2F0YA

Crystal structure of human protein farnesyltransferase complexed with farnesyl diphosphate and hydantoin derivative
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
314
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title hydantoin derivatives as Non-pepridic inhibitors of Ras Farnesyl transferase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 118
structure length 314
sequence length 314
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2f0yA00
2BEDA 4GTPA 1JCSA 1LD7A 3PZ4A 3SFYA 4YDOA 1S64A 2H6IA 3DSSA 1O1TA 3E32A 3DPYA 3Q79A 1N4QA 4EHMA 1FPPA 1LTXA 3HXDA 3Q78A 1O1SA 1NL4A 2F0YA 1JCQA 3SFXA 3Q7FA 2H6HA 4MBGA 1KZOA 1TNOA 4GTRA 1D8DA 1NI1A 3Q73A 3E33A 1O1RA 3PZ1A 3E37A 3DSXA 1KZPA 1N94A 3EU5A 3DRAA 1TN8A 3Q7AA 1JCRA 1N4RA 4L9PA 1TNUA 3PZ3A 1O5MA 1SA5A 1QBQA 1N4PA 4LNBA 1TNBA 1FT1A 1N9AA 3HXFA 1DCEA 1X81A 2ZISA 3HXBA 3HXCA 3HXEA 2H6FA 2ZIRA 4YDEA 3EUVA 3C72A 2IEJA 3DSVA 4GTQA 1TN7A 3KSLA 4GTMA 4LNGA 1N95A 3E30A 1D8EA 1LD8A 1TNZA 1TN6A 2R2LA 2H6GA 4GTOA 4GTSA 4GTVA 3KSQA 1SA4A 4GTTA 3DSUA 1FT2A 3DSTA 1N4SA 3DSWA 3E34A 1S63A 3Q75A 3PZ2A 1MZCA 1TNYA
chains in the Genus database with same CATH superfamily
3APDA 5B1AE 3TXMA 3AG4E 4DX5D 5KJKA 3CVUA 2GRPB 1SW6A 2H6IA 1Z6TA 4HOUA 1JWGA 2KCKA 3CVVA 5KJMA 2IO2C 2AXUA 2OCCE 3Q9UC 1UOHA 1N4QA 4GMRA 4LNUD 3SZ7A 3T5XA 1HFAA 1TJCA 5CMWA 3AG2E 4XIFA 3HVEB 1KZOA 3FTXA 3IBEA 4BX8A 1NI1A 4BETA 4CGWA 3FULA 3LPZA 2XCCA 1OWNA 1N4RA 3PE3A 2L6BA 3PZ3A 4I6EA 1EPUA 4EZLA 2BKGA 4HFGA 3L13A 4TXQA 2WQ7A 3CHRA 4U8YD 2KM4A 3TWVA 4GMLA 4HI8A 2ZU6B 2AWIA 3FFLA 5AJDA 3Q47B 4FLHA 5BNWA 2XQ0A 4XKCA 4XX5A 4AVXA 5G05C 2KBXA 4QQIA 4ANVA 5HQ8A 3APFA 4GZ3A 3KD7A 5D2MC 5ENSD 3LJ3A 3CHOA 4F7AA 3U3WA 4CCAA 1HO8A 3C3OA 3FTWA 1BPOA 1MZCA 5AQ9A 5D0OD 4EZKA 2ETBA 4AJWA 1IHGA 3Q15A 3D9JA 4DI4A 4FA6A 4H7XA 2DYRE 2ETAA 2EILE 2ZXWE 3FP3A 3N71A 4RSYA 3JQ0A 2YQ8A 3UT4A 3ISMC 4B89A 4J8SA 3SFXA 3Q7FA 3MA5A 3FUKA 3DSXA 2WXGA 1JCRA 2EQXA 2M63A 1N0RA 1OT8A 1UN9A 3G2TA 1N4PA 1JUQA 3FTSA 3SGHA 4GYOA 3FTZA 3SF4A 5EDSA 5G2NA 2MYOA 3SQVA 5KBAA 2VSXE 3MV3B 2WXIA 1IQRA 5KWDA 1E8XA 5D0QD 3CK8A 3C5RA 2I2OA 3DEPA 1OWOA 2A4ZA 4EPZA 3F6QA 4N3CA 5KJNA 3L82A 2QZAA 3D9IA 5JMND 4URKA 1LD8A 3ULYA 1PC2A 4NIKA 3RU0A 3DSTA 1TR4A 3EHMA 4GZDA 1DCQA 1KPSB 4ATZD 3FH5A 3ZHEB 1QNFA 3SFYA 2UY1A 1S64A 3IKOB 2PM6A 1K1BA 4ME2A 3Q4AB 2ZGGA 1S70B 4A3VA 2X6JA 4GMJA 4LG6A 2V5FA 1UJJA 4R7LA 2GRNB 1D8DA 3NB2A 2Y1LE 3U64A 3G2WA 3L08A 2XHEA 3FU3A 3EU5A 4WWPA 2C2LA 5ENQD 3QC1A 3OXFA 4ILIA 2WXQA 2J9QA 4JW1A 3JUIA 2EINE 4QFVA 1U2VG 3D9KA 2ONDA 4GYWA 4I43A 1FT1A 3ENEA 3HXFA 4IULA 5HI7A 4BESA 2XEVA 2X6IA 1IQUA 1AP7A 5BW8C 3TAXA 1H2TC 5BXUA 3TWXA 4CDMA 4MS6A 2RG8A 2R05A 1WM5A 4UWGA 5FIOA 3I4GA 3ML8A 3CLJA 3UI2A 4Q96A 3FWVA 3EDTB 3DSUA 5AARA 2J4BA 4GU5A 1N4SA 3E34A 3B7UX 1L5JA 3QOUA 1LD7A 4G2VA 2DZOA 3S7DA 4TXRA 2AVPA 2KZTA 4A55A 3D9NA 2P9IG 2LXMA 3ASFA 2WB2A 2WXJA 1IHBA 4K5AB 1Y8MA 4DX7D 2WXFA 2NYJA 3ZW3A 4WNFA 1MX4A 2CHWA 1HXIA 4IYPA 4XZ4A 3UT7A 3ZEFA 5D66A 5EILA 4F53A 1SZAA 4TRQA 2GGFA 1ELKA 4N5CA 2L0IA 1KT0A 3G2VA 5FINA 4UI9K 4I1AA 2JEKA 3FUDA 3SY2A 3ZXPA 4F1SA 1KZPA 1OWLA 3ESLA 4B93B 3QDNA 5CRVA 4ACLA 2V0PA 2VTBB 1U3DA 3HDXA 3RRUA 3UINC 5HS0A 3CHPA 2I6HA 