4AIFA

Aip tpr domain in complex with human hsp90 peptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
144
structure length
144
Chain Sequence
AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/peptide
molecule keywords AH RECEPTOR-INTERACTING PROTEIN
publication title Structure of the Tpr Domain of Aip: Lack of Client Protein Interaction with the C-Terminal Alpha-7 Helix of the Tpr Domain of Aip is Sufficient for Pituitary Adenoma Predisposition.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4aifA00
3EDTB 4G1TA 4HOQA 2AVPA 4BT9A 4N3CA 2LSUA 3UQ3A 2VGXA 4AM9A 2NC9A 2PL2A 4A1SA 4BTBA 4I17A 3RJVA 4CDRA 4UI9J 5AYWD 3CV0A 3MV3B 4F3VA 4WNEA 4WUYA 5ARFA 4KBQA 2J9QA 1XNFA 1WM5A 3LYAA 4J8FA 4I9EA 3WXXA 3AS5A 3ZHEA 3CEQA 3O48A 5CHEE 2LSVA 5KJLA 4Y6WA 4NQ0A 5FZRA 4HOUA 2HO1A 3TG5A 5JJ6A 2Q7FA 4G25A 4IN3B 3K9IA 2VGYA 3QDNA 3BEEA 1OUVA 4HOSA 3ASFA 3ESKA 3KS2A 5FJYA 3MA5A 2MHKA 4UQYA 2E2EA 3QWWA 5M72A 5A6CA 3AS4A 2KCVA 5G05C 3Q5MA 2KCLA 3CK9A 4EQFA 2C0MA 2XEVA 2QFCA 2XGMA 3S7FA 1HZ4A 3S7DA 5CCLA 4CGWA 4YVOA 2FO7A 4N5CA 1NZNA 1ELRA 2YHCA 1QQEA 4U07A 2PQRA 2PQNA 4XIFA 2XCCA 5G05J 5LCWJ 4N39A 5FZQA 4UQZA 4U0ZA 5EX0A 4GA1A 4B94A 2V5FA 3LCAA 5KJMA 3LY7A 3Q47B 3TG4A 5JJ7A 3PE4A 4APOA 4G23A 4AIFA 3TGOA 1E96B 3S7BA 3R9AB 5HI7A 1IHGA 3HYMB 3Q4AB 5FZSA 3ASDA 5BT1A 3SF4A 4RG9A 5CCMA 5G04C 1ZBPA 3CVLA 3GW4A 4WNFA 1KT1A 2OOEA 1ELWA 3SZ7A 3FFLA 3OXLA 4G24A 2UWJG 4GCNA 5DIZA 1KT0A 5D0QD 3FWVA 3URZA 2DBAA 1KLXA 4JA7A 4UI9K 4I2ZA 2FEZA 2LNIA 4GA2A 2IFUA 1NA0A 5EKQD 4I2WA 3ULQA 5G04J 1NA3A 2VSNA 5BW8C 5EX3A 1W3BA 4GCOA 4ME2A 5LCWC 4HORA 3RU0A 2XGOA 3S7JA 3LKUA 2FF4A 3E4BA 4N3BA 4XI0A 4JA9A 3RKVA 4H7XA 4YNDA 5HQ8A 3RIBA 2IF4A 3CVNA 3ZN3A 4BWRA 3VTYA 2XPIA 3LPZA 4J8DA 2KCKA 4GYYA 2WQHA 4GA0A 2HR2A 3OXFA 3QOUA 3QWPA 1WAO1 3ZFWA 3LY9A 1A17A 1QZ2A 5C1DA 4WNGA 2VYIA 2KATA 2UY1B 5DBKA 5FT9A 5A7DB 2GW1A 3GYZA 1YA0A 4U0UA 2PZIA 3IEGA 3N71A 3FP3A 3VTXA 4G2VA 3AS8A 3PDNA 3RO3A 2P58C 3OXGA 2L6JA 5BNWA 2R5SA 3CK7A 4GZ3A 2XGSA 3CKCA 3ASGA 4JL0A 1ZU2A 2KC7A 3MKRA 3TAXA 1FCHA 2HYZA 4RG6A 3U3WA 4XI9A 4J0UA 3UPVA 3PE3A 2VGXB 4ABNA 5JJTA 2YQ8A 4O6FA 3KD7A 2XCBA 5FTPA 4KXKB 4H7YA 2VQ2A 4G26A 1IYGA 2Y4TA 3CK8A 5KJNA 2Y4UA 3CVQA 2FI7A 4WNDA 2ONDA 2C2LA 3QKYA 1PC2A 3Q15A 4BTAA 3KAEA 4GZ6A 4I9CA 4HOTA 3JYSA 4GYWA 3ZHEB 4CGVA 3ZPJA 4KYOB 5KJKA 3U4TA 4LEUA 4N2QA 1B89A 3LY8A 4GYOA 2C0LA 4AY6A 2I6HA 4YVQC 4W9RA 3ZGQA 4Y6CA 1TJCA 4UQXA 5D0OD 4GPKA 4AY5A 1HH8A 3Q49B 3GZ1A 2BUGA 4BT8A 4N2SA 3NF1A 3CKBA 2FBNA 2UY1A 3MV2B 5ARGA 3GZ2A 3QWVA 4J8EA 4GZ5A 3UUXA 4I1AA 4U04A 3ASHA 3CVPA 2VSYA 1HXIA 2JLBA 2WPVA 4UI9C 3RO2A 1Y8MA 4NRHB 1P5QA 3MEKA 4JHRA 4U0SA 4N3AA
chains in the Genus database with same CATH superfamily
3QK0A 1YMPA 5ENRD 2KXPC 3FTZA 2RG8A 4N3CA 1BPOA 4ANXA 4M7CA 3FH7A 3FULA 2XEHA 3NOCD 3UIOC 3APFA 3FHEA 3PEVB 1X81A 3CVVA 3Q73A 4U63A 4F3VA 3ESLA 3SI5A 2XPYA 3FUIA 4KBQA 3CHQA 3JCKC 1EYHA 2V0PA 3LYAA 3WXXA 2QC9A 3TXNA 3FH5A 3NAWA 3UT7A 3CEQA 3R7RA 4EHMA 3O48A 3LEWA 5CHEE 2QY7A 3SBSA 5D2MC 4K0RA 1OWMA 5FQ7A 4G25A 3QB2A 3TWUA 3BEEA 1OUVA 3PNLB 1SQMA 4HOSA 3LS8A 4C0EA 3MKQA 5FJYA 3TWSA 3CR3A 3FTXA 1HF8A 2CHWA 2E2EA 1TN7A 4QFVA 3ASOE 4EPZA 5G05C 1BI7B 4BERA 2KCLA 3CVUA 4OAVB 3L13A 2C0MA 4XZ4A 5EDSA 2QFCA 4HB5A 2R05A 1KPSB 3S7FA 5AQBA 2R59A 5B1BE 3ZNGA 2IU1A 3E32A 2PM7A 3PH0C 1ELKA 1E8ZA 3PS6A 4CGWA 2L0IA 1NZNA 1ELRA 1QQEA 2BTDA 4U07A 2PQRA 2ETAA 3ZYLA 2Y3AA 4N39A 1MJ0A 4FULA 3ABKE 2F8YA 4ACLA 3C72A 2V5FA 1HG2A 2WXJA 3OTNA 4G23A 1E96B 3S7BA 2J8SD 1IHGA 3BQOA 3UKUG 3L08A 4XEIG 5FZSA 4BX9A 4JW1A 4RG9A 5CCMA 5JHBA 4JPSA 1MX2A 2R03A 3J5PA 2IY0C 4WNFA 1N4RA 1KT1A 1FPPA 1O1TA 4N5QA 3SY2A 3ONKA 3NBNB 4HBDA 4DUIA 3FWVA 3JXJA 2DBAA 3SFXA 3TWXA 4L23A 4JHKA 4I6EA 3DSUA 1SZ9A 5FINA 2RFMA 3B7UX 3CVYA 1NA0A 5EKQD 3KSLA 1XGWA 1DC2A 1W3BA 2DWZA 2QYJA 4WWNA 3SO8A 3S7JA 4NURA 3FU3A 3FU5A 3E4BA 3BG1B 4N3BA 4RQIA 4XI0A 1RZ4A 2EIJE 3JXIA 3G2UA 5HQ8A 4TXPA 2EIKE 3D9HA 3Q7FA 3SHFA 2KM4A 2IF4A 3CVNA 3DSXA 2RD0A 1JWGA 3LPZA 4J8DA 4FC8A 3UXGA 3NB2A 1BI8B 1SA4A 2HR2A 2J08A 3OXFA 3QWPA 4D10C 3G2WA 4EECA 3LY9A 1E8YA 3PVLA 3QNKA 3AG2E 2VYIA 3FTVA 4PUCA 2GRRB 5CECB 5DBKA 4ZHBA 1DCEA 5FT9A 2DIWA 2KZTA 2GW1A 1SW6A 3PRZA 3CQCB 1YA0A 2B6CA 3BUAA 2IEJA 5FWQA 3N71A 3TWTA 2OEWA 5KNGA 1H6KA 3CHPA 3EU5A 1OCZE 4MKTA 4BSZB 4I1MA 4JL0A 2WXRA 2KC7A 3MKRA 2HYZA 2X6FA 5EIBE 3TXMA 3UPVA 2VGXB 4ABNA 4ANUA 4DK5A 3EIQC 2WVIA 3CLJA 3ZEFA 4O6FA 5FIOA 4MRUA 1TYQG 1U3CA 2DCPA 2Y4TA 4BETA 5LX8A 5KJNA 5AJDA 2WB2A 3CVQA 4LRZA 3P2BA 2WMNA 4OVUA 5CBOA 3EU9A 4PS8A 4EZKA 2V5QC 4OAUC 1PC2A 2DVWA 4HI8A 4KMOA 1IHBA 3E33A 2WXLA 5ENSD 3ZVVA 1N95A 2EQXA 4C0MA 1PY1A 3U4TA 1TN8A 2EIME 2WXMA 3RAUA 3ENEA 3TWQA 4P29A 1N0QA 4AY6A 2I6HA 4YVQC 2IOLA 3UI2A 4Y6CA 1TJCA 2GRLA 4GPKA 3GZ1A 2ZXWE 3LDZA 3C3QA 4O1PA 2FBNA 3ZKJA 5ARGA 5ITZF 4CCAA 4GTMA 3UUXA 4CRWA 2M63A 3B95A 4IRUA 4WWPA 2GRPB 3CVPA 2XS8A 5EN5D 3CHRA 4DX5D 3DPYA 2WPVA 4LNBA 2GRMA 2GGFA 4MLPA 3FUDA 2VSOE 4BX8A 3EDTB 2AVPA 5BXUA 4BT9A 1LTXA 3AU5A 2NC9A 2PL2A 5G2NA 4LG6A 2AWIA 3B13A 2AXZA 3R9MA 1BU9A 4ILGA 3IXEA 4UWGA 4WNEA 2X3MA 4WUYA 3LXUX 1DNPA 3ISMC 4UWLA 1XNFA 2GROB 3HG0D 1WM5A 4J8FA 3MX3A 4I9EA 5AN8A 5ENPD 3B7SA 3SBTB 1V55E 3ZHEA 3UT8A 2LSVA 1TEZA 4Y6WA 4JB8P 4NQ0A 5FQ6A 3D9PA 3EJNA 3AG4E 4LERA 2Q7FA 1MYOA 4IN3B 3JQ0A 2V8SE 4JEUA 5CEAA 2XS1A 3FU0A 2J49A 4A3VA 3ESKA 