3ASHA

Mama d159k mutant 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
172
structure length
172
Chain Sequence
NDDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
total genus 63
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ashA01
1A17A 3OXLA 2XEVA 3MV3B 2Y4TA 4GA1A 4GYYA 2YHCA 2LNIA 3LCAA 5A7DB 4F3VA 3E4BA 3GZ1A 3PDNA 4JHRA 3VTXA 3S7DA 2KCLA 3KAEA 3MEKA 4N2SA 4G23A 4J8EA 4U04A 5CCLA 4IN3B 1B89A 4AM9A 3ZHEA 4JA9A 3KD7A 3FP3A 3ESKA 4B94A 3SZ7A 2NC9A 2C0LA 5A6CA 5C1DA 3KS2A 5FZSA 4I9CA 5EX3A 4UQXA 4BWRA 3S7BA 3MV2B 2OOEA 5LCWJ 5FT9A 2UY1B 3OXGA 4J8FA 4AY6A 1E96B 4GZ3A 5G04J 4N3BA 3O48A 4G24A 3PE4A 3URZA 2QFCA 3CVNA 4CGWA 1ELRA 2VQ2A 5D0OD 4WNGA 4GZ6A 1PC2A 1KLXA 2V5FA 4RG9A 4KBQA 3U4TA 3RKVA 1Y8MA 3LY9A 4U0SA 2LSVA 4N3CA 4AY5A 1KT0A 4G25A 4JL0A 5EX0A 5DBKA 3QWPA 3Q5MA 2PQRA 4NRHB 4GPKA 3ZPJA 5FTPA 4APOA 1YA0A 3ZHEB 5G05C 5HQ8A 3ASGA 3LPZA 5FZRA 1FCHA 4YNDA 5ARFA 2VGXB 4YVOA 4J0UA 4UI9K 3ASFA 3UUXA 3VTYA 5M72A 4KXKB 3IEGA 3ASDA 2FEZA 4H7YA 5CCMA 3CVQA 1XNFA 3MKRA 2C2LA 5BW8C 2C0MA 5JJ6A 2FBNA 4KYOB 4U07A 5BNWA 4AIFA 5EKQD 3EDTB 2WPVA 2PQNA 4H7XA 4UI9C 4N2QA 5HI7A 3OXFA 2J9QA 4N5CA 4HOQA 3TG4A 2P58C 3TG5A 1ZU2A 3TAXA 2HO1A 4W9RA 4HOTA 5D0QD 5LCWC 5FZQA 2FF4A 2VSNA 2KCKA 4BTAA 3ASHA 4N3AA 4HORA 5FJYA 2XCBA 3S7FA 3AS4A 4ABNA 4GYOA 3ULQA 5BT1A 3RO2A 2PZIA 3NF1A 3FWVA 4U0ZA 1HXIA 2VYIA 2IF4A 4CGVA 5AYWD 4HOSA 3CK7A 3QWVA 2BUGA 4Y6WA 2VSYA 1WAO1 3ZGQA 1W3BA 1WM5A 2FI7A 2KCVA 2E2EA 3JYSA 3CK8A 3TGOA 3CV0A 1NA0A 2PL2A 3U3WA 4EQFA 3QOUA 4N39A 3QDNA 3ZN3A 3RJVA 2AVPA 5G05J 3FFLA 4BT8A 3LY8A 4G1TA 3CVPA 2L6JA 4XI0A 4YVQC 1QQEA 2FO7A 4GYWA 5KJMA 4GCOA 4I9EA 3Q49B 4G2VA 4I2ZA 5ARGA 4BTBA 3ZFWA 2VGYA 4Y6CA 3AS5A 3CKCA 4WUYA 3RU0A 4I1AA 2Q7FA 3N71A 4CDRA 3AS8A 5KJLA 2HYZA 4GA0A 2DBAA 4GA2A 2XGOA 4I2WA 2KATA 4UQYA 5DIZA 3RO3A 4I17A 3Q15A 3PE3A 1P5QA 1ZBPA 2R5SA 4NQ0A 4UI9J 2VGXA 3WXXA 3S7JA 1NA3A 5CHEE 3CEQA 3CVLA 4WNDA 4GCNA 2UWJG 3K9IA 3RIBA 1NZNA 2KC7A 2YQ8A 2GW1A 3Q47B 4BT9A 5G04C 4G26A 5KJKA 2MHKA 5JJ7A 1KT1A 3QKYA 3R9AB 4A1SA 3Q4AB 4WNEA 3UQ3A 4LEUA 4XI9A 2ONDA 3HYMB 3QWWA 2XPIA 3CKBA 3LY7A 4U0UA 2I6HA 2WQHA 4GZ5A 3LKUA 4O6FA 2XGSA 3BEEA 1IHGA 2XGMA 4XIFA 2XCCA 4UQZA 2JLBA 2Y4UA 4J8DA 4JA7A 1HZ4A 1IYGA 1OUVA 5JJTA 2UY1A 3MA5A 3GYZA 2IFUA 2HR2A 1TJCA 3GZ2A 4RG6A 1HH8A 1ELWA 4WNFA 3SF4A 4HOUA 3LYAA 3UPVA 3CK9A 5KJNA 2LSUA 4ME2A 1QZ2A 3GW4A
chains in the Genus database with same CATH superfamily
4N5QA 2XEVA 1V55E 5A7DB 3E4BA 4JHRA 1FT1A 2EIJE 4JW1A 3R9MA 1IHBA 2AXZA 4N2SA 1JPLA 4J8EA 2KBXA 3F6QA 1B89A 5CMWA 3V31A 4DX5D 2X38A 3SHFA 3PRZA 5JHBA 3FP3A 4C48B 4B94A 1TYQG 1H6KA 1N95A 3CHMA 5A6CA 4GAAA 1E7VA 1SZAA 4LCTA 5EX3A 4BWRA 3S7BA 3I4GA 3PNTB 3PZ1A 5CBNA 2DCPA 1E96B 3PVLA 1IXVA 4ILHB 3J5QB 5CMYA 5AQBA 3T9KA 3PE4A 1PAQA 3CVNA 4CGWA 3MKQB 2QC9A 2A5UA 4WNGA 5AAOA 4BY6A 4FHJA 2KZTB 4PH4B 4K5AB 1KLXA 4HVBA 4FJYA 2I1JA 4KBQA 3OAWA 4WWPA 2I2OA 2NYJA 4HQDA 1OCCE 4N3CA 3C3RA 1O1RA 3UM0A 3GZSA 5EX0A 3CVXA 3ZYQA 3ULEG 5DBKA 3TJPA 1DVPA 3QWPA 3Q5MA 4FLBA 3B13A 2P9LG 2R2LA 2OVFA 4NRHB 3RK6A 1GW6A 5FTPA 4APOA 3W9FA 4XKBA 5KWDA 2XPZA 4YVOA 5CEDB 4DK5A 1MJ0A 5JHAA 3TWVA 2B0OE 4GTQA 4G8LA 3DBSA 1JCSA 4DLQA 4U8VD 2RFMA 3FEYA 2VSOE 2WXIA 2P9SG 3LDZA 3LVQE 2C2LA 2C0MA 3AU4A 1MX4A 3T5VA 1K1AA 3UI2A 4BERA 4AIFA 3NQPA 5ENOD 5FWQA 2BKGA 3C72A 4U95D 5ENSD 1N54A 1H2VC 3FU3A 5FINA 2IY0C 3BQOA 4N2QA 4U7EB 4GZDA 3CQGB 2LAHA 3TG5A 1UN9A 3FUDA 4HOTA 1HF8A 1VDYA 3B7BA 4XZ4A 3SFXA 5FZQA 2VSNA 5ENPD 4HXIA 3IKOB 4PUCA 3FTVA 4BTAA 3ASHA 2Y0BG 4EPZA 1TEZA 5FJYA 3ZEFA 2NXPA 1E8XA 3RO2A 4F7AA 3NF1A 5AQAA 1BPOA 1MQSA 4GMLA 1TNUA 3TXNA 1L5JA 2XEHA 3C5RA 3E37A 3CK7A 4I43A 4AVXA 3ZUVB 1BLXB 3NOGD 3ZGQA 4ANXA 2KCVA 3CGHA 5JMND 2R02A 2BEDA 3JUEA 5CEAA 5G05J 2P9IG 5CBOA 4OAUC 3FFLA 4GB9A 2Y3AA 1HFAA 5B1BE 4L9PA 4XI0A 2LXLA 2IU1A 5KJMA 1UOHA 1G3NB 5ENQD 2ZGGA 4I9EA 4BETA 3HG0D 2EINE 4DPRA 4I2ZA 3ABKE 4L2LA 4L2YA 2WQ6A 4RQIA 2EQXA 4I1AA 3PZ2A 3UINC 2H6GA 2HE0A 2Q7FA 1TN7A 3QB2A 4YDOA 2PNNA 3DSVA 2YINA 4GA2A 4B8AA 3ESLA 4IULA 2KATA 4GTVA 4O1PA 3PE3A 1P5QA 3DSUA 1S63A 1ZBPA 3AG3E 3D9JA 3D9IA 2IO2C 4G11A 3S7JA 3CLJA 2NSZA 4GMJA 1LD8A 3DPYA 4KMOA 4I6GA 4X8QA 2V5QC 4DJAA 3HXDA 5G04C 2IO3C 4KVMA 1TNZA 4A1SA 4WNEA 1U3CA 3PUKA 3DSWA 2WXPA 2XZDG 2I6HA 3HIZA 3L6AA 3R7RA 1TN6A 4TV3A 2XGSA 3E33A 2XGMA 4XIFA 3L08A 1HE8A 2XCCA 4UQZA 2JLBA 2Y4UA 4XX5A 4UWHA 4V3IA 3DEPA 4AXHA 4HRLA 1IYGA 5JJTA 1N0QA 5EYPF 