3ASHA

Mama d159k mutant 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
172
structure length
172
Chain Sequence
NDDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
molecule keywords MamA
total genus 63
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ashA01
4AY6A 5G05C 5EX0A 4U0UA 4J8EA 2FEZA 3LY8A 3OXLA 1HZ4A 3QWWA 3Q47B 3JYSA 2KATA 4ME2A 4YVOA 1QZ2A 4KYOB 3FFLA 4HORA 2XEVA 5CCMA 3SF4A 4CGVA 2Q7FA 3QDNA 4GYOA 2OOEA 5CCLA 1HXIA 4AIFA 4I9EA 3EDTB 1IHGA 2JLBA 2Y4UA 3CK8A 3O48A 3MKRA 4HOQA 2XCCA 3Q49B 2P58C 3HYMB 1A17A 3PDNA 4UI9J 4KXKB 5M72A 4W9RA 1E96B 4HOSA 3UQ3A 2VGXB 3Q15A 4U0ZA 2E2EA 5BNWA 3K9IA 5FZRA 4WNGA 4GPKA 1B89A 2YHCA 4JA9A 4Y6CA 3ASHA 3CV0A 5FZSA 4N2QA 3ULQA 1HH8A 2HO1A 3CKCA 1TJCA 3RKVA 4GZ6A 5JJ6A 3CVPA 3QWVA 2HYZA 3Q5MA 5AYWD 4U0SA 4AY5A 2NC9A 4G26A 2KCVA 4G2VA 4I1AA 4CGWA 4JL0A 4BT9A 1NA0A 3LKUA 4KBQA 3RO2A 2BUGA 2HR2A 4HOUA 4N3AA 5A6CA 5ARGA 5FZQA 4GA2A 4GYWA 5KJKA 4WNDA 3PE4A 4J8DA 2PQRA 2IFUA 4NQ0A 5CHEE 4I2ZA 3FP3A 1XNFA 2XGMA 5EX3A 3SZ7A 1ZU2A 4N3CA 2UY1A 3LCAA 3ZN3A 3MV2B 3PE3A 4G24A 1KT1A 3QKYA 3TAXA 3CK9A 3RO3A 3AS5A 3RU0A 3TG4A 4WNEA 3ZPJA 2C0MA 3AS8A 3CEQA 5JJTA 4HOTA 4UI9C 3UPVA 1OUVA 2GW1A 3KAEA 1Y8MA 2UY1B 3IEGA 2C2LA 2VGXA 2MHKA 3MEKA 2IF4A 3E4BA 3R9AB 3ZHEB 5BT1A 4BT8A 2XPIA 4N5CA 3UUXA 5KJMA 3S7FA 2LNIA 2VYIA 2FF4A 4UQXA 1P5QA 3N71A 4WUYA 3ASDA 3LYAA 3KS2A 4N39A 3VTXA 1YA0A 4YNDA 2WPVA 4CDRA 2C0LA 3LY7A 3ZHEA 4B94A 3CVNA 2LSVA 4NRHB 1WM5A 1QQEA 2ONDA 2VSNA 3OXFA 3QOUA 4U04A 5ARFA 3LY9A 2J9QA 4LEUA 4XI9A 1NZNA 2VQ2A 4GA1A 3RIBA 2V5FA 3U4TA 2FI7A 5DIZA 3TG5A 5LCWJ 4BTBA 2QFCA 3GZ2A 1PC2A 2VGYA 2XCBA 5DBKA 4G23A 1NA3A 1KLXA 2I6HA 2XGOA 3BEEA 4F3VA 2PL2A 1FCHA 2UWJG 5FJYA 4N3BA 4A1SA 3KD7A 4N2SA 4XI0A 2AVPA 5LCWC 4YVQC 3MV3B 3CKBA 3S7BA 5A7DB 4GCNA 3S7DA 3ZGQA 3CVQA 4GZ5A 4BTAA 3TGOA 4Y6WA 3LPZA 4I9CA 4JA7A 3CVLA 5KJLA 5EKQD 3S7JA 5C1DA 3U3WA 1WAO1 2KC7A 3OXGA 4XIFA 5D0OD 4RG9A 4I2WA 3VTYA 3GZ1A 3MA5A 3NF1A 2PQNA 2XGSA 3QWPA 3ZFWA 4APOA 5HI7A 3URZA 1ELRA 5FT9A 5HQ8A 1IYGA 3FWVA 2DBAA 4IN3B 4O6FA 4U07A 5D0QD 3GW4A 4WNFA 4GCOA 4ABNA 4H7YA 4G1TA 5G04C 2KCLA 1W3BA 3ASGA 5KJNA 4H7XA 2FBNA 3WXXA 5JJ7A 5FTPA 2YQ8A 4UQYA 4GA0A 3AS4A 4UQZA 5G05J 3CK7A 2KCKA 1ELWA 4JHRA 4UI9K 4AM9A 4BWRA 4RG6A 1KT0A 1ZBPA 5BW8C 4EQFA 3Q4AB 4GYYA 4J0UA 5G04J 2L6JA 4GZ3A 4J8FA 2FO7A 2VSYA 2LSUA 2Y4TA 4G25A 4I17A 3ASFA 2PZIA 3ESKA 2WQHA 2R5SA 3RJVA 3GYZA
chains in the Genus database with same CATH superfamily
4YVOA 1H6OA 4HORA 2XEVA 4K5CA 4AIFA 5KNGA 5BXUA 5HRYA 1N11A 4AOFA 2GGFA 3NQPA 4HLLA 5ENSD 5FZRA 1U3CA 2VTBB 3LDZA 2KCVA 3UM2A 3C3QA 4G2VA 1FPPA 3ZYLA 3V79K 1UG3A 4WNDA 3CHQA 2J4BA 3PZ1A 4HOTA 4WNEA 4GMLA 2GW1A 2XEHA 3E4BA 2FF4A 3HXDA 1HFAA 4PH4B 3L17A 3CHSA 4CDRA 2PM6A 1BI8B 5HKPA 4LRZA 2V5QC 3UI2A 3PREA 3EHNA 3BQOA 3MGBA 1SZAA 1OWLA 4GB9A 4HXIA 3IHVA 1V54E 5J90A 4MRUA 3KSLA 3MKQA 3ZYKA 2M63A 5CEDB 3FUKA 3P2BA 2DBAA 4WNFA 4B0ZA 3TXNA 4G1TA 3V31A 3WXXA 2JABA 4UQYA 4KZCA 4IYPA 4AM9A 4RG6A 4EQFA 2RG8A 4FULA 1OWPA 3L82A 2KATA 2WVIA 3DSTA 4HNAD 3BU8A 3ULYA 5CCLA 4AVXA 4I9EA 2RFMA 3PEVB 2Y4UA 4J8YA 5M72A 4XKBA 3UQ3A 4U0ZA 4URKA 2E2EA 2AWIA 4ILHB 1TJCA 2B0OE 5JJ6A 1TN6A 4AY5A 3SHFA 3EUVA 2YNQA 2IFUA 3CSTA 2XGMA 2A4ZA 3LCAA 5JA4D 4LNBA 4O60A 1JWGA 1ZB1A 3MYVA 3QKYA 3SFXA 2IY0C 3NZUA 2V4HC 2EINE 4OVUA 4RLYA 5H7PA 3S7FA 3QB2A 4X8QA 5ENPD 3Q78A 5ENOD 4NRHB 4NACA 3HXFA 3RSEG 3BEEA 1FT2A 4A63B 4N3BA 5EIDA 5C2YA 3HRAA 5FQ7A 4FHJA 3SY2A 2VGEA 5BV0A 4FP7A 2H6IA 2E0IA 3DWLG 3FHEA 1LF8A 1H2UA 3OXGA 4XIFA 5D0OD 1OWOA 3FWVA 4GTSA 3L6AA 4GA0A 4UUCA 3Q9UC 2ILRA 3L08A 2LXMA 5G04J 3TWQA 3AAAC 1QZ2A 4TXRA 3ZRHA 3D9JA 3CK8A 4LEUA 2P58C 4UI9J 1E96B 3E37A 1D9SA 3K9IA 5AN8A 4FJYA 4BERA 4ILIA 4GMJA 3ZU7B 1NA0A 2I9CA 3UIPC 4G11A 1OCRE 4A3TA 2BF0X 3RU0A 5G2NA 3IXEA 1E8WA 2BTDA 3KEAA 3CVVA 3IEGA 3CR3A 2Y3AA 4N5CA 2VJ8A 2QZAA 5EYPF 4YNDA 4TV3A 2LSVA 1TNZA 2J9QA 3HXCA 3RIBA 2RD0A 5DIZA 3TG5A 2OEVA 4KMOA 2GRRB 3I3NA 4YDOA 3CKBA 3T8KA 3TGOA 3LPZA 4I2WA 3MA5A 3RRUA 2AXUA 5BUZA 3URZA 3QARA 4IN3B 2H6HA 2A5UA 3FTSA 2DVWA 1N0RA 3B7SA 2R59A 4MS6A 5CBNA 2XZDG 4QFVA 4NURA 1JUQA 2YINA 2VSOE 5G05C 4ATGA 1HZ4A 3Q47B 1IQRA 3HVEA 3FUEA 5CCMA 1HG2A 4GYOA 3TWSA 5AQAA 3UTMA 4AXHA 3WG7E 2EIJE 2WXQA 4C9BB 3EJNA 2IEJA 5CRVA 2MYOA 3Q5MA 2NC9A 1H6PA 3FUHA 3L9TA 4KBQA 4HOUA 4AV7A 4J8DA 4G8LA 3CSFA 5J08A 3UX4A 3ASOE 3PZDA 2IF4A 3PZ2A 3JXJA 4JPSA 2EIME 3CVXA 2LNIA 2GRNB 1E8ZA 4ANVA 3UT4A 3HXBA 2VQ2A 3ML9A 3APCA 4CDMA 4K03A 4YDYA 3GZSA 4TXPA 1UJKA 1L5JA 4GTMA 3C5RA 5FQ6A 4GTTA 4I9CA 1NFIE 1FT1A 2FO1E 3ZYQA 3VLEA 5C1DA 3EU5A 1WAO1 3GZ1A 3QWPA 2LO6A 4L2LA 5ANRA 4O6FA 3E33A 1NI1A 5JJ7A 2YQ8A 4DJAA 4PS8A 5BW8C 3Q4AB 1H0AA 3I4RB 4IRUA 2LSUA 1E90A 2WXFA 2ETAA 3FUJA 2FEZA 4GPMA 3QWWA 1O1RA 2I1KA 3BUAA 4DLOA 2X6KA 1JPLA 3IBEA 2OCCE 3QDNA 4LG6A 2XHEA 1HS6A 5CMYA 2QYUA 2HO1A 4P29A 2GRLA 4GZ6A 5CRUA 4TUUA 1BU9A 3PUJA 1ZU2A 4N3CA 3JXIA 1KT1A 3D9HA 3ZW3A 1OUVA 2GRPB 2KZTA 2C2LA 2LUHA 4BT8A 2XPIA 1Q2ZA 4UQXA 3LJ3A 4U96D 1OXJA 4BX8A 1WM5A 4O1PA 1X5BA 5E76A 5AQ7A 4J8SA 3ZYMA 2WXHA 4IULA 5FJYA 3MZLB 4DRXE 3FUNA 3MV3B 4DI3A 4GZ5A 2P2CP 4HFGA 3DXKG 1O1SA 1WY6A 3NF1A 4K5BA 3TWXA 3IKOB 2KCLA 4GZDA 3V30A 3D9IA 2Y69E 1KT0A 4LSZE 3I4GA 3T8MA 3RJVA 2DIWA 1DCQA 4ME2A 2ZISA 3E30A 3SF4A 2CG3A 3U66A 1IHGA 2NXPA 3E32A 2OVBA 4C0MA 3RRNB 1A5EA 3C72A 