3ASHA

Mama d159k mutant 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
172
structure length
172
Chain Sequence
NDDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
total genus 63
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ashA01
5BT1A 4EQFA 1HZ4A 3CK8A 2XGOA 3S7BA 2VGXB 4WUYA 5G05C 5JJ7A 2KCLA 4J8FA 1IHGA 5FZRA 5FZQA 4HOSA 4B94A 1NA0A 1QZ2A 4A1SA 5FTPA 3R9AB 3QDNA 5G04J 3O48A 3RU0A 3OXFA 3MV2B 5KJNA 3ZHEB 1A17A 2FO7A 3EDTB 2JLBA 5DBKA 4N2QA 2XGSA 4AIFA 3GW4A 5CHEE 2PQRA 4G25A 3N71A 3MV3B 4AM9A 1W3BA 3ZPJA 5CCMA 4N3BA 2PQNA 2YHCA 4W9RA 3K9IA 3LY8A 3HYMB 4BWRA 4I2ZA 4GA0A 2FBNA 3SF4A 4BT8A 1TJCA 3QWPA 3RO2A 3CK7A 3RJVA 2R5SA 3LPZA 4J0UA 3ZFWA 3NF1A 4U0SA 4GA2A 3SZ7A 4JL0A 1ELWA 4KBQA 2ONDA 2YQ8A 4LEUA 3LY7A 2VSYA 3PE4A 2KC7A 4N5CA 4Y6CA 4CDRA 1QQEA 1B89A 5M72A 4AY6A 3MEKA 2C0MA 3U4TA 2QFCA 3GYZA 3Q5MA 1KLXA 4G23A 1XNFA 5D0OD 4GCOA 3CEQA 4HOUA 3TG5A 2Y4UA 4IN3B 2DBAA 4JA7A 3TGOA 4BT9A 2UY1A 3Q49B 4WNDA 2LSUA 3CVPA 4U0ZA 4NQ0A 5FT9A 4RG9A 2J9QA 4GYYA 3RKVA 1KT1A 4H7YA 2HO1A 4XI9A 5LCWJ 3CKBA 2V5FA 3PE3A 4N39A 2LNIA 3BEEA 4U0UA 2XGMA 4HOQA 3ASFA 4GYOA 4JA9A 4BTBA 2VQ2A 3QOUA 2C2LA 4G26A 3AS8A 2XPIA 5G04C 5KJLA 4CGVA 2UWJG 3JYSA 3RO3A 3AS4A 4J8EA 3CV0A 4UI9J 3MKRA 4AY5A 2C0LA 3CVQA 1WAO1 2UY1B 5EKQD 1PC2A 1ELRA 3OXGA 5BW8C 2LSVA 2FEZA 4UQYA 3GZ1A 5ARFA 3FP3A 3KAEA 2Y4TA 2MHKA 3URZA 5ARGA 3ASDA 3ASGA 2IF4A 5D0QD 2WQHA 1P5QA 3Q15A 5HI7A 5KJMA 3TAXA 5A6CA 4F3VA 1ZBPA 1Y8MA 2WPVA 2PL2A 1OUVA 3GZ2A 4CGWA 3CVLA 4XIFA 3ZHEA 3LKUA 2L6JA 2NC9A 3WXXA 3LCAA 1E96B 5G05J 4WNFA 4O6FA 4APOA 2KATA 2FI7A 4H7XA 3CVNA 3KS2A 4I1AA 4N3CA 1ZU2A 1NA3A 3QWVA 4KYOB 4ME2A 5KJKA 4GPKA 3S7JA 3PDNA 4WNEA 3LYAA 3LY9A 4ABNA 4NRHB 4GZ3A 3AS5A 2VGYA 4YVOA 5FZSA 4KXKB 2E2EA 3E4BA 5HQ8A 5AYWD 5A7DB 4GCNA 4N3AA 5JJTA 1HH8A 2GW1A 3U3WA 4HOTA 4RG6A 3RIBA 5BNWA 2HYZA 4I9EA 4YNDA 1KT0A 4GYWA 3QKYA 5LCWC 4G1TA 3IEGA 2I6HA 4U04A 3UUXA 4GZ6A 4Y6WA 4I9CA 2XCCA 5DIZA 4HORA 2XEVA 3CK9A 4GA1A 5EX3A 2OOEA 1FCHA 2BUGA 2KCKA 4I17A 4UQXA 4UI9C 3S7FA 2XCBA 3QWWA 4JHRA 2VGXA 1NZNA 5EX0A 3ESKA 3TG4A 2P58C 3MA5A 2AVPA 2VYIA 4G24A 4G2VA 3ASHA 2IFUA 2FF4A 4UQZA 4GZ5A 4YVQC 2Q7FA 5JJ6A 2HR2A 2KCVA 3UPVA 3OXLA 1HXIA 4UI9K 4WNGA 5C1DA 3Q47B 4U07A 1YA0A 3UQ3A 3S7DA 3KD7A 4N2SA 4XI0A 3FFLA 3VTXA 4BTAA 3ZN3A 3FWVA 4I2WA 3ULQA 4J8DA 3CKCA 3Q4AB 5FJYA 5CCLA 3VTYA 1IYGA 3ZGQA 2VSNA 1WM5A 2PZIA
chains in the Genus database with same CATH superfamily
1HFAA 3HRAA 2XQ0A 5BT1A 3T5VA 3CK8A 4L23A 4KVOA 2XGOA 1OCCE 2VGXB 5G05C 2PM6A 1N9AA 5FZRA 4EZKA 3ZKJA 1QNFA 4LNGA 3PNLB 3ZU7B 1QZ2A 4F7AA 4I1MA 3R9AB 1WY6A 2GRNB 5ENTD 5KJNA 1K3ZD 3D9OA 4C0EA 3FUMA 4NIKA 4MLPA 3LJNA 3UI2A 3FUHA 1V54E 2XS8A 1BLXB 4AM9A 1V55E 3P2BA 1MX6A 3APFA 2QZAA 3HHMA 1W3BA 5CCMA 1PY1A 4N3BA 4FADA 2PQNA 4W9RA 3K9IA 3JUEA 2L0TB 3HYMB 4GTOA 2F0YA 4K5AB 2ZU6B 2XHEA 3SF4A 3LDZA 1N0QA 2J49A 3CR3A 3MJWA 2WQ6A 1N4RA 5ANLA 3FUEA 4GTQA 2OVBA 2CFUA 2R5SA 2PNNA 4J0UA 4U0SA 1OXJA 3FU5A 5AJDA 1Z6TA 4LEUA 2R05A 3SBSA 2EIME 3LS8A 4DX2A 2VJ8A 2VSXE 4JB8P 3R7RA 1EPUA 3LJ3A 5M72A 3MEKA 4M3OA 2C0MA 4XKCA 3U4TA 3C72A 1ZB1A 3HDXA 2ZIRA 1XNFA 4GCOA 3AG4E 4ACLA 3SNXA 4WWNA 4Q69A 2P9PG 2RD0A 4AEZC 4G8LA 2XS1A 5C2YA 1KZPA 1N52A 4APFA 3Q49B 3L13A 4WNDA 4BEPA 2LXMA 3OTNA 4PS3A 4U0ZA 2EQXA 3TXNA 5JMND 3JQ0A 3UX4A 3W9GA 4YDEA 4H7YA 3CKBA 3PZ1A 5AQ9A 4N39A 2A5UA 3EHMA 4I1OB 4J8SA 3T9KA 4HVBA 4JA9A 3UXGA 3DXKG 3L17A 4BTBA 2IY0C 5JHAA 1UW4B 3APCA 3CHSA 1FVHA 3E37A 3RO3A 2ZXWE 4J8EA 3IKOB 2Y69E 3QJZA 1TNYA 4CCAA 4UWGA 4BFRA 4DLQA 3PVLA 3Q78A 5BW8C 2X6IA 3TWXA 2DCPA 5BPPA 5A23A 2CG3A 3CSFA 2BEDA 3DPYA 2IOSA 3KEZA 4ATGA 5CRVA 5ITZF 3V30A 3URZA 5AENA 4XKBA 5ARGA 4FP7A 4HBDA 5G2NA 2PM7A 5AN8A 2NXPA 3G2VA 2R17C 5KJMA 5E75A 2XZTG 1Y8MA 1N54A 1PAQA 3BUAA 4GB9A 3DEPA 3TWSA 3CVLA 2NC9A 1OCZE 1TR4A 2QYUA 1H2TC 4TXPA 3C3RA 3BG0B 5G05J 4JD2G 4A55A 3KS2A 4QFVA 1LD7A 2J4DA 4N3CA 3ISMC 4JHJA 3PZ3A 4ZFHA 1ZU2A 1NA3A 3QWVA 5KNGA 4JVSA 4GPKA 1Z3YA 3LYAA 3LY9A 4NRHB 4GTSA 4DUIA 4JEUA 5ENQD 4JZYA 5CBOA 2P9LG 3AG3E 2V0PA 4A3TA 3PZDA 4HQDA 1EYHA 3ZIMA 2VTBB 4HOTA 3B7BA 4KZ0A 4RG6A 4K5BA 4L2YA 5BNWA 4FU3A 4I9EA 3DEOA 2CHWA 1KT0A 1FT2A 3D9HA 2I6HA 4O1PA 4U04A 4I9CA 4HORA 3FHEA 3SFXA 4HS2A 2XEVA 1UG3A 1U3CA 4IYPA 5EX3A 3UM1A 3PUKA 2P9UG 3AU4A 2BUGA 2KCKA 3QARA 3CHQA 4UQXA 3KEAA 2OV8A 2XPYA 1VDYA 5EX0A 2IFUA 4UQZA 4FA6A 2WXRA 2WXLA 5H7PA 4YVQC 4B93B 3C5RA 2YINA 2Q7FA 3PREA 3G2TA 1Z5SC 2YNQA 3Q47B 3JXJA 1YA0A 2X6HA 3UQ3A 3S7DA 1KPSB 4N2SA 3D9IA 4XX5A 4CT4A 4GZCA 1SZ9A 4J8YA 4BTAA 2YHEA 4GZDA 1H6OA 4Q96A 4G11A 3UM3A 3CKCA 2DZOA 5FJYA 1TNBA 5CCLA 1E8YA 4C0MA 1IYGA 2KBXA 1WM5A 1TEZA 2PZIA 3EIJA 3Q9NC 4AP2A 5JA4D 3FUKA 4RSYA 1HX8A 2KCLA 3DSVA 1IHGA 5AJLA 4GTTA 4FLHA 4GTMA 4HXIA 1IKND 3OAWA 4L2LA 1K1AA 3QDNA 1H6KA 2XRZA 3SBTB 3O48A 4EZLA 5FIOA 3MV2B 1MHQA 3X2QE 2BKGA 3LVQE 4UWHA 2FO7A 4N2QA 2P9SG 4FULA 4AIFA 5CHEE 2PQRA 5CEAA 3ONLA 3ZVVA 5FQ4A 3IXEA 3MV3B 2RFMA 1LD8A 1O5MA 4MRUA 2E0IA 4O60A 4JHKA 1HE8A 3L22A 3ZXSA 4GA0A 1OWNA 3BU8A 4BT8A 1TJCA 1E7VA 3RO2A 1SA4A 3PNTB 2L9BA 3MCXA 1X81A 3KSLA 3SI5A 3ZFWA 4DX5D 3IV0A 5AQBA 4MBGA 3UM2A 4TRQA 1ELWA 3I3NA 2AW6A 4KBQA 5CECB 5CBNA 3V2OA 3JQ1A 3RRNB 2VSYA 3PE4A 2XEEA 5ENOD 1OY3D 1Q2ZA 3D9PA 4JC8A 2EIKE 4AY6A 2H6HA 4N5QA 4RVBA 5EYPF 1KLXA 5D0OD 1E90A 3ZYLA 3TG5A 3FTWA 3NB2A 3JXIA 