4AIFA

Aip tpr domain in complex with human hsp90 peptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
144
structure length
144
Chain Sequence
b'AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARIRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AH RECEPTOR-INTERACTING PROTEIN
publication title Structure of the Tpr Domain of Aip: Lack of Client Protein Interaction with the C-Terminal Alpha-7 Helix of the Tpr Domain of Aip is Sufficient for Pituitary Adenoma Predisposition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 62
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4aifA00
4I1AA 3CKBA 4U04A 3Q49B 3FFLA 5C1DA 3LY8A 2XGSA 1QZ2A 5ARFA 2C0MA 3S7FA 3O48A 1NA3A 5CHEE 3S7JA 3MV3B 4F3VA 2BUGA 5G05C 4G24A 3SZ7A 1P5QA 4G26A 3TGOA 3GYZA 1PC2A 2R5SA 1W3BA 4AY6A 1HZ4A 4WNGA 2VGXA 2KCLA 2ONDA 3UUXA 3ZFWA 2XEVA 3MEKA 5G04J 2XGMA 4HOSA 1WAO1 3CEQA 3ASDA 4JA7A 1KT0A 2IF4A 4Y6CA 5HI7A 3LY9A 4RG6A 3LY7A 3TG5A 4YVQC 3ESKA 4NRHB 4XIFA 3QOUA 3OXFA 5CCLA 4J0UA 2Y4UA 1ELWA 4KXKB 2FF4A 3CVNA 3JYSA 3QWPA 4HORA 5JJ6A 4ME2A 5FZQA 3LPZA 5BW8C 4B94A 4N3AA 2E2EA 2WQHA 3CV0A 3URZA 3GZ2A 2YHCA 3HYMB 4G2VA 2VQ2A 5D0QD 4GA0A 4BT8A 2XGOA 5AYWD 2J9QA 5A6CA 3OXLA 1OUVA 2GW1A 4GZ3A 3MV2B 2PL2A 5HQ8A 2HYZA 5A7DB 4G25A 2PQRA 3PDNA 2AVPA 4LEUA 2FI7A 5KJMA 4J8DA 2OOEA 2HO1A 3LKUA 4AM9A 4UQYA 4EQFA 4G1TA 4GA1A 2LSUA 4CGVA 1NZNA 1KLXA 5EKQD 1YA0A 3WXXA 5LCWC 3RU0A 3RIBA 4CDRA 4WNEA 2XCBA 4I9EA 3RO3A 4NQ0A 5KJNA 3E4BA 3KS2A 5G05J 3VTXA 5LCWJ 1IYGA 4YVOA 3S7BA 3GZ1A 4XI0A 3TG4A 2MHKA 5FZRA 2JLBA 2IFUA 2FEZA 3EDTB 3KAEA 4JL0A 2FBNA 2KC7A 4HOTA 4W9RA 3Q15A 3N71A 4WNFA 1E96B 2Q7FA 5DBKA 4IN3B 4JA9A 3QKYA 4U0SA 4I2ZA 5FT9A 2KCVA 5JJ7A 2KATA 3PE4A 4N2QA 4U07A 4UQZA 5M72A 2I6HA 3GW4A 4UQXA 3BEEA 4AY5A 3S7DA 1IHGA 4UI9C 3CVQA 3UPVA 3ASHA 3RJVA 2Y4TA 4GPKA 1WM5A 4GYOA 3R9AB 4G23A 5ARGA 3FWVA 1ZU2A 4WUYA 4GCOA 4H7XA 3ZHEB 3ZHEA 4HOUA 4KYOB 1XNFA 2V5FA 4O6FA 4CGWA 4I17A 3CVLA 3CK9A 4GCNA 5EX0A 3Q47B 2P58C 2VYIA 2C0LA 1TJCA 1Y8MA 4J8FA 2LNIA 3ZN3A 5FTPA 2VGYA 3Q5MA 2PZIA 2QFCA 3MKRA 2DBAA 1NA0A 4N2SA 4WNDA 4GA2A 2YQ8A 2XPIA 3ULQA 5G04C 2L6JA 3UQ3A 4U0ZA 4BTBA 3QWVA 5FJYA 3CK8A 5BNWA 4Y6WA 3SF4A 4UI9K 4KBQA 5KJLA 3QDNA 2VGXB 2VSNA 3AS5A 3CVPA 4N39A 5FZSA 3U3WA 1KT1A 3AS4A 3CKCA 2HR2A 4H7YA 4A1SA 3PE3A 3AS8A 1FCHA 3LYAA 3U4TA 3ASGA 3VTYA 2NC9A 4N3CA 3RO2A 5CCMA 2KCKA 3OXGA 4YNDA 3CK7A 2XCCA 3QWWA 5KJKA 1A17A 2LSVA 2C2LA 4GZ5A 3NF1A 3IEGA 3TAXA 3K9IA 2WPVA 3KD7A 4U0UA 3FP3A 4I2WA 2UY1B 2VSYA 3ZGQA 4AIFA 1HH8A 4JHRA 2UY1A 2UWJG 5BT1A 4GYYA 4APOA 4BWRA 4ABNA 4HOQA 1HXIA 2PQNA 3LCAA 5EX3A 3ZPJA 3ASFA 4N3BA 3RKVA 4BT9A 4BTAA 4I9CA 1QQEA 1B89A 2FO7A 3Q4AB 5D0OD 4GYWA 1ZBPA 4N5CA 3MA5A 4XI9A 1ELRA 5DIZA 5JJTA 4UI9J 4J8EA 4RG9A 4GZ6A
chains in the Genus database with same CATH superfamily
2JABA 4I1AA 4U04A 4F53A 3FU0A 2XGSA 2CHWA 3V2XA 4TXRA 4FHKA 3BU8A 4ANWA 3O48A 1Y6IA 4YDOA 4JW1A 1DCQA 5G05C 2PM6A 4NURA 1YMPA 3GYZA 4JZYA 4WNGA 4C48B 1WDYA 1KZOA 2WXIA 4F6RD 4X8QA 3ZFWA 2X6HA 5G04J 4HOSA 4JHJA 1OWPA 2BEDA 4JXTA 3ULYA 1KPSB 4RG6A 3J5PA 4GAAA 4U8YD 2DYSE 3QOUA 3TXNA 5D66A 4KXKB 4DX2A 2L0TB 5ENPD 3JYSA 4TXQA 4CDMA 4HORA 4PS7A 1IXVA 1S64A 5BW8C 3PUJA 3PS6A 1E8ZA 2LXLA 2WQHA 3F6QA 4BX8A 3URZA 3GZ2A 4B89A 3UM1A 2YHCA 2H6FA 2VQ2A 2IEJA 5CEDB 5D0QD 4GA0A 3L9TA 3ZXSA 4B8AA 2XGOA 2J9QA 1NP7A 3OXLA 2GW1A 3APDA 5FQ7A 4GZ3A 4JB8P 4KVMA 2PL2A 5A7DB 4GTQA 1QYMA 3AG3E 2QZAA 5CERB 2PQRA 1OWMA 4J8DA 3G2VA 2F8YA 2OOEA 2HO1A 3LKUA 4AM9A 3QB2A 3EHQA 4CGVA 3LEWA 4L23A 2OEVA 4WAFA 2Y3AA 2XS1A 5EKQD 2X6IA 4WWPA 2P9SG 1MX6A 3RU0A 3CVYA 5ANRA 1HFAA 3UTMA 4CDRA 4EBAA 4KVOA 3PNTB 4L7TA 4BESA 2CHZA 5EN5D 1OCOE 3KEAA 3LXUX 5KJNA 4ILGA 4BEPA 3SY2A 1H2VC 3GZSA 5G05J 2XHEA 3S7BA 5EYLA 3Q7FA 5B3SE 1H6KA 4LNGA 3GZ1A 3ULEG 4XKBA 2VTBA 3TG4A 3UKUG 3DXMG 4BY6A 3P1UA 5CBOA 5B1BE 3X2QE 3PVLA 3SFZA 2KZTB 3L82A 3SQVA 2X38A 5ENQD 1H6OA 5FQ6A 3QKYA 2WXOA 2GRQB 5T3RA 1S63A 2KCVA 1NFIE 5CRVA 3OTNA 3JUEA 4J7WA 5M72A 3D9MA 4MBGA 2CHXA 4G8KA 2L6BA 3GW4A 2QYUA 3Q75A 4UQXA 4UI9C 3UPVA 1JUQA 4U7EB 3RJVA 3HXDA 1WM5A 3SFXA 4APFA 4HB5A 3FWVA 4UWGA 4H7XA 2QC9A 1JCRA 3RRUA 4M7CA 3AG4E 3PZ2A 2X6KA 2BKGA 1Q2ZA 4O6FA 1SA4A 2XS8A 3BQOA 3EJNA 4U8HA 2OEWA 2VYIA 3DRAA 2A4ZA 1PAQA 1TJCA 2J09A 4J8SA 2GRPB 3EU9A 2LAIA 2LNIA 3FTZA 3AAAC 4I1OB 2PZIA 3MKRA 4EZLA 4GZDA 2XRZA 2OCCE 4F1SA 4GA2A 2YQ8A 3PZ1A 2XPIA 3PEVB 1UW4B 3CHMA 1E90A 3FH5A 2F0YA 3SD5A 4U0ZA 4EECA 2YINA 2PNNA 3CK8A 5AENA 4KZCA 4UI9K 1N52A 5E75A 4CCAA 4FLHA 3PZDA 1N11A 3FH7A 1LTXA 5FQ8A 3MKQB 3ZW3A 4JHKA 3KSLA 4N39A 5FZSA 2ZISA 1KT1A 1K8KG 5AQAA 4A1SA 2I1KA 3PE3A 3CHQA 3QAQA 3AS8A 1X5BA 4YDYA 3U4TA 4ACKA 3D9NA 2NC9A 3RO2A 3D9HA 3NBNB 2Y1LE 3PUKA 3CQCB 2WB2A 2WMNA 5KJKA 2C2LA 3D9JA 3SBTB 3FUIA 1SZ9A 3MCXA 4U0UA 4AVXA 4DUIA 3EIQC 2ZGDA 2ILRA 4GTPA 4EZKA 4HOQA 1HE8A 4Q94A 2WXPA 2XZTG 5EX3A 3ZPJA 3RKVA 4JD2G 4BT9A 2XEHA 1B89A 3Q4AB 4PS8A 4GYWA 4AV7A 3NOGD 3EUVA 4GB9A 3ZEFA 3MA5A 3Q73A 4UI9J 4DI3A 2XPYA 4RG9A 4GZ6A 3CKBA 1HG5A 4DX7D 3MX3A 3MZLB 3LY8A 4DX1A 5JMND 3ZNGA 1SZAA 2IONA 1K1BA 4FP7A 4O60A 4L2LA 4TXPA 1OCCE 2WXKA 3L17A 4JPSA 3S7JA 3CSTA 1O5MA 3ZXPA 4AJWA 4E6HA 4G26A 2CFZA 1PC2A 2R5SA 2R05A 4K5AB 1W3BA 4GU5A 1UN8A 1OWOA 3NZUA 3APFA 2ONDA 1S0PA 3AG1E 3FTUA 3J5QB 3KEZA 3FTSA 4ANXA 3DEPA 2VTBB 3ASDA 3DWLG 4XKCA 3TJPA 4Y6CA 3AU5A 2IOLA 2QYJA 3ESKA 4XX5A 1UJKA 