4AIFA

Aip tpr domain in complex with human hsp90 peptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
144
structure length
144
Chain Sequence
AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Tpr Domain of Aip: Lack of Client Protein Interaction with the C-Terminal Alpha-7 Helix of the Tpr Domain of Aip is Sufficient for Pituitary Adenoma Predisposition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords AH RECEPTOR-INTERACTING PROTEIN
total genus 62
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4aifA00
4GCNA 4NRHB 5AYWD 3FP3A 1ZU2A 4O6FA 3U3WA 2JLBA 2V5FA 3MEKA 3KAEA 4N5CA 3Q47B 3RO3A 4YVOA 4BTBA 1WM5A 3TG4A 2XCCA 2PQRA 3CVLA 4GZ6A 3RJVA 2DBAA 2P58C 5FJYA 4AY5A 4XI0A 5KJNA 3ASFA 2OOEA 2XGMA 4W9RA 3ZGQA 1WAO1 3LPZA 4GZ5A 1B89A 1ELRA 2FO7A 1TJCA 4I1AA 4G1TA 4G25A 3LCAA 2VYIA 3O48A 3KD7A 1NA0A 4UQYA 2PQNA 5CCLA 4RG9A 5G04J 2C0LA 2C0MA 2NC9A 2WPVA 5KJMA 2J9QA 3RU0A 4AM9A 5LCWC 3HYMB 5EX0A 3KS2A 2VGYA 2XPIA 4N3AA 5EX3A 2VGXA 2KCLA 3PE4A 4J8DA 2LSVA 1IHGA 1OUVA 4HOUA 4I2WA 5JJ6A 4BWRA 5DBKA 5C1DA 1W3BA 2Y4UA 4Y6CA 4GA2A 4NQ0A 4GA1A 1QQEA 5CCMA 3ESKA 4YVQC 5A6CA 5HQ8A 2GW1A 4GZ3A 4GYYA 4UQXA 1P5QA 4N2SA 3LY9A 4Y6WA 2UY1A 4I17A 1HH8A 5FZSA 3FWVA 3UUXA 3RIBA 3S7BA 3ULQA 3OXGA 5JJ7A 2FEZA 3GW4A 3S7FA 4U0SA 5BW8C 2L6JA 4G23A 3TAXA 3SZ7A 4UI9K 4J8EA 1NA3A 1KLXA 3ASHA 3AS8A 1IYGA 1YA0A 3ZN3A 4I9EA 3MV2B 2E2EA 4IN3B 2FI7A 5LCWJ 2LSUA 3NF1A 3OXLA 4WNEA 3ZPJA 1KT1A 1ZBPA 3N71A 5KJKA 3MKRA 4GA0A 4BT9A 3UPVA 2YHCA 5G05J 4I9CA 4WNGA 3RKVA 3VTYA 5JJTA 3CVPA 4WNDA 2IFUA 4J8FA 5D0QD 5G05C 1A17A 3S7DA 3LKUA 4U07A 3CEQA 4HOSA 2I6HA 3CKBA 4RG6A 2KC7A 2XGOA 4N3CA 2VGXB 3Q5MA 5EKQD 4KYOB 5FZRA 3ZFWA 5M72A 4WNFA 3JYSA 3GZ2A 2KATA 3Q15A 4U0ZA 5A7DB 3QWPA 2PL2A 4KXKB 2QFCA 1XNFA 2BUGA 1E96B 1FCHA 2MHKA 3GZ1A 2UY1B 2VSNA 5HI7A 3CV0A 3MV3B 3VTXA 4HORA 4N2QA 4EQFA 2Y4TA 1HXIA 3E4BA 2UWJG 3IEGA 4G24A 4JA7A 4APOA 3QDNA 4CGVA 4UQZA 5BT1A 4UI9J 4AY6A 3CK9A 3CK7A 4U04A 4BT8A 5KJLA 4HOTA 3URZA 4KBQA 2AVPA 3Q49B 3UQ3A 4JA9A 2KCKA 4CDRA 4XI9A 3ASDA 3LY8A 3SF4A 4YNDA 2XCBA 4A1SA 4JL0A 4N39A 2VQ2A 3AS4A 3QWWA 3U4TA 4WUYA 3QKYA 4GPKA 4GYOA 5DIZA 5ARGA 3LY7A 3R9AB 4BTAA 1Y8MA 3OXFA 4J0UA 1HZ4A 4UI9C 5D0OD 3ASGA 3ZHEA 2HR2A 3EDTB 2IF4A 3PDNA 3RO2A 4B94A 3TGOA 2C2LA 3S7JA 2HYZA 4JHRA 4U0UA 3GYZA 3QWVA 2Q7FA 4AIFA 5BNWA 3QOUA 5CHEE 4G26A 2LNIA 2XEVA 3BEEA 3CK8A 4G2VA 3CVQA 2FBNA 1KT0A 2KCVA 3MA5A 4ME2A 1PC2A 2HO1A 3LYAA 4GCOA 4N3BA 4XIFA 3ZHEB 1ELWA 4I2ZA 3AS5A 4F3VA 3CVNA 4ABNA 2YQ8A 5G04C 1NZNA 4H7XA 2PZIA 2FF4A 3CKCA 3FFLA 3Q4AB 4LEUA 5ARFA 3K9IA 3WXXA 1QZ2A 2R5SA 4HOQA 4CGWA 2ONDA 5FT9A 5FZQA 2XGSA 3TG5A 4GYWA 2WQHA 4H7YA 5FTPA 3PE3A 2VSYA
chains in the Genus database with same CATH superfamily
5CEDB 1ZU2A 4BESA 3MEKA 4A1GA 2IO2C 4JZYA 3AG3E 1PAQA 2XGMA 2AXUA 4GZ5A 3L08A 1B89A 4PS7A 2FO7A 1N9AA 3C3QA 1BLXB 3FH7A 2WQ6A 3ASNE 4URKA 3G2VA 4I1MA 5C1DA 2XZTG 1MQSA 2XEHA 4YVQC 5E76A 3D9MA 4ILHB 2MRIA 4J8EA 4B8AA 5BV0A 1X81A 5BUZA 4DX6D 3TXMA 2CG3A 3LDZA 2V0PA 3ML9A 3B13A 1QNFA 4RSYA 3SBTB 4DJAA 3IHYA 5A7DB 2OVBA 3SY2A 1FCHA 3E32A 3QC1A 2LUHA 5JHAA 4RLYA 2WXHA 4BETA 2I9CA 1FT2A 5DIZA 2IF4A 3E34A 1L5JA 5AJLA 4CZ2D 2YHEA 1U3DA 4K5BA 3GYZA 1BPOA 1HG2A 5T3RA 1KT0A 4BSZB 2J8SD 1PC2A 3B7SA 5ARFA 3K9IA 1N94A 5LOZA 4DRXE 1N0QA 2BKGA 1K1AA 3FP3A 1AP7A 3Q47B 4BTBA 1WM5A 2Y0BG 1UN8A 4GTMA 4LG6A 2R03A 2XRYA 1OWMA 4I6JA 3KD7A 1WDYA 5KJMA 3CQGB 5EX0A 4LERA 2KZTA 3LJNA 4I2WA 4HOUA 1QQEA 3DPDA 4G8KA 3RIBA 3TAXA 4FU3A 4UI9K 5IY5E 3DSUA 5CBOA 5LCWJ 1Z6TA 1JUQA 3NF1A 3W9FA 3SQVA 3ZU7B 4I6GA 1V54E 1QYMA 1BU9A 2L0TB 3Q5MA 1S63A 4QFVA 2QY7A 1E8XA 2EIKE 4RVBA 3E4BA 2UWJG 5EIDA 3FUNA 3FEYA 3QDNA 3CK9A 3ZXPA 3SBSA 2BF0X 2OVFA 4UWHA 4LNUD 1OCCE 3CVVA 2ILRA 3CVXA 2F8XK 1TNUA 4HNAD 3ASGA 2P9SG 1TNYA 2H6FA 4CT0A 5EX3A 5AQ9A 3FU6A 3AS5A 3EHMA 4I1OB 2FF4A 4R7LA 3JQ1A 3MYVA 5ENRD 3ZW3A 1IHBA 3TG4A 3TWRA 1D8EA 2VSOE 3UKUG 3LPZA 3L82A 5BXUA 4EBAA 2J9QA 2Y1LE 3KS2A 3FUMA 4U63A 5CCMA 5JJ6A 3KSLA 3I4GA 3E30A 5EYPF 5EIBE 1GW6A 4JHJA 1BD8A 4PUCA 3DEOA 3SD5A 1YA0A 4U8VD 2LSUA 3CVYA 2A5UA 2ETCA 1SW6A 4XKBA 4WWNA 5G05J 2VGXB 4KYOB 1FVFA 4HS2A 3FH8A 4KXKB 2IQCA 4GB9A 3L17A 3CQCB 2Y4TA 3DSTA 2XZDG 4U04A 4CYMD 4RQIA 2KCKA 3Q75A 4JHKA 1FT1A 4F7AA 1N11A 3PNLB 1E8WA 4J0UA 1FPPA 4FC8A 3BG1B 2DCPA 1TJFA 1SVXA 3CK8A 4XIFA 5ENQD 4AEZC 3T5VA 4ZFHA 4YDEA 4K03A 4LEUA 1YCSB 5JMND 2KZTB 1BI7B 3L54A 2XGSA 1RZ4A 3D9HA 3EHNA 5AQ7A 3ZYLA 2KXPC 3ZGQA 4LRZA 1ELRA 4OVVA 2PQNA 3D9OA 3D9PA 5LCWC 3UM3A 3L22A 2J08A 2X38A 1P5QA 1TNOA 3S7BA 2WXLA 5BW8C 5FQ6A 5KWDA 3Q7AA 3V2XA 4ATZD 3LVQE 5KJKA 4GA0A 3ZNGA 3RKVA 4EZLA 2IFUA 4DI3A 1A17A 1HO8A 4U07A 3CEQA 3FUKA 3NB2A 4WNFA 1E96B 2UY1B 2ZGDA 3ZYKA 3IXEA 4CGVA 4MS6A 3QNKA 4KBQA 3CVWA 3RRUA 3TWSA 2F37A 4K0RA 3L9TA 2Y69E 4BTAA 2MYOA 5D66A 4O1PA 4ILGA 3LJ3A 4JHRA 4DLOA 3C3RA 1N52A 2KCVA 4GCOA 4JVSA 1RW2A 3VLEA 1UOHA 4NIKA 3FFLA 3AU4A 3NAWA 2XPYA 4GYWA 3D3MA 3IV0A 4FP7A 1K1BA 3HIZA 1E7VA 3UXGA 1MZCA 4GZ6A 4WWPA 5T4YA 2VYIA 3ABLE 4IRUA 3DBSA 1NA0A 4E85A 4RG9A 4L9PA 2IY0C 4PDXA 3B7TA 3QK0A 3RSEG 1HU3A 2VGXA 2WM9A 2DYSE 5DBKA 4CEMA 3B95A 4KT6B 3O4ZA 4C0MA 4N2SA 4Y6WA 1TR4A 4JEUA 3FWVA 3ULQA 3ESLA 4FLBA 4F53A 3SO8A 2FI7A 1D8DA 3N71A 3NOGD 4RG6A 3B7BA 3HDXA 1E8ZA 1MX6A 4U0ZA 3MKQB 2QFCA 4UWGA 2MHKA 5EYLA 3GZ1A 2CG2A 2OEWA 4GTRA 3FUJA 5CRUA 4NURA 5BPPA 3CHPA 2ZGGA 