2Y4UA 3UINC 1MQSA 4IN3B 4Q94A 3G2WA 1N4PA 5AAOA 4CEMA 3TGOA 2WB2A 4BT9A 5BV0A 5EIDA 4BX8A 3LVRE 3T5XA 2LSUA 3TXMA 5AARA 3CVPA 4NQ0A 1OT8A 1LF8A 1SVXA 3SHFA 5HRYA 2X38A 2WQ7A 3UT4A 4GYYA 3FUJA 4B0ZA 1KT1A 3AAAC 4B89A 5E76A 3T8KA 2V5FA 4HB5A 2BF0X 3PE3A 4FC8A 3FU3A 4D10C 1FVFA 4U0UA 3BEEA 4GTPA 1DNPA 4HOQA 3ASFA 1EF1C 3DSUA 2GGFA 3RK6A 4XE0A 1QYMA 2DZNA 2C2LA 2P9NG 3CV0A 4AY5A 1BI8B 3T8MA 2WXIA 2XEHA 3L9TA 3UKUG 3ENEA 1WAO1 2UY1B 5EKQD 4U8HA 4RLYA 2LSVA 4HI8A 4E6HA 3EIQC 3NZSA 2DYRE 5B1AE 3FP3A 3EJNA 2WMNA 2IF4A 4OVVA 5D0QD 4C48B 2LO6A 3FUIA 4URKA 5HI7A 2VGEA 2H6IA 2WPVA 1UOHA 3UIPC 2ETBA 3MKQA 3HVEB 3I4RB 1OUVA 3SY2A 4GPMA 2WM9A 2L6JA 5T4YA 4F6RD 5CMYA 4DX7D 3VLEA 2V4HC 4L1BA 4KZCA 4WNFA 4O6FA 4APOA 2KATA 3AU5A 2J8SD 1ELKA 3CVNA 4EECA 3SGHA 2WVIA 5FWQA 5KJKA 3PDNA 1BPOA 3U9WA 3FTUA 4GZ3A 1UJKA 4B8CB 3NOGD 4YVOA 5FZSA 4KXKB 1NI1A 2E2EA 3BQOA 4ZHBA 3UT8A 1UN8A 4LNUD 2EILE 2F37A 3CHPA 4ANWA 4ILGA 4AVXA 2MYOA 2GROB 1HH8A 2GW1A 3U3WA 2J09A 4FHJA 3FTYA 3FUFA 1TNUA 3SFYA 3JUIA 3NAWA 4GYWA 3MGBA 2V5QC 5LCWC 4KT6B 3AJIA 1AWCB 3UUXA 4GZ6A 3QNKA 4HRMB 5DIZA 1N4SA 3RSEG 2QYJA 3CK9A 5AQAA 1IQUA 2RKKA 4I17A 2XENA 4UI9C 3S7FA 2XCBA 2VGXA 1HG5A 1NZNA 3TG4A 2P58C 4IRUA 2DWZA 3MA5A 3BG1B 1TYQG 2VYIA 4BSXA 5B3SE 3DWLG 2EIJE 4AV7A 3FTZA 3OXLA 4UI9K 3CHRA 3RAUA 2ETCA 4DK5A 2B0OE 2L0IA 3PEVB 5CRUA 1N11A 2AJAA 2LAHA 4KMOA 4UWLA 2KXPC 3VTXA 2J08A 2F8YA 4ANXA 3ZN3A 4GTRA 3FWVA 5ENSD 4MS6A 4BX9A 2JEKA 3W9FA 4LNBA 3QB2A 3IHVA 1A5EA 2DYSE 1OWMA 4LUNU 3G2SA 4U63A 3Q75A 3U64A 4EQFA 4WUYA 2I1KA 3CVYA 3ZUVB 2GRLA 5AIJA 5FZQA 5BUZA 3CIAA 4HOSA 1NA0A 1OCRE 3CQGB 4A1SA 3HIZA 2QY7A 3SO8A 3RU0A 3IBEA 2ZISA 3FEXA 4HNAD 1YCSB 2XGSA 1DCQA 2I1JA 3GW4A 2X6JA 2GRMA 3N71A 3EU5A 3SQVA 2DVWA 4JEHA 4UWKA 1S70B 3P1UA 3ZPJA 3JCKC 3UT7A 2IO3C 3SD5A 5EN5D 3D9NA 4M7CA 1S64A 3LY8A 1IHBA 1TN8A 1U2VG 1D8DA 4I43A 3HXFA 1BU9A 5ENPD 1L5JA 3CK7A 3RJVA 3LPZA 1FT1A 2CG2A 3DBSA 3NF1A 3SZ7A 3PH0C 4JL0A 1U3DA 2YQ8A 3LY7A 1Z3XA 4N5CA 2P9KG 4Y6CA 2CHZA 3DPDA 1GW6A 5HS0A 1B89A 4PUCA 1H6PA 3B7SA 1G3NB 4NURA 2WXGA 3ULEG 4GU5A 1NFIE 4G23A 2V8SE 4TXRA 3CEQA 3R9MA 2R2LA 4DX6D 4EZJA 1JWFA 4A1GA 3WG7E 3B13A 3PZ4A 3Q79A 3TWWA 4DRXE 4I6GA 3FDHA 1RZ4A 5ENRD 5CERB 3DSXA 4AOFA 3B7RL 4TXQA 3TWRA 3Q73A 4O1OA 3ABLE 1E7UA 3FH8A 4P29A 2X6KA 4DI4A 2WXFA 5EDSA 2HO1A 4XI9A 5LCWJ 1N95A 2AWIA 1MZCA 2LNIA 2XGMA 2OCCE 2R59A 1TJFA 4GYOA 3EHNA 1OWPA 2MOWA 3D9MA 5HKPA 3E32A 2VQ2A 2R02A 3AS8A 1DCEA 2XPIA 5G04C 5KJLA 3Q9UC 2HE0A 4UI9J 4HFGA 4GAAA 5J90A 1HF8A 1PC2A 1E8XA 1ELRA 2FEZA 4UQYA 3GZ1A 3ABKE 3PRZA 4DX1A 3HG0D 3CLJA 4LSZE 3EHQA 2Y4TA 2ZGGA 4MKTA 3DSSA 3ASDA 3ASGA 3HXCA 4CDNA 2IQCA 2OEVA 1K8KG 3CGHA 1P5QA 3PS6A 3J5PA 4F3VA 4LRZA 3MZLB 5KNHD 4JXTA 4R7LA 2P9IG 3GZ2A 4ANVA 2VTBA 3ZYQA 4CGWA 3MYVA 4XIFA 5BXOA 3FTSA 2GRQB 5ANRA 1H2VC 4BERA 4YDWA 5EIBE 4U96D 4EBAG 2WXMA 1E96B 3LCAA 3I5PA 1OWLA 1EDUA 4UWFA 4HRNA 3L08A 2L6BA 2KZTB 3VLDA 2AXUA 4H7XA 3ABME 4HI9A 4I1AA 4L7TA 3QAQA 3Q7AA 4J7WA 4WAFA 4ME2A 5G55A 3S2AA 3S7JA 2FO1E 1X5BA 5EILA 3DRAA 3UIOC 2J4BA 5BV1A 2CFZA 1HS6A 3R7QA 3E4BA 2GRRB 2IONA 3B7UX 5T8IA 3UTMA 5IY5E 2AXZA 4A3VA 3FY4A 2XPZA 2CHXA 5FINA 5A7DB 1BI7B 3LEWA 1N94A 4GCNA 4N3AA 5J08A 1TNZA 3HXEA 5LP0A 4PH4B 2HM8A 1N0RA 2A4ZA 3PEUB 1UJJA 4G1TA 3IEGA 3L54A 4CDMA 4Y6WA 5KCMA 1SZAA 2XCCA 4BSZB 4HLLA 2QC9A 3ZRHA 3Q7FA 3RRUA 4GA1A 4EBAA 2OOEA 3B95A 1E8ZA 1S0PA 4HLEA 2B6CA 3QWWA 4JHRA 2X3MA 2P2CP 1JPLA 3F6QA 1S63A 4TUUA 4FJYA 3CHOA 3CHMA 3PUJA 1QBQA 2WXJA 4G2VA 3TWVA 4GZ5A 4YDYA 2RG8A 3TJPA 4RQIA 1BD8A 4BETA 5JJ6A 4U8VD 2HR2A 3UPVA 1HXIA 3TL5A 4U07A 1SA5A 3ESLA 3FH5A 3ULQA 2GRPB 3Q4AB 3TWTA 4JPSA 1DC2A 3EU9A 2NSZA 4JW1A 3ZGQA 3NBNB 1NL4A 3QK0A 1DVPA 2WXKA 5B1BE 1O1RA 1HZ4A 3CVUA 4G8KA 4DJAA 3S7BA 1D9SA 2RFAA 5KBAA 4GMRA 1WG0A 4J8FA 5JJ7A 2WXPA 4E85A 4B94A 3ZXPA 2IJGX 4U7EB 5LX8A 2H6GA 3D3MA 2DIWA 4XZ4A 4OVUA 3ZYMA 3CVWA 5FTPA 3MX3A 1E8WA 5G04J 4UUCA 3OXFA 3ZHEB 1A17A 3HXDA 1HG2A 3ASOE 3EDTB 2JLBA 5DBKA 3CVXA 3IHYA 1MYOA 4G25A 3AG2E 1RW2A 1SQMA 3ASNE 4BESA 5JHBA 3TWUA 3L82A 3TWQA 4GMLA 2YHCA 1N4QA 1SW6A 1JCQA 5FQ7A 2R03A 4BWRA 4I2ZA 3C3QA 4J6IA 1XGWA 2KZTA 2FBNA 4FLBA 2IO2C 3QWPA 4A63B 3AG1E 3PZ2A 1KZOA 3CSTA 4ANUA 3QC1A 1OWOA 4GA2A 3SFZA 3C3OA 1TN6A 2ONDA 3KSQA 4DI3A 2KM4A 4CYMD 2KC7A 2VSOE 4CDRA 3NOCD 5LFAA 4CT0A 1YMPA 2WXOA 3ULYA 2WMOA 1QQEA 3ZYKA 4F53A 1HO8A 2XZDG 2QFCA 3GYZA 1TNOA 3Q5MA 2JABA 3D9LA 4U8YD 3APDA 3UKRG 4TV3A 1MJ0A 4HOUA 5KWDA 4TUMA 3FULA 2DBAA 1MX4A 4JA7A 3FUNA 2UY1A 3RRMB 4EPZA 1O1TA 2M63A 4PDXA 4AJWA 5BXUA 4YDOA 5FQ6A 4L9PA 2X6FA 3V31A 5T3RA 4LG6A 5FQ8A 5FT9A 4QQIA 3DSTA 4RG9A 4X8QA 2BKKB 1JUQA 4K03A 2J9QA 3RKVA 2H6FA 4ACKA 3ZW3A 1H0AA 2LAIA 3C98A 4CRWA 4EHMA 1OCOE 2WXHA 1MX2A 1INZA 3E33A 3V79K 4PS7A 1TN7A 3HVEA 1H19A 3ONKA 2V4LA 2FULA 3QOUA 3UM0A 4G26A 4KVMA 2IOLA 4BY6A 3I4GA 4FJZA 4CGVA 2UWJG 1D8EA 3DSWA 3JYSA 3AS4A 3MKRA 4DLOA 2I2OA 2C0LA 3CVQA 2BTDA 2IEJA 4OYSA 4F1PA 3NZUA 4NACA 3OXGA 4AXHA 2WXQA 5CMWA 5ARFA 4OAVB 4V3IA 2I9CA 3KAEA 4C9BB 4GTVA 3V2XA 2MHKA 3ML8A 1JCSA 2WQHA 1AP7A 3D9KA 4LCTA 4LERA 3Q15A 3TAXA 5A6CA 1ZBPA 3FTVA 2LXLA 2PL2A 2ZGDA 2ILRA 4OAUC 3CVVA 4PS8A 3ZHEA 3LKUA 2Y0BG 3WXXA 1NP7A 3DXMG 3B7TA 2WXNA 2FI7A 1YYHA 3FUDA 4KYOB 3O4ZA 4I6EA 4WNEA 4I6JA 4ABNA 3AS5A 1FPPA 2VGYA 3ML9A 4IULA 5LOZA 1HU3A 3E30A 4WWPA 5HQ8A 5D66A 5AQ7A 3MKQB 4ATZD 4U95D 5AYWD 1O1SA 3E34A 5JJTA 4B8AA 4DPRA 3L16A 3RIBA 2HYZA 1K1BA 4YNDA 3HXBA 3QKYA 2OVFA 3G2UA 3FU6A 4Z68A 4K0RA 3EHRA 2Y3AA 3UMVA 2J07A 3J5QB 4F1SA 3U66A 2XRYA 3CQCB 2NYJA 1FCHA 4ILIA 1IQRA 4K5CA 3ZEFA 2A5EA 1Y6IA 4HRLA 3VLFA 3FEYA 3GZSA 1WDYA 3ESKA 2AVPA 3LXUX 4G24A 2Y1LE 3ASHA 2FF4A 4CZ2D 2MRIA 1H2UA 3L6AA 3FU0A 1JCRA 2KCVA 2AXVA 3NQPA 4WNGA 2EINE 5C1DA 2LUHA 4WWOA 1LTXA 3ZNGA 3EUVA 5EYLA 4XEIG 3KD7A 2ETAA 3D9JA 5CEDB 4XI0A 3FH7A 3FFLA 2F8XK 5D2MC 4I2WA 5ENNA 2OEWA 4J8DA 1IXVA 3FTXA 4FHKA 2IU1A 3VTYA 1UN9A 4ILHB 2VSNA 1JWGA 4GMJA