4RVBA 4BSXA 2WXJA 3GZ2A 2OEWA 1ELWA 2FO1E 3LYAA 2J4DA 3CK9A 2LSUA 2HM8A 2M63A 3MV3B 2J8SD 4GYYA 2X6KA 2WQ7A 2AJAA 3C98A 1H2TC 3GZ1A 2LUHA 3VTXA 2KCLA 3KAEA 5BXOA 3FUJA 2QYJA 2P2CP 2IJGX 4HS2A 3MEKA 4HLEA 1IQUA 4OVUA 4IN3B 4GTOA 2BF0X 5ANRA 1D8DA 4JA9A 2VGEA 3CHRA 3SZ7A 3JQ0A 3BG0B 5KNGA 5BV0A 5EYLA 3NOCD 3EHQA 3KS2A 1KPSB 3DRAA 3E34A 5T4YA 2RFAA 5LCWJ 2CG2A 3ASNE 5FT9A 4EBAA 3ZIMA 3CSFA 3ABLE 2J09A 4J8FA 3ABME 3RRMB 4HB5A 4LNBA 2MOWA 3E30A 3FUKA 3EHRA 4DX1A 4G24A 1EPUA 2QFCA 4RLYA 1OCZE 4NACA 1ELRA 4J6IA 3FUFA 5EIBE 4I1OB 1ELKA 2VQ2A 2RD0A 1HU3A 1HS6A 4A63B 4AEZC 3EJNA 4FC8A 1PC2A 1AP7A 3HDXA 3LXUX 4C0MA 4Q94A 4HI8A 4B0ZA 3LY9A 3UKUG 2P9UG 2LSVA 4G25A 3DSTA 4HRNA 1K1BA 5AIJA 5BV1A 2QYUA 1LD7A 3CR3A 1FT2A 3AG2E 2L9BA 5HQ8A 3EHNA 3ASGA 5FZRA 2VGXB 3J5PA 4UI9K 2WM9A 3ASFA 3UUXA 3SD5A 3AJIA 3IEGA 3ZKJA 2GRLA 2OCCE 4P29A 2A5EA 2FEZA 2JEKA 4DI3A 4H7YA 4UWKA 3CVQA 5CRVA 5IY5E 3D9MA 2WXGA 4FLHA 3CHQA 4K03A 4U07A 2I9CA 4CEMA 2ILRA 1FVFA 4FP7A 3OTNA 3EDTB 4U63A 4UI9C 2WXRA 2F8YA 3FU6A 4N5CA 1BD8A 3TG4A 1U2VG 5KCMA 1FPPA 1ZU2A 5AARA 3SY2A 2XS8A 3LVRE 2ETCA 2HO1A 5D0QD 5CRUA 2J49A 5LCWC 1E90A 2XS1A 2FF4A 4QQIA 4A1GA 3JXJA 4J8YA 2WXQA 4MRUA 2JABA 3FTZA 4N3AA 4HORA 2J07A 4LUNU 3IHVA 3D9LA 4ABNA 2Y1LE 2R03A 4J7WA 5BT1A 2PZIA 4EHMA 3PNLB 3FWVA 1AWCB 4CGVA 4ILIA 5AYWD 4HOSA 3TWRA 3TL5A 4FU3A 3SO8A 4UWGA 3SI5A 5ITZF 1WAO1 1N52A 4E85A 4AOFA 1NP7A 1V54E 1NA0A 4ILGA 4RSYA 4A3VA 3U3WA 2LAIA 3Q7AA 3CHSA 1MYOA 3QDNA 4F53A 1YYHA 1U3DA 3RAUA 3FH8A 2KM4A 2CHXA 4M7CA 4YVQC 2FO7A 2XHEA 3U9WA 5LX8A 3QC1A 3UT4A 2WB2A 3Q49B 3G2VA 2BKKB 5ARGA 4XE0A 1OT8A 2R05A 4OAVB 3PEUB 2WXKA 3ML9A 4WUYA 3RU0A 2V4LA 3FTSA 4ZHBA 3X2QE 1SW6A 2X6JA 1Z3YA 1UN8A 3PH0C 4I6JA 2DIWA 3JQ1A 1WY6A 3RO3A 3FTXA 3PZ4A 5HRYA 3BUAA 3D3MA 4EZKA 1NA3A 5CHEE 3MX3A 5BXUA 2WXOA 4DRXE 5AJDA 3RIBA 4LERA 2YQ8A 1IKND 5FIOA 5FQ4A 4G26A 2XPYA 4ATGA 1KZPA 2MHKA 1IQRA 1QYMA 3HXFA 3QKYA 1H19A 3UQ3A 3Q75A 1Q2ZA 5AENA 2ONDA 3HYMB 3QWWA 3CKBA 1TN8A 3SBSA 5BPPA 3PEVB 3UM3A 3LKUA 3VLDA 2DZOA 3SBTB 1MZCA 4JD2G 2VJ8A 5LFAA 4GTPA 3SNXA 2FULA 4K5BA 2CFUA 4JHKA 4DUIA 4I1MA 1E8YA 3NZSA 3UT7A 1KZOA 2QZAA 5FQ8A 3TXMA 4HOUA 1HX8A 3CIAA 3D9PA 4ACLA 4CT0A 4BSZB 2X6IA 3L16A 4AP2A 5G55A 2CFZA 5LP0A 3GW4A 2H6HA 2Y4TA 2P9KG 4GA1A 2XQ0A 3LCAA 3MGBA 4BESA 1Z6TA 4GTRA 4L1BA 3PDNA 3S7DA 3L82A 5E75A 1EDUA 3NB2A 4U04A 1O1SA 3FTUA 4TUMA 4MBGA 4AM9A 1JCQA 1BI7B 1DNPA 1SVXA 3KD7A 5EN5D 1N4QA 4DX2A 2C0LA 2WXHA 1OWPA 3ZYKA 4GTTA 3RRNB 4EZLA 3FU5A 3QAQA 3E32A 4ATZD 2EIME 3EIQC 2WXMA 3MV2B 3QARA 1TR4A 4CYMD 4LNUD 5LOZA 4EBAG 2L0IA 3OXGA 5E76A 4FJZA 4AY6A 5ANLA 2A4ZA 4GZ3A 1UW4B 4NIKA 3DEOA 1S0PA 4E6HA 1LF8A 4CDMA 1UJJA 4N3BA 2XENA 3P2BA 3B7TA 3TWQA 1BU9A 1O1TA 3PZ3A 3Q9UC 3C3OA 4PS7A 1X81A 4MKTA 2LO6A 2V5FA 1S70B 3FUNA 3ENEA 4U0SA 1K8KG 3NBNB 3ZRHA 5HKPA 4JL0A 4JZYA 3HXEA 3ONKA 1DCQA 2GRMA 2PQRA 3RSEG 4GPKA 5FQ6A 1YA0A 3FH7A 1X5BA 5G05C 3Q78A 3LPZA 3B95A 4YNDA 5ARFA 1TNYA 1PY1A 3VTYA 5M72A 1O5MA 4DX7D 1OWNA 4YDYA 2V0PA 5C2YA 3SQVA 3LJ3A 3ML8A 4LSZE 1HG2A 5CCMA 3FUIA 1NL4A 4F6RD 4OVVA 1XNFA 3MKRA 4GTMA 2H6IA 4TUUA 4BEPA 2P9PG 2ZGDA 3D9KA 3V2XA 1MX6A 1EF1C 5CECB 3EUVA 2ZXWE 5BNWA 4JXTA 2WXFA 3Q79A 4URKA 2XZTG 4LG6A 1OCRE 2L0TB 4H7XA 5HI7A 3OXFA 4KZ0A 4JHJA 3HHMA 1TNBA 1OWOA 2AW6A 4TXQA 2EILE 3TWWA 2DVWA 3TAXA 3SGHA 2CG3A 2RG8A 4I6EA 3AG4E 3C3QA 3QK0A 2V4HC 2GGFA 3ZYLA 3S7FA 2ZU6B 4PS3A 4HRMB 4GU5A 4DLOA 1A5EA 2WMOA 3ULQA 4XEIG 1N4RA 1HXIA 4KZCA 3UMVA 5J90A 4AV7A 3QWVA 2BUGA 3IV0A 4IYPA 4Y6WA 5T8IA 3AAAC 2KXPC 2VSYA 3I5PA 3ZW3A 2FI7A 3TWTA 2F37A 2XRYA 2PL2A 3CVUA 2GRPB 3UM2A 3QOUA 4CZ2D 4YDWA 2AWIA 3RJVA 2AVPA 1K3ZD 2DWZA 4TXPA 4UUCA 4BT8A 2DYRE 3LY8A 3D9OA 3FH5A 1QQEA 3FULA 3PUJA 2IQCA 4GYWA 4B93B 4MS6A 4GCOA 4APFA 3TWXA 3APCA 4BTBA 2MYOA 3W9GA 3Q73A 4O1OA 3ZFWA 3DPDA 4Y6CA 3CKCA 3CVWA 4U96D 2F8XK 5FQ7A 5ENRD 3N71A 4KT6B 3AS8A 3SFYA 4FADA 2HYZA 2L6BA 3B7UX 4GA0A 1ZB1A 3TWUA 2XGOA 4I2WA 3UXGA 5DIZA 3G2SA 2RKKA 3Q15A 1H0AA 5A23A 4KVOA 3I4RB 5EILA 3CEQA 4WNDA 2R59A 4C9BB 4DX6D 4CT4A 2Y69E 4GCNA 3UIPC 3DSXA 2UWJG 3K9IA 3UX4A 1NZNA 2GW1A 3Q47B 4BT9A 5KJKA 1E7UA 2IOLA 1OCOE 1KT1A 5D66A 3Q4AB 2GRNB 1OXJA 3KSQA 1UJKA 3D9NA 3U66A 3L22A 3LY7A 3DXKG 4U0UA 2WQHA 3KSLA 4O6FA 3JUIA 3HXBA 1WG0A 4CDNA 3R7QA 1TNOA 4J8DA 4JA7A 1FVHA 1HZ4A 3NZUA 3IHYA 2UY1A 3MA5A 1TJFA 4O60A 5ENTD 3GYZA 4J8SA 4LNGA 3ASOE 1TJCA 2ZIRA 3BG1B 1HH8A 3HVEA 3CVVA 3SF4A 5B1AE 3UPVA 3CHOA 3PREA 3T5XA 