4UQZA 1DVPA 4BT8A 2GRQB 4HOTA 5CMYA 3URZA 4YDYA 4OVUA 2MOWA 3ASDA 3DWLG 2VQ2A 3PZ1A 3HRAA 1MJ0A 4GYOA 3FTXA 5D0OD 1HZ4A 3ULEG 3Q7FA 5ENSD 4J7WA 1TEZA 3LYAA 1ELWA 3Q4AB 3EU5A 4HOQA 4Z68A 4DK5A 4EHMA 4U7EB 2VSYA 3B7UX 3G2SA 4AY5A 3ASFA 3ASOE 4DUIA 1MHQA 2XEEA 4FADA 2C0MA 3F6QA 2P9NG 4HRNA 4LNBA 3BU8A 4A3TA 1SA4A 2X6FA 2LSVA 1KZOA 4NQ0A 1MX2A 2XHEA 1NL4A 3ZEFA 2GRNB 1N54A 2L6JA 1IYGA 3D9JA 3ZXSA 3CLJA 2KBXA 3MKRA 4LCTA 1UJJA 4ILIA 1OCOE 5D0QD 3KSQA 2JEKA 2WXGA 2J07A 3UX4A 5AAOA 5ANLA 5AARA 3SNXA 4OYSA 2VSNA 4APOA 5AENA 2XENA 1IQUA 3CIAA 2IEJA 3LY8A 3SF4A 3AS4A 2QZAA 3PDNA 3RO2A 5KNGA 1JCQA 2LNIA 2Y3AA 4IULA 4HFGA 5FINA 3HXBA 3AJIA 4G11A 3MCXA 3R9MA 3UIPC 2WB2A 3RO3A 4YVOA 2VTBA 1V55E 3FU0A 3GZSA 3UTMA 3RJVA 4CDNA 3FH5A 4GMRA 2WMOA 4BX9A 4UQYA 3MZLB 5FWQA 5CRVA 3LVRE 2R17C 3X2QE 3C3OA 4HVBA 4J8DA 2WXNA 2I2OA 1ELKA 1JWGA 2DYRE 5A6CA 3UUXA 3I4RB 2OEVA 3CHQA 3G2WA 3C72A 3PEVB 4WNEA 5AN8A 3UPVA 2WMNA 2EQXA 3UT8A 3FUHA 3J5QB 4GZCA 3QJZA 4N3CA 1NP7A 3PUKA 3JXIA 1DCQA 1JPLA 5G55A 2WXJA 4B0ZA 3QAQA 3SFZA 4JA9A 2GRRB 4YNDA 3FTSA 1S0PA 3APCA 1H0AA 3R9AB 1EPUA 3SFYA 2LXLA 3EIQC 2FULA 2VJ8A 4ANXA 1H6PA 2J09A 4U8HA 2P9KG 5FIOA 2WXRA 2X6IA 4MKTA 3APDA 4D10C 2YQ8A 2M63A 4H7XA 4BEPA 2H6IA 2WXFA 5FT9A 5FZQA 2YNQA 2OCCE 4FLHA 3FTYA 1INZA 4YDWA 3JUIA 4CRWA 1N4SA 3CVLA 2RFMA 1OWLA 4DX5D 3IKOB 1A5EA 2WXKA 5CCLA 4XX5A 1H2VC 4AM9A 3HYMB 4JXTA 3ULYA 3BQOA 3KEAA 4ACKA 3ESKA 3PEUB 2WXQA 4A3VA 2R59A 4CT4A 5FZSA 1H2UA 2FEZA 5HKPA 3HHMA 1U3CA 2PNNA 5ENOD 3BUAA 4WNGA 4GTQA 3W9GA 4J8FA 5A23A 2I1KA 3ZFWA 2P2CP 3PS6A 3ABME 1KZPA 3TWXA 2YINA 3TWTA 2F0YA 4JD2G 4K5CA 4UI9J 4Q69A 4E6HA 3D9KA 2ETBA 4AVXA 5ARGA 2VTBB 5CBNA 1MYOA 4Q96A 2Q7FA 3QOUA 2HM8A 4XKCA 3BEEA 4N2QA 2ZU6B 3FY4A 2PM7A 4JC8A 5G04C 5B1AE 3JCKC 4BERA 2XPZA 3G2UA 4WWOA 3JXJA 2RFAA 1K3ZD 2P58C 5FJYA 4KZ0A 1WAO1 1OCZE 5KCMA 4A55A 3FUDA 3SI5A 4FJZA 3PE4A 4M7CA 2CFUA 4GPMA 3B7RL 2J4DA 4L2LA 1HFAA 4DX2A 2WQ7A 2UY1A 2KM4A 3PVLA 3OTNA 1NI1A 5B3SE 1JCRA 1Z3XA 3VTYA 1HS6A 2L0IA 3L6AA 3LKUA 2I6HA 3JQ0A 5JHBA 3DPYA 2A4ZA 2IJGX 4GTTA 4F6RD 3IEGA 3CK7A 2LXMA 2BKKB 2WVIA 5LP0A 4GTPA 1PY1A 4OAVB 2NXPA 4I6EA 3OXFA 4GU5A 4CDRA 2XQ0A 2B6CA 3T8KA 1H2TC 2FO1E 3RRNB 4G2VA 2FBNA 3RRMB 3MA5A 5ANRA 3CVNA 4B89A 4HB5A 3WXXA 3CSFA 4PH4B 3LXUX 1TN6A 2WQHA 4AJWA 4TV3A 1AWCB 1OWPA 2PQRA 4XI0A 4BY6A 3PRZA 3P2BA 4B93B 2JABA 3SFXA 1TNZA 3ZUVB 1S64A 5EILA 1LD7A 4DLQA 4HI8A 1OUVA 1W3BA 1K8KG 4U96D 3EHQA 2PM6A 4I17A 4FHKA 3SZ7A 3E33A 5HRYA 3D9NA 2IOLA 4GZDA 1H6KA 5J08A 5JA4D 1DNPA 3ONKA 3CKBA 2V8SE 5FZRA 1JCSA 4A63B 3GZ2A 3ZVVA 3QWPA 2DWZA 5HI7A 3CV0A 1G3NB 3HXFA 2P9IG 4KVOA 3RK6A 1DC2A 1EYHA 3EUVA 4DX7D 3FTVA 4HRLA 4KZCA 2HYZA 3QWVA 3PZ3A 5BNWA 5HS0A 1Z5SC 2HO1A 4L2YA 2H6HA 4ANVA 1NZNA 3U9WA 5G2NA 3G2TA 4TXQA 2ONDA 3FUEA 2I1JA 4GMLA 4O6FA 4LNGA 5AJDA 3TL5A 5KBAA 3VLFA 2OOEA 5AQAA 4PS3A 1UN9A 3DSSA 3EHRA 1TJCA 3CGHA 3DRAA 3UKRG 1UG3A 2E0IA 1E7UA 4O1OA 3L13A 4BWRA 3ML8A 2Y4UA 4AV7A 1ZB1A 5B1BE 2AWIA 2J49A 4GYYA 2V5QC 3UINC 3ZKJA 3ZN3A 3MV2B 4ANWA 4HRMB 1ZBPA 4XZ4A 4GTOA 3DXMG 4U8YD 1XGWA 4I9CA 1H6OA 3PZ2A 1OT8A 4UWLA 4HOSA 1WY6A 4IYPA 4F1SA 3U64A 2CHZA 2LO6A 3EJNA 2J4BA 3ZYMA 5EDSA 4HORA 1D9SA 5KJLA 3U4TA 3QKYA 3AG4E 4G8LA 3CHOA 1Y8MA 1LF8A 2C2LA 2AW6A 3NQPA 3CR3A 4I2ZA 4FA6A 2H6GA 1X5BA 1QZ2A 1YYHA 3P1UA 5AIJA 5FTPA 2XS1A 4CDMA 2V5FA 3UMVA 3NZSA 2V4LA 2R05A 4I1AA 4Q94A 5FQ8A 3Q9UC 3UIOC 3LEWA 3IBEA 3D9LA 3T8MA 1OWOA 3TWWA 4FJYA 1EDUA 2B0OE 3HXDA 4X8QA 4C0EA 1NFIE 3LY9A 4DPRA 3UT4A 3FEXA 4DX1A 3AG2E 3PH0C 3DSWA 3FUIA 2WXMA 4MLPA 2XGOA 2WXIA 5ENPD 3R7RA 2X6JA 2L9BA 3SHFA 1HG5A 2PL2A 2EINE 4AXHA 5CEAA 4EQFA 1HXIA 4G24A 2A5EA 4KVMA 3C5RA 3KEZA 2X6KA 1O1RA 2EIJE 3UQ3A 4XI9A 4JL0A 3ABKE 4TRQA 1Y6IA 4GMJA 4EBAG 3I5PA 4JB8P 3LY7A 4KMOA 3TWUA 3EDTB 4LSZE 5ITZF 5LFAA 4HI9A 2XEVA 5ENTD 4F3VA 2DZOA 3Q78A 1O1TA 4C48B 4B8CB 4CGWA 4GCNA 5AYWD 4N5CA 5H7PA 2R02A 1WG0A 3R7QA 3PZ4A 3LS8A 3J5PA 4J8YA 3E37A 3O48A 3ONLA 2C0LA 3HXCA 3PUJA 3OAWA 1H19A 4N3AA 4Y6CA 2ZISA 3PNTB 4YDOA 3TXNA 2GW1A 4GZ3A 4UQXA 2QYJA 2DIWA 4JW1A 1HH8A 4N5QA 4ANUA 5J90A 3TWQA 3UT7A 1NA3A 3AS8A 4HXIA 2WXPA 3FTUA 4I9EA 4UWFA 3OXLA 3S7DA 1O5MA 5CMWA 5C2YA 3DXKG 3JYSA 4FHJA 4EECA 1BI8B 4U95D 2RG8A 4P29A 2BUGA 2R2LA 3EIJA 1HE8A 4QQIA 1N0RA 1IQRA 3VLDA 1TN8A 2XCBA 2P9PG 1MX4A 2X3MA 2RD0A 4HLEA 4GTSA 3V2OA 5CHEE 4WUYA 2GRMA 3NOCD 2GRLA 3BG0B 3CSTA 4ABNA 4GAAA 2PZIA 4MBGA 3PREA 3V79K 2P9UG 5T8IA 3CVUA 4WAFA 5AQBA 4L7TA 2JLBA 2IOSA 3FTWA 4JEHA 5BV1A 2F8YA 1N4RA 2DBAA 5KJNA 1QBQA 2LAHA 4G1TA 4G25A 3LCAA 3AU5A 2NC9A 2ETAA 4V3IA 2L6BA 3FHEA 1TYQG 1IKND 2XRZA 2P9LG 5BXOA 4EPZA 2QYUA 1SZAA 2AXVA 4ACLA 4AOFA 4BSXA 4IN3B 1UW4B 3ZPJA 1KT1A 4HQDA 1IXVA 4L23A 2CHWA 3U66A 2NSZA 3L16A 3MGBA 5JJTA 3CVPA 5G05C 2BEDA 5E75A 3AG1E 3DSVA 4J6IA 3CHRA 2KATA 3Q15A 2RKKA 1XNFA 3FU3A 4DI4A 3ZRHA 5FQ4A 4UWKA 3V31A 2AJAA 5KNHD 5BT1A 4AY6A 2GGFA 1N4QA 1FVHA 4XE0A 3HVEB 2NYJA 4OAUC 3WG7E 1KPSB 4UI9C 2CFZA 3TGOA 4U0UA 4TUUA 4G26A 4C9BB 2EIME 4ME2A 3CVQA 4K5AB 2VGEA 4L1BA 4APFA 4O60A 4TUMA 3T9KA 3CHSA 4F1PA 3FUFA 2R5SA 3EU9A 4FULA 1S70B 3TG5A 4EZKA 4H7YA 2OV8A 3UM0A 3PE3A 3TWVA 3U3WA 1LD8A 4ZHBA 1O1SA 4PS8A 4JPSA 4W9RA 4NACA 2GROB 1N4PA 2DZNA 5G04J 5EN5D 3D9IA 2XPIA 3C98A 2HE0A 3IHVA 2KCLA 3DEPA 4UUCA 2IU1A 3I3NA 4GA2A 3Q79A 3APFA 3GW4A 1U2VG 3CHMA 4G23A 4U0SA 5ENNA 1KLXA 3V30A 3ASHA 4J8SA 3UM2A 2BTDA 2YHCA 3NZUA 2AXZA 2GRPB 5M72A 3ISMC 5EKQD 1DCEA 3ENEA 1OY3D 3Q73A 3UM1A 1UJKA 3T5XA 2CHXA 4JA7A 3NBNB 2AVPA 1TNBA 4A1SA 4N39A 3FU5A 3HG0D 4B94A 3MX3A 5JJ7A 4LUNU 3ZHEB 5HQ8A 5D2MC 4EZJA 4I43A 3CKCA 2V4HC 4MRUA 1TN7A 4NRHB 3QB2A 3MKQA 1YMPA 3KAEA 4AP2A 2X6HA 2XCCA 2QC9A 1SQMA 2IO3C 3Q9NC 3ZIMA 3S2AA 4GTVA 2XS8A 1HF8A 5CERB 5FQ7A 4TXPA 2WPVA 3RU0A 1SZ9A 2VGYA 3SGHA 1Q2ZA 1IHGA 1EF1C 4CCAA 4GA1A 1LTXA 3HXEA 3ZYQA 2LAIA 2DVWA 3OXGA 2IONA 3QARA 2ZIRA 2E2EA 3RAUA 4BT9A 4M3OA 3HVEA 4WNDA 1N95A 3UI2A 4XEIG 1VDYA 1OXJA 2KC7A 2WXOA 1SA5A 3PZDA 4BFRA 3MV3B 3VTXA 1Z3YA 3FULA 4ATGA 3Q49B 2VSXE 4BX8A 3QWWA 1JWFA 4GPKA 3AAAC 3TJPA 5LX8A 5CECB 3ZHEA 2HR2A 2ZXWE 3S7JA 1E90A 1OWNA 4HLLA 4AIFA 1E8YA 3FTZA 3S7FA 3FDHA 4N3BA 3JUEA 2EILE 3MJWA 4HBDA 4TXRA 3DSXA 1OCRE 1HX8A