2EIJE 3OXFA 3R9MA 2V4LA 3FY4A 3QWPA 4XEIG 3TWWA 1DCEA 2PM7A 2DZNA 5HKPA 2GRRB 2V4HC 1E8YA 3FUMA 1Z6TA 5JHAA 3TWVA 1IHBA 4G2VA 1EF1C 5A6CA 3FUJA 4RLYA 2J8SD 2WXGA 2MYOA 3FH8A 4HFGA 1FPPA 4G25A 1SQMA 3ENEA 3PDNA 2MOWA 5G2NA 4LEUA 3CIAA 3L6AA 2FI7A 5AQBA 1E8WA 3LJNA 4UQYA 4EQFA 1JPLA 2VSXE 1OCRE 1TNYA 3FDHA 2OV8A 2IOSA 2GRMA 2I1JA 2R59A 4BX9A 4GTSA 3FUDA 3ZYLA 4LNBA 2AWIA 1FVHA 3RIBA 4HNAD 3TL5A 1K3ZD 3B7TA 4HRLA 4I9EA 5LFAA 3HXEA 4YDEA 3FHEA 2VJ8A 4LNUD 4NQ0A 3DBSA 3ZIMA 3ZRHA 1OCZE 2WXQA 5J90A 3ZYQA 2OVBA 4CYMD 3DSUA 2P9PG 1QBQA 3KS2A 3VTXA 4YVOA 1MZCA 2QY7A 4LG6A 3RSEG 5EYPF 1O1SA 4GMLA 1INZA 2A5EA 1WG0A 2IFUA 4FULA 1MYOA 2WVIA 1X81A 3C72A 2EINE 4C0MA 2FEZA 2FBNA 3EHRA 4DRXE 3EU5A 3N71A 5KNHD 4WNFA 3BG0B 2CG2A 5T4YA 2Q7FA 4JA9A 3C3QA 3U9WA 2V5QC 5JJ7A 4ATZD 4ZFHA 4N2QA 3C3OA 4U07A 3EHMA 4UQZA 2I6HA 5BXOA 4HRMB 3BEEA 3ASOE 4AY5A 3S7DA 1TNBA 3V79K 3CVQA 4ILHB 3ASHA 2DYRE 2X3MA 1BI7B 3JUIA 3B7SA 1PY1A 4G23A 5ARGA 3IHYA 4WUYA 4IRUA 1TN8A 3ZHEA 2GRLA 3NAWA 4OAVB 3WG7E 3E34A 1D8DA 1Z5SC 2WXMA 3R7QA 3D9IA 3CK9A 4A3VA 4I6JA 5AAOA 4GCNA 5KNGA 3KSQA 5EX0A 1IQRA 5A23A 3I4GA 4A3TA 2C0LA 2YHEA 4ILIA 3PEUB 3B7BA 4DLQA 2J08A 3VLDA 3OAWA 3QARA 5D2MC 4UWLA 2XEEA 3PNLB 3UIPC 1N4SA 1TNZA 2DBAA 1ZB1A 5CEAA 3IHVA 2AJAA 4Z68A 4JEUA 1TN7A 1UOHA 3UQ3A 4QFVA 3TWRA 3CLJA 3HXCA 3JQ0A 2EILE 3NZSA 4I1MA 4LUNU 5KJLA 3ZU7B 1HX8A 1N9AA 4B8CB 3CHSA 2VSNA 4I6EA 1AP7A 3LYAA 2LXMA 3FUHA 4HVBA 1JWGA 5CCMA 2KCKA 1O1TA 2V0PA 3TWUA 2XCCA 1A5EA 4CZ2D 4IULA 2Y0BG 3T8KA 4GZ5A 4RVBA 2AW6A 3HHMA 3IEGA 4A55A 2X6JA 2P2CP 3K9IA 1BD8A 4F7AA 4AOFA 2WXLA 4TUUA 4WWOA 2WM9A 3ZGQA 1HH8A 2UY1A 3P2BA 3BUAA 1N95A 4APOA 2LO6A 4BWRA 4ABNA 4LERA 2R03A 2V8SE 2FULA 3T8MA 3ASFA 3MGBA 4BTAA 1N0QA 4FHJA 4I9CA 1H19A 1WY6A 4DX6D 4G11A 2E0IA 4U8VD 3EHNA 4UWHA 3UT7A 4J8EA 4ATGA 2WXJA 3B13A 3Q49B 3LVQE 3FU5A 3S2AA 4I6GA 4CT0A 4RSYA 5IY5E 5ARFA 4FJYA 3S7FA 3TWXA 2DVWA 5CHEE 3MV3B 4B0ZA 1D8EA 1HS6A 2BUGA 4HI9A 4G24A 3TWQA 4D10C 2IY0C 1P5QA 1H2TC 1K1AA 2J07A 4AY6A 2RG8A 2VGXA 4AEZC 1JCQA 3DSVA 5CECB 4KMOA 3MEKA 2XGMA 4ACLA 3L16A 4U95D 1WAO1 3CEQA 2B0OE 4JA7A 3HXFA 3HVEA 5HI7A 3LY7A 5BPPA 2L9BA 4YVQC 4NRHB 3CHRA 4XIFA 4UUCA 3AG2E 4J0UA 3SBSA 3UM2A 1ELWA 2FF4A 3CQGB 3CVNA 4LSZE 3U64A 1MHQA 5JJ6A 4NACA 4N3AA 2L0IA 5AJDA 4C9BB 4K03A 2R02A 2LAHA 4OVUA 3DEOA 5KBAA 1V55E 2RFAA 3HRAA 1TN6A 4BT8A 4HXIA 3PREA 4HLEA 2P9KG 4DI4A 1U3CA 3MV2B 5BV1A 4QQIA 2HYZA 3EIJA 1LF8A 2IO2C 4V3IA 4XE0A 2AVPA 2MRIA 5KJMA 4IYPA 1Z3XA 1D9SA 2VGEA 3DPYA 3CVXA 3Q9UC 2XRYA 1UN9A 1MX4A 4GA1A 2LSUA 2B6CA 1KLXA 2XQ0A 1YA0A 2CG3A 3FUKA 4FADA 3D3MA 5BXUA 1AWCB 3G2TA 3DPDA 2NXPA 4MKTA 4WNEA 4GTOA 2XCBA 4HS2A 3RRNB 4GMJA 3SNXA 2ETBA 3V31A 2NSZA 1H0AA 4K5CA 1S70B 5ANLA 3E4BA 2WXRA 2WXHA 3CVWA 5LCWJ 1BI8B 2Y69E 3D9PA 1YCSB 2GGFA 2MHKA 5KWDA 5FZRA 2JLBA 1N54A 3IBEA 5ENRD 2WMOA 4DK5A 2H6HA 3EDTB 3KAEA 4JL0A 4HOTA 5B1AE 3W9GA 1N0RA 3Q15A 4LCTA 1O1RA 3DXKG 3ML8A 1GW6A 1E96B 4FC8A 5ENSD 4I2ZA 2ETAA 2P9UG 2KATA 3L22A 3PE4A 4E85A 4M3OA 2OVFA 2WXFA 2ZU6B 3AJIA 2FO1E 1TYQG 3MJWA 4GYOA 3Q79A 3PZ3A 3RAUA 4GCOA 2RKKA 1SVXA 5LOZA 4KYOB 1N4PA 1XNFA 3HXBA 3ABME 1EYHA 2GRNB 2V5FA 3RK6A 2R2LA 4I17A 3CVLA 3SI5A 2ZIRA 3CGHA 2F37A 3CR3A 4PH4B 4O1OA 3Q47B 2P58C 3PH0C 3FTWA 1SW6A 4Q96A 1Y8MA 5FTPA 2VGYA 4CRWA 3Q5MA 1L5JA 2QFCA 2EIME 3UXGA 1E8XA 4N2SA 3L54A 4Q69A 5G55A 2R17C 4HQDA 1IQUA 2DIWA 2NYJA 4JC8A 3ULQA 5BNWA 3SF4A 1BLXB 4URKA 3IV0A 4CT4A 4I43A 4KBQA 5LP0A 3FTYA 5EILA 2KXPC 4U96D 2VGXB 5AQ7A 5AARA 2DWZA 3NQPA 3B7RL 3MKQA 3AS5A 2AXZA 1N4RA 1OXJA 3AS4A 3CKCA 3APCA 2ZGGA 2HR2A 4H7YA 1EPUA 5EDSA 2H6IA 4ANUA 1FCHA 3SFYA 3ASGA 3Q78A 3VTYA 4WWNA 2BKKB 3HVEB 3OXGA 5CBNA 3E33A 3G2SA 2P9LG 4BETA 1E7UA 1A17A 5ENOD 1RW2A 3ML9A 3RRMB 3NF1A 3MYVA 3TAXA 4FU3A 4EZJA 3AU4A 3V30A 1H6PA 2IQCA 3G2WA 2KBXA 4GTTA 4JHRA 5BT1A 3UKRG 1TJFA 5EIBE 4OVVA 3CVUA 2XENA 2PQNA 3LCAA 3Q9NC 3SO8A 3FU3A 3UT4A 3UX4A 3I4RB 2RFMA 2J49A 1QNFA 3JXIA 4BERA 1ZBPA 4N5CA 4XI9A 5AIJA 3O4ZA 1ELKA 3W9FA 5DIZA 4GTVA 1BU9A 2M63A 3B95A 4ZHBA 3UM3A 4TUMA 3FFLA 5C1DA 1N4QA 2KM4A 3B7UX 3PRZA 1QZ2A 4R7LA 1YYHA 5FQ4A 2C0MA 3V2OA 1NA3A 3DSWA 1SA5A 3JXJA 2A5UA 2CFUA 4F3VA 2J4BA 3ASNE 3FTXA 5CRUA 3E37A 3UINC 3HDXA 3SZ7A 1NI1A 3TGOA 4K0RA 3DSTA 3JQ1A 1UJJA 3FUFA 3LDZA 3UM0A 1HZ4A 2IO3C 3QK0A 4BFRA 2KCLA 3UUXA 5ITZF 3DSXA 2XEVA 4P29A 1FT2A 5ENTD 4HBDA 1DNPA 1KT0A 3L08A 4DPRA 2IF4A 2WQ6A 4MS6A 3LY9A 3TG5A 3ABKE 1TNUA 4A1GA 5BV0A 5CCLA 4RQIA 2Y4UA 3UI2A 3E30A 2EIKE 3QC1A 4ME2A 5FZQA 3LPZA 4HI8A 2XZDG 4B94A 2E2EA 5BUZA 5AJLA 4UWKA 4TV3A 3CV0A 3CSFA 2GROB 2EQXA 3R7RA 3HYMB 1OWNA 1HF8A 4FLBA 4GPMA 2I2OA 4FJZA 3LJ3A 5H7PA 3ZYMA 3PZ4A 5AYWD 1OUVA 2LUHA 4LRZA 4NIKA 3ONLA 3ZYKA 4EBAG 3U66A 5KCMA 3VLFA 4YDWA 5HQ8A 3TWTA 3FU6A 2ZXWE 3IKOB 3FTVA 5EIDA 4DLOA 1UG3A 2DZOA 4G1TA 5C2YA 4BSZB 4GTRA 1NZNA 4C0EA 1HG2A 4JVSA 4PUCA 5FWQA 3NOCD 2HM8A 1DC2A 2X6FA 3WXXA 3BG1B 5LCWC 4J8YA 4MLPA 2AXVA 4K5BA 4AXHA 1EDUA 1MJ0A 2H6GA 4O1PA 5FIOA 2DCPA 4UWFA 3RO3A 4L9PA 1HU3A 4J6IA 3UIOC 5HRYA 1OWLA 3CVVA 1OY3D 1BPOA 3TWSA 3IXEA 4GTMA 1IYGA 2BF0X 2XPZA 3ZUVB 3TXMA 2JEKA 4XI0A 3LVRE 3FUNA 4DJAA 5LX8A 3D9LA 4PDXA 2KC7A 4W9RA 3UMVA 4KT6B 5CMYA 5JHBA 3C5RA 3D9OA 4HRNA 5DBKA 3I5PA 4IN3B 4U0SA 3LS8A 4ANVA 5FT9A 4A63B 2J4DA 3HIZA 1TEZA 4BSXA 1LD7A 3FEYA 2P9NG 1FT1A 2RD0A 2HE0A 4AP2A 4N5QA 1IHGA 3T5VA 4B93B 4CEMA 3VLEA 3C3RA 2Y4TA 4GPKA 1E7VA 