5KJNA 2R17C 4ME2A 1SQMA 1QZ2A 4JVSA 1A17A 3OXLA 2CHZA 2B6CA 2YHCA 2LNIA 3T8MA 4BFRA 3UM1A 4F3VA 3MYVA 4M3OA 4JEHA 3CSTA 3Q7FA 2OEVA 2IOSA 4G23A 5CCLA 3ISMC 3EU5A 2XRZA 3ZHEA 4F1PA 3ESKA 2NC9A 3B7RL 4GZCA 3FTYA 4K0RA 2AXVA 5C1DA 3HRAA 1N0RA 3O4ZA 5FZSA 3S2AA 3G2UA 4I9CA 4Q96A 4UQXA 2V8SE 4EECA 3ZU7B 2OOEA 4U8YD 3P1UA 3V30A 2UY1B 3FY4A 4Z68A 4HI9A 3FHEA 1E8WA 3DXMG 3JXIA 3ZVVA 5G04J 2J08A 1JWFA 1MX2A 3FUEA 3FU0A 3SFZA 3EIJA 3APFA 1N4SA 3O48A 3URZA 3HVEB 1RW2A 3VLEA 5AJLA 4HFGA 2WXNA 1N11A 4ACKA 4BX9A 5D0OD 4GZ6A 4B89A 3LS8A 2WXLA 3ZXSA 4RG9A 2DYSE 5AQ7A 2ZISA 3U4TA 1JUQA 3RKVA 1Y8MA 4UWFA 4FULA 4AY5A 1KT0A 1H2UA 3Q9NC 2VSXE 2XEEA 4A55A 1YMPA 3ZPJA 4Q69A 3ZHEB 4YDEA 4L23A 1UG3A 3V79K 2WVIA 3QJZA 2GRRB 3ULYA 3KEAA 3MZLB 1FCHA 4WAFA 1N94A 1SZ9A 3I3NA 1NFIE 4EZJA 4J0UA 4ANVA 4L7TA 4KXKB 2EIKE 1S64A 3ASDA 3FDHA 1OWLA 4FHKA 2DZNA 2J4BA 3TWSA 1N9AA 5KBAA 2PM6A 5BW8C 5JJ6A 2FBNA 3HXCA 3IXEA 3L9TA 4KYOB 4R7LA 1QNFA 5EKQD 2GRQB 4K5CA 2ETBA 3WG7E 2VTBA 2WPVA 2PQNA 1D8EA 2J9QA 4AJWA 4HOQA 1EYHA 3ONLA 4GTSA 2P58C 3AG1E 3QNKA 3LJNA 3UKRG 4W9RA 4OYSA 1RZ4A 5KNHD 3CVYA 4A3TA 1QBQA 2MRIA 1HG5A 2KCKA 4IRUA 3D9HA 5HS0A 3L17A 2XCBA 3AS4A 4GYOA 3UTMA 1OY3D 4JC8A 3B7SA 4U0ZA 1SA4A 2VYIA 4HLLA 4WWOA 2IF4A 3FTWA 4C0EA 4DI4A 3DSSA 2WMNA 1SA5A 4U8HA 1W3BA 1WM5A 2E2EA 3JYSA 3CK8A 3TGOA 3EU9A 2PM7A 3CV0A 1DC2A 5D2MC 5B3SE 1XGWA 4GPMA 4JPSA 3ZYMA 2X6FA 4EQFA 1DCEA 4N39A 3ZN3A 3G2WA 4NURA 2E0IA 5EDSA 4G1TA 3CVPA 2L6JA 4G8KA 2VTBB 4WWNA 5AQ9A 1INZA 3MCXA 2H6FA 3KEZA 2X3MA 3ZXPA 2CHWA 1WDYA 4ZFHA 4G2VA 3FEXA 2YHEA 1BI8B 3AU5A 2LXMA 2VGYA 3VLFA 3AS5A 3U64A 3UT8A 2QY7A 2GROB 4BX8A 2IEJA 3G2TA 1JWGA 3FUHA 4CDRA 3BU8A 1H6PA 5KJLA 2DBAA 3DWLG 4QFVA 4UQYA 5G2NA 2AXUA 3L54A 4I17A 4UWLA 2R5SA 2OVBA 4NQ0A 4UI9J 2VGXA 5AN8A 3MJWA 4JB8P 3WXXA 5BUZA 3LEWA 3CVLA 4CRWA 5J08A 1D9SA 4HBDA 3JCKC 4TRQA 2KC7A 4ANWA 1Y6IA 1H6OA 3T8KA 5JJ7A 4PDXA 3R9AB 3CQCB 1YCSB 4LEUA 5CERB 2BTDA 4XI9A 1HO8A 4FA6A 2XPIA 4MLPA 4GZ5A 3PZDA 4CCAA 2I1KA 3BEEA 1IHGA 5EIDA 1OWMA 5ENNA 4B8CB 5JA4D 5H7PA 3APDA 1Z3XA 1OUVA 4ANUA 3ZNGA 2ETAA 2YNQA 3UIOC 1JCRA 4F1SA 2OV8A 2IFUA 3IBEA 3L13A 5T3RA 1E8ZA 3NAWA 2IONA 4D10C 1NI1A 3RRUA 4XKCA 2HR2A 1LTXA 4HNAD 2F0YA 3V2OA 4RG6A 4TXRA 3EHMA 4WNFA 4PS8A 3FUMA 3MKQA 1Z5SC 4JEUA 1N4PA 3PS6A 2X6HA 1MHQA 4GMRA 4LRZA 2P9NG 3CHPA 2KZTA
chains in the Genus database with same CATH topology
1A17A 3OXLA 2M63A 2XEVA 3MV3B 2Y4TA 2CHZA 4GA1A 4GYYA 2YHCA 2XQ0A 2LNIA 3T8MA 2X6KA 3LCAA 3MGBA 4BFRA 5A7DB 2WQ7A 1Z6TA 4F3VA 3C98A 3MYVA 4M3OA 3E4BA 4L1BA 1H2TC 3GZ1A 3PDNA 4JHRA 3CSTA 4JEHA 3VTXA 4JW1A 3S7DA 2KCLA 3KAEA 2AXZA 3FUJA 5E75A 1EDUA 2IJGX 3MEKA 4HS2A 4HLEA 4N2SA 1IQUA 1JPLA 2IOSA 4G23A 4J8EA 4U04A 4OVUA 5CCLA 3FTUA 4IN3B 2BF0X 5ANRA 1B89A 5CMWA 4AM9A 2X38A 3SHFA 2XRZA 3ZHEA 4JA9A 1DNPA 3KD7A 3PRZA 3CHRA 5JHBA 3FP3A 3ESKA 4B94A 3SZ7A 3JQ0A 2NC9A 3B7RL 2C0LA 2WXHA 3BG0B 1H6KA 4GZCA 1OWPA 3CHMA 3ZYKA 3FTYA 5BV0A 5A6CA 3RRNB 4K0RA 2AXVA 4EZLA 3FU5A 4GAAA 3QAQA 5C1DA 3KS2A 1E7VA 3O4ZA 5FZSA 1SZAA 5T4YA 3G2UA 4I9CA 4LCTA 5EX3A 4Q96A 3S2AA 4UQXA 4BWRA 3EIQC 2V8SE 3S7BA 3I4GA 2WXMA 4EECA 3MV2B 3QARA 3PNTB 2OOEA 5LCWJ 2CG2A 5FT9A 4EBAA 3P1UA 3ZIMA 2UY1B 5LOZA 3FY4A 2L0IA 4EBAG 3CSFA 3OXGA 5E76A 4FJZA 3FHEA 1E8WA 2J09A 4J8FA 4AY6A 2DCPA 1E96B 5ANLA 2A4ZA 3PVLA 4GZ3A 3ZVVA 3RRMB 5G04J 1UW4B 1JWFA 2J08A 3FUEA 2MOWA 4ILHB 3FU0A 3SFZA 1S0PA 3EIJA 3APFA 4E6HA 1LF8A 3FUKA 4CDMA 1UJJA 4N3BA 3O48A 3P2BA 4G24A 5CMYA 1EPUA 3PE4A 3URZA 1PAQA 2QFCA 3CVNA 3HVEB 4CGWA 4NACA 1ELRA 3B7TA 3VLEA 3MKQB 4J6IA 3FUFA 4HFGA 5AJLA 4I1OB 2WXNA 1ELKA 2VQ2A 2RD0A 4ACKA 1HU3A 1HS6A 4BX9A 4PS7A 5D0OD 2A5UA 4GZ6A 4WNGA 4B89A 4AEZC 3EJNA 4BY6A 4FHJA 4MKTA 4FC8A 2KZTB 4PH4B 1PC2A 2LO6A 3LS8A 1KLXA 2WXLA 2V5FA 4FJYA 3ZXSA 4HVBA 4RG9A 2I1JA 3HDXA 4KBQA 3LXUX 4C0MA 3U4TA 3OAWA 4Q94A 3FUNA 4WWPA 1JUQA 3RKVA 2I2OA 1Y8MA 3ENEA 4B0ZA 3LY9A 4U0SA 2LSVA 4UWFA 4N3CA 4FULA 4AY5A 3ZRHA 1KT0A 4G25A 1H2UA 3GZSA 4JL0A 5EX0A 3ZYQA 4JZYA 3CVXA 2VSXE 5DBKA 3TJPA 1DVPA 3QWPA 3Q5MA 3ONKA 4FLBA 3B13A 4A55A 2GRMA 5AIJA 5BV1A 2PQRA 2OVFA 4NRHB 3CR3A 3RK6A 4GPKA 1GW6A 3ZPJA 5FTPA 4APOA 5FQ6A 1YA0A 3FH7A 3ZHEB 1X5BA 2L9BA 5G05C 4L23A 1UG3A 4Q69A 4XKBA 2WVIA 3EHNA 5HQ8A 3ASGA 3QJZA 3LPZA 5FZRA 3MZLB 1FCHA 2XPZA 4YNDA 4WAFA 5ARFA 1SZ9A 1PY1A 2VGXB 3I3NA 4YVOA 4EZJA 4J0UA 4DK5A 4UI9K 2WM9A 3ASFA 3UUXA 4ANVA 3VTYA 5M72A 4L7TA 3SD5A 4KXKB 5JHAA 3IEGA 3ASDA 3FDHA 