2GRMA 4OVVA 1LTXA 5BNWA 3NB2A 3CKCA 1SA5A 4TRQA 2HYZA 2B6CA 4I1AA 4CGWA 3Q75A 2EIKE 2IJGX 4D10C 5FZQA 3VLDA 3RRMB 4JZYA 2L9BA 2LAHA 3ZPJA 3UIOC 3S2AA 1LD7A 3ABLE 3KAEA 4PS3A 3TWUA 4JC8A 3NOCD 3NAWA 4N39A 4ACLA 2WXJA 3LY7A 3CVNA 3FTVA 1ELKA 3OXFA 4HQDA 3QK0A 2V5FA 3U4TA 3ABME 3ULEG 2DZOA 4DX7D 3TJPA 4EZJA 3SNXA 2AVPA 3S7BA 3P1UA 4GCNA 3S7DA 1S64A 4BESA 2HM8A 3S7JA 3FDHA 3FUFA 3FTWA 1EF1C 4APOA 1ELRA 1DCEA 4CRWA 3ISMC 1N4QA 4GCOA 2QY7A 3D9NA 3ASGA 3RAUA 5FTPA 4HS2A 4HLEA 3UKRG 4ILGA 4J0UA 4GZ3A 5AQ9A 3UM1A 5LP0A 2Y4TA 2WQHA 4GTRA 1D8EA 3GYZA 3LY8A 2H6FA 2XEEA 2V0PA 1HXIA 3Q49B 2QYJA 2H6GA 4FA6A 2FULA 1UN9A 4WNGA 2WXLA 4JA9A 2XENA 4APFA 3KEZA 3ZIMA 4PS7A 4A1GA 2CHXA 1V55E 1MYOA 4N3AA 4GA2A 4ZHBA 4KT6B 4NQ0A 5EX3A 1HF8A 5KJKA 1RW2A 4DUIA 5B1BE 2F8YA 4F6RD 5JJTA 2CFZA 1EPUA 3Q7FA 2DYRE 4FC8A 2R05A 3L16A 5BPPA 3R7RA 1P5QA 3N71A 4Q96A 4Q69A 3FY4A 3DEPA 3UT8A 3AU4A 3DSSA 4HBDA 2WMOA 3DRAA 3TXMA 3F6QA 3R9MA 1WDYA 3SFZA 2XGOA 1MZCA 5AIJA 5CMWA 4BTAA 5ENQD 1K3ZD 3OAWA 2AW6A 3I5PA 2WMNA 2XGSA 5HI7A 4E85A 5HQ8A 1OT8A 5D0QD 2F0YA 1TN8A 4H7XA 4BETA 3EIQC 4JHRA 3NZSA 4L2YA 2P9SG 5EN5D 3C3OA 3HIZA 1JCSA 3JYSA 2NSZA 2J08A 3D3MA 3DSXA 3U64A 4BEPA 3FTUA 1N52A 4CT0A 2XCCA 3B13A 1A17A 1JCQA 4W9RA 4DX6D 3APDA 3JCKC 1N4RA 5AARA 1QBQA 3B7UX 3QWVA 1IHBA 4JW1A 5T4YA 5A6CA 3MCXA 5AJLA 4TXQA 5LX8A 2X6JA 3D9OA 3MV2B 3ZEFA 1N54A 3B7RL 3AS8A 3CEQA 2V8SE 1WG0A 4A55A 1H6KA 2VGXA 3ZHEB 3SFYA 1YMPA 3G2VA 4XX5A 1N0QA 4B94A 2L6BA 2XZTG 3D9PA 3CHOA 4QQIA 3SBSA 4U04A 3FU3A 4XI9A 1KZOA 2WXIA 4ZFHA 3MX3A 4JB8P 5AJDA 1DC2A 2QFCA 1PC2A 2VGYA 3SQVA 5DBKA 4HB5A 4B8CB 4XI0A 3ZGQA 4R7LA 3L54A 5KJLA 2WB2A 2IOSA 3IHYA 3VTYA 3B95A 1N4PA 4U8HA 5CERB 5AENA 3DXMG 5KWDA 1DVPA 4EBAA 3FTZA 3ASFA 3Q73A 4HRLA 2QC9A 4KYOB 2IOLA 3W9FA 2BEDA 4XKCA 5AYWD 4CDNA 4HOSA 1S63A 3V2OA 1OCOE 3B7TA 3CHMA 1N4SA 3ASHA 2WQ7A 3ULQA 2KXPC 3DSWA 4U0SA 1TN7A 3BG0B 5JHBA 4L1BA 3PZ3A 4ANUA 3L22A 2F8XK 3QJZA 2HR2A 1AP7A 5ARGA 5AAOA 4UWLA 2X6IA 2MOWA 3TAXA 5BV1A 1BD8A 1HO8A 3D9LA 4DX5D 4FADA 5BT1A 2R03A 2ETCA 3QAQA 2WPVA 2Y1LE 5HS0A 2VSNA 3QOUA 3LY9A 2VSXE 1NZNA 4GA1A 3ZNGA 1YCSB 3NOGD 4XEIG 3LEWA 4OYSA 3DPYA 2PNNA 3SGHA 1QYMA 1HU3A 2UWJG 1N94A 3ABKE 4RSYA 4U63A 2DZNA 1BI7B 5CBOA 3D9MA 1JCRA 2IONA 1UN8A 3D9KA 1Y6IA 3CVYA 4DX2A 2XQ0A 5KJNA 2EQXA 2BKKB 4U7EB 4FLBA 4I1OB 4K5AB 2RFAA 2KZTB 4V3IA 1KPSB 1E8XA 5D2MC 4Q94A 3OTNA 3ESLA 3G2WA 1SZ9A 3O48A 4KXKB 3C3RA 4HI8A 2WXMA 3CV0A 4I1MA 3AU5A 5FIOA 1MHQA 1MX4A 4KZ0A 4I43A 3UM0A 3FTXA 3ZN3A 3RO3A 1TNOA 4O1OA 4N5QA 4Z68A 1Z6TA 3PNTB 5B3SE 4C48B 3MEKA 3Q9NC 3ZXSA 2XPYA 4JD2G 3KS2A 4RQIA 3FH5A 3ZHEA 5FQ4A 1QQEA 2IU1A 2X6FA 4EHMA 4F1SA 3ASNE 2F37A 3CQCB 4G23A 4F3VA 4E6HA 3APFA 3FEXA 4YVQC 3JUIA 1RZ4A 3CVLA 5LFAA 3SI5A 1KZPA 3DEOA 3GW4A 1H19A 1IQUA 4AEZC 2FBNA 3AS4A 3TWTA 1INZA 1OCCE 3LXUX 3L13A 3KSQA 4WAFA 5EILA 3ONKA 3TWRA 5EDSA 2ZIRA 4K0RA 4L7TA 3EDTB 2JLBA 2KBXA 3MKRA 3PDNA 4GTOA 2DCPA 2WXNA 2X3MA 3SO8A 1TR4A 3R7QA 1K8KG 1N95A 4U95D 2LAIA 1E8YA 2BUGA 1SQMA 5CHEE 4JEHA 1BLXB 4I2ZA 3ZKJA 1E7VA 4G24A 2J4DA 5CECB 2WXGA 4HRNA 3B7BA 1OY3D 3QC1A 2R02A 3DSVA 3UT7A 4WWNA 2DWZA 3FH8A 1MJ0A 3VTXA 5ARFA 2ONDA 2CHWA 3G2UA 2OVFA 1PY1A 3AG1E 4EBAG 3Q7AA 5LCWJ 2XPZA 2I6HA 5A7DB 3SBTB 3U3WA 4HVBA 3W9GA 3CHPA 5FQ8A 4JHJA 3PS6A 3ZUVB 2J8SD 2J07A 1TYQG 3EIJA 1O1TA 2IQCA 3CLJA 2VSYA 2PZIA 1SW6A 5EX0A 4J8EA 1EYHA 2I1JA 4GAAA 2Q7FA 2Y0BG 4ABNA 4HOQA 2ZGGA 5T8IA 3ZXPA 1HG5A 2IO2C 1H2TC 4GPKA 3DBSA 5G55A 3PNLB 3VLFA 3EHRA 1O5MA 5E75A 4J6IA 2UY1A 4ANWA 2OV8A 2J09A 3TG4A 1DNPA 1H2VC 4LUNU 1Y8MA 2UY1B 2GROB 5KBAA 2VYIA 4GTQA 3LYAA 1D8DA 4B8AA 4EZLA 3FUIA 2CHZA 5A23A 3GZ2A 1NP7A 4ACKA 4CCAA 2P9IG 2XRYA 3LJNA 4J7WA 5D66A 2ETBA 2IO3C 4GMRA 2PM7A 3Q79A 4JA7A 1AWCB 3PEUB 4U8YD 3RK6A 2WXPA 4F7AA 1HX8A 1G3NB 5FWQA 4F1PA 4H7YA 1SA4A 1OWMA 1OWNA 4FU3A 4RVBA 4YDEA 4ANXA 4BWRA 3FUMA 4GYYA 5ENNA 4I17A 4G25A 2VTBA 3ESKA 3AG2E 3FP3A 4L9PA 4DK5A 1X81A 3OXLA 3LVQE 2WXRA 3FFLA 4CGVA 5EIBE 2AXZA 4DLQA 2VGXB 2R17C 1QNFA 1B89A 1U2VG 3HDXA 2NYJA 4N2QA 5FZSA 3RKVA 2P9UG 1K1BA 3LKUA 4UWGA 1VDYA 4BX9A 1S0PA 2GRQB 1FVFA 5AQBA 3AS5A 3PVLA 4UI9C 2X38A 3UMVA 2RKKA 2P9PG 4FJZA 3DPDA 3CQGB 3UUXA 2WXOA 3FU6A 4WUYA 3UKUG 3EHMA 3PRZA 1FVHA 1E7UA 4C0EA 4OAUC 2P9KG 1KLXA 2PL2A 4N2SA 4HRMB 1OCZE 4OAVB 3LS8A 4FHKA 5JHAA 4DI4A 1MQSA 3LVRE 5FT9A 4CT4A 4BSZB 1W3BA 4GZCA 4LNGA 3MJWA 3J5QB 4I6GA 3BG1B 5ENTD 3TL5A 3CK7A 1Z5SC 1ELWA 2XRZA 1K1AA 2YHEA 2R5SA 2ZU6B 3UINC 3ML8A 2OOEA 2X6HA 3QNKA 3HYMB 1TEZA 2MRIA 1UJJA 4MKTA 4EZKA 3JQ1A 3AG3E 3FU0A 4G26A 4B93B 1U3DA 4JL0A 4BT9A 4YDWA 4JVSA 3CVUA 3PE4A 4CEMA 1XNFA 3CGHA 3SZ7A 4LCTA 3JQ0A 3HHMA 5EYLA 4PDXA 4DX1A 2XS1A 5KJMA 3UXGA 1TNBA 3ASDA 5ITZF 4CZ2D 4U8VD 2FI7A 4NIKA 2XCBA 3JUEA 1MX2A 1NA3A 3EHQA 3ZVVA 1JWFA 4B89A 3FEYA 3CVQA 4UWKA 4WWOA 2AXVA 5KNHD 3FULA 2KM4A 4RG9A 1MX6A 2PQNA 3C98A 3IV0A 3TWWA 5G04C 3PH0C 2P9LG 4ATZD 4UI9K 2LXLA 4KVMA 4J8FA 4LERA 4BSXA 4AY6A 5B1AE 1Z3XA 4U0UA 1HE8A 4A3VA 5KCMA 2ZGDA 4TUMA 5FINA 4F53A 2WM9A 1N9AA 1S70B 3E34A 3Q15A 4MLPA 3CVPA 4I6JA 4GTPA 3HXEA 4GTVA 3PE3A 3CK9A 1PAQA 2C0MA 3SD5A 5T3RA 3ENEA 1XGWA 2JEKA 4G8KA 3V2XA 5LOZA 2MHKA 3R9AB 2C0LA 3HVEB 1EDUA 4XE0A 2A5EA 1Z3YA 1FCHA 1UOHA 3J5PA 4A1SA 2AJAA 4BFRA 5LCWC 3MKQB 4EPZA 2V4LA 1LD8A 5EKQD 2L0IA 1TJFA 4MBGA 2I2OA 3ZFWA 4JXTA 4U07A 4I6EA 3CHRA 2BKGA 2EILE 3PUKA 3HG0D 5IY5E 5ANLA 4UQZA 5G05J 3T5XA 2KCKA 3TWVA 4M3OA 4JEUA 3CVWA 1IKND 2L0TB 4XZ4A 4BY6A 2CG2A 4EECA 1TNYA 3O4ZA 5CEAA 3FU5A 4JHKA 4AP2A 2HE0A 4CYMD 2J49A 2WQ6A 2OEWA 2YHCA 4Y6CA 3FH7A 1HH8A 3T9KA 4KVOA 2R2LA 3X2QE 3RO2A 4GYWA 2PQRA 1NL4A 4M7CA 3G2SA 3U9WA 2WXKA 3UPVA 3FTYA 3DSUA 4UWFA 5JMND 4PUCA 1SVXA 1YA0A 4GU5A 3ONLA 1IXVA 1YYHA 3FUDA 3NBNB 3T5VA 5ENRD 4BTBA 4LNUD 3PZ4A 1GW6A 4UWHA 3KD7A 4AJWA 4L23A 1BPOA 2DYSE 1TNUA 4Y6WA 2XS8A 2ZXWE 1UW4B 2KC7A 2P9NG 4FLHA 1IYGA 4WWPA 4HI9A 3AG4E 3AJIA 5BXOA 3EU9A 3UM3A 3G2TA 1ZBPA 4DPRA 2L6JA 2CFUA 2FO7A 3CIAA