3Q7AA 3R9AB 2WQ7A 4MRUA 2F8XK 1V54E 1VDYA 3FULA 4TRQA 1ZU2A 3ZHEB 3G2UA 1MQSA 4OAUC 3ESLA 4HOUA 5CMWA 1TR4A 5ENNA 5AN8A 1TNOA 1IKND 4CGWA 4F1PA 1MX2A 2YNQA 3NB2A 1HO8A 3C98A 5AQ9A 1U2VG 3L13A 4JEHA 5FINA 3ZKJA 4G8LA 3ONKA 4DX5D 4J8FA 3ZN3A 4HLLA 1G3NB 2VSOE 3JCKC 2ETCA 3SHFA 1NA0A 3D9KA 4WNDA 5J08A 3FUEA 4U63A 3SGHA 5G04C 2L6JA 3UT8A 1DVPA 5T8IA 4BTBA 3QWVA 4PS3A 5FJYA 1KZPA 4L1BA 4Y6WA 3ISMC 1NL4A 3FEXA 2P9IG 3QDNA 1Z3YA 3CVPA 3U3WA 1LD8A 3HG0D 4GMRA 2BTDA 3ABLE 1OT8A 4N3CA 4XZ4A 1JCSA 2KZTA 4FA6A 1U3DA 4YNDA 2IU1A 3CK7A 3ZVVA 1FVFA 2AXUA 3I3NA 3CHPA 3QWWA 2LSVA 3T5XA 4KZ0A 1N94A 2WPVA 3E32A 5E76A 3KD7A 2IJGX 3FP3A 3DSSA 4EHMA 4OYSA 4I2WA 2UY1B 2VSYA 4AIFA 1RZ4A 4CDNA 2UWJG 4GYYA 3T9KA 1HXIA 2WXNA 1XGWA 5JA4D 4EPZA 4N3BA 5HS0A 1QQEA 3CHOA 2FO7A 5D0OD 1H2UA 3QJZA 4L2YA 1ELRA 5JJTA 3QNKA 2I9CA 1JWFA 4GZCA
chains in the Genus database with same CATH topology
4ATGA 4I1AA 2WXJA 3B13A 3CKBA 4U04A 4F53A 1HG5A 3MX3A 3FFLA 3MZLB 3Q49B 5C1DA 2KM4A 3LY8A 3B7UX 3LVQE 3FU5A 3PRZA 3S2AA 1SZAA 4I6GA 3FU0A 2XGSA 1QZ2A 4R7LA 2CHWA 2IONA 4CT0A 4RSYA 5FQ4A 4FHKA 5ARFA 2C0MA 4FJYA 4FP7A 3S7FA 4L2LA 4ANWA 3O48A 1NA3A 1Y6IA 5CHEE 3S7JA 2WXKA 3L17A 3MV3B 4JPSA 4B0ZA 2A5UA 2CFUA 3CSTA 4JW1A 4F3VA 1HS6A 2BUGA 2J4BA 3FTXA 5G05C 2PM6A 4G24A 4AJWA 4NURA 3HDXA 4D10C 4E6HA 3SZ7A 1P5QA 4G26A 2CFZA 3TGOA 1H2TC 4K0RA 3GYZA 2J07A 3JQ1A 1UJJA 1PC2A 2R5SA 3FUFA 1W3BA 4AY6A 3LDZA 4JZYA 4GU5A 1HZ4A 4WNGA 3QK0A 4BFRA 1UN8A 2RG8A 1OWOA 2VGXA 4AEZC 3NZUA 2KCLA 2WXIA 3APFA 2ONDA 3UUXA 1S0PA 4KMOA 3ZFWA 2X6HA 2XEVA 3MEKA 4P29A 5G04J 2XGMA 4ACLA 3FTUA 3L16A 4HOSA 1WAO1 4JHJA 1OWPA 3KEZA 3FTSA 3CEQA 4ANXA 2VTBB 3ASDA 1DNPA 4JA7A 4JXTA 1KT0A 3L08A 4DPRA 4XKCA 3TJPA 2IF4A 4Y6CA 3HVEA 5HI7A 2WQ6A 4MS6A 3LY9A 4RG6A 3AU5A 2IOLA 3LY7A 3TG5A 5BPPA 2L9BA 4YVQC 3ESKA 4XX5A 4NRHB 3CHRA 4GAAA 1UJKA 4XIFA 3QOUA 3OXFA 4A1GA 5BV0A 3TXNA 2V4LA 5CCLA 4J0UA 2Y4UA 3SBSA 1ELWA 4KXKB 2L0TB 2FF4A 3CQGB 3CVNA 3JYSA 3FY4A 3QWPA 4CDMA 3QC1A 3U64A 1MHQA 4HORA 5JJ6A 2PM7A 4NACA 4ME2A 4PS7A 5FZQA 3LPZA 1E8YA 5BW8C 3PUJA 3PS6A 4B94A 4N3AA 2E2EA 1E8ZA 5BUZA 2L0IA 1Z6TA 3FUMA 2WQHA 5AJDA 5AJLA 4C9BB 4UWKA 4TV3A 4K03A 5JHAA 3CV0A 4BX8A 3CSFA 3GZ2A 3URZA 4B89A 2EQXA 2YHCA 3R7RA 3HYMB 1OWNA 1HF8A 2LAHA 4OVUA 4G2VA 2VQ2A 4FLBA 2I2OA 5D0QD 1EF1C 3LJ3A 4FJZA 4GA0A 3ZXSA 4BT8A 3ZYMA 4HXIA 4B8AA 3PREA 2XGOA 5AYWD 4HLEA 2J9QA 5A6CA 1NP7A 3OXLA 1OUVA 2GW1A 4DI4A 3APDA 3FUJA 5FQ7A 4GZ3A 4LRZA 1U3CA 2WXGA 3MV2B 3ONLA 3ZYKA 4EBAG 5BV1A 3FH8A 4KVMA 4HFGA 5KCMA 3U66A 3VLFA 2PL2A 5HQ8A 2HYZA 5A7DB 3EIJA 1LF8A 4G25A 4V3IA 4XE0A 1SQMA 2PQRA 3FU6A 3ENEA 1OWMA 3PDNA 2AVPA 2MOWA 5G2NA 4LEUA 2MRIA 3CIAA 3L6AA 2FI7A 5KJMA 4IYPA 4J8DA 1Z3XA 3G2VA 3FTVA 3IKOB 2OOEA 2HO1A 3LKUA 3CVXA 4AM9A 4DLOA 1E8WA 1UG3A 4UQYA 2XRYA 3QB2A 1UN9A 4EQFA 1JPLA 2VSXE 4G1TA 4GA1A 2LSUA 5C2YA 4CGVA 3LEWA 4L23A 4WAFA 1NZNA 2Y3AA 3FDHA 4C0EA 1HG2A 4JVSA 2OV8A 1KLXA 2IOSA 4PUCA 5FWQA 2XQ0A 2HM8A 2GRMA 2I1JA 2X6FA 5EKQD 2X6IA 1YA0A 3WXXA 3BG1B 2R59A 4BX9A 4MLPA 2CG3A 2AXVA 3FUKA 3FUDA 4WWPA 3D3MA 4AXHA 4FADA 1EDUA 3ZYLA 2AWIA 1FVHA 3G2TA 3RU0A 3RIBA 3CVYA 5ANRA 1HFAA 3TL5A 3DPDA 4CDRA 2NXPA 4MKTA 4WNEA 3B7TA 2XCBA 4KVOA 3PNTB 4HS2A 4I9EA 4L7TA 4EBAA 5LFAA 2CHZA 2DCPA 3FHEA 2VJ8A 3RRNB 4UWFA 4GMJA 3RO3A 3SNXA 4NQ0A 3DBSA 3LXUX 3ZRHA 3ZIMA 5KJNA 2WXQA 1HU3A 4ILGA 2NSZA 5J90A 3ZYQA 4J6IA 2OVBA 1H0AA 5ANLA 3E4BA 1OWLA 3CVVA 1H2VC 2WXRA 1BPOA 3GZSA 2WXHA 3KS2A 5G05J 2XHEA 3CVWA 3VTXA 5LCWJ 1IYGA 2BF0X 4YVOA 2QY7A 3D9PA 3S7BA 2XPZA 1H6KA 3GZ1A 3TXMA 4XKBA 2VTBA 2JEKA 2GGFA 4XI0A 3LVRE 3TG4A 3FUNA 2MHKA 5FZRA 4GMLA 1INZA 2JLBA 1N54A 4BY6A 2IFUA 4DJAA 3IBEA 4FULA 2WMOA 5LX8A 2WVIA 3P1UA 3D9LA 4C0MA 4PDXA 4DK5A 2FEZA 3EDTB 3KAEA 4JL0A 2FBNA 3PVLA 3SFZA 2KC7A 4HOTA 4W9RA 3UMVA 4KT6B 5CMYA 2KZTB 3Q15A 4LCTA 5JHBA 3D9OA 3N71A 2X38A 4WNFA 3BG0B 2CG2A 3ML8A 5T4YA 1GW6A 1E96B 2Q7FA 5DBKA 3I5PA 4IN3B 4FC8A 4JA9A 3QKYA 5FQ6A 2WXOA 4U0SA 5T3RA 3U9WA 3LS8A 4I2ZA 4ANVA 5FT9A 2KCVA 2J4DA 5JJ7A 2KATA 3HIZA 3L22A 3OTNA 3PE4A 4BSXA 1TEZA 4E85A 4N2QA 4U07A 3FEYA 3EHMA 4M3OA 4UQZA 3D9MA 5M72A 2CHXA 2OVFA 2RD0A 2I6HA 3GW4A 2WXFA 2ZU6B 4UQXA 3BEEA 4AY5A 4AP2A 3S7DA 1IHGA 4UI9C 3T5VA 3CVQA 1JUQA 3MJWA 4ILHB 3VLEA 3ASHA 4CEMA 2X3MA 3RJVA 3UPVA 2Y4TA 4GPKA 3JUIA 1WM5A 4GYOA 3B7SA 1PY1A 1E7VA 3R9AB 4G23A 4APFA 2WQ7A 4MRUA 5ARGA 1VDYA 3FULA 3FWVA 3IHYA 4TRQA 4UWGA 1ZU2A 4WUYA 4GCOA 4H7XA 4IRUA 3ZHEB 3G2UA 1MQSA 3ZHEA 2GRLA 3ESLA 5LOZA 4HOUA 4KYOB 5CMWA 3RRUA 5ENNA 1XNFA 2X6KA 1EYHA 2V5FA 5LCWC 3RK6A 4O6FA 4CGWA 4I17A 3CVLA 2WXMA 3R7QA 3SI5A 3EJNA 3CGHA 4U8HA 3D9IA 3CK9A 4A3VA 2YNQA 3CR3A 4I6JA 4PH4B 4GCNA 5EX0A 1HO8A 3Q47B 1IQRA 2P58C 2VYIA 5A23A 3C98A 3FTWA 3I4GA 3PH0C 4A3TA 2C0LA 2YHEA 2A4ZA 1PAQA 4JEHA 3L13A 1TJCA 4ILIA 2J09A 3PEUB 4J8SA 4Q96A 1Y8MA 4DLQA 2J08A 3VLDA 3ONKA 4J8FA 2LAIA 2LNIA 3OAWA 3FTZA 3QARA 5FTPA 3ZN3A 2VGYA 4CRWA 3Q5MA 2VSOE 1L5JA 3JCKC 3PNLB 2PZIA 4I1OB 2QFCA 3MKRA 4UWLA 3SHFA 4GZDA 4EZLA 1E8XA 2DBAA 2XRZA 1NA0A 3D9KA 4N2SA 4WNDA 3L54A 4Q69A 5G55A 2R17C 4F1SA 4GA2A 1IQUA 2DIWA 2YQ8A 2XPIA 3IHVA 5J08A 4JC8A 3PEVB 3ULQA 1UW4B 3FUEA 3CHMA 1E90A 3FH5A 4U63A 4JEUA 5G04C 3SGHA 2L6JA 3UT8A 3SD5A 3UQ3A 4U0ZA 4QFVA 1DVPA 5T8IA 4BTBA 4EECA 3QWVA 4PS3A 5FJYA 3CLJA 2YINA 3CK8A 5BNWA 3JQ0A 4L1BA 4KZCA 4Y6WA 3SF4A 5AENA 4UI9K 4URKA 1N52A 3FEXA 3IV0A 5E75A 4CT4A 