chains in the Genus database with same CATH topology
4GCNA 5AYWD 3D3MA 1ZU2A 3IV0A 4FP7A 3MEKA 3HIZA 4N5CA 4A1GA 1E7VA 4JZYA 4GZ6A 2P58C 5FJYA 1PAQA 4WWPA 4KZ0A 2XGMA 3R7QA 2AXUA 1WAO1 4GZ5A 3L08A 1B89A 4PS7A 2FO7A 3LS8A 5KCMA 5T4YA 2VYIA 3O48A 4IRUA 3DBSA 1NA0A 4E85A 4RG9A 3ONLA 2C0LA 4A55A 3FUDA 3PUJA 4PDXA 3B7TA 3FH7A 3SI5A 2WQ6A 3QK0A 3OAWA 1H19A 4N3AA 1HU3A 3G2VA 4URKA 4I1MA 2VGXA 4FJZA 3PE4A 2WM9A 5DBKA 4CEMA 4Y6CA 5C1DA 2CFUA 3B7RL 3PNTB 2J4DA 4L2LA 1HFAA 4KT6B 3TXNA 1MQSA 4YVQC 2WQ7A 2GW1A 3O4ZA 4GZ3A 4UQXA 4C0MA 4N2SA 4Y6WA 2DIWA 2UY1A 4JEUA 4JW1A 1HH8A 5E76A 3FWVA 4ANUA 3D9MA 3ULQA 4ILHB 3ESLA 2KM4A 4FLBA 4F53A 5J90A 2MRIA 3UT7A 3PVLA 4J8EA 1NA3A 3OTNA 3AS8A 4HXIA 2WXPA 3FTUA 4I9EA 4UWFA 4B8AA 2FI7A 3OXLA 5BV0A 3N71A 5BUZA 1Z3XA 3VTYA 1HS6A 2L0IA 3S7DA 3TXMA 3L6AA 3LKUA 2CG3A 5CMWA 5C2YA 2I6HA 4RG6A 3LDZA 2V0PA 3ML9A 3B13A 1QNFA 3HDXA 3JQ0A 1E8ZA 5JHBA 4RSYA 3JYSA 4FHJA 3SBTB 4U0ZA 4DJAA 3MKQB 3IHYA 5A7DB 2A4ZA 4EECA 2QFCA 2IJGX 2OVBA 2RG8A 2BUGA 4P29A 2MHKA 1FCHA 3GZ1A 4UWGA 2CG2A 3QC1A 3FUJA 4NURA 5BPPA 3CHPA 3IEGA 3EIJA 1HE8A 4UQZA 1DVPA 3CK7A 4BT8A 4HOTA 5CMYA 3URZA 1IQRA 5JHAA 4OVUA 2MOWA 3ASDA 3VLDA 2XCBA 2WXHA 2VQ2A 2WVIA 5LP0A 2I9CA 4GYOA 3FTXA 5DIZA 1PY1A 2X3MA 2NXPA 4I6EA 3OXFA 5D0OD 1HZ4A 2RD0A 4GU5A 4CDRA 4HLEA 2IF4A 1L5JA 5AJLA 2YHEA 1U3DA 2XQ0A 3GYZA 1BPOA 1HG2A 1H2TC 5CHEE 5T3RA 3RRNB 4G2VA 4WUYA 2FBNA 1KT0A 3MA5A 2GRMA 3RRMB 1PC2A 3LYAA 1TEZA 3B7SA 5ANRA 1ELWA 2GRLA 3BG0B 3CVNA 3CSTA 4ABNA 4B89A 4GAAA 2PZIA 3Q4AB 5ARFA 3WXXA 3CSFA 3K9IA 3PREA 4PH4B 3LXUX 4HOQA 5LOZA 2WQHA 4DK5A 5T8IA 3CVUA 4WAFA 2VSYA 3B7UX 4AJWA 3FP3A 4L7TA 3G2SA 4TV3A 2JLBA 2IOSA 1OWPA 3FTWA 3Q47B 4BTBA 1WM5A 4JEHA 5BV1A 2PQRA 2DBAA 5KJNA 4AY5A 4XI0A 1UN8A 3ASFA 4BY6A 3PRZA 3P2BA 2LAHA 4G1TA 2XRYA 3LCAA 4G25A 1OWMA 4I6JA 1MHQA 3KD7A 4FADA 3AU5A 2C0MA 2NC9A 5KJMA 4V3IA 3CQGB 5EX0A 4A3TA 4LERA 2X6FA 3FHEA 2KZTA 4DLQA 4I2WA 2LSVA 1OUVA 4HOUA 1W3BA 4NQ0A 2XRZA 1QQEA 3DPDA 2PM6A 2XHEA 4EPZA 4I17A 4FHKA 1SZAA 3ZEFA 3RIBA 2AXVA 4ACLA 4AOFA 1N54A 4BSXA 2L6JA 3TAXA 3SZ7A 4FU3A 4UI9K 1IYGA 3D9JA 4IN3B 3ZXSA 1UW4B 3CLJA 5LCWJ 1Z6TA 1JUQA 3NF1A 3ZPJA 1KT1A 3D9NA 3MKRA 2IOLA 4LCTA 4GZDA 4I6GA 1H6KA 1UJJA 4L23A 2CHWA 3U66A 2NSZA 3L16A 3MGBA 4ILIA 5J08A 3CVPA 5D0QD 5JJTA 5G05C 1DNPA 5E75A 2JEKA 2WXGA 3ONKA 2J07A 3UX4A 3CKBA 2V8SE 2L0TB 5FZRA 3Q5MA 5ANLA 4J6IA 3GZ2A 3CHRA 4QFVA 2KATA 3Q15A 3ZVVA 3QWPA 2QY7A 3SNXA 1XNFA 3FU3A 4DI4A 1E8XA 4OYSA 2VSNA 5HI7A 3CV0A 3ZRHA 4RVBA 5FQ4A 3E4BA 4APOA 2UWJG 4KVOA 4UWKA 3FUNA 3FEYA 3QDNA 5AENA 5BT1A 1IQUA 3RK6A 4AY6A 3CK9A 2GGFA 3SBSA 3CIAA 1FVHA 1EYHA 2BF0X 2OVFA 4UWHA 3LY8A 3SF4A 4XE0A 3HVEB 3AS4A 3FTVA 3CVVA 2ILRA 3CVXA 4UI9C 2CFZA 3ASGA 3PDNA 3RO2A 3TGOA 4KZCA 2HYZA 4U0UA 4TUUA 3QWVA 5BNWA 4G26A 4CT0A 2LNIA 4C9BB 5EX3A 4ME2A 3CVQA 4L1BA 2Y3AA 2HO1A 4IULA 4APFA 4L2YA 4HFGA 3FU6A 3AS5A 3EHMA 4ANVA 4I1OB 1NZNA 3U9WA 2FF4A 3CHSA 4R7LA 5G2NA 3FUFA 2R5SA 3G2TA 4FULA 3JQ1A 2ONDA 4G11A 3TG5A 3MCXA 4EZKA 4H7YA 3MYVA 2OV8A 3FUEA 3PE3A 3U3WA 2I1JA 4GMLA 4O6FA 3ZW3A 5AJDA 2WB2A 3RO3A 4YVOA 3TL5A 3TG4A 2VTBA 3FU0A 3GZSA 4PS8A 3RJVA 3VLFA 4JPSA 4CDNA 2OOEA 4W9RA 4NACA 2VSOE 3FH5A 3LPZA 4PS3A 1UN9A 2WMOA 1TJCA 3CGHA 4BX9A 4UQYA 4EBAA 3MZLB 5FWQA 1UG3A 5G04J 3LVRE 2R17C 2E0IA 2J9QA 3D9IA 1E7UA 4HVBA 3KS2A 2XPIA 3C98A 3FUMA 4U63A 3IHVA 2KCLA 3L13A 4J8DA 2IU1A 2WXNA 5CCMA 5JJ6A 3I3NA 4BWRA 3ML8A 2Y4UA 4AV7A 2I2OA 4GA2A 1ELKA 2AWIA 1JWGA 3I4GA 5A6CA 2J49A 4GYYA 1GW6A 3APFA 4JHJA 3UUXA 3I4RB 3CHQA 3GW4A 4U0SA 3CHMA 3G2WA 4G23A 4PUCA 5ENNA 1KLXA 3SD5A 3ASHA 1YA0A 3ZN3A 3MV2B 4ANWA 2LSUA 3PEVB 3CVYA 4WNEA 2A5UA 1ZBPA 4XZ4A 4J8SA 4XKBA 2BTDA 3UPVA 2YHCA 3NZUA 4WWNA 5G05J 1XGWA 4I9CA 2WMNA 2EQXA 2AXZA 4UWLA 4HOSA 3UT8A 3FUHA 4GZCA 3QJZA 5M72A 4N3CA 1WY6A 2VGXB 5EKQD 4KYOB 4IYPA 1FVFA 4HS2A 3ENEA 4F1SA 3FH8A 1NP7A 3U64A 2CHZA 4KXKB 2IQCA 2LO6A 4GB9A 3L17A 3PUKA 3EJNA 1JPLA 2J4BA 1UJKA 3CQCB 5G55A 3ZYMA 3T5XA 5EDSA 2CHXA 4HORA 2WXJA 2Y4TA 4JA7A 4B0ZA 3QAQA 3SFZA 5KJLA 4U04A 2AVPA 4JA9A 2KCKA 4A1SA 4YNDA 3FTSA 4JHKA 4N39A 3FU5A 3U4TA 1S0PA 3APCA 3QKYA 4F7AA 1H0AA 3PNLB 1EPUA 3CHOA 3R9AB 1E8WA 1Y8MA 4J0UA 4B94A 4FC8A 3MX3A 3EIQC 1LF8A 2C2LA 3BG1B 2FULA 2VJ8A 2DCPA 4ANXA 2AW6A 1TJFA 2J09A 3NQPA 3CK8A 4U8HA 5JJ7A 4LUNU 4XIFA 3CR3A 2WXRA 3ZHEB 2X6IA 5HQ8A 4I2ZA 3APDA 4MKTA 4D10C 4FA6A 4EZJA 4AEZC 4I43A 2YQ8A 2M63A 4H7XA 3T5VA 3CKCA 4K03A 4LEUA 2WXFA 1X5BA 1QZ2A 2KZTB 3L54A 5FT9A 5FZQA 2XGSA 4MRUA 3P1UA 5AIJA 2YNQA 5FTPA 4NRHB 4FLHA 3FTYA 4CDMA 2V5FA 1INZA 3QB2A 3MKQA 3JUIA 