4J7WA 2WXHA 4DX7D 5IY5E 4UQYA 5M72A 2JEKA 1U3DA 5A6CA 2ZGGA 4HS2A 2I2OA 2KCVA 3KEZA 3Q5MA 3D9LA 1H6OA 3CK9A 4EQFA 1N4SA 3D9JA 4UWKA 2XGMA 4PS7A 4ANWA 3IBEA 2R2LA 4FLHA 2VTBB 4AP2A 4ILHB 3S7DA 5CCLA 4IULA 3PZ1A 4GB9A 4KVMA 3MZLB 5CRUA 2A4ZA 5EIDA 2I1JA 4YVOA 4JEHA 1K1BA 4N5CA 4ZFHA 2PQNA 4JZYA 2XCCA 1INZA 3I4GA 2RFAA 3QJZA 4UQZA 5EX0A 2PM6A 1OY3D 2R02A 4M3OA 3MCXA 3LY7A 3TG4A 4OYSA 3DSVA 4APOA 4AIFA 1Y6IA 3O4ZA 2H6IA 1G3NB 3DEPA 2BEDA 4XKBA 3R9AB 1K3ZD 3HYMB 2OV8A 3J5QB 1N54A 4E85A 3ASDA 3SF4A 2L9BA 5CMYA 3UM0A 4GTRA 4U7EB 3L22A 5BPPA 2OOEA 3PREA 3CSFA 3ABLE 3FFLA 3OXLA 3CVWA 4J6IA 1D8EA 3SFZA 2FO1E 3SGHA 3T9KA 2QYUA 5D0QD 1KLXA 2IOSA 4PDXA 1N11A 4XX5A 4B8CB 1S70B 2FEZA 2YNQA 1HO8A 2LAIA 2OEVA 3APDA 4LSZE 3ULQA 5G04J 4K5AB 1NA3A 5BW8C 4HORA 2XGOA 1H2VC 3LKUA 5AAOA 3EHRA 3D3MA 2V4LA 2XQ0A 4JA9A 2J09A 1FT2A 3V2XA 4DPRA 4LNUD 4MBGA 1JUQA 4BWRA 3VTYA 1E7VA 1LD8A 2BF0X 2XPIA 2WQHA 2P9UG 2XENA 1WY6A 1EPUA 1N0RA 5LP0A 1UN9A 1WAO1 4WAFA 2ZISA 4Z68A 4FP7A 5LOZA 2J07A 3UTMA 3FTSA 1FT1A 3ML8A 2ZGDA 4F53A 3QARA 4E6HA 3HVEB 4GZCA 4U0UA 4A3TA 5BUZA 2PZIA 3IEGA 4KVOA 2HE0A 3U64A 3AS8A 4NACA 3HXDA 3PDNA 3RO3A 2P58C 2R5SA 4O1OA 2MRIA 4GMRA 4GZ3A 4FADA 2XGSA 3CKCA 2CHXA 4ANVA 4JC8A 3TAXA 1YCSB 3OAWA 4DI3A 3U3WA 4XI9A 2ILRA 4DI4A 2P9PG 1N9AA 2X38A 2YQ8A 3W9FA 3KD7A 2XCBA 1OCRE 4KXKB 4H7YA 2CFUA 2P2CP 1IYGA 2GRQB 3FUMA 3DXKG 3VLEA 3L9TA 2ONDA 2CG3A 3HXBA 4APFA 3HDXA 4GZ6A 4I9CA 4GYWA 5G55A 4PH4B 5ENTD 3MJWA 1TNOA 4BESA 3UM2A 4K03A 4LEUA 3ZXPA 4HLEA 4BY6A 3LY8A 1EDUA 3ZUVB 4UWFA 3TJPA 2C0LA 2LXMA 3Q78A 3MKQB 1EF1C 5T4YA 3IKOB 2VJ8A 3CKBA 3G2TA 3CVXA 2DZOA 5BV0A 2UY1A 3MV2B 3GZ2A 3QWVA 4YDOA 4GZ5A 3UM1A 1NFIE 4CYMD 4TRQA 3L6AA 3FU6A 4ATGA 1Z3XA 1HG5A 5BV1A 2NXPA 5KCMA 4UUCA 2X6HA 4NRHB 4HRNA 3FEYA 4EZLA 1NI1A 4JHRA 3ZW3A 4U0SA 2ZU6B 4G1TA 3ULEG 2LSUA 3UQ3A 3SFYA 1HU3A 4JD2G 3S2AA 3VLDA 5KWDA 4I17A 2LUHA 3RJVA 1TNBA 3B7RL 1E8WA 4UI9J 4FU3A 3FTYA 2IONA 4GMLA 3PZ2A 4A55A 5J08A 2V4HC 4GTTA 3CGHA 3ZRHA 5J90A 3LVQE 1IQUA 3AS5A 4URKA 1HS6A 5KJLA 4YDYA 3MGBA 2WXGA 3K9IA 4K5CA 4CEMA 3QDNA 1H0AA 1LF8A 4RSYA 3ASFA 5CMWA 3KS2A 1MQSA 1BD8A 3DBSA 3I5PA 3AS4A 4TV3A 2AXUA 2VTBA 3D9OA 4HFGA 3QC1A 4MS6A 1S0PA 3FUHA 2XEVA 1KZOA 1E7UA 4Q69A 2WQ7A 1HZ4A 4GTVA 1O5MA 4UWHA 4GTPA 5D66A 3FUEA 3HIZA 4HNAD 2WMOA 4BFRA 2CFZA 4IYPA 2AXVA 3Q7AA 1H2TC 2WXPA 2FO7A 4EBAA 4XIFA 2WXQA 1Z6TA 5G05J 5FZQA 3EHNA 5B3SE 1S64A 3NZSA 4U0ZA 3CIAA 4KZ0A 2KBXA 3Q47B 5HKPA 1MX4A 5JJ7A 1H2UA 3FTUA 1UJJA 3TGOA 4ACKA 2XZDG 3VLFA 3BU8A 1TR4A 3CHOA 2CG2A 2NYJA 4GTQA 5T8IA 3V30A 3LVRE 4AVXA 1A5EA 3CVLA 3GW4A 1BLXB 5CRVA 2HM8A 2IO3C 1ELWA 3PZDA 2H6GA 4XKCA 4G24A 2NSZA 2WXKA 2FULA 4F1SA 4GCNA 1RW2A 4B89A 1O1RA 2XRYA 4U8HA 1KT0A 4JA7A 1N4QA 4UI9K 4I2ZA 3IHVA 2LNIA 4G8LA 3ZYQA 4U8YD 2IFUA 3FUJA 4R7LA 3UKRG 2LAHA 4GCOA 4ME2A 5LCWC 5ENOD 4HRLA 1OCCE 5E75A 4AV7A 5LFAA 4I6JA 1KZPA 3DWLG 1HFAA 1JCSA 1HE8A 3U66A 4O60A 4TXQA 5JHAA 3FEXA 4H7XA 4YNDA 3V31A 2KCKA 4GYYA 3R7QA 5T3RA 2IJGX 2RKKA 3AG1E 3QOUA 1UG3A 1QBQA 1WDYA 3WG7E 5C1DA 4WNGA 3NQPA 3HVEA 2KATA 1V54E 5E76A 2VGEA 4TXRA 5EYPF 4EBAG 4G11A 2A5UA 3UX4A 4YDEA 5ENNA 4GPMA 3FP3A 2F8XK 4NIKA 2AW6A 3ASGA 2OVFA 2WQ6A 1FCHA 1FVFA 1MX6A 4AEZC 1TNZA 4RG6A 3EIJA 3ASNE 3TWWA 3ABME 2EINE 3W9GA 4DLQA 4L2YA 2Y4UA 1YYHA 1O1SA 4FJZA 2Y0BG 1ZB1A 4WNDA 1TNUA 3KAEA 4HRMB 3JYSA 4HVBA 3SQVA 1Q2ZA 4CZ2D 1MZCA 3ZHEB 4I43A 4DX2A 2B0OE 4DJAA 3ZPJA 2XRZA 3EHQA 3RRMB 1OXJA 4N2QA 1QNFA 4JXTA 4GYOA 3ZXSA 3KSQA 3ZIMA 1L5JA 1PAQA 4UQXA 5D0OD 4YDWA 4AY5A 3CSTA 2LXLA 4I6GA 3PEUB 1S63A 3HRAA 4BT8A 4N2SA 4HI9A 4U96D 2YINA 3FTWA 1OWPA 3NZUA 3C3RA 3UIPC 2WXOA 4J8EA 1OWNA 2WXFA 4B93B 1UN8A 2WXIA 2P9IG 2XPZA 1IXVA 3ASHA 1H6PA 3HXFA 4F6RD 2VSYA 1HXIA 3D9NA 5A23A 3ULYA 1Y8MA 1K1AA 3AJIA 1K8KG 1P5QA 3MEKA 4Q96A 1JCRA 3T8MA 1AWCB 3DEOA 3APCA 4L9PA 4N3AA 3Q79A 4L2LA 4HOQA 3GZSA 3Q9NC 4FHKA 2VGXA 1FVHA 4AM9A 5FQ4A 4U95D 4X8QA 2DYRE 3V2OA 4A63B 4A1SA 4OVVA 1Z5SC 4BTBA 2X6JA 3LJ3A 3NOGD 3CQGB 3U9WA 4CDRA 1JCQA 4C9BB 2I1KA 5AYWD 3CV0A 3MV3B 4FJYA 5AJLA 3CHMA 2I9CA 3RSEG 2XEEA 3RRUA 2Y69E 5ARFA 5AQ9A 5AIJA 3ONLA 2J9QA 4DX1A 4XE0A 3T5XA 2OCCE 3PZ4A 3EHMA 4AXHA 4Q94A 1IQRA 5FZRA 2R17C 3P1UA 4HOUA 1NP7A 2ETBA 2HO1A 3UT4A 3TG5A 2EILE 1X5BA 5JJ6A 4GMJA 5KBAA 3C3OA 2VGYA 3T8KA 1SZAA 3AG3E 3JUIA 2ETCA 3RRNB 2WM9A 2JABA 3DSSA 1D8DA 3MA5A 3HHMA 2MHKA 5FQ8A 4DRXE 3QWWA 2L6BA 2VSXE 4QQIA 1JWFA 4BSXA 4GAAA 1TNYA 3UMVA 3FY4A 2X6IA 1SA5A 3MYVA 5EILA 3DSWA 3DSTA 1OT8A 4KZCA 3TL5A 4J8YA 4LNGA 1UJKA 4HXIA 4ILIA 1GW6A 2DZNA 3TWRA 2YHCA 3ML9A 2H6HA 4V3IA 5LCWJ 3ZYMA 4GA1A 3QAQA 1N52A 4B94A 1DVPA 3LCAA 4DLOA 5KJMA 2J4DA 2CHZA 3X2QE 3PE4A 5CEDB 1OWOA 4AJWA 1SVXA 1HX8A 4LCTA 4F1PA 1H19A 3Q9UC 2DYSE 5HI7A 5C2YA 4HLLA 5AQAA 3Q4AB 3EUVA 2P9NG 3DPDA 2QZAA 4U8VD 1N94A 5BT1A 3JQ1A 1U2VG 3B7TA 3L54A 1D9SA 3L16A 5JMND 5AQ7A 1E8XA 5G04C 1ZBPA 4CDNA 5CBNA 1VDYA 2ZIRA 2WXNA 4CT0A 4AOFA 4FHJA 3SZ7A 1UOHA 2UWJG 2MOWA 5DIZA 3PZ3A 4GU5A 4FA6A 3KEAA 3URZA 1OCOE 1UW4B 2BKKB 2AJAA 1IKND 3PNTB 1N4PA 1Z3YA 4GA2A 4TUMA 4I2WA 2XZTG 3IHYA 2BKGA 1E90A 2VSNA 5EX3A 5BXOA 3RU0A 3I3NA 3L82A 3FUNA 2FF4A 2P9SG 3Q75A 3ZU7B 3RKVA 3IV0A 4GTSA 4J8SA 5H7PA 4F7AA 2OVBA 3RIBA 4JVSA 3ZN3A 3L17A 1DCQA 3G2SA 1JPLA 3E37A 4DX6D 4GA0A 4RVBA 4B8AA 3V79K 4RLYA 3ZFWA 1A17A 3CHSA 1QZ2A 3PUKA 2IO2C 2UY1B 3F6QA 3UM3A 1MHQA 5A7DB 4GTOA 4EZJA 2J4BA 4TUUA 3GYZA 1WG0A 3FH8A 1NL4A 2P9KG 3FUFA 4CT4A 2F37A 2L0TB 2KZTB 4K5BA 4L7TA 5HS0A 3VTXA 4G2VA 3OXGA 3D9KA 2L6JA 5BNWA 3CK7A 2A5EA 3SNXA 4A1GA 4BEPA 3BG0B 3C5RA 1ZU2A 5KNHD 4L1BA 4JHJA 2X6KA 5ANLA 4J0UA 3PE3A 3I4RB 5JJTA 3C98A 4B0ZA 5FTPA 3ZYKA 2VQ2A 4G26A 5AARA 4G8KA 3AAAC 2F0YA 3CK8A 4FLBA 2IQCA 2FI7A 1TN6A 3D9IA 3DRAA 2C2LA 2MYOA 3QKYA 4HQDA 3FDHA 3Q15A 4BTAA 2H6FA 3D9MA 5ENQD 5AENA 3TWVA 1TJFA 1QYMA 4GZDA 5EYLA 4HOTA 2Y1LE 3FUKA 3JUEA 4CGVA 2E0IA 3SD5A 1LD7A 4KYOB 5KJKA 1B89A 5HRYA 2P9LG 4W9RA 3ZGQA 4CDMA 4WWOA 1AP7A 4C48B 5JA4D 1HH8A 3Q49B 3G2VA 2PNNA 2BUGA 3DXMG 3NF1A 2XHEA 4I1OB 3HXEA 5ANRA 3T5VA 5CERB 1OWLA 2GRNB 3PUJA 3HXCA 3LJNA 4ATZD 5B1AE 3B7BA 3AU4A 4I1AA 4U04A 3UINC 3E34A 2JLBA 4UI9C 3RO2A 2LO6A 3E30A 4KT6B 3RK6A 4LUNU 2YHEA 4PS3A
