2F0YA

Crystal structure of human protein farnesyltransferase complexed with farnesyl diphosphate and hydantoin derivative
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
314
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title hydantoin derivatives as Non-pepridic inhibitors of Ras Farnesyl transferase
rcsb
source organism Homo sapiens
total genus 118
structure length 314
sequence length 314
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2f0yA00
4GTPA 4GTRA 3DPYA 3EUVA 1LTXA 3KSLA 1O1RA 1N4RA 2R2LA 1KZOA 1MZCA 4EHMA 1TNZA 1N4PA 1DCEA 2ZISA 1LD8A 1S64A 1S63A 1FT2A 3PZ2A 1TNUA 1JCRA 3PZ1A 3E37A 1QBQA 3Q75A 3KSQA 2H6HA 1LD7A 3E30A 1TNOA 3DRAA 1X81A 3Q7FA 3HXEA 3E32A 1N4QA 1NL4A 3DSUA 4GTVA 1NI1A 2ZIRA 3E33A 3DSTA 1KZPA 1FPPA 1N9AA 4GTTA 2BEDA 1D8DA 3DSVA 3HXFA 2IEJA 3EU5A 3PZ4A 1N94A 2H6IA 3PZ3A 3HXCA 4GTQA 4YDOA 1TNBA 1O1TA 2H6GA 1TNYA 3Q79A 1FT1A 3Q78A 3DSSA 4MBGA 3Q73A 4GTOA 1SA4A 1O5MA 2F0YA 2H6FA 4LNBA 3HXDA 1TN8A 1TN6A 1JCSA 1O1SA 4GTMA 3SFXA 1N95A 3SFYA 4LNGA 1SA5A 3HXBA 4YDEA 1N4SA 1TN7A 3DSWA 3Q7AA 4L9PA 3DSXA 3E34A 1JCQA 1D8EA 3C72A 4GTSA
chains in the Genus database with same CATH superfamily
2EQXA 5CCLA 3AG1E 4U07A 3ZGQA 4FP7A 4F6RD 3FUIA 1QNFA 1N4PA 2L0TB 3ZPJA 5ENRD 2XQ0A 3CHQA 3NBNB 4BX9A 3LKUA 2WXGA 5EKQD 2XPIA 1A5EA 1U2VG 5ANRA 4ANUA 3G2TA 3U66A 2NC9A 2IO2C 5CBOA 5JA4D 2IONA 2VJ8A 2B0OE 1EYHA 3ISMC 3QOUA 1P5QA 3SBSA 1V55E 3Q47B 4DI4A 3BEEA 4EQFA 3MV3B 3UXGA 4RLYA 4I1AA 4RQIA 5FQ8A 2WMOA 2V4HC 1H6OA 4N2SA 3TAXA 3V30A 2XENA 4WWPA 2F0YA 2DIWA 5EILA 4G23A 4DLOA 4LNBA 3JQ1A 1K1AA 4N3BA 1OWLA 4ACKA 3Q9NC 2P9PG 1WG0A 2L0IA 3HXBA 1PY1A 2IJGX 4YDEA 4I1MA 1OCZE 2DZNA 2IO3C 3C72A 5CEAA 4ANWA 4O6FA 2WXOA 2HYZA 3QK0A 4BY6A 1E7UA 3ZYQA 3DPYA 3KSLA 4G8KA 3KAEA 3AG4E 2UY1A 5AENA 3L16A 4AM9A 5CRUA 4CT0A 2OV8A 1HS6A 2WXHA 4GYOA 1IXVA 1OT8A 4DLQA 3EHQA 4GZDA 1Z5SC 4CT4A 1G3NB 2R05A 2KC7A 3ULQA 1ELRA 4IYPA 4D10C 3UM0A 3E30A 5G04C 1X81A 3CHMA 3PDNA 2QY7A 1YA0A 4YDYA 2XCCA 2F8YA 3E33A 5FIOA 2L9BA 4AVXA 1FPPA 3CSTA 4QFVA 3UKUG 3CVPA 5B3SE 5IY5E 3ZN3A 3ZXSA 2DBAA 1QYMA 4YNDA 5J90A 4JPSA 5KCMA 4KYOB 3CHOA 4CDNA 3BUAA 3OXFA 2V4LA 4LERA 3HXDA 2IY0C 1SA5A 4I1OB 5FQ6A 2QYJA 4NRHB 1JWGA 5EYPF 2NSZA 4EZJA 3DSXA 4RG6A 2WB2A 5EX3A 4L2YA 3NOGD 4I6EA 3LY8A 3TGOA 5JHAA 2L6JA 2XRZA 1N4RA 2R2LA 5JMND 3I4RB 2AJAA 3RRUA 4DX1A 3MGBA 3FTYA 2XZDG 4GYWA 3SI5A 4K5CA 2P9UG 1N11A 1WY6A 1TNUA 4U63A 1KPSB 5KNGA 3G2SA 3S7JA 3UI2A 3FH5A 2PM7A 3U9WA 2X6KA 1E8ZA 4A1SA 3DSTA 2KCKA 5LFAA 2LAHA 3UKRG 4Q96A 3ZKJA 3G2VA 3CHSA 3L9TA 5AN8A 4CDMA 4L7TA 1OWMA 1TNBA 1TNYA 3CVLA 3L08A 4HRNA 3ZVVA 2VSYA 4GTOA 4KT6B 4AY5A 5CHEE 3TWSA 1HFAA 3CVNA 3SFXA 4JHKA 1E8WA 3Q4AB 2DYSE 3RK6A 1Z3XA 1E96B 2P2CP 1HU3A 2HR2A 4U8HA 3F6QA 3EUVA 3LJ3A 2XEHA 1Z3YA 3LS8A 1B89A 2FO7A 2XPZA 4F53A 3PREA 3B7TA 3SGHA 4R7LA 3UINC 2Y4UA 4HLLA 3AS4A 3CR3A 4Y6CA 1MX2A 2WXNA 1FVFA 1IHGA 4EBAA 4GMJA 3UX4A 2B6CA 4IN3B 4CGWA 5KNHD 2P9NG 2NYJA 2RG8A 3OXLA 2M63A 3UT4A 5EN5D 1BD8A 1EDUA 4G25A 3PZ3A 4FLBA 3RU0A 4HQDA 3L13A 4KVMA 5BV1A 4HI9A 3CEQA 4HRMB 3D9NA 2AVPA 2QZAA 3PNLB 3FU0A 1H6KA 1SA4A 3MA5A 5FZSA 2X6FA 4UWGA 3SQVA 3FTSA 2PL2A 4UWLA 5AIJA 4XE0A 4DK5A 1E7VA 4N2QA 3T5XA 1OWOA 3KEZA 5CBNA 1TN7A 