3KAEA 3UMVA 4AP2A 4CRWA 3NZSA 2X6HA 3EHNA 2V4LA 2XCCA 3CVLA 1SQMA 3ZYLA 3ZGQA 4LRZA 3ZIMA 1ELRA 1OWLA 3S2AA 4I1AA 4Q94A 4OVVA 3IKOB 5FQ8A 1HF8A 2WXKA 5FQ7A 2PQNA 5CCLA 3D9OA 3D9PA 4XX5A 3LEWA 2WPVA 3RU0A 1H2VC 1SZ9A 3HYMB 4JXTA 4AM9A 3IBEA 5LCWC 2VGYA 3D9LA 3SGHA 3T8MA 1OWOA 1IHGA 4ACKA 1EF1C 4FJYA 1EDUA 4CCAA 4GA1A 4C0EA 3ESKA 3PEUB 2WXQA 4A3VA 3L22A 2J08A 3ZYQA 2X38A 1P5QA 2LAIA 2R59A 3LY9A 4CT4A 4DPRA 5FZSA 1H2UA 3S7BA 3UT4A 2WXLA 3OXGA 2FEZA 5BW8C 2IONA 5FQ6A 3QARA 3FEXA 3HHMA 3PH0C 1U3CA 2E2EA 3LVQE 5KJKA 4GA0A 4BT9A 4M3OA 4WNGA 3RKVA 3HVEA 4EZLA 4WNDA 3FUIA 2IFUA 2WXMA 4J8FA 4DI3A 1A17A 1HO8A 4MLPA 4U07A 3CEQA 5A23A 3FUKA 2I1KA 1VDYA 2KC7A 2XGOA 2WXIA 3ZFWA 3PS6A 4WNFA 2WXOA 3R7RA 2X6JA 2L9BA 3SHFA 1HG5A 3PZDA 4BFRA 2PL2A 1E96B 2YINA 2UY1B 4AXHA 3MV3B 3VTXA 3ZYKA 4EQFA 1HXIA 4G24A 1Z3YA 4MS6A 3FULA 4UI9J 4CGVA 4Q69A 3QNKA 4KVMA 3KEZA 2X6KA 4KBQA 4ATGA 3Q49B 3UQ3A 4E6HA 3CVWA 3RRUA 4XI9A 3D9KA 2VSXE 4BX8A 4JL0A 4TRQA 1Y6IA 4GMJA 3QWWA 4EBAG 4K0RA 3I5PA 1JWFA 4AVXA 4GPKA 5ARGA 3LY7A 4BTAA 2VTBB 4KMOA 3TJPA 5LX8A 3ZHEA 2HR2A 3EDTB 4ILGA 4Q96A 3LJ3A 3S7JA 4JHRA 5LFAA 1E90A 1OWNA 2Q7FA 4AIFA 4DLOA 3QOUA 2HM8A 4XKCA 2XEVA 3BEEA 1E8YA 1N52A 2KCVA 3FTZA 3S7FA 4N2QA 2ZU6B 3FDHA 3FY4A 4GCOA 4N3BA 4F3VA 4JVSA 2PM7A 3VLEA 3MJWA 4JC8A 5G04C 3FFLA 3AU4A 2XPYA 4B8CB 4CGWA 1HX8A 3JCKC 4GYWA 2XPZA 3G2UA 4WWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCN A;  4NRH B;  5AYW D;  3FP3 A;  1ZU2 A;  4O6F A;  3U3W A;  2JLB A;  2V5F A;  3MEK A;  3KAE A;  4N5C A;  3Q47 B;  3RO3 A;  4YVO A;  4BTB A;  1WM5 A;  3TG4 A;  2XCC A;  2PQR A;  3CVL A;  4GZ6 A;  3RJV A;  2DBA A;  2P58 C;  5FJY A;  4AY5 A;  4XI0 A;  5KJN A;  3ASF A;  2OOE A;  2XGM A;  4W9R A;  3ZGQ A;  1WAO 1;  3LPZ A;  4GZ5 A;  1B89 A;  1ELR A;  2FO7 A;  1TJC A;  4I1A A;  4G1T A;  4G25 A;  3LCA A;  2VYI A;  3O48 A;  3KD7 A;  1NA0 A;  4UQY A;  2PQN A;  5CCL A;  4RG9 A;  5G04 J;  2C0L A;  2C0M A;  2NC9 A;  2WPV A;  5KJM A;  2J9Q A;  3RU0 A;  4AM9 A;  5LCW C;  3HYM B;  5EX0 A;  3KS2 A;  2VGY A;  2XPI A;  4N3A A;  5EX3 A;  2VGX A;  2KCL A;  3PE4 A;  4J8D A;  2LSV A;  1IHG A;  1OUV A;  4HOU A;  4I2W A;  5JJ6 A;  4BWR A;  5DBK A;  5C1D A;  1W3B A;  2Y4U A;  4Y6C A;  4GA2 A;  4NQ0 A;  4GA1 A;  1QQE A;  5CCM A;  3ESK A;  4YVQ C;  5A6C A;  5HQ8 A;  2GW1 A;  4GZ3 A;  4GYY A;  4UQX A;  1P5Q A;  4N2S A;  3LY9 A;  4Y6W A;  2UY1 A;  4I17 A;  1HH8 A;  5FZS A;  3FWV A;  3UUX A;  3RIB A;  3S7B A;  3ULQ A;  3OXG A;  5JJ7 A;  2FEZ A;  3GW4 A;  3S7F A;  4U0S A;  5BW8 C;  2L6J A;  4G23 A;  3TAX A;  3SZ7 A;  4UI9 K;  4J8E A;  1NA3 A;  1KLX A;  3ASH A;  3AS8 A;  1IYG A;  1YA0 A;  3ZN3 A;  4I9E A;  3MV2 B;  2E2E A;  4IN3 B;  2FI7 A;  5LCW J;  2LSU A;  3NF1 A;  3OXL A;  4WNE A;  3ZPJ A;  1KT1 A;  1ZBP A;  3N71 A;  5KJK A;  3MKR A;  4GA0 A;  4BT9 A;  3UPV A;  2YHC A;  5G05 J;  4I9C A;  4WNG A;  3RKV A;  3VTY A;  5JJT A;  3CVP A;  4WND A;  2IFU A;  4J8F A;  5D0Q D;  5G05 C;  1A17 A;  3S7D A;  3LKU A;  4U07 A;  3CEQ A;  4HOS A;  2I6H A;  3CKB A;  4RG6 A;  2KC7 A;  2XGO A;  4N3C A;  2VGX B;  3Q5M A;  5EKQ D;  4KYO B;  5FZR A;  3ZFW A;  5M72 A;  4WNF A;  3JYS A;  3GZ2 A;  2KAT A;  3Q15 A;  4U0Z A;  5A7D B;  3QWP A;  2PL2 A;  4KXK B;  2QFC A;  1XNF A;  2BUG A;  1E96 B;  1FCH A;  2MHK A;  3GZ1 A;  2UY1 B;  2VSN A;  5HI7 A;  3CV0 A;  3MV3 B;  3VTX A;  4HOR A;  4N2Q A;  4EQF A;  2Y4T A;  1HXI A;  3E4B A;  2UWJ G;  3IEG A;  4G24 A;  4JA7 A;  4APO A;  3QDN A;  4CGV A;  4UQZ A;  5BT1 A;  4UI9 J;  4AY6 A;  3CK9 A;  3CK7 A;  4U04 A;  4BT8 A;  5KJL A;  4HOT A;  3URZ A;  4KBQ A;  2AVP A;  3Q49 B;  3UQ3 A;  4JA9 A;  2KCK A;  4CDR A;  4XI9 A;  3ASD A;  3LY8 A;  3SF4 A;  4YND A;  2XCB A;  4A1S A;  4JL0 A;  4N39 A;  2VQ2 A;  3AS4 A;  3QWW A;  3U4T A;  4WUY A;  3QKY A;  4GPK A;  4GYO A;  5DIZ A;  5ARG A;  3LY7 A;  3R9A B;  4BTA A;  1Y8M A;  3OXF A;  4J0U A;  1HZ4 A;  4UI9 C;  5D0O D;  3ASG A;  3ZHE A;  2HR2 A;  3EDT B;  2IF4 A;  3PDN A;  3RO2 A;  4B94 A;  3TGO A;  2C2L A;  3S7J A;  2HYZ A;  4JHR A;  4U0U A;  3GYZ A;  3QWV A;  2Q7F A;  4AIF A;  5BNW A;  3QOU A;  5CHE E;  4G26 A;  2LNI A;  2XEV A;  3BEE A;  3CK8 A;  4G2V A;  3CVQ A;  2FBN A;  1KT0 A;  2KCV A;  3MA5 A;  4ME2 A;  1PC2 A;  2HO1 A;  3LYA A;  4GCO A;  4N3B A;  4XIF A;  3ZHE B;  1ELW A;  4I2Z A;  3AS5 A;  4F3V A;  3CVN A;  4ABN A;  2YQ8 A;  5G04 C;  1NZN A;  4H7X A;  2PZI A;  2FF4 A;  3CKC A;  3FFL A;  3Q4A B;  4LEU A;  5ARF A;  3K9I A;  3WXX A;  1QZ2 A;  2R5S A;  4HOQ A;  4CGW A;  2OND A;  5FT9 A;  5FZQ A;  2XGS A;  3TG5 A;  4GYW A;  2WQH A;  4H7Y A;  5FTP A;  3PE3 A;  2VSY A; 
#chains in the Genus database with same CATH topology