4I43A 4KBQA 4CCAA 4FLHA 5LP0A 3FTYA 3PZDA 3NZSA 4I1MA 4LUNU 5KJLA 3QDNA 1Z3YA 1HX8A 3FH7A 2VGXB 4B8CB 5FQ8A 3MKQB 3CHSA 2VSNA 3ZW3A 3NQPA 3B7RL 3MKQA 3AS5A 4JHKA 2AXZA 3CVPA 4I6EA 4N39A 5FZSA 3U3WA 1KT1A 3AS4A 3CKCA 3APCA 2HR2A 4H7YA 1EPUA 5EDSA 4A1SA 2I1KA 3PE3A 3CHQA 3QAQA 3AS8A 4ANUA 1FCHA 3LYAA 1X5BA 3U4TA 4ACKA 3ASGA 3FUHA 4HVBA 3D9NA 3VTYA 2BTDA 2NC9A 4N3CA 4WWNA 4XZ4A 1JWGA 3RO2A 3HVEB 4FA6A 2KZTA 5CCMA 1U3DA 2KCKA 3OXGA 2V0PA 4YNDA 2IU1A 3CK7A 3PUKA 3CQCB 3G2SA 2XCCA 1FVFA 3ZVVA 2AXUA 3I3NA 3CHPA 3QWWA 2WB2A 1E7UA 2WMNA 1A17A 4IULA 2LSVA 5KJKA 2C2LA 4GZ5A 4RVBA 2AW6A 3ML9A 3T5XA 4KZ0A 3D9JA 3RRMB 3HHMA 3NF1A 3IEGA 4A55A 3MYVA 3SBTB 2X6JA 3TAXA 3FUIA 4FU3A 3K9IA 2WPVA 1SZ9A 4EZJA 3AU4A 5E76A 3MCXA 3KD7A 4U0UA 2IJGX 3FP3A 4AVXA 4F7AA 4AOFA 2WXLA 4TUUA 4WWOA 3EIQC 4OYSA 4I2WA 2IQCA 2UY1B 2VSYA 2WM9A 3G2WA 2ILRA 3ZGQA 4AIFA 1HH8A 4JHRA 2UY1A 4CDNA 2UWJG 3P2BA 5BT1A 4GYYA 4EZKA 4APOA 2LO6A 1TJFA 4BWRA 4ABNA 4HOQA 1HE8A 4LERA 4Q94A 1HXIA 2WXPA 4OVVA 2WXNA 1XGWA 2V8SE 3CVUA 2FULA 2PQNA 3LCAA 5EX3A 3UT4A 3FU3A 3T8MA 3UX4A 4EPZA 3ZPJA 3ASFA 3I4RB 4N3BA 3RKVA 3MGBA 4BT9A 4BTAA 2J49A 1QNFA 4FHJA 4I9CA 1QQEA 3CHOA 1H19A 1B89A 2FO7A 1WY6A 3Q4AB 4PS8A 5D0OD 4GYWA 1H2UA 4AV7A 4G11A 4GB9A 3ZEFA 1ZBPA 2E0IA 3QJZA 3MA5A 4N5CA 4XI9A 5AIJA 4L2YA 3O4ZA 1ELRA 1ELKA 3EHNA 5DIZA 4UWHA 4UI9J 3UT7A 3QNKA 4DI3A 5JJTA 2I9CA 2XPYA 1JWFA 2M63A 4GZCA 4J8EA 4RG9A 4GZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1A A;  3CKB A;  4U04 A;  3Q49 B;  3FFL A;  5C1D A;  3LY8 A;  2XGS A;  1QZ2 A;  5ARF A;  2C0M A;  3S7F A;  3O48 A;  1NA3 A;  5CHE E;  3S7J A;  3MV3 B;  4F3V A;  2BUG A;  5G05 C;  4G24 A;  3SZ7 A;  1P5Q A;  4G26 A;  3TGO A;  3GYZ A;  1PC2 A;  2R5S A;  1W3B A;  4AY6 A;  1HZ4 A;  4WNG A;  2VGX A;  2KCL A;  2OND A;  3UUX A;  3ZFW A;  2XEV A;  3MEK A;  5G04 J;  2XGM A;  4HOS A;  1WAO 1;  3CEQ A;  3ASD A;  4JA7 A;  1KT0 A;  2IF4 A;  4Y6C A;  5HI7 A;  3LY9 A;  4RG6 A;  3LY7 A;  3TG5 A;  4YVQ C;  3ESK A;  4NRH B;  4XIF A;  3QOU A;  3OXF A;  5CCL A;  4J0U A;  2Y4U A;  1ELW A;  4KXK B;  2FF4 A;  3CVN A;  3JYS A;  3QWP A;  4HOR A;  5JJ6 A;  4ME2 A;  5FZQ A;  3LPZ A;  5BW8 C;  4B94 A;  4N3A A;  2E2E A;  2WQH A;  3CV0 A;  3URZ A;  3GZ2 A;  2YHC A;  3HYM B;  4G2V A;  2VQ2 A;  5D0Q D;  4GA0 A;  4BT8 A;  2XGO A;  5AYW D;  2J9Q A;  5A6C A;  3OXL A;  1OUV A;  2GW1 A;  4GZ3 A;  3MV2 B;  2PL2 A;  5HQ8 A;  2HYZ A;  5A7D B;  4G25 A;  2PQR A;  3PDN A;  2AVP A;  4LEU A;  2FI7 A;  5KJM A;  4J8D A;  2OOE A;  2HO1 A;  3LKU A;  4AM9 A;  4UQY A;  4EQF A;  4G1T A;  4GA1 A;  2LSU A;  4CGV A;  1NZN A;  1KLX A;  5EKQ D;  1YA0 A;  3WXX A;  5LCW C;  3RU0 A;  3RIB A;  4CDR A;  4WNE A;  2XCB A;  4I9E A;  3RO3 A;  4NQ0 A;  5KJN A;  3E4B A;  3KS2 A;  5G05 J;  3VTX A;  5LCW J;  1IYG A;  4YVO A;  3S7B A;  3GZ1 A;  4XI0 A;  3TG4 A;  2MHK A;  5FZR A;  2JLB A;  2IFU A;  2FEZ A;  3EDT B;  3KAE A;  4JL0 A;  2FBN A;  2KC7 A;  4HOT A;  4W9R A;  3Q15 A;  3N71 A;  4WNF A;  1E96 B;  2Q7F A;  5DBK A;  4IN3 B;  4JA9 A;  3QKY A;  4U0S A;  4I2Z A;  5FT9 A;  2KCV A;  5JJ7 A;  2KAT A;  3PE4 A;  4N2Q A;  4U07 A;  4UQZ A;  5M72 A;  2I6H A;  3GW4 A;  4UQX A;  3BEE A;  4AY5 A;  3S7D A;  1IHG A;  4UI9 C;  3CVQ A;  3UPV A;  3ASH A;  3RJV A;  2Y4T A;  4GPK A;  1WM5 A;  4GYO A;  3R9A B;  4G23 A;  5ARG A;  3FWV A;  1ZU2 A;  4WUY A;  4GCO A;  4H7X A;  3ZHE B;  3ZHE A;  4HOU A;  4KYO B;  1XNF A;  2V5F A;  4O6F A;  4CGW A;  4I17 A;  3CVL A;  3CK9 A;  4GCN A;  5EX0 A;  3Q47 B;  2P58 C;  2VYI A;  2C0L A;  1TJC A;  1Y8M A;  4J8F A;  2LNI A;  3ZN3 A;  5FTP A;  2VGY A;  3Q5M A;  2PZI A;  2QFC A;  3MKR A;  2DBA A;  1NA0 A;  4N2S A;  4WND A;  4GA2 A;  2YQ8 A;  2XPI A;  3ULQ A;  5G04 C;  2L6J A;  3UQ3 A;  4U0Z A;  4BTB A;  3QWV A;  5FJY A;  3CK8 A;  5BNW A;  4Y6W A;  3SF4 A;  4UI9 K;  4KBQ A;  5KJL A;  3QDN A;  2VGX B;  2VSN A;  3AS5 A;  3CVP A;  4N39 A;  5FZS A;  3U3W A;  1KT1 A;  3AS4 A;  3CKC A;  2HR2 A;  4H7Y A;  4A1S A;  3PE3 A;  3AS8 A;  1FCH A;  3LYA A;  3U4T A;  3ASG A;  3VTY A;  2NC9 A;  4N3C A;  3RO2 A;  5CCM A;  2KCK A;  3OXG A;  4YND A;  3CK7 A;  2XCC A;  3QWW A;  5KJK A;  1A17 A;  2LSV A;  2C2L A;  4GZ5 A;  3NF1 A;  3IEG A;  3TAX A;  3K9I A;  2WPV A;  3KD7 A;  4U0U A;  3FP3 A;  4I2W A;  2UY1 B;  2VSY A;  3ZGQ A;  4AIF A;  1HH8 A;  4JHR A;  2UY1 A;  2UWJ G;  5BT1 A;  4GYY A;  4APO A;  4BWR A;  4ABN A;  4HOQ A;  1HXI A;  2PQN A;  3LCA A;  5EX3 A;  3ZPJ A;  3ASF A;  4N3B A;  3RKV A;  4BT9 A;  4BTA A;  4I9C A;  1QQE A;  1B89 A;  2FO7 A;  3Q4A B;  5D0O D;  4GYW A;  1ZBP A;  4N5C A;  3MA5 A;  4XI9 A;  1ELR A;  5DIZ A;  5JJT A;  4UI9 J;  4J8E A;  4RG9 A;  4GZ6 A; 
#chains in the Genus database with same CATH topology
