YDE A;  4ATG A;  4AY6 A;  2NXP A;  1SW6 A;  2VGX B;  4RSY A;  1MZC A;  3E32 A;  4N3C A;  2V0P A;  2ETB A;  2ZIS A;  2H6F A;  1HXI A;  3ZN3 A;  4GA2 A;  1OCZ E;  1D8E A;  2FO1 E;  2X3M A;  2J49 A;  4L23 A;  3TWW A;  2YHE A;  2L6J A;  2XGM A;  3FH7 A;  4C0M A;  2H6I A;  4RG9 A;  5LX8 A;  3ASD A;  3CHP A;  3CQC B;  4H7X A;  2KZT B;  4FJY A;  3ZYQ A;  4FA6 A;  3CHS A;  3C3R A;  3AG3 E;  1NZN A;  2MHK A;  3IEG A;  3CVU A;  3V79 K;  3T5X A;  1FVH A;  3L82 A;  2ZXW E;  1OCR E;  2IO2 C;  4CDR A;  3IHY A;  1HG2 A;  3OTN A;  1HO8 A;  2KM4 A;  5EID A;  4AEZ C;  5CEC B;  3HXE A;  3CK8 A;  4MRU A;  4U0U A;  3TWV A;  3AS5 A;  3MKQ B;  2WXR A;  3OXG A;  1SVX A;  4LER A;  5EYL A;  3LPZ A;  3FU6 A;  3U9W A;  1U3D A;  3DWL G;  5B1A E;  3SI5 A;  1N0R A;  1DCQ A;  3CVX A;  1ZB1 A;  3KEA A;  4F6R D;  3IKO B;  2WXL A;  4J8F A;  2DWZ A;  3DBS A;  4NUR A;  4JB8 P;  2CHZ A;  1W3B A;  1N0Q A;  5LCW C;  1MQS A;  4WNF A;  3BU8 A;  3FTV A;  4ILH B;  3Q49 B;  4XZ4 A;  3MA5 A;  2HYZ A;  3D9J A;  3HVE A;  1JCR A;  3LVR E;  3FUI A;  3V31 A;  4I2Z A;  4BX9 A;  3DEP A;  5BV0 A;  1TN8 A;  4KZ0 A;  1QYM A;  1IHB A;  3LJ3 A;  3FU0 A;  1N4R A;  1WG0 A;  1E7V A;  4J8D A;  2WM9 A;  3P1U A;  1H6P A;  5G55 A;  4JW1 A;  4APF A;  1X81 A;  4EQF A;  5T8I A;  2XPY A;  4ATZ D;  2GW1 A;  1UW4 B;  3PDN A;  4DX2 A;  2GRN B;  1OUV A;  4G1T A;  3FH5 A;  4PS7 A;  3JYS A;  3SNX A;  3L9T A;  3CEQ A;  4BSZ B;  1JCQ A;  4WND A;  1Y6I A;  4B8A A;  2JEK A;  1S0P A;  3CHM A;  4BET A;  3R7R A;  4BY6 A;  3BG0 B;  4CDN A;  2XHE A;  4UWG A;  5CEA A;  3ZUV B;  1E8Y A;  3ABM E;  5G05 C;  4KYO B;  3J5P A;  4AXH A;  5AN8 A;  5D66 A;  1E8Z A;  2IF4 A;  4NRH B;  1UN8 A;  4WWP A;  3PUK A;  3B7U X;  2KC7 A;  4X8Q A;  4LRZ A;  2DYR E;  4JPS A;  1HU3 A;  3D9I A;  4N3A A;  3PRZ A;  4HB5 A;  3UXG A;  1NFI E;  4Y6C A;  3GZS A;  2EIK E;  4UQZ A;  3ZHE A;  1N52 A;  3S7J A;  5KNH D;  3FUJ A;  2LO6 A;  1JUQ A;  3APC A;  1BLX B;  3PEU B;  2EQX A;  5E76 A;  2FUL A;  4U8H A;  3D9M A;  3Q4A B;  4JD2 G;  4FHJ A;  3BUA A;  3CHO A;  3QAR A;  3NB2 A;  4B8C B;  3PZ3 A;  4HFG A;  2DVW A;  3LCA A;  3DRA A;  4DJA A;  4UI9 K;  2H6G A;  3LY7 A;  1KPS B;  1KT0 A;  2X38 A;  2CG3 A;  2EIL