 5CED B;  1ZU2 A;  4BES A;  3MEK A;  4A1G A;  2IO2 C;  4JZY A;  3AG3 E;  1PAQ A;  2XGM A;  2AXU A;  4GZ5 A;  3L08 A;  1B89 A;  4PS7 A;  2FO7 A;  1N9A A;  3C3Q A;  1BLX B;  3FH7 A;  2WQ6 A;  3ASN E;  4URK A;  3G2V A;  4I1M A;  5C1D A;  2XZT G;  1MQS A;  2XEH A;  4YVQ C;  5E76 A;  3D9M A;  4ILH B;  2MRI A;  4J8E A;  4B8A A;  5BV0 A;  1X81 A;  5BUZ A;  4DX6 D;  3TXM A;  2CG3 A;  3LDZ A;  2V0P A;  3ML9 A;  3B13 A;  1QNF A;  4RSY A;  3SBT B;  4DJA A;  3IHY A;  5A7D B;  2OVB A;  3SY2 A;  1FCH A;  3E32 A;  3QC1 A;  2LUH A;  5JHA A;  4RLY A;  2WXH A;  4BET A;  2I9C A;  1FT2 A;  5DIZ A;  2IF4 A;  3E34 A;  1L5J A;  5AJL A;  4CZ2 D;  2YHE A;  1U3D A;  4K5B A;  3GYZ A;  1BPO A;  1HG2 A;  5T3R A;  1KT0 A;  4BSZ B;  2J8S D;  1PC2 A;  3B7S A;  5ARF A;  3K9I A;  1N94 A;  5LOZ A;  4DRX E;  1N0Q A;  2BKG A;  1K1A A;  3FP3 A;  1AP7 A;  3Q47 B;  4BTB A;  1WM5 A;  2Y0B G;  1UN8 A;  4GTM A;  4LG6 A;  2R03 A;  2XRY A;  1OWM A;  4I6J A;  3KD7 A;  1WDY A;  5KJM A;  3CQG B;  5EX0 A;  4LER A;  2KZT A;  3LJN A;  4I2W A;  4HOU A;  1QQE A;  3DPD A;  4G8K A;  3RIB A;  3TAX A;  4FU3 A;  4UI9 K;  5IY5 E;  3DSU A;  5CBO A;  5LCW J;  1Z6T A;  1JUQ A;  3NF1 A;  3W9F A;  3SQV A;  3ZU7 B;  4I6G A;  1V54 E;  1QYM A;  1BU9 A;  2L0T B;  3Q5M A;  1S63 A;  4QFV A;  2QY7 A;  1E8X A;  2EIK E;  4RVB A;  3E4B A;  2UWJ G;  5EID A;  3FUN A;  3FEY A;  3QDN A;  3CK9 A;  3ZXP A;  3SBS A;  2BF0 X;  2OVF A;  4UWH A;  4LNU D;  1OCC E;  3CVV A;  2ILR A;  3CVX A;  2F8X K;  1TNU A;  4HNA D;  3ASG A;  2P9S G;  1TNY A;  2H6F A;  4CT0 A;  5EX3 A;  5AQ9 A;  3FU6 A;  3AS5 A;  3EHM A;  4I1O B;  2FF4 A;  4R7L A;  3JQ1 A;  3MYV A;  5ENR D;  3ZW3 A;  1IHB A;  3TG4 A;  3TWR A;  1D8E A;  2VSO E;  3UKU G;  3LPZ A;  3L82 A;  5BXU A;  4EBA A;  2J9Q A;  2Y1L E;  3KS2 A;  3FUM A;  4U63 A;  5CCM A;  5JJ6 A;  3KSL A;  3I4G A;  3E30 A;  5EYP F;  5EIB E;  1GW6 A;  4JHJ A;  1BD8 A;  4PUC A;  3DEO A;  3SD5 A;  1YA0 A;  4U8V D;  2LSU A;  3CVY A;  2A5U A;  2ETC A;  1SW6 A;  4XKB A;  4WWN A;  5G05 J;  2VGX B;  4KYO B;  1FVF A;  4HS2 A;  3FH8 A;  4KXK B;  2IQC A;  4GB9 A;  3L17 A;  3CQC B;  2Y4T A;  3DST A;  2XZD G;  4U04 A;  4CYM D;  4RQI A;  2KCK A;  3Q75 A;  4JHK A;  1FT1 A;  4F7A A;  1N11 A;  3PNL B;  1E8W A;  4J0U A;  1FPP A;  4FC8 A;  3BG1 B;  2DCP A;  1TJF A;  1SVX A;  3CK8 A;  4XIF A;  5ENQ D;  4AEZ C;  3T5V A;  4ZFH A;  4YDE A;  4K03 A;  4LEU A;  1YCS B;  5JMN D;  2KZT B;  1BI7 B;  3L54 A;  2XGS A;  1RZ4 A;  3D9H A;  3EHN A;  5AQ7 A;  3ZYL A;  2KXP C;  3ZGQ A;  4LRZ A;  1ELR A;  4OVV A;  2PQN A;  3D9O A;  3D9P A;  5LCW C;  3UM3 A;  3L22 A;  2J08 A;  2X38 A;  1P5Q A;  1TNO A;  3S7B A;  2WXL A;  5BW8 C;  5FQ6 A;  5KWD A;  3Q7A A;  3V2X A;  4ATZ D;  3LVQ E;  5KJK A;  4GA0 A;  3ZNG A;  3RKV A;  4EZL A;  2IFU A;  4DI3 A;  1A17 A;  1HO8 A;  4U07 A;  3CEQ A;  3FUK A;  3NB2 A;  4WNF A;  1E96 B;  2UY1 B;  2ZGD A;  3ZYK A;  3IXE A;  4CGV A;  4MS6 A;  3QNK A;  4KBQ A;  3CVW A;  3RRU A;  3TWS A;  2F37 A;  4K0R A;  3L9T A;  2Y69 E;  4BTA A;  2MYO A;  5D66 A;  4O1P A;  4ILG A;  3LJ3 A;  4JHR A;  4DLO A;  3C3R A;  1N52 A;  2KCV A;  4GCO A;  4JVS A;  1RW2 A;  3VLE A;  1UOH A;  4NIK A;  3FFL A;  3AU4 A;  3NAW A;  2XPY A;  4GYW A;  3D3M A;  3IV0 A;  4FP7 A;  1K1B A;  3HIZ A;  1E7V A;  3UXG A;  1MZC A;  4GZ6 A;  4WWP A;  5T4Y A;  2VYI A;  3ABL E;  4IRU A;  3DBS A;  1NA0 A;  4E85 A;  4RG9 A;  4L9P A;  2IY0 C;  4PDX A;  3B7T A;  3QK0 A;  3RSE G;  1HU3 A;  2VGX A;  2WM9 A;  2DYS E;  5DBK A;  4CEM A;  3B95 A;  4KT6 B;  3O4Z A;  4C0M A;  4N2S A;  4Y6W A;  1TR4 A;  4JEU A;  3FWV A;  3ULQ A;  3ESL A;  4FLB A;  4F53 A;  3SO8 A;  2FI7 A;  1D8D A;  3N71 A;  3NOG D;  4RG6 A;  3B7B A;  3HDX A;  1E8Z A;  1MX6 A;  4U0Z A;  3MKQ B;  2QFC A;  4UWG A;  2MHK A;  5EYL A;  3GZ1 A;  2CG2 A;  2OEW A;  4GTR A;  3FUJ A;  5CRU A;  4NUR A;  5BPP A;  3CHP A;  2ZGG A;  4UQZ A;  1DVP A;  4BT8 A;  2GRQ B;  4HOT A;  5CMY A;  3URZ A;  4YDY A;  4OVU A;  2MOW A;  3ASD A;  3DWL G;  2VQ2 A;  3PZ1 A;  3HRA A;  1MJ0 A;  4GYO A;  3FTX A;  5D0O D;  1HZ4 A;  3ULE G;  3Q7F A;  5ENS D;  4J7W A;  1TEZ A;  3LYA A;  1ELW A;  3Q4A B;  3EU5 A;  4HOQ A;  4Z68 A;  4DK5 A;  4EHM A;  4U7E B;  2VSY A;  3B7U X;  3G2S A;  4AY5 A;  3ASF A;  3ASO E;  4DUI A;  1MHQ A;  2XEE A;  4FAD A;  2C0M A;  3F6Q A;  2P9N G;  4HRN A;  4LNB A;  3BU8 A;  4A3T A;  1SA4 A;  2X6F A;  2LSV A;  1KZO A;  4NQ0 A;  1MX2 A;  2XHE A;  1NL4 A;  3ZEF A;  2GRN B;  1N54 A;  2L6J A;  1IYG A;  3D9J A;  3ZXS A;  3CLJ A;  2KBX A;  3MKR A;  4LCT A;  1UJJ A;  4ILI A;  1OCO E;  5D0Q D;  3KSQ A;  2JEK A;  2WXG A;  2J07 A;  3UX4 A;  5AAO A;  5ANL A;  5AAR A;  3SNX A;  4OYS A;  2VSN A;  4APO A;  5AEN A;  2XEN A;  1IQU A;  3CIA A;  2IEJ A;  3LY8 A;  3SF4 A;  3AS4 A;  2QZA A;  3PDN A;  3RO2 A;  5KNG A;  1JCQ A;  2LNI A;  2Y3A A;  4IUL A;  4HFG A;  5FIN A;  3HXB A;  3AJI A;  4G11 A;  3MCX A;  3R9M A;  3UIP C;  2WB2 A;  3RO3 A;  4YVO A;  2VTB A;  1V55 E;  3FU0 A;  3GZS A;  3UTM A;  3RJV A;  4CDN A;  3FH5 A;  4GMR A;  2WMO A;  4BX9 A;  4UQY A;  3MZL B;  5FWQ A;  5CRV A;  3LVR E;  2R17 C;  3X2Q E;  3C3O A;  4HVB A;  4J8D A;  2WXN A;  2I2O A;  1ELK A;  1JWG A;  2DYR E;  5A6C A;  3UUX A;  3I4R B;  2OEV A;  3CHQ A;  3G2W A;  3C72 A;  3PEV B;  4WNE A;  5AN8 A;  3UPV A;  2WMN A;  2EQX A;  3UT8 A;  3FUH A;  3J5Q B;  4GZC A;  3QJZ A;  4N3C A;  1NP7 A;  3PUK A;  3JXI A;  1DCQ A;  1JPL A;  5G55 A;  2WXJ A;  4B0Z A;  3QAQ A;  3SFZ A;  4JA9 A;  2GRR B;  4YND A;  3FTS A;  1S0P A;  3APC A;  1H0A A;  3R9A B;  1EPU A;  3SFY A;  2LXL A;  3EIQ C;  2FUL A;  2VJ8 A;  4ANX A;  1H6P A;  2J09 A;  4U8H A;  2P9K G;  5FIO A;  2WXR A;  2X6I A;  4MKT A;  3APD A;  4D10 C;  2YQ8 A;  2M63 A;  4H7X A;  4BEP A;  2H6I A;  2WXF A;  5FT9 A;  5FZQ A;  2YNQ A;  2OCC E;  4FLH A;  3FTY A;  1INZ A;  4YDW A;  3JUI A;  4CRW A;  1N4S A;  3CVL A;  2RFM A;  1OWL A;  4DX5 D;  3IKO B;  1A5E A;  2WXK A;  5CCL A;  4XX5 A;  1H2V C;  4AM9 A;  3HYM B;  4JXT A;  3ULY