 2JAB A;  4I1A A;  4U04 A;  4F53 A;  3FU0 A;  2XGS A;  2CHW A;  3V2X A;  4TXR A;  4FHK A;  3BU8 A;  4ANW A;  3O48 A;  1Y6I A;  4YDO A;  4JW1 A;  1DCQ A;  5G05 C;  2PM6 A;  4NUR A;  1YMP A;  3GYZ A;  4JZY A;  4WNG A;  4C48 B;  1WDY A;  1KZO A;  2WXI A;  4F6R D;  4X8Q A;  3ZFW A;  2X6H A;  5G04 J;  4HOS A;  4JHJ A;  1OWP A;  2BED A;  4JXT A;  3ULY A;  1KPS B;  4RG6 A;  3J5P A;  4GAA A;  4U8Y D;  2DYS E;  3QOU A;  3TXN A;  5D66 A;  4KXK B;  4DX2 A;  2L0T B;  5ENP D;  3JYS A;  4TXQ A;  4CDM A;  4HOR A;  4PS7 A;  1IXV A;  1S64 A;  5BW8 C;  3PUJ A;  3PS6 A;  1E8Z A;  2LXL A;  2WQH A;  3F6Q A;  4BX8 A;  3URZ A;  3GZ2 A;  4B89 A;  3UM1 A;  2YHC A;  2H6F A;  2VQ2 A;  2IEJ A;  5CED B;  5D0Q D;  4GA0 A;  3L9T A;  3ZXS A;  4B8A A;  2XGO A;  2J9Q A;  1NP7 A;  3OXL A;  2GW1 A;  3APD A;  5FQ7 A;  4GZ3 A;  4JB8 P;  4KVM A;  2PL2 A;  5A7D B;  4GTQ A;  1QYM A;  3AG3 E;  2QZA A;  5CER B;  2PQR A;  1OWM A;  4J8D A;  3G2V A;  2F8Y A;  2OOE A;  2HO1 A;  3LKU A;  4AM9 A;  3QB2 A;  3EHQ A;  4CGV A;  3LEW A;  4L23 A;  2OEV A;  4WAF A;  2Y3A A;  2XS1 A;  5EKQ D;  2X6I A;  4WWP A;  2P9S G;  1MX6 A;  3RU0 A;  3CVY A;  5ANR A;  1HFA A;  3UTM A;  4CDR A;  4EBA A;  4KVO A;  3PNT B;  4L7T A;  4BES A;  2CHZ A;  5EN5 D;  1OCO E;  3KEA A;  3LXU X;  5KJN A;  4ILG A;  4BEP A;  3SY2 A;  1H2V C;  3GZS A;  5G05 J;  2XHE A;  3S7B A;  5EYL A;  3Q7F A;  5B3S E;  1H6K A;  4LNG A;  3GZ1 A;  3ULE G;  4XKB A;  2VTB A;  3TG4 A;  3UKU G;  3DXM G;  4BY6 A;  3P1U A;  5CBO A;  5B1B E;  3X2Q E;  3PVL A;  3SFZ A;  2KZT B;  3L82 A;  3SQV A;  2X38 A;  5ENQ D;  1H6O A;  5FQ6 A;  3QKY A;  2WXO A;  2GRQ B;  5T3R A;  1S63 A;  2KCV A;  1NFI E;  5CRV A;  3OTN A;  3JUE A;  4J7W A;  5M72 A;  3D9M A;  4MBG A;  2CHX A;  4G8K A;  2L6B A;  3GW4 A;  2QYU A;  3Q75 A;  4UQX A;  4UI9 C;  3UPV A;  1JUQ A;  4U7E B;  3RJV A;  3HXD A;  1WM5 A;  3SFX A;  4APF A;  4HB5 A;  3FWV A;  4UWG A;  4H7X A;  2QC9 A;  1JCR A;  3RRU A;  4M7C A;  3AG4 E;  3PZ2 A;  2X6K A;  2BKG A;  1Q2Z A;  4O6F A;  1SA4 A;  2XS8 A;  3BQO A;  3EJN A;  4U8H A;  2OEW A;  2VYI A;  3DRA A;  2A4Z A;  1PAQ A;  1TJC A;  2J09 A;  4J8S A;  2GRP B;  3EU9 A;  2LAI A;  2LNI A;  3FTZ A;  3AAA C;  4I1O B;  2PZI A;  3MKR A;  4EZL A;  4GZD A;  2XRZ A;  2OCC E;  4F1S A;  4GA2 A;  2YQ8 A;  3PZ1 A;  2XPI A;  3PEV B;  1UW4 B;  3CHM A;  1E90 A;  3FH5 A;  2F0Y A;  3SD5 A;  4U0Z A;  4EEC A;  2YIN A;  2PNN A;  3CK8 A;  5AEN A;  4KZC A;  4UI9 K;  1N52 A;  5E75 A;  4CCA A;  4FLH A;  3PZD A;  1N11 A;  3FH7 A;  1LTX A;  5FQ8 A;  3MKQ B;  3ZW3 A;  4JHK A;  3KSL A;  4N39 A;  5FZS A;  2ZIS A;  1KT1 A;  1K8K G;  5AQA A;  4A1S A;  2I1K A;  3PE3 A;  3CHQ A;  3QAQ A;  3AS8 A;  1X5B A;  4YDY A;  3U4T A;  4ACK A;  3D9N A;  2NC9 A;  3RO2 A;  3D9H A;  3NBN B;  2Y1L E;  3PUK A;  3CQC B;  2WB2 A;  2WMN A;  5KJK A;  2C2L A;  3D9J A;  3SBT B;  3FUI A;  1SZ9 A;  3MCX A;  4U0U A;  4AVX A;  4DUI A;  3EIQ C;  2ZGD A;  2ILR A;  4GTP A;  4EZK A;  4HOQ A;  1HE8 A;  4Q94 A;  2WXP A;  2XZT G;  5EX3 A;  3ZPJ A;  3RKV A;  4JD2 G;  4BT9 A;  2XEH A;  1B89 A;  3Q4A B;  4PS8 A;  4GYW A;  4AV7 A;  3NOG D;  3EUV A;  4GB9 A;  3ZEF A;  3MA5 A;  3Q73 A;  4UI9 J;  4DI3 A;  2XPY A;  4RG9 A;  4GZ6 A;  3CKB A;  1HG5 A;  4DX7 D;  3MX3 A;  3MZL B;  3LY8 A;  4DX1 A;  5JMN D;  3ZNG A;  1SZA A;  2ION A;  1K1B A;  4FP7 A;  4O60 A;  4L2L A;  4TXP A;  1OCC E;  2WXK A;  3L17 A;  4JPS A;  3S7J A;  3CST A;  1O5M A;  3ZXP A;  4AJW A;  4E6H A;  4G26 A;  2CFZ A;  1PC2 A;  2R5S A;  2R05 A;  4K5A B;  1W3B A;  4GU5 A;  1UN8 A;  1OWO A;  3NZU A;  3APF A;  2OND A;  1S0P A;  3AG1 E;  3FTU A;  3J5Q B;  3KEZ A;  3FTS A;  4ANX A;  3DEP A;  2VTB B;  3ASD A;  3DWL G;  4XKC A;  3TJP A;  4Y6C A;  3AU5 A;  2IOL A;  2QYJ A;  3ESK A;  4XX5 A;  1UJK A;  2EIJ E;  3OXF A;  3R9M A;  2V4L A;  3FY4 A;  3QWP A;  4XEI G;  3TWW A;  1DCE A;  2PM7 A;  2DZN A;  5HKP A;  2GRR B;  2V4H C;  1E8Y A;  3FUM A;  1Z6T A;  5JHA A;  3TWV A;  1IHB A;  4G2V A;  1EF1 C;  5A6C A;  3FUJ A;  4RLY A;  2J8S D;  2WXG A;  2MYO A;  3FH8 A;  4HFG A;  1FPP A;  4G25 A;  1SQM A;  3ENE A;  3PDN A;  2MOW A;  5G2N A;  4LEU A;  3CIA A;  3L6A A;  2FI7 A;  5AQB A;  1E8W A;  3LJN A;  4UQY A;  4EQF A;  1JPL A;  2VSX E;  1OCR E;  1TNY A;  3FDH A;  2OV8 A;  2IOS A;  2GRM A;  2I1J A;  2R59 A;  4BX9 A;  4GTS A;  3FUD A;  3ZYL A;  4LNB A;  2AWI A;  1FVH A;  3RIB A;  4HNA D;  3TL5 A;  1K3Z D;  3B7T A;  4HRL A;  4I9E A;  5LFA A;  3HXE A;  4YDE A;  3FHE A;  2VJ8 A;  4LNU D;  4NQ0 A;  3DBS A;  3ZIM A;  3ZRH A;  1OCZ E;  2WXQ A;  5J90 A;  3ZYQ A;  2OVB A;  4CYM D;  3DSU A;  2P9P G;  1QBQ A;  3KS2 A;  3VTX A;  4YVO A;  1MZC A;  2QY7 A;  4LG6 A;  3RSE G;  5EYP F;  1O1S A;  4GML A;  1INZ A;  2A5E A;  1WG0 A;  2IFU A;  4FUL A;  1MYO A;  2WVI A;  1X81 A;  3C72 A;  2EIN E;  4C0M A;  2FEZ A;  2FBN A;  3EHR A;  4DRX E;  3EU5 A;  3N71 A;  5KNH D;  4WNF A;  3BG0 B;  2CG2 A;  5T4Y A;  2Q7F A;  4JA9 A;  3C3Q A;  3U9W A;  2V5Q C;  5JJ7 A;  4ATZ D;  4ZFH A;  4N2Q A;  3C3O A;  4U07 A;  3EHM A;  4UQZ A;  2I6H A;  5BXO A;  4HRM B;  3BEE A;  3ASO E;  4AY5 A;  3S7D A;  1TNB A;  3V79 K;  3CVQ A;  4ILH B;  3ASH A;  2DYR E;  2X3M A;  1BI7 B;  3JUI A;  3B7S A;  1PY1 A;  4G23 A;  5ARG A;  3IHY A;  4WUY A;  4IRU A;  1TN8 A;  3ZHE A;  2GRL A;  3NAW A;  4OAV B;  3WG7 E;  3E34 A;  1D8D A;  1Z5S C;  2WXM A;  3R7Q A;  3D9I A;  3CK9 A;  4A3V A;  4I6J A;  5AAO A;  4GCN A;  5KNG A;  3KSQ A;  5EX0 A;  1IQR A;  5A23 A;  3I4G A;  4A3T A;  2C0L A;  2YHE A;  4ILI A;  3PEU B;  3B7B A;  4DLQ A;  2J08 A;  3VLD A;  3OAW A;  3QAR A;  5D2M C;  4UWL A;  2XEE A;  3PNL B;  3UIP C;  1N4S A;  1TNZ A;  2DBA A;  1ZB1 A;  5CEA A;  3IHV A;  2AJA A;  4Z68 A;  4JEU A;  1TN7 A;  1UOH A;  3UQ3 A;  4QFV A;  3TWR A;  3CLJ A;  3HXC A;  3JQ0 A;  2EIL E;  3NZS A;  4I1M A;  4LUN U;  5KJL A;  3ZU7 B;  1HX8 A;  1N9A A;  4B8C B;  3CHS A;  2VSN A;  4I6E A;  1AP7 A;  3LYA A;  2LXM A;  3FUH A;  4HVB A;  1JWG A;  