chains in the Genus database with same CATH topology
1HFAA 2WXKA 3EIJA 3U64A 2XQ0A 5BT1A 4EQFA 4AP2A 3T5VA 1HZ4A 3CK8A 4L23A 4KVOA 3CVUA 2XGOA 4DJAA 3S7BA 3FUKA 2VGXB 4WUYA 5G05C 2I1KA 2PM6A 1HX8A 4RSYA 5JJ7A 2KCLA 4J8FA 1IHGA 3CVYA 4EZKA 5FZRA 2WXPA 5AJLA 2GRLA 1QNFA 4FLHA 5FZQA 5AIJA 5BUZA 4E85A 3PNLB 3CIAA 4B94A 4HOSA 2IJGX 1NA0A 4HXIA 1QZ2A 5LX8A 3OAWA 4L2LA 3D3MA 2DIWA 4XZ4A 3CQGB 4OVUA 3ZYMA 4A1SA 4F7AA 3CVWA 4I1MA 3HIZA 2QY7A 5FTPA 1WY6A 3MX3A 3R9AB 1E8WA 3QDNA 5G04J 1H6KA 2XRZA 3SBTB 3O48A 3RU0A 3IBEA 4EZLA 3OXFA 3MV2B 3FEXA 1MHQA 5KJNA 3LVQE 3ZHEB 1A17A 1HG2A 3D9OA 4C0EA 4UWHA 2FO7A 3FUMA 3EDTB 2JLBA 5DBKA 4N2QA 3CVXA 3IHYA 2XGSA 2I1JA 4FULA 4AIFA 4MLPA 3GW4A 5CHEE 2PQRA 2X6JA 4G25A 2GRMA 3FUHA 3N71A 3ONLA 3ZVVA 5FQ4A 4JEHA 3MV3B 1SQMA 4AM9A 4UWKA 3P2BA 3APFA 3HHMA 1W3BA 3P1UA 4MRUA 2E0IA 3JCKC 3ZPJA 3UT7A 5CCMA 5JHBA 3SD5A 1PY1A 3D9NA 1HE8A 4JHKA 2PQNA 4N3BA 4GMLA 4FADA 2YHCA 4W9RA 3K9IA 5FQ7A 3LY8A 3L22A 2L0TB 3HYMB 4BWRA 4I2ZA 4J6IA 2ZU6B 3ZXSA 1XGWA 2KZTA 1OWNA 2FBNA 2XHEA 4GA0A 4I43A 4FLBA 3SF4A 1TJCA 4BT8A 3QWPA 3LDZA 2J49A 3CR3A 3MJWA 2WQ6A 5ANLA 1E7VA 3FUEA 3RO2A 1L5JA 3CK7A 2OVBA 3RJVA 2CFUA 2R5SA 3PNTB 2L9BA 3MCXA 3SI5A 3LPZA 4J0UA 3ZFWA 3IV0A 3CSTA 4ANUA 3QC1A 2CG2A 3DBSA 3NF1A 1OWOA 4U0SA 4TRQA 4GA2A 3SZ7A 3SFZA 3PH0C 4JL0A 1U3DA 1ELWA 3FU5A 3I3NA 2AW6A 5AJDA 4KBQA 1Z6TA 2ONDA 4DI3A 2KM4A 2YQ8A 4LEUA 3LY7A 3JQ1A 3RRNB 2VSYA 3PE4A 3SBSA 2KC7A 2VSOE 1Z3XA 4N5CA 4Y6CA 4CDRA 2CHZA 5LFAA 3LS8A 2VJ8A 3DPDA 2VSXE 4CT0A 3D9PA 2WXOA 3R7RA 1EPUA 1GW6A 4JC8A 2WMOA 3LJ3A 1QQEA 3ZYKA 4F53A 1B89A 1HO8A 5M72A 4AY6A 4PUCA 3MEKA 4M3OA 2C0MA 4XKCA 3U4TA 2QFCA 3GYZA 3B7SA 3Q5MA 4NURA 2WXGA 4GU5A 1KLXA 3HDXA 4RVBA 4G23A 1XNFA 2V8SE 5D0OD 3D9LA 4GCOA 1E90A 3ZYLA 4ACLA 3CEQA 3APDA 4WWNA 3SNXA 4Q69A 4TV3A 4HOUA 3TG5A 3FTWA 2RD0A 4AEZC 4EZJA 1JWFA 2Y4UA 4A1GA 1MQSA 3B13A 4IN3B 4Q94A 5C2YA 3FULA 2DBAA 3G2WA 1N52A 4JA7A 4CEMA 3TGOA 2WB2A 4I6GA 4BT9A 4APFA 3FUNA 3FDHA 5BV0A 2UY1A 3RRMB 3Q49B 3L13A 4WNDA 4BX8A 3LVRE 3OTNA 4EPZA 2M63A 4PDXA 4AJWA 3T5XA 2LSUA 3TXMA 5FQ6A 2X6FA 4PS3A 3CVPA 4U0ZA 4AOFA 5T3RA 3B7RL 2EQXA 4NQ0A 5FQ8A 4GMJA 5FT9A 1LF8A 3SHFA 3TXNA 4RG9A 1JUQA 2X38A 2WQ7A 4K03A 3UT4A 1E7UA 2J9QA 4GYYA 3FH8A 3FUJA 3JQ0A 4P29A 3RKVA 4B0ZA 3UX4A 1KT1A 4ACKA 3ZW3A 1H0AA 2X6KA 4B89A 2LAIA 4DI4A 2WXFA 5E76A 5EDSA 3C98A 4H7YA 4CRWA 2HO1A 4XI9A 5LCWJ 3CKBA 2V5FA 2BF0X 3PE3A 4FC8A 2WXHA 3FU3A 4N39A 2AWIA 1INZA 2A5UA 3EHMA 4D10C 1FVFA 2LNIA 3BEEA 4I1OB 4U0UA 2XGMA 4J8SA 4PS7A 2R59A 1DNPA 1TJFA 3ASFA 4HOQA 4GYOA 3HVEA 4HVBA 3EHNA 1H19A 1OWPA 3ONKA 1EF1C 4JA9A 2MOWA 3L17A 4BTBA 2V4LA 5JHAA 1UW4B 2GGFA 3APCA 3RK6A 4XE0A 3D9MA 2FULA 2VQ2A 3QOUA 2C2LA 4G26A 4KVMA 2IOLA 3AS8A 4BY6A 3I4GA 2XPIA 5G04C 3CHSA 5KJLA 4FJZA 4CGVA 2UWJG 1FVHA 3JYSA 3RO3A 3AS4A 4J8EA 3CV0A 3IKOB 3MKRA 4HFGA 4UI9J 4AY5A 3T8MA 2WXIA 3QJZA 4GAAA 5J90A 4DLOA 2I2OA 4CCAA 2C0LA 4UWGA 4BFRA 1HF8A 3CVQA 4DLQA 3PVLA 3ENEA 1WAO1 2UY1B 5EKQD 1PC2A 1E8XA 2BTDA 4OYSA 4U8HA 3NZUA 1ELRA 4NACA 3OXGA 2LSVA 2X6IA 5BW8C 2DCPA 2FEZA 5BPPA 4E6HA 5A23A 4AXHA 3EIQC 3NZSA 2CG3A 3CSFA 4UQYA 3GZ1A 2WXQA 3PRZA 5CMWA 5ARFA 2IOSA 3CLJA 3FP3A 3KEZA 4V3IA 2I9CA 3KAEA 4ATGA 3EJNA 4C9BB 2Y4TA 2WMNA 2MHKA 3URZA 3ML8A 4MKTA 4XKBA 5ARGA 5AENA 4FP7A 3ASDA 3ASGA 5G2NA 2PM7A 4CDNA 2IF4A 4OVVA 5D0QD 2NXPA 2WQHA 2IQCA 2R17C 3G2VA 3D9KA 3CGHA 2LO6A 1P5QA 4LCTA 3FUIA 4URKA 3PS6A 4LERA 4U63A 3Q15A 5HI7A 5KJMA 3TAXA 5A6CA 5E75A 4F3VA 4LRZA 3MZLB 1ZBPA 1Y8MA 2WPVA 3FTVA 4JXTA 1N54A 1PAQA 3MKQA 3HVEB 3I4RB 4R7LA 2PL2A 4GB9A 1OUVA 2ILRA 3CVVA 3GZ2A 4ANVA 2VTBA 3ZYQA 4CGWA 3MYVA 3CVLA 4XIFA 4PS8A 2WM9A 3ZHEA 3LKUA 2L6JA 3FTSA 5ANRA 5T4YA 5CMYA 2NC9A 1H2VC 3VLEA 3WXXA 1NP7A 1H2TC 4EBAG 2WXMA 1E96B 3LCAA 4L1BA 3I5PA 4KZCA 1OWLA 1EDUA 4UWFA 3BG0B 4WNFA 5G05J 4O6FA 3L08A 3B7TA 4APOA 2KATA 3AU5A 2WXNA 2KZTB 1ELKA 3VLDA 4A55A 2AXUA 2FI7A 4H7XA 3CVNA 3KS2A 4QFVA 4I1AA 2J4DA 4L7TA 4N3CA 4JHJA 4EECA 3QAQA 3SGHA 1ZU2A 2WVIA 1NA3A 3QWVA 3FUDA 4WAFA 4KYOB 4JVSA 3O4ZA 4ME2A 5FWQA 5KJKA 5G55A 3S2AA 4GPKA 3S7JA 1Z3YA 3PDNA 4I6EA 1BPOA 4WNEA 3U9WA 3LYAA 3FTUA 4I6JA 1X5BA 3LY9A 4ABNA 4NRHB 4GZ3A 1UJKA 2J4BA 2VGYA 3AS5A 4JEUA 4B8CB 5BV1A 3ML9A 4IULA 4JZYA 4YVOA 5FZSA 5LOZA 2CFZA 4KXKB 2E2EA 1HS6A 3R7QA 3UT8A 1HU3A 3E4BA 4WWPA 1UN8A 2IONA 5HQ8A 2V0PA 3B7UX 5T8IA 2AXZA 4A3TA 3CHPA 4ANWA 3PZDA 4ILGA 4A3VA 3FY4A 3MKQB 2XPZA 2CHXA 5AYWD 5A7DB 3LEWA 4AVXA 4GCNA 4N3AA 5J08A 1EYHA 5JJTA 3ZIMA 2VTBB 1HH8A 2GW1A 3U3WA 2J09A 4HOTA 4B8AA 4KZ0A 4RG6A 4DPRA 4FHJA 3L16A 3FTYA 3FUFA 4L2YA 3RIBA 5BNWA 2HYZA 5LP0A 4FU3A 4I9EA 4PH4B 2HM8A 4YNDA 1TEZA 3JUIA 2A4ZA 3PEUB 2CHWA 1KT0A 3MGBA 3QKYA 4GYWA 2OVFA 1UJJA 4G1TA 5LCWC 4KT6B 3G2UA 3IEGA 2I6HA 3FU6A 3L54A 