chains in the Genus database with same CATH topology
1E90A 2WXFA 3FUJA 4DK5A 2FEZA 3OXLA 3QWWA 4YVOA 3LVQE 2I1KA 4HORA 4KYOB 2WXRA 3FFLA 2X6KA 1JPLA 2XEVA 3IBEA 4DLOA 2IOLA 4CGVA 3QDNA 4AIFA 4XKCA 5AYWD 2AXZA 4CDNA 4HOSA 2XHEA 4DLQA 4AOFA 2GGFA 1HS6A 2VGXB 3NQPA 2R17C 3B7TA 3CHMA 5CMYA 5FZRA 1QNFA 1B89A 3HDXA 1U3CA 4N2QA 3ASHA 5FZSA 2WQ7A 3ULQA 2HO1A 4P29A 2VTBB 2GRLA 3RKVA 4GZ6A 4U0SA 3LDZA 2KCVA 3BG0B 4G2VA 5JHBA 3LKUA 4L1BA 3ZYLA 4ANUA 3L22A 3QJZA 1UG3A 2HR2A 4UWGA 1VDYA 5ARGA 4BX9A 4WNDA 4UWLA 1S0PA 3CHQA 4TUUA 3PUJA 1ZU2A 4N3CA 2J4BA 1KT1A 1FVFA 2X6IA 2MOWA 3TAXA 3AS5A 4HOTA 4WNEA 5BV1A 4GMLA 3PVLA 4UI9C 2X38A 3ZW3A 3UMVA 1OUVA 2GW1A 1HO8A 3D9LA 2KZTA 2C2LA 4FADA 4FJZA 3DPDA 3CQGB 3E4BA 5BT1A 4BT8A 2XPIA 3UUXA 2FF4A 4UQXA 2WXOA 3FU6A 1HFAA 3LJ3A 3QAQA 4PH4B 4WUYA 3L17A 3CHSA 2WPVA 4BX8A 2PM6A 3EHMA 4CDRA 3PRZA 1WM5A 2VSNA 3QOUA 3LY9A 1FVHA 2VSXE 1X5BA 1NZNA 1E7UA 5E76A 4GA1A 4C0EA 4LRZA 3LEWA 4OYSA 3PREA 3EHNA 4J8SA 3SGHA 3MGBA 3ZYMA 1SZAA 1OWLA 4GB9A 1HU3A 1KLXA 2WXHA 4HXIA 4IULA 2PL2A 2UWJG 3IHVA 5FJYA 3MZLB 4N2SA 3FUNA 3MV3B 4DI3A 4RSYA 4GZ5A 4U63A 5J90A 4HFGA 4MRUA 3LS8A 4FHKA 5JHAA 3MKQA 3ZYKA 3D9MA 2M63A 4DI4A 1WY6A 3NF1A 3FUKA 2IONA 1MQSA 3P2BA 3LVRE 5FT9A 1UN8A 2DBAA 3IKOB 4CT4A 4WNFA 3D9KA 4B0ZA 1Y6IA 3TXNA 3CVYA 4G1TA 2KCLA 1W3BA 2XQ0A 4GZCA 5KJNA 3MJWA 4GZDA 4I6GA 3BG1B 2EQXA 3WXXA 4UQYA 4FLBA 3TL5A 3CK7A 4KZCA 1ELWA 3D9IA 4I1OB 4IYPA 4AM9A 4RG6A 1KT0A 4EQFA 2KZTB 4V3IA 2XRZA 2RG8A 2YHEA 3I4GA 3T8MA 1E8XA 4FULA 1OWPA 3RJVA 4Q94A 2R5SA 2ZU6B 2DIWA 3OTNA 4ME2A 2KATA 3ESLA 2WVIA 3ML8A 3SF4A 2CG3A 2OOEA 3G2WA 4AVXA 5CCLA 1SZ9A 4I9EA 3U66A 3PEVB 1IHGA 2NXPA 2X6HA 2Y4UA 3O48A 2OVBA 3QNKA 5M72A 3HYMB 4XKBA 4C0MA 1TEZA 4KXKB 2MRIA 1UJJA 3RRNB 4MKTA 3UQ3A 4U0ZA 2GRMA 4OVVA 4EZKA 4URKA 2E2EA 5BNWA 3JQ1A 2WXMA 3CV0A 2AWIA 4ILHB 3CKCA 1TJCA 4I1MA 5JJ6A 4TRQA 2HYZA 3AU5A 3SHFA 4AY5A 3FU0A 4G26A 4I1AA 4CGWA 1U3DA 2YNQA 1MHQA 4JL0A 4BT9A 2IJGX 4KZ0A 4I43A 4JVSA 4D10C 5FZQA 3VLDA 3CVUA 3RRMB 3PE4A 2IFUA 3CSTA 3FTXA 4CEMA 1XNFA 2XGMA 3CGHA 2A4ZA 4LCTA 3SZ7A 3ZN3A 3LCAA 4JZYA 3JQ0A 2L9BA 2LAHA 1JWGA 3MYVA 3QKYA 3HHMA 3RO3A 3ZPJA 3NZUA 4PDXA 1Z6TA 3PNTB 3S2AA 3KAEA 4OVUA 4PS3A 4JC8A 3MEKA 5KJMA 3S7FA 3ZXSA 2XPYA 3ASDA 3KS2A 3QB2A 4N39A 4ACLA 3FH5A 2WXJA 3ZHEA 3LY7A 5FQ4A 3CVNA 3FTVA 4NRHB 1ELKA 1QQEA 2IU1A 2X6FA 3OXFA 4F1SA 3QK0A 4NACA 2V5FA 3U4TA 2FI7A 3CQCB 2XCBA 4G23A 1NA3A 3TJPA 4EZJA 3BEEA 3SNXA 3ZVVA 4F3VA 1JWFA 4N3BA 4E6HA 5C2YA 3APFA 5FQ7A 4B89A 2AVPA 3FEYA 4FHJA 3FEXA 4YVQC 3S7BA 3P1UA 4GCNA 3S7DA 4FP7A 3CVQA 5BV0A 4UWKA 3JUIA 2E0IA 4WWOA 3CVLA 2AXVA 2HM8A 3S7JA 3FDHA 3FULA 3FUFA 3FHEA 1LF8A 1H2UA 3OXGA 2KM4A 3FTWA 4XIFA 4RG9A 5D0OD 5LFAA 1EF1C 1OWOA 2PQNA 4APOA 3SI5A 1ELRA 3FWVA 3C98A 4CRWA 3GW4A 1H19A 4GCOA 2QY7A 3D9NA 1IQUA 3IV0A 5G04C 3ASGA 3PH0C 4AEZC 2FBNA 5FTPA 3L6AA 4GA0A 3AS4A 4UI9K 2ILRA 4HS2A 4HLEA 4KVMA 3L08A 4ILGA 1INZA 4J0UA 5G04J 4GZ3A 5LP0A 4J8FA 2Y4TA 3LXUX 2WQHA 4LERA 4BSXA 3GYZA 3L13A 4AY6A 4WAFA 1Z3XA 4U0UA 3LY8A 1HE8A 3ONKA 5EDSA 1QZ2A 3ZRHA 3D9JA 4A3VA 2V0PA 4K0RA 5KCMA 1HXIA 4L7TA 3EDTB 4F53A 2JLBA 3CK8A 4LEUA 3MKRA 3Q49B 2P58C 2WM9A 3PDNA 4UI9J 1E96B 2DCPA 3Q15A 4MLPA 2WXNA 4FA6A 2FULA 1UN9A 3K9IA 4WNGA 2X3MA 2WXLA 4JA9A 3R7QA 4FJYA 4APFA 3CVPA 2LAIA 3KEZA 4ILIA 4PS7A 3ZIMA 4A1GA 4GMJA 2CHXA 4I6JA 1NA0A 1E8YA 2I9CA 2BUGA 4N3AA 4GA2A 4KT6B 1SQMA 5CHEE 4JEHA 4NQ0A 5EX3A 1HF8A 4I2ZA 5KJKA 4G11A 1E7VA 3PE3A 4G24A 2J4DA 4A3TA 2BF0X 3CK9A 5G2NA 3RU0A 1PAQA 5JJTA 2CFZA 1EPUA 2C0MA 3SD5A 2WXGA 1E8WA 2BTDA 4FC8A 5T3RA 3ENEA 3CVVA 1XGWA 2JEKA 3IEGA 3L16A 3QC1A 5LOZA 5BPPA 3CR3A 2MHKA 3R9AB 2Y3AA 4N5CA 2VJ8A 4WWNA 3R7RA 3UT7A 3FH8A 1P5QA 3N71A 4Q96A 3VTXA 4YNDA 4TV3A 4Q69A 2C0LA 3FY4A 3HVEB 1EDUA 2LSVA 2ONDA 2CHWA 3G2UA 5ARFA 4XE0A 2J9QA 2OVFA 3UT8A 3AU4A 1PY1A 3RIBA 2RD0A 4EBAG 2WMOA 5DIZA 3TG5A 5LCWJ 1Z3YA 3TXMA 2XPZA 4KMOA 3SFZA 2I6HA 2XGOA 1FCHA 3I3NA 4A1SA 5AIJA 4BFRA 5LCWC 3MKQB 5CMWA 3CKBA 4BTAA 2V4LA 5A7DB 4EPZA 3SBTB 3TGOA 3LPZA 5EKQD 2L0IA 3U3WA 1TJFA 3OAWA 2I2OA 4I2WA 3MA5A 3RRUA 4HVBA 2AW6A 2AXUA 2WMNA 2XGSA 3I5PA 3ZFWA 5HI7A 4E85A 3URZA 5BUZA 3QARA 4JXTA 5HQ8A 4IN3B 3CHPA 4U07A 4I6EA 5D0QD 3CHRA 5FQ8A 4JHJA 3PUKA 2A5UA 3FTSA 3PS6A 4H7XA 2J07A 5ANLA 4UQZA 3B7SA 5G05J 2R59A 2KCKA 4MS6A 4M3OA 3T5XA 3EIQC 4JHRA 3EIJA 4JEUA 3CVWA 2IQCA 2L0TB 3CLJA 3NZSA 4L2YA 4QFVA 4XZ4A 2VSYA 4BY6A 2PZIA 4NURA 2YINA 1JUQA 2VSOE 5G05C 3HIZA 5EX0A 4ATGA 4J8EA 1EYHA 2I1JA 1HZ4A 3Q47B 3JYSA 2CG2A 1IQRA 4EECA 3HVEA 3FUEA 2NSZA 1HG2A 2J08A 3D3MA 4GAAA 2Q7FA 5CCMA 4GYOA 3U64A 4AXHA 3O4ZA 3FTUA 1N52A 4CT0A 3FU5A 4HOQA 2XCCA 3B13A 4JHKA 2WXQA 1A17A 5T8IA 4ABNA 4AP2A 4W9RA 4C9BB 3EJNA 1HG5A 1H2TC 2J49A 3APDA 4GPKA 3DBSA 