chains in the Genus database with same CATH topology
3EDTB 3QK0A 2ZU6B 4G1TA 4HOQA 3GZSA 2AVPA 3FTZA 4BT9A 2RG8A 4N3CA 2LSUA 4FHKA 3AU5A 1BPOA 2VGXA 3UQ3A 1FVHA 2NC9A 4AM9A 2PL2A 5FQ4A 4ANXA 5G2NA 2AWIA 3FH7A 3FULA 4A1SA 3B13A 4OVVA 1HU3A 3S2AA 3VLDA 4BTBA 2X6JA 2AXZA 3LJ3A 4I17A 3CQGB 3APFA 3RJVA 3FHEA 3U9WA 3B7RL 4CDRA 1E8WA 3PEVB 4C9BB 4ILGA 3CVVA 4UI9J 2I1KA 5AYWD 3CV0A 3MV3B 4FU3A 4FJYA 4U63A 4UWGA 4WNEA 3FTYA 3ESLA 2X3MA 5AJLA 4F3VA 3CHMA 2I9CA 3SI5A 2IONA 4WUYA 4GMLA 3RRUA 2XPYA 5ARFA 3FUIA 3LXUX 1DNPA 4KBQA 4A55A 5AIJA 3ONLA 3CHQA 3JCKC 5J08A 4UWLA 2J9QA 3CGHA 3ZRHA 1EYHA 1XNFA 2V0PA 5J90A 1WM5A 3LYAA 4J8FA 4XE0A 3T5XA 3MX3A 3LVQE 4I9EA 3TXNA 1IQUA 3B7SA 3FH5A 3WXXA 3AS5A 3SBTB 3UT7A 4URKA 3ZHEA 3CEQA 1HS6A 3EHMA 3R7RA 3UT8A 4AXHA 3O48A 4Q94A 3LEWA 5CHEE 2QY7A 3SBSA 1IQRA 2LSVA 1TEZA 5KJLA 4Y6WA 4NQ0A 5FZRA 2R17C 3P1UA 4HOUA 5FQ6A 3D9PA 4K0RA 3MGBA 1NP7A 3EJNA 1OWMA 2HO1A 2WXGA 3UT4A 3TG5A 5FQ7A 1X5BA 4LERA 5JJ6A 4GMJA 2Q7FA 4G25A 3QB2A 4IN3B 3K9IA 3JQ0A 2V8SE 2VGYA 4JEUA 4CEMA 3QDNA 1H0AA 1SZAA 1LF8A 3JUIA 3BEEA 1OUVA 3PNLB 3FU0A 1SQMA 2J49A 4RSYA 3RRNB 4HOSA 2WM9A 3ASFA 4A3VA 3ESKA 3LS8A 4C0EA 5CMWA 2WXHA 3MKQA 3KS2A 5FJYA 3MA5A 3CR3A 3FTXA 3HHMA 1HF8A 1MQSA 2MHKA 5FQ8A 3DBSA 2CHWA 2E2EA 4UQYA 3QWWA 5M72A 4QFVA 3I5PA 2JEKA 2VSXE 4EPZA 1U3DA 5A6CA 3AS4A 4TV3A 4HS2A 2AXUA 1JWFA 4BSXA 2I2OA 2KCVA 3D9OA 3KEZA 4GAAA 5G05C 2VTBA 4HFGA 3UMVA 3QC1A 3Q5MA 4MS6A 2KCLA 3D9LA 3CVUA 3L13A 3CK9A 3FY4A 1S0PA 2C0MA 2X6IA 4XZ4A 3FUHA 4EQFA 2XEVA 2QFCA 5EDSA 3D9JA 2XGMA 4PS7A 4UWKA 3MYVA 3S7FA 1E7UA 3IBEA 4FLHA 4ANWA 2VTBB 4AP2A 4Q69A 2R59A 2WQ7A 1HZ4A 4ILHB 4UWHA 3FUEA 3S7DA 2IU1A 3HIZA 5CCLA 4IULA 2PM7A 4KZCA 4GB9A 3PH0C 3MZLB 4KVMA 1ELKA 3TL5A 1UJKA 4HXIA 4ILIA 2A4ZA 1E8ZA 1GW6A 3PS6A 2WMOA 4BFRA 2CFZA 2I1JA 4IYPA 2AXVA 4YVOA 1H2TC 4CGWA 4JEHA 2WXPA 2FO7A 2L0IA 4N5CA 1NZNA 1ELRA 2YHCA 1QQEA 2BTDA 4U07A 2PQRA 2PQNA 3ZYLA 4XIFA 4EBAA 2WXQA 3ML9A 4JZYA 2XCCA 1INZA 4V3IA 1Z6TA 2Y3AA 4N39A 3EHNA 5FZQA 5G05J 5LCWJ 3I4GA 3QJZA 3ZYMA 3NZSA 4UQZA 4U0ZA 5EX0A 4GA1A 3CIAA 4FULA 3QAQA 2PM6A 4KZ0A 1N52A 4ACLA 4B94A 2V5FA 1HG2A 1DVPA 3LCAA 4M3OA 4DLOA 5KJMA 3MCXA 2WXJA 3OTNA 3LY7A 3Q47B 2J4DA 3TG4A 4OYSA 2CHZA 5JJ7A 1H2UA 3PE4A 4APOA 4G23A 4AIFA 1Y6IA 3FTUA 1UJJA 3TGOA 3O4ZA 1OWOA 1E96B 4ACKA 3S7BA 4AJWA 1HX8A 4LCTA 1H19A 4XKBA 3R9AB 3VLFA 5HI7A 5C2YA 1IHGA 3HYMB 3Q4AB 2OV8A 3CHOA 1N54A 2CG2A 3L08A 5T8IA 4E85A 3DPDA 5FZSA 4BX9A 3ASDA 5BT1A 3SF4A 2L9BA 3JQ1A 4JW1A 5CMYA 3LVRE 4RG9A 4AVXA 5CCMA 3L54A 3B7TA 3L16A 5JHBA 4JPSA 1E8XA 5G04C 1ZBPA 3ZW3A 4CDNA 1VDYA 3CVLA 3GW4A 2WXNA 4WNFA 1KT1A 2HM8A 3L22A 5BPPA 2OOEA 4CT0A 4AOFA 3PREA 1ELWA 4FHJA 3PZDA 3CSFA 4XKCA 3FFLA 3OXLA 3SZ7A 3CVWA 4G24A 4J6IA 2NSZA 2WXKA 3SFZA 2FULA 2UWJG 4F1SA 2MOWA 4GCNA 5DIZA 3SGHA 3ONKA 4B89A 4GU5A 2XRYA 4U8HA 1KT0A 4FA6A 5D0QD 3FWVA 3URZA 2DBAA 1KLXA 4JA7A 1UW4B 2IOSA 4PDXA 4L23A 4JHKA 4XX5A 4B8CB 4UI9K 4I6EA 4I2ZA 2FEZA 2YNQA 3IHVA 1SZ9A 3PNTB 1HO8A 2LAIA 3B7UX 2LNIA 3ZYQA 1Z3YA 4GA2A 3CVYA 2IFUA 1NA0A 3FUJA 3APDA 5EKQD 4I2WA 3ULQA 4R7LA 3IHYA 5G04J 4BX8A 1E90A 1NA3A 2VSNA 5BW8C 1XGWA 5EX3A 2LAHA 1W3BA 4GCOA 4ME2A 5LCWC 4HORA 3RU0A 2XGOA 5E75A 4AV7A 3I3NA 5LFAA 3FUNA 4I6JA 4WWNA 1H2VC 3S7JA 3LKUA 4NURA 3FU3A 2FF4A 3FU5A 1HFAA 2V4LA 3D3MA 3E4BA 3BG1B 4N3BA 1HE8A 2XQ0A 4XI0A 4JA9A 2J09A 3U66A 3RKVA 3IV0A 4J8SA 4DPRA 5JHAA 3FEXA 4H7XA 4F7AA 4YNDA 3G2UA 2OVBA 5HQ8A 3RIBA 4JVSA 3SHFA 2KM4A 2IF4A 3CVNA 3L17A 3ZN3A 1JUQA 4BWRA 3VTYA 1E7VA 2RD0A 2BF0X 1JWGA 2XPIA 3G2SA 1JPLA 3LPZA 4J8DA 2KCKA 4GYYA 2WQHA 3R7QA 4FC8A 1WY6A 4GA0A 2IJGX 5T3RA 1EPUA 2HR2A 2J08A 4RVBA 3OXFA 3QOUA 5LP0A 4B8AA 3QWPA 1UG3A 4D10C 1UN9A 1WAO1 3G2WA 4WAFA 3ZFWA 4EECA 3LY9A 1A17A 3CHSA 1QZ2A 1E8YA 3PVLA 5C1DA 4WNGA 3QNKA 3NQPA 3PUKA 2VYIA 3FTVA 3HVEA 2KATA 4PUCA 4FP7A 2UY1B 5E76A 5LOZA 5DBKA 2J07A 5FT9A 3FTSA 2DIWA 2KZTA 1MHQA 3ML8A 5A7DB 2GW1A 3PRZA 4F53A 4EZJA 4EBAG 3QARA 4G11A 2J4BA 4E6HA 4TUUA 3HVEB 3CQCB 1YA0A 3GYZA 4GZCA 4U0UA 4A3TA 2A5UA 3UX4A 5BUZA 3FH8A 3FUFA 5ENNA 4CT4A 2PZIA 3IEGA 5FWQA 3N71A 2L0TB 2KZTB 3FP3A 4KVOA 4L7TA 3U64A 3VTXA 4G2VA 3AS8A 4NACA 3PDNA 3RO3A 2P58C 3OXGA 2AW6A 3D9KA 2L6JA 5BNWA 1H6KA 2R5SA 3CK7A 2MRIA 4GZ3A 3SNXA 4A1GA 4FADA 2XGSA 3CHPA 3CKCA 2CHXA 3BG0B 3ASGA 4ANVA 4MKTA 4I1MA 4JL0A 2WXRA 1ZU2A 4L1BA 2KC7A 4JC8A 3MKRA 2OVFA 3TAXA 2WQ6A 4JHJA 1FCHA 2HYZA 2X6KA 2X6FA 1FVFA 5ANLA 4AEZC 3OAWA 4RG6A 4DI3A 3TXMA 3EIJA 3U3WA 4XI9A 4J0UA 3UPVA 2ILRA 3PE3A 4DI4A 2VGXB 4ABNA 4ANUA 2X38A 3I4RB 4DK5A 3EIQC 2WVIA 3CLJA 5JJTA 3ZEFA 