4CDMA 4U04A 3UUXA 4GZ6A 4Y6WA 3QNKA 4I9CA 5KCMA 4K0RA 1SZAA 2XCCA 5DIZA 2Y3AA 4HORA 3FHEA 2J07A 3UMVA 4F1SA 4HS2A 3ZRHA 2XEVA 1UG3A 3U66A 1U3CA 2XRYA 3CQCB 4IYPA 3RRUA 3CK9A 4GA1A 5EX3A 4EBAA 1IQUA 2OOEA 1FCHA 4ILIA 1E8ZA 1S0PA 3PUKA 3AU4A 1IQRA 2BUGA 3ZEFA 4HLEA 2KCKA 3QARA 4I17A 3CHQA 1Y6IA 4UQXA 4UI9C 3S7FA 2XCBA 2OV8A 2XPYA 3QWWA 4JHRA 2X3MA 2VGXA 1JPLA 3VLFA 3FEYA 3GZSA 4TUUA 4FJYA 1HG5A 1NZNA 3CHOA 1VDYA 3CHMA 5EX0A 3ESKA 3TG4A 2P58C 4IRUA 3MA5A 3PUJA 3BG1B 2AVPA 3LXUX 2VYIA 2WXJA 4BSXA 4G24A 4G2VA 3ASHA 2IFUA 2FF4A 4UQZA 4GZ5A 4FA6A 4AV7A 2WXRA 2RG8A 2WXLA 2MRIA 1H2UA 4YVQC 3PREA 2YINA 2Q7FA 3FTZA 3L6AA 3TJPA 3FU0A 3G2TA 5JJ6A 2HR2A 2KCVA 3UPVA 2YNQA 3OXLA 1HXIA 2AXVA 3NQPA 4UI9K 4WNGA 5C1DA 3CHRA 4WWOA 3TL5A 3Q47B 4U07A 1YA0A 2X6HA 4LUNU 4DK5A 3UQ3A 3S7DA 3PEVB 2L0IA 3KD7A 4N2SA 3D9JA 3D9IA 4XI0A 4XX5A 4CT4A 4GZCA 1SZ9A 3FH7A 2LAHA 3FFLA 4KMOA 4UWLA 3VTXA 2J08A 4BTAA 4ANXA 3ZN3A 2YHEA 3ESLA 4GZDA 3FWVA 4Q96A 3FH5A 4G11A 4I2WA 5ENNA 3ULQA 4J8DA 3CKCA 3Q4AB 4MS6A 4BX9A 2JEKA 3FTXA 5FJYA 4JPSA 5CCLA 1E8YA 4C0MA 4FHKA 2IU1A 3QB2A 3VTYA 1IYGA 3IHVA 2NSZA 4JW1A 1UN9A 4ILHB 3ZGQA 2VSNA 1JWGA 3QK0A 1OWMA 1DVPA 1WM5A 3G2SA 2PZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT1 A;  4EQF A;  1HZ4 A;  3CK8 A;  2XGO A;  3S7B A;  2VGX B;  4WUY A;  5G05 C;  5JJ7 A;  2KCL A;  4J8F A;  1IHG A;  5FZR A;  5FZQ A;  4HOS A;  4B94 A;  1NA0 A;  1QZ2 A;  4A1S A;  5FTP A;  3R9A B;  3QDN A;  5G04 J;  3O48 A;  3RU0 A;  3OXF A;  3MV2 B;  5KJN A;  3ZHE B;  1A17 A;  2FO7 A;  3EDT B;  2JLB A;  5DBK A;  4N2Q A;  2XGS A;  4AIF A;  3GW4 A;  5CHE E;  2PQR A;  4G25 A;  3N71 A;  3MV3 B;  4AM9 A;  1W3B A;  3ZPJ A;  5CCM A;  4N3B A;  2PQN A;  2YHC A;  4W9R A;  3K9I A;  3LY8 A;  3HYM B;  4BWR A;  4I2Z A;  4GA0 A;  2FBN A;  3SF4 A;  4BT8 A;  1TJC A;  3QWP A;  3RO2 A;  3CK7 A;  3RJV A;  2R5S A;  3LPZ A;  4J0U A;  3ZFW A;  3NF1 A;  4U0S A;  4GA2 A;  3SZ7 A;  4JL0 A;  1ELW A;  4KBQ A;  2OND A;  2YQ8 A;  4LEU A;  3LY7 A;  2VSY A;  3PE4 A;  2KC7 A;  4N5C A;  4Y6C A;  4CDR A;  1QQE A;  1B89 A;  5M72 A;  4AY6 A;  3MEK A;  2C0M A;  3U4T A;  2QFC A;  3GYZ A;  3Q5M A;  1KLX A;  4G23 A;  1XNF A;  5D0O D;  4GCO A;  3CEQ A;  4HOU A;  3TG5 A;  2Y4U A;  4IN3 B;  2DBA A;  4JA7 A;  3TGO A;  4BT9 A;  2UY1 A;  3Q49 B;  4WND A;  2LSU A;  3CVP A;  4U0Z A;  4NQ0 A;  5FT9 A;  4RG9 A;  2J9Q A;  4GYY A;  3RKV A;  1KT1 A;  4H7Y A;  2HO1 A;  4XI9 A;  5LCW J;  3CKB A;  2V5F A;  3PE3 A;  4N39 A;  2LNI A;  3BEE A;  4U0U A;  2XGM A;  4HOQ A;  3ASF A;  4GYO A;  4JA9 A;  4BTB A;  2VQ2 A;  3QOU A;  2C2L A;  4G26 A;  3AS8 A;  2XPI A;  5G04 C;  5KJL A;  4CGV A;  2UWJ G;  3JYS A;  3RO3 A;  3AS4 A;  4J8E A;  3CV0 A;  4UI9 J;  3MKR A;  4AY5 A;  2C0L A;  3CVQ A;  1WAO 1;  2UY1 B;  5EKQ D;  1PC2 A;  1ELR A;  3OXG A;  5BW8 C;  2LSV A;  2FEZ A;  4UQY A;  3GZ1 A;  5ARF A;  3FP3 A;  3KAE A;  2Y4T A;  2MHK A;  3URZ A;  5ARG A;  3ASD A;  3ASG A;  2IF4 A;  5D0Q D;  2WQH A;  1P5Q A;  3Q15 A;  5HI7 A;  5KJM A;  3TAX A;  5A6C A;  4F3V A;  1ZBP A;  1Y8M A;  2WPV A;  2PL2 A;  1OUV A;  3GZ2 A;  4CGW A;  3CVL A;  4XIF A;  3ZHE A;  3LKU A;  2L6J A;  2NC9 A;  3WXX A;  3LCA A;  1E96 B;  5G05 J;  4WNF A;  4O6F A;  4APO A;  2KAT A;  2FI7 A;  4H7X A;  3CVN A;  3KS2 A;  4I1A A;  4N3C A;  1ZU2 A;  1NA3 A;  3QWV A;  4KYO B;  4ME2 A;  5KJK A;  4GPK A;  3S7J A;  3PDN A;  4WNE A;  3LYA A;  3LY9 A;  4ABN A;  4NRH B;  4GZ3 A;  3AS5 A;  2VGY A;  4YVO A;  5FZS A;  4KXK B;  2E2E A;  3E4B A;  5HQ8 A;  5AYW D;  5A7D B;  4GCN A;  4N3A A;  5JJT A;  1HH8 A;  2GW1 A;  3U3W A;  4HOT A;  4RG6 A;  3RIB A;  5BNW A;  2HYZ A;  4I9E A;  4YND A;  1KT0 A;  4GYW A;  3QKY A;  5LCW C;  4G1T A;  3IEG A;  2I6H A;  4U04 A;  3UUX A;  4GZ6 A;  4Y6W A;  4I9C A;  2XCC A;  5DIZ A;  4HOR A;  2XEV A;  3CK9 A;  4GA1 A;  5EX3 A;  2OOE A;  1FCH A;  2BUG A;  2KCK A;  4I17 A;  4UQX A;  4UI9 C;  3S7F A;  2XCB A;  3QWW A;  4JHR A;  2VGX A;  1NZN A;  5EX0 A;  3ESK A;  3TG4 A;  2P58 C;  3MA5 A;  2AVP A;  2VYI A;  4G24 A;  4G2V A;  3ASH A;  2IFU A;  2FF4 A;  4UQZ A;  4GZ5 A;  4YVQ C;  2Q7F A;  5JJ6 A;  2HR2 A;  2KCV A;  3UPV A;  3OXL A;  1HXI A;  4UI9 K;  4WNG A;  5C1D A;  3Q47 B;  4U07 A;  1YA0 A;  3UQ3 A;  3S7D A;  3KD7 A;  4N2S A;  4XI0 A;  3FFL A;  3VTX A;  4BTA A;  3ZN3 A;  3FWV A;  4I2W A;  3ULQ A;  4J8D A;  3CKC A;  3Q4A B;  5FJY A;  5CCL A;  3VTY A;  1IYG A;  3ZGQ A;  2VSN A;  1WM5 A;  2PZI A; 
#chains in the Genus database with same CATH topology
 1HFA A;  3HRA A;  2XQ0 A;  5BT1 A;  3T5V A;  3CK8 A;  4L23 A;  4KVO A;  2XGO A;  1OCC E;  2VGX B;  5G05 C;  2PM6 A;  1N9A A;  5FZR A;  4EZK A;  3ZKJ A;  1QNF A;  4LNG A;  3PNL B;  3ZU7 B;  1QZ2 A;  4F7A A;  4I1M A;  3R9A B;  1WY6 A;  2GRN B;  5ENT D;  5KJN A;  1K3Z D;  3D9O A;  4C0E A;  3FUM A;  4NIK A;  4MLP A;  3LJN A;  3UI2 A;  3FUH A;  1V54 E;  2XS8 A;  1BLX B;  4AM9 A;  1V55 E;  3P2B A;  1MX6 A;  3APF A;  2QZA A;  3HHM A;  1W3B A;  5CCM A;  1PY1 A;  4N3B A;  4FAD A;  2PQN A;  4W9R A;  3K9I A;  3JUE A;  2L0T B;  3HYM B;  4GTO A;  2F0Y A;  4K5A B;  2ZU6 B;  2XHE A;  3SF4 A;  3LDZ A;  1N0Q A;  2J49 A;  3CR3 A;  3MJW A;  2WQ6 A;  1N4R A;  5ANL A;  3FUE A;  4GTQ A;  2OVB A;  2CFU A;  2R5S A;  2PNN A;  4J0U A;  4U0S A;  1OXJ A;  3FU5 A;  5AJD A;  1Z6T A;  