E;  3G2W A;  2LXL A;  2MRI A;  4L7T A;  3QOU A;  5FZR A;  3VLF A;  3RRM B;  3QDN A;  1OWN A;  3D3M A;  3FUF A;  4UWH A;  4I1M A;  4TV3 A;  3PE4 A;  3PEV B;  1PY1 A;  2PL2 A;  3DXM G;  3RRN B;  2XEH A;  5G04 C;  4MBG A;  4C0E A;  2ZIR A;  4A1G A;  3CR3 A;  3HG0 D;  5T3R A;  5FQ6 A;  4HVB A;  3PNL B;  2IFU A;  3SQV A;  3ZPJ A;  3HVE B;  3I3N A;  4I6J A;  4DX5 D;  2OVB A;  2IQC A;  1OCO E;  3V30 A;  1AWC B;  2LAH A;  4RLY A;  3FEY A;  3L6A A;  3MV3 B;  1DVP A;  3HXC A;  4ANU A;  1UG3 A;  1TR4 A;  3EHM A;  2WXJ A;  3KS2 A;  2PM7 A;  2J4B A;  1YA0 A;  2WXP A;  1HH8 A;  4O1O A;  2DZN A;  3MKR A;  1DC2 A;  2NC9 A;  3ESL A;  4HI8 A;  2WQ7 A;  1N4Q A;  3L13 A;  4NAC A;  4HQD A;  2NYJ A;  5CRU A;  1TEZ A;  4IRU A;  5BV1 A;  1EDU A;  3F6Q A;  4GB9 A;  3VTY A;  1QNF A;  2RFM A;  2P9U G;  4WAF A;  3AG1 E;  4R7L A;  4GCN A;  3RIB A;  4MS6 A;  3EU5 A;  1OXJ A;  4APO A;  3DSU A;  4UI9 C;  3ZRH A;  2EIJ E;  4HXI A;  3UM2 A;  5HRY A;  4A3T A;  4BES A;  2C0M A;  3D9H A;  3HYM B;  3TWS A;  2CHW A;  3L17 A;  1BU9 A;  3I4R B;  3TWU A;  4IN3 B;  1JWF A;  4JEH A;  3WG7 E;  3L54 A;  4JXT A;  4DI3 A;  3FU3 A;  5ARF A;  4JHJ A;  1TYQ G;  5FIO A;  5KNG A;  3TXM A;  4DLQ A;  4HRM B;  2WXQ A;  2L0T B;  4I6G A;  1K1A A;  3UKU G;  2P58 C;  3ULY A;  4JA9 A;  4LEU A;  3PVL A;  1N4P A;  2R59 A;  3ZIM A;  3CHR A;  1DCE A;  2DCP A;  2J9Q A;  1O5M A;  2VTB B;  2XGO A;  4ZHB A;  3IBE A;  5CRV A;  3IV0 A;  4DX6 D;  3DXK G;  1WAO 1;  5EN5 D;  4HS2 A;  3L16 A;  3K9I A;  1LD8 A;  4TRQ A;  2DZO A;  3TG5 A;  2GRQ B;  3E37 A;  3U64 A;  4XI9 A;  3FTY A;  4U07 A;  4U0S A;  3UIN C;  5ENO D;  4AVX A;  3VTX A;  4I1A A;  4N3B A;  5CBO A;  3CSF A;  4N5C A;  4HNA D;  4G23 A;  1MX6 A;  2GRP B;  1QZ2 A;  1S70 B;  5ANR A;  4AJW A;  2IOL A;  2AXV A;  4GTP A;  5FZS A;  2Y69 E;  1YYH A;  1E7U A;  3Q79 A;  4TUU A;  1O1T A;  1ELW A;  3FTZ A;  5KCM A;  3B7S A;  3GZ1 A;  3D9K A;  1OWL A;  2XGS A;  2KCK A;  4G8L A;  4N39 A;  1MHQ A;  5JJ7 A;  4WNG A;  3UX4 A;  4ANW A;  2AXZ A;  3T9K A;  1Z3X A;  5AAR A;  5JHB A;  3JUI A;  2WQH A;  4WWN A;  2R5S A;  3PRE A;  3LVQ E;  2AWI A;  1FT2 A;  2OVF A;  3FDH A;  1X5B A;  2VGY A;  3CVP A;  4GTV A;  2NSZ A;  4EBA G;  