3ASGA 3IV0A 3E4BA 4C0MA 3TXNA 2XEVA 1OCRE 4WNGA 3S7DA 2WVIA 3AG3E 4E6HA 2KZTA 1O1RA 4N5CA 4PS8A 3U3WA 1PAQA 4J8EA 2PNNA 1D9SA 3URZA 3SF4A 5H7PA 4J8SA 2I6HA 4JA9A 5D0OD 3D9HA 3FUFA 2P9KG 4G8LA 1E8XA 2FF4A 4YVOA 2LXMA 3DXKG 3CVXA 4IULA 4AIFA 2ETAA 4DRXE 5AARA 1OXJA 3LVRE 2KCLA 1OWPA 2WPVA 2WXPA 1LD7A 1TNOA 5HQ8A 3LJNA 2XS8A 4B93B 4GU5A 4APOA 2RD0A 3DEPA 4BWRA 5AJDA 3IEGA 1NP7A 3CQGB 2C2LA 3J5PA 1NA3A 4HXIA 2RKKA 1N94A 4JL0A 4A1GA 4N3CA 4U8YD 4XZ4A 4GMRA 1FT1A 5A23A 4XI0A 3FEXA 2AW6A 3Q73A 4M7CA 3LDZA 5HRYA 2DZOA 2OVFA 2MHKA 5ENTD 3CV0A 4GTMA 5JJTA 3R9MA 5LX8A 4WWOA 4BX8A 3N71A 3EHRA 4I2ZA 5CERB 4JVSA 2X6JA 2XZTG 2ZGDA 2WXRA 4WAFA 4JHJA 1BPOA 4FA6A 3MKQB 2PQRA 1KZOA 2Q7FA 4UWFA 2YNQA 4XEIG 3SFZA 3JXJA 3UM1A 2PM6A 1K3ZD 3HDXA 5B1AE 3ZYLA 1IQUA 3VTYA 3V79K 3CSFA 4JD2G 2BUGA 3ASFA 3UTMA 1FT2A 2UWJG 2P9LG 1NZNA 1AP7A 2V0PA 4XKCA 4UUCA 1JPLA 3B7RL 3FTXA 3D9LA 4GCNA 3DSUA 4ATZD 4F7AA 5FJYA 3ZNGA 2ZXWE 3SBTB 2ILRA 1UG3A 2DYRE 1ZU2A 2BEDA 4DX6D 4ME2A 5AQAA 4J8FA 3HXCA 1UJKA 4I6JA 4GTQA 4YDOA 4U7EB 3B13A 3DSSA 5C1DA 4A3TA 4JXTA 3ABKE 1N54A 3B7BA 4U04A 4TV3A 4EZKA 2DCPA 3AU4A 2LXLA 1TN6A 3CVQA 4J8YA 5EDSA 4EZLA 4EBAG 1Q2ZA 1TEZA 4XX5A 2J8SD 4M3OA 2YHEA 3MKQA 3W9GA 4HS2A 2WXFA 2GRLA 4ZHBA 2NXPA 3ENEA 5AQ9A 3PEUB 2X6HA 3D9KA 2Y4TA 2GRNB 3TWVA 2VGEA 4LNUD 4AJWA 4TXQA 5A7DB 4HLEA 3LEWA 4K5BA 1S0PA 1Y8MA 3ZW3A 2Y0BG 4MS6A 4LRZA 3PZ1A 4Q94A 2J07A 1K8KG 3QC1A 3ZYMA 2P58C 3MZLB 4B94A 1N4QA 5HI7A 3FDHA 4RSYA 1SVXA 4UWHA 3FTWA 1N0QA 2VSOE 3MKRA 3OTNA 3TG4A 3K9IA 2BKGA 1JUQA 3NQPA 1RZ4A 3UT7A 3GZ2A 3PZ4A 3WG7E 4F3VA 2XEEA 5BNWA 1OCCE 4YVQC 2XGSA 1QQEA 2Y1LE 4UQYA 3IHYA 4BSXA 1O1TA 3S2AA 2LUHA 5T3RA 4ILGA 3AS5A 2HO1A 1ZBPA 4CZ2D 2V5FA 3ZUVB 4J6IA 2AXUA 1O1SA 3QARA 5FQ4A 3L82A 4GZCA 4LNGA 4LG6A 4FLHA 5C2YA 1NA0A 5ARGA 4ZFHA 4V3IA 3T5VA 2MYOA 1IHBA 3UIPC 3FH8A 4APFA 1BLXB 4IRUA 3QWVA 3BG0B 4GZ3A 1Y6IA 4GAAA 2WQHA 4A3VA 2QC9A 1HF8A 3IKOB 3MYVA 5G05C 1IQRA 3B95A 2R5SA 5LCWC 3HVEB 1S63A 3R7QA 2A4ZA 3RRMB 2E0IA 4BT9A 3IHVA 3QAQA 4GTVA 2ZIRA 3TWXA 3Q15A 3LVQE 3FTZA 4GTTA 1TJCA 4U0ZA 4BEPA 3C3RA 5E75A 5M72A 1KLXA 1UN8A 3CKCA 2BTDA 5AYWD 5FWQA 5BPPA 5FTPA 4XIFA 1RW2A 4HI8A 5EX0A 3RIBA 3PZDA 4KZ0A 2WXKA 4U0UA 3UPVA 3UUXA 3I4GA 2E2EA 3DEOA 4C48B 3FUHA 4G24A 4FC8A 2KBXA 3HHMA 3T9KA 3TG5A 1N4SA 4PS7A 3Q7AA 5EYLA 2J9QA 4J7WA 4GTPA 4KVOA 4Y6WA 3WXXA 1MZCA 4DJAA 1XNFA 2WQ7A 1TNZA 3X2QE 1DCEA 4MLPA 2C0MA 3QWWA 4GA0A 1EPUA 3GW4A 1LD8A 2WQ6A 3TJPA 2V8SE 5AJLA 2FI7A 1EF1C 2IF4A 1BU9A 3ZXPA 3CK7A 2P9SG 2XCBA 2CFUA 3PEVB 4N39A 3SO8A 3V2XA 2VTBB 3KEAA 1ELWA 5JJ7A 1D8DA 3PVLA 3PUJA 4JZYA 3CHPA 4BTAA 5ENNA 3OAWA 4N5QA 2H6GA 2GRQB 4K5AB 1KT1A 3CVWA 3JCKC 3AG2E 4OYSA 2LSUA 4GPMA 4DX5D 3NZSA 5FZRA 3ESLA 1O5MA 3D3MA 2IOLA 3ULYA 4L23A 1JCSA 5CECB 4WWNA 3L22A 3C3QA 5FQ7A 1MQSA 3FUMA 1BI7B 3GZ1A 1SW6A 4Q69A 1IYGA 3DSWA 1SQMA 2BF0X 3D9IA 1ZB1A 4K0RA 2P9IG 4O1PA 3I3NA 5A6CA 2KXPC 4NURA 5KJNA 4ILIA 4AP2A 4AOFA 1VDYA 3CKBA 4EHMA 3JXIA 1MX4A 3EDTB 3CVUA 2ZISA 2C0LA 4GA2A 4BSZB 3APFA 3EHNA 3CHRA 3GZSA 3C5RA 5B1BE 1LF8A 3QB2A 3Q5MA 3O4ZA 2AXZA 5G05J 3LCAA 4DI3A 5ENOD 2JLBA 4CGVA 3TL5A 5LCWJ 1NI1A 4NQ0A 1MYOA 1DVPA 3JUEA 2XS1A 4OVUA 3VLDA 1N9AA 5CEDB 3FWVA 4GB9A 4PH4B 4JW1A 3MX3A 4UI9C 2A5EA 