4I1OB 2AJAA 1YCSB 1FVFA 5LOZA 2RFAA 3ABKE 1MQSA 1IXVA 1XGWA 4GYYA 4AM9A 4ABNA 3JXJA 2XEHA 3L54A 2UY1B 4KT6B 2OVBA 3URZA 2NC9A 5KCMA 4O1OA 4PH4B 4CDRA 4UQXA 4XE0A 1PY1A 1INZA 3RAUA 3L9TA 3L17A 3UMVA 3DSWA 4FC8A 1OCRE 3W9GA 3CHQA 4GPMA 3NQPA 2A5EA 1K8KG 3P2BA 3LY9A 3OXLA 3MKQA 3U9WA 1QZ2A 2HE0A 2XENA 3RO3A 3BQOA 1NL4A 4N3AA 3ESKA 4J8YA 4MBGA 3D9LA 3CKBA 4FULA 3BG1B 2P9NG 1JPLA 4N5QA 1N94A 4FJYA 3DRAA 1HX8A 3EHRA 2IFUA 2CG3A 3D9MA 4WNGA 2CG2A 2WMOA 4KYOB 4G26A 3ONLA 4GAAA 1N9AA 4F6RD 5CRUA 4L2LA 5BPPA 5EN5D 2PL2A 5HKPA 2H6FA 3U66A 1GW6A 3FH8A 4A3TA 2YHEA 2DBAA 3SO8A 5JJ6A 2IEJA 2PM7A 3ASNE 4WNDA 1H19A 1HG2A 1TEZA 2B6CA 4L23A 2L0TB 1SZ9A 3CK9A 3LDZA 2XZTG 2KC7A 4TUUA 2RD0A 3PZ2A 3MZLB 1TNYA 3MJWA 1E90A 1HZ4A 3RRNB 3UM0A 1PAQA 2OOEA 2PQNA 5CBNA 4N2SA 4FJZA 4NRHB 3PDNA 3HHMA 4HOSA 3CVWA 3KEAA 4JZYA 4APFA 2F0YA 5FQ8A 2ZGDA 1W3BA 2A5UA 2FO7A 3G2UA 2KATA 3QNKA 3R7QA 4EBAG 4TUMA 4GZ5A 1BI8B 3FU5A 1ELWA 3QAQA 3NOGD 2XGSA 3CQCB 2VSNA 5ENNA 5AQBA 4DX1A 5T3RA 2WXPA 5FZQA 2IO3C 4HS2A 1G3NB 4A63B 3ZYKA 5AIJA 3ZYMA 2ZISA 3SBTB 3AG1E 5FQ7A 4EZJA 3V79K 4PS7A 2AW6A 5B3SE 4JL0A 3ZIMA 1KLXA 3SHFA 2PZIA 2VJ8A 5FT9A 3WXXA 4K5BA 3EIQC 3HIZA 3LCAA 4LNGA 1HG5A 2EIJE 4Z68A 3MKQB 1WAO1 1OCCE 3MCXA 2XPYA 4YDYA 1RW2A 3CVXA 1UJKA 4I6GA 1HU3A 1E8WA 3PNTB 4HBDA 4CRWA 2BEDA 3DEOA 4AOFA 2KCLA 3VLDA 4JHKA 2IONA 4X8QA 4DK5A 2IJGX 3E32A 3LS8A 5G04J 1Z5SC 1JWFA 3CKCA 3FU0A 2GW1A 4K0RA 2E2EA 2XRYA 3NAWA 4G24A 5DIZA 2DYSE 2Y69E 3HXDA 2QC9A 5CEDB 5AYWD 4J8EA 1DNPA 4JPSA 4B0ZA 3EHQA 3HYMB 2P58C 1OXJA 3FU6A 5H7PA 2LUHA 1NP7A 3PUJA 1HE8A 2WXMA 2F8XK 2BTDA 4LUNU 3V2OA 5KNGA 4I17A 3CVNA 4CEMA 1N54A 4L9PA 3SNXA 3IEGA 4HXIA 2VSOE 2EIME 5FZRA 3ABLE 4AEZC 4I1MA 3W9FA 4P29A 3RJVA 5T4YA 3EU9A 3T9KA 3DXKG 1X5BA 4U63A 2XPZA 3HXCA 1YYHA 3FUIA 3TWTA 2PNNA 3S7BA 4CT4A 3LKUA 3JUEA 2V4LA 2VGXB 3LVRE 3NZSA 2WXLA 4U8VD 3UTMA 4JVSA 4AXHA 4YVQC 4HB5A 3TXNA 4UWLA 3DWLG 1D8EA 3ZKJA 1MX2A 3S7FA 5JJTA 1MYOA 1SA4A 4KZCA 3IV0A 1N0QA 1BI7B 2Y0BG 3FUHA 4EQFA 3CEQA 3AJIA 3D9OA 1HS6A 3AU5A 3GZ2A 2DIWA 2KCVA 1H6PA 2GROB 3DSSA 4GZCA 3GZSA 1WG0A 5CERB 2KXPC 3OTNA 3FUFA 4LERA 1H6KA 2E0IA 2WQ6A 1XNFA 1JCQA 2I1JA 4LSZE 2RFMA 2J09A 5FJYA 3FEXA 4WAFA 3MV2B 3V30A 4DJAA 2R02A 4O6FA 3Q7AA 4LCTA 5CBOA 5JHBA 1EYHA 4WWOA 5KNHD 4E6HA 4U8HA 3VLEA 4J6IA 4B94A 1H0AA 2HYZA 2ZIRA 2CFZA 2XS8A 3BEEA 4F1PA 4DLQA 1NZNA 4GA0A 4YNDA 3V31A 4JHRA 3PE4A 4M3OA 4O1PA 1OCZE 1SQMA 4WNEA 4L7TA 3UUXA 4GA1A 1BLXB 2OVFA 2ILRA 5ARGA 3CVQA 4CZ2D 3Q79A 3TWSA 4EHMA 5G55A 1FPPA 4BFRA 3ZNGA 3ZU7B 4F3VA 2X6KA 4ANXA 2V8SE 4B8AA 2LXLA 2P2CP 4G23A 4U07A 1YA0A 3D3MA 2Q7FA 3IXEA 4G1TA 4AP2A 4CYMD 4UI9J 3Q73A 2UWJG 5LCWC 1IKND 2F37A 5ENPD 5EYLA 4Q94A 3T8KA 4KVMA 4BSZB 2DVWA 2IQCA 1TN8A 5BXOA 3R9MA 1TNUA 2OV8A 4BY6A 3CHMA 4DX6D 2P9UG 3R9AB 5IY5E 1H2UA 4J8FA 3QWVA 3MEKA 2IU1A 4AV7A 3AU4A 3BUAA 4NQ0A 5LX8A 3PREA 4DLOA 4DI3A 4TV3A 3DSVA 2PQRA 3I3NA 2X6FA 5AENA 3FHEA 5EYPF 2LSVA 1V55E 3D9PA 2P9LG 1N95A 1FVHA 3E30A 2WM9A 4OYSA 3LJNA 1A5EA 1LF8A 3PS6A 4RVBA 4U04A 3TL5A 4GTTA 4HNAD 3HG0D 5ENTD 3O4ZA 4CT0A 3L6AA 2WXHA 1QQEA 2CHXA 4GTPA 4C0MA 4YDOA 4TXPA 1VDYA 2LNIA 3J5QB 2R59A 3IHVA 4Q69A 3TWWA 2IOSA 2WPVA 4XEIG 4U0UA 4GPKA 3PRZA 2V5QC 4ZHBA 1E96B 4C0EA 2DWZA 2J08A 