1ELR A;  4CEM A;  4GU5 A;  4PDX A;  4TXP A;  4LSZ E;  4YVO A;  1WDY A;  5LFA A;  5BUZ A;  4N5Q A;  2Y4T A;  1BPO A;  1IXV A;  2YIN A;  4G11 A;  1E8X A;  4UWL A;  3VLD A;  3ZU7 B;  2JAB A;  4E6H A;  1TJF A;  1DNP A;  3B7T A;  3ABK E;  4YND A;  4GML A;  3NOC D;  3RU0 A;  3DST A;  2ILR A;  3S2A A;  2QYU A;  5KJM A;  3NQP A;  3VLE A;  4XEI G;  1B89 A;  3QNK A;  4I1O B;  1H0A A;  3LDZ A;  3ASF A;  5CCL A;  4I9C A;  4DX1 A;  1K3Z D;  4EEC A;  2A5E A;  3ULE G;  3NZU A;  3LS8 A;  3C98 A;  2J8S D;  3SBS A;  4B93 B;  1TNU A;  1NL4 A;  3SHF A;  4RG6 A;  2BTD A;  3FTX A;  2BKK B;  1QBQ A;  3MCX A;  4BTA A;  5AIJ A;  4UQX A;  1AP7 A;  4JZY A;  5BW8 C;  3UQ3 A;  3WXX A;  3ASN E;  1LTX A;  1TJC A;  1N4S A;  3J5Q B;  4A1S A;  4UQY A;  4BSX A;  2R2L A;  3FHE A;  3LEW A;  2UY1 A;  4FP7 A;  2HM8 A;  4F3V A;  3OXF A;  4XIF A;  5BXO A;  3RO2 A;  3TAX A;  1HZ4 A;  4GZ3 A;  2KXP C;  4HRL A;  3TXN A;  2QYJ A;  2I6H A;  5JJT A;  4U7E B;  3OAW A;  2I1K A;  3ZXS A;  3SZ7 A;  2LUH A;  3E34 A;  3Q73 A;  3BG1 B;  4HOU A;  4HLL A;  4GTR A;  3Q7F A;  4PUC A;  3C5R A;  4IYP A;  2P2C P;  4QFV A;  3R9A B;  5D0Q D;  5EYP F;  4CCA A;  3ML9 A;  4ACL A;  4O1P A;  3RJV A;  2KCV A;  5CCM A;  3C72 A;  5AQB A;  4L1B A;  1SA5 A;  3FY4 A;  3AU4 A;  3CVL A;  4U63 A;  4CZ2 D;  3QWV A;  2J07 A;  3CKB A;  1UJJ A;  1G3N B;  3SFX A;  4JC8 A;  4HRN A;  5ITZ F;  2PZI A;  1S64 A;  3V2X A;  2P9I G;  1FT1 A;  3T8K A;  1RZ4 A;  3D9O A;  2IO3 C;  2P9L G;  1SQM A;  3FWV A;  4QQI A;  2B6C A;  5J08 A;  4GPK A;  2HO1 A;  1IQU A;  1FPP A;  3AS8 A;  5ENT D;  3EDT B;  4GMR A;  1V54 E;  3FTU A;  3FTS A;  1BI7 B;  1N94 A;  3RRU A;  1SZ9 A;  4GZ5 A;  3RO3 A;  4KT6 B;  4TUM A;  4XE0 A;  5AEN A;  3S7D A;  4GTS A;  2FI7 A;  5HS0 A;  3ZYK A;  2VJ8 A;  1OWM A;  1TNZ A;  2IJG X;  2F37 A;  3ZGQ A;  2WB2 A;  4I9E A;  4AOF A;  1U3C A;  3ZYM A;  3LY9 A;  1MYO A;  4I2W A;  2RD0 A;  4DI4 A;  1MX2 A;  1INZ A;  2VQ2 A;  4XI0 A;  3UTM A;  2E0I A;  1Z6T A;  3BEE A;  4LNG A;  2VTB A;  5DBK A;  1WY6 A;  2VSN A;  5AQ9 A;  3UIP C;  1OY3 D;  4OVV A;  2XPI A;  2WXO A;  2LSV A;  3AG2 E;  5G04 J;  2P9S G;  3Q9N C;  1Y8M A;  2E2E A;  3QB2 A;  4I17 A;  4U8Y D;  3U66 A;  4K5A B;  1GW6 