3JCKC 2YHCA 4Y6CA 5G55A 2WQ6A 3PNLB 3FH7A 1HH8A 4KVOA 3B7UX 3QWVA 3VLFA 3Q5MA 2NC9A 4JW1A 3FUHA 4KBQA 3RO2A 5T4YA 4HOUA 5A6CA 3MCXA 4GYWA 5AJLA 4AV7A 4J8DA 2PQRA 5E75A 4J6IA 5LX8A 2X6JA 3D9OA 2UY1A 3CSFA 3G2SA 4ANWA 5J08A 3MV2B 3ZEFA 1N54A 3B7RL 3U9WA 2OV8A 2J09A 3TG4A 1DNPA 2WXKA 3AS8A 3CEQA 2V8SE 3UX4A 3UPVA 1H2VC 4LUNU 3FTYA 1H6KA 4A55A 4UWFA 1Y8MA 2UY1B 3PZDA 2VGXA 4PUCA 2IF4A 3ZHEB 4JPSA 3CVXA 2LNIA 2VYIA 3G2VA 1E8ZA 3LYAA 4XX5A 1YA0A 4ANVA 4GU5A 3UT4A 4B8AA 3SBSA 3D9PA 4B94A 3CHOA 4EZLA 3ONLA 4U04A 3FUDA 3FU3A 4XI9A 2VQ2A 2WXIA 3FUIA 3ML9A 3MX3A 3T5VA 2CHZA 5AJDA 3APCA 4BTBA 5A23A 2QFCA 3GZ2A 4CDMA 1PC2A 2VGYA 5DBKA 1NP7A 4K03A 1GW6A 3ASFA 3GZSA 4ACKA 4CCAA 4B8CB 4UWHA 3KD7A 4AJWA 1UJKA 1L5JA 4XI0A 4L23A 1BPOA 2XRYA 3ZGQA 4R7LA 4Y6WA 5FQ6A 2PM7A 4I9CA 4JA7A 3L54A 3ZYQA 5KJLA 3VLEA 1UW4B 5C1DA 2WB2A 3PEUB 1WAO1 2IOSA 2KC7A 3IHYA 4FLHA 3VTYA 3GZ1A 3RK6A 3QWPA 2LO6A 2WXPA 4L2LA 4U8HA 1HX8A 4F7AA 1IYGA 4WWPA 5ANRA 4O6FA 5FWQA 5AENA 4H7YA 5JJ7A 1OWMA 1OWNA 4FU3A 4RVBA 2YQ8A 4DJAA 4ANXA 4BWRA 3G2TA 1DVPA 1ZBPA 4PS8A 5BW8C 4DPRA 3FTZA 4EBAA 3FUMA 3Q4AB 1H0AA 4GYYA 2L6JA 5ENNA 3I4RB 2CFUA 2FO7A 4IRUA 2LSUA 4G25A 4I17A 2VTBA 3CIAA 3ESKA 3FP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AY6 A;  5G05 C;  5EX0 A;  4U0U A;  4J8E A;  2FEZ A;  3LY8 A;  3OXL A;  1HZ4 A;  3QWW A;  3Q47 B;  3JYS A;  2KAT A;  4ME2 A;  4YVO A;  1QZ2 A;  4KYO B;  3FFL A;  4HOR A;  2XEV A;  5CCM A;  3SF4 A;  4CGV A;  2Q7F A;  3QDN A;  4GYO A;  2OOE A;  5CCL A;  1HXI A;  4AIF A;  4I9E A;  3EDT B;  1IHG A;  2JLB A;  2Y4U A;  3CK8 A;  3O48 A;  3MKR A;  4HOQ A;  2XCC A;  3Q49 B;  2P58 C;  3HYM B;  1A17 A;  3PDN A;  4UI9 J;  4KXK B;  5M72 A;  4W9R A;  1E96 B;  4HOS A;  3UQ3 A;  2VGX B;  3Q15 A;  4U0Z A;  2E2E A;  5BNW A;  3K9I A;  5FZR A;  4WNG A;  4GPK A;  1B89 A;  2YHC A;  4JA9 A;  4Y6C A;  3ASH A;  3CV0 A;  5FZS A;  4N2Q A;  3ULQ A;  1HH8 A;  2HO1 A;  3CKC A;  1TJC A;  3RKV A;  4GZ6 A;  5JJ6 A;  3CVP A;  3QWV A;  2HYZ A;  3Q5M A;  5AYW D;  4U0S A;  4AY5 A;  2NC9 A;  4G26 A;  2KCV A;  4G2V A;  4I1A A;  4CGW A;  4JL0 A;  4BT9 A;  1NA0 A;  3LKU A;  4KBQ A;  3RO2 A;  2BUG A;  2HR2 A;  4HOU A;  4N3A A;  5A6C A;  5ARG A;  5FZQ A;  4GA2 A;  4GYW A;  5KJK A;  4WND A;  3PE4 A;  4J8D A;  2PQR A;  2IFU A;  4NQ0 A;  5CHE E;  4I2Z A;  3FP3 A;  1XNF A;  2XGM A;  5EX3 A;  3SZ7 A;  1ZU2 A;  4N3C A;  2UY1 A;  3LCA A;  3ZN3 A;  3MV2 B;  3PE3 A;  4G24 A;  1KT1 A;  3QKY A;  3TAX A;  3CK9 A;  3RO3 A;  3AS5 A;  3RU0 A;  3TG4 A;  4WNE A;  3ZPJ A;  2C0M A;  3AS8 A;  3CEQ A;  5JJT A;  4HOT A;  4UI9 C;  3UPV A;  1OUV A;  2GW1 A;  3KAE A;  1Y8M A;  2UY1 B;  3IEG A;  2C2L A;  2VGX A;  2MHK A;  3MEK A;  2IF4 A;  3E4B A;  3R9A B;  3ZHE B;  5BT1 A;  4BT8 A;  2XPI A;  4N5C A;  3UUX A;  5KJM A;  3S7F A;  2LNI A;  2VYI A;  2FF4 A;  4UQX A;  1P5Q A;  3N71 A;  4WUY A;  3ASD A;  3LYA A;  3KS2 A;  4N39 A;  3VTX A;  1YA0 A;  4YND A;  2WPV A;  4CDR A;  2C0L A;  3LY7 A;  3ZHE A;  4B94 A;  3CVN A;  2LSV A;  4NRH B;  1WM5 A;  1QQE A;  2OND A;  2VSN A;  3OXF A;  3QOU A;  4U04 A;  5ARF A;  3LY9 A;  2J9Q A;  4LEU A;  4XI9 A;  1NZN A;  2VQ2 A;  4GA1 A;  3RIB A;  2V5F A;  3U4T A;  2FI7 A;  5DIZ A;  3TG5 A;  5LCW J;  4BTB A;  2QFC A;  3GZ2 A;  1PC2 A;  2VGY A;  2XCB A;  5DBK A;  4G23 A;  1NA3 A;  1KLX A;  2I6H A;  2XGO A;  3BEE A;  4F3V A;  2PL2 A;  1FCH A;  2UWJ G;  5FJY A;  4N3B A;  4A1S A;  3KD7 A;  4N2S A;  4XI0 A;  2AVP A;  5LCW C;  4YVQ C;  3MV3 B;  3CKB A;  3S7B A;  5A7D B;  4GCN A;  3S7D A;  3ZGQ A;  3CVQ A;  4GZ5 A;  4BTA A;  3TGO A;  4Y6W A;  3LPZ A;  4I9C A;  4JA7 A;  3CVL A;  5KJL A;  5EKQ D;  3S7J A;  5C1D A;  3U3W A;  1WAO 1;  2KC7 A;  3OXG A;  4XIF A;  5D0O D;  4RG9 A;  4I2W A;  3VTY A;  3GZ1 A;  3MA5 A;  3NF1 A;  2PQN A;  2XGS A;  3QWP A;  3ZFW A;  4APO A;  5HI7 A;  3URZ A;  1ELR A;  5FT9 A;  5HQ8 A;  1IYG A;  3FWV A;  2DBA A;  4IN3 B;  4O6F A;  4U07 A;  5D0Q D;  3GW4 A;  4WNF A;  4GCO A;  4ABN A;  4H7Y A;  4G1T A;  5G04 C;  2KCL A;  1W3B A;  3ASG A;  5KJN A;  4H7X A;  2FBN A;  3WXX A;  5JJ7 A;  5FTP A;  2YQ8 A;  4UQY A;  4GA0 A;  3AS4 A;  4UQZ A;  5G05 J;  3CK7 A;  2KCK A;  1ELW A;  4JHR A;  4UI9 K;  4AM9 A;  4BWR A;  4RG6 A;  1KT0 A;  1ZBP A;  5BW8 C;  4EQF A;  3Q4A B;  4GYY A;  4J0U A;  5G04 J;  2L6J A;  4GZ3 A;  4J8F A;  2FO7 A;  2VSY A;  2LSU A;  2Y4T A;  4G25 A;  4I17 A;  3ASF A;  2PZI A;  3ESK A;  2WQH A;  2R5S A;  3RJV A;  3GYZ A; 
#chains in the Genus database with same CATH topology