3L16A 3RO2A 1OWMA 3U4TA 4JEHA 4J7WA 2DCPA 3ULEG 3QKYA 1K3ZD 3C3QA 3EHNA 1KT1A 5EIBE 4LNBA 2R5SA 4I6JA 3V2XA 3RKVA 3FTUA 5BUZA 2C0MA 3I5PA 5BV1A 5ANRA 4JXTA 1EF1C 1TJFA 4HRMB 4I2WA 3HXEA 3FTYA 2XGOA 3J5PA 3VTXA 3C72A 3PEUB 3MGBA 4JC8A 2OEVA 4GTQA 1NA0A 3Q5MA 1E8ZA 3NBNB 2LO6A 3QJZA 3KSQA 2MRIA 3FTVA 3Q75A 4HRLA 3CVYA 1H2VC 3CSFA 3VLFA 2AXVA 3QWPA 2IF4A 3KS2A 3PUKA 1MHQA 2KZTB 3KEZA 3ZYQA 3L22A 5HRYA 4W9RA 5JJ7A 2QFCA 4AIFA 5CECB 1Z3XA 3QK0A 2X3MA 1ZU2A 2FEZA 3SBSA 5AQ7A 5C1DA 1MX6A 4BWRA 4RG9A 3RIBA 5DBKA 3CIAA 4C48B 2FBNA 4ILHB 2Y4TA 4HVBA 3ZPJA 3DBSA 1OY3D 2QY7A 3ASHA 3GW4A 4BX9A 1SA5A 1QBQA 3HRAA 2LAIA 4K5CA 4E85A 2XS1A 1K1AA 1ZBPA 4G8LA 3B7TA 2AXZA 1DCEA 4RLYA 4JEUA 3TJPA 3ABME 2GRMA 2WXOA 2R03A 2BF0X 4APOA 4DPRA 3FUJA 2GRLA 1HH8A 4KXKB 3QWWA 2H6GA 4U0ZA 4LRZA 2HO1A 4WWNA 2HR2A 4BERA 4KZ0A 1EDUA 2QYUA 4FP7A 3OXGA 1D9SA 3ZHEA 3CK7A 3I4RB 4DRXE 1RZ4A 3FY4A 5EX3A 4GB9A 4HOTA 2B0OE 4GCOA 3ASOE 3PH0C 4KVOA 3Q78A 1O1SA 3ASGA 4L2YA 4G11A 2Y3AA 4I2ZA 3R7RA 3MYVA 3P1UA 3O48A 4C9BB 1TNOA 4XKBA 1NA3A 4UQZA 4KMOA 4EBAA 5G04C 2P9SG 1E8YA 2X6HA 2FO1E 2CHZA 4GA2A 4JA9A 3JCKC 3DXMG 2VQ2A 2J8SD 4RQIA 5G05J 5J08A 3JYSA 2LAHA 3UM3A 4XI9A 5CCLA 1OCOE 4OAUC 1E7UA 3PEVB 3HXBA 1V54E 3T8MA 4MLPA 2QYJA 2R17C 3LY8A 3JQ1A 5EIDA 5FQ6A 3UM1A 4IN3B 1QYMA 2WXNA 2F8YA 3S7JA 4WUYA 1U3CA 3B95A 3B7RL 4GTVA 4OVUA 4HRNA 5ENRD 4U96D 1FT2A 4OVVA 3ML9A 1S63A 1IYGA 3ZRHA 1JCSA 4PDXA 3KAEA 3K9IA 3MKRA 4UUCA 4JB8P 4HOQA 4I9EA 3E4BA 2YHCA 1MJ0A 4PS8A 4N3BA 5B1BE 3CGHA 2VSYA 3PZDA 1LTXA 1P5QA 4NURA 5FTPA 2V4HC 3AAAC 3NZUA 4O60A 3LYAA 3LY7A 3SFZA 2I9CA 2WXKA 3PZ1A 4JHJA 3TGOA 4UWKA 5JHAA 3FUMA 2JLBA 4U0SA 1OUVA 3ASDA 4FHJA 4V3IA 2VTBA 3UQ3A 4U7EB 2MHKA 1UG3A 3ZXSA 3CSTA 4HLLA 2MOWA 5LP0A 3DPDA 3LVQE 3S2AA 4NACA 4FU3A 3B7SA 5A23A 3ULQA 5AQAA 1A17A 2XEEA 3EUVA 3FUEA 1N11A 4AY6A 4N2QA 1NFIE 2X38A 3FUNA 3NOCD 5EX0A 2ETCA 1TNZA 1TN6A 3FH7A 3T5VA 3GZ1A 2IOLA 3AS4A 4FADA 3Q9NC 1ZB1A 1O1TA 3UM2A 4EECA 2EIKE 5ITZF 2J49A 3NF1A 3LXUX 2RKKA 4HLEA 3UT8A 5C2YA 4HORA 5CCMA 3AS5A 3PNLB 3RRMB 2VYIA 4IRUA 5E75A 4Y6WA 4Y6CA 4GTRA 4FLBA 4BEPA 2NXPA 3E33A 3TG5A 1BD8A 3CQGB 3E37A 2WXRA 5AJLA 2XCBA 4ILGA 2JABA 1O5MA 2WVIA 4HI9A 2XZDG 5T8IA 4UI9C 4UQYA 1WY6A 3CV0A 1BU9A 1YMPA 3IHYA 2Y4UA 3UXGA 5CEAA 4BT9A 5ANLA 1DC2A 1WDYA 1Y6IA 5A6CA 4UWHA 2P9KG 5M72A 3SI5A 4GTOA 5LCWJ 3OAWA 3B13A 4RG6A 5AAOA 3UX4A 4JD2G 3BU8A 3UIPC 4YVOA 4BT8A 1UN8A 2GRQB 3PZ4A 2L6JA 4KBQA 4DX2A 5FQ4A 4U95D 4A1SA 3UKUG 1Z3YA 3FDHA 3DPYA 4XI0A 3ZVVA 4MKTA 3TWQA 5FZSA 5KJLA 5J90A 3ZN3A 2XGMA 1AWCB 1DVPA 2H6HA 4L1BA 4D10C 4J8DA 3FEYA 3CHSA 5A7DB 1O1RA 2VGEA 4N39A 3UIOC 4PS3A 5CHEE 1B89A 3ZGQA 5AN8A 4UWFA 5E76A 4JA7A 3AS8A 1SVXA 4G8KA 5BT1A 4M7CA 3TWUA 3CR3A 3APCA 5BV0A 2WQHA 4LEUA 3HVEA 4BTBA 4AY5A 3LEWA 3RK6A 1X81A 3Q49B 4B8CB 3C98A 3UKRG 3EJNA 1FCHA 3X2QE 3QARA 3PVLA 3KSLA 4ACKA 3AG3E 2R2LA 4ZFHA 1H6OA 3ONKA 4DUIA 3ZFWA 3GYZA 2J07A 2I1KA 2GRRB 4A1GA 3CVLA 4ANWA 2YINA 1UW4B 1Q2ZA 3G2SA 5LFAA 4GCNA 1TYQG 2YNQA 3VTYA 4BTAA 3TWRA 4PUCA 5JA4D 1E7VA 5ARFA 2LSUA 3UPVA 4BSXA 2DZNA 4H7YA 2OEWA 2XPIA 5CMYA 2J4DA 3D9HA 2P9PG 3B7BA 3SD5A 3QB2A 2WMNA 4ANUA 5FWQA 1OWPA 2C0LA 5ENOD 4G25A 2BUGA 1HF8A 3MX3A 3EIJA 4CDNA 5EKQD 4OAVB 3RSEG 1S0PA 4J0UA 2XRZA 4HQDA 2NSZA 4CGVA 1TNBA 2CFUA 4I9CA 3BG0B 2VGYA 4ATGA 3WG7E 4K03A 3ZUVB 2L9BA 2FI7A 3CVPA 4YDEA 4GZ6A 2VGXA 2FF4A 3ZYLA 1TN7A 4GTMA 2FULA 2IY0C 4FHKA 4MRUA 3C3RA 2HM8A 4GTSA 4YDWA 1N52A 2BKKB 3JXIA 3TG4A 1ELRA