A;  3BQO A;  3KEA A;  4ACK A;  3ESK A;  3PEU B;  2WXQ A;  4A3V A;  2R59 A;  4CT4 A;  5FZS A;  1H2U A;  2FEZ A;  5HKP A;  3HHM A;  1U3C A;  2PNN A;  5ENO D;  3BUA A;  4WNG A;  4GTQ A;  3W9G A;  4J8F A;  5A23 A;  2I1K A;  3ZFW A;  2P2C P;  3PS6 A;  3ABM E;  1KZP A;  3TWX A;  2YIN A;  3TWT A;  2F0Y A;  4JD2 G;  4K5C A;  4UI9 J;  4Q69 A;  4E6H A;  3D9K A;  2ETB A;  4AVX A;  5ARG A;  2VTB B;  5CBN A;  1MYO A;  4Q96 A;  2Q7F A;  3QOU A;  2HM8 A;  4XKC A;  3BEE A;  4N2Q A;  2ZU6 B;  3FY4 A;  2PM7 A;  4JC8 A;  5G04 C;  5B1A E;  3JCK C;  4BER A;  2XPZ A;  3G2U A;  4WWO A;  3JXJ A;  2RFA A;  1K3Z D;  2P58 C;  5FJY A;  4KZ0 A;  1WAO 1;  1OCZ E;  5KCM A;  4A55 A;  3FUD A;  3SI5 A;  4FJZ A;  3PE4 A;  4M7C A;  2CFU A;  4GPM A;  3B7R L;  2J4D A;  4L2L A;  1HFA A;  4DX2 A;  2WQ7 A;  2UY1 A;  2KM4 A;  3PVL A;  3OTN A;  1NI1 A;  5B3S E;  1JCR A;  1Z3X A;  3VTY A;  1HS6 A;  2L0I A;  3L6A A;  3LKU A;  2I6H A;  3JQ0 A;  5JHB A;  3DPY A;  2A4Z A;  2IJG X;  4GTT A;  4F6R D;  3IEG A;  3CK7 A;  2LXM A;  2BKK B;  2WVI A;  5LP0 A;  4GTP A;  1PY1 A;  4OAV B;  2NXP A;  4I6E A;  3OXF A;  4GU5 A;  4CDR A;  2XQ0 A;  2B6C A;  3T8K A;  1H2T C;  2FO1 E;  3RRN B;  4G2V A;  2FBN A;  3RRM B;  3MA5 A;  5ANR A;  3CVN A;  4B89 A;  4HB5 A;  3WXX A;  3CSF A;  4PH4 B;  3LXU X;  1TN6 A;  2WQH A;  4AJW A;  4TV3 A;  1AWC B;  1OWP A;  2PQR A;  4XI0 A;  4BY6 A;  3PRZ A;  3P2B A;  4B93 B;  2JAB A;  3SFX A;  1TNZ A;  3ZUV B;  1S64 A;  5EIL A;  1LD7 A;  4DLQ A;  4HI8 A;  1OUV A;  1W3B A;  1K8K G;  4U96 D;  3EHQ A;  2PM6 A;  4I17 A;  4FHK A;  3SZ7 A;  3E33 A;  5HRY A;  3D9N A;  2IOL A;  4GZD A;  1H6K A;  5J08 A;  5JA4 D;  1DNP A;  3ONK A;  3CKB A;  2V8S E;  5FZR A;  1JCS A;  4A63 B;  3GZ2 A;  3ZVV A;  3QWP A;  2DWZ A;  5HI7 A;  3CV0 A;  1G3N B;  3HXF A;  2P9I G;  4KVO A;  3RK6 A;  1DC2 A;  1EYH A;  3EUV A;  4DX7 D;  3FTV A;  4HRL A;  4KZC A;  2HYZ A;  3QWV A;  3PZ3 A;  5BNW A;  5HS0 A;  1Z5S C;  2HO1 A;  4L2Y A;  2H6H A;  4ANV A;  1NZN A;  3U9W A;  5G2N A;  3G2T A;  4TXQ A;  2OND A;  3FUE A;  2I1J A;  4GML A;  4O6F A;  4LNG A;  5AJD A;  3TL5 A;  5KBA A;  3VLF A;  2OOE A;  5AQA A;  4PS3 A;  1UN9 A;  3DSS A;  3EHR A;  1TJC A;  3CGH A;  3DRA A;  3UKR G;  1UG3 A;  2E0I A;  1E7U A;  4O1O A;  3L13 A;  4BWR A;  3ML8 A;  2Y4U A;  4AV7 A;  1ZB1 A;  5B1B E;  2AWI A;  2J49 A;  4GYY A;  2V5Q C;  3UIN C;  3ZKJ A;  3ZN3 A;  3MV2 B;  4ANW A;  4HRM B;  1ZBP A;  4XZ4 A;  4GTO A;  3DXM G;  4U8Y D;  1XGW A;  4I9C A;  1H6O A;  3PZ2 A;  1OT8 A;  4UWL A;  4HOS A;  1WY6 A;  4IYP A;  4F1S A;  3U64 A;  2CHZ A;  2LO6 A;  3EJN A;  2J4B A;  3ZYM A;  5EDS A;  4HOR A;  1D9S A;  5KJL A;  3U4T A;  3QKY A;  3AG4 E;  4G8L A;  3CHO A;  1Y8M A;  1LF8 A;  2C2L A;  2AW6 A;  3NQP A;  3CR3 A;  4I2Z A;  4FA6 A;  2H6G A;  1X5B A;  1QZ2 A;  1YYH A;  3P1U A;  5AIJ A;  5FTP A;  2XS1 A;  4CDM A;  2V5F A;  3UMV A;  3NZS A;  2V4L A;  2R05 A;  4I1A A;  4Q94 A;  5FQ8 A;  3Q9U C;  3UIO C;  3LEW A;  3IBE A;  3D9L A;  3T8M A;  1OWO A;  3TWW A;  4FJY A;  1EDU A;  2B0O E;  3HXD A;  4X8Q A;  4C0E A;  1NFI E;  3LY9 A;  4DPR A;  3UT4 A;  3FEX A;  4DX1 A;  3AG2 E;  3PH0 C;  3DSW A;  3FUI A;  2WXM A;  4MLP A;  2XGO A;  2WXI A;  5ENP D;  3R7R A;  2X6J A;  2L9B A;  3SHF A;  1HG5 A;  2PL2 A;  2EIN E;  4AXH A;  5CEA A;  4EQF A;  1HXI A;  4G24 A;  2A5E A;  4KVM A;  3C5R A;  3KEZ A;  2X6K A;  1O1R A;  2EIJ E;  3UQ3 A;  4XI9 A;  4JL0 A;  3ABK E;  4TRQ A;  1Y6I A;  4GMJ A;  4EBA G;  3I5P A;  4JB8 P;  3LY7 A;  4KMO A;  3TWU A;  3EDT B;  4LSZ E;  5ITZ F;  5LFA A;  4HI9 A;  2XEV A;  5ENT D;  4F3V A;  2DZO A;  3Q78 A;  1O1T A;  4C48 B;  4B8C B;  4CGW A;  4GCN A;  5AYW D;  4N5C A;  5H7P A;  2R02 A;  1WG0 A;  3R7Q A;  3PZ4 A;  3LS8 A;  3J5P A;  4J8Y A;  3E37 A;  3O48 A;  3ONL A;  2C0L A;  3HXC A;  3PUJ A;  3OAW A;  1H19 A;  4N3A A;  4Y6C A;  2ZIS A;  3PNT B;  4YDO A;  3TXN A;  2GW1 A;  4GZ3 A;  4UQX A;  2QYJ A;  2DIW A;  4JW1 A;  1HH8 A;  4N5Q A;  4ANU A;  5J90 A;  3TWQ A;  3UT7 A;  1NA3 A;  3AS8 A;  4HXI A;  2WXP A;  3FTU A;  4I9E A;  4UWF A;  3OXL A;  3S7D A;  1O5M A;  5CMW A;  5C2Y A;  3DXK G;  3JYS A;  4FHJ A;  4EEC A;  1BI8 B;  4U95 D;  2RG8 A;  4P29 A;  2BUG A;  2R2L A;  3EIJ A;  1HE8 A;  4QQI A;  1N0R A;  1IQR A;  3VLD A;  1TN8 A;  2XCB A;  2P9P G;  1MX4 A;  2X3M A;  2RD0 A;  4HLE A;  4GTS A;  3V2O A;  5CHE E;  4WUY A;  2GRM A;  3NOC D;  2GRL A;  3BG0 B;  3CST A;  4ABN A;  4GAA A;  2PZI A;  4MBG A;  3PRE A;  3V79 K;  2P9U G;  5T8I A;  3CVU A;  4WAF A;  5AQB A;  4L7T A;  2JLB A;  2IOS A;  3FTW A;  4JEH A;  5BV1 A;  2F8Y A;  1N4R A;  2DBA A;  5KJN A;  1QBQ A;  2LAH A;  4G1T A;  4G25 A;  3LCA A;  3AU5 A;  2NC9 A;  2ETA A;  4V3I A;  2L6B A;  3FHE A;  1TYQ G;  1IKN D;  2XRZ A;  2P9L G;  5BXO A;  4EPZ A;  2QYU A;  1SZA A;  2AXV A;  4ACL A;  4AOF A;  4BSX A;  4IN3 B;  1UW4 B;  3ZPJ A;  1KT1 A;  4HQD A;  1IXV A;  4L23 A;  2CHW A;  3U66 A;  2NSZ A;  3L16 A;  3MGB A;  5JJT A;  3CVP A;  5G05 C;  2BED A;  5E75 A;  3AG1 E;  3DSV A;  4J6I A;  3CHR A;  2KAT A;  3Q15 A;  2RKK A;  1XNF A;  3FU3 A;  4DI4 A;  3ZRH A;  5FQ4 A;  4UWK A;  3V31 A;  2AJA A;  5KNH D;  5BT1 A;  4AY6 A;  2GGF A;  1N4Q A;  1FVH A;  4XE0 A;  3HVE B;  2NYJ A;  4OAU C;  3WG7 E;  1KPS B;  4UI9 C;  2CFZ A;  3TGO A;  4U0U A;  4TUU A;  4G26 A;  4C9B B;  2EIM E;  4ME2 A;  