2BKKB 3MEKA 5CCMA 2OEVA 2R02A 2R17C 4LEUA 1H0AA 4HNAD 4BT8A 4XI9A 2CHZA 3ULEG 5T4YA 1U3CA 3RO2A 3CVVA 5E76A 4BERA 1H6PA 3O48A 4GZ6A 3EIJA 4GTSA 3D9JA 4B8CB 3EJNA 1UW4B 5ENQD 5EIBE 5KJMA 3DPDA 4AY6A 5KJKA 2IFUA 1AWCB 4LSZE 4KBQA 4AV7A 3TWQA 5FT9A 4ABNA 2XHEA 2CHXA 4UI9K 4CCAA 1S64A 3PS6A 5DBKA 4U0SA 2I2OA 2VGXB 5KBAA 4TXPA 5D0QD 5JJ6A 4BETA 4I6GA 3LPZA 3Q75A 4QQIA 3CIAA 2WMNA 1NL4A 4PDXA 5CMYA 4F1PA 2KM4A 1E90A 1HE8A 1WAO1 3C3OA 4TUUA 2ETBA 3JYSA 4I9EA 5HS0A 2YINA 5BW8C 3EU5A 2EIME 3EHMA 2H6IA 3VLFA 4J0UA 1A17A 2XRYA 4GA1A 3JUIA 5ENPD 2MOWA 4DPRA 3I5PA 1BI8B 2H6FA 3Q49B 1X5BA 5JHBA 3FU3A 3U64A 3SNXA 2GRRB 2KCVA 3R9AB 1YMPA 2UY1B 5EIDA 3BG1B 3FP3A 3NOCD 4AEZC 2IOSA 3ONLA 3RO3A 3JQ0A 4WNDA 2I1JA 4I43A 3FHEA 1ELKA 2F37A 2Y3AA 4BFRA 3FTVA 2PQNA 2JABA 4JHRA 3RJVA 3CK8A 3LY7A 1TR4A 4E85A 2WXJA 2VGXA 3BQOA 4KZCA 3PZ2A 4LCTA 4UQZA 2XGOA 3DRAA 5AQ7A 5G55A 3CQCB 3G2WA 4XKBA 4AXHA 3J5QB 3APCA 3AU5A 5DIZA 1TYQG 2OVBA 3CVYA 3LY9A 4UQXA 5FINA 2AWIA 3ML8A 1FVHA 2Y69E 3FU5A 3PE4A 3ZRHA 1WM5A 1SZAA 4G11A 1XGWA 4O1OA 1HZ4A 1E8YA 3HG0D 2HE0A 2CG2A 3R7RA 4I2WA 1OY3D 4UI9J 1N95A 3V2OA 4FULA 5T8IA 4I17A 2XPYA 5BUZA 4GPKA 4U95D 2VSXE 1D8EA 3KS2A 4NIKA 4TRQA 2ZU6B 4KXKB 2AXVA 4JC8A 4ANXA 5LP0A 4G26A 1DNPA 4GCOA 3OXGA 1H2UA 3FTUA 4TUMA 5BXOA 3FUDA 3UQ3A 3FUJA 4ATGA 3HYMB 4Z68A 4BTBA 3FU6A 4FU3A 3MJWA 2OCCE 3UM2A 3SZ7A 3FEYA 3QDNA 3V31A 1JCRA 3B7SA 3E37A 4J8DA 1NFIE 3NF1A 2EIKE 3Q7FA 3IBEA 3PUKA 2ZGGA 4ILHB 1YCSB 5AQBA 4O60A 4OVVA 1INZA 4OAVB 5D2MC 2GRMA 4HFGA 3RSEG 3NAWA 1L5JA 5BXUA 1KT0A 3FY4A 4GZ5A 3CGHA 3Q78A 2VQ2A 4LUNU 3GYZA 4U96D 3ASNE 3BU8A 2VGYA 4WNEA 4FHKA 4HOTA 3P2BA 2J09A 2GRPB 3L6AA 3RKVA 3AS8A 3DBSA 5AAOA 1TJFA 3PH0C 4CRWA 1HO8A 4MKTA 5KJLA 2EIJE 5CMWA 2VSNA 2J4DA 3TWUA 3TWTA 3FUNA 4G1TA 2KATA 2I1KA 3C98A 1DCQA 3ESKA 4DUIA 2J08A 1HX8A 2VYIA 5HKPA 3D9OA 2OEWA 5G2NA 1HG2A 1V54E 2LSVA 4YDWA 1QZ2A 3B7UX 1UJJA 5ARFA 3ML9A 4HOUA 1PC2A 2DVWA 2LAIA 2QYUA 4L1BA 4A55A 4UWKA 2L6BA 4H7YA 4PS3A 4KMOA 2IU1A 1DC2A 5BT1A 3LXUX 4FJZA 4BESA 3D9MA 2A5UA 4X8QA 5J08A 2CG3A 2OOEA 3HVEA 4RG9A 3HXFA 3NZUA 3P1UA 2JEKA 2LNIA 3AJIA 1MHQA 1GW6A 5LOZA 4FHJA 4WUYA 3MCXA 3QKYA 1HXIA 4C0EA 4U8VD 3S7FA 3LYAA 2X3MA 4I9CA 2IQCA 2HM8A 1H19A 4GMLA 3ZFWA 2KZTB 2WXQA 3SFYA 2ONDA 3PRZA 4K03A 1HG5A 2GW1A 3Q9UC 1JCQA 3ONKA 4HORA 1K1BA 3FFLA 3CLJA 4P29A 3ABLE 3D9PA 4F1SA 3APDA 3PNTB 2EILE 3SD5A 4GTRA 1N52A 3UM3A 3HRAA 1WDYA 4DX2A 3RRNB 2LO6A 3ASOE 4NACA 3ZU7B 1H2TC 3UMVA 3ZIMA 4MRUA 5G04J 3W9FA 5ENSD 3KSQA 2H6HA 3SY2A 1S70B 3HXEA 5FZQA 3DWLG 3TWWA 4OAUC 4HVBA 2EINE 3T8KA 2CFZA 4C9BB 1FCHA 3L17A 4JA7A 4TXRA 3TWRA 3TXMA 3ZHEB 5BV0A 3QJZA 2GGFA 1U3DA 3QNKA 3ASDA 4HBDA 3QWPA 4HOSA 2R59A 3AAAC 2X38A 4HRLA 3ASHA 3Q79A 3VTXA 2WXIA 4JEHA 4MBGA 4EECA 2VTBA 1N0RA 4PUCA 1H2VC 3UIOC 1HH8A 1TN8A 3ABME 2WM9A 4CYMD 3FH7A 4H7XA 4B0ZA 4WNFA 1Z6TA 4L9PA 3E34A 4L2LA 1OWNA 5ANLA 3UT8A 1YYHA 3ZYKA 3NB2A 3U4TA 1JWFA 2V5QC 3FULA 3ZEFA 1IKND 2FULA 1LTXA 4CEMA 2QFCA 4JB8P 2J49A 4JEUA 3EIQC 2GROB 3CK9A 2YQ8A 2ETCA 1SZ9A 2I9CA 1UOHA 1W3BA 4GYYA 5ITZF 2RFAA 1MJ0A 2FBNA 3IXEA 1OUVA 1UN9A 1QBQA 4HOQA 1MX6A 3EU9A 3E32A 4B8AA 5KWDA 4A63B 1KZPA 2FO1E 3ZHEA 2RFMA 2PZIA 4ANVA 4G2VA 3DSVA 2IEJA 3FUEA 4DX7D 3VLEA 1OCOE 4RVBA 3DXMG 2XGMA 2CHWA 4FADA 3HIZA 4FJYA 3T8MA 2WXLA 3S7BA 3MV2B 2DWZA 2X6IA 3PE3A 3KD7A 2MRIA 5D66A 2J4BA 2FEZA 3G2UA 4N3AA 3FUKA 2WXMA 4B89A 4CDRA 4W9RA 3RAUA 2R03A 2F8XK 3SHFA 4HB5A 2YHCA 4EPZA 4URKA 4ACLA 3L54A 5CRVA