chains in the Genus database with same CATH topology
2BEDA 4GTPA 1JCSA 1LD7A 3PZ4A 3SFYA 4YDOA 1S64A 2H6IA 3DSSA 1O1TA 3E32A 3DPYA 3Q79A 1N4QA 4EHMA 1FPPA 1LTXA 3HXDA 3Q78A 1O1SA 1NL4A 2F0YA 1JCQA 3SFXA 3Q7FA 2H6HA 4MBGA 1KZOA 1TNOA 4GTRA 1D8DA 1NI1A 3Q73A 3E33A 1O1RA 3PZ1A 3E37A 3DSXA 1KZPA 1N94A 3EU5A 3DRAA 1TN8A 3Q7AA 1JCRA 1N4RA 4L9PA 1TNUA 3PZ3A 1O5MA 1SA5A 1QBQA 1N4PA 4LNBA 1TNBA 1FT1A 1N9AA 3HXFA 1DCEA 1X81A 2ZISA 3HXBA 3HXCA 3HXEA 2H6FA 2ZIRA 4YDEA 3EUVA 3C72A 2IEJA 3DSVA 4GTQA 1TN7A 3KSLA 4GTMA 4LNGA 1N95A 3E30A 1D8EA 1LD8A 1TNZA 1TN6A 2R2LA 2H6GA 4GTOA 4GTSA 4GTVA 3KSQA 1SA4A 4GTTA 3DSUA 1FT2A 3DSTA 1N4SA 3DSWA 3E34A 1S63A 3Q75A 3PZ2A 1MZCA 1TNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BED A;  4GTP A;  1JCS A;  1LD7 A;  3PZ4 A;  3SFY A;  4YDO A;  1S64 A;  2H6I A;  3DSS A;  1O1T A;  3E32 A;  3DPY A;  3Q79 A;  1N4Q A;  4EHM A;  1FPP A;  1LTX A;  3HXD A;  3Q78 A;  1O1S A;  1NL4 A;  2F0Y A;  1JCQ A;  3SFX A;  3Q7F A;  2H6H A;  4MBG A;  1KZO A;  1TNO A;  4GTR A;  1D8D A;  1NI1 A;  3Q73 A;  3E33 A;  1O1R A;  3PZ1 A;  3E37 A;  3DSX A;  1KZP A;  1N94 A;  3EU5 A;  3DRA A;  1TN8 A;  3Q7A A;  1JCR A;  1N4R A;  4L9P A;  1TNU A;  3PZ3 A;  1O5M A;  1SA5 A;  1QBQ A;  1N4P A;  4LNB A;  1TNB A;  1FT1 A;  1N9A A;  3HXF A;  1DCE A;  1X81 A;  2ZIS A;  3HXB A;  3HXC A;  3HXE A;  2H6F A;  2ZIR A;  4YDE A;  3EUV A;  3C72 A;  2IEJ A;  3DSV A;  4GTQ A;  1TN7 A;  3KSL A;  4GTM A;  4LNG A;  1N95 A;  3E30 A;  1D8E A;  1LD8 A;  1TNZ A;  1TN6 A;  2R2L A;  2H6G A;  4GTO A;  4GTS A;  4GTV A;  3KSQ A;  1SA4 A;  4GTT A;  3DSU A;  1FT2 A;  3DST A;  1N4S A;  3DSW A;  3E34 A;  1S63 A;  3Q75 A;  3PZ2 A;  1MZC A;  1TNY A; 
#chains in the Genus database with same CATH topology
 3APD A;  5B1A E;  3TXM A;  3AG4 E;  4DX5 D;  5KJK A;  3CVU A;  2GRP B;  1SW6 A;  2H6I A;  1Z6T A;  4HOU A;  1JWG A;  2KCK A;  3CVV A;  5KJM A;  2IO2 C;  2AXU A;  2OCC E;  3Q9U C;  1UOH A;  1N4Q A;  4GMR A;  4LNU D;  3SZ7 A;  3T5X A;  1HFA A;  1TJC A;  5CMW A;  3AG2 E;  4XIF A;  3HVE B;  1KZO A;  3FTX A;  3IBE A;  4BX8 A;  1NI1 A;  4BET A;  4CGW A;  3FUL A;  3LPZ A;  2XCC A;  1OWN A;  1N4R A;  3PE3 A;  2L6B A;  3PZ3 A;  4I6E A;  1EPU A;  4EZL A;  2BKG A;  4HFG A;  3L13 A;  4TXQ A;  2WQ7 A;  3CHR A;  4U8Y D;  2KM4 A;  3TWV A;  4GML A;  4HI8 A;  2ZU6 B;  2AWI A;  3FFL A;  5AJD A;  3Q47 B;  4FLH A;  5BNW A;  2XQ0 A;  4XKC A;  4XX5 A;  4AVX A;  5G05 C;  2KBX A;  4QQI A;  4ANV A;  5HQ8 A;  3APF A;  4GZ3 A;  3KD7 A;  5D2M C;  5ENS D;  3LJ3 A;  3CHO A;  4F7A A;  3U3W A;  4CCA A;  1HO8 A;  3C3O A;  3FTW A;  1BPO A;  1MZC A;  5AQ9 A;  5D0O D;  4EZK A;  2ETB A;  4AJW A;  1IHG A;  3Q15 A;  3D9J A;  4DI4 A;  4FA6 A;  4H7X A;  2DYR E;  2ETA A;  2EIL E;  2ZXW E;  3FP3 A;  3N71 A;  4RSY A;  3JQ0 A;  2YQ8 A;  3UT4 A;  3ISM C;  4B89 A;  4J8S A;  3SFX A;  3Q7F A;  3MA5 A;  3FUK A;  3DSX A;  2WXG A;  1JCR A;  2EQX A;  2M63 A;  1N0R A;  1OT8 A;  1UN9 A;  3G2T A;  1N4P A;  1JUQ A;  