2YQ8A 4O6FA 3C98A 3KD7A 4B0ZA 2XCBA 5FTPA 4KXKB 4H7YA 3ZYKA 4MRUA 2CFUA 2VQ2A 4G26A 1U3CA 2DCPA 1IYGA 2Y4TA 3CK8A 5LX8A 5KJNA 3FUMA 4FLBA 2IQCA 5AJDA 4L2YA 4DLQA 2Y4UA 2WB2A 3CVQA 2FI7A 4LRZA 3P2BA 3VLEA 2WMNA 4FJZA 4WNDA 3D9IA 4OVUA 2ONDA 2C2LA 3QKYA 2CG3A 4PS8A 4EZKA 1PC2A 3FDHA 3Q15A 4BTAA 3D9MA 3KAEA 4APFA 5AENA 3HDXA 4GZ6A 4I9CA 1TJFA 4GZDA 4KMOA 3JYSA 4HOTA 4HVBA 4GYWA 2WXLA 5G55A 4PH4B 3FUKA 3ZVVA 3ZHEB 4CGVA 4I43A 2EQXA 2E0IA 3SD5A 4DJAA 3ZPJA 3MJWA 4C0MA 4KYOB 5KJKA 1PY1A 3U4TA 2XRZA 2WXMA 4K03A 4LEUA 3RRMB 4HLEA 4BY6A 4N2QA 1B89A 3ENEA 1QNFA 4JXTA 3LY8A 4GYOA 1EDUA 4P29A 4UWFA 3TJPA 3ZXSA 2C0LA 3ZIMA 4AY6A 2I6HA 4YVQC 4W9RA 2IOLA 1L5JA 1PAQA 3ZGQA 4Y6CA 4CDMA 1TJCA 4UQXA 4WWOA 5D0OD 2GRLA 4GPKA 4AY5A 1HH8A 3Q49B 3G2VA 3CSTA 3GZ1A 2BUGA 4I6GA 3LDZA 3PEUB 4BT8A 3MKQB 4N2SA 3NF1A 1EF1C 2XHEA 5T4YA 3IKOB 2VJ8A 3CKBA 4I1OB 3G2TA 5ANRA 2FBNA 3T5VA 2YINA 5BV0A 3CVXA 3FTWA 2UY1A 1OWLA 3MV2B 1OWPA 3NZUA 5ARGA 3GZ2A 3PUJA 3QWVA 2WXOA 4GZ5A 4J8EA 1OWNA 4CCAA 3UUXA 2WXFA 4CRWA 2M63A 1UN8A 2WXIA 4IRUA 2XPZA 3AU4A 4TRQA 4WWPA 4I1AA 3L6AA 4U04A 3ASHA 3FU6A 4ATGA 3CVPA 1Z3XA 2VSYA 1HG5A 3CHRA 1HXIA 5BV1A 3D9NA 2JLBA 2NXPA 2WPVA 4UI9C 3RO2A 2GRMA 2LO6A 5KCMA 5A23A 1Y8MA 4KT6B 2X6HA 4NRHB 2GGFA 3RK6A 3FEYA 1P5QA 4MLPA 3MEKA 3FUDA 4EZLA 4LUNU 2YHEA 4Q96A 2VSOE 3T8MA 4JHRA 3APCA 4PS3A 4U0SA 4N3AA 4L2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDT B;  4G1T A;  4HOQ A;  2AVP A;  4BT9 A;  4N3C A;  2LSU A;  3UQ3 A;  2VGX A;  4AM9 A;  2NC9 A;  2PL2 A;  4A1S A;  4BTB A;  4I17 A;  3RJV A;  4CDR A;  4UI9 J;  5AYW D;  3CV0 A;  3MV3 B;  4F3V A;  4WNE A;  4WUY A;  5ARF A;  4KBQ A;  2J9Q A;  1XNF A;  1WM5 A;  3LYA A;  4J8F A;  4I9E A;  3WXX A;  3AS5 A;  3ZHE A;  3CEQ A;  3O48 A;  5CHE E;  2LSV A;  5KJL A;  4Y6W A;  4NQ0 A;  5FZR A;  4HOU A;  2HO1 A;  3TG5 A;  5JJ6 A;  2Q7F A;  4G25 A;  4IN3 B;  3K9I A;  2VGY A;  3QDN A;  3BEE A;  1OUV A;  4HOS A;  3ASF A;  3ESK A;  3KS2 A;  5FJY A;  3MA5 A;  2MHK A;  4UQY A;  2E2E A;  3QWW A;  5M72 A;  5A6C A;  3AS4 A;  2KCV A;  5G05 C;  3Q5M A;  2KCL A;  3CK9 A;  4EQF A;  2C0M A;  2XEV A;  2QFC A;  2XGM A;  3S7F A;  1HZ4 A;  3S7D A;  5CCL A;  4CGW A;  4YVO A;  2FO7 A;  4N5C A;  1NZN A;  1ELR A;  2YHC A;  1QQE A;  4U07 A;  2PQR A;  2PQN A;  4XIF A;  2XCC A;  5G05 J;  5LCW J;  4N39 A;  5FZQ A;  4UQZ A;  4U0Z A;  5EX0 A;  4GA1 A;  4B94 A;  2V5F A;  3LCA A;  5KJM A;  3LY7 A;  3Q47 B;  3TG4 A;  5JJ7 A;  3PE4 A;  4APO A;  4G23 A;  4AIF A;  3TGO A;  1E96 B;  3S7B A;  3R9A B;  5HI7 A;  1IHG A;  3HYM B;  3Q4A B;  5FZS A;  3ASD A;  5BT1 A;  3SF4 A;  4RG9 A;  5CCM A;  5G04 C;  1ZBP A;  3CVL A;  3GW4 A;  4WNF A;  1KT1 A;  2OOE A;  1ELW A;  3SZ7 A;  3FFL A;  3OXL A;  4G24 A;  2UWJ G;  4GCN A;  5DIZ A;  1KT0 A;  5D0Q D;  3FWV A;  3URZ A;  2DBA A;  1KLX A;  4JA7 A;  4UI9 K;  4I2Z A;  2FEZ A;  2LNI A;  4GA2 A;  2IFU A;  1NA0 A;  5EKQ D;  4I2W A;  3ULQ A;  5G04 J;  1NA3 A;  2VSN A;  5BW8 C;  5EX3 A;  1W3B A;  4GCO A;  4ME2 A;  5LCW C;  4HOR A;  3RU0 A;  2XGO A;  3S7J A;  3LKU A;  2FF4 A;  3E4B A;  4N3B A;  4XI0 A;  4JA9 A;  3RKV A;  4H7X A;  4YND A;  5HQ8 A;  3RIB A;  2IF4 A;  3CVN A;  3ZN3 A;  4BWR A;  3VTY A;  2XPI A;  3LPZ A;  4J8D A;  2KCK A;  4GYY A;  2WQH A;  4GA0 A;  2HR2 A;  3OXF A;  3QOU A;  3QWP A;  1WAO 1;  3ZFW A;  3LY9 A;  1A17 A;  1QZ2 A;  5C1D A;  4WNG A;  2VYI A;  2KAT A;  2UY1 B;  5DBK A;  5FT9 A;  5A7D B;  2GW1 A;  3GYZ A;  1YA0 A;  4U0U A;  2PZI A;  3IEG A;  3N71 A;  3FP3 A;  3VTX A;  4G2V A;  3AS8 A;  3PDN A;  3RO3 A;  2P58 C;  3OXG A;  2L6J A;  5BNW A;  2R5S A;  3CK7 A;  4GZ3 A;  2XGS A;  3CKC A;  3ASG A;  4JL0 A;  1ZU2 A;  2KC7 A;  3MKR A;  3TAX A;  1FCH A;  2HYZ A;  4RG6 A;  3U3W A;  4XI9 A;  4J0U A;  3UPV A;  3PE3 A;  2VGX B;  4ABN A;  5JJT A;  2YQ8 A;  4O6F A;  3KD7 A;  2XCB A;  5FTP A;  4KXK B;  4H7Y A;  2VQ2 A;  4G26 A;  1IYG A;  2Y4T A;  3CK8 A;  5KJN A;  2Y4U A;  3CVQ A;  2FI7 A;  4WND A;  2OND A;  2C2L A;  3QKY A;  1PC2 A;  3Q15 A;  4BTA A;  3KAE A;  4GZ6 A;  4I9C A;  4HOT A;  3JYS A;  4GYW A;  3ZHE B;  4CGV A;  3ZPJ A;  4KYO B;  5KJK A;  3U4T A;  4LEU A;  4N2Q A;  1B89 A;  3LY8 A;  4GYO A;  2C0L A;  4AY6 A;  2I6H A;  4YVQ C;  4W9R A;  3ZGQ A;  4Y6C A;  1TJC A;  4UQX A;  5D0O D;  4GPK A;  4AY5 A;  1HH8 A;  3Q49 B;  3GZ1 A;  2BUG A;  4BT8 A;  4N2S A;  3NF1 A;  3CKB A;  2FBN A;  2UY1 A;  3MV2 B;  5ARG A;  3GZ2 A;  3QWV A;  4J8E A;  4GZ5 A;  3UUX A;  4I1A A;  4U04 A;  3ASH A;  3CVP A;  2VSY A;  1HXI A;  2JLB A;  2WPV A;  4UI9 C;  3RO2 A;  1Y8M A;  4NRH B;  1P5Q A;  3MEK A;  4JHR A;  4U0S A;  4N3A A; 
#chains in the Genus database with same CATH topology