chains in the Genus database with same CATH topology
4GTPA 4GTRA 3DPYA 3EUVA 1LTXA 3KSLA 1O1RA 1N4RA 2R2LA 1KZOA 1MZCA 4EHMA 1TNZA 1N4PA 1DCEA 2ZISA 1LD8A 1S64A 1S63A 1FT2A 3PZ2A 1TNUA 1JCRA 3PZ1A 3E37A 1QBQA 3Q75A 3KSQA 2H6HA 1LD7A 3E30A 1TNOA 3DRAA 1X81A 3Q7FA 3HXEA 3E32A 1N4QA 1NL4A 3DSUA 4GTVA 1NI1A 2ZIRA 3E33A 3DSTA 1KZPA 1FPPA 1N9AA 4GTTA 2BEDA 1D8DA 3DSVA 3HXFA 2IEJA 3EU5A 3PZ4A 1N94A 2H6IA 3PZ3A 3HXCA 4GTQA 4YDOA 1TNBA 1O1TA 2H6GA 1TNYA 3Q79A 1FT1A 3Q78A 3DSSA 4MBGA 3Q73A 4GTOA 1SA4A 1O5MA 2F0YA 2H6FA 4LNBA 3HXDA 1TN8A 1TN6A 1JCSA 1O1SA 4GTMA 3SFXA 1N95A 3SFYA 4LNGA 1SA5A 3HXBA 4YDEA 1N4SA 1TN7A 3DSWA 3Q7AA 4L9PA 3DSXA 3E34A 1JCQA 1D8EA 3C72A 4GTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTP A;  4GTR A;  3DPY A;  3EUV A;  1LTX A;  3KSL A;  1O1R A;  1N4R A;  2R2L A;  1KZO A;  1MZC A;  4EHM A;  1TNZ A;  1N4P A;  1DCE A;  2ZIS A;  1LD8 A;  1S64 A;  1S63 A;  1FT2 A;  3PZ2 A;  1TNU A;  1JCR A;  3PZ1 A;  3E37 A;  1QBQ A;  3Q75 A;  3KSQ A;  2H6H A;  1LD7 A;  3E30 A;  1TNO A;  3DRA A;  1X81 A;  3Q7F A;  3HXE A;  3E32 A;  1N4Q A;  1NL4 A;  3DSU A;  4GTV A;  1NI1 A;  2ZIR A;  3E33 A;  3DST A;  1KZP A;  1FPP A;  1N9A A;  4GTT A;  2BED A;  1D8D A;  3DSV A;  3HXF A;  2IEJ A;  3EU5 A;  3PZ4 A;  1N94 A;  2H6I A;  3PZ3 A;  3HXC A;  4GTQ A;  4YDO A;  1TNB A;  1O1T A;  2H6G A;  1TNY A;  3Q79 A;  1FT1 A;  3Q78 A;  3DSS A;  4MBG A;  3Q73 A;  4GTO A;  1SA4 A;  1O5M A;  2F0Y A;  2H6F A;  4LNB A;  3HXD A;  1TN8 A;  1TN6 A;  1JCS A;  1O1S A;  4GTM A;  3SFX A;  1N95 A;  3SFY A;  4LNG A;  1SA5 A;  3HXB A;  4YDE A;  1N4S A;  1TN7 A;  3DSW A;  3Q7A A;  4L9P A;  3DSX A;  3E34 A;  1JCQ A;  1D8E A;  3C72 A;  4GTS A; 
#chains in the Genus database with same CATH topology
 2EQX A;  5CCL A;  3AG1 E;  4U07 A;  3ZGQ A;  4FP7 A;  4F6R D;  3FUI A;  1QNF A;  1N4P A;  2L0T B;  3ZPJ A;  5ENR D;  2XQ0 A;  3CHQ A;  3NBN B;  4BX9 A;  3LKU A;  2WXG A;  5EKQ D;  2XPI A;  1A5E A;  1U2V G;  5ANR A;  4ANU A;  3G2T A;  3U66 A;  2NC9 A;  2IO2 C;  5CBO A;  5JA4 D;  2ION A;  2VJ8 A;  2B0O E;  1EYH A;  3ISM C;  3QOU A;  1P5Q A;  3SBS A;  1V55 E;  3Q47 B;  4DI4 A;  3BEE A;  4EQF A;  3MV3 B;  3UXG A;  4RLY A;  4I1A A;  4RQI A;  5FQ8 A;  2WMO A;  2V4H C;  1H6O A;  4N2S A;  3TAX A;  3V30 A;  2XEN A;  4WWP A;  2F0Y A;  2DIW A;  5EIL A;  4G23 A;  4DLO A;  4LNB A;  3JQ1 A;  1K1A A;  4N3B A;  1OWL A;  4ACK A;  3Q9N C;  2P9P G;  1WG0 A;  2L0I A;  3HXB A;  1PY1 A;  2IJG X;  4YDE A;  4I1M A;  1OCZ E;  2DZN A;  2IO3 C;  3C72 A;  5CEA A;  4ANW A;  4O6F A;  2WXO A;  2HYZ A;  3QK0 A;  4BY6 A;  1E7U A;  3ZYQ A;  3DPY A;  3KSL A;  4G8K A;  3KAE A;  3AG4 E;  2UY1 A;  5AEN A;  3L16 A;  4AM9 A;  5CRU A;  4CT0 A;  2OV8 A;  1HS6 A;  2WXH A;  4GYO A;  1IXV A;  1OT8 A;  4DLQ A;  3EHQ A;  4GZD A;  1Z5S C;  4CT4 A;  1G3N B;  2R05 A;  2KC7 A;  3ULQ A;  1ELR A;  4IYP A;  4D10 C;  3UM0 A;  3E30 A;  5G04 C;  1X81 A;  3CHM A;  3PDN A;  2QY7 A;  1YA0 A;  4YDY A;  2XCC A;  2F8Y A;  3E33 