3FTS A;  3SGH A;  4GYO A;  3FTZ A;  3SF4 A;  5EDS A;  5G2N A;  2MYO A;  3SQV A;  5KBA A;  2VSX E;  3MV3 B;  2WXI A;  1IQR A;  5KWD A;  1E8X A;  5D0Q D;  3CK8 A;  3C5R A;  2I2O A;  3DEP A;  1OWO A;  2A4Z A;  4EPZ A;  3F6Q A;  4N3C A;  5KJN A;  3L82 A;  2QZA A;  3D9I A;  5JMN D;  4URK A;  1LD8 A;  3ULY A;  1PC2 A;  4NIK A;  3RU0 A;  3DST A;  1TR4 A;  3EHM A;  4GZD A;  1DCQ A;  1KPS B;  4ATZ D;  3FH5 A;  3ZHE B;  1QNF A;  3SFY A;  2UY1 A;  1S64 A;  3IKO B;  2PM6 A;  1K1B A;  4ME2 A;  3Q4A B;  2ZGG A;  1S70 B;  4A3V A;  2X6J A;  4GMJ A;  4LG6 A;  2V5F A;  1UJJ A;  4R7L A;  2GRN B;  1D8D A;  3NB2 A;  2Y1L E;  3U64 A;  3G2W A;  3L08 A;  2XHE A;  3FU3 A;  3EU5 A;  4WWP A;  2C2L A;  5ENQ D;  3QC1 A;  3OXF A;  4ILI A;  2WXQ A;  2J9Q A;  4JW1 A;  3JUI A;  2EIN E;  4QFV A;  1U2V G;  3D9K A;  2OND A;  4GYW A;  4I43 A;  1FT1 A;  3ENE A;  3HXF A;  4IUL A;  5HI7 A;  4BES A;  2XEV A;  2X6I A;  1IQU A;  1AP7 A;  5BW8 C;  3TAX A;  1H2T C;  5BXU A;  3TWX A;  4CDM A;  4MS6 A;  2RG8 A;  2R05 A;  1WM5 A;  4UWG A;  5FIO A;  3I4G A;  3ML8 A;  3CLJ A;  3UI2 A;  4Q96 A;  3FWV A;  3EDT B;  3DSU A;  5AAR A;  2J4B A;  4GU5 A;  1N4S A;  3E34 A;  3B7U X;  1L5J A;  3QOU A;  1LD7 A;  4G2V A;  2DZO A;  3S7D A;  4TXR A;  2AVP A;  2KZT A;  4A55 A;  3D9N A;  2P9I G;  2LXM A;  3ASF A;  2WB2 A;  2WXJ A;  1IHB A;  4K5A B;  1Y8M A;  4DX7 D;  2WXF A;  2NYJ A;  3ZW3 A;  4WNF A;  1MX4 A;  2CHW A;  1HXI A;  4IYP A;  4XZ4 A;  3UT7 A;  3ZEF A;  5D66 A;  5EIL A;  4F53 A;  1SZA A;  4TRQ A;  2GGF A;  1ELK A;  4N5C A;  2L0I A;  1KT0 A;  3G2V A;  5FIN A;  4UI9 K;  4I1A A;  2JEK A;  3FUD A;  3SY2 A;  3ZXP A;  4F1S A;  1KZP A;  1OWL A;  3ESL A;  4B93 B;  3QDN A;  5CRV A;  4ACL A;  2V0P A;  2VTB B;  1U3D A;  3HDX A;  3RRU A;  3UIN C;  5HS0 A;  3CHP A;  2I6H A;  4I1O B;  2AJA A;  1YCS B;  1FVF A;  5LOZ A;  2RFA A;  3ABK E;  1MQS A;  1IXV A;  1XGW A;  4GYY A;  4AM9 A;  4ABN A;  3JXJ A;  2XEH A;  3L54 A;  2UY1 B;  4KT6 B;  2OVB A;  3URZ A;  2NC9 A;  5KCM A;  4O1O A;  4PH4 B;  4CDR A;  4UQX A;  4XE0 A;  1PY1 A;  1INZ A;  3RAU A;  3L9T A;  3L17 A;  3UMV A;  3DSW A;  4FC8 A;  1OCR E;  3W9G A;  3CHQ A;  4GPM A;  3NQP A;  2A5E A;  1K8K G;  3P2B A;  3LY9 A;  3OXL A;  3MKQ A;  3U9W A;  1QZ2 A;  2HE0 A;  2XEN A;  3RO3 A;  3BQO A;  1NL4 A;  4N3A A;  3ESK A;  4J8Y A;  4MBG A;  3D9L A;  3CKB A;  4FUL A;  3BG1 B;  2P9N G;  1JPL A;  4N5Q A;  1N94 A;  4FJY A;  3DRA A;  1HX8 A;  3EHR A;  2IFU A;  2CG3 A;  3D9M A;  4WNG A;  2CG2 A;  2WMO A;  4KYO B;  4G26 A;  3ONL A;  4GAA A;  1N9A A;  4F6R D;  5CRU A;  4L2L A;  5BPP A;  5EN5 D;  2PL2 A;  5HKP A;  2H6F A;  3U66 A;  1GW6 A;  3FH8 A;  4A3T A;  2YHE A;  2DBA A;  3SO8 A;  5JJ6 A;  2IEJ A;  2PM7 A;  3ASN E;  4WND A;  1H19 A;  1HG2 A;  1TEZ A;  2B6C A;  4L23 A;  2L0T B;  1SZ9 A;  3CK9 A;  3LDZ A;  2XZT G;  2KC7 A;  4TUU A;  2RD0 A;  3PZ2 A;  3MZL B;  1TNY A;  3MJW A;  1E90 A;  1HZ4 A;  3RRN B;  3UM0 A;  1PAQ A;  2OOE A;  2PQN A;  5CBN A;  4N2S A;  4FJZ A;  4NRH B;  3PDN A;  3HHM A;  4HOS A;  3CVW A;  3KEA A;  4JZY A;  4APF A;  2F0Y A;  5FQ8 A;  2ZGD A;  1W3B A;  2A5U A;  2FO7 A;  3G2U A;  2KAT A;  3QNK A;  3R7Q A;  4EBA G;  4TUM A;  4GZ5 A;  1BI8 B;  3FU5 A;  1ELW