 3QK0 A;  1YMP A;  5ENR D;  2KXP C;  3FTZ A;  2RG8 A;  4N3C A;  1BPO A;  4ANX A;  4M7C A;  3FH7 A;  3FUL A;  2XEH A;  3NOC D;  3UIO C;  3APF A;  3FHE A;  3PEV B;  1X81 A;  3CVV A;  3Q73 A;  4U63 A;  4F3V A;  3ESL A;  3SI5 A;  2XPY A;  3FUI A;  4KBQ A;  3CHQ A;  3JCK C;  1EYH A;  2V0P A;  3LYA A;  3WXX A;  2QC9 A;  3TXN A;  3FH5 A;  3NAW A;  3UT7 A;  3CEQ A;  3R7R A;  4EHM A;  3O48 A;  3LEW A;  5CHE E;  2QY7 A;  3SBS A;  5D2M C;  4K0R A;  1OWM A;  5FQ7 A;  4G25 A;  3QB2 A;  3TWU A;  3BEE A;  1OUV A;  3PNL B;  1SQM A;  4HOS A;  3LS8 A;  4C0E A;  3MKQ A;  5FJY A;  3TWS A;  3CR3 A;  3FTX A;  1HF8 A;  2CHW A;  2E2E A;  1TN7 A;  4QFV A;  3ASO E;  4EPZ A;  5G05 C;  1BI7 B;  4BER A;  2KCL A;  3CVU A;  4OAV B;  3L13 A;  2C0M A;  4XZ4 A;  5EDS A;  2QFC A;  4HB5 A;  2R05 A;  1KPS B;  3S7F A;  5AQB A;  2R59 A;  5B1B E;  3ZNG A;  2IU1 A;  3E32 A;  2PM7 A;  3PH0 C;  1ELK A;  1E8Z A;  3PS6 A;  4CGW A;  2L0I A;  1NZN A;  1ELR A;  1QQE A;  2BTD A;  4U07 A;  2PQR A;  2ETA A;  3ZYL A;  2Y3A A;  4N39 A;  1MJ0 A;  4FUL A;  3ABK E;  2F8Y A;  4ACL A;  3C72 A;  2V5F A;  1HG2 A;  2WXJ A;  3OTN A;  4G23 A;  1E96 B;  3S7B A;  2J8S D;  1IHG A;  3BQO A;  3UKU G;  3L08 A;  4XEI G;  5FZS A;  4BX9 A;  4JW1 A;  4RG9 A;  5CCM A;  5JHB A;  4JPS A;  1MX2 A;  2R03 A;  3J5P A;  2IY0 C;  4WNF A;  1N4R A;  1KT1 A;  1FPP A;  1O1T A;  4N5Q A;  3SY2 A;  3ONK A;  3NBN B;  4HBD A;  4DUI A;  3FWV A;  3JXJ A;  2DBA A;  3SFX A;  3TWX A;  4L23 A;  4JHK A;  4I6E A;  3DSU A;  1SZ9 A;  5FIN A;  2RFM A;  3B7U X;  3CVY A;  1NA0 A;  5EKQ D;  3KSL A;  1XGW A;  1DC2 A;  1W3B A;  2DWZ A;  2QYJ A;  4WWN A;  3SO8 A;  3S7J A;  4NUR A;  3FU3 A;  3FU5 A;  3E4B A;  3BG1 B;  4N3B A;  4RQI A;  4XI0 A;  1RZ4 A;  2EIJ E;  3JXI A;  3G2U A;  5HQ8 A;  4TXP A;  2EIK E;  3D9H A;  3Q7F A;  3SHF A;  2KM4 A;  2IF4 A;  3CVN A;  3DSX A;  2RD0 A;  1JWG A;  3LPZ A;  4J8D A;  4FC8 A;  3UXG A;  3NB2 A;  1BI8 B;  1SA4 A;  2HR2 A;  2J08 A;  3OXF A;  3QWP A;  4D10 C;  3G2W A;  4EEC A;  3LY9 A;  1E8Y A;  3PVL A;  3QNK A;  3AG2 E;  2VYI A;  3FTV A;  4PUC A;  2GRR B;  5CEC B;  5DBK A;  4ZHB A;  1DCE A;  5FT9 A;  2DIW A;  2KZT A;  2GW1 A;  1SW6 A;  3PRZ A;  3CQC B;  1YA0 A;  2B6C A;  3BUA A;  2IEJ A;  5FWQ A;  3N71 A;  3TWT A;  2OEW A;  5KNG A;  1H6K A;  3CHP A;  3EU5 A;  1OCZ E;  4MKT A;  4BSZ B;  4I1M A;  4JL0 A;  2WXR A;  2KC7 A;  3MKR A;  2HYZ A;  2X6F A;  5EIB E;  3TXM A;  3UPV A;  2VGX B;  4ABN A;  4ANU A;  4DK5 A;  3EIQ C;  2WVI A;  3CLJ A;  3ZEF A;  4O6F A;  5FIO A;  4MRU A;  1TYQ G;  1U3C A;  2DCP A;  2Y4T A;  4BET A;  5LX8 A;  5KJN A;  5AJD A;  2WB2 A;  3CVQ A;  4LRZ A;  3P2B A;  2WMN A;  4OVU A;  5CBO A;  3EU9 A;  4PS8 A;  4EZK A;  2V5Q C;  4OAU C;  1PC2 A;  2DVW A;  4HI8 A;  4KMO A;  1IHB A;  3E33 A;  2WXL A;  5ENS D;  3ZVV A;  1N95 A;  2EQX A;  4C0M A;  1PY1 A;  3U4T A;  1TN8 A;  2EIM E;  2WXM A;  3RAU A;  3ENE A;  3TWQ A;  4P29 A;  1N0Q A;  4AY6 A;  2I6H A;  4YVQ C;  2IOL A;  3UI2 A;  4Y6C A;  1TJC A;  2GRL A;  4GPK A;  3GZ1 A;  2ZXW E;  3LDZ A;  3C3Q A;  4O1P A;  2FBN A;  3ZKJ A;  5ARG A;  5ITZ F;  4CCA A;  4GTM A;  3UUX A;  4CRW A;  2M63 A;  3B95 A;  4IRU A;  4WWP A;  2GRP B;  3CVP A;  2XS8 A;  5EN5 D;  3CHR A;  4DX5 D;  3DPY A;  2WPV A;  4LNB A;  2GRM A;  2GGF A;  4MLP A;  3FUD A;  2VSO E;  4BX8 A;  3EDT B;  2AVP A;  5BXU A;  4BT9 A;  1LTX A;  3AU5 A;  2NC9 A;  2PL2 A;  5G2N A;  4LG6 A;  2AWI A;  3B13 A;  2AXZ A;  3R9M A;  1BU9 A;  4ILG A;  3IXE A;  4UWG A;  4WNE A;  2X3M A;  4WUY A;  3LXU X;  1DNP A;  3ISM C;  4UWL A;  1XNF A;  2GRO B;  3HG0 D;  1WM5 A;  4J8F A;  3MX3 A;  4I9E A;  5AN8 A;  5ENP D;  3B7S A;  3SBT B;  1V55 E;  3ZHE A;  3UT8 A;  2LSV A;  1TEZ A;  4Y6W A;  4JB8 P;  4NQ0 A;  5FQ6 A;  3D9P A;  3EJN A;  3AG4 E;  4LER A;  2Q7F A;  1MYO A;  4IN3 B;  3JQ0 A;  2V8S E;  4JEU A;  5CEA A;  2XS1 A;  3FU0 A;  2J49 A;  4A3V A;  3ESK A;  4J7W A;  2WXH A;  4DX7 D;  5IY5 E;  4UQY A;  5M72 A;  2JEK A;  1U3D A;  5A6C A;  2ZGG A;  4HS2 A;  2I2O A;  2KCV A;  3KEZ A;  3Q5M A;  3D9L A;  1H6O A;  3CK9 A;  4EQF A;  1N4S A;  3D9J A;  4UWK A;  2XGM A;  4PS7 A;  4ANW A;  3IBE A;  2R2L A;  4FLH A;  2VTB B;  4AP2 A;  4ILH B;  3S7D A;  5CCL A;  4IUL A;  3PZ1 A;  4GB9 A;  4KVM A;  3MZL B;  5CRU A;  2A4Z A;  5EID A;  2I1J A;  4YVO A;  4JEH A;  1K1B A;  4N5C A;  4ZFH A;  2PQN A;  4JZY A;  2XCC A;  1INZ A;  3I4G A;  2RFA A;  3QJZ A;  4UQZ A;  5EX0 A;  2PM6 A;  1OY3 D;  2R02 A;  4M3O A;  3MCX A;  3LY7 A;  3TG4 A;  4OYS A;  3DSV A;  4APO A;  4AIF A;  1Y6I A;  3O4Z A;  2H6I A;  1G3N B;  3DEP A;  2BED A;  4XKB A;  3R9A B;  1K3Z D;  3HYM B;  2OV8 A;  3J5Q B;  1N54 A;  4E85 A;  3ASD A;  3SF4 A;  2L9B A;  5CMY A;  3UM0 A;  4GTR A;  4U7E B;  3L22 A;  5BPP A;  2OOE A;  3PRE A;  3CSF A;  3ABL E;  3FFL A;  3OXL A;  3CVW A;  4J6I A;  1D8E A;  3SFZ A;  2FO1 E;  3SGH A;  3T9K A;  2QYU A;  5D0Q D;  1KLX A;  2IOS A;  4PDX A;  1N11 A;  4XX5 A;  4B8C B;  1S70 B;  2FEZ A;  2YNQ A;  1HO8 A;  2LAI A;  2OEV A;  3APD A;  4LSZ E;  3ULQ A;  5G04 J;  4K5A B;  1NA3 A;  5BW8 C;  4HOR A;  2XGO A;  1H2V C;  3LKU A;  5AAO A;  3EHR A;  3D3M A;  2V4L A;  2XQ0 A;  4JA9 A;  2J09 A;  1FT2 A;  3V2X A;  4DPR A;  4LNU D;  4MBG A;  1JUQ A;  4BWR A;  3VTY A;  1E7V A;  1LD8 A;  2BF0 X;  2XPI A;  2WQH A;  2P9U G;  2XEN A;  1WY6 A;  1EPU A;  1N0R A;  5LP0 A;  1UN9 A;  1WAO 1;  4WAF A;  2ZIS A;  4Z68 A;  4FP7 A;  5LOZ A;  2J07 A;  3UTM A;  3FTS A;  1FT1 A;  3ML8 A;  2ZGD A;  4F53 A;  3QAR A;  4E6H A;  3HVE B;  4GZC A;  4U0U A;  4A3T A;  5BUZ A;  2PZI A;  3IEG A;  4KVO A;  2HE0 A;  3U64 A;  3AS8 A;  4NAC A;  3HXD A;  3PDN A;  3RO3 A;  2P58 C;  2R5S A;  4O1O A;  2MRI A;  4GMR A;  4GZ3 A;  4FAD A;  2XGS A;  3CKC A;  2CHX A;  4ANV A;  4JC8 A;  3TAX A;  1YCS B;  3OAW A;  4DI3 A;  3U3W A;  4XI9 A;  2ILR A;  4DI4 A;  2P9P G;  1N9A A;  2X38 A;  2YQ8 A;  3W9F A;  3KD7 A;  2XCB A;  1OCR E;  4KXK B;  4H7Y A;  2CFU A;  2P2C P;  1IYG A;  2GRQ B;  3FUM A;  3DXK G;  3VLE