A;  5FIO A;  2L9B A;  4AVX A;  1FPP A;  3CST A;  4QFV A;  3UKU G;  3CVP A;  5B3S E;  5IY5 E;  3ZN3 A;  3ZXS A;  2DBA A;  1QYM A;  4YND A;  5J90 A;  4JPS A;  5KCM A;  4KYO B;  3CHO A;  4CDN A;  3BUA A;  3OXF A;  2V4L A;  4LER A;  3HXD A;  2IY0 C;  1SA5 A;  4I1O B;  5FQ6 A;  2QYJ A;  4NRH B;  1JWG A;  5EYP F;  2NSZ A;  4EZJ A;  3DSX A;  4RG6 A;  2WB2 A;  5EX3 A;  4L2Y A;  3NOG D;  4I6E A;  3LY8 A;  3TGO A;  5JHA A;  2L6J A;  2XRZ A;  1N4R A;  2R2L A;  5JMN D;  3I4R B;  2AJA A;  3RRU A;  4DX1 A;  3MGB A;  3FTY A;  2XZD G;  4GYW A;  3SI5 A;  4K5C A;  2P9U G;  1N11 A;  1WY6 A;  1TNU A;  4U63 A;  1KPS B;  5KNG A;  3G2S A;  3S7J A;  3UI2 A;  3FH5 A;  2PM7 A;  3U9W A;  2X6K A;  1E8Z A;  4A1S A;  3DST A;  2KCK A;  5LFA A;  2LAH A;  3UKR G;  4Q96 A;  3ZKJ A;  3G2V A;  3CHS A;  3L9T A;  5AN8 A;  4CDM A;  4L7T A;  1OWM A;  1TNB A;  1TNY A;  3CVL A;  3L08 A;  4HRN A;  3ZVV A;  2VSY A;  4GTO A;  4KT6 B;  4AY5 A;  5CHE E;  3TWS A;  1HFA A;  3CVN A;  3SFX A;  4JHK A;  1E8W A;  3Q4A B;  2DYS E;  3RK6 A;  1Z3X A;  1E96 B;  2P2C P;  1HU3 A;  2HR2 A;  4U8H A;  3F6Q A;  3EUV A;  3LJ3 A;  2XEH A;  1Z3Y A;  3LS8 A;  1B89 A;  2FO7 A;  2XPZ A;  4F53 A;  3PRE A;  3B7T A;  3SGH A;  4R7L A;  3UIN C;  2Y4U A;  4HLL A;  3AS4 A;  3CR3 A;  4Y6C A;  1MX2 A;  2WXN A;  1FVF A;  1IHG A;  4EBA A;  4GMJ A;  3UX4 A;  2B6C A;  4IN3 B;  4CGW A;  5KNH D;  2P9N G;  2NYJ A;  2RG8 A;  3OXL A;  2M63 A;  3UT4 A;  5EN5 D;  1BD8 A;  1EDU A;  4G25 A;  3PZ3 A;  4FLB A;  3RU0 A;  4HQD A;  3L13 A;  4KVM A;  5BV1 A;  4HI9 A;  3CEQ A;  4HRM B;  3D9N A;  2AVP A;  2QZA A;  3PNL B;  3FU0 A;  1H6K A;  1SA4 A;  3MA5 A;  5FZS A;  2X6F A;  4UWG A;  3SQV A;  3FTS A;  2PL2 A;  4UWL A;  5AIJ A;  4XE0 A;  4DK5 A;  1E7V A;  4N2Q A;  3T5X A;  1OWO A;  3KEZ A;  5CBN A;  1TN7 A;  3ASG A;  3IV0 A;  3E4B A;  4C0M A;  3TXN A;  2XEV A;  1OCR E;  4WNG A;  3S7D A;  2WVI A;  3AG3 E;  4E6H A;  2KZT A;  1O1R A;  4N5C A;  4PS8 A;  3U3W A;  1PAQ A;  4J8E A;  2PNN A;  1D9S A;  3URZ A;  3SF4 A;  5H7P A;  4J8S A;  2I6H A;  4JA9 A;  5D0O D;  3D9H A;  3FUF A;  2P9K G;  4G8L A;  1E8X A;  2FF4 A;  4YVO A;  2LXM A;  3DXK G;  3CVX A;  4IUL A;  4AIF A;  2ETA A;  4DRX E;  5AAR A;  1OXJ A;  3LVR E;  2KCL A;  1OWP A;  2WPV A;  2WXP A;  1LD7 A;  1TNO A;  5HQ8 A;  3LJN A;  2XS8 A;  4B93 B;  4GU5 A;  4APO A;  2RD0 A;  3DEP A;  4BWR A;  5AJD A;  3IEG A;  1NP7 A;  3CQG B;  2C2L A;  3J5P A;  1NA3 A;  4HXI A;  2RKK A;  1N94 A;  4JL0 A;  4A1G A;  4N3C A;  4U8Y D;  4XZ4 A;  4GMR A;  1FT1 A;  5A23 A;  4XI0 A;  3FEX A;  2AW6 A;  3Q73 A;  4M7C A;  3LDZ A;  5HRY A;  2DZO A;  2OVF A;  2MHK A;  5ENT D;  3CV0 A;  4GTM A;  5JJT A;  3R9M A;  5LX8 A;  4WWO A;  4BX8 A;  3N71 A;  3EHR A;  4I2Z A;  5CER B;  4JVS A;  2X6J A;  2XZT G;  2ZGD A;  2WXR A;  4WAF A;  4JHJ A;  1BPO A;  4FA6 A;  3MKQ B;  2PQR A;  1KZO A;  2Q7F A;  4UWF A;  2YNQ A;  4XEI G;  3SFZ A;  3JXJ A;  3UM1 A;  2PM6 A;  1K3Z D;  3HDX A;  5B1A E;  3ZYL A;  1IQU A;  3VTY A;  3V79 K;  3CSF A;  4JD2 G;  2BUG A;  3ASF A;  3UTM A;  1FT2 A;  2UWJ G;  2P9L G;  1NZN A;  1AP7 A;  2V0P A;  4XKC A;  4UUC A;  1JPL A;  3B7R L;  3FTX A;  3D9L A;  4GCN A;  3DSU A;  4ATZ D;  4F7A A;  5FJY A;  3ZNG