1OWNA 2GRLA 2V0PA 4P29A 3DBSA 5C2YA 2FEZA 2JEKA 4DLQA 3LJ3A 3ML8A 4DI3A 4H7YA 1OWLA 4UWKA 1HG2A 5CCMA 3FEYA 2VSOE 3CVQA 4FHKA 3FUIA 2WXIA 4OVVA 2J4BA 3LDZA 1XNFA 3D9MA 3LVQE 3MKRA 2PM6A 2WXGA 4TUUA 2C2LA 4FLHA 5BW8C 2C0MA 3AU4A 3CHQA 5JJ6A 3D9KA 2FBNA 4K03A 4KYOB 1EF1C 3T5VA 4U07A 5BNWA 4JXTA 2I9CA 4CEMA 4R7LA 2ILRA 1QNFA 1FVFA 2WXFA 4AIFA 5EKQD 3NQPA 4FP7A 5FWQA 4URKA 3OTNA 2VTBA 3EDTB 1N54A 1H2VC 2L0TB 3FU3A 4U63A 2WPVA 2PQNA 4H7XA 4UI9C 2WXRA 5HI7A 3OXFA 4N2QA 4GZDA 2J9QA 4KZ0A 4JHJA 4AJWA 3FU6A 4N5CA 3HHMA 1EYHA 4HOQA 3ONLA 1OWOA 3CQGB 2AW6A 2LAHA 2P58C 3TG5A 1UN9A 5KCMA 3TG4A 1ZU2A 3TAXA 3QNKA 3LVRE 3SGHA 2HO1A 3FUDA 4OYSA 4W9RA 4HOTA 5D0QD 1HF8A 2J49A 1VDYA 4XZ4A 5LCWC 3CVYA 1E90A 4LRZA 4A3TA 5FZQA 2CG3A 2FF4A 4A1GA 2RG8A 2MRIA 1HG5A 2KCKA 2VSNA 4HXIA 3IKOB 4PUCA 3FTVA 4BTAA 4IRUA 2WXQA 4I6EA 3ASHA 3FTZA 4MRUA 4N3AA 4HORA 3L17A 4EPZA 1TEZA 2J07A 3QK0A 5FJYA 3ZEFA 4LUNU 2GGFA 3ZYLA 3IHVA 2XCBA 3D9LA 3S7FA 2ZU6B 2NXPA 3AS4A 4GYOA 4PS3A 4ABNA 4GU5A 4DLOA 1E8XA 2WMOA 3ULQA 5BT1A 3RO2A 4JC8A 2PZIA 3B7SA 4F7AA 3NF1A 3PNLB 3FWVA 4U0ZA 1BPOA 1HXIA 1MQSA 4GMLA 4KZCA 3UMVA 2VYIA 5J90A 4WWOA 2IF4A 3TXNA 1L5JA 4CGVA 3FTWA 4AV7A 4C0EA 4ILIA 5AYWD 4HOSA 3TL5A 4FU3A 4DI4A 3CK7A 3QWVA 2BUGA 3IV0A 4I43A 4IYPA 4Y6WA 4AVXA 5T8IA 2WMNA 2VSYA 4UWGA 3SI5A 3I5PA 4U8HA 1WAO1 3ZGQA 1W3BA 1WM5A 3ZW3A 1N52A 2FI7A 2KCVA 4ANXA 4E85A 2E2EA 3JYSA 3CGHA 4AOFA 3CK8A 3TGOA 1NP7A 2PM7A 1NA0A 3CV0A 4ILGA 2XRYA 2PL2A 1XGWA 4JPSA 4RSYA 3ZYMA 3CVUA 4A3VA 3U3WA 2X6FA 4EQFA 2LAIA 3CHSA 3QOUA 4N39A 3QDNA 3ZN3A 3G2WA 4NURA 2AWIA 2E0IA 3RJVA 4F53A 2AVPA 5G05J 5EDSA 1U3DA 3FFLA 4BT8A 3LY8A 4GB9A 2Y3AA 4G1TA 3CVPA 3FH8A 2L6JA 3D9OA 1HFAA 2VTBB 2KM4A 4WWNA 3FH5A 1INZA 4XI0A 2CHXA 4YVQC 1QQEA 2FO7A 3FULA 2XHEA 3MCXA 3PUJA 3U9WA 2IQCA 2IU1A 4GYWA 3KEZA 5KJMA 5LX8A 4MS6A 3QC1A 4GCOA 3UT4A 2X3MA 2CHWA 4I9EA 3Q49B 2WB2A 3G2VA 4DPRA 4APFA 4G2VA 3APCA 4I2ZA 5ARGA 4XE0A 3FEXA 4BTBA 4L2LA 2YHEA 3ZFWA 4L2YA 2WQ6A 3AU5A 3PEUB 2VGYA 3DPDA 3VLFA 2EQXA 2WXKA 4Y6CA 3CKCA 3AS5A 3U64A 3CVWA 3ML9A 4WUYA 3RU0A 4I1AA 3UT8A 2QY7A 2V4LA 4BX8A 3FTSA 3G2TA 2Q7FA 5FQ7A 1JWGA 3FUHA 2X6JA 3N71A 3QB2A 4CDRA 4KT6B 3AS8A 5KJLA 4FADA 2HYZA 3B7UX 1Z3YA 4GA0A 1UN8A 2DBAA 2YINA 3PH0C 4GA2A 4I6JA 4B8AA 3ESLA 2XGOA 4IULA 2DIWA 3JQ1A 4I2WA 4QFVA 2KATA 4UQYA 1WY6A 5G2NA 2AXUA 5DIZA 3RO3A 3L54A 3G2SA 3Q15A 4I17A 3PE3A 3FTXA 1P5QA 1H0AA 4UWLA 1ZBPA 2OVBA 2R5SA 4NQ0A 4UI9J 3D9JA 3D9IA 2VGXA 5A23A 3D3MA 3MJWA 3WXXA 5BUZA 4KVOA 3I4RB 4EZKA 4G11A 3S7JA 3CLJA 1NA3A 3LEWA 5CHEE 3CEQA 3CVLA 4WNDA 5KJNA 2NSZA 2R59A 3MX3A 4C9BB 4GMJA 4CRWA 4CT4A 5J08A 4GCNA 2WXOA 2UWJG 3K9IA 3UX4A 5AJDA 4KMOA 3RIBA 4I6GA 1NZNA 3JCKC 4LERA 2KC7A 4TRQA 2YQ8A 2GW1A 4DJAA 4ANWA 5FQ4A 3Q47B 4BT9A 5G04C 1Y6IA 4G26A 2XPYA 4ATGA 5KJKA 4KVMA 2MHKA 1IQRA 1E7UA 2IOLA 5JJ7A 1KT1A 3QKYA 4PDXA 3R9AB 4A1SA 3Q4AB 1H19A 4WNEA 3CQCB 1U3CA 3UQ3A 3PUKA 4LEUA 5AENA 2BTDA 2WXPA 4XI9A 1HO8A 4FA6A 1UJKA 2ONDA 3D9NA 3HYMB 3L22A 3QWWA 2XPIA 3CKBA 3U66A 3LY7A 4U0UA 2I6HA 2WQHA 4MLPA 3HIZA 3L6AA 4GZ5A 3R7RA 3PZDA 4TV3A 3SBSA 4CCAA 3PEVB 2I1KA 5BPPA 3LKUA 4O6FA 3VLDA 3JUIA 2XGSA 3BEEA 1IHGA 2XGMA 4XIFA 3L08A 1HE8A 2XCCA 1OWMA 3SBTB 5ENNA 4B8CB 4CDNA 3R7QA 4UQZA 2JLBA 2Y4UA 4XX5A 4J8DA 4JA7A 3APDA 4UWHA 4V3IA 1FVHA 1HZ4A 1Z3XA 3NZUA 4AXHA 2VJ8A 5LFAA 1IYGA 1OUVA 4ANUA 3IHYA 5JJTA 2UY1A 5LP0A 3SNXA 2YNQA 2FULA 3MA5A 2CFUA 4JHKA 1TJFA 4RVBA 4F1SA 2OV8A 4I1MA 3GYZA 1E8YA 2IFUA 3IBEA 3L13A 4BSXA 3NZSA 4J8SA 5T3RA 1E8ZA 2IONA 2WXJA 3RRUA 4D10C 4XKCA 2HR2A 1TJCA 3BG1B 3UT7A 3GZ2A 4RG6A 3EHMA 1HH8A 3HVEA 1ELWA 4WNFA 4PS8A 5FQ8A 3FUMA 3TXMA 3CVVA 3MKQA 3SF4A 4JEUA 4HOUA 3PS6A 3LYAA 1HX8A 3UPVA 3CIAA 2J4DA 3CHOA 3D9PA 3CK9A 3PREA 3T5XA 4ACLA 4CT0A 2X6HA 1MHQA 2LSUA 2HM8A 2R17C 2X6IA 3L16A 1SQMA 2CFZA 1QZ2A 4JVSA 4ME2A 5G55A 4AP2A 3GW4A 3CHPA 2KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A17 A;  3OXL A;  2XEV A;  3MV3 B;  2Y4T A;  4GA1 A;  4GYY A;  2YHC A;  2LNI A;  3LCA A;  5A7D B;  4F3V A;  3E4B A;  3GZ1 A;  3PDN A;  4JHR A;  3VTX A;  3S7D A;  2KCL A;  3KAE A;  3MEK A;  4N2S A;  4G23 A;  4J8E A;  4U04 A;  5CCL A;  4IN3 B;  1B89 A;  4AM9 A;  3ZHE A;  4JA9 A;  3KD7 A;  3FP3 A;  3ESK A;  4B94 A;  3SZ7 A;  2NC9 A;  2C0L A;  5A6C A;  5C1D A;  3KS2 A;  5FZS A;  4I9C A;  5EX3 A;  4UQX A;  4BWR A;  3S7B A;  3MV2 B;  2OOE A;  5LCW J;  5FT9 A;  2UY1 B;  3OXG A;  4J8F A;  4AY6 A;  1E96 B;  