A;  3QAQ A;  3NOG D;  2XGS A;  3CQC B;  2VSN A;  5ENN A;  5AQB A;  4DX1 A;  5T3R A;  2WXP A;  5FZQ A;  2IO3 C;  4HS2 A;  1G3N B;  4A63 B;  3ZYK A;  5AIJ A;  3ZYM A;  2ZIS A;  3SBT B;  3AG1 E;  5FQ7 A;  4EZJ A;  3V79 K;  4PS7 A;  2AW6 A;  5B3S E;  4JL0 A;  3ZIM A;  1KLX A;  3SHF A;  2PZI A;  2VJ8 A;  5FT9 A;  3WXX A;  4K5B A;  3EIQ C;  3HIZ A;  3LCA A;  4LNG A;  1HG5 A;  2EIJ E;  4Z68 A;  3MKQ B;  1WAO 1;  1OCC E;  3MCX A;  2XPY A;  4YDY A;  1RW2 A;  3CVX A;  1UJK A;  4I6G A;  1HU3 A;  1E8W A;  3PNT B;  4HBD A;  4CRW A;  2BED A;  3DEO A;  4AOF A;  2KCL A;  3VLD A;  4JHK A;  2ION A;  4X8Q A;  4DK5 A;  2IJG X;  3E32 A;  3LS8 A;  5G04 J;  1Z5S C;  1JWF A;  3CKC A;  3FU0 A;  2GW1 A;  4K0R A;  2E2E A;  2XRY A;  3NAW A;  4G24 A;  5DIZ A;  2DYS E;  2Y69 E;  3HXD A;  2QC9 A;  5CED B;  5AYW D;  4J8E A;  1DNP A;  4JPS A;  4B0Z A;  3EHQ A;  3HYM B;  2P58 C;  1OXJ A;  3FU6 A;  5H7P A;  2LUH A;  1NP7 A;  3PUJ A;  1HE8 A;  2WXM A;  2F8X K;  2BTD A;  4LUN U;  3V2O A;  5KNG A;  4I17 A;  3CVN A;  4CEM A;  1N54 A;  4L9P A;  3SNX A;  3IEG A;  4HXI A;  2VSO E;  2EIM E;  5FZR A;  3ABL E;  4AEZ C;  4I1M A;  3W9F A;  4P29 A;  3RJV A;  5T4Y A;  3EU9 A;  3T9K A;  3DXK G;  1X5B A;  4U63 A;  2XPZ A;  3HXC A;  1YYH A;  3FUI A;  3TWT A;  2PNN A;  3S7B A;  4CT4 A;  3LKU A;  3JUE A;  2V4L A;  2VGX B;  3LVR E;  3NZS A;  2WXL A;  4U8V D;  3UTM A;  4JVS A;  4AXH A;  4YVQ C;  4HB5 A;  3TXN A;  4UWL A;  3DWL G;  1D8E A;  3ZKJ A;  1MX2 A;  3S7F A;  5JJT A;  1MYO A;  1SA4 A;  4KZC A;  3IV0 A;  1N0Q A;  1BI7 B;  2Y0B G;  3FUH A;  4EQF A;  3CEQ A;  3AJI A;  3D9O A;  1HS6 A;  3AU5 A;  3GZ2 A;  2DIW A;  2KCV A;  1H6P A;  2GRO B;  3DSS A;  4GZC A;  3GZS A;  1WG0 A;  5CER B;  2KXP C;  3OTN A;  3FUF A;  4LER A;  1H6K A;  2E0I A;  2WQ6 A;  1XNF A;  1JCQ A;  2I1J A;  4LSZ E;  2RFM A;  2J09 A;  5FJY A;  3FEX A;  4WAF A;  3MV2 B;  3V30 A;  4DJA A;  2R02 A;  4O6F A;  3Q7A A;  4LCT A;  5CBO A;  5JHB A;  1EYH A;  4WWO A;  5KNH D;  4E6H A;  4U8H A;  3VLE A;  4J6I A;  4B94 A;  1H0A A;  2HYZ A;  2ZIR A;  2CFZ A;  2XS8 A;  3BEE A;  4F1P A;  4DLQ A;  1NZN A;  4GA0 A;  4YND A;  3V31 A;  4JHR A;  3PE4 A;  4M3O A;  4O1P A;  1OCZ E;  1SQM A;  4WNE A;  4L7T A;  3UUX A;  4GA1 A;  1BLX B;  2OVF A;  2ILR A;  5ARG A;  3CVQ A;  4CZ2 D;  3Q79 A;  3TWS A;  4EHM A;  5G55 A;  1FPP A;  4BFR A;  3ZNG A;  3ZU7 B;  4F3V A;  2X6K A;  4ANX A;  2V8S E;  4B8A A;  2LXL A;  2P2C P;  4G23 A;  4U07 A;  1YA0 A;  3D3M A;  2Q7F A;  3IXE A;  4G1T A;  4AP2 A;  4CYM D;  4UI9 J;  3Q73 A;  2UWJ G;  5LCW C;  1IKN D;  2F37 A;  5ENP D;  5EYL A;  4Q94 A;  3T8K A;  4KVM A;  4BSZ B;  2DVW A;  2IQC A;  1TN8 A;  5BXO A;  3R9M A;  1TNU A;  2OV8 A;  4BY6 A;  3CHM A;  4DX6 D;  2P9U G;  3R9A B;  5IY5 E;  1H2U A;  4J8F A;  3QWV A;  3MEK A;  2IU1 A;  4AV7 A;  3AU4 A;  3BUA A;  4NQ0 A;  5LX8 A;  3PRE A;  4DLO A;  4DI3 A;  4TV3 A;  3DSV A;  2PQR A;  3I3N A;  2X6F A;  5AEN A;  3FHE A;  5EYP F;  2LSV A;  1V55 E;  3D9P A;  2P9L G;  1N95 A;  1FVH A;  3E30 A;  2WM9 A;  4OYS A;  3LJN A;  1A5E A;  1LF8 A;  3PS6 A;  4RVB A;  4U04 A;  3TL5 A;  4GTT A;  4HNA D;  3HG0 D;  5ENT D;  3O4Z A;  4CT0 A;  3L6A A;  2WXH A;  1QQE A;  2CHX A;  4GTP A;  4C0M