5CCM A;  2KCK A;  1O1T A;  2V0P A;  3TWU A;  2XCC A;  1A5E A;  4CZ2 D;  4IUL A;  2Y0B G;  3T8K A;  4GZ5 A;  4RVB A;  2AW6 A;  3HHM A;  3IEG A;  4A55 A;  2X6J A;  2P2C P;  3K9I A;  1BD8 A;  4F7A A;  4AOF A;  2WXL A;  4TUU A;  4WWO A;  2WM9 A;  3ZGQ A;  1HH8 A;  2UY1 A;  3P2B A;  3BUA A;  1N95 A;  4APO A;  2LO6 A;  4BWR A;  4ABN A;  4LER A;  2R03 A;  2V8S E;  2FUL A;  3T8M A;  3ASF A;  3MGB A;  4BTA A;  1N0Q A;  4FHJ A;  4I9C A;  1H19 A;  1WY6 A;  4DX6 D;  4G11 A;  2E0I A;  4U8V D;  3EHN A;  4UWH A;  3UT7 A;  4J8E A;  4ATG A;  2WXJ A;  3B13 A;  3Q49 B;  3LVQ E;  3FU5 A;  3S2A A;  4I6G A;  4CT0 A;  4RSY A;  5IY5 E;  5ARF A;  4FJY A;  3S7F A;  3TWX A;  2DVW A;  5CHE E;  3MV3 B;  4B0Z A;  1D8E A;  1HS6 A;  2BUG A;  4HI9 A;  4G24 A;  3TWQ A;  4D10 C;  2IY0 C;  1P5Q A;  1H2T C;  1K1A A;  2J07 A;  4AY6 A;  2RG8 A;  2VGX A;  4AEZ C;  1JCQ A;  3DSV A;  5CEC B;  4KMO A;  3MEK A;  2XGM A;  4ACL A;  3L16 A;  4U95 D;  1WAO 1;  3CEQ A;  2B0O E;  4JA7 A;  3HXF A;  3HVE A;  5HI7 A;  3LY7 A;  5BPP A;  2L9B A;  4YVQ C;  4NRH B;  3CHR A;  4XIF A;  4UUC A;  3AG2 E;  4J0U A;  3SBS A;  3UM2 A;  1ELW A;  2FF4 A;  3CQG B;  3CVN A;  4LSZ E;  3U64 A;  1MHQ A;  5JJ6 A;  4NAC A;  4N3A A;  2L0I A;  5AJD A;  4C9B B;  4K03 A;  2R02 A;  2LAH A;  4OVU A;  3DEO A;  5KBA A;  1V55 E;  2RFA A;  3HRA A;  1TN6 A;  4BT8 A;  4HXI A;  3PRE A;  4HLE A;  2P9K G;  4DI4 A;  1U3C A;  3MV2 B;  5BV1 A;  4QQI A;  2HYZ A;  3EIJ A;  1LF8 A;  2IO2 C;  4V3I A;  4XE0 A;  2AVP A;  2MRI A;  5KJM A;  4IYP A;  1Z3X A;  1D9S A;  2VGE A;  3DPY A;  3CVX A;  3Q9U C;  2XRY A;  1UN9 A;  1MX4 A;  4GA1 A;  2LSU A;  2B6C A;  1KLX A;  2XQ0 A;  1YA0 A;  2CG3 A;  3FUK A;  4FAD A;  3D3M A;  5BXU A;  1AWC B;  3G2T A;  3DPD A;  2NXP A;  4MKT A;  4WNE A;  4GTO A;  2XCB A;  4HS2 A;  3RRN B;  4GMJ A;  3SNX A;  2ETB A;  3V31 A;  2NSZ A;  1H0A A;  4K5C A;  1S70 B;  5ANL A;  3E4B A;  2WXR A;  2WXH A;  3CVW A;  5LCW J;  1BI8 B;  2Y69 E;  3D9P A;  1YCS B;  2GGF A;  2MHK A;  5KWD A;  5FZR A;  2JLB A;  1N54 A;  3IBE A;  5ENR D;  2WMO A;  4DK5 A;  2H6H A;  3EDT B;  3KAE A;  4JL0 A;  4HOT A;  5B1A E;  3W9G A;  1N0R A;  3Q15 A;  4LCT A;  1O1R A;  3DXK G;  3ML8 A;  1GW6 A;  1E96 B;  4FC8 A;  5ENS D;  4I2Z A;  2ETA A;  2P9U G;  2KAT A;  3L22 A;  3PE4 A;  4E85 A;  4M3O A;  2OVF A;  2WXF A;  2ZU6 B;  3AJI A;  2FO1 E;  1TYQ G;  3MJW A;  4GYO A;  3Q79 A;  3PZ3 A;  3RAU A;  4GCO A;  2RKK A;  1SVX A;  5LOZ A;  4KYO B;  1N4P A;  1XNF A;  3HXB A;  3ABM E;  1EYH A;  2GRN B;  2V5F A;  3RK6 A;  2R2L A;  4I17 A;  3CVL A;  3SI5 A;  2ZIR A;  3CGH A;  2F37 A;  3CR3 A;  4PH4 B;  4O1O A;  3Q47 B;  2P58 C;  3PH0 C;  3FTW A;  1SW6 A;  4Q96 A;  1Y8M A;  5FTP A;  2VGY A;  4CRW A;  3Q5M A;  1L5J A;  2QFC A;  2EIM E;  3UXG A;  1E8X A;  4N2S A;  3L54 A;  4Q69 A;  5G55 A;  2R17 C;  4HQD A;  1IQU A;  2DIW A;  2NYJ A;  4JC8 A;  3ULQ A;  5BNW A;  3SF4 A;  1BLX B;  4URK A;  3IV0 A;  4CT4 A;  4I43 A;  4KBQ A;  5LP0 A;  3FTY A;  5EIL A;  2KXP C;  4U96 D;  2VGX B;  5AQ7 A;  5AAR A;  2DWZ A;  3NQP A;  3B7R L;  3MKQ A;  3AS5 A;  2AXZ A;  1N4R A;  1OXJ A;  3AS4 A;  3CKC A;  3APC A;  2ZGG A;  2HR2 A;  4H7Y A;  1EPU A;  5EDS A;  2H6I A;  4ANU A;  1FCH A;  3SFY A;  3ASG A;  3Q78 A;  3VTY A;  4WWN A;  2BKK B;  3HVE B;  3OXG A;  5CBN A;  3E33 A;  3G2S A;  2P9L G;  4BET A;  1E7U A;  1A17 A;  5ENO D;  1RW2 A;  3ML9 A;  3RRM B;  3NF1 A;  3MYV A;  3TAX A;  4FU3 A;  4EZJ A;  3AU4 A;  3V30 A;  1H6P A;  2IQC A;  3G2W A;  2KBX A;  4GTT A;  4JHR A;  5BT1 A;  3UKR G;  1TJF A;  5EIB E;  4OVV A;  3CVU A;  2XEN A;  2PQN A;  3LCA A;  3Q9N C;  3SO8 A;  3FU3 A;  3UT4 A;  3UX4 A;  3I4R B;  2RFM A;  2J49 A;  1QNF A;  3JXI A;  4BER A;  1ZBP A;  4N5C A;  4XI9 A;  5AIJ A;  3O4Z A;  1ELK A;  3W9F A;  5DIZ A;  4GTV A;  1BU9 A;  2M63 A;  3B95 A;  4ZHB A;  3UM3 A;  4TUM A;  3FFL A;  5C1D A;  1N4Q A;  2KM4 A;  3B7U X;  3PRZ A;  1QZ2 A;  4R7L A;  1YYH A;  5FQ4 A;  2C0M A;  3V2O A;  1NA3 A;  3DSW A;  1SA5 A;  3JXJ A;  2A5U A;  2CFU A;  4F3V A;  2J4B A;  3ASN E;  3FTX A;  5CRU A;  3E37 A;  3UIN C;  3HDX A;  3SZ7 A;  1NI1 A;  3TGO A;  4K0R A;  3DST A;  3JQ1 A;  1UJJ A;  3FUF A;  3LDZ A;  3UM0 A;  1HZ4 A;  2IO3 C;  3QK0 A;  4BFR A;  2KCL A;  3UUX A;  5ITZ F;  3DSX A;  2XEV A;  4P29 A;  1FT2 A;  5ENT D;  4HBD A;  1DNP A;  1KT0 A;  3L08 A;  4DPR A;  2IF4 A;  2WQ6 A;  4MS6 A;  3LY9 A;  3TG5 A;  3ABK E;  1TNU A;  4A1G A;  5BV0 A;  5CCL A;  4RQI A;  2Y4U A;  3UI2 A;  3E30 A;  2EIK E;  3QC1 A;  4ME2 A;  5FZQ A;  3LPZ A;  4HI8 A;  2XZD G;  4B94 A;  2E2E A;  5BUZ A;  5AJL A;  4UWK A;  4TV3 A;  3CV0 A;  3CSF A;  2GRO B;  2EQX A;  3R7R A;  3HYM B;  1OWN A;  1HF8 A;  4FLB A;  4GPM A;  2I2O A;  4FJZ A;  3LJ3 A;  5H7P A;  3ZYM A;  3PZ4 A;  5AYW D;  1OUV A;  2LUH A;  4LRZ A;  4NIK A;  3ONL A;  3ZYK A;  4EBA G;  3U66 A;  5KCM A;  3VLF A;  4YDW A;  5HQ8 A;  3TWT A;  3FU6 A;  2ZXW E;  3IKO B;  3FTV A;  5EID A;  4DLO A;  1UG3 A;  2DZO A;  4G1T A;  5C2Y A;  4BSZ B;  4GTR A;  1NZN A;  4C0E A;  1HG2 A;  4JVS A;  4PUC A;  5FWQ A;  3NOC D;  2HM8 A;  1DC2 A;  2X6F A;  3WXX A;  3BG1 B;  5LCW C;  4J8Y A;  4MLP A;  2AXV A;  4K5B A;  4AXH A;  1EDU A;  1MJ0 A;  2H6G A;  4O1P A;  5FIO A;  2DCP A;  4UWF A;  3RO3 A;  4L9P A;  1HU3 A;  4J6I A;  3UIO C;  5HRY A;  1OWL A;  3CVV A;  1OY3 D;  1BPO A;  3TWS A;  