4GZ3 A;  5G04 J;  4N3B A;  3O48 A;  4G24 A;  3PE4 A;  3URZ A;  2QFC A;  3CVN A;  4CGW A;  1ELR A;  2VQ2 A;  5D0O D;  4WNG A;  4GZ6 A;  1PC2 A;  1KLX A;  2V5F A;  4RG9 A;  4KBQ A;  3U4T A;  3RKV A;  1Y8M A;  3LY9 A;  4U0S A;  2LSV A;  4N3C A;  4AY5 A;  1KT0 A;  4G25 A;  4JL0 A;  5EX0 A;  5DBK A;  3QWP A;  3Q5M A;  2PQR A;  4NRH B;  4GPK A;  3ZPJ A;  5FTP A;  4APO A;  1YA0 A;  3ZHE B;  5G05 C;  5HQ8 A;  3ASG A;  3LPZ A;  5FZR A;  1FCH A;  4YND A;  5ARF A;  2VGX B;  4YVO A;  4J0U A;  4UI9 K;  3ASF A;  3UUX A;  3VTY A;  5M72 A;  4KXK B;  3IEG A;  3ASD A;  2FEZ A;  4H7Y A;  5CCM A;  3CVQ A;  1XNF A;  3MKR A;  2C2L A;  5BW8 C;  2C0M A;  5JJ6 A;  2FBN A;  4KYO B;  4U07 A;  5BNW A;  4AIF A;  5EKQ D;  3EDT B;  2WPV A;  2PQN A;  4H7X A;  4UI9 C;  4N2Q A;  5HI7 A;  3OXF A;  2J9Q A;  4N5C A;  4HOQ A;  3TG4 A;  2P58 C;  3TG5 A;  1ZU2 A;  3TAX A;  2HO1 A;  4W9R A;  4HOT A;  5D0Q D;  5LCW C;  5FZQ A;  2FF4 A;  2VSN A;  2KCK A;  4BTA A;  3ASH A;  4N3A A;  4HOR A;  5FJY A;  2XCB A;  3S7F A;  3AS4 A;  4ABN A;  4GYO A;  3ULQ A;  5BT1 A;  3RO2 A;  2PZI A;  3NF1 A;  3FWV A;  4U0Z A;  1HXI A;  2VYI A;  2IF4 A;  4CGV A;  5AYW D;  4HOS A;  3CK7 A;  3QWV A;  2BUG A;  4Y6W A;  2VSY A;  1WAO 1;  3ZGQ A;  1W3B A;  1WM5 A;  2FI7 A;  2KCV A;  2E2E A;  3JYS A;  3CK8 A;  3TGO A;  3CV0 A;  1NA0 A;  2PL2 A;  3U3W A;  4EQF A;  3QOU A;  4N39 A;  3QDN A;  3ZN3 A;  3RJV A;  2AVP A;  5G05 J;  3FFL A;  4BT8 A;  3LY8 A;  4G1T A;  3CVP A;  2L6J A;  4XI0 A;  4YVQ C;  1QQE A;  2FO7 A;  4GYW A;  5KJM A;  4GCO A;  4I9E A;  3Q49 B;  4G2V A;  4I2Z A;  5ARG A;  4BTB A;  3ZFW A;  2VGY A;  4Y6C A;  3AS5 A;  3CKC A;  4WUY A;  3RU0 A;  4I1A A;  2Q7F A;  3N71 A;  4CDR A;  3AS8 A;  5KJL A;  2HYZ A;  4GA0 A;  2DBA A;  4GA2 A;  2XGO A;  4I2W A;  2KAT A;  4UQY A;  5DIZ A;  3RO3 A;  4I17 A;  3Q15 A;  3PE3 A;  1P5Q A;  1ZBP A;  2R5S A;  4NQ0 A;  4UI9 J;  2VGX A;  3WXX A;  3S7J A;  1NA3 A;  5CHE E;  3CEQ A;  3CVL A;  4WND A;  4GCN A;  2UWJ G;  3K9I A;  3RIB A;  1NZN A;  2KC7 A;  2YQ8 A;  2GW1 A;  3Q47 B;  4BT9 A;  5G04 C;  4G26 A;  5KJK A;  2MHK A;  5JJ7 A;  1KT1 A;  3QKY A;  3R9A B;  4A1S A;  3Q4A B;  4WNE A;  3UQ3 A;  4LEU A;  4XI9 A;  2OND A;  3HYM B;  3QWW A;  2XPI A;  3CKB A;  3LY7 A;  4U0U A;  2I6H A;  2WQH A;  4GZ5 A;  3LKU A;  4O6F A;  2XGS A;  3BEE A;  1IHG A;  2XGM A;  4XIF A;  2XCC A;  4UQZ A;  2JLB A;  2Y4U A;  4J8D A;  4JA7 A;  1HZ4 A;  1IYG A;  1OUV A;  5JJT A;  2UY1 A;  3MA5 A;  3GYZ A;  2IFU A;  2HR2 A;  1TJC A;  3GZ2 A;  4RG6 A;  1HH8 A;  1ELW A;  4WNF A;  3SF4 A;  4HOU A;  3LYA A;  3UPV A;  3CK9 A;  5KJN A;  2LSU A;  4ME2 A;  1QZ2 A;  3GW4 A; 
#chains in the Genus database with same CATH topology
 4N5Q A;  2XEV A;  1V55 E;  5A7D B;  3E4B A;  4JHR A;  1FT1 A;  2EIJ E;  4JW1 A;  3R9M A;  1IHB A;  2AXZ A;  4N2S A;  1JPL A;  4J8E A;  2KBX A;  3F6Q A;  1B89 A;  5CMW A;  3V31 A;  4DX5 D;  2X38 A;  3SHF A;  3PRZ A;  5JHB A;  3FP3 A;  4C48 B;  4B94 A;  1TYQ G;  1H6K A;  1N95 A;  3CHM A;  5A6C A;  4GAA A;  1E7V A;  1SZA A;  4LCT A;  5EX3 A;  4BWR A;  3S7B A;  3I4G A;  3PNT B;  3PZ1 A;  5CBN A;  2DCP A;  1E96 B;  3PVL A;  1IXV A;  4ILH B;  3J5Q B;  5CMY A;  5AQB A;  3T9K A;  3PE4 A;  1PAQ A;  3CVN A;  4CGW A;  3MKQ B;  2QC9 A;  2A5U A;  4WNG A;  5AAO A;  4BY6 A;  4FHJ A;  2KZT B;  4PH4 B;  4K5A B;  1KLX A;  4HVB A;  4FJY A;  2I1J A;  4KBQ A;  3OAW A;  4WWP A;  2I2O A;  2NYJ A;  4HQD A;  1OCC E;  4N3C A;  3C3R A;  1O1R A;  3UM0 A;  3GZS A;  5EX0 A;  3CVX A;  3ZYQ A;  3ULE G;  5DBK A;  3TJP A;  1DVP A;  3QWP A;  3Q5M A;  4FLB A;  3B13 A;  2P9L G;  2R2L A;  2OVF A;  4NRH B;  3RK6 A;  1GW6 A;  5FTP A;  4APO A;  3W9F A;  4XKB A;  5KWD A;  2XPZ A;  4YVO A;  5CED B;  4DK5 A;  1MJ0 A;  5JHA A;  3TWV A;  2B0O E;  4GTQ A;  4G8L A;  3DBS A;  1JCS A;  4DLQ A;  4U8V D;  2RFM A;  3FEY A;  2VSO E;  2WXI A;  2P9S G;  3LDZ A;  3LVQ E;  2C2L A;  2C0M A;  3AU4 A;  1MX4 A;  3T5V A;  1K1A A;  3UI2 A;  4BER A;  4AIF A;  3NQP A;  5ENO D;  5FWQ A;  2BKG A;  3C72 A;  4U95 D;  5ENS D;  1N54 A;  1H2V C;  3FU3 A;  5FIN A;  2IY0 C;  3BQO A;  4N2Q A;  4U7E B;  4GZD A;  3CQG B;  2LAH A;  3TG5 A;  1UN9 A;  3FUD A;  4HOT A;  1HF8 A;  1VDY A;  3B7B A;  4XZ4 A;  3SFX A;  5FZQ A;  2VSN A;  5ENP D;  4HXI A;  3IKO B;  4PUC A;  3FTV A;  4BTA A;  3ASH A;  2Y0B G;  4EPZ A;  1TEZ A;  5FJY A;  3ZEF A;  2NXP A;  1E8X A;  3RO2 A;  4F7A A;  