A;  4YDO A;  4TXP A;  1VDY A;  2LNI A;  3J5Q B;  2R59 A;  3IHV A;  4Q69 A;  3TWW A;  2IOS A;  2WPV A;  4XEI G;  4U0U A;  4GPK A;  3PRZ A;  2V5Q C;  4ZHB A;  1E96 B;  4C0E A;  2DWZ A;  2J08 A;  3L16 A;  3RO2 A;  1OWM A;  3U4T A;  4JEH A;  4J7W A;  2DCP A;  3ULE G;  3QKY A;  1K3Z D;  3C3Q A;  3EHN A;  1KT1 A;  5EIB E;  4LNB A;  2R5S A;  4I6J A;  3V2X A;  3RKV A;  3FTU A;  5BUZ A;  2C0M A;  3I5P A;  5BV1 A;  5ANR A;  4JXT A;  1EF1 C;  1TJF A;  4HRM B;  4I2W A;  3HXE A;  3FTY A;  2XGO A;  3J5P A;  3VTX A;  3C72 A;  3PEU B;  3MGB A;  4JC8 A;  2OEV A;  4GTQ A;  1NA0 A;  3Q5M A;  1E8Z A;  3NBN B;  2LO6 A;  3QJZ A;  3KSQ A;  2MRI A;  3FTV A;  3Q75 A;  4HRL A;  3CVY A;  1H2V C;  3CSF A;  3VLF A;  2AXV A;  3QWP A;  2IF4 A;  3KS2 A;  3PUK A;  1MHQ A;  2KZT B;  3KEZ A;  3ZYQ A;  3L22 A;  5HRY A;  4W9R A;  5JJ7 A;  2QFC A;  4AIF A;  5CEC B;  1Z3X A;  3QK0 A;  2X3M A;  1ZU2 A;  2FEZ A;  3SBS A;  5AQ7 A;  5C1D A;  1MX6 A;  4BWR A;  4RG9 A;  3RIB A;  5DBK A;  3CIA A;  4C48 B;  2FBN A;  4ILH B;  2Y4T A;  4HVB A;  3ZPJ A;  3DBS A;  1OY3 D;  2QY7 A;  3ASH A;  3GW4 A;  4BX9 A;  1SA5 A;  1QBQ A;  3HRA A;  2LAI A;  4K5C A;  4E85 A;  2XS1 A;  1K1A A;  1ZBP A;  4G8L A;  3B7T A;  2AXZ A;  1DCE A;  4RLY A;  4JEU A;  3TJP A;  3ABM E;  2GRM A;  2WXO A;  2R03 A;  2BF0 X;  4APO A;  4DPR A;  3FUJ A;  2GRL A;  1HH8 A;  4KXK B;  3QWW A;  2H6G A;  4U0Z A;  4LRZ A;  2HO1 A;  4WWN A;  2HR2 A;  4BER A;  4KZ0 A;  1EDU A;  2QYU A;  4FP7 A;  3OXG A;  1D9S A;  3ZHE A;  3CK7 A;  3I4R B;  4DRX E;  1RZ4 A;  3FY4 A;  5EX3 A;  4GB9 A;  4HOT A;  2B0O E;  4GCO A;  3ASO E;  3PH0 C;  4KVO A;  3Q78 A;  1O1S A;  3ASG A;  4L2Y A;  4G11 A;  2Y3A A;  4I2Z A;  3R7R A;  3MYV A;  3P1U A;  3O48 A;  4C9B B;  1TNO A;  4XKB A;  1NA3 A;  4UQZ A;  4KMO A;  4EBA A;  5G04 C;  2P9S G;  1E8Y A;  2X6H A;  2FO1 E;  2CHZ A;  4GA2 A;  4JA9 A;  3JCK C;  3DXM G;  2VQ2 A;  2J8S D;  4RQI A;  5G05 J;  5J08 A;  3JYS A;  2LAH A;  3UM3 A;  4XI9 A;  5CCL A;  1OCO E;  4OAU C;  1E7U A;  3PEV B;  3HXB A;  1V54 E;  3T8M A;  4MLP A;  2QYJ A;  2R17 C;  3LY8 A;  3JQ1 A;  5EID A;  5FQ6 A;  3UM1 A;  4IN3 B;  1QYM A;  2WXN A;  2F8Y A;  3S7J A;  4WUY A;  1U3C A;  3B95 A;  3B7R L;  4GTV A;  4OVU A;  4HRN A;  5ENR D;  4U96 D;  1FT2 A;  4OVV A;  3ML9 A;  1S63 A;  1IYG A;  3ZRH A;  1JCS A;  4PDX A;  3KAE A;  3K9I A;  3MKR A;  4UUC A;  4JB8 P;  4HOQ A;  4I9E A;  3E4B A;  2YHC A;  1MJ0 A;  4PS8 A;  4N3B A;  5B1B E;  3CGH A;  2VSY A;  3PZD A;  1LTX A;  1P5Q A;  4NUR A;  5FTP A;  2V4H C;  3AAA C;  3NZU A;  4O60 A;  3LYA A;  3LY7 A;  3SFZ A;  2I9C A;  2WXK A;  3PZ1 A;  4JHJ A;  3TGO A;  4UWK A;  5JHA A;  3FUM A;  2JLB A;  4U0S A;  1OUV A;  3ASD A;  4FHJ A;  4V3I A;  2VTB A;  3UQ3 A;  4U7E B;  2MHK A;  1UG3 A;  3ZXS A;  3CST A;  4HLL A;  2MOW A;  5LP0 A;  3DPD A;  3LVQ E;  3S2A A;  4NAC A;  4FU3 A;  3B7S A;  5A23 A;  3ULQ A;  5AQA A;  1A17 A;  2XEE A;  3EUV A;  3FUE A;  1N11 A;  4AY6 A;  4N2Q A;  1NFI E;  2X38 A;  3FUN A;  3NOC D;  5EX0 A;  2ETC A;  1TNZ A;  1TN6 A;  3FH7 A;  3T5V A;  3GZ1 A;  2IOL A;  3AS4 A;  4FAD A;  3Q9N C;  1ZB1 A;  1O1T A;  3UM2 A;  4EEC A;  2EIK E;  5ITZ F;  2J49 A;  3NF1 A;  3LXU X;  2RKK A;  4HLE A;  3UT8 