4LEU A;  2R05 A;  3SBS A;  2EIM E;  3LS8 A;  4DX2 A;  2VJ8 A;  2VSX E;  4JB8 P;  3R7R A;  1EPU A;  3LJ3 A;  5M72 A;  3MEK A;  4M3O A;  2C0M A;  4XKC A;  3U4T A;  3C72 A;  1ZB1 A;  3HDX A;  2ZIR A;  1XNF A;  4GCO A;  3AG4 E;  4ACL A;  3SNX A;  4WWN A;  4Q69 A;  2P9P G;  2RD0 A;  4AEZ C;  4G8L A;  2XS1 A;  5C2Y A;  1KZP A;  1N52 A;  4APF A;  3Q49 B;  3L13 A;  4WND A;  4BEP A;  2LXM A;  3OTN A;  4PS3 A;  4U0Z A;  2EQX A;  3TXN A;  5JMN D;  3JQ0 A;  3UX4 A;  3W9G A;  4YDE A;  4H7Y A;  3CKB A;  3PZ1 A;  5AQ9 A;  4N39 A;  2A5U A;  3EHM A;  4I1O B;  4J8S A;  3T9K A;  4HVB A;  4JA9 A;  3UXG A;  3DXK G;  3L17 A;  4BTB A;  2IY0 C;  5JHA A;  1UW4 B;  3APC A;  3CHS A;  1FVH A;  3E37 A;  3RO3 A;  2ZXW E;  4J8E A;  3IKO B;  2Y69 E;  3QJZ A;  1TNY A;  4CCA A;  4UWG A;  4BFR A;  4DLQ A;  3PVL A;  3Q78 A;  5BW8 C;  2X6I A;  3TWX A;  2DCP A;  5BPP A;  5A23 A;  2CG3 A;  3CSF A;  2BED A;  3DPY A;  2IOS A;  3KEZ A;  4ATG A;  5CRV A;  5ITZ F;  3V30 A;  3URZ A;  5AEN A;  4XKB A;  5ARG A;  4FP7 A;  4HBD A;  5G2N A;  2PM7 A;  5AN8 A;  2NXP A;  3G2V A;  2R17 C;  5KJM A;  5E75 A;  2XZT G;  1Y8M A;  1N54 A;  1PAQ A;  3BUA A;  4GB9 A;  3DEP A;  3TWS A;  3CVL A;  2NC9 A;  1OCZ E;  1TR4 A;  2QYU A;  1H2T C;  4TXP A;  3C3R A;  3BG0 B;  5G05 J;  4JD2 G;  4A55 A;  3KS2 A;  4QFV A;  1LD7 A;  2J4D A;  4N3C A;  3ISM C;  4JHJ A;  3PZ3 A;  4ZFH A;  1ZU2 A;  1NA3 A;  3QWV A;  5KNG A;  4JVS A;  4GPK A;  1Z3Y A;  3LYA A;  3LY9 A;  4NRH B;  4GTS A;  4DUI A;  4JEU A;  5ENQ D;  4JZY A;  5CBO A;  2P9L G;  3AG3 E;  2V0P A;  4A3T A;  3PZD A;  4HQD A;  1EYH A;  3ZIM A;  2VTB B;  4HOT A;  3B7B A;  4KZ0 A;  4RG6 A;  4K5B A;  4L2Y A;  5BNW A;  4FU3 A;  4I9E A;  3DEO A;  2CHW A;  1KT0 A;  1FT2 A;  3D9H A;  2I6H A;  4O1P A;  4U04 A;  4I9C A;  4HOR A;  3FHE A;  3SFX A;  4HS2 A;  2XEV A;  1UG3 A;  1U3C A;  4IYP A;  5EX3 A;  3UM1 A;  3PUK A;  2P9U G;  3AU4 A;  2BUG A;  2KCK A;  3QAR A;  3CHQ A;  4UQX A;  3KEA A;  2OV8 A;  2XPY A;  1VDY A;  5EX0 A;  2IFU A;  4UQZ A;  4FA6 A;  2WXR A;  2WXL A;  5H7P A;  4YVQ C;  4B93 B;  3C5R A;  2YIN A;  2Q7F A;  3PRE A;  3G2T A;  1Z5S C;  2YNQ A;  3Q47 B;  3JXJ A;  1YA0 A;  2X6H A;  3UQ3 A;  3S7D A;  1KPS B;  4N2S A;  3D9I A;  4XX5 A;  4CT4 A;  4GZC A;  1SZ9 A;  4J8Y A;  4BTA A;  2YHE A;  4GZD A;  1H6O A;  4Q96 A;  4G11 A;  3UM3 A;  3CKC A;  2DZO A;  5FJY A;  1TNB A;  5CCL A;  1E8Y A;  4C0M A;  1IYG A;  2KBX A;  1WM5 A;  1TEZ A;  2PZI A;  3EIJ A;  3Q9N C;  4AP2 A;  5JA4 D;  3FUK A;  4RSY A;  1HX8 A;  2KCL A;  3DSV A;  1IHG A;  5AJL A;  4GTT A;  4FLH A;  4GTM A;  4HXI A;  1IKN D;  3OAW A;  4L2L A;  1K1A A;  3QDN A;  1H6K A;  2XRZ A;  3SBT B;  3O48 A;  4EZL A;  5FIO A;  3MV2 B;  1MHQ A;  3X2Q E;  2BKG A;  3LVQ E;  4UWH A;  2FO7 A;  4N2Q A;  2P9S G;  4FUL A;  4AIF A;  5CHE E;  2PQR A;  5CEA A;  3ONL A;  3ZVV A;  5FQ4 A;  3IXE A;  3MV3 B;  2RFM A;  1LD8 A;  1O5M A;  4MRU A;  2E0I A;  4O60 A;  4JHK A;  1HE8 A;  3L22 A;  3ZXS A;  4GA0 A;  1OWN A;  3BU8 A;  4BT8 A;  1TJC A;  1E7V A;  3RO2 A;  1SA4 A;  3PNT B;  2L9B A;  3MCX A;  1X81 A;  3KSL A;  3SI5 A;  3ZFW A;  4DX5 D;  3IV0 A;  5AQB A;  4MBG A;  3UM2 A;  4TRQ A;  1ELW A;  3I3N A;  2AW6 A;  4KBQ A;  5CEC B;  5CBN A;  3V2O A;  3JQ1 A;  3RRN B;  2VSY A;  3PE4 A;  2XEE A;  5ENO D;  1OY3 D;  1Q2Z A;  3D9P A;  4JC8 A;  2EIK E;  4AY6 A;  2H6H A;  4N5Q A;  4RVB A;  5EYP F;  1KLX A;  5D0O D;  1E90 A;  3ZYL A;  3TG5 A;  3FTW A;  3NB2 A;  3JXI A;  2Y4U A;  3UIN C;  1MQS A;  4IN3 B;  4Q94 A;  3G2W A;  1N4P A;  5AAO A;  4CEM A;  3TGO A;  2WB2 A;  4BT9 A;  5BV0 A;  5EID A;  4BX8 A;  3LVR E;  3T5X A;  2LSU A;  3TXM A;  5AAR A;  3CVP A;  4NQ0 A;  1OT8 A;  1LF8 A;  1SVX A;  3SHF A;  5HRY A;  2X38 A;  2WQ7 A;  3UT4 A;  4GYY A;  3FUJ A;  4B0Z A;  1KT1 A;  3AAA C;  4B89 A;  5E76 A;  3T8K A;  2V5F A;  4HB5 A;  2BF0 X;  3PE3 A;  4FC8 A;  3FU3 A;  4D10 C;  1FVF A;  4U0U A;  3BEE A;  4GTP A;  1DNP A;  4HOQ A;  3ASF A;  1EF1 C;  3DSU A;  2GGF A;  3RK6 A;  4XE0 A;  1QYM A;  2DZN A;  2C2L A;  2P9N G;  3CV0 A;  4AY5 A;  1BI8 B;  3T8M A;  2WXI A;  2XEH A;  3L9T A;  3UKU G;  3ENE A;  1WAO 1;  2UY1 B;  5EKQ D;  4U8H A;  4RLY A;  2LSV A;  4HI8 A;  4E6H A;  3EIQ C;  3NZS A;  2DYR E;  5B1A E;  3FP3 A;  3EJN A;  2WMN A;  2IF4 A;  4OVV A;  5D0Q D;  4C48 B;  2LO6 A;  3FUI A;  4URK A;  5HI7 A;  2VGE A;  2H6I A;  2WPV A;  1UOH A;  3UIP C;  2ETB A;  3MKQ A;  3HVE B;  3I4R B;  1OUV A;  3SY2 A;  4GPM A;  2WM9 A;  2L6J A;  5T4Y A;  4F6R D;  5CMY A;  4DX7 D;  3VLE A;  2V4H C;  4L1B A;  4KZC A;  4WNF A;  4O6F A;  4APO A;  2KAT A;  3AU5 A;  2J8S D;  1ELK A;  3CVN A;  4EEC A;  3SGH A;  2WVI A;  5FWQ A;  5KJK A;  3PDN A;  1BPO A;  3U9W A;  3FTU A;  4GZ3 A;  1UJK A;  4B8C B;  3NOG D;  4YVO A;  5FZS A;  4KXK B;  1NI1 A;  2E2E A;  3BQO A;  4ZHB A;  3UT8 A;  1UN8 A;  4LNU D;  2EIL E;  2F37 A;  3CHP A;  4ANW A;  4ILG A;  4AVX A;  2MYO A;  2GRO B;  1HH8 A;  2GW1 A;  3U3W A;  2J09 A;  4FHJ A;  3FTY A;  3FUF A;  1TNU A;  3SFY A;  3JUI A;  3NAW A;  4GYW A;  3MGB A;  2V5Q C;  5LCW C;  4KT6 B;  3AJI A;  1AWC B;  3UUX A;  4GZ6 A;  3QNK A;  4HRM B;  5DIZ A;  1N4S A;  3RSE G;  2QYJ A;  3CK9 A;  5AQA A;  1IQU A;  2RKK A;  4I17 A;  2XEN A;  4UI9 C;  3S7F A;  2XCB A;  2VGX A;  1HG5 A;  1NZN A;  3TG4 A;  2P58 C;  