A;  4GZD A;  2Q7F A;  2XZD G;  3HDX A;  5AJD A;  4GPM A;  4MKT A;  3UT7 A;  4WUY A;  5EIL A;  3TWX A;  1XNF A;  4JVS A;  4YDY A;  2VYI A;  4AIF A;  2FF4 A;  2J09 A;  3RK6 A;  1LD7 A;  4B0Z A;  2R03 A;  3CVV A;  3G2T A;  3SD5 A;  1JPL A;  1V55 E;  4EZK A;  4L2Y A;  3U3W A;  4TXQ A;  4GYY A;  1E96 B;  2V5Q C;  4WWO A;  2CFZ A;  3DSW A;  5ENQ D;  3ML8 A;  3DPD A;  2B0O E;  3GYZ A;  2EIN E;  4BT9 A;  1O1R A;  5CMY A;  3LY8 A;  4UUC A;  4G8K A;  4KVM A;  3LJN A;  2WXK A;  2A4Z A;  2ZU6 B;  4G26 A;  4J8S A;  4Q96 A;  4BFR A;  1OWO A;  4N2Q A;  1KT1 A;  3JQ1 A;  3CQG B;  4EPZ A;  1IKN D;  4XKC A;  3DSX A;  3I5P A;  2YNQ A;  3DSV A;  2J4D A;  3AS4 A;  3ZYL A;  1K8K G;  3G2S A;  5DIZ A;  3GZ2 A;  2X6J A;  3TG4 A;  4BTB A;  4DLO A;  3UM3 A;  2QFC A;  3ZKJ A;  3UUX A;  4GZ6 A;  4J8Y A;  3JUE A;  5C1D A;  4NIK A;  4BEP A;  2I2O A;  2GRO B;  1KZP A;  4PS8 A;  2XQ0 A;  3B95 A;  2V4L A;  3SF4 A;  3QWP A;  4K0R A;  3SY2 A;  2ION A;  3CK9 A;  3Q75 A;  3Q5M A;  3FUH A;  3SFZ A;  2H6H A;  5KJN A;  5IY5 E;  4JA7 A;  2WXG A;  3V2O A;  5D0O D;  2R02 A;  1TN6 A;  2M63 A;  1VDY A;  3FUK A;  3KAE A;  4JL0 A;  4KXK B;  2V4H C;  4V3I A;  2YQ8 A;  3FUD A;  4Y6W A;  1N11 A;  4K5C A;  1K1B A;  4UI9 J;  2OEW A;  3DSS A;  4PS3 A;  3ZW3 A;  4F53 A;  2XRZ A;  3APD A;  1MJ0 A;  3MX3 A;  2OCC E;  4EBA A;  3CVW A;  4CGV A;  4A63 B;  5J90 A;  1D8D A;  3TGO A;  1WM5 A;  4F1P A;  4Q94 A;  3S7F A;  3TWT A;  3Q78 A;  4URK A;  2KCL A;  2VSY A;  3EIQ C;  1O1S A;  2BKG A;  4DK5 A;  2LAI A;  3FUE A;  4O60 A;  2WXM A;  3B13 A;  1KLX A;  1LF8 A;  3MZL B;  2F0Y A;  4GTO A;  4JHK A;  4LNU D;  4U04 A;  4LCT A;  5CER B;  2RG8 A;  1EYH A;  4DPR A;  2WPV A;  5EX0 A;  3HHM A;  2QZA A;  2HR2 A;  3SBT B;  1Q2Z A;  4HOQ A;  2IEJ A;  4Z68 A;  4J8E A;  5HI7 A;  4O6F A;  4MLP A;  2X6K A;  4L9P A;  2IOS A;  1BI8 B;  4ZFH A;  2DBA A;  2I1J A;  2C0L A;  3B7R L;  4YVQ C;  1UJK A;  2XS1 A;  1UN9 A;  1N95 A;  3ABL E;  4UWF A;  2Y1L E;  1N54 A;  4EZL A;  2BUG A;  4LUN U;  4F1S A;  3EIJ A;  4CGW A;  4BX8 A;  3EU9 A;  2XEN A;  3CVQ A;  3QC1 A;  2VSX E;  4YDW A;  4OVU A;  3RSE G;  5AQ7 A;  2ETA A;  3D9N A;  3JQ0 A;  3HRA A;  5CHE E;  3FU5 A;  3Q9U C;  2I9C A;  