A;  2ZXW E;  3SBT B;  2ILR A;  1UG3 A;  2DYR E;  1ZU2 A;  2BED A;  4DX6 D;  4ME2 A;  5AQA A;  4J8F A;  3HXC A;  1UJK A;  4I6J A;  4GTQ A;  4YDO A;  4U7E B;  3B13 A;  3DSS A;  5C1D A;  4A3T A;  4JXT A;  3ABK E;  1N54 A;  3B7B A;  4U04 A;  4TV3 A;  4EZK A;  2DCP A;  3AU4 A;  2LXL A;  1TN6 A;  3CVQ A;  4J8Y A;  5EDS A;  4EZL A;  4EBA G;  1Q2Z A;  1TEZ A;  4XX5 A;  2J8S D;  4M3O A;  2YHE A;  3MKQ A;  3W9G A;  4HS2 A;  2WXF A;  2GRL A;  4ZHB A;  2NXP A;  3ENE A;  5AQ9 A;  3PEU B;  2X6H A;  3D9K A;  2Y4T A;  2GRN B;  3TWV A;  2VGE A;  4LNU D;  4AJW A;  4TXQ A;  5A7D B;  4HLE A;  3LEW A;  4K5B A;  1S0P A;  1Y8M A;  3ZW3 A;  2Y0B G;  4MS6 A;  4LRZ A;  3PZ1 A;  4Q94 A;  2J07 A;  1K8K G;  3QC1 A;  3ZYM A;  2P58 C;  3MZL B;  4B94 A;  1N4Q A;  5HI7 A;  3FDH A;  4RSY A;  1SVX A;  4UWH A;  3FTW A;  1N0Q A;  2VSO E;  3MKR A;  3OTN A;  3TG4 A;  3K9I A;  2BKG A;  1JUQ A;  3NQP A;  1RZ4 A;  3UT7 A;  3GZ2 A;  3PZ4 A;  3WG7 E;  4F3V A;  2XEE A;  5BNW A;  1OCC E;  4YVQ C;  2XGS A;  1QQE A;  2Y1L E;  4UQY A;  3IHY A;  4BSX A;  1O1T A;  3S2A A;  2LUH A;  5T3R A;  4ILG A;  3AS5 A;  2HO1 A;  1ZBP A;  4CZ2 D;  2V5F A;  3ZUV B;  4J6I A;  2AXU A;  1O1S A;  3QAR A;  5FQ4 A;  3L82 A;  4GZC A;  4LNG A;  4LG6 A;  4FLH A;  5C2Y A;  1NA0 A;  5ARG A;  4ZFH A;  4V3I A;  3T5V A;  2MYO A;  1IHB A;  3UIP C;  3FH8 A;  4APF A;  1BLX B;  4IRU A;  3QWV A;  3BG0 B;  4GZ3 A;  1Y6I A;  4GAA A;  2WQH A;  4A3V A;  2QC9 A;  1HF8 A;  3IKO B;  3MYV A;  5G05 C;  1IQR A;  3B95 A;  2R5S A;  5LCW C;  3HVE B;  1S63 A;  3R7Q A;  2A4Z A;  3RRM B;  2E0I A;  4BT9 A;  3IHV A;  3QAQ A;  4GTV A;  2ZIR A;  3TWX A;  3Q15 A;  3LVQ E;  3FTZ A;  4GTT A;  1TJC A;  4U0Z A;  4BEP A;  3C3R A;  5E75 A;  5M72 A;  1KLX A;  1UN8 A;  3CKC A;  2BTD A;  5AYW D;  5FWQ A;  5BPP A;  5FTP A;  4XIF A;  1RW2 A;  4HI8 A;  5EX0 A;  3RIB A;  3PZD A;  4KZ0 A;  2WXK A;  4U0U A;  3UPV A;  3UUX A;  3I4G A;  2E2E A;  3DEO A;  4C48 B;  3FUH A;  4G24 A;  4FC8 A;  2KBX A;  3HHM A;  3T9K A;  3TG5 A;  1N4S A;  4PS7 A;  3Q7A A;  5EYL A;  2J9Q A;  4J7W A;  4GTP A;  4KVO A;  4Y6W A;  3WXX A;  1MZC A;  4DJA A;  1XNF A;  2WQ7 A;  1TNZ A;  3X2Q E;  1DCE A;  4MLP A;  2C0M A;  3QWW A;  4GA0 A;  1EPU A;  3GW4 A;  1LD8 A;  2WQ6 A;  3TJP A;  2V8S E;  5AJL A;  2FI7 A;  1EF1 C;  2IF4 A;  1BU9 A;  3ZXP A;  3CK7 A;  2P9S G;  2XCB A;  2CFU A;  3PEV B;  4N39 A;  3SO8 A;  3V2X A;  2VTB B;  3KEA A;  1ELW A;  5JJ7 A;  1D8D A;  3PVL A;  3PUJ A;  4JZY A;  3CHP A;  4BTA A;  5ENN A;  3OAW A;  4N5Q A;  2H6G A;  2GRQ B;  4K5A B;  1KT1 A;  3CVW A;  3JCK C;  3AG2 E;  4OYS A;  2LSU A;  4GPM A;  4DX5 D;  3NZS A;  5FZR A;  3ESL A;  1O5M A;  3D3M A;  2IOL A;  3ULY A;  4L23 A;  1JCS A;  5CEC B;  4WWN A;  3L22 A;  3C3Q A;  5FQ7 A;  1MQS A;  3FUM A;  1BI7 B;  3GZ1 A;  1SW6 A;  4Q69 A;  1IYG A;  3DSW A;  1SQM A;  2BF0 X;  3D9I A;  1ZB1 A;  4K0R A;  2P9I G;  4O1P A;  3I3N A;  5A6C A;  2KXP C;  4NUR A;  5KJN A;  4ILI A;  4AP2 A;  4AOF A;  1VDY A;  3CKB A;  4EHM A;  3JXI A;  1MX4 A;  3EDT B;  3CVU A;  2ZIS A;  2C0L A;  4GA2 A;  4BSZ B;  3APF A;  3EHN A;  3CHR A;  3GZS A;  3C5R A;  5B1B E;  1LF8 A;  3QB2 A;  3Q5M A;  3O4Z A;  2AXZ A;  5G05 J;  3LCA A;  4DI3 A;  5ENO