3IXE A;  4GTM A;  1IYG A;  2BF0 X;  2XPZ A;  3ZUV B;  3TXM A;  2JEK A;  4XI0 A;  3LVR E;  3FUN A;  4DJA A;  5LX8 A;  3D9L A;  4PDX A;  2KC7 A;  4W9R A;  3UMV A;  4KT6 B;  5CMY A;  5JHB A;  3C5R A;  3D9O A;  4HRN A;  5DBK A;  3I5P A;  4IN3 B;  4U0S A;  3LS8 A;  4ANV A;  5FT9 A;  4A63 B;  2J4D A;  3HIZ A;  1TEZ A;  4BSX A;  1LD7 A;  3FEY A;  2P9N G;  1FT1 A;  2RD0 A;  2HE0 A;  4AP2 A;  4N5Q A;  1IHG A;  3T5V A;  4B93 B;  4CEM A;  3VLE A;  3C3R A;  2Y4T A;  4GPK A;  1E7V A;  3Q7A A;  3R9A B;  2WQ7 A;  4MRU A;  2F8X K;  1V54 E;  1VDY A;  3FUL A;  4TRQ A;  1ZU2 A;  3ZHE B;  3G2U A;  1MQS A;  4OAU C;  3ESL A;  4HOU A;  5CMW A;  1TR4 A;  5ENN A;  5AN8 A;  1TNO A;  1IKN D;  4CGW A;  4F1P A;  1MX2 A;  2YNQ A;  3NB2 A;  1HO8 A;  3C98 A;  5AQ9 A;  1U2V G;  3L13 A;  4JEH A;  5FIN A;  3ZKJ A;  4G8L A;  3ONK A;  4DX5 D;  4J8F A;  3ZN3 A;  4HLL A;  1G3N B;  2VSO E;  3JCK C;  2ETC A;  3SHF A;  1NA0 A;  3D9K A;  4WND A;  5J08 A;  3FUE A;  4U63 A;  3SGH A;  5G04 C;  2L6J A;  3UT8 A;  1DVP A;  5T8I A;  4BTB A;  3QWV A;  4PS3 A;  5FJY A;  1KZP A;  4L1B A;  4Y6W A;  3ISM C;  1NL4 A;  3FEX A;  2P9I G;  3QDN A;  1Z3Y A;  3CVP A;  3U3W A;  1LD8 A;  3HG0 D;  4GMR A;  2BTD A;  3ABL E;  1OT8 A;  4N3C A;  4XZ4 A;  1JCS A;  2KZT A;  4FA6 A;  1U3D A;  4YND A;  2IU1 A;  3CK7 A;  3ZVV A;  1FVF A;  2AXU A;  3I3N A;  3CHP A;  3QWW A;  2LSV A;  3T5X A;  4KZ0 A;  1N94 A;  2WPV A;  3E32 A;  5E76 A;  3KD7 A;  2IJG X;  3FP3 A;  3DSS A;  4EHM A;  4OYS A;  4I2W A;  2UY1 B;  2VSY A;  4AIF A;  1RZ4 A;  4CDN A;  2UWJ G;  4GYY A;  3T9K A;  1HXI A;  2WXN A;  1XGW A;  5JA4 D;  4EPZ A;  4N3B A;  5HS0 A;  1QQE A;  3CHO A;  2FO7 A;  5D0O D;  1H2U A;  3QJZ A;  4L2Y A;  1ELR A;  5JJT A;  3QNK A;  2I9C A;  1JWF A;  4GZC A; 
#chains in the Genus database with same CATH homology
 4ATG A;  4I1A A;  2WXJ A;  3B13 A;  3CKB A;  4U04 A;  4F53 A;  1HG5 A;  3MX3 A;  3FFL A;  3MZL B;  3Q49 B;  5C1D A;  2KM4 A;  3LY8 A;  3B7U X;  3LVQ E;  3FU5 A;  3PRZ A;  3S2A A;  1SZA A;  4I6G A;  3FU0 A;  2XGS A;  1QZ2 A;  4R7L A;  2CHW A;  2ION A;  4CT0 A;  4RSY A;  5FQ4 A;  4FHK A;  5ARF A;  2C0M A;  4FJY A;  4FP7 A;  3S7F A;  4L2L A;  4ANW A;  3O48 A;  1NA3 A;  1Y6I A;  5CHE E;  3S7J A;  2WXK A;  3L17 A;  3MV3 B;  4JPS A;  4B0Z A;  2A5U A;  2CFU A;  3CST A;  4JW1 A;  4F3V A;  1HS6 A;  2BUG A;  2J4B A;  3FTX A;  5G05 C;  2PM6 A;  4G24 A;  4AJW A;  4NUR A;  3HDX A;  4D10 C;  4E6H A;  3SZ7 A;  1P5Q A;  4G26 A;  2CFZ A;  3TGO A;  1H2T C;  4K0R A;  3GYZ A;  2J07 A;  3JQ1 A;  1UJJ A;  1PC2 A;  2R5S A;  3FUF A;  1W3B A;  4AY6 A;  3LDZ A;  4JZY A;  4GU5 A;  1HZ4 A;  4WNG A;  3QK0 A;  4BFR A;  1UN8 A;  2RG8 A;  1OWO A;  2VGX A;  4AEZ C;  3NZU A;  2KCL A;  2WXI A;  3APF A;  2OND A;  3UUX A;  1S0P A;  4KMO A;  3ZFW A;  2X6H A;  2XEV A;  3MEK A;  4P29 A;  5G04 J;  2XGM A;  4ACL A;  3FTU A;  3L16 A;  4HOS A;  1WAO 1;  4JHJ A;  1OWP A;  3KEZ A;  3FTS A;  3CEQ A;  4ANX A;  2VTB B;  3ASD A;  1DNP A;  4JA7 A;  4JXT A;  1KT0 A;  3L08 A;  4DPR A;  4XKC A;  3TJP A;  2IF4 A;  4Y6C A;  3HVE A;  5HI7 A;  2WQ6 A;  4MS6 A;  3LY9 A;  4RG6 A;  3AU5 A;  2IOL A;  3LY7 A;  3TG5 A;  5BPP A;  2L9B A;  4YVQ C;  3ESK A;  4XX5 A;  4NRH B;  3CHR A;  4GAA A;  1UJK A;  4XIF A;  3QOU A;  3OXF A;  4A1G A;  5BV0 A;  3TXN A;  2V4L A;  5CCL A;  4J0U A;  2Y4U A;  3SBS A;  1ELW A;  4KXK B;  2L0T B;  2FF4 A;  3CQG B;  3CVN A;  3JYS A;  3FY4 A;  3QWP A;  4CDM A;  3QC1 A;  3U64 A;  1MHQ A;  4HOR A;  5JJ6 A;  2PM7 A;  4NAC A;  4ME2 A;  4PS7 A;  5FZQ A;  3LPZ A;  1E8Y A;  5BW8 C;  3PUJ A;  3PS6 A;  4B94 A;  4N3A A;  2E2E A;  1E8Z A;  5BUZ A;  2L0I A;  1Z6T A;  3FUM A;  2WQH A;  5AJD A;  5AJL A;  4C9B B;  4UWK A;  4TV3 A;  4K03 A;  5JHA A;  3CV0 A;  4BX8 A;  3CSF A;  3GZ2 A;  3URZ A;  4B89 A;  2EQX A;  2YHC A;  3R7R A;  3HYM B;  1OWN A;  1HF8 A;  2LAH A;  4OVU A;  4G2V A;  2VQ2 A;  4FLB A;  2I2O A;  5D0Q D;  1EF1 C;  3LJ3 A;  4FJZ A;  4GA0 A;  3ZXS A;  4BT8 A;  3ZYM A;  4HXI A;  4B8A A;  3PRE A;  2XGO A;  5AYW D;  4HLE A;  2J9Q A;  5A6C A;  1NP7 A;  3OXL A;  1OUV A;  2GW1 A;  4DI4 A;  3APD A;  3FUJ A;  5FQ7 A;  4GZ3 A;  4LRZ A;  1U3C A;  2WXG A;  3MV2 B;  3ONL A;  3ZYK A;  4EBA G;  5BV1 A;  3FH8 A;  4KVM A;  4HFG A;  5KCM A;  3U66 A;  3VLF A;  2PL2 A;  5HQ8 A;  2HYZ A;  5A7D B;  3EIJ A;  1LF8 A;  4G25 A;  4V3I A;  4XE0 A;  1SQM A;  2PQR A;  3FU6 A;  3ENE A;  1OWM A;  3PDN A;  2AVP A;  2MOW A;  5G2N A;  4LEU A;  2MRI A;  3CIA A;  3L6A A;  2FI7 A;  5KJM A;  4IYP A;  4J8D A;  1Z3X A;  3G2V A;  3FTV A;  3IKO B;  2OOE A;  2HO1 A;  3LKU A;  3CVX A;  4AM9 A;  4DLO A;  1E8W A;  1UG3 A;  4UQY A;  2XRY A;  3QB2 A;  1UN9 A;  4EQF A;  1JPL A;  2VSX E;  4G1T A;  4GA1 A;  2LSU A;  5C2Y A;  4CGV A;  3LEW A;  4L23 A;  4WAF A;  1NZN A;  2Y3A A;  3FDH A;  4C0E A;  1HG2 A;  4JVS A;  2OV8 A;  1KLX A;  2IOS A;  4PUC A;  5FWQ A;  2XQ0 A;  2HM8 A;  2GRM A;  2I1J A;  2X6F A;  5EKQ D;  2X6I A;  1YA0 A;  3WXX A;  3BG1 B;  2R59 A;  4BX9 A;  4MLP A;  2CG3 A;  2AXV A;  3FUK A;  3FUD A;  4WWP A;  3D3M A;  4AXH A;  4FAD A;  1EDU A;  3ZYL A;  2AWI A;  1FVH A;  3G2T A;  3RU0 A;  3RIB A;  3CVY A;  5ANR A;  1HFA A;  3TL5 A;  3DPD A;  4CDR A;  2NXP A;  4MKT A;  4WNE A;  3B7T A;  2XCB A;  4KVO A;  3PNT B;  4HS2 A;  4I9E A;  4L7T A;  4EBA A;  5LFA A;  2CHZ A;  2DCP A;  3FHE