3E30 A;  2KAT A;  3EUV A;  5ARG A;  2RKK A;  5ANL A;  4F7A A;  4U96 D;  5ENS D;  2FEZ A;  4DUI A;  5JJ6 A;  4N2S A;  3UT4 A;  4GCO A;  2FBN A;  3T8M A;  5FQ8 A;  4M3O A;  5AAO A;  5E75 A;  3MJW A;  3QJZ A;  3HXD A;  3L08 A;  3S7B A;  5AQA A;  2L0I A;  2ZGD A;  1P5Q A;  2AW6 A;  2XCC A;  4ABN A;  5A6C A;  3AU5 A;  3NAW A;  5ENP D;  2R05 A;  3FTW A;  2OOE A;  2GGF A;  5BT1 A;  2LXM A;  1YMP A;  3HXF A;  3KSL A;  3URZ A;  2HE0 A;  2X6F A;  5H7P A;  5EKQ D;  1Z5S C;  3CLJ A;  3UT8 A;  3DPY A;  1Z3Y A;  4ANV A;  3CST A;  3D9P A;  5A7D B;  2UWJ G;  2V5F A;  1IHG A;  2XCB A;  3MKQ A;  1XGW A;  4BWR A;  3TWQ A;  3RAU A;  4AP2 A;  1ZBP A;  1OT8 A;  4OAV B;  3G2U A;  2DYS E;  2L9B A;  5LOZ A;  1A5E A;  1JCS A;  2GRM A;  3Q47 B;  2AJA A;  1UOH A;  1H19 A;  1D9S A;  3KEZ A;  5HKP A;  4K03 A;  4W9R A;  3TWR A;  2XEV A;  2L6B A;  2PNN A;  4ACK A;  2EIM E;  4I43 A;  3JXI A;  4FLH A;  4C48 B;  3O4Z A;  4FJZ A;  1H2V C;  4P29 A;  1FVF A;  3RKV A;  2ETC A;  3MYV A;  4J6I A;  2KZT A;  4OYS A;  2X6H A;  3ENE A;  1S63 A;  4HBD A;  3CGH A;  3NBN B;  2BED A;  1NP7 A;  1FCH A;  3ZVV A;  5FT9 A;  3TL5 A;  5FWQ A;  5KBA A;  1TNY A;  2MOW A;  5CMW A;  1NA0 A;  4FC8 A;  4PH4 B;  3O48 A;  4J7W A;  3QAQ A;  3AG4 E;  4HOR A;  3W9F A;  1HS6 A;  4GYW A;  4LNB A;  4JEU A;  1L5J A;  1HE8 A;  5FZQ A;  1QQE A;  2VGX A;  4KBQ A;  5BPP A;  2Y0B G;  2WVI A;  3ASG A;  3LYA A;  2WXH A;  2DIW A;  4OAU C;  5CBN A;  1SA4 A;  2Y3A A;  2KBX A;  4GTT A;  3PZ2 A;  3UIO C;  3SFY A;  5G05 J;  2WXI A;  5AJL A;  2X6I A;  5C2Y A;  3KSQ A;  3PH0 C;  5EX3 A;  3PZ1 A;  2WXF A;  2YHC A;  3JCK C;  4G24 A;  3OXL A;  2OEV A;  1HFA A;  1IQR A;  3UMV A;  2MYO A;  4GTQ A;  4U8V D;  1H2U A;  3ISM C;  4UWK A;  3ULQ A;  4DX7 D;  2WQ6 A;  2LSU A;  2AVP A;  3ESK A;  3ASH A;  5T4Y A;  2F8X K;  3CVN A;  5B3S E;  2OND A;  3PZ4 A;  2FO7 A;  2QY7 A;  4U95 D;  4KMO A;  3FFL A;  2CHX A;  5FIN A;  3CK7 A;  3TJP A;  4FU3 A;  3HXB A;  4G25 A;  4YDO A;  5BNW A;  4CDM A;  3R7Q A;  3UPV A;  5CED B;  4ILI A;  4FUL A;  1TNO A;  2WMN A;  2PQR A;  3ZNG A;  2C2L A;  3DEO A;  5B1B E;  5KWD A;  4HOS A;  4AM9 A;  4ILG A;  4ME2 A;  2GRL A;  5KJL A;  4KZC A;  3Q15 A;  4HI9 A;  