A;  5C2Y A;  4HOR A;  5CCM A;  3AS5 A;  3PNL B;  3RRM B;  2VYI A;  4IRU A;  5E75 A;  4Y6W A;  4Y6C A;  4GTR A;  4FLB A;  4BEP A;  2NXP A;  3E33 A;  3TG5 A;  1BD8 A;  3CQG B;  3E37 A;  2WXR A;  5AJL A;  2XCB A;  4ILG A;  2JAB A;  1O5M A;  2WVI A;  4HI9 A;  2XZD G;  5T8I A;  4UI9 C;  4UQY A;  1WY6 A;  3CV0 A;  1BU9 A;  1YMP A;  3IHY A;  2Y4U A;  3UXG A;  5CEA A;  4BT9 A;  5ANL A;  1DC2 A;  1WDY A;  1Y6I A;  5A6C A;  4UWH A;  2P9K G;  5M72 A;  3SI5 A;  4GTO A;  5LCW J;  3OAW A;  3B13 A;  4RG6 A;  5AAO A;  3UX4 A;  4JD2 G;  3BU8 A;  3UIP C;  4YVO A;  4BT8 A;  1UN8 A;  2GRQ B;  3PZ4 A;  2L6J A;  4KBQ A;  4DX2 A;  5FQ4 A;  4U95 D;  4A1S A;  3UKU G;  1Z3Y A;  3FDH A;  3DPY A;  4XI0 A;  3ZVV A;  4MKT A;  3TWQ A;  5FZS A;  5KJL A;  5J90 A;  3ZN3 A;  2XGM A;  1AWC B;  1DVP A;  2H6H A;  4L1B A;  4D10 C;  4J8D A;  3FEY A;  3CHS A;  5A7D B;  1O1R A;  2VGE A;  4N39 A;  3UIO C;  4PS3 A;  5CHE E;  1B89 A;  3ZGQ A;  5AN8 A;  4UWF A;  5E76 A;  4JA7 A;  3AS8 A;  1SVX A;  4G8K A;  5BT1 A;  4M7C A;  3TWU A;  3CR3 A;  3APC A;  5BV0 A;  2WQH A;  4LEU A;  3HVE A;  4BTB A;  4AY5 A;  3LEW A;  3RK6 A;  1X81 A;  3Q49 B;  4B8C B;  3C98 A;  3UKR G;  3EJN A;  1FCH A;  3X2Q E;  3QAR A;  3PVL A;  3KSL A;  4ACK A;  3AG3 E;  2R2L A;  4ZFH A;  1H6O A;  3ONK A;  4DUI A;  3ZFW A;  3GYZ A;  2J07 A;  2I1K A;  2GRR B;  4A1G A;  3CVL A;  4ANW A;  2YIN A;  1UW4 B;  1Q2Z A;  3G2S A;  5LFA A;  4GCN A;  1TYQ G;  2YNQ A;  3VTY A;  4BTA A;  3TWR A;  4PUC A;  5JA4 D;  1E7V A;  5ARF A;  2LSU A;  3UPV A;  4BSX A;  2DZN A;  4H7Y A;  2OEW A;  2XPI A;  5CMY A;  2J4D A;  3D9H A;  2P9P G;  3B7B A;  3SD5 A;  3QB2 A;  2WMN A;  4ANU A;  5FWQ A;  1OWP A;  2C0L A;  5ENO D;  4G25 A;  2BUG A;  1HF8 A;  3MX3 A;  3EIJ A;  4CDN A;  5EKQ D;  4OAV B;  3RSE G;  1S0P A;  4J0U A;  2XRZ A;  4HQD A;  2NSZ A;  4CGV A;  1TNB A;  2CFU A;  4I9C A;  3BG0 B;  2VGY A;  4ATG A;  3WG7 E;  4K03 A;  3ZUV B;  2L9B A;  2FI7 A;  3CVP A;  4YDE A;  4GZ6 A;  2VGX A;  2FF4 A;  3ZYL A;  1TN7 A;  4GTM A;  2FUL A;  2IY0 C;  4FHK A;  4MRU A;  3C3R A;  2HM8 A;  4GTS A;  4YDW A;  1N52 A;  2BKK B;  3JXI A;  3TG4 A;  1ELR A; 
#chains in the Genus database with same CATH homology
 2BED A;  4GTP A;  1JCS A;  1LD7 A;  3PZ4 A;  3SFY A;  4YDO A;  1S64 A;  2H6I A;  3DSS A;  1O1T A;  3E32 A;  3DPY A;  3Q79 A;  1N4Q A;  4EHM A;  1FPP A;  1LTX A;  3HXD A;  3Q78 A;  1O1S A;  1NL4 A;  2F0Y A;  1JCQ A;  3SFX A;  3Q7F A;  2H6H A;  4MBG A;  1KZO A;  1TNO A;  4GTR A;  1D8D A;  1NI1 A;  3Q73 A;  3E33 A;  1O1R A;  3PZ1 A;  3E37 A;  3DSX A;  1KZP A;  1N94 A;  3EU5 A;  3DRA A;  1TN8 A;  3Q7A A;  1JCR A;  1N4R A;  4L9P A;  1TNU A;  3PZ3 A;  1O5M A;  1SA5 A;  1QBQ A;  1N4P A;  4LNB A;  1TNB A;  1FT1 A;  1N9A A;  3HXF A;  1DCE A;  1X81 A;  2ZIS A;  3HXB A;  3HXC A;  3HXE A;  2H6F A;  2ZIR A;  4YDE A;  3EUV A;  3C72 A;  2IEJ A;  3DSV A;  4GTQ A;  1TN7 A;  3KSL A;  4GTM A;  4LNG A;  1N95 A;  3E30 A;  1D8E A;  1LD8 A;  1TNZ A;  1TN6 A;  2R2L A;  2H6G A;  4GTO A;  4GTS A;  4GTV A;  3KSQ A;  1SA4 A;  4GTT A;  3DSU A;  1FT2 A;  3DST A;  1N4S A;  3DSW A;  3E34 A;  1S63 A;  3Q75 A;  3PZ2 A;  1MZC A;  1TNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...