3NF1 A;  5AQA A;  1BPO A;  1MQS A;  4GML A;  1TNU A;  3TXN A;  1L5J A;  2XEH A;  3C5R A;  3E37 A;  3CK7 A;  4I43 A;  4AVX A;  3ZUV B;  1BLX B;  3NOG D;  3ZGQ A;  4ANX A;  2KCV A;  3CGH A;  5JMN D;  2R02 A;  2BED A;  3JUE A;  5CEA A;  5G05 J;  2P9I G;  5CBO A;  4OAU C;  3FFL A;  4GB9 A;  2Y3A A;  1HFA A;  5B1B E;  4L9P A;  4XI0 A;  2LXL A;  2IU1 A;  5KJM A;  1UOH A;  1G3N B;  5ENQ D;  2ZGG A;  4I9E A;  4BET A;  3HG0 D;  2EIN E;  4DPR A;  4I2Z A;  3ABK E;  4L2L A;  4L2Y A;  2WQ6 A;  4RQI A;  2EQX A;  4I1A A;  3PZ2 A;  3UIN C;  2H6G A;  2HE0 A;  2Q7F A;  1TN7 A;  3QB2 A;  4YDO A;  2PNN A;  3DSV A;  2YIN A;  4GA2 A;  4B8A A;  3ESL A;  4IUL A;  2KAT A;  4GTV A;  4O1P A;  3PE3 A;  1P5Q A;  3DSU A;  1S63 A;  1ZBP A;  3AG3 E;  3D9J A;  3D9I A;  2IO2 C;  4G11 A;  3S7J A;  3CLJ A;  2NSZ A;  4GMJ A;  1LD8 A;  3DPY A;  4KMO A;  4I6G A;  4X8Q A;  2V5Q C;  4DJA A;  3HXD A;  5G04 C;  2IO3 C;  4KVM A;  1TNZ A;  4A1S A;  4WNE A;  1U3C A;  3PUK A;  3DSW A;  2WXP A;  2XZD G;  2I6H A;  3HIZ A;  3L6A A;  3R7R A;  1TN6 A;  4TV3 A;  2XGS A;  3E33 A;  2XGM A;  4XIF A;  3L08 A;  1HE8 A;  2XCC A;  4UQZ A;  2JLB A;  2Y4U A;  4XX5 A;  4UWH A;  4V3I A;  3DEP A;  4AXH A;  4HRL A;  1IYG A;  5JJT A;  1N0Q A;  5EYP F;  4RVB A;  4BSX A;  2WXJ A;  3GZ2 A;  2OEW A;  1ELW A;  2FO1 E;  3LYA A;  2J4D A;  3CK9 A;  2LSU A;  2HM8 A;  2M63 A;  3MV3 B;  2J8S D;  4GYY A;  2X6K A;  2WQ7 A;  2AJA A;  3C98 A;  1H2T C;  3GZ1 A;  2LUH A;  3VTX A;  2KCL A;  3KAE A;  5BXO A;  3FUJ A;  2QYJ A;  2P2C P;  2IJG X;  4HS2 A;  3MEK A;  4HLE A;  1IQU A;  4OVU A;  4IN3 B;  4GTO A;  2BF0 X;  5ANR A;  1D8D A;  4JA9 A;  2VGE A;  3CHR A;  3SZ7 A;  3JQ0 A;  3BG0 B;  5KNG A;  5BV0 A;  5EYL A;  3NOC D;  3EHQ A;  3KS2 A;  1KPS B;  3DRA A;  3E34 A;  5T4Y A;  2RFA A;  5LCW J;  2CG2 A;  3ASN E;  5FT9 A;  4EBA A;  3ZIM A;  3CSF A;  3ABL E;  2J09 A;  4J8F A;  3ABM E;  3RRM B;  4HB5 A;  4LNB A;  2MOW A;  3E30 A;  3FUK A;  3EHR A;  4DX1 A;  4G24 A;  1EPU A;  2QFC A;  4RLY A;  1OCZ E;  4NAC A;  1ELR A;  4J6I A;  3FUF A;  5EIB E;  4I1O B;  1ELK A;  2VQ2 A;  2RD0 A;  1HU3 A;  1HS6 A;  4A63 B;  4AEZ C;  3EJN A;  4FC8 A;  1PC2 A;  1AP7 A;  3HDX A;  3LXU X;  4C0M A;  4Q94 A;  4HI8 A;  4B0Z A;  3LY9 A;  3UKU G;  2P9U G;  2LSV A;  4G25 A;  3DST A;  4HRN A;  1K1B A;  5AIJ A;  5BV1 A;  2QYU A;  1LD7 A;  3CR3 A;  1FT2 A;  3AG2 E;  2L9B A;  5HQ8 A;  3EHN A;  3ASG A;  5FZR A;  2VGX B;  3J5P A;  4UI9 K;  2WM9 A;  3ASF A;  3UUX A;  3SD5 A;  3AJI A;  3IEG A;  3ZKJ A;  2GRL A;  2OCC E;  4P29 A;  2A5E A;  2FEZ A;  2JEK A;  4DI3 A;  4H7Y A;  4UWK A;  3CVQ A;  5CRV A;  5IY5 E;  3D9M A;  2WXG A;  4FLH A;  3CHQ A;  4K03 A;  4U07 A;  2I9C A;  4CEM A;  2ILR A;  1FVF A;  4FP7 A;  3OTN A;  3EDT B;  4U63 A;  4UI9 C;  2WXR A;  2F8Y A;  3FU6 A;  4N5C A;  1BD8 A;  3TG4 A;  1U2V G;  5KCM A;  1FPP A;  1ZU2 A;  5AAR A;  3SY2 A;  2XS8 A;  3LVR E;  2ETC A;  2HO1 A;  5D0Q D;  5CRU A;  2J49 A;  5LCW C;  1E90 A;  2XS1 A;  2FF4 A;  4QQI A;  4A1G A;  3JXJ A;  4J8Y A;  2WXQ A;  4MRU A;  2JAB A;  3FTZ A;  4N3A A;  4HOR A;  2J07 A;  4LUN U;  3IHV A;  3D9L A;  4ABN A;  2Y1L E;  2R03 A;  4J7W A;  5BT1 A;  2PZI A;  4EHM A;  3PNL B;  3FWV A;  1AWC B;  4CGV A;  4ILI A;  5AYW D;  4HOS A;  3TWR A;  3TL5 A;  4FU3 A;  3SO8 A;  4UWG A;  3SI5 A;  5ITZ F;  1WAO 1;  1N52 A;  4E85 A;  4AOF A;  1NP7 A;  1V54 E;  1NA0 A;  4ILG A;  4RSY A;  4A3V A;  3U3W A;  2LAI A;  3Q7A A;  3CHS A;  1MYO A;  3QDN A;  4F53 A;  1YYH A;  1U3D A;  3RAU A;  3FH8 A;  2KM4 A;  2CHX A;  4M7C A;  4YVQ C;  2FO7 A;  2XHE A;  3U9W A;  5LX8 A;  3QC1 A;  3UT4 A;  2WB2 A;  3Q49 B;  3G2V A;  2BKK B;  5ARG A;  4XE0 A;  1OT8 A;  2R05 A;  4OAV B;  3PEU B;  2WXK A;  3ML9 A;  4WUY A;  3RU0 A;  2V4L A;  3FTS A;  4ZHB A;  3X2Q E;  1SW6 A;  2X6J A;  1Z3Y A;  1UN8 A;  3PH0 C;  4I6J A;  2DIW A;  3JQ1 A;  1WY6 A;  3RO3 A;  3FTX A;  3PZ4 A;  5HRY A;  3BUA A;  3D3M A;  4EZK A;  1NA3 A;  5CHE E;  3MX3 A;  5BXU A;  2WXO A;  4DRX E;  5AJD A;  3RIB A;  4LER A;  2YQ8 A;  1IKN D;  5FIO A;  5FQ4 A;  4G26 A;  2XPY A;  4ATG A;  1KZP A;  2MHK A;  1IQR A;  1QYM A;  3HXF A;  3QKY A;  1H19 A;  3UQ3 A;  3Q75 A;  1Q2Z A;  5AEN A;  2OND A;  3HYM B;  3QWW A;  3CKB A;  1TN8 A;  3SBS A;  5BPP A;  3PEV B;  3UM3 A;  3LKU A;  3VLD A;  2DZO A;  3SBT B;  1MZC A;  4JD2 G;  2VJ8 A;  5LFA A;  4GTP A;  3SNX A;  2FUL A;  4K5B A;  2CFU A;  4JHK A;  4DUI