D;  2JLB A;  4CGV A;  3TL5 A;  5LCW J;  1NI1 A;  4NQ0 A;  1MYO A;  1DVP A;  3JUE A;  2XS1 A;  4OVU A;  3VLD A;  1N9A A;  5CED B;  3FWV A;  4GB9 A;  4PH4 B;  4JW1 A;  3MX3 A;  4UI9 C;  2A5E A;  2BKK B;  3MEK A;  5CCM A;  2OEV A;  2R02 A;  2R17 C;  4LEU A;  1H0A A;  4HNA D;  4BT8 A;  4XI9 A;  2CHZ A;  3ULE G;  5T4Y A;  1U3C A;  3RO2 A;  3CVV A;  5E76 A;  4BER A;  1H6P A;  3O48 A;  4GZ6 A;  3EIJ A;  4GTS A;  3D9J A;  4B8C B;  3EJN A;  1UW4 B;  5ENQ D;  5EIB E;  5KJM A;  3DPD A;  4AY6 A;  5KJK A;  2IFU A;  1AWC B;  4LSZ E;  4KBQ A;  4AV7 A;  3TWQ A;  5FT9 A;  4ABN A;  2XHE A;  2CHX A;  4UI9 K;  4CCA A;  1S64 A;  3PS6 A;  5DBK A;  4U0S A;  2I2O A;  2VGX B;  5KBA A;  4TXP A;  5D0Q D;  5JJ6 A;  4BET A;  4I6G A;  3LPZ A;  3Q75 A;  4QQI A;  3CIA A;  2WMN A;  1NL4 A;  4PDX A;  5CMY A;  4F1P A;  2KM4 A;  1E90 A;  1HE8 A;  1WAO 1;  3C3O A;  4TUU A;  2ETB A;  3JYS A;  4I9E A;  5HS0 A;  2YIN A;  5BW8 C;  3EU5 A;  2EIM E;  3EHM A;  2H6I A;  3VLF A;  4J0U A;  1A17 A;  2XRY A;  4GA1 A;  3JUI A;  5ENP D;  2MOW A;  4DPR A;  3I5P A;  1BI8 B;  2H6F A;  3Q49 B;  1X5B A;  5JHB A;  3FU3 A;  3U64 A;  3SNX A;  2GRR B;  2KCV A;  3R9A B;  1YMP A;  2UY1 B;  5EID A;  3BG1 B;  3FP3 A;  3NOC D;  4AEZ C;  2IOS A;  3ONL A;  3RO3 A;  3JQ0 A;  4WND A;  2I1J A;  4I43 A;  3FHE A;  1ELK A;  2F37 A;  2Y3A A;  4BFR A;  3FTV A;  2PQN A;  2JAB A;  4JHR A;  3RJV A;  3CK8 A;  3LY7 A;  1TR4 A;  4E85 A;  2WXJ A;  2VGX A;  3BQO A;  4KZC A;  3PZ2 A;  4LCT A;  4UQZ A;  2XGO A;  3DRA A;  5AQ7 A;  5G55 A;  3CQC B;  3G2W A;  4XKB A;  4AXH A;  3J5Q B;  3APC A;  3AU5 A;  5DIZ A;  1TYQ G;  2OVB A;  3CVY A;  3LY9 A;  4UQX A;  5FIN A;  2AWI A;  3ML8 A;  1FVH A;  2Y69 E;  3FU5 A;  3PE4 A;  3ZRH A;  1WM5 A;  1SZA A;  4G11 A;  1XGW A;  4O1O A;  1HZ4 A;  1E8Y A;  3HG0 D;  2HE0 A;  2CG2 A;  3R7R A;  4I2W A;  1OY3 D;  4UI9 J;  1N95 A;  3V2O A;  4FUL A;  5T8I A;  4I17 A;  2XPY A;  5BUZ A;  4GPK A;  4U95 D;  2VSX E;  1D8E A;  3KS2 A;  4NIK A;  4TRQ A;  2ZU6 B;  4KXK B;  2AXV A;  4JC8 A;  4ANX A;  5LP0 A;  4G26 A;  1DNP A;  4GCO A;  3OXG A;  1H2U A;  3FTU A;  4TUM A;  5BXO A;  3FUD A;  3UQ3 A;  3FUJ A;  4ATG A;  3HYM B;  4Z68 A;  4BTB A;  3FU6 A;  4FU3 A;  3MJW A;  2OCC E;  3UM2 A;  3SZ7 A;  3FEY A;  3QDN A;  3V31 A;  1JCR A;  3B7S A;  3E37 A;  4J8D A;  1NFI E;  3NF1 A;  2EIK E;  3Q7F A;  3IBE A;  3PUK A;  2ZGG A;  4ILH B;  1YCS B;  5AQB A;  4O60 A;  4OVV A;  1INZ A;  4OAV B;  5D2M C;  2GRM A;  4HFG A;  3RSE G;  3NAW A;  1L5J A;  5BXU A;  1KT0 A;  3FY4 A;  4GZ5 A;  3CGH A;  3Q78 A;  2VQ2 A;  4LUN U;  3GYZ A;  4U96 D;  3ASN E;  3BU8 A;  2VGY A;  4WNE A;  4FHK A;  4HOT A;  3P2B A;  2J09 A;  2GRP B;  3L6A A;  3RKV A;  3AS8 A;  3DBS A;  5AAO A;  1TJF A;  3PH0 C;  4CRW A;  1HO8 A;  4MKT A;  5KJL A;  2EIJ E;  5CMW A;  2VSN A;  2J4D A;  3TWU A;  3TWT A;  3FUN A;  4G1T A;  2KAT A;  2I1K A;  3C98 A;  1DCQ A;  3ESK A;  4DUI A;  2J08 A;  1HX8 A;  2VYI A;  5HKP A;  3D9O A;  2OEW A;  5G2N A;  1HG2 A;  1V54 E;  2LSV A;  4YDW A;  1QZ2 A;  3B7U X;  1UJJ A;  5ARF A;  3ML9 A;  4HOU A;  1PC2 A;  2DVW A;  2LAI A;  2QYU A;  4L1B A;  4A55 A;  4UWK A;  2L6B A;  4H7Y A;  4PS3 A;  4KMO A;  2IU1 A;  1DC2 A;  5BT1 A;  3LXU