 4YVO A;  1H6O A;  4HOR A;  2XEV A;  4K5C A;  4AIF A;  5KNG A;  5BXU A;  5HRY A;  1N11 A;  4AOF A;  2GGF A;  3NQP A;  4HLL A;  5ENS D;  5FZR A;  1U3C A;  2VTB B;  3LDZ A;  2KCV A;  3UM2 A;  3C3Q A;  4G2V A;  1FPP A;  3ZYL A;  3V79 K;  1UG3 A;  4WND A;  3CHQ A;  2J4B A;  3PZ1 A;  4HOT A;  4WNE A;  4GML A;  2GW1 A;  2XEH A;  3E4B A;  2FF4 A;  3HXD A;  1HFA A;  4PH4 B;  3L17 A;  3CHS A;  4CDR A;  2PM6 A;  1BI8 B;  5HKP A;  4LRZ A;  2V5Q C;  3UI2 A;  3PRE A;  3EHN A;  3BQO A;  3MGB A;  1SZA A;  1OWL A;  4GB9 A;  4HXI A;  3IHV A;  1V54 E;  5J90 A;  4MRU A;  3KSL A;  3MKQ A;  3ZYK A;  2M63 A;  5CED B;  3FUK A;  3P2B A;  2DBA A;  4WNF A;  4B0Z A;  3TXN A;  4G1T A;  3V31 A;  3WXX A;  2JAB A;  4UQY A;  4KZC A;  4IYP A;  4AM9 A;  4RG6 A;  4EQF A;  2RG8 A;  4FUL A;  1OWP A;  3L82 A;  2KAT A;  2WVI A;  3DST A;  4HNA D;  3BU8 A;  3ULY A;  5CCL A;  4AVX A;  4I9E A;  2RFM A;  3PEV B;  2Y4U A;  4J8Y A;  5M72 A;  4XKB A;  3UQ3 A;  4U0Z A;  4URK A;  2E2E A;  2AWI A;  4ILH B;  1TJC A;  2B0O E;  5JJ6 A;  1TN6 A;  4AY5 A;  3SHF A;  3EUV A;  2YNQ A;  2IFU A;  3CST A;  2XGM A;  2A4Z A;  3LCA A;  5JA4 D;  4LNB A;  4O60 A;  1JWG A;  1ZB1 A;  3MYV A;  3QKY A;  3SFX A;  2IY0 C;  3NZU A;  2V4H C;  2EIN E;  4OVU A;  4RLY A;  5H7P A;  3S7F A;  3QB2 A;  4X8Q A;  5ENP D;  3Q78 A;  5ENO D;  4NRH B;  4NAC A;  3HXF A;  3RSE G;  3BEE A;  1FT2 A;  4A63 B;  4N3B A;  5EID A;  5C2Y A;  3HRA A;  5FQ7 A;  4FHJ A;  3SY2 A;  2VGE A;  5BV0 A;  4FP7 A;  2H6I A;  2E0I A;  3DWL G;  3FHE A;  1LF8 A;  1H2U A;  3OXG A;  4XIF A;  5D0O D;  1OWO A;  3FWV A;  4GTS A;  3L6A A;  4GA0 A;  4UUC A;  3Q9U C;  2ILR A;  3L08 A;  2LXM A;  5G04 J;  3TWQ A;  3AAA C;  1QZ2 A;  4TXR A;  3ZRH A;  3D9J A;  3CK8 A;  4LEU A;  2P58 C;  4UI9 J;  1E96 B;  3E37 A;  1D9S A;  3K9I A;  5AN8 A;  4FJY A;  4BER A;  4ILI A;  4GMJ A;  3ZU7 B;  1NA0 A;  2I9C A;  3UIP C;  4G11 A;  1OCR E;  4A3T A;  2BF0 X;  3RU0 A;  5G2N A;  3IXE A;  1E8W A;  2BTD A;  3KEA A;  3CVV A;  3IEG A;  3CR3 A;  2Y3A A;  4N5C A;  2VJ8 A;  2QZA A;  5EYP F;  4YND A;  4TV3 A;  2LSV A;  1TNZ A;  2J9Q A;  3HXC A;  3RIB A;  2RD0 A;  5DIZ A;  3TG5 A;  2OEV A;  4KMO A;  2GRR B;  3I3N A;  4YDO A;  3CKB A;  3T8K A;  3TGO A;  3LPZ A;  4I2W A;  3MA5 A;  3RRU A;  2AXU A;  5BUZ A;  3URZ A;  3QAR A;  4IN3 B;  2H6H A;  2A5U A;  3FTS A;  2DVW A;  1N0R A;  3B7S A;  2R59 A;  4MS6 A;  5CBN A;  2XZD G;  4QFV A;  4NUR A;  1JUQ A;  2YIN A;  2VSO E;  5G05 C;  4ATG A;  1HZ4 A;  3Q47 B;  1IQR A;  3HVE A;  3FUE A;  5CCM A;  1HG2 A;  4GYO A;  3TWS A;  5AQA A;  3UTM A;  4AXH A;  3WG7 E;  2EIJ E;  2WXQ A;  4C9B B;  3EJN A;  2IEJ A;  5CRV A;  2MYO A;  3Q5M A;  2NC9 A;  1H6P A;  3FUH A;  3L9T A;  4KBQ A;  4HOU A;  4AV7 A;  4J8D A;  4G8L A;  3CSF A;  5J08 A;  3UX4 A;  3ASO E;  3PZD A;  2IF4 A;  3PZ2 A;  3JXJ A;  4JPS A;  2EIM E;  3CVX A;  2LNI A;  2GRN B;  1E8Z A;  4ANV A;  3UT4 A;  3HXB A;  2VQ2 A;  3ML9 A;  3APC A;  4CDM A;  4K03 A;  4YDY A;  3GZS A;  4TXP A;  1UJK A;  1L5J A;  4GTM A;  3C5R A;  5FQ6 A;  4GTT A;  4I9C A;  1NFI E;  1FT1 A;  2FO1 E;  3ZYQ A;  3VLE A;  5C1D A;  3EU5 A;  1WAO 1;  3GZ1 A;  3QWP A;  2LO6 A;  4L2L A;  5ANR A;  4O6F A;  3E33 A;  1NI1 A;  5JJ7 A;  2YQ8 A;  4DJA A;  4PS8 A;  5BW8 C;  3Q4A B;  1H0A A;  3I4R B;  4IRU A;  2LSU A;  1E90 A;  2WXF A;  2ETA A;  3FUJ A;  2FEZ A;  4GPM A;  3QWW A;  1O1R A;  2I1K A;  3BUA A;  4DLO A;  2X6K A;  1JPL A;  3IBE A;  2OCC E;  3QDN A;  4LG6 A;  2XHE A;  1HS6 A;  5CMY A;  2QYU A;  2HO1 A;  4P29 A;  2GRL A;  4GZ6 A;  5CRU A;  4TUU A;  1BU9 A;  3PUJ A;  1ZU2 A;  4N3C A;  3JXI A;  1KT1 A;  3D9H A;  3ZW3 A;  1OUV A;  2GRP B;  2KZT A;  2C2L A;  2LUH A;  4BT8 A;  2XPI A;  1Q2Z A;  4UQX A;  3LJ3 A;  4U96 D;  1OXJ A;  4BX8 A;  1WM5 A;  4O1P A;  1X5B A;  5E76 A;  5AQ7 A;  4J8S A;  3ZYM A;  2WXH A;  4IUL A;  5FJY A;  3MZL B;  4DRX E;  3FUN A;  3MV3 B;  4DI3 A;  4GZ5 A;  2P2C P;  4HFG A;  3DXK G;  1O1S A;  1WY6 A;  3NF1 A;  4K5B A;  3TWX A;  3IKO B;  2KCL A;  4GZD A;  3V30 A;  3D9I A;  2Y69 E;  1KT0 A;  4LSZ E;  3I4G A;  3T8M A;  3RJV A;  2DIW A;  1DCQ A;  4ME2 A;  2ZIS A;  3E30 A;  3SF4 A;  2CG3 A;  3U66 A;  1IHG A;  2NXP A;  3E32 A;  2OVB A;  4C0M A;  3RRN B;  1A5E A;  3C72 A;  2GRM A;  4OVV A;  1LTX A;  5BNW A;  3NB2 A;  3CKC A;  1SA5 A;  4TRQ A;  2HYZ A;  2B6C A;  4I1A A;  4CGW A;  3Q75 A;  2EIK E;  2IJG X;  4D10 C;  5FZQ A;  3VLD A;  3RRM B;  4JZY A;  2L9B A;  2LAH A;  3ZPJ A;  3UIO C;  3S2A A;  1LD7 A;  3ABL E;  3KAE A;  4PS3 A;  3TWU A;  4JC8 A;  3NOC D;  3NAW A;  4N39 A;  4ACL A;  2WXJ A;  3LY7 A;  3CVN A;  3FTV A;  1ELK A;  3OXF A;  4HQD A;  3QK0 A;  2V5F A;  3U4T A;  3ABM E;  3ULE G;  2DZO A;  4DX7 D;  3TJP A;  4EZJ A;  3SNX A;  2AVP A;  3S7B A;  3P1U A;  4GCN A;  3S7D A;  1S64 A;  4BES A;  2HM8 A;  3S7J A;  3FDH A;  3FUF A;  3FTW A;  1EF1 C;  4APO A;  1ELR A;  1DCE A;  4CRW A;  3ISM C;  1N4Q A;  4GCO A;  2QY7 A;  3D9N A;  3ASG A;  3RAU A;  5FTP A;  4HS2 A;  4HLE A;  3UKR G;  4ILG A;  4J0U A;  4GZ3 A;  5AQ9 A;  3UM1 A;  5LP0 A;  2Y4T A;  2WQH A;  4GTR A;  1D8E A;  3GYZ A;  3LY8 A;  2H6F A;  2XEE A;  2V0P A;  1HXI A;  3Q49 B;  2QYJ A;  2H6G A;  4FA6 A;  2FUL A;  1UN9 A;  4WNG A;  2WXL A;  4JA9 A;  2XEN A;  4APF A;  3KEZ A;  3ZIM A;  4PS7 A;  4A1G A;  2CHX A;  1V55 E;  1MYO A;  4N3A A;  4GA2 A;  4ZHB A;  4KT6 B;  4NQ0 A;  5EX3 A;  1HF8 A;  5KJK A;  1RW2 A;  4DUI A;  5B1B E;  2F8Y A;  4F6R D;  5JJT A;  2CFZ A;  1EPU A;  3Q7F A;  2DYR E;  4FC8 A;  2R05 A;  3L16 A;  5BPP A;  3R7R A;  1P5Q A;  3N71 A;  4Q96 A;  4Q69 A;  3FY4 A;  3DEP A;  3UT8 A;  3AU4 A;  3DSS A;  4HBD A;  2WMO A;  3DRA A;  3TXM A;  3F6Q A;  3R9M A;  1WDY A;  3SFZ A;  2XGO A;  1MZC A;  5AIJ A;  5CMW A;  4BTA A;  5ENQ D;  1K3Z D;  3OAW A;  2AW6 A;  3I5P A;  2WMN A;  2XGS A;  5HI7 A;  4E85 A;  5HQ8 A;  1OT8 A;  5D0Q D;  2F0Y A;  1TN8 A;  4H7X A;  4BET A;  3EIQ C;  4JHR A;  3NZS A;  4L2Y A;  2P9S G;  5EN5 D;  3C3O A;  3HIZ A;  1JCS A;  3JYS A;  2NSZ A;  2J08 A;  3D3M A;  3DSX A;  3U64 A;  4BEP A;  3FTU A;  1N52 A;  4CT0 A;  2XCC A;  3B13 A;  