A;  4I1M A;  1E8Y A;  3NZS A;  3UT7 A;  1KZO A;  2QZA A;  5FQ8 A;  3TXM A;  4HOU A;  1HX8 A;  3CIA A;  3D9P A;  4ACL A;  4CT0 A;  4BSZ B;  2X6I A;  3L16 A;  4AP2 A;  5G55 A;  2CFZ A;  5LP0 A;  3GW4 A;  2H6H A;  2Y4T A;  2P9K G;  4GA1 A;  2XQ0 A;  3LCA A;  3MGB A;  4BES A;  1Z6T A;  4GTR A;  4L1B A;  3PDN A;  3S7D A;  3L82 A;  5E75 A;  1EDU A;  3NB2 A;  4U04 A;  1O1S A;  3FTU A;  4TUM A;  4MBG A;  4AM9 A;  1JCQ A;  1BI7 B;  1DNP A;  1SVX A;  3KD7 A;  5EN5 D;  1N4Q A;  4DX2 A;  2C0L A;  2WXH A;  1OWP A;  3ZYK A;  4GTT A;  3RRN B;  4EZL A;  3FU5 A;  3QAQ A;  3E32 A;  4ATZ D;  2EIM E;  3EIQ C;  2WXM A;  3MV2 B;  3QAR A;  1TR4 A;  4CYM D;  4LNU D;  5LOZ A;  4EBA G;  2L0I A;  3OXG A;  5E76 A;  4FJZ A;  4AY6 A;  5ANL A;  2A4Z A;  4GZ3 A;  1UW4 B;  4NIK A;  3DEO A;  1S0P A;  4E6H A;  1LF8 A;  4CDM A;  1UJJ A;  4N3B A;  2XEN A;  3P2B A;  3B7T A;  3TWQ A;  1BU9 A;  1O1T A;  3PZ3 A;  3Q9U C;  3C3O A;  4PS7 A;  1X81 A;  4MKT A;  2LO6 A;  2V5F A;  1S70 B;  3FUN A;  3ENE A;  4U0S A;  1K8K G;  3NBN B;  3ZRH A;  5HKP A;  4JL0 A;  4JZY A;  3HXE A;  3ONK A;  1DCQ A;  2GRM A;  2PQR A;  3RSE G;  4GPK A;  5FQ6 A;  1YA0 A;  3FH7 A;  1X5B A;  5G05 C;  3Q78 A;  3LPZ A;  3B95 A;  4YND A;  5ARF A;  1TNY A;  1PY1 A;  3VTY A;  5M72 A;  1O5M A;  4DX7 D;  1OWN A;  4YDY A;  2V0P A;  5C2Y A;  3SQV A;  3LJ3 A;  3ML8 A;  4LSZ E;  1HG2 A;  5CCM A;  3FUI A;  1NL4 A;  4F6R D;  4OVV A;  1XNF A;  3MKR A;  4GTM A;  2H6I A;  4TUU A;  4BEP A;  2P9P G;  2ZGD A;  3D9K A;  3V2X A;  1MX6 A;  1EF1 C;  5CEC B;  3EUV A;  2ZXW E;  5BNW A;  4JXT A;  2WXF A;  3Q79 A;  4URK A;  2XZT G;  4LG6 A;  1OCR E;  2L0T B;  4H7X A;  5HI7 A;  3OXF A;  4KZ0 A;  4JHJ A;  3HHM A;  1TNB A;  1OWO A;  2AW6 A;  4TXQ A;  2EIL E;  3TWW A;  2DVW A;  3TAX A;  3SGH A;  2CG3 A;  2RG8 A;  4I6E A;  3AG4 E;  3C3Q A;  3QK0 A;  2V4H C;  2GGF A;  3ZYL A;  3S7F A;  2ZU6 B;  4PS3 A;  4HRM B;  4GU5 A;  4DLO A;  1A5E A;  2WMO A;  3ULQ A;  4XEI G;  1N4R A;  1HXI A;  4KZC A;  3UMV A;  5J90 A;  4AV7 A;  3QWV A;  2BUG A;  3IV0 A;  4IYP A;  4Y6W A;  5T8I A;  3AAA C;  2KXP C;  2VSY A;  3I5P A;  3ZW3 A;  2FI7 A;  3TWT A;  2F37 A;  2XRY A;  2PL2 A;  3CVU A;  2GRP B;  3UM2 A;  3QOU A;  4CZ2 D;  4YDW A;  2AWI A;  3RJV A;  2AVP A;  1K3Z D;  2DWZ A;  4TXP A;  4UUC A;  4BT8 A;  2DYR E;  3LY8 A;  3D9O A;  3FH5 A;  1QQE A;  3FUL A;  3PUJ A;  2IQC A;  4GYW A;  4B93 B;  4MS6 A;  4GCO A;  4APF A;  3TWX A;  3APC A;  4BTB A;  2MYO A;  3W9G A;  3Q73 A;  4O1O A;  3ZFW A;  3DPD A;  4Y6C A;  3CKC A;  3CVW A;  4U96 D;  2F8X K;  5FQ7 A;  5ENR D;  3N71 A;  4KT6 B;  3AS8 A;  3SFY A;  4FAD A;  2HYZ A;  2L6B A;  3B7U X;  4GA0 A;  1ZB1 A;  3TWU A;  2XGO A;  4I2W A;  3UXG A;  5DIZ A;  3G2S A;  2RKK A;  3Q15 A;  1H0A A;  5A23 A;  4KVO A;  3I4R B;  5EIL A;  3CEQ A;  4WND A;  2R59 A;  4C9B B;  4DX6 D;  4CT4 A;  2Y69 E;  4GCN A;  3UIP C;  3DSX A;  2UWJ G;  3K9I A;  3UX4 A;  1NZN A;  2GW1 A;  3Q47 B;  4BT9 A;  5KJK A;  1E7U A;  2IOL A;  1OCO E;  1KT1 A;  5D66 A;  3Q4A B;  2GRN B;  1OXJ A;  3KSQ A;  1UJK A;  3D9N A;  3U66 A;  3L22 A;  3LY7 A;  3DXK G;  4U0U A;  2WQH A;  3KSL A;  4O6F A;  3JUI A;  3HXB A;  1WG0 A;  4CDN A;  3R7Q A;  1TNO A;  4J8D A;  4JA7 A;  1FVH A;  1HZ4 A;  3NZU A;  3IHY A;  2UY1 A;  3MA5 A;  1TJF A;  4O60 A;  5ENT D;  3GYZ A;  4J8S A;  4LNG A;  3ASO E;  1TJC A;  2ZIR A;  3BG1 B;  1HH8 A;  3HVE A;  3CVV A;  3SF4 A;  5B1A E;  3UPV A;  3CHO A;  3PRE A;  3T5X A;  5KJN A;  2R17 C;  4ME2 A;  1SQM A;  1QZ2 A;  4JVS A;  1A17 A;  3OXL A;  2CHZ A;  2B6C A;  2YHC A;  2LNI A;  3T8M A;  4BFR A;  3UM1 A;  4F3V A;  3MYV A;  4M3O A;  4JEH A;  3CST A;  3Q7F A;  2OEV A;  2IOS A;  4G23 A;  5CCL A;  3ISM C;  3EU5 A;  2XRZ A;  3ZHE A;  4F1P A;  3ESK A;  2NC9 A;  3B7R L;  4GZC A;  3FTY A;  4K0R A;  2AXV A;  5C1D A;  3HRA A;  1N0R A;  3O4Z A;  5FZS A;  3S2A A;  3G2U A;  4I9C A;  4Q96 A;  4UQX A;  2V8S E;  4EEC A;  3ZU7 B;  2OOE A;  4U8Y D;  3P1U A;  3V30 A;  2UY1 B;  3FY4 A;  4Z68 A;  4HI9 A;  3FHE A;  1E8W A;  3DXM G;  3JXI A;  3ZVV A;  5G04 J;  2J08 A;  1JWF A;  1MX2 A;  3FUE A;  3FU0 A;  3SFZ A;  3EIJ A;  3APF A;  1N4S A;  3O48 A;  3URZ A;  3HVE B;  1RW2 A;  3VLE A;  5AJL A;  4HFG A;  2WXN A;  1N11 A;  4ACK A;  4BX9 A;  5D0O D;  4GZ6 A;  4B89 A;  3LS8 A;  2WXL A;  3ZXS A;  4RG9 A;  2DYS E;  5AQ7 A;  2ZIS A;  3U4T A;  1JUQ A;  3RKV A;  1Y8M A;  4UWF A;  4FUL A;  4AY5 A;  