A;  3L9T A;  2OND A;  2CG3 A;  3HXB A;  4APF A;  3HDX A;  4GZ6 A;  4I9C A;  4GYW A;  5G55 A;  4PH4 B;  5ENT D;  3MJW A;  1TNO A;  4BES A;  3UM2 A;  4K03 A;  4LEU A;  3ZXP A;  4HLE A;  4BY6 A;  3LY8 A;  1EDU A;  3ZUV B;  4UWF A;  3TJP A;  2C0L A;  2LXM A;  3Q78 A;  3MKQ B;  1EF1 C;  5T4Y A;  3IKO B;  2VJ8 A;  3CKB A;  3G2T A;  3CVX A;  2DZO A;  5BV0 A;  2UY1 A;  3MV2 B;  3GZ2 A;  3QWV A;  4YDO A;  4GZ5 A;  3UM1 A;  1NFI E;  4CYM D;  4TRQ A;  3L6A A;  3FU6 A;  4ATG A;  1Z3X A;  1HG5 A;  5BV1 A;  2NXP A;  5KCM A;  4UUC A;  2X6H A;  4NRH B;  4HRN A;  3FEY A;  4EZL A;  1NI1 A;  4JHR A;  3ZW3 A;  4U0S A;  2ZU6 B;  4G1T A;  3ULE G;  2LSU A;  3UQ3 A;  3SFY A;  1HU3 A;  4JD2 G;  3S2A A;  3VLD A;  5KWD A;  4I17 A;  2LUH A;  3RJV A;  1TNB A;  3B7R L;  1E8W A;  4UI9 J;  4FU3 A;  3FTY A;  2ION A;  4GML A;  3PZ2 A;  4A55 A;  5J08 A;  2V4H C;  4GTT A;  3CGH A;  3ZRH A;  5J90 A;  3LVQ E;  1IQU A;  3AS5 A;  4URK A;  1HS6 A;  5KJL A;  4YDY A;  3MGB A;  2WXG A;  3K9I A;  4K5C A;  4CEM A;  3QDN A;  1H0A A;  1LF8 A;  4RSY A;  3ASF A;  5CMW A;  3KS2 A;  1MQS A;  1BD8 A;  3DBS A;  3I5P A;  3AS4 A;  4TV3 A;  2AXU A;  2VTB A;  3D9O A;  4HFG A;  3QC1 A;  4MS6 A;  1S0P A;  3FUH A;  2XEV A;  1KZO A;  1E7U A;  4Q69 A;  2WQ7 A;  1HZ4 A;  4GTV A;  1O5M A;  4UWH A;  4GTP A;  5D66 A;  3FUE A;  3HIZ A;  4HNA D;  2WMO A;  4BFR A;  2CFZ A;  4IYP A;  2AXV A;  3Q7A A;  1H2T C;  2WXP A;  2FO7 A;  4EBA A;  4XIF A;  2WXQ A;  1Z6T A;  5G05 J;  5FZQ A;  3EHN A;  5B3S E;  1S64 A;  3NZS A;  4U0Z A;  3CIA A;  4KZ0 A;  2KBX A;  3Q47 B;  5HKP A;  1MX4 A;  5JJ7 A;  1H2U A;  3FTU A;  1UJJ A;  3TGO A;  4ACK A;  2XZD G;  3VLF A;  3BU8 A;  1TR4 A;  3CHO A;  2CG2 A;  2NYJ A;  4GTQ A;  5T8I A;  3V30 A;  3LVR E;  4AVX A;  1A5E A;  3CVL A;  3GW4 A;  1BLX B;  5CRV A;  2HM8 A;  2IO3 C;  1ELW A;  3PZD A;  2H6G A;  4XKC A;  4G24 A;  2NSZ A;  2WXK A;  2FUL A;  4F1S A;  4GCN A;  1RW2 A;  4B89 A;  1O1R A;  2XRY A;  4U8H A;  1KT0 A;  4JA7 A;  1N4Q A;  4UI9 K;  4I2Z A;  3IHV A;  2LNI A;  4G8L A;  3ZYQ A;  4U8Y D;  2IFU A;  3FUJ A;  4R7L A;  3UKR G;  2LAH A;  4GCO A;  4ME2 A;  5LCW C;  5ENO D;  4HRL A;  1OCC E;  5E75 A;  4AV7 A;  5LFA A;  4I6J A;  1KZP A;  3DWL G;  1HFA A;  1JCS A;  1HE8 A;  3U66 A;  4O60 A;  4TXQ A;  5JHA A;  3FEX A;  4H7X A;  4YND A;  3V31 A;  2KCK A;  4GYY A;  3R7Q A;  5T3R A;  2IJG X;  2RKK A;  3AG1 E;  3QOU A;  1UG3 A;  1QBQ A;  1WDY A;  3WG7 E;  5C1D A;  4WNG A;  3NQP A;  3HVE A;  2KAT A;  1V54 E;  5E76 A;  2VGE A;  4TXR A;  5EYP F;  4EBA G;  4G11 A;  2A5U A;  3UX4 A;  4YDE A;  5ENN A;  4GPM A;  3FP3 A;  2F8X K;  4NIK A;  2AW6 A;  3ASG A;  2OVF A;  2WQ6 A;  1FCH A;  1FVF A;  1MX6 A;  4AEZ C;  1TNZ A;  4RG6 A;  3EIJ A;  3ASN E;  3TWW A;  3ABM E;  2EIN E;  3W9G A;  4DLQ A;  4L2Y A;  2Y4U A;  1YYH A;  1O1S A;  4FJZ A;  2Y0B G;  1ZB1 A;  4WND A;  1TNU A;  3KAE A;  4HRM B;  3JYS A;  4HVB A;  3SQV A;  1Q2Z A;  4CZ2 D;  1MZC A;  3ZHE B;  4I43 A;  4DX2 A;  2B0O E;  4DJA A;  3ZPJ A;  2XRZ A;  3EHQ A;  3RRM B;  1OXJ A;  4N2Q A;  1QNF A;  4JXT A;  4GYO A;  3ZXS A;  3KSQ A;  3ZIM A;  1L5J A;  1PAQ A;  4UQX A;  5D0O D;  4YDW A;  4AY5 A;  3CST A;  2LXL A;  4I6G A;  3PEU B;  1S63 A;  3HRA A;  4BT8 A;  4N2S A;  4HI9 A;  4U96 D;  2YIN A;  3FTW A;  1OWP A;  3NZU A;  3C3R A;  3UIP C;  2WXO A;  4J8E A;  1OWN A;  2WXF A;  4B93 B;  1UN8 A;  2WXI A;  2P9I G;  2XPZ A;  1IXV A;  3ASH A;  1H6P A;  3HXF A;  4F6R D;  2VSY A;  1HXI A;  3D9N A;  5A23 A;  3ULY A;  1Y8M A;  1K1A A;  3AJI A;  1K8K G;  1P5Q A;  3MEK A;  4Q96 A;  1JCR A;  3T8M A;  1AWC B;  3DEO A;  3APC A;  4L9P A;  4N3A A;  3Q79 A;  4L2L A;  4HOQ A;  3GZS A;  3Q9N C;  4FHK A;  2VGX A;  1FVH A;  4AM9 A;  5FQ4 A;  4U95 D;  4X8Q A;  2DYR E;  3V2O A;  4A63 B;  4A1S A;  4OVV A;  1Z5S C;  4BTB A;  2X6J A;  3LJ3 A;  3NOG D;  3CQG B;  3U9W A;  4CDR A;  1JCQ A;  4C9B B;  2I1K A;  5AYW D;  3CV0 A;  3MV3 B;  4FJY A;  5AJL A;  3CHM A;  2I9C A;  3RSE G;  2XEE A;  3RRU A;  2Y69 E;  5ARF A;  5AQ9 A;  5AIJ A;  3ONL A;  2J9Q A;  4DX1 A;  4XE0 A;  3T5X A;  2OCC E;  3PZ4 A;  3EHM A;  4AXH A;  4Q94 A;  1IQR A;  5FZR A;  2R17 C;  3P1U A;  4HOU A;  1NP7 A;  2ETB A;  2HO1 A;  3UT4 A;  3TG5 A;  2EIL E;  1X5B A;  5JJ6 A;  4GMJ A;  5KBA A;  3C3O A;  2VGY A;  3T8K A;  1SZA A;  3AG3 E;  3JUI A;  2ETC A;  3RRN B;  2WM9 A;  2JAB A;  3DSS A;  1D8D A;  3MA5 A;  3HHM A;  2MHK A;  5FQ8 A;  4DRX E;  3QWW A;  2L6B A;  2VSX E;  4QQI A;  1JWF A;  4BSX A;  4GAA A;  1TNY A;  3UMV A;  3FY4 A;  2X6I A;  1SA5 A;  3MYV A;  5EIL A;  3DSW A;  3DST A;  1OT8 A;  4KZC A;  3TL5 A;  4J8Y A;  4LNG A;  1UJK A;  4HXI A;  4ILI A;  1GW6 A;  2DZN A;  3TWR A;  2YHC A;  3ML9 A;  2H6H A;  4V3I A;  5LCW J;  3ZYM A;  4GA1 A;  3QAQ A;  1N52 A;  4B94 A;  1DVP A;  3LCA A;  4DLO A;  5KJM A;  2J4D A;  2CHZ A;  3X2Q E;  3PE4 A;  5CED B;  1OWO A;  4AJW A;  1SVX A;  1HX8 A;  4LCT A;  4F1P A;  1H19 A;  3Q9U C;  2DYS E;  5HI7 A;  5C2Y A;  4HLL A;  5AQA A;  3Q4A B;  3EUV A;  2P9N G;  3DPD A;  2QZA A;  4U8V D;  1N94 A;  5BT1 A;  3JQ1 A;  1U2V G;  3B7T A;  3L54 A;  1D9S A;  3L16 A;  5JMN D;  5AQ7 A;  1E8X A;  5G04 C;  1ZBP A;  4CDN A;  5CBN A;  1VDY A;  2ZIR A;  2WXN A;  4CT0 A;  4AOF A;  4FHJ A;  3SZ7 A;  1UOH A;  2UWJ G;  2MOW A;  5DIZ A;  3PZ3 A;  4GU5 A;  4FA6 A;  3KEA A;  3URZ A;  1OCO