1A17 A;  1JCQ A;  4W9R A;  4DX6 D;  3APD A;  3JCK C;  1N4R A;  5AAR A;  1QBQ A;  3B7U X;  3QWV A;  1IHB A;  4JW1 A;  5T4Y A;  5A6C A;  3MCX A;  5AJL A;  4TXQ A;  5LX8 A;  2X6J A;  3D9O A;  3MV2 B;  3ZEF A;  1N54 A;  3B7R L;  3AS8 A;  3CEQ A;  2V8S E;  1WG0 A;  4A55 A;  1H6K A;  2VGX A;  3ZHE B;  3SFY A;  1YMP A;  3G2V A;  4XX5 A;  1N0Q A;  4B94 A;  2L6B A;  2XZT G;  3D9P A;  3CHO A;  4QQI A;  3SBS A;  4U04 A;  3FU3 A;  4XI9 A;  1KZO A;  2WXI A;  4ZFH A;  3MX3 A;  4JB8 P;  5AJD A;  1DC2 A;  2QFC A;  1PC2 A;  2VGY A;  3SQV A;  5DBK A;  4HB5 A;  4B8C B;  4XI0 A;  3ZGQ A;  4R7L A;  3L54 A;  5KJL A;  2WB2 A;  2IOS A;  3IHY A;  3VTY A;  3B95 A;  1N4P A;  4U8H A;  5CER B;  5AEN A;  3DXM G;  5KWD A;  1DVP A;  4EBA A;  3FTZ A;  3ASF A;  3Q73 A;  4HRL A;  2QC9 A;  4KYO B;  2IOL A;  3W9F A;  2BED A;  4XKC A;  5AYW D;  4CDN A;  4HOS A;  1S63 A;  3V2O A;  1OCO E;  3B7T A;  3CHM A;  1N4S A;  3ASH A;  2WQ7 A;  3ULQ A;  2KXP C;  3DSW A;  4U0S A;  1TN7 A;  3BG0 B;  5JHB A;  4L1B A;  3PZ3 A;  4ANU A;  3L22 A;  2F8X K;  3QJZ A;  2HR2 A;  1AP7 A;  5ARG A;  5AAO A;  4UWL A;  2X6I A;  2MOW A;  3TAX A;  5BV1 A;  1BD8 A;  1HO8 A;  3D9L A;  4DX5 D;  4FAD A;  5BT1 A;  2R03 A;  2ETC A;  3QAQ A;  2WPV A;  2Y1L E;  5HS0 A;  2VSN A;  3QOU A;  3LY9 A;  2VSX E;  1NZN A;  4GA1 A;  3ZNG A;  1YCS B;  3NOG D;  4XEI G;  3LEW A;  4OYS A;  3DPY A;  2PNN A;  3SGH A;  1QYM A;  1HU3 A;  2UWJ G;  1N94 A;  3ABK E;  4RSY A;  4U63 A;  2DZN A;  1BI7 B;  5CBO A;  3D9M A;  1JCR A;  2ION A;  1UN8 A;  3D9K A;  1Y6I A;  3CVY A;  4DX2 A;  2XQ0 A;  5KJN A;  2EQX A;  2BKK B;  4U7E B;  4FLB A;  4I1O B;  4K5A B;  2RFA A;  2KZT B;  4V3I A;  1KPS B;  1E8X A;  5D2M C;  4Q94 A;  3OTN A;  3ESL A;  3G2W A;  1SZ9 A;  3O48 A;  4KXK B;  3C3R A;  4HI8 A;  2WXM A;  3CV0 A;  4I1M A;  3AU5 A;  5FIO A;  1MHQ A;  1MX4 A;  4KZ0 A;  4I43 A;  3UM0 A;  3FTX A;  3ZN3 A;  3RO3 A;  1TNO A;  4O1O A;  4N5Q A;  4Z68 A;  1Z6T A;  3PNT B;  5B3S E;  4C48 B;  3MEK A;  3Q9N C;  3ZXS A;  2XPY A;  4JD2 G;  3KS2 A;  4RQI A;  3FH5 A;  3ZHE A;  5FQ4 A;  1QQE A;  2IU1 A;  2X6F A;  4EHM A;  4F1S A;  3ASN E;  2F37 A;  3CQC B;  4G23 A;  4F3V A;  4E6H A;  3APF A;  3FEX A;  4YVQ C;  3JUI A;  1RZ4 A;  3CVL A;  5LFA A;  3SI5 A;  1KZP A;  3DEO A;  3GW4 A;  1H19 A;  1IQU A;  4AEZ C;  2FBN A;  3AS4 A;  3TWT A;  1INZ A;  1OCC E;  3LXU X;  3L13 A;  3KSQ A;  4WAF A;  5EIL A;  3ONK A;  3TWR A;  5EDS A;  2ZIR A;  4K0R A;  4L7T A;  3EDT B;  2JLB A;  2KBX A;  3MKR A;  3PDN A;  4GTO A;  2DCP A;  2WXN A;  2X3M A;  3SO8 A;  1TR4 A;  3R7Q A;  1K8K G;  1N95 A;  4U95 D;  2LAI A;  1E8Y A;  2BUG A;  1SQM A;  5CHE E;  4JEH A;  1BLX B;  4I2Z A;  3ZKJ A;  1E7V A;  4G24 A;  2J4D A;  5CEC B;  2WXG A;  4HRN A;  3B7B A;  1OY3 D;  3QC1 A;  2R02 A;  3DSV A;  3UT7 A;  4WWN A;  2DWZ A;  3FH8 A;  1MJ0 A;  3VTX A;  5ARF A;  2OND A;  2CHW A;  3G2U A;  2OVF A;  1PY1 A;  3AG1 E;  4EBA G;  3Q7A A;  5LCW J;  2XPZ A;  2I6H A;  5A7D B;  3SBT B;  3U3W A;  4HVB A;  3W9G A;  3CHP A;  5FQ8 A;  4JHJ A;  3PS6 A;  3ZUV B;  2J8S D;  2J07 A;  1TYQ G;  3EIJ A;  1O1T A;  2IQC A;  3CLJ A;  2VSY A;  2PZI A;  1SW6 A;  5EX0 A;  4J8E A;  1EYH A;  2I1J A;  4GAA A;  2Q7F A;  2Y0B G;  4ABN A;  4HOQ A;  2ZGG A;  5T8I A;  3ZXP A;  1HG5 A;  2IO2 C;  1H2T C;  4GPK A;  3DBS A;  5G55 A;  3PNL B;  3VLF A;  3EHR A;  1O5M A;  5E75 A;  4J6I A;  2UY1 A;  4ANW A;  2OV8 A;  2J09 A;  3TG4 A;  1DNP A;  1H2V C;  4LUN U;  1Y8M A;  2UY1 B;  2GRO B;  5KBA A;  2VYI A;  4GTQ A;  3LYA A;  1D8D A;  4B8A A;  4EZL A;  3FUI A;  2CHZ A;  5A23 A;  3GZ2 A;  1NP7 A;  4ACK A;  4CCA A;  2P9I G;  2XRY A;  3LJN A;  4J7W A;  5D66 A;  2ETB A;  2IO3 C;  4GMR A;  2PM7 A;  3Q79 A;  4JA7 A;  1AWC B;  3PEU B;  4U8Y D;  3RK6 A;  2WXP A;  4F7A A;  1HX8 A;  1G3N B;  5FWQ A;  4F1P A;  4H7Y A;  1SA4 A;  1OWM A;  1OWN A;  4FU3 A;  4RVB A;  4YDE A;  4ANX A;  4BWR A;  3FUM A;  4GYY A;  5ENN A;  4I17 A;  4G25 A;  2VTB A;  3ESK A;  3AG2 E;  3FP3 A;  4L9P A;  4DK5 A;  1X81 A;  3OXL A;  3LVQ E;  2WXR A;  3FFL A;  4CGV A;  5EIB E;  2AXZ A;  4DLQ A;  2VGX B;  2R17 C;  1QNF A;  1B89 A;  1U2V G;  3HDX A;  2NYJ A;  4N2Q A;  5FZS A;  3RKV A;  2P9U G;  1K1B A;  3LKU A;  4UWG A;  1VDY A;  4BX9 A;  1S0P A;  2GRQ B;  1FVF A;  5AQB A;  3AS5 A;  3PVL A;  4UI9 C;  2X38 A;  3UMV A;  2RKK A;  2P9P G;  4FJZ A;  3DPD A;  3CQG B;  3UUX A;  2WXO A;  3FU6 A;  4WUY A;  3UKU G;  3EHM A;  3PRZ A;  1FVH A;  1E7U A;  4C0E A;  4OAU C;  2P9K G;  1KLX A;  2PL2 A;  4N2S A;  4HRM B;  1OCZ E;  4OAV B;  3LS8 A;  4FHK A;  5JHA A;  4DI4 A;  1MQS A;  3LVR E;  5FT9 A;  4CT4 A;  4BSZ B;  1W3B A;  4GZC A;  4LNG A;  3MJW A;  3J5Q B;  4I6G A;  3BG1 B;  5ENT D;  3TL5 A;  3CK7 A;  1Z5S C;  1ELW A;  2XRZ A;  1K1A A;  2YHE A;  2R5S A;  2ZU6 B;  3UIN C;  3ML8 A;  2OOE A;  2X6H A;  3QNK A;  3HYM B;  1TEZ A;  2MRI A;  1UJJ A;  4MKT A;  4EZK A;  3JQ1 A;  3AG3 E;  3FU0 A;  4G26 A;  4B93 B;  1U3D A;  4JL0 A;  4BT9 A;  4YDW A;  4JVS A;  3CVU A;  3PE4 A;  4CEM A;  1XNF A;  3CGH A;  3SZ7 A;  4LCT A;  3JQ0 A;  3HHM A;  5EYL A;  4PDX A;  4DX1 A;  2XS1 A;  5KJM A;  3UXG A;  1TNB A;  3ASD A;  5ITZ F;  4CZ2 D;  4U8V D;  2FI7 A;  4NIK A;  2XCB A;  3JUE A;  1MX2 A;  1NA3 A;  3EHQ A;  3ZVV A;  1JWF A;  4B89 A;  3FEY A;  3CVQ A;  4UWK A;  