3CVQ A;  4K5A B;  2VGE A;  4L1B A;  4APF A;  4O60 A;  4TUM A;  3T9K A;  3CHS A;  4F1P A;  3FUF A;  2R5S A;  3EU9 A;  4FUL A;  1S70 B;  3TG5 A;  4EZK A;  4H7Y A;  2OV8 A;  3UM0 A;  3PE3 A;  3TWV A;  3U3W A;  1LD8 A;  4ZHB A;  1O1S A;  4PS8 A;  4JPS A;  4W9R A;  4NAC A;  2GRO B;  1N4P A;  2DZN A;  5G04 J;  5EN5 D;  3D9I A;  2XPI A;  3C98 A;  2HE0 A;  3IHV A;  2KCL A;  3DEP A;  4UUC A;  2IU1 A;  3I3N A;  4GA2 A;  3Q79 A;  3APF A;  3GW4 A;  1U2V G;  3CHM A;  4G23 A;  4U0S A;  5ENN A;  1KLX A;  3V30 A;  3ASH A;  4J8S A;  3UM2 A;  2BTD A;  2YHC A;  3NZU A;  2AXZ A;  2GRP B;  5M72 A;  3ISM C;  5EKQ D;  1DCE A;  3ENE A;  1OY3 D;  3Q73 A;  3UM1 A;  1UJK A;  3T5X A;  2CHX A;  4JA7 A;  3NBN B;  2AVP A;  1TNB A;  4A1S A;  4N39 A;  3FU5 A;  3HG0 D;  4B94 A;  3MX3 A;  5JJ7 A;  4LUN U;  3ZHE B;  5HQ8 A;  5D2M C;  4EZJ A;  4I43 A;  3CKC A;  2V4H C;  4MRU A;  1TN7 A;  4NRH B;  3QB2 A;  3MKQ A;  1YMP A;  3KAE A;  4AP2 A;  2X6H A;  2XCC A;  2QC9 A;  1SQM A;  2IO3 C;  3Q9N C;  3ZIM A;  3S2A A;  4GTV A;  2XS8 A;  1HF8 A;  5CER B;  5FQ7 A;  4TXP A;  2WPV A;  3RU0 A;  1SZ9 A;  2VGY A;  3SGH A;  1Q2Z A;  1IHG A;  1EF1 C;  4CCA A;  4GA1 A;  1LTX A;  3HXE A;  3ZYQ A;  2LAI A;  2DVW A;  3OXG A;  2ION A;  3QAR A;  2ZIR A;  2E2E A;  3RAU A;  4BT9 A;  4M3O A;  3HVE A;  4WND A;  1N95 A;  3UI2 A;  4XEI G;  1VDY A;  1OXJ A;  2KC7 A;  2WXO A;  1SA5 A;  3PZD A;  4BFR A;  3MV3 B;  3VTX A;  1Z3Y A;  3FUL A;  4ATG A;  3Q49 B;  2VSX E;  4BX8 A;  3QWW A;  1JWF A;  4GPK A;  3AAA C;  3TJP A;  5LX8 A;  5CEC B;  3ZHE A;  2HR2 A;  2ZXW E;  3S7J A;  1E90 A;  1OWN A;  4HLL A;  4AIF A;  1E8Y A;  3FTZ A;  3S7F A;  3FDH A;  4N3B A;  3JUE A;  2EIL E;  3MJW A;  4HBD A;  4TXR A;  3DSX A;  1OCR E;  1HX8 A; 
#chains in the Genus database with same CATH homology
 4GCN A;  5AYW D;  3D3M A;  1ZU2 A;  3IV0 A;  4FP7 A;  3MEK A;  3HIZ A;  4N5C A;  4A1G A;  1E7V A;  4JZY A;  4GZ6 A;  2P58 C;  5FJY A;  1PAQ A;  4WWP A;  4KZ0 A;  2XGM A;  3R7Q A;  2AXU A;  1WAO 1;  4GZ5 A;  3L08 A;  1B89 A;  4PS7 A;  2FO7 A;  3LS8 A;  5KCM A;  5T4Y A;  2VYI A;  3O48 A;  4IRU A;  3DBS A;  1NA0 A;  4E85 A;  4RG9 A;  3ONL A;  2C0L A;  4A55 A;  3FUD A;  3PUJ A;  4PDX A;  3B7T A;  3FH7 A;  3SI5 A;  2WQ6 A;  3QK0 A;  3OAW A;  1H19 A;  4N3A A;  1HU3 A;  3G2V A;  4URK A;  4I1M A;  2VGX A;  4FJZ A;  3PE4 A;  2WM9 A;  5DBK A;  4CEM A;  4Y6C A;  5C1D A;  2CFU A;  3B7R L;  3PNT B;  2J4D A;  4L2L A;  1HFA A;  4KT6 B;  3TXN A;  1MQS A;  4YVQ C;  2WQ7 A;  2GW1 A;  3O4Z A;  4GZ3 A;  4UQX A;  4C0M A;  4N2S A;  4Y6W A;  2DIW A;  2UY1 A;  4JEU A;  4JW1 A;  1HH8 A;  5E76 A;  3FWV A;  4ANU A;  3D9M A;  3ULQ A;  4ILH B;  3ESL A;  2KM4 A;  4FLB A;  4F53 A;  5J90 A;  2MRI A;  3UT7 A;  3PVL A;  4J8E A;  1NA3 A;  3OTN A;  3AS8 A;  4HXI A;  2WXP A;  3FTU A;  4I9E A;  4UWF A;  4B8A A;  2FI7 A;  3OXL A;  5BV0 A;  3N71 A;  5BUZ A;  1Z3X A;  3VTY A;  1HS6 A;  2L0I A;  3S7D A;  3TXM A;  3L6A A;  3LKU A;  2CG3 A;  5CMW A;  5C2Y A;  2I6H A;  4RG6 A;  3LDZ A;  2V0P A;  3ML9 A;  3B13 A;  1QNF A;  3HDX A;  3JQ0 A;  1E8Z A;  5JHB A;  4RSY A;  3JYS A;  4FHJ A;  3SBT B;  4U0Z A;  4DJA A;  3MKQ B;  3IHY A;  5A7D B;  2A4Z A;  4EEC A;  2QFC A;  2IJG X;  2OVB A;  2RG8 A;  2BUG A;  4P29 A;  2MHK A;  1FCH A;  3GZ1 A;  4UWG A;  2CG2 A;  3QC1 A;  3FUJ A;  4NUR A;  5BPP A;  3CHP A;  3IEG A;  3EIJ A;  1HE8 A;  4UQZ A;  1DVP A;  3CK7 A;  4BT8 A;  4HOT A;  5CMY A;  3URZ A;  1IQR A;  5JHA A;  4OVU A;  2MOW A;  3ASD A;  3VLD A;  2XCB A;  2WXH A;  2VQ2 A;  2WVI A;  5LP0 A;  2I9C A;  4GYO A;  3FTX A;  5DIZ A;  1PY1 A;  2X3M A;  2NXP A;  4I6E A;  3OXF A;  5D0O D;  1HZ4 A;  2RD0 A;  4GU5 A;  4CDR A;  4HLE A;  2IF4 A;  1L5J A;  5AJL A;  2YHE A;  1U3D A;  2XQ0 A;  3GYZ A;  1BPO A;  1HG2 A;  1H2T C;  5CHE E;  5T3R A;  3RRN B;  4G2V A;  4WUY A;  2FBN A;  1KT0 A;  3MA5 A;  2GRM A;  3RRM B;  1PC2 A;  3LYA A;  1TEZ A;  3B7S A;  5ANR A;  1ELW A;  2GRL A;  3BG0 B;  3CVN A;  3CST A;  4ABN A;  4B89 A;  4GAA A;  2PZI A;  3Q4A B;  5ARF A;  3WXX A;  3CSF A;  3K9I A;  3PRE A;  4PH4 B;  3LXU X;  4HOQ A;  5LOZ A;  2WQH A;  4DK5 A;  5T8I A;  3CVU A;  4WAF A;  2VSY A;  3B7U X;  4AJW A;  3FP3 A;  4L7T A;  3G2S A;  4TV3 A;  2JLB A;  2IOS A;  1OWP A;  3FTW A;  3Q47 B;  4BTB A;  1WM5 A;  4JEH A;  5BV1 A;  2PQR A;  2DBA A;  5KJN A;  4AY5 A;  4XI0 A;  1UN8 A;  3ASF A;  4BY6 A;  3PRZ A;  3P2B A;  2LAH A;  4G1T A;  2XRY A;  3LCA A;  4G25 A;  1OWM A;  4I6J A;  1MHQ A;  3KD7 A;  4FAD A;  3AU5 A;  2C0M A;  2NC9 A;  5KJM A;  4V3I A;  3CQG B;  5EX0 A;  4A3T A;  4LER A;  2X6F A;  3FHE A;  2KZT A;  4DLQ A;  4I2W A;  2LSV A;  1OUV A;  4HOU A;  1W3B A;  4NQ0 A;  2XRZ A;  1QQE A;  3DPD A;  2PM6 A;  2XHE A;  4EPZ A;  4I17 A;  4FHK A;  1SZA A;  3ZEF A;  3RIB A;  2AXV A;  4ACL A;  4AOF A;  1N54 A;  4BSX A;  2L6J A;  3TAX A;  3SZ7 A;  4FU3 A;  4UI9 K;  1IYG A;  3D9J A;  4IN3 B;  3ZXS A;  1UW4 B;  3CLJ A;  5LCW J;  1Z6T A;  1JUQ A;  3NF1 A;  3ZPJ A;  1KT1 A;  3D9N A;  3MKR A;  2IOL A;  4LCT A;  4GZD A;  4I6G A;  1H6K A;  1UJJ A;  4L23 A;  2CHW A;  3U66 A;  2NSZ A;  3L16 A;  3MGB A;  4ILI A;  5J08 A;  3CVP A;  5D0Q D;  5JJT A;  5G05 C;  1DNP A;  5E75 A;  2JEK A;  2WXG A;  3ONK A;  2J07 A;  3UX4 A;  3CKB A;  2V8S E;  2L0T B;  5FZR A;  3Q5M A;  5ANL A;  4J6I A;  3GZ2 A;  3CHR A;  4QFV