4IRU A;  2DWZ A;  3MA5 A;  3BG1 B;  1TYQ G;  2VYI A;  4BSX A;  5B3S E;  3DWL G;  2EIJ E;  4AV7 A;  3FTZ A;  3OXL A;  4UI9 K;  3CHR A;  3RAU A;  2ETC A;  4DK5 A;  2B0O E;  2L0I A;  3PEV B;  5CRU A;  1N11 A;  2AJA A;  2LAH A;  4KMO A;  4UWL A;  2KXP C;  3VTX A;  2J08 A;  2F8Y A;  4ANX A;  3ZN3 A;  4GTR A;  3FWV A;  5ENS D;  4MS6 A;  4BX9 A;  2JEK A;  3W9F A;  4LNB A;  3QB2 A;  3IHV A;  1A5E A;  2DYS E;  1OWM A;  4LUN U;  3G2S A;  4U63 A;  3Q75 A;  3U64 A;  4EQF A;  4WUY A;  2I1K A;  3CVY A;  3ZUV B;  2GRL A;  5AIJ A;  5FZQ A;  5BUZ A;  3CIA A;  4HOS A;  1NA0 A;  1OCR E;  3CQG B;  4A1S A;  3HIZ A;  2QY7 A;  3SO8 A;  3RU0 A;  3IBE A;  2ZIS A;  3FEX A;  4HNA D;  1YCS B;  2XGS A;  1DCQ A;  2I1J A;  3GW4 A;  2X6J A;  2GRM A;  3N71 A;  3EU5 A;  3SQV A;  2DVW A;  4JEH A;  4UWK A;  1S70 B;  3P1U A;  3ZPJ A;  3JCK C;  3UT7 A;  2IO3 C;  3SD5 A;  5EN5 D;  3D9N A;  4M7C A;  1S64 A;  3LY8 A;  1IHB A;  1TN8 A;  1U2V G;  1D8D A;  4I43 A;  3HXF A;  1BU9 A;  5ENP D;  1L5J A;  3CK7 A;  3RJV A;  3LPZ A;  1FT1 A;  2CG2 A;  3DBS A;  3NF1 A;  3SZ7 A;  3PH0 C;  4JL0 A;  1U3D A;  2YQ8 A;  3LY7 A;  1Z3X A;  4N5C A;  2P9K G;  4Y6C A;  2CHZ A;  3DPD A;  1GW6 A;  5HS0 A;  1B89 A;  4PUC A;  1H6P A;  3B7S A;  1G3N B;  4NUR A;  2WXG A;  3ULE G;  4GU5 A;  1NFI E;  4G23 A;  2V8S E;  4TXR A;  3CEQ A;  3R9M A;  2R2L A;  4DX6 D;  4EZJ A;  1JWF A;  4A1G A;  3WG7 E;  3B13 A;  3PZ4 A;  3Q79 A;  3TWW A;  4DRX E;  4I6G A;  3FDH A;  1RZ4 A;  5ENR D;  5CER B;  3DSX A;  4AOF A;  3B7R L;  4TXQ A;  3TWR A;  3Q73 A;  4O1O A;  3ABL E;  1E7U A;  3FH8 A;  4P29 A;  2X6K A;  4DI4 A;  2WXF A;  5EDS A;  2HO1 A;  4XI9 A;  5LCW J;  1N95 A;  2AWI A;  1MZC A;  2LNI A;  2XGM A;  2OCC E;  2R59 A;  1TJF A;  4GYO A;  3EHN A;  1OWP A;  2MOW A;  3D9M A;  5HKP A;  3E32 A;  2VQ2 A;  2R02 A;  3AS8 A;  1DCE A;  2XPI A;  5G04 C;  5KJL A;  3Q9U C;  2HE0 A;  4UI9 J;  4HFG A;  4GAA A;  5J90 A;  1HF8 A;  1PC2 A;  1E8X A;  1ELR A;  2FEZ A;  4UQY A;  3GZ1 A;  3ABK E;  3PRZ A;  4DX1 A;  3HG0 D;  3CLJ A;  4LSZ E;  3EHQ A;  2Y4T A;  2ZGG A;  4MKT A;  3DSS A;  3ASD A;  3ASG A;  3HXC A;  4CDN A;  2IQC A;  2OEV A;  1K8K G;  3CGH A;  1P5Q A;  3PS6 A;  3J5P A;  4F3V A;  4LRZ A;  3MZL B;  5KNH D;  4JXT A;  4R7L A;  2P9I G;  3GZ2 A;  4ANV A;  2VTB A;  3ZYQ A;  4CGW A;  3MYV A;  4XIF A;  5BXO A;  3FTS A;  2GRQ B;  5ANR A;  1H2V C;  4BER A;  4YDW A;  5EIB E;  4U96 D;  4EBA G;  2WXM A;  1E96 B;  3LCA A;  3I5P A;  1OWL A;  1EDU A;  4UWF A;  4HRN A;  3L08 A;  2L6B A;  2KZT B;  3VLD A;  2AXU A;  4H7X A;  3ABM E;  4HI9 A;  4I1A A;  4L7T A;  3QAQ A;  3Q7A A;  4J7W A;  4WAF A;  4ME2 A;  5G55 A;  3S2A A;  3S7J A;  2FO1 E;  1X5B A;  5EIL A;  3DRA A;  3UIO C;  2J4B A;  5BV1 A;  2CFZ A;  1HS6 A;  3R7Q A;  3E4B A;  2GRR B;  2ION A;  3B7U X;  5T8I A;  3UTM A;  5IY5 E;  2AXZ A;  4A3V A;  3FY4 A;  2XPZ A;  2CHX A;  5FIN A;  5A7D B;  1BI7 B;  3LEW A;  1N94 A;  4GCN A;  4N3A A;  5J08 A;  1TNZ A;  3HXE A;  5LP0 A;  4PH4 B;  2HM8 A;  1N0R A;  2A4Z A;  3PEU B;  1UJJ A;  4G1T A;  3IEG A;  3L54 A;  4CDM A;  4Y6W A;  5KCM A;  1SZA A;  2XCC A;  4BSZ B;  4HLL A;  2QC9 A;  3ZRH A;  3Q7F A;  3RRU A;  4GA1 A;  4EBA A;  2OOE A;  3B95 A;  1E8Z A;  1S0P A;  4HLE A;  2B6C A;  3QWW A;  4JHR A;  2X3M A;  2P2C P;  1JPL A;  3F6Q A;  1S63 A;  4TUU A;  4FJY A;  3CHO A;  3CHM A;  3PUJ A;  1QBQ A;  2WXJ A;  4G2V A;  3TWV A;  4GZ5 A;  4YDY A;  2RG8 A;  3TJP A;  4RQI A;  1BD8 A;  4BET A;  5JJ6 A;  4U8V D;  2HR2 A;  3UPV A;  1HXI A;  3TL5 A;  4U07 A;  1SA5 A;  3ESL A;  3FH5 A;  3ULQ A;  2GRP B;  3Q4A B;  3TWT A;  4JPS A;  1DC2 A;  3EU9 A;  2NSZ A;  4JW1 A;  3ZGQ A;  3NBN B;  1NL4 A;  3QK0 A;  1DVP A;  2WXK A;  5B1B E;  1O1R A;  1HZ4 A;  3CVU A;  4G8K A;  4DJA A;  3S7B A;  1D9S A;  2RFA A;  5KBA A;  4GMR A;  1WG0 A;  4J8F A;  5JJ7 A;  2WXP A;  4E85 A;  4B94 A;  3ZXP A;  2IJG X;  4U7E B;  5LX8 A;  2H6G A;  3D3M A;  2DIW A;  4XZ4 A;  4OVU A;  3ZYM A;  3CVW A;  5FTP A;  3MX3 A;  1E8W A;  5G04 J;  4UUC A;  3OXF A;  3ZHE B;  1A17 A;  3HXD A;  1HG2 A;  3ASO E;  3EDT B;  2JLB A;  5DBK A;  3CVX A;  3IHY A;  1MYO A;  4G25 A;  3AG2 E;  1RW2 A;  1SQM A;  3ASN E;  4BES A;  5JHB A;  3TWU A;  3L82 A;  3TWQ A;  4GML A;  2YHC A;  1N4Q A;  1SW6 A;  1JCQ A;  5FQ7 A;  2R03 A;  4BWR A;  4I2Z A;  3C3Q A;  4J6I A;  1XGW A;  2KZT A;  2FBN A;  4FLB A;  2IO2 C;  3QWP A;  4A63 B;  3AG1 E;  3PZ2 A;  1KZO A;  3CST A;  4ANU A;  3QC1 A;  1OWO A;  4GA2 A;  3SFZ A;  3C3O A;  1TN6 A;  2OND A;  3KSQ A;  4DI3 A;  2KM4 A;  4CYM D;  2KC7 A;  2VSO E;  4CDR A;  3NOC D;  5LFA A;  4CT0 A;  1YMP A;  2WXO A;  3ULY A;  2WMO A;  1QQE A;  3ZYK A;  4F53 A;  1HO8 A;  2XZD G;  2QFC A;  3GYZ A;  1TNO A;  3Q5M A;  2JAB A;  3D9L A;  4U8Y D;  3APD A;  3UKR G;  4TV3 A;  1MJ0 A;  4HOU A;  5KWD A;  4TUM A;  3FUL A;  2DBA A;  1MX4 A;  4JA7 A;  3FUN A;  2UY1 A;  3RRM B;  4EPZ A;  1O1T A;  2M63 A;  4PDX A;  4AJW A;  5BXU A;  4YDO A;  5FQ6 A;  4L9P A;  2X6F A;  3V31 A;  5T3R A;  4LG6 A;  5FQ8 A;  5FT9 A;  4QQI A;  3DST A;  4RG9 A;  4X8Q A;  2BKK B;  1JUQ A;  4K03 A;  2J9Q A;  3RKV A;  2H6F A;  4ACK A;  3ZW3 A;  1H0A A;  2LAI A;  3C98 A;  4CRW A;  4EHM A;  1OCO E;  2WXH A;  1MX2 A;  1INZ A;  3E33 A;  3V79 K;  4PS7 A;  1TN7 A;  3HVE A;  1H19 A;  3ONK A;  2V4L A;  