4WWO A;  2AXV A;  5KNH D;  3FUL A;  2KM4 A;  4RG9 A;  1MX6 A;  2PQN A;  3C98 A;  3IV0 A;  3TWW A;  5G04 C;  3PH0 C;  2P9L G;  4ATZ D;  4UI9 K;  2LXL A;  4KVM A;  4J8F A;  4LER A;  4BSX A;  4AY6 A;  5B1A E;  1Z3X A;  4U0U A;  1HE8 A;  4A3V A;  5KCM A;  2ZGD A;  4TUM A;  5FIN A;  4F53 A;  2WM9 A;  1N9A A;  1S70 B;  3E34 A;  3Q15 A;  4MLP A;  3CVP A;  4I6J A;  4GTP A;  3HXE A;  4GTV A;  3PE3 A;  3CK9 A;  1PAQ A;  2C0M A;  3SD5 A;  5T3R A;  3ENE A;  1XGW A;  2JEK A;  4G8K A;  3V2X A;  5LOZ A;  2MHK A;  3R9A B;  2C0L A;  3HVE B;  1EDU A;  4XE0 A;  2A5E A;  1Z3Y A;  1FCH A;  1UOH A;  3J5P A;  4A1S A;  2AJA A;  4BFR A;  5LCW C;  3MKQ B;  4EPZ A;  2V4L A;  1LD8 A;  5EKQ D;  2L0I A;  1TJF A;  4MBG A;  2I2O A;  3ZFW A;  4JXT A;  4U07 A;  4I6E A;  3CHR A;  2BKG A;  2EIL E;  3PUK A;  3HG0 D;  5IY5 E;  5ANL A;  4UQZ A;  5G05 J;  3T5X A;  2KCK A;  3TWV A;  4M3O A;  4JEU A;  3CVW A;  1IKN D;  2L0T B;  4XZ4 A;  4BY6 A;  2CG2 A;  4EEC A;  1TNY A;  3O4Z A;  5CEA A;  3FU5 A;  4JHK A;  4AP2 A;  2HE0 A;  4CYM D;  2J49 A;  2WQ6 A;  2OEW A;  2YHC A;  4Y6C A;  3FH7 A;  1HH8 A;  3T9K A;  4KVO A;  2R2L A;  3X2Q E;  3RO2 A;  4GYW A;  2PQR A;  1NL4 A;  4M7C A;  3G2S A;  3U9W A;  2WXK A;  3UPV A;  3FTY A;  3DSU A;  4UWF A;  5JMN D;  4PUC A;  1SVX A;  1YA0 A;  4GU5 A;  3ONL A;  1IXV A;  1YYH A;  3FUD A;  3NBN B;  3T5V A;  5ENR D;  4BTB A;  4LNU D;  3PZ4 A;  1GW6 A;  4UWH A;  3KD7 A;  4AJW A;  4L23 A;  1BPO A;  2DYS E;  1TNU A;  4Y6W A;  2XS8 A;  2ZXW E;  1UW4 B;  2KC7 A;  2P9N G;  4FLH A;  1IYG A;  4WWP A;  4HI9 A;  3AG4 E;  3AJI A;  5BXO A;  3EU9 A;  3UM3 A;  3G2T A;  1ZBP A;  4DPR A;  2L6J A;  2CFU A;  2FO7 A;  3CIA A; 
#chains in the Genus database with same CATH homology
 1E90 A;  2WXF A;  3FUJ A;  4DK5 A;  2FEZ A;  3OXL A;  3QWW A;  4YVO A;  3LVQ E;  2I1K A;  4HOR A;  4KYO B;  2WXR A;  3FFL A;  2X6K A;  1JPL A;  2XEV A;  3IBE A;  4DLO A;  2IOL A;  4CGV A;  3QDN A;  4AIF A;  4XKC A;  5AYW D;  2AXZ A;  4CDN A;  4HOS A;  2XHE A;  4DLQ A;  4AOF A;  2GGF A;  1HS6 A;  2VGX B;  3NQP A;  2R17 C;  3B7T A;  3CHM A;  5CMY A;  5FZR A;  1QNF A;  1B89 A;  3HDX A;  1U3C A;  4N2Q A;  3ASH A;  5FZS A;  2WQ7 A;  3ULQ A;  2HO1 A;  4P29 A;  2VTB B;  2GRL A;  3RKV A;  4GZ6 A;  4U0S A;  3LDZ A;  2KCV A;  3BG0 B;  4G2V A;  5JHB A;  3LKU A;  4L1B A;  3ZYL A;  4ANU A;  3L22 A;  3QJZ A;  1UG3 A;  2HR2 A;  4UWG A;  1VDY A;  5ARG A;  4BX9 A;  4WND A;  4UWL A;  1S0P A;  3CHQ A;  4TUU A;  3PUJ A;  1ZU2 A;  4N3C A;  2J4B A;  1KT1 A;  1FVF A;  2X6I A;  2MOW A;  3TAX A;  3AS5 A;  4HOT A;  4WNE A;  5BV1 A;  4GML A;  3PVL A;  4UI9 C;  2X38 A;  3ZW3 A;  3UMV A;  1OUV A;  2GW1 A;  1HO8 A;  3D9L A;  2KZT A;  2C2L A;  4FAD A;  4FJZ A;  3DPD A;  3CQG B;  3E4B A;  5BT1 A;  4BT8 A;  2XPI A;  3UUX A;  2FF4 A;  4UQX A;  2WXO A;  3FU6 A;  1HFA A;  3LJ3 A;  3QAQ A;  4PH4 B;  4WUY A;  3L17 A;  3CHS A;  2WPV A;  4BX8 A;  2PM6 A;  3EHM A;  4CDR A;  3PRZ A;  1WM5 A;  2VSN A;  3QOU A;  3LY9 A;  1FVH A;  2VSX E;  1X5B A;  1NZN A;  1E7U A;  5E76 A;  4GA1 A;  4C0E A;  4LRZ A;  3LEW A;  4OYS A;  3PRE A;  3EHN A;  4J8S A;  3SGH A;  3MGB A;  3ZYM A;  1SZA A;  1OWL A;  4GB9 A;  1HU3 A;  1KLX A;  2WXH A;  4HXI A;  4IUL A;  2PL2 A;  2UWJ G;  3IHV A;  5FJY A;  3MZL B;  4N2S A;  3FUN A;  3MV3 B;  4DI3 A;  4RSY A;  4GZ5 A;  4U63 A;  5J90 A;  4HFG A;  4MRU A;  3LS8 A;  4FHK A;  5JHA A;  3MKQ A;  3ZYK A;  3D9M A;  2M63 A;  4DI4 A;  1WY6 A;  3NF1 A;  3FUK A;  2ION A;  1MQS A;  3P2B A;  3LVR E;  5FT9 A;  1UN8 A;  2DBA A;  3IKO B;  4CT4 A;  4WNF A;  3D9K A;  4B0Z A;  1Y6I A;  3TXN A;  3CVY A;  4G1T A;  2KCL A;  1W3B A;  2XQ0 A;  4GZC A;  5KJN A;  3MJW A;  4GZD A;  4I6G A;  3BG1 B;  2EQX A;  3WXX A;  4UQY A;  4FLB A;  3TL5 A;  3CK7 A;  4KZC A;  1ELW A;  3D9I A;  4I1O B;  4IYP A;  4AM9 A;  4RG6 A;  1KT0 A;  4EQF A;  2KZT B;  4V3I A;  2XRZ A;  2RG8 A;  2YHE A;  3I4G A;  3T8M A;  1E8X A;  4FUL A;  1OWP A;  3RJV A;  4Q94 A;  2R5S A;  2ZU6 B;  2DIW A;  3OTN A;  4ME2 A;  2KAT A;  3ESL A;  2WVI A;  3ML8 A;  3SF4 A;  2CG3 A;  2OOE A;  3G2W A;  4AVX A;  5CCL A;  1SZ9 A;  4I9E A;  3U66 A;  3PEV B;  1IHG A;  2NXP A;  2X6H A;  2Y4U A;  3O48 A;  2OVB A;  3QNK A;  5M72 A;  3HYM B;  4XKB A;  4C0M A;  1TEZ A;  4KXK B;  2MRI A;  1UJJ A;  3RRN B;  4MKT A;  3UQ3 A;  4U0Z A;  2GRM A;  4OVV A;  4EZK A;  4URK A;  2E2E A;  5BNW A;  3JQ1 A;  2WXM A;  3CV0 A;  2AWI A;  4ILH B;  3CKC A;  1TJC A;  4I1M A;  5JJ6 A;  4TRQ A;  2HYZ A;  3AU5 A;  3SHF A;  4AY5 A;  3FU0 A;  4G26 A;  4I1A A;  4CGW A;  1U3D A;  2YNQ A;  1MHQ A;  4JL0 A;  4BT9 A;  2IJG X;  4KZ0 A;  4I43 A;  4JVS A;  4D10 C;  5FZQ A;  3VLD A;  3CVU A;  3RRM B;  3PE4 A;  2IFU A;  3CST A;  3FTX A;  4CEM A;  1XNF A;  2XGM A;  3CGH A;  2A4Z A;  4LCT A;  3SZ7 A;  3ZN3 A;  3LCA A;  4JZY A;  3JQ0 A;  2L9B A;  2LAH A;  1JWG A;  3MYV A;  3QKY A;  3HHM A;  3RO3 A;  3ZPJ A;  3NZU A;  4PDX A;  1Z6T A;  3PNT B;  3S2A A;  3KAE A;  4OVU A;  4PS3 A;  4JC8 A;  3MEK A;  5KJM A;  3S7F A;  3ZXS A;  2XPY A;  3ASD A;  3KS2 A;  3QB2 A;  4N39 A;  4ACL A;  3FH5 A;  2WXJ A;  3ZHE A;  3LY7 A;  5FQ4 A;  3CVN A;  3FTV A;  4NRH B;  1ELK A;  1QQE A;  2IU1 A;  2X6F A;  3OXF A;  4F1S A;  3QK0 A;  4NAC A;  2V5F A;  3U4T A;  2FI7 A;  3CQC B;  2XCB A;  4G23 A;  1NA3 A;  3TJP