A;  2VJ8 A;  3RRN B;  4UWF A;  4GMJ A;  3RO3 A;  3SNX A;  4NQ0 A;  3DBS A;  3LXU X;  3ZRH A;  3ZIM A;  5KJN A;  2WXQ A;  1HU3 A;  4ILG A;  2NSZ A;  5J90 A;  3ZYQ A;  4J6I A;  2OVB A;  1H0A A;  5ANL A;  3E4B A;  1OWL A;  3CVV A;  1H2V C;  2WXR A;  1BPO A;  3GZS A;  2WXH A;  3KS2 A;  5G05 J;  2XHE A;  3CVW A;  3VTX A;  5LCW J;  1IYG A;  2BF0 X;  4YVO A;  2QY7 A;  3D9P A;  3S7B A;  2XPZ A;  1H6K A;  3GZ1 A;  3TXM A;  4XKB A;  2VTB A;  2JEK A;  2GGF A;  4XI0 A;  3LVR E;  3TG4 A;  3FUN A;  2MHK A;  5FZR A;  4GML A;  1INZ A;  2JLB A;  1N54 A;  4BY6 A;  2IFU A;  4DJA A;  3IBE A;  4FUL A;  2WMO A;  5LX8 A;  2WVI A;  3P1U A;  3D9L A;  4C0M A;  4PDX A;  4DK5 A;  2FEZ A;  3EDT B;  3KAE A;  4JL0 A;  2FBN A;  3PVL A;  3SFZ A;  2KC7 A;  4HOT A;  4W9R A;  3UMV A;  4KT6 B;  5CMY A;  2KZT B;  3Q15 A;  4LCT A;  5JHB A;  3D9O A;  3N71 A;  2X38 A;  4WNF A;  3BG0 B;  2CG2 A;  3ML8 A;  5T4Y A;  1GW6 A;  1E96 B;  2Q7F A;  5DBK A;  3I5P A;  4IN3 B;  4FC8 A;  4JA9 A;  3QKY A;  5FQ6 A;  2WXO A;  4U0S A;  5T3R A;  3U9W A;  3LS8 A;  4I2Z A;  4ANV A;  5FT9 A;  2KCV A;  2J4D A;  5JJ7 A;  2KAT A;  3HIZ A;  3L22 A;  3OTN A;  3PE4 A;  4BSX A;  1TEZ A;  4E85 A;  4N2Q A;  4U07 A;  3FEY A;  3EHM A;  4M3O A;  4UQZ A;  3D9M A;  5M72 A;  2CHX A;  2OVF A;  2RD0 A;  2I6H A;  3GW4 A;  2WXF A;  2ZU6 B;  4UQX A;  3BEE A;  4AY5 A;  4AP2 A;  3S7D A;  1IHG A;  4UI9 C;  3T5V A;  3CVQ A;  1JUQ A;  3MJW A;  4ILH B;  3VLE A;  3ASH A;  4CEM A;  2X3M A;  3RJV A;  3UPV A;  2Y4T A;  4GPK A;  3JUI A;  1WM5 A;  4GYO A;  3B7S A;  1PY1 A;  1E7V A;  3R9A B;  4G23 A;  4APF A;  2WQ7 A;  4MRU A;  5ARG A;  1VDY A;  3FUL A;  3FWV A;  3IHY A;  4TRQ A;  4UWG A;  1ZU2 A;  4WUY A;  4GCO A;  4H7X A;  4IRU A;  3ZHE B;  3G2U A;  1MQS A;  3ZHE A;  2GRL A;  3ESL A;  5LOZ A;  4HOU A;  4KYO B;  5CMW A;  3RRU A;  5ENN A;  1XNF A;  2X6K A;  1EYH A;  2V5F A;  5LCW C;  3RK6 A;  4O6F A;  4CGW A;  4I17 A;  3CVL A;  2WXM A;  3R7Q A;  3SI5 A;  3EJN A;  3CGH A;  4U8H A;  3D9I A;  3CK9 A;  4A3V A;  2YNQ A;  3CR3 A;  4I6J A;  4PH4 B;  4GCN A;  5EX0 A;  1HO8 A;  3Q47 B;  1IQR A;  2P58 C;  2VYI A;  5A23 A;  3C98 A;  3FTW A;  3I4G A;  3PH0 C;  4A3T A;  2C0L A;  2YHE A;  2A4Z A;  1PAQ A;  4JEH A;  3L13 A;  1TJC A;  4ILI A;  2J09 A;  3PEU B;  4J8S A;  4Q96 A;  1Y8M A;  4DLQ A;  2J08 A;  3VLD A;  3ONK A;  4J8F A;  2LAI A;  2LNI A;  3OAW A;  3FTZ A;  3QAR A;  5FTP A;  3ZN3 A;  2VGY A;  4CRW A;  3Q5M A;  2VSO E;  1L5J A;  3JCK C;  3PNL B;  2PZI A;  4I1O B;  2QFC A;  3MKR A;  4UWL A;  3SHF A;  4GZD A;  4EZL A;  1E8X A;  2DBA A;  2XRZ A;  1NA0 A;  3D9K A;  4N2S A;  4WND A;  3L54 A;  4Q69 A;  5G55 A;  2R17 C;  4F1S A;  4GA2 A;  1IQU A;  2DIW A;  2YQ8 A;  2XPI A;  3IHV A;  5J08 A;  4JC8 A;  3PEV B;  3ULQ A;  1UW4 B;  3FUE A;  3CHM A;  1E90 A;  3FH5 A;  4U63 A;  4JEU A;  5G04 C;  3SGH A;  2L6J A;  3UT8 A;  3SD5 A;  3UQ3 A;  4U0Z A;  4QFV A;  1DVP A;  5T8I A;  4BTB A;  4EEC A;  3QWV A;  4PS3 A;  5FJY A;  3CLJ A;  2YIN A;  3CK8 A;  5BNW A;  3JQ0 A;  4L1B A;  4KZC A;  4Y6W A;  3SF4 A;  5AEN A;  4UI9 K;  4URK A;  1N52 A;  3FEX A;  3IV0 A;  5E75 A;  4CT4 A;  4I43 A;  4KBQ A;  4CCA A;  4FLH A;  5LP0 A;  3FTY A;  3PZD A;  3NZS A;  4I1M A;  4LUN U;  5KJL A;  3QDN A;  1Z3Y A;  1HX8 A;  3FH7 A;  2VGX B;  4B8C B;  5FQ8 A;  3MKQ B;  3CHS A;  2VSN A;  3ZW3 A;  3NQP A;  3B7R L;  3MKQ A;  3AS5 A;  4JHK A;  2AXZ A;  3CVP A;  4I6E A;  4N39 A;  5FZS A;  3U3W A;  1KT1 A;  3AS4 A;  3CKC A;  3APC A;  2HR2 A;  4H7Y A;  1EPU A;  5EDS A;  4A1S A;  2I1K A;  3PE3 A;  3CHQ A;  3QAQ A;  3AS8 A;  4ANU A;  1FCH A;  3LYA A;  1X5B A;  3U4T A;  4ACK A;  3ASG A;  3FUH A;  4HVB A;  3D9N A;  3VTY A;  2BTD A;  2NC9 A;  4N3C A;  4WWN A;  4XZ4 A;  1JWG A;  3RO2 A;  3HVE B;  4FA6 A;  2KZT A;  5CCM A;  1U3D A;  2KCK A;  3OXG A;  2V0P A;  4YND A;  2IU1 A;  3CK7 A;  3PUK A;  3CQC B;  3G2S A;  2XCC A;  1FVF A;  3ZVV A;  2AXU A;  3I3N A;  3CHP A;  3QWW A;  2WB2 A;  1E7U A;  2WMN A;  1A17 A;  4IUL A;  2LSV A;  5KJK A;  2C2L A;  4GZ5 A;  4RVB A;  2AW6 A;  3ML9 A;  3T5X A;  4KZ0 A;  3D9J A;  3RRM B;  3HHM A;  3NF1 A;  3IEG A;  4A55 A;  3MYV A;  3SBT B;  2X6J A;  3TAX A;  3FUI A;  4FU3 A;  3K9I A;  2WPV A;  1SZ9 A;  4EZJ A;  3AU4 A;  5E76 A;  3MCX A;  3KD7 A;  4U0U A;  2IJG X;  3FP3 A;  4AVX A;  4F7A A;  4AOF A;  2WXL A;  4TUU A;  4WWO A;  3EIQ C;  4OYS A;  4I2W A;  2IQC A;  2UY1 B;  2VSY A;  2WM9 A;  3G2W A;  2ILR A;  3ZGQ A;  4AIF A;  1HH8 A;  4JHR A;  2UY1 A;  4CDN A;  2UWJ G;  3P2B A;  5BT1 A;  4GYY A;  4EZK A;  4APO A;  2LO6 A;  1TJF A;  4BWR A;  4ABN A;  4HOQ A;  1HE8 A;  4LER A;  4Q94 A;  1HXI A;  2WXP A;  4OVV A;  2WXN A;  1XGW A;  2V8S E;  3CVU A;  2FUL A;  2PQN A;  3LCA A;  5EX3 A;  3UT4 A;  3FU3 A;  3T8M A;  3UX4 A;  4EPZ A;  3ZPJ A;  3ASF A;  3I4R B;  4N3B A;  3RKV A;  3MGB A;  4BT9 A;  4BTA A;  2J49 A;  1QNF A;  4FHJ A;  4I9C A;  1QQE A;  3CHO A;  1H19 A;  1B89 A;  2FO7 A;  1WY6 A;  3Q4A B;  4PS8 A;  5D0O D;  4GYW A;  1H2U A;  4AV7 A;  4G11 A;  4GB9 A;  3ZEF A;  1ZBP A;  2E0I A;  3QJZ A;  3MA5 A;  4N5C A;  4XI9 A;  5AIJ A;  4L2Y A;  3O4Z A;  1ELR A;  1ELK A;  3EHN A;  5DIZ A;  4UWH A;  4UI9 J;  3UT7 A;  3QNK A;  4DI3 A;  5JJT A;  2I9C A;  2XPY A;  1JWF A;  2M63 A;  4GZC A;  4J8E A;  4RG9 A;  4GZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...