4B94 A;  3QKY A;  2IY0 C;  4GA1 A;  3SO8 A;  2P9P G;  4E85 A;  2J08 A;  3E4B A;  2V8S E;  3CHQ A;  3P2B A;  3PE3 A;  3FH8 A;  3ZEF A;  3NOG D;  2VGE A;  4HLE A;  5EIB E;  5FQ7 A;  3FEX A;  4LG6 A;  3FUM A;  3MV2 B;  3CKC A;  4KVO A;  3LKU A;  1E90 A;  2P9K G;  1EF1 C;  3R9M A;  3NF1 A;  4EHM A;  3AAA C;  5FTP A;  3X2Q E;  3MEK A;  3CVY A;  4XX5 A;  2BF0 X;  5HQ8 A;  5M72 A;  3IHV A;  2CFU A;  3QK0 A;  4GAA A;  4C9B B;  3U4T A;  4CT4 A;  4EZJ A;  3ONL A;  4D10 C;  4AY5 A;  3E33 A;  1HG5 A;  4GMJ A;  4A3V A;  1KZO A;  1RW2 A;  2QC9 A;  2ZGG A;  2GRR B;  4GZC A;  3ONK A;  3QWW A;  4GYO A;  1OWP A;  5LCW J;  5A23 A;  4I6E A;  1H6O A;  4RVB A;  1BD8 A;  5D2M C;  2UY1 B;  3G2V A;  4A55 A;  4GTM A;  3ASO E;  3I4G A;  3CV0 A;  4IUL A;  5EDS A;  1EPU A;  1MX4 A;  4CT0 A;  2XEE A;  3N71 A;  5JMN D;  3T5V A;  1YCS B;  3GW4 A;  3LXU X;  4NQ0 A;  1PC2 A;  3C3Q A;  3ZHE B;  1HF8 A;  1ZU2 A;  1A17 A;  3APF A;  4CYM D;  3ZXP A;  2WXN A;  1TN7 A;  1ELK A;  3UM0 A;  3UM1 A;  3UKR G;  3D9L A;  1JWG A;  2PQN A;  4FLB A;  2XZT G;  4J0U A;  4G2V A;  3CIA A;  3FUN A;  5ENR D;  4B89 A;  5JA4 D;  4U0Z A;  3KD7 A; 
#chains in the Genus database with same CATH homology
 3PZ4 A;  3DSX A;  4YDE A;  1SA5 A;  3DSV A;  1MZC A;  3SFX A;  1NI1 A;  3E32 A;  3Q78 A;  3EU5 A;  2ZIS A;  1O1S A;  1S64 A;  3HXB A;  2H6F A;  3E33 A;  4YDO A;  1S63 A;  3DSU A;  1KZO A;  1TNU A;  1NL4 A;  2BED A;  1FT1 A;  1D8E A;  4GTP A;  2F0Y A;  4GTO A;  1QBQ A;  3Q79 A;  4MBG A;  1O1T A;  1FPP A;  1TNY A;  3HXD A;  2ZIR A;  1TNO A;  1LD7 A;  1N9A A;  1KZP A;  2H6I A;  1JCR A;  1LTX A;  1TNB A;  2IEJ A;  1N4S A;  4GTM A;  2R2L A;  4LNB A;  1TN8 A;  1N94 A;  3DSW A;  4L9P A;  3HXF A;  3KSL A;  1N4R A;  3Q75 A;  4GTS A;  2H6H A;  1TNZ A;  3DPY A;  1N95 A;  1FT2 A;  1O1R A;  1TN6 A;  1SA4 A;  1N4P A;  3HXC A;  4GTV A;  3E34 A;  1X81 A;  4GTT A;  3PZ2 A;  1DCE A;  3Q7A A;  3Q73 A;  3SFY A;  1O5M A;  1TN7 A;  3KSQ A;  1JCS A;  3PZ3 A;  4GTR A;  4LNG A;  4EHM A;  3HXE A;  3PZ1 A;  3Q7F A;  3DSS A;  3DRA A;  1LD8 A;  2H6G A;  1N4Q A;  3E37 A;  4GTQ A;  3E30 A;  1JCQ A;  3EUV A;  3DST A;  3C72 A;  1D8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...