2FUL A;  3QOU A;  3UM0 A;  4G26 A;  4KVM A;  2IOL A;  4BY6 A;  3I4G A;  4FJZ A;  4CGV A;  2UWJ G;  1D8E A;  3DSW A;  3JYS A;  3AS4 A;  3MKR A;  4DLO A;  2I2O A;  2C0L A;  3CVQ A;  2BTD A;  2IEJ A;  4OYS A;  4F1P A;  3NZU A;  4NAC A;  3OXG A;  4AXH A;  2WXQ A;  5CMW A;  5ARF A;  4OAV B;  4V3I A;  2I9C A;  3KAE A;  4C9B B;  4GTV A;  3V2X A;  2MHK A;  3ML8 A;  1JCS A;  2WQH A;  1AP7 A;  3D9K A;  4LCT A;  4LER A;  3Q15 A;  3TAX A;  5A6C A;  1ZBP A;  3FTV A;  2LXL A;  2PL2 A;  2ZGD A;  2ILR A;  4OAU C;  3CVV A;  4PS8 A;  3ZHE A;  3LKU A;  2Y0B G;  3WXX A;  1NP7 A;  3DXM G;  3B7T A;  2WXN A;  2FI7 A;  1YYH A;  3FUD A;  4KYO B;  3O4Z A;  4I6E A;  4WNE A;  4I6J A;  4ABN A;  3AS5 A;  1FPP A;  2VGY A;  3ML9 A;  4IUL A;  5LOZ A;  1HU3 A;  3E30 A;  4WWP A;  5HQ8 A;  5D66 A;  5AQ7 A;  3MKQ B;  4ATZ D;  4U95 D;  5AYW D;  1O1S A;  3E34 A;  5JJT A;  4B8A A;  4DPR A;  3L16 A;  3RIB A;  2HYZ A;  1K1B A;  4YND A;  3HXB A;  3QKY A;  2OVF A;  3G2U A;  3FU6 A;  4Z68 A;  4K0R A;  3EHR A;  2Y3A A;  3UMV A;  2J07 A;  3J5Q B;  4F1S A;  3U66 A;  2XRY A;  3CQC B;  2NYJ A;  1FCH A;  4ILI A;  1IQR A;  4K5C A;  3ZEF A;  2A5E A;  1Y6I A;  4HRL A;  3VLF A;  3FEY A;  3GZS A;  1WDY A;  3ESK A;  2AVP A;  3LXU X;  4G24 A;  2Y1L E;  3ASH A;  2FF4 A;  4CZ2 D;  2MRI A;  1H2U A;  3L6A A;  3FU0 A;  1JCR A;  2KCV A;  2AXV A;  3NQP A;  4WNG A;  2EIN E;  5C1D A;  2LUH A;  4WWO A;  1LTX A;  3ZNG A;  3EUV A;  5EYL A;  4XEI G;  3KD7 A;  2ETA A;  3D9J A;  5CED B;  4XI0 A;  3FH7 A;  3FFL A;  2F8X K;  5D2M C;  4I2W A;  5ENN A;  2OEW A;  4J8D A;  1IXV A;  3FTX A;  4FHK A;  2IU1 A;  3VTY A;  1UN9 A;  4ILH B;  2VSN A;  1JWG A;  4GMJ A; 
#chains in the Genus database with same CATH homology
 1HFA A;  2WXK A;  3EIJ A;  3U64 A;  2XQ0 A;  5BT1 A;  4EQF A;  4AP2 A;  3T5V A;  1HZ4 A;  3CK8 A;  4L23 A;  4KVO A;  3CVU A;  2XGO A;  4DJA A;  3S7B A;  3FUK A;  2VGX B;  4WUY A;  5G05 C;  2I1K A;  2PM6 A;  1HX8 A;  4RSY A;  5JJ7 A;  2KCL A;  4J8F A;  1IHG A;  3CVY A;  4EZK A;  5FZR A;  2WXP A;  5AJL A;  2GRL A;  1QNF A;  4FLH A;  5FZQ A;  5AIJ A;  5BUZ A;  4E85 A;  3PNL B;  3CIA A;  4B94 A;  4HOS A;  2IJG X;  1NA0 A;  4HXI A;  1QZ2 A;  5LX8 A;  3OAW A;  4L2L A;  3D3M A;  2DIW A;  4XZ4 A;  3CQG B;  4OVU A;  3ZYM A;  4A1S A;  4F7A A;  3CVW A;  4I1M A;  3HIZ A;  2QY7 A;  5FTP A;  1WY6 A;  3MX3 A;  3R9A B;  1E8W A;  3QDN A;  5G04 J;  1H6K A;  2XRZ A;  3SBT B;  3O48 A;  3RU0 A;  3IBE A;  4EZL A;  3OXF A;  3MV2 B;  3FEX A;  1MHQ A;  5KJN A;  3LVQ E;  3ZHE B;  1A17 A;  1HG2 A;  3D9O A;  4C0E A;  4UWH A;  2FO7 A;  3FUM A;  3EDT B;  2JLB A;  5DBK A;  4N2Q A;  3CVX A;  3IHY A;  2XGS A;  2I1J A;  4FUL A;  4AIF A;  4MLP A;  3GW4 A;  5CHE E;  2PQR A;  2X6J A;  4G25 A;  2GRM A;  3FUH A;  3N71 A;  3ONL A;  3ZVV A;  5FQ4 A;  4JEH A;  3MV3 B;  1SQM A;  4AM9 A;  4UWK A;  3P2B A;  3APF A;  3HHM A;  1W3B A;  3P1U A;  4MRU A;  2E0I A;  3JCK C;  3ZPJ A;  3UT7 A;  5CCM A;  5JHB A;  3SD5 A;  1PY1 A;  3D9N A;  1HE8 A;  4JHK A;  2PQN A;  4N3B A;  4GML A;  4FAD A;  2YHC A;  4W9R A;  3K9I A;  5FQ7 A;  3LY8 A;  3L22 A;  2L0T B;  3HYM B;  4BWR A;  4I2Z A;  4J6I A;  2ZU6 B;  3ZXS A;  1XGW A;  2KZT A;  1OWN A;  2FBN A;  2XHE A;  4GA0 A;  4I43 A;  4FLB A;  3SF4 A;  1TJC A;  4BT8 A;  3QWP A;  3LDZ A;  2J49 A;  3CR3 A;  3MJW A;  2WQ6 A;  5ANL A;  1E7V A;  3FUE A;  3RO2 A;  1L5J A;  3CK7 A;  2OVB A;  3RJV A;  2CFU A;  2R5S A;  3PNT B;  2L9B A;  3MCX A;  3SI5 A;  3LPZ A;  4J0U A;  3ZFW A;  3IV0 A;  3CST A;  4ANU A;  3QC1 A;  2CG2 A;  3DBS A;  3NF1 A;  1OWO A;  4U0S A;  4TRQ A;  4GA2 A;  3SZ7 A;  3SFZ A;  3PH0 C;  4JL0 A;  1U3D A;  1ELW A;  3FU5 A;  3I3N A;  2AW6 A;  5AJD A;  4KBQ A;  1Z6T A;  2OND A;  4DI3 A;  2KM4 A;  2YQ8 A;  4LEU A;  3LY7 A;  3JQ1 A;  3RRN B;  2VSY A;  3PE4 A;  3SBS A;  2KC7 A;  2VSO E;  1Z3X A;  4N5C A;  4Y6C A;  4CDR A;  2CHZ A;  5LFA A;  3LS8 A;  2VJ8 A;  3DPD A;  2VSX E;  4CT0 A;  3D9P A;  2WXO A;  3R7R A;  1EPU A;  1GW6 A;  4JC8 A;  2WMO A;  3LJ3 A;  1QQE A;  3ZYK A;  4F53 A;  1B89 A;  1HO8 A;  5M72 A;  4AY6 A;  4PUC A;  3MEK A;  4M3O A;  2C0M A;  4XKC A;  3U4T A;  2QFC A;  3GYZ A;  3B7S A;  3Q5M A;  4NUR A;  2WXG A;  4GU5 A;  1KLX A;  3HDX A;  4RVB A;  4G23 A;  1XNF A;  2V8S E;  5D0O D;  3D9L A;  4GCO A;  1E90 A;  3ZYL A;  4ACL A;  3CEQ A;  3APD A;  4WWN A;  3SNX A;  4Q69 A;  4TV3 A;  4HOU A;  3TG5 A;  3FTW A;  2RD0 A;  4AEZ C;  4EZJ A;  1JWF A;  2Y4U A;  4A1G A;  1MQS A;  3B13 A;  4IN3 B;  4Q94 A;  5C2Y A;  3FUL A;  2DBA A;  3G2W A;  1N52 A;  4JA7 A;  4CEM A;  3TGO A;  2WB2 A;  4I6G A;  4BT9 A;  4APF A;  3FUN A;  3FDH A;  5BV0 A;  2UY1 A;  3RRM B;  3Q49 B;  3L13 A;  4WND A;  4BX8 A;  3LVR E;  3OTN A;  4EPZ A;  2M63 A;  4PDX A;  4AJW A;  3T5X A;  2LSU A;  3TXM A;  5FQ6 A;  2X6F A;  4PS3 A;  3CVP A;  4U0Z A;  4AOF A;  5T3R A;  3B7R L;  2EQX A;  4NQ0 A;  5FQ8 A;  4GMJ A;  5FT9 A;  1LF8 A;  3SHF A;  3TXN A;  4RG9 A;  1JUQ A;  2X38 A;  2WQ7 A;  4K03 A;  3UT4 A;  1E7U A;  2J9Q A;  4GYY A;  3FH8 A;  3FUJ A;  3JQ0 A;  4P29 A;  3RKV A;  4B0Z A;  3UX4 A;  1KT1 A;  4ACK A;  3ZW3 A;  1H0A A;  2X6K A;  4B89 A;  2LAI A;  4DI4 A;  2WXF A;  5E76 A;  5EDS A;  3C98 A;  4H7Y A;  4CRW A;  2HO1 A;  4XI9 A;  5LCW J;  3CKB A;  2V5F A;  2BF0 X;  3PE3 A;  4FC8 A;  2WXH