A;  2KAT A;  3Q15 A;  3ZVV A;  3QWP A;  2QY7 A;  3SNX A;  1XNF A;  3FU3 A;  4DI4 A;  1E8X A;  4OYS A;  2VSN A;  5HI7 A;  3CV0 A;  3ZRH A;  4RVB A;  5FQ4 A;  3E4B A;  4APO A;  2UWJ G;  4KVO A;  4UWK A;  3FUN A;  3FEY A;  3QDN A;  5AEN A;  5BT1 A;  1IQU A;  3RK6 A;  4AY6 A;  3CK9 A;  2GGF A;  3SBS A;  3CIA A;  1FVH A;  1EYH A;  2BF0 X;  2OVF A;  4UWH A;  3LY8 A;  3SF4 A;  4XE0 A;  3HVE B;  3AS4 A;  3FTV A;  3CVV A;  2ILR A;  3CVX A;  4UI9 C;  2CFZ A;  3ASG A;  3PDN A;  3RO2 A;  3TGO A;  4KZC A;  2HYZ A;  4U0U A;  4TUU A;  3QWV A;  5BNW A;  4G26 A;  4CT0 A;  2LNI A;  4C9B B;  5EX3 A;  4ME2 A;  3CVQ A;  4L1B A;  2Y3A A;  2HO1 A;  4IUL A;  4APF A;  4L2Y A;  4HFG A;  3FU6 A;  3AS5 A;  3EHM A;  4ANV A;  4I1O B;  1NZN A;  3U9W A;  2FF4 A;  3CHS A;  4R7L A;  5G2N A;  3FUF A;  2R5S A;  3G2T A;  4FUL A;  3JQ1 A;  2OND A;  4G11 A;  3TG5 A;  3MCX A;  4EZK A;  4H7Y A;  3MYV A;  2OV8 A;  3FUE A;  3PE3 A;  3U3W A;  2I1J A;  4GML A;  4O6F A;  3ZW3 A;  5AJD A;  2WB2 A;  3RO3 A;  4YVO A;  3TL5 A;  3TG4 A;  2VTB A;  3FU0 A;  3GZS A;  4PS8 A;  3RJV A;  3VLF A;  4JPS A;  4CDN A;  2OOE A;  4W9R A;  4NAC A;  2VSO E;  3FH5 A;  3LPZ A;  4PS3 A;  1UN9 A;  2WMO A;  1TJC A;  3CGH A;  4BX9 A;  4UQY A;  4EBA A;  3MZL B;  5FWQ A;  1UG3 A;  5G04 J;  3LVR E;  2R17 C;  2E0I A;  2J9Q A;  3D9I A;  1E7U A;  4HVB A;  3KS2 A;  2XPI A;  3C98 A;  3FUM A;  4U63 A;  3IHV A;  2KCL A;  3L13 A;  4J8D A;  2IU1 A;  2WXN A;  5CCM A;  5JJ6 A;  3I3N A;  4BWR A;  3ML8 A;  2Y4U A;  4AV7 A;  2I2O A;  4GA2 A;  1ELK A;  2AWI A;  1JWG A;  3I4G A;  5A6C A;  2J49 A;  4GYY A;  1GW6 A;  3APF A;  4JHJ A;  3UUX A;  3I4R B;  3CHQ A;  3GW4 A;  4U0S A;  3CHM A;  3G2W A;  4G23 A;  4PUC A;  5ENN A;  1KLX A;  3SD5 A;  3ASH A;  1YA0 A;  3ZN3 A;  3MV2 B;  4ANW A;  2LSU A;  3PEV B;  3CVY A;  4WNE A;  2A5U A;  1ZBP A;  4XZ4 A;  4J8S A;  4XKB A;  2BTD A;  3UPV A;  2YHC A;  3NZU A;  4WWN A;  5G05 J;  1XGW A;  4I9C A;  2WMN A;  2EQX A;  2AXZ A;  4UWL A;  4HOS A;  3UT8 A;  3FUH A;  4GZC A;  3QJZ A;  5M72 A;  4N3C A;  1WY6 A;  2VGX B;  5EKQ D;  4KYO B;  4IYP A;  1FVF A;  4HS2 A;  3ENE A;  4F1S A;  3FH8 A;  1NP7 A;  3U64 A;  2CHZ A;  4KXK B;  2IQC A;  2LO6 A;  4GB9 A;  3L17 A;  3PUK A;  3EJN A;  1JPL A;  2J4B A;  1UJK A;  3CQC B;  5G55 A;  3ZYM A;  3T5X A;  5EDS A;  2CHX A;  4HOR A;  2WXJ A;  2Y4T A;  4JA7 A;  4B0Z A;  3QAQ A;  3SFZ A;  5KJL A;  4U04 A;  2AVP A;  4JA9 A;  2KCK A;  4A1S A;  4YND A;  3FTS A;  4JHK A;  4N39 A;  3FU5 A;  3U4T A;  1S0P A;  3APC A;  3QKY A;  4F7A A;  1H0A A;  3PNL B;  1EPU A;  3CHO A;  3R9A B;  1E8W A;  1Y8M A;  4J0U A;  4B94 A;  4FC8 A;  3MX3 A;  3EIQ C;  1LF8 A;  2C2L A;  3BG1 B;  2FUL A;  2VJ8 A;  2DCP A;  4ANX A;  2AW6 A;  1TJF A;  2J09 A;  3NQP A;  3CK8 A;  4U8H A;  5JJ7 A;  4LUN U;  4XIF A;  3CR3 A;  2WXR A;  3ZHE B;  2X6I A;  5HQ8 A;  4I2Z A;  3APD A;  4MKT A;  4D10 C;  4FA6 A;  4EZJ A;  4AEZ C;  4I43 A;  2YQ8 A;  2M63 A;  4H7X A;  3T5V A;  3CKC A;  4K03 A;  4LEU A;  2WXF A;  1X5B A;  1QZ2 A;  2KZT B;  3L54 A;  5FT9 A;  5FZQ A;  2XGS A;  4MRU A;  3P1U A;  5AIJ A;  2YNQ A;  5FTP A;  4NRH B;  4FLH A;  3FTY A;  4CDM A;  2V5F A;  1INZ A;  3QB2 A;  3MKQ A;  3JUI A;  3KAE A;  3UMV A;  4AP2 A;  4CRW A;  3NZS A;  2X6H A;  3EHN A;  2V4L A;  2XCC A;  3CVL A;  1SQM A;  3ZYL A;  3ZGQ A;  4LRZ A;  3ZIM A;  1ELR A;  1OWL A;  3S2A A;  4I1A A;  4Q94 A;  4OVV A;  3IKO B;  5FQ8 A;  1HF8 A;  2WXK A;  5FQ7 A;  2PQN A;  5CCL A;  3D9O A;  3D9P A;  4XX5 A;  3LEW A;  2WPV A;  3RU0 A;  1H2V C;  1SZ9 A;  3HYM B;  4JXT A;  4AM9 A;  3IBE A;  5LCW C;  2VGY A;  3D9L A;  3SGH A;  3T8M A;  1OWO A;  1IHG A;  4ACK A;  1EF1 C;  4FJY A;  1EDU A;  4CCA A;  4GA1 A;  4C0E A;  3ESK A;  3PEU B;  2WXQ A;  4A3V A;  3L22 A;  2J08 A;  3ZYQ A;  2X38 A;  1P5Q A;  2LAI A;  2R59 A;  3LY9 A;  4CT4 A;  4DPR A;  5FZS A;  1H2U A;  3S7B A;  3UT4 A;  2WXL A;  3OXG A;  2FEZ A;  5BW8 C;  2ION A;  5FQ6 A;  3QAR A;  3FEX A;  3HHM A;  3PH0 C;  1U3C A;  2E2E A;  3LVQ E;  5KJK A;  4GA0 A;  4BT9 A;  4M3O A;  4WNG A;  3RKV A;  3HVE A;  4EZL A;  4WND A;  3FUI A;  2IFU A;  2WXM A;  4J8F A;  4DI3 A;  1A17 A;  1HO8 A;  4MLP A;  4U07 A;  3CEQ A;  5A23 A;  3FUK A;  2I1K A;  1VDY A;  2KC7 A;  2XGO A;  2WXI A;  3ZFW A;  3PS6 A;  4WNF A;  2WXO A;  3R7R A;  2X6J A;  2L9B A;  3SHF A;  1HG5 A;  3PZD A;  4BFR A;  2PL2 A;  1E96 B;  2YIN A;  2UY1 B;  4AXH A;  3MV3 B;  3VTX A;  3ZYK A;  4EQF A;  1HXI A;  4G24 A;  1Z3Y A;  4MS6 A;  3FUL A;  4UI9 J;  4CGV A;  4Q69 A;  3QNK A;  4KVM A;  3KEZ A;  2X6K A;  4KBQ A;  4ATG A;  3Q49 B;  3UQ3 A;  4E6H A;  3CVW A;  3RRU A;  4XI9 A;  3D9K A;  2VSX E;  4BX8 A;  4JL0 A;  4TRQ A;  1Y6I A;  4GMJ A;  3QWW A;  4EBA G;  4K0R A;  3I5P A;  1JWF A;  4AVX A;  4GPK A;  5ARG A;  3LY7 A;  4BTA A;  2VTB B;  4KMO A;  3TJP A;  5LX8 A;  3ZHE A;  2HR2 A;  3EDT B;  4ILG A;  4Q96 A;  3LJ3 A;  3S7J A;  4JHR A;  5LFA A;  1E90 A;  1OWN A;  2Q7F A;  4AIF A;  4DLO A;  3QOU A;  2HM8 A;  4XKC A;  2XEV A;  3BEE A;  1E8Y A;  1N52 A;  2KCV A;  3FTZ A;  3S7F A;  4N2Q A;  2ZU6 B;  3FDH A;  3FY4 A;  4GCO A;  4N3B A;  4F3V A;  4JVS A;  2PM7 A;  3VLE A;  3MJW A;  4JC8 A;  5G04 C;  3FFL A;  3AU4 A;  2XPY A;  4B8C B;  4CGW A;  1HX8 A;  3JCK C;  4GYW A;  2XPZ A;  3G2U A;  4WWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...