E;  1UW4 B;  2BKK B;  2AJA A;  1IKN D;  3PNT B;  1N4P A;  1Z3Y A;  4GA2 A;  4TUM A;  4I2W A;  2XZT G;  3IHY A;  2BKG A;  1E90 A;  2VSN A;  5EX3 A;  5BXO A;  3RU0 A;  3I3N A;  3L82 A;  3FUN A;  2FF4 A;  2P9S G;  3Q75 A;  3ZU7 B;  3RKV A;  3IV0 A;  4GTS A;  4J8S A;  5H7P A;  4F7A A;  2OVB A;  3RIB A;  4JVS A;  3ZN3 A;  3L17 A;  1DCQ A;  3G2S A;  1JPL A;  3E37 A;  4DX6 D;  4GA0 A;  4RVB A;  4B8A A;  3V79 K;  4RLY A;  3ZFW A;  1A17 A;  3CHS A;  1QZ2 A;  3PUK A;  2IO2 C;  2UY1 B;  3F6Q A;  3UM3 A;  1MHQ A;  5A7D B;  4GTO A;  4EZJ A;  2J4B A;  4TUU A;  3GYZ A;  1WG0 A;  3FH8 A;  1NL4 A;  2P9K G;  3FUF A;  4CT4 A;  2F37 A;  2L0T B;  2KZT B;  4K5B A;  4L7T A;  5HS0 A;  3VTX A;  4G2V A;  3OXG A;  3D9K A;  2L6J A;  5BNW A;  3CK7 A;  2A5E A;  3SNX A;  4A1G A;  4BEP A;  3BG0 B;  3C5R A;  1ZU2 A;  5KNH D;  4L1B A;  4JHJ A;  2X6K A;  5ANL A;  4J0U A;  3PE3 A;  3I4R B;  5JJT A;  3C98 A;  4B0Z A;  5FTP A;  3ZYK A;  2VQ2 A;  4G26 A;  5AAR A;  4G8K A;  3AAA C;  2F0Y A;  3CK8 A;  4FLB A;  2IQC A;  2FI7 A;  1TN6 A;  3D9I A;  3DRA A;  2C2L A;  2MYO A;  3QKY A;  4HQD A;  3FDH A;  3Q15 A;  4BTA A;  2H6F A;  3D9M A;  5ENQ D;  5AEN A;  3TWV A;  1TJF A;  1QYM A;  4GZD A;  5EYL A;  4HOT A;  2Y1L E;  3FUK A;  3JUE A;  4CGV A;  2E0I A;  3SD5 A;  1LD7 A;  4KYO B;  5KJK A;  1B89 A;  5HRY A;  2P9L G;  4W9R A;  3ZGQ A;  4CDM A;  4WWO A;  1AP7 A;  4C48 B;  5JA4 D;  1HH8 A;  3Q49 B;  3G2V A;  2PNN A;  2BUG A;  3DXM G;  3NF1 A;  2XHE A;  4I1O B;  3HXE A;  5ANR A;  3T5V A;  5CER B;  1OWL A;  2GRN B;  3PUJ A;  3HXC A;  3LJN A;  4ATZ D;  5B1A E;  3B7B A;  3AU4 A;  4I1A A;  4U04 A;  3UIN C;  3E34 A;  2JLB A;  4UI9 C;  3RO2 A;  2LO6 A;  3E30 A;  4KT6 B;  3RK6 A;  4LUN U;  2YHE A;  4PS3 A; 
#chains in the Genus database with same CATH homology
 3EDT B;  3QK0 A;  2ZU6 B;  4G1T A;  4HOQ A;  3GZS A;  2AVP A;  3FTZ A;  4BT9 A;  2RG8 A;  4N3C A;  2LSU A;  4FHK A;  3AU5 A;  1BPO A;  2VGX A;  3UQ3 A;  1FVH A;  2NC9 A;  4AM9 A;  2PL2 A;  5FQ4 A;  4ANX A;  5G2N A;  2AWI A;  3FH7 A;  3FUL A;  4A1S A;  3B13 A;  4OVV A;  1HU3 A;  3S2A A;  3VLD A;  4BTB A;  2X6J A;  2AXZ A;  3LJ3 A;  4I17 A;  3CQG B;  3APF A;  3RJV A;  3FHE A;  3U9W A;  3B7R L;  4CDR A;  1E8W A;  3PEV B;  4C9B B;  4ILG A;  3CVV A;  4UI9 J;  2I1K A;  5AYW D;  3CV0 A;  3MV3 B;  4FU3 A;  4FJY A;  4U63 A;  4UWG A;  4WNE A;  3FTY A;  3ESL A;  2X3M A;  5AJL A;  4F3V A;  3CHM A;  2I9C A;  3SI5 A;  2ION A;  4WUY A;  4GML A;  3RRU A;  2XPY A;  5ARF A;  3FUI A;  3LXU X;  1DNP A;  4KBQ A;  4A55 A;  5AIJ A;  3ONL A;  3CHQ A;  3JCK C;  5J08 A;  4UWL A;  2J9Q A;  3CGH A;  3ZRH A;  1EYH A;  1XNF A;  2V0P A;  5J90 A;  1WM5 A;  3LYA A;  4J8F A;  4XE0 A;  3T5X A;  3MX3 A;  3LVQ E;  4I9E A;  3TXN A;  1IQU A;  3B7S A;  3FH5 A;  3WXX A;  3AS5 A;  3SBT B;  3UT7 A;  4URK A;  3ZHE A;  3CEQ A;  1HS6 A;  3EHM A;  3R7R A;  3UT8 A;  4AXH A;  3O48 A;  4Q94 A;  3LEW A;  5CHE E;  2QY7 A;  3SBS A;  1IQR A;  2LSV A;  1TEZ A;  5KJL A;  4Y6W A;  4NQ0 A;  5FZR A;  2R17 C;  3P1U A;  4HOU A;  5FQ6 A;  3D9P A;  4K0R A;  3MGB A;  1NP7 A;  3EJN A;  1OWM A;  2HO1 A;  2WXG A;  3UT4 A;  3TG5 A;  5FQ7 A;  1X5B A;  4LER A;  5JJ6 A;  4GMJ A;  2Q7F A;  4G25 A;  3QB2 A;  4IN3 B;  3K9I A;  3JQ0 A;  2V8S E;  2VGY A;  4JEU A;  4CEM A;  3QDN A;  1H0A A;  1SZA A;  1LF8 A;  3JUI A;  3BEE A;  1OUV A;  3PNL B;  3FU0 A;  1SQM A;  2J49 A;  4RSY A;  3RRN B;  4HOS A;  2WM9 A;  3ASF A;  4A3V A;  3ESK A;  3LS8 A;  4C0E A;  5CMW A;  2WXH A;  3MKQ A;  3KS2 A;  5FJY A;  3MA5 A;  3CR3 A;  3FTX A;  3HHM A;  1HF8 A;  1MQS A;  2MHK A;  5FQ8 A;  3DBS A;  2CHW A;  2E2E A;  4UQY A;  3QWW A;  5M72 A;  4QFV A;  3I5P A;  2JEK A;  2VSX E;  4EPZ A;  1U3D A;  5A6C A;  3AS4 A;  4TV3 A;  4HS2 A;  2AXU A;  1JWF A;  4BSX A;  2I2O A;  2KCV A;  3D9O A;  3KEZ A;  4GAA A;  5G05 C;  2VTB A;  4HFG A;  3UMV A;  3QC1 A;  3Q5M A;  4MS6 A;  2KCL A;  3D9L A;  3CVU A;  3L13 A;  3CK9 A;  3FY4 A;  1S0P A;  2C0M A;  2X6I A;  4XZ4 A;  3FUH A;  4EQF A;  2XEV A;  2QFC A;  5EDS A;  3D9J A;  2XGM A;  4PS7 A;  4UWK A;  3MYV A;  3S7F A;  1E7U A;  3IBE A;  4FLH A;  4ANW A;  2VTB B;  4AP2 A;  4Q69 A;  2R59 A;  2WQ7 A;  1HZ4 A;  4ILH B;  4UWH A;  3FUE A;  3S7D A;  2IU1 A;  3HIZ A;  5CCL A;  4IUL A;  2PM7 A;  4KZC A;  4GB9 A;  3PH0 C;  3MZL B;  4KVM A;  1ELK A;  3TL5 A;  1UJK A;  4HXI A;  4ILI A;  2A4Z A;  1E8Z A;  1GW6 A;  3PS6 A;  2WMO A;  4BFR A;  2CFZ A;  2I1J A;  4IYP A;  2AXV A;  4YVO A;  1H2T C;  4CGW A;  4JEH A;  2WXP A;  2FO7 A;  2L0I A;  4N5C A;  1NZN A;  1ELR A;  2YHC A;  1QQE A;  2BTD A;  4U07 A;  2PQR A;  2PQN A;  3ZYL A;  4XIF A;  4EBA A;  2WXQ A;  3ML9 A;  4JZY A;  2XCC A;  1INZ A;  4V3I A;  1Z6T A;  2Y3A A;  4N39 A;  3EHN A;  5FZQ A;  5G05 J;  5LCW J;  3I4G A;  3QJZ A;  3ZYM A;  3NZS A;  4UQZ A;  4U0Z A;  5EX0 A;  4GA1 A;  3CIA A;  4FUL A;  3QAQ A;  2PM6 A;  4KZ0 A;  1N52 A;  4ACL A;  4B94 A;  2V5F A;  1HG2 A;  1DVP A;  3LCA A;  4M3O A;  4DLO A;  5KJM A;  3MCX A;  2WXJ A;  3OTN A;  3LY7 A;  3Q47 B;  2J4D A;  3TG4 A;  4OYS A;  2CHZ A;  5JJ7 A;  1H2U A;  3PE4 A;  4APO A;  4G23 A;  4AIF A;  1Y6I A;  3FTU A;  1UJJ A;  3TGO A;  3O4Z A;  1OWO A;  1E96 B;  4ACK A;  3S7B A;  4AJW A;  1HX8 A;  4LCT A;  1H19 A;  4XKB A;  3R9A B;  3VLF A;  5HI7 A;  5C2Y A;  1IHG A;  3HYM B;  3Q4A B;  2OV8 A;  