A;  3FU3 A;  4N39 A;  2AWI A;  1INZ A;  2A5U A;  3EHM A;  4D10 C;  1FVF A;  2LNI A;  3BEE A;  4I1O B;  4U0U A;  2XGM A;  4J8S A;  4PS7 A;  2R59 A;  1DNP A;  1TJF A;  3ASF A;  4HOQ A;  4GYO A;  3HVE A;  4HVB A;  3EHN A;  1H19 A;  1OWP A;  3ONK A;  1EF1 C;  4JA9 A;  2MOW A;  3L17 A;  4BTB A;  2V4L A;  5JHA A;  1UW4 B;  2GGF A;  3APC A;  3RK6 A;  4XE0 A;  3D9M A;  2FUL A;  2VQ2 A;  3QOU A;  2C2L A;  4G26 A;  4KVM A;  2IOL A;  3AS8 A;  4BY6 A;  3I4G A;  2XPI A;  5G04 C;  3CHS A;  5KJL A;  4FJZ A;  4CGV A;  2UWJ G;  1FVH A;  3JYS A;  3RO3 A;  3AS4 A;  4J8E A;  3CV0 A;  3IKO B;  3MKR A;  4HFG A;  4UI9 J;  4AY5 A;  3T8M A;  2WXI A;  3QJZ A;  4GAA A;  5J90 A;  4DLO A;  2I2O A;  4CCA A;  2C0L A;  4UWG A;  4BFR A;  1HF8 A;  3CVQ A;  4DLQ A;  3PVL A;  3ENE A;  1WAO 1;  2UY1 B;  5EKQ D;  1PC2 A;  1E8X A;  2BTD A;  4OYS A;  4U8H A;  3NZU A;  1ELR A;  4NAC A;  3OXG A;  2LSV A;  2X6I A;  5BW8 C;  2DCP A;  2FEZ A;  5BPP A;  4E6H A;  5A23 A;  4AXH A;  3EIQ C;  3NZS A;  2CG3 A;  3CSF A;  4UQY A;  3GZ1 A;  2WXQ A;  3PRZ A;  5CMW A;  5ARF A;  2IOS A;  3CLJ A;  3FP3 A;  3KEZ A;  4V3I A;  2I9C A;  3KAE A;  4ATG A;  3EJN A;  4C9B B;  2Y4T A;  2WMN A;  2MHK A;  3URZ A;  3ML8 A;  4MKT A;  4XKB A;  5ARG A;  5AEN A;  4FP7 A;  3ASD A;  3ASG A;  5G2N A;  2PM7 A;  4CDN A;  2IF4 A;  4OVV A;  5D0Q D;  2NXP A;  2WQH A;  2IQC A;  2R17 C;  3G2V A;  3D9K A;  3CGH A;  2LO6 A;  1P5Q A;  4LCT A;  3FUI A;  4URK A;  3PS6 A;  4LER A;  4U63 A;  3Q15 A;  5HI7 A;  5KJM A;  3TAX A;  5A6C A;  5E75 A;  4F3V A;  4LRZ A;  3MZL B;  1ZBP A;  1Y8M A;  2WPV A;  3FTV A;  4JXT A;  1N54 A;  1PAQ A;  3MKQ A;  3HVE B;  3I4R B;  4R7L A;  2PL2 A;  4GB9 A;  1OUV A;  2ILR A;  3CVV A;  3GZ2 A;  4ANV A;  2VTB A;  3ZYQ A;  4CGW A;  3MYV A;  3CVL A;  4XIF A;  4PS8 A;  2WM9 A;  3ZHE A;  3LKU A;  2L6J A;  3FTS A;  5ANR A;  5T4Y A;  5CMY A;  2NC9 A;  1H2V C;  3VLE A;  3WXX A;  1NP7 A;  1H2T C;  4EBA G;  2WXM A;  1E96 B;  3LCA A;  4L1B A;  3I5P A;  4KZC A;  1OWL A;  1EDU A;  4UWF A;  3BG0 B;  4WNF A;  5G05 J;  4O6F A;  3L08 A;  3B7T A;  4APO A;  2KAT A;  3AU5 A;  2WXN A;  2KZT B;  1ELK A;  3VLD A;  4A55 A;  2AXU A;  2FI7 A;  4H7X A;  3CVN A;  3KS2 A;  4QFV A;  4I1A A;  2J4D A;  4L7T A;  4N3C A;  4JHJ A;  4EEC A;  3QAQ A;  3SGH A;  1ZU2 A;  2WVI A;  1NA3 A;  3QWV A;  3FUD A;  4WAF A;  4KYO B;  4JVS A;  3O4Z A;  4ME2 A;  5FWQ A;  5KJK A;  5G55 A;  3S2A A;  4GPK A;  3S7J A;  1Z3Y A;  3PDN A;  4I6E A;  1BPO A;  4WNE A;  3U9W A;  3LYA A;  3FTU A;  4I6J A;  1X5B A;  3LY9 A;  4ABN A;  4NRH B;  4GZ3 A;  1UJK A;  2J4B A;  2VGY A;  3AS5 A;  4JEU A;  4B8C B;  5BV1 A;  3ML9 A;  4IUL A;  4JZY A;  4YVO A;  5FZS A;  5LOZ A;  2CFZ A;  4KXK B;  2E2E A;  1HS6 A;  3R7Q A;  3UT8 A;  1HU3 A;  3E4B A;  4WWP A;  1UN8 A;  2ION A;  5HQ8 A;  2V0P A;  3B7U X;  5T8I A;  2AXZ A;  4A3T A;  3CHP A;  4ANW A;  3PZD A;  4ILG A;  4A3V A;  3FY4 A;  3MKQ B;  2XPZ A;  2CHX A;  5AYW D;  5A7D B;  3LEW A;  4AVX A;  4GCN A;  4N3A A;  5J08 A;  1EYH A;  5JJT A;  3ZIM A;  2VTB B;  1HH8 A;  2GW1 A;  3U3W A;  2J09 A;  4HOT A;  4B8A A;  4KZ0 A;  4RG6 A;  4DPR A;  4FHJ A;  3L16 A;  3FTY A;  3FUF A;  4L2Y A;  3RIB A;  5BNW A;  2HYZ A;  5LP0 A;  4FU3 A;  4I9E A;  4PH4 B;  2HM8 A;  4YND A;  1TEZ A;  3JUI A;  2A4Z A;  3PEU B;  2CHW A;  1KT0 A;  3MGB A;  3QKY A;  4GYW A;  2OVF A;  1UJJ A;  4G1T A;  5LCW C;  4KT6 B;  3G2U A;  3IEG A;  2I6H A;  3FU6 A;  3L54 A;  4CDM A;  4U04 A;  3UUX A;  4GZ6 A;  4Y6W A;  3QNK A;  4I9C A;  5KCM A;  4K0R A;  1SZA A;  2XCC A;  5DIZ A;  2Y3A A;  4HOR A;  3FHE A;  2J07 A;  3UMV A;  4F1S A;  4HS2 A;  3ZRH A;  2XEV A;  1UG3 A;  3U66 A;  1U3C A;  2XRY A;  3CQC B;  4IYP A;  3RRU A;  3CK9 A;  4GA1 A;  5EX3 A;  4EBA A;  1IQU A;  2OOE A;  1FCH A;  4ILI A;  1E8Z A;  1S0P A;  3PUK A;  3AU4 A;  1IQR A;  2BUG A;  3ZEF A;  4HLE A;  2KCK A;  3QAR A;  4I17 A;  3CHQ A;  1Y6I A;  4UQX A;  4UI9 C;  3S7F A;  2XCB A;  2OV8 A;  2XPY A;  3QWW A;  4JHR A;  2X3M A;  2VGX A;  1JPL A;  3VLF A;  3FEY A;  3GZS A;  4TUU A;  4FJY A;  1HG5 A;  1NZN A;  3CHO A;  1VDY A;  3CHM A;  5EX0 A;  3ESK A;  3TG4 A;  2P58 C;  4IRU A;  3MA5 A;  3PUJ A;  3BG1 B;  2AVP A;  3LXU X;  2VYI A;  2WXJ A;  4BSX A;  4G24 A;  4G2V A;  3ASH A;  2IFU A;  2FF4 A;  4UQZ A;  4GZ5 A;  4FA6 A;  4AV7 A;  2WXR A;  2RG8 A;  2WXL A;  2MRI A;  1H2U A;  4YVQ C;  3PRE A;  2YIN A;  2Q7F A;  3FTZ A;  3L6A A;  3TJP A;  3FU0 A;  3G2T A;  5JJ6 A;  2HR2 A;  2KCV A;  3UPV A;  2YNQ A;  3OXL A;  1HXI A;  2AXV A;  3NQP A;  4UI9 K;  4WNG A;  5C1D A;  3CHR A;  4WWO A;  3TL5 A;  3Q47 B;  4U07 A;  1YA0 A;  2X6H A;  4LUN U;  4DK5 A;  3UQ3 A;  3S7D A;  3PEV B;  2L0I A;  3KD7 A;  4N2S A;  3D9J A;  3D9I A;  4XI0 A;  4XX5 A;  4CT4 A;  4GZC A;  1SZ9 A;  3FH7 A;  2LAH A;  3FFL A;  4KMO A;  4UWL A;  3VTX A;  2J08 A;  4BTA A;  4ANX A;  3ZN3 A;  2YHE A;  3ESL A;  4GZD A;  3FWV A;  4Q96 A;  3FH5 A;  4G11 A;  4I2W A;  5ENN A;  3ULQ A;  4J8D A;  3CKC A;  3Q4A B;  4MS6 A;  4BX9 A;  2JEK A;  3FTX A;  5FJY A;  4JPS A;  5CCL A;  1E8Y A;  4C0M A;  4FHK A;  2IU1 A;  3QB2 A;  3VTY A;  1IYG A;  3IHV A;  2NSZ A;  4JW1 A;  1UN9 A;  4ILH B;  3ZGQ A;  2VSN A;  1JWG A;  3QK0 A;  1OWM A;  1DVP A;  1WM5 A;  3G2S A;  2PZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...