X;  4FJZ A;  4BES A;  3D9M A;  2A5U A;  4X8Q A;  5J08 A;  2CG3 A;  2OOE A;  3HVE A;  4RG9 A;  3HXF A;  3NZU A;  3P1U A;  2JEK A;  2LNI A;  3AJI A;  1MHQ A;  1GW6 A;  5LOZ A;  4FHJ A;  4WUY A;  3MCX A;  3QKY A;  1HXI A;  4C0E A;  4U8V D;  3S7F A;  3LYA A;  2X3M A;  4I9C A;  2IQC A;  2HM8 A;  1H19 A;  4GML A;  3ZFW A;  2KZT B;  2WXQ A;  3SFY A;  2OND A;  3PRZ A;  4K03 A;  1HG5 A;  2GW1 A;  3Q9U C;  1JCQ A;  3ONK A;  4HOR A;  1K1B A;  3FFL A;  3CLJ A;  4P29 A;  3ABL E;  3D9P A;  4F1S A;  3APD A;  3PNT B;  2EIL E;  3SD5 A;  4GTR A;  1N52 A;  3UM3 A;  3HRA A;  1WDY A;  4DX2 A;  3RRN B;  2LO6 A;  3ASO E;  4NAC A;  3ZU7 B;  1H2T C;  3UMV A;  3ZIM A;  4MRU A;  5G04 J;  3W9F A;  5ENS D;  3KSQ A;  2H6H A;  3SY2 A;  1S70 B;  3HXE A;  5FZQ A;  3DWL G;  3TWW A;  4OAU C;  4HVB A;  2EIN E;  3T8K A;  2CFZ A;  4C9B B;  1FCH A;  3L17 A;  4JA7 A;  4TXR A;  3TWR A;  3TXM A;  3ZHE B;  5BV0 A;  3QJZ A;  2GGF A;  1U3D A;  3QNK A;  3ASD A;  4HBD A;  3QWP A;  4HOS A;  2R59 A;  3AAA C;  2X38 A;  4HRL A;  3ASH A;  3Q79 A;  3VTX A;  2WXI A;  4JEH A;  4MBG A;  4EEC A;  2VTB A;  1N0R A;  4PUC A;  1H2V C;  3UIO C;  1HH8 A;  1TN8 A;  3ABM E;  2WM9 A;  4CYM D;  3FH7 A;  4H7X A;  4B0Z A;  4WNF A;  1Z6T A;  4L9P A;  3E34 A;  4L2L A;  1OWN A;  5ANL A;  3UT8 A;  1YYH A;  3ZYK A;  3NB2 A;  3U4T A;  1JWF A;  2V5Q C;  3FUL A;  3ZEF A;  1IKN D;  2FUL A;  1LTX A;  4CEM A;  2QFC A;  4JB8 P;  2J49 A;  4JEU A;  3EIQ C;  2GRO B;  3CK9 A;  2YQ8 A;  2ETC A;  1SZ9 A;  2I9C A;  1UOH A;  1W3B A;  4GYY A;  5ITZ F;  2RFA A;  1MJ0 A;  2FBN A;  3IXE A;  1OUV A;  1UN9 A;  1QBQ A;  4HOQ A;  1MX6 A;  3EU9 A;  3E32 A;  4B8A A;  5KWD A;  4A63 B;  1KZP A;  2FO1 E;  3ZHE A;  2RFM A;  2PZI A;  4ANV A;  4G2V A;  3DSV A;  2IEJ A;  3FUE A;  4DX7 D;  3VLE A;  1OCO E;  4RVB A;  3DXM G;  2XGM A;  2CHW A;  4FAD A;  3HIZ A;  4FJY A;  3T8M A;  2WXL A;  3S7B A;  3MV2 B;  2DWZ A;  2X6I A;  3PE3 A;  3KD7 A;  2MRI A;  5D66 A;  2J4B A;  2FEZ A;  3G2U A;  4N3A A;  3FUK A;  2WXM A;  4B89 A;  4CDR A;  4W9R A;  3RAU A;  2R03 A;  2F8X K;  3SHF A;  4HB5 A;  2YHC A;  4EPZ A;  4URK A;  4ACL A;  3L54 A;  5CRV A; 
#chains in the Genus database with same CATH homology
 4GTP A;  4GTR A;  3DPY A;  3EUV A;  1LTX A;  3KSL A;  1O1R A;  1N4R A;  2R2L A;  1KZO A;  1MZC A;  4EHM A;  1TNZ A;  1N4P A;  1DCE A;  2ZIS A;  1LD8 A;  1S64 A;  1S63 A;  1FT2 A;  3PZ2 A;  1TNU A;  1JCR A;  3PZ1 A;  3E37 A;  1QBQ A;  3Q75 A;  3KSQ A;  2H6H A;  1LD7 A;  3E30 A;  1TNO A;  3DRA A;  1X81 A;  3Q7F A;  3HXE A;  3E32 A;  1N4Q A;  1NL4 A;  3DSU A;  4GTV A;  1NI1 A;  2ZIR A;  3E33 A;  3DST A;  1KZP A;  1FPP A;  1N9A A;  4GTT A;  2BED A;  1D8D A;  3DSV A;  3HXF A;  2IEJ A;  3EU5 A;  3PZ4 A;  1N94 A;  2H6I A;  3PZ3 A;  3HXC A;  4GTQ A;  4YDO A;  1TNB A;  1O1T A;  2H6G A;  1TNY A;  3Q79 A;  1FT1 A;  3Q78 A;  3DSS A;  4MBG A;  3Q73 A;  4GTO A;  1SA4 A;  1O5M A;  2F0Y A;  2H6F A;  4LNB A;  3HXD A;  1TN8 A;  1TN6 A;  1JCS A;  1O1S A;  4GTM A;  3SFX A;  1N95 A;  3SFY A;  4LNG A;  1SA5 A;  3HXB A;  4YDE A;  1N4S A;  1TN7 A;  3DSW A;  3Q7A A;  4L9P A;  3DSX A;  3E34 A;  1JCQ A;  1D8E A;  3C72 A;  4GTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...