3CHO A;  1N54 A;  2CG2 A;  3L08 A;  5T8I A;  4E85 A;  3DPD A;  5FZS A;  4BX9 A;  3ASD A;  5BT1 A;  3SF4 A;  2L9B A;  3JQ1 A;  4JW1 A;  5CMY A;  3LVR E;  4RG9 A;  4AVX A;  5CCM A;  3L54 A;  3B7T A;  3L16 A;  5JHB A;  4JPS A;  1E8X A;  5G04 C;  1ZBP A;  3ZW3 A;  4CDN A;  1VDY A;  3CVL A;  3GW4 A;  2WXN A;  4WNF A;  1KT1 A;  2HM8 A;  3L22 A;  5BPP A;  2OOE A;  4CT0 A;  4AOF A;  3PRE A;  1ELW A;  4FHJ A;  3PZD A;  3CSF A;  4XKC A;  3FFL A;  3OXL A;  3SZ7 A;  3CVW A;  4G24 A;  4J6I A;  2NSZ A;  2WXK A;  3SFZ A;  2FUL A;  2UWJ G;  4F1S A;  2MOW A;  4GCN A;  5DIZ A;  3SGH A;  3ONK A;  4B89 A;  4GU5 A;  2XRY A;  4U8H A;  1KT0 A;  4FA6 A;  5D0Q D;  3FWV A;  3URZ A;  2DBA A;  1KLX A;  4JA7 A;  1UW4 B;  2IOS A;  4PDX A;  4L23 A;  4JHK A;  4XX5 A;  4B8C B;  4UI9 K;  4I6E A;  4I2Z A;  2FEZ A;  2YNQ A;  3IHV A;  1SZ9 A;  3PNT B;  1HO8 A;  2LAI A;  3B7U X;  2LNI A;  3ZYQ A;  1Z3Y A;  4GA2 A;  3CVY A;  2IFU A;  1NA0 A;  3FUJ A;  3APD A;  5EKQ D;  4I2W A;  3ULQ A;  4R7L A;  3IHY A;  5G04 J;  4BX8 A;  1E90 A;  1NA3 A;  2VSN A;  5BW8 C;  1XGW A;  5EX3 A;  2LAH A;  1W3B A;  4GCO A;  4ME2 A;  5LCW C;  4HOR A;  3RU0 A;  2XGO A;  5E75 A;  4AV7 A;  3I3N A;  5LFA A;  3FUN A;  4I6J A;  4WWN A;  1H2V C;  3S7J A;  3LKU A;  4NUR A;  3FU3 A;  2FF4 A;  3FU5 A;  1HFA A;  2V4L A;  3D3M A;  3E4B A;  3BG1 B;  4N3B A;  1HE8 A;  2XQ0 A;  4XI0 A;  4JA9 A;  2J09 A;  3U66 A;  3RKV A;  3IV0 A;  4J8S A;  4DPR A;  5JHA A;  3FEX A;  4H7X A;  4F7A A;  4YND A;  3G2U A;  2OVB A;  5HQ8 A;  3RIB A;  4JVS A;  3SHF A;  2KM4 A;  2IF4 A;  3CVN A;  3L17 A;  3ZN3 A;  1JUQ A;  4BWR A;  3VTY A;  1E7V A;  2RD0 A;  2BF0 X;  1JWG A;  2XPI A;  3G2S A;  1JPL A;  3LPZ A;  4J8D A;  2KCK A;  4GYY A;  2WQH A;  3R7Q A;  4FC8 A;  1WY6 A;  4GA0 A;  2IJG X;  5T3R A;  1EPU A;  2HR2 A;  2J08 A;  4RVB A;  3OXF A;  3QOU A;  5LP0 A;  4B8A A;  3QWP A;  1UG3 A;  4D10 C;  1UN9 A;  1WAO 1;  3G2W A;  4WAF A;  3ZFW A;  4EEC A;  3LY9 A;  1A17 A;  3CHS A;  1QZ2 A;  1E8Y A;  3PVL A;  5C1D A;  4WNG A;  3QNK A;  3NQP A;  3PUK A;  2VYI A;  3FTV A;  3HVE A;  2KAT A;  4PUC A;  4FP7 A;  2UY1 B;  5E76 A;  5LOZ A;  5DBK A;  2J07 A;  5FT9 A;  3FTS A;  2DIW A;  2KZT A;  1MHQ A;  3ML8 A;  5A7D B;  2GW1 A;  3PRZ A;  4F53 A;  4EZJ A;  4EBA G;  3QAR A;  4G11 A;  2J4B A;  4E6H A;  4TUU A;  3HVE B;  3CQC B;  1YA0 A;  3GYZ A;  4GZC A;  4U0U A;  4A3T A;  2A5U A;  3UX4 A;  5BUZ A;  3FH8 A;  3FUF A;  5ENN A;  4CT4 A;  2PZI A;  3IEG A;  5FWQ A;  3N71 A;  2L0T B;  2KZT B;  3FP3 A;  4KVO A;  4L7T A;  3U64 A;  3VTX A;  4G2V A;  3AS8 A;  4NAC A;  3PDN A;  3RO3 A;  2P58 C;  3OXG A;  2AW6 A;  3D9K A;  2L6J A;  5BNW A;  1H6K A;  2R5S A;  3CK7 A;  2MRI A;  4GZ3 A;  3SNX A;  4A1G A;  4FAD A;  2XGS A;  3CHP A;  3CKC A;  2CHX A;  3BG0 B;  3ASG A;  4ANV A;  4MKT A;  4I1M A;  4JL0 A;  2WXR A;  1ZU2 A;  4L1B A;  2KC7 A;  4JC8 A;  3MKR A;  2OVF A;  3TAX A;  2WQ6 A;  4JHJ A;  1FCH A;  2HYZ A;  2X6K A;  2X6F A;  1FVF A;  5ANL A;  4AEZ C;  3OAW A;  4RG6 A;  4DI3 A;  3TXM A;  3EIJ A;  3U3W A;  4XI9 A;  4J0U A;  3UPV A;  2ILR A;  3PE3 A;  4DI4 A;  2VGX B;  4ABN A;  4ANU A;  2X38 A;  3I4R B;  4DK5 A;  3EIQ C;  2WVI A;  3CLJ A;  5JJT A;  3ZEF A;  2YQ8 A;  4O6F A;  3C98 A;  3KD7 A;  4B0Z A;  2XCB A;  5FTP A;  4KXK B;  4H7Y A;  3ZYK A;  4MRU A;  2CFU A;  2VQ2 A;  4G26 A;  1U3C A;  2DCP A;  1IYG A;  2Y4T A;  3CK8 A;  5LX8 A;  5KJN A;  3FUM A;  4FLB A;  2IQC A;  5AJD A;  4L2Y A;  4DLQ A;  2Y4U A;  2WB2 A;  3CVQ A;  2FI7 A;  4LRZ A;  3P2B A;  3VLE A;  2WMN A;  4FJZ A;  4WND A;  3D9I A;  4OVU A;  2OND A;  2C2L A;  3QKY A;  2CG3 A;  4PS8 A;  4EZK A;  1PC2 A;  3FDH A;  3Q15 A;  4BTA A;  3D9M A;  3KAE A;  4APF A;  5AEN A;  3HDX A;  4GZ6 A;  4I9C A;  1TJF A;  4GZD A;  4KMO A;  3JYS A;  4HOT A;  4HVB A;  4GYW A;  2WXL A;  5G55 A;  4PH4 B;  3FUK A;  3ZVV A;  3ZHE B;  4CGV A;  4I43 A;  2EQX A;  2E0I A;  3SD5 A;  4DJA A;  3ZPJ A;  3MJW A;  4C0M A;  4KYO B;  5KJK A;  1PY1 A;  3U4T A;  2XRZ A;  2WXM A;  4K03 A;  4LEU A;  3RRM B;  4HLE A;  4BY6 A;  4N2Q A;  1B89 A;  3ENE A;  1QNF A;  4JXT A;  3LY8 A;  4GYO A;  1EDU A;  4P29 A;  4UWF A;  3TJP A;  3ZXS A;  2C0L A;  3ZIM A;  4AY6 A;  2I6H A;  4YVQ C;  4W9R A;  2IOL A;  1L5J A;  1PAQ A;  3ZGQ A;  4Y6C A;  4CDM A;  1TJC A;  4UQX A;  4WWO A;  5D0O D;  2GRL A;  4GPK A;  4AY5 A;  1HH8 A;  3Q49 B;  3G2V A;  3CST A;  3GZ1 A;  2BUG A;  4I6G A;  3LDZ A;  3PEU B;  4BT8 A;  3MKQ B;  4N2S A;  3NF1 A;  1EF1 C;  2XHE A;  5T4Y A;  3IKO B;  2VJ8 A;  3CKB A;  4I1O B;  3G2T A;  5ANR A;  2FBN A;  3T5V A;  2YIN A;  5BV0 A;  3CVX A;  3FTW A;  2UY1 A;  1OWL A;  3MV2 B;  1OWP A;  3NZU A;  5ARG A;  3GZ2 A;  3PUJ A;  3QWV A;  2WXO A;  4GZ5 A;  4J8E A;  1OWN A;  4CCA A;  3UUX A;  2WXF A;  4CRW A;  2M63 A;  1UN8 A;  2WXI A;  4IRU A;  2XPZ A;  3AU4 A;  4TRQ A;  4WWP A;  4I1A A;  3L6A A;  4U04 A;  3ASH A;  3FU6 A;  4ATG A;  3CVP A;  1Z3X A;  2VSY A;  1HG5 A;  3CHR A;  1HXI A;  5BV1 A;  3D9N A;  2JLB A;  2NXP A;  2WPV A;  4UI9 C;  3RO2 A;  2GRM A;  2LO6 A;  5KCM A;  5A23 A;  1Y8M A;  4KT6 B;  2X6H A;  4NRH B;  2GGF A;  3RK6 A;  3FEY A;  1P5Q A;  4MLP A;  3MEK A;  3FUD A;  4EZL A;  4LUN U;  2YHE A;  4Q96 A;  2VSO E;  3T8M A;  4JHR A;  3APC A;  4PS3 A;  4U0S A;  4N3A A;  4L2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...