A;  4EZJ A;  3BEE A;  3SNX A;  3ZVV A;  4F3V A;  1JWF A;  4N3B A;  4E6H A;  5C2Y A;  3APF A;  5FQ7 A;  4B89 A;  2AVP A;  3FEY A;  4FHJ A;  3FEX A;  4YVQ C;  3S7B A;  3P1U A;  4GCN A;  3S7D A;  4FP7 A;  3CVQ A;  5BV0 A;  4UWK A;  3JUI A;  2E0I A;  4WWO A;  3CVL A;  2AXV A;  2HM8 A;  3S7J A;  3FDH A;  3FUL A;  3FUF A;  3FHE A;  1LF8 A;  1H2U A;  3OXG A;  2KM4 A;  3FTW A;  4XIF A;  4RG9 A;  5D0O D;  5LFA A;  1EF1 C;  1OWO A;  2PQN A;  4APO A;  3SI5 A;  1ELR A;  3FWV A;  3C98 A;  4CRW A;  3GW4 A;  1H19 A;  4GCO A;  2QY7 A;  3D9N A;  1IQU A;  3IV0 A;  5G04 C;  3ASG A;  3PH0 C;  4AEZ C;  2FBN A;  5FTP A;  3L6A A;  4GA0 A;  3AS4 A;  4UI9 K;  2ILR A;  4HS2 A;  4HLE A;  4KVM A;  3L08 A;  4ILG A;  1INZ A;  4J0U A;  5G04 J;  4GZ3 A;  5LP0 A;  4J8F A;  2Y4T A;  3LXU X;  2WQH A;  4LER A;  4BSX A;  3GYZ A;  3L13 A;  4AY6 A;  4WAF A;  1Z3X A;  4U0U A;  3LY8 A;  1HE8 A;  3ONK A;  5EDS A;  1QZ2 A;  3ZRH A;  3D9J A;  4A3V A;  2V0P A;  4K0R A;  5KCM A;  1HXI A;  4L7T A;  3EDT B;  4F53 A;  2JLB A;  3CK8 A;  4LEU A;  3MKR A;  3Q49 B;  2P58 C;  2WM9 A;  3PDN A;  4UI9 J;  1E96 B;  2DCP A;  3Q15 A;  4MLP A;  2WXN A;  4FA6 A;  2FUL A;  1UN9 A;  3K9I A;  4WNG A;  2X3M A;  2WXL A;  4JA9 A;  3R7Q A;  4FJY A;  4APF A;  3CVP A;  2LAI A;  3KEZ A;  4ILI A;  4PS7 A;  3ZIM A;  4A1G A;  4GMJ A;  2CHX A;  4I6J A;  1NA0 A;  1E8Y A;  2I9C A;  2BUG A;  4N3A A;  4GA2 A;  4KT6 B;  1SQM A;  5CHE E;  4JEH A;  4NQ0 A;  5EX3 A;  1HF8 A;  4I2Z A;  5KJK A;  4G11 A;  1E7V A;  3PE3 A;  4G24 A;  2J4D A;  4A3T A;  2BF0 X;  3CK9 A;  5G2N A;  3RU0 A;  1PAQ A;  5JJT A;  2CFZ A;  1EPU A;  2C0M A;  3SD5 A;  2WXG A;  1E8W A;  2BTD A;  4FC8 A;  5T3R A;  3ENE A;  3CVV A;  1XGW A;  2JEK A;  3IEG A;  3L16 A;  3QC1 A;  5LOZ A;  5BPP A;  3CR3 A;  2MHK A;  3R9A B;  2Y3A A;  4N5C A;  2VJ8 A;  4WWN A;  3R7R A;  3UT7 A;  3FH8 A;  1P5Q A;  3N71 A;  4Q96 A;  3VTX A;  4YND A;  4TV3 A;  4Q69 A;  2C0L A;  3FY4 A;  3HVE B;  1EDU A;  2LSV A;  2OND A;  2CHW A;  3G2U A;  5ARF A;  4XE0 A;  2J9Q A;  2OVF A;  3UT8 A;  3AU4 A;  1PY1 A;  3RIB A;  2RD0 A;  4EBA G;  2WMO A;  5DIZ A;  3TG5 A;  5LCW J;  1Z3Y A;  3TXM A;  2XPZ A;  4KMO A;  3SFZ A;  2I6H A;  2XGO A;  1FCH A;  3I3N A;  4A1S A;  5AIJ A;  4BFR A;  5LCW C;  3MKQ B;  5CMW A;  3CKB A;  4BTA A;  2V4L A;  5A7D B;  4EPZ A;  3SBT B;  3TGO A;  3LPZ A;  5EKQ D;  2L0I A;  3U3W A;  1TJF A;  3OAW A;  2I2O A;  4I2W A;  3MA5 A;  3RRU A;  4HVB A;  2AW6 A;  2AXU A;  2WMN A;  2XGS A;  3I5P A;  3ZFW A;  5HI7 A;  4E85 A;  3URZ A;  5BUZ A;  3QAR A;  4JXT A;  5HQ8 A;  4IN3 B;  3CHP A;  4U07 A;  4I6E A;  5D0Q D;  3CHR A;  5FQ8 A;  4JHJ A;  3PUK A;  2A5U A;  3FTS A;  3PS6 A;  4H7X A;  2J07 A;  5ANL A;  4UQZ A;  3B7S A;  5G05 J;  2R59 A;  2KCK A;  4MS6 A;  4M3O A;  3T5X A;  3EIQ C;  4JHR A;  3EIJ A;  4JEU A;  3CVW A;  2IQC A;  2L0T B;  3CLJ A;  3NZS A;  4L2Y A;  4QFV A;  4XZ4 A;  2VSY A;  4BY6 A;  2PZI A;  4NUR A;  2YIN A;  1JUQ A;  2VSO E;  5G05 C;  3HIZ A;  5EX0 A;  4ATG A;  4J8E A;  1EYH A;  2I1J A;  1HZ4 A;  3Q47 B;  3JYS A;  2CG2 A;  1IQR A;  4EEC A;  3HVE A;  3FUE A;  2NSZ A;  1HG2 A;  2J08 A;  3D3M A;  4GAA A;  2Q7F A;  5CCM A;  4GYO A;  3U64 A;  4AXH A;  3O4Z A;  3FTU A;  1N52 A;  4CT0 A;  3FU5 A;  4HOQ A;  2XCC A;  3B13 A;  4JHK A;  2WXQ A;  1A17 A;  5T8I A;  4ABN A;  4AP2 A;  4W9R A;  4C9B B;  3EJN A;  1HG5 A;  1H2T C;  2J49 A;  3APD A;  4GPK A;  3DBS A;  3JCK C;  2YHC A;  4Y6C A;  5G55 A;  2WQ6 A;  3PNL B;  3FH7 A;  1HH8 A;  4KVO A;  3B7U X;  3QWV A;  3VLF A;  3Q5M A;  2NC9 A;  4JW1 A;  3FUH A;  4KBQ A;  3RO2 A;  5T4Y A;  4HOU A;  5A6C A;  3MCX A;  4GYW A;  5AJL A;  4AV7 A;  4J8D A;  2PQR A;  5E75 A;  4J6I A;  5LX8 A;  2X6J A;  3D9O A;  2UY1 A;  3CSF A;  3G2S A;  4ANW A;  5J08 A;  3MV2 B;  3ZEF A;  1N54 A;  3B7R L;  3U9W A;  2OV8 A;  2J09 A;  3TG4 A;  1DNP A;  2WXK A;  3AS8 A;  3CEQ A;  2V8S E;  3UX4 A;  3UPV A;  1H2V C;  4LUN U;  3FTY A;  1H6K A;  4A55 A;  4UWF A;  1Y8M A;  2UY1 B;  3PZD A;  2VGX A;  4PUC A;  2IF4 A;  3ZHE B;  4JPS A;  3CVX A;  2LNI A;  2VYI A;  3G2V A;  1E8Z A;  3LYA A;  4XX5 A;  1YA0 A;  4ANV A;  4GU5 A;  3UT4 A;  4B8A A;  3SBS A;  3D9P A;  4B94 A;  3CHO A;  4EZL A;  3ONL A;  4U04 A;  3FUD A;  3FU3 A;  4XI9 A;  2VQ2 A;  2WXI A;  3FUI A;  3ML9 A;  3MX3 A;  3T5V A;  2CHZ A;  5AJD A;  3APC A;  4BTB A;  5A23 A;  2QFC A;  3GZ2 A;  4CDM A;  1PC2 A;  2VGY A;  5DBK A;  1NP7 A;  4K03 A;  1GW6 A;  3ASF A;  3GZS A;  4ACK A;  4CCA A;  4B8C B;  4UWH A;  3KD7 A;  4AJW A;  1UJK A;  1L5J A;  4XI0 A;  4L23 A;  1BPO A;  2XRY A;  3ZGQ A;  4R7L A;  4Y6W A;  5FQ6 A;  2PM7 A;  4I9C A;  4JA7 A;  3L54 A;  3ZYQ A;  5KJL A;  3VLE A;  1UW4 B;  5C1D A;  2WB2 A;  3PEU B;  1WAO 1;  2IOS A;  2KC7 A;  3IHY A;  4FLH A;  3VTY A;  3GZ1 A;  3RK6 A;  3QWP A;  2LO6 A;  2WXP A;  4L2L A;  4U8H A;  1HX8 A;  4F7A A;  1IYG A;  4WWP A;  5ANR A;  4O6F A;  5FWQ A;  5AEN A;  4H7Y A;  5JJ7 A;  1OWM A;  1OWN A;  4FU3 A;  4RVB A;  2YQ8 A;  4DJA A;  4ANX A;  4BWR A;  3G2T A;  1DVP A;  1ZBP A;  4PS8 A;  5BW8 C;  4DPR A;  3FTZ A;  4EBA A;  3FUM A;  3Q4A B;  1H0A A;  4GYY A;  2L6J A;  5ENN A;  3I4R B;  2CFU A;  2FO7 A;  4IRU A;  2LSU A;  4G25 A;  4I17 A;  2VTB A;  3CIA A;  3ESK A;  3FP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...