1KT0 A;  1H2U A;  3Q9N C;  2VSX E;  2XEE A;  4A55 A;  1YMP A;  3ZPJ A;  4Q69 A;  3ZHE B;  4YDE A;  4L23 A;  1UG3 A;  3V79 K;  2WVI A;  3QJZ A;  2GRR B;  3ULY A;  3KEA A;  3MZL B;  1FCH A;  4WAF A;  1N94 A;  1SZ9 A;  3I3N A;  1NFI E;  4EZJ A;  4J0U A;  4ANV A;  4L7T A;  4KXK B;  2EIK E;  1S64 A;  3ASD A;  3FDH A;  1OWL A;  4FHK A;  2DZN A;  2J4B A;  3TWS A;  1N9A A;  5KBA A;  2PM6 A;  5BW8 C;  5JJ6 A;  2FBN A;  3HXC A;  3IXE A;  3L9T A;  4KYO B;  4R7L A;  1QNF A;  5EKQ D;  2GRQ B;  4K5C A;  2ETB A;  3WG7 E;  2VTB A;  2WPV A;  2PQN A;  1D8E A;  2J9Q A;  4AJW A;  4HOQ A;  1EYH A;  3ONL A;  4GTS A;  2P58 C;  3AG1 E;  3QNK A;  3LJN A;  3UKR G;  4W9R A;  4OYS A;  1RZ4 A;  5KNH D;  3CVY A;  4A3T A;  1QBQ A;  2MRI A;  1HG5 A;  2KCK A;  4IRU A;  3D9H A;  5HS0 A;  3L17 A;  2XCB A;  3AS4 A;  4GYO A;  3UTM A;  1OY3 D;  4JC8 A;  3B7S A;  4U0Z A;  1SA4 A;  2VYI A;  4HLL A;  4WWO A;  2IF4 A;  3FTW A;  4C0E A;  4DI4 A;  3DSS A;  2WMN A;  1SA5 A;  4U8H A;  1W3B A;  1WM5 A;  2E2E A;  3JYS A;  3CK8 A;  3TGO A;  3EU9 A;  2PM7 A;  3CV0 A;  1DC2 A;  5D2M C;  5B3S E;  1XGW A;  4GPM A;  4JPS A;  3ZYM A;  2X6F A;  4EQF A;  1DCE A;  4N39 A;  3ZN3 A;  3G2W A;  4NUR A;  2E0I A;  5EDS A;  4G1T A;  3CVP A;  2L6J A;  4G8K A;  2VTB B;  4WWN A;  5AQ9 A;  1INZ A;  3MCX A;  2H6F A;  3KEZ A;  2X3M A;  3ZXP A;  2CHW A;  1WDY A;  4ZFH A;  4G2V A;  3FEX A;  2YHE A;  1BI8 B;  3AU5 A;  2LXM A;  2VGY A;  3VLF A;  3AS5 A;  3U64 A;  3UT8 A;  2QY7 A;  2GRO B;  4BX8 A;  2IEJ A;  3G2T A;  1JWG A;  3FUH A;  4CDR A;  3BU8 A;  1H6P A;  5KJL A;  2DBA A;  3DWL G;  4QFV A;  4UQY A;  5G2N A;  2AXU A;  3L54 A;  4I17 A;  4UWL A;  2R5S A;  2OVB A;  4NQ0 A;  4UI9 J;  2VGX A;  5AN8 A;  3MJW A;  4JB8 P;  3WXX A;  5BUZ A;  3LEW A;  3CVL A;  4CRW A;  5J08 A;  1D9S A;  4HBD A;  3JCK C;  4TRQ A;  2KC7 A;  4ANW A;  1Y6I A;  1H6O A;  3T8K A;  5JJ7 A;  4PDX A;  3R9A B;  3CQC B;  1YCS B;  4LEU A;  5CER B;  2BTD A;  4XI9 A;  1HO8 A;  4FA6 A;  2XPI A;  4MLP A;  4GZ5 A;  3PZD A;  4CCA A;  2I1K A;  3BEE A;  1IHG A;  5EID A;  1OWM A;  5ENN A;  4B8C B;  5JA4 D;  5H7P A;  3APD A;  1Z3X A;  1OUV A;  4ANU A;  3ZNG A;  2ETA A;  2YNQ A;  3UIO C;  1JCR A;  4F1S A;  2OV8 A;  2IFU A;  3IBE A;  3L13 A;  5T3R A;  1E8Z A;  3NAW A;  2ION A;  4D10 C;  1NI1 A;  3RRU A;  4XKC A;  2HR2 A;  1LTX A;  4HNA D;  2F0Y A;  3V2O A;  4RG6 A;  4TXR A;  3EHM A;  4WNF A;  4PS8 A;  3FUM A;  3MKQ A;  1Z5S C;  4JEU A;  1N4P A;  3PS6 A;  2X6H A;  1MHQ A;  4GMR A;  4LRZ A;  2P9N G;  3CHP A;  2KZT A; 
#chains in the Genus database with same CATH homology
 1A17 A;  3OXL A;  2M63 A;  2XEV A;  3MV3 B;  2Y4T A;  2CHZ A;  4GA1 A;  4GYY A;  2YHC A;  2XQ0 A;  2LNI A;  3T8M A;  2X6K A;  3LCA A;  3MGB A;  4BFR A;  5A7D B;  2WQ7 A;  1Z6T A;  4F3V A;  3C98 A;  3MYV A;  4M3O A;  3E4B A;  4L1B A;  1H2T C;  3GZ1 A;  3PDN A;  4JHR A;  3CST A;  4JEH A;  3VTX A;  4JW1 A;  3S7D A;  2KCL A;  3KAE A;  2AXZ A;  3FUJ A;  5E75 A;  1EDU A;  2IJG X;  3MEK A;  4HS2 A;  4HLE A;  4N2S A;  1IQU A;  1JPL A;  2IOS A;  4G23 A;  4J8E A;  4U04 A;  4OVU A;  5CCL A;  3FTU A;  4IN3 B;  2BF0 X;  5ANR A;  1B89 A;  5CMW A;  4AM9 A;  2X38 A;  3SHF A;  2XRZ A;  3ZHE A;  4JA9 A;  1DNP A;  3KD7 A;  3PRZ A;  3CHR A;  5JHB A;  3FP3 A;  3ESK A;  4B94 A;  3SZ7 A;  3JQ0 A;  2NC9 A;  3B7R L;  2C0L A;  2WXH A;  3BG0 B;  1H6K A;  4GZC A;  1OWP A;  3CHM A;  3ZYK A;  3FTY A;  5BV0 A;  5A6C A;  3RRN B;  4K0R A;  2AXV A;  4EZL A;  3FU5 A;  4GAA A;  3QAQ A;  5C1D A;  3KS2 A;  1E7V A;  3O4Z A;  5FZS A;  1SZA A;  5T4Y A;  3G2U A;  4I9C A;  4LCT A;  5EX3 A;  4Q96 A;  3S2A A;  4UQX A;  4BWR A;  3EIQ C;  2V8S E;  3S7B A;  3I4G A;  2WXM A;  4EEC A;  3MV2 B;  3QAR A;  3PNT B;  2OOE A;  5LCW J;  2CG2 A;  5FT9 A;  4EBA A;  3P1U A;  3ZIM A;  2UY1 B;  5LOZ A;  3FY4 A;  2L0I A;  4EBA G;  3CSF A;  3OXG A;  5E76 A;  4FJZ A;  3FHE A;  1E8W A;  2J09 A;  4J8F A;  4AY6 A;  2DCP A;  1E96 B;  5ANL A;  2A4Z A;  3PVL A;  4GZ3 A;  3ZVV A;  3RRM B;  5G04 J;  1UW4 B;  1JWF A;  2J08 A;  3FUE A;  2MOW A;  4ILH B;  3FU0 A;  3SFZ A;  1S0P A;  3EIJ A;  3APF A;  4E6H A;  1LF8 A;  3FUK A;  4CDM A;  1UJJ A;  4N3B A;  3O48 A;  3P2B A;  4G24 A;  5CMY A;  1EPU A;  3PE4 A;  3URZ A;  1PAQ A;  2QFC A;  3CVN A;  3HVE B;  4CGW A;  4NAC A;  1ELR A;  3B7T A;  3VLE A;  3MKQ B;  4J6I A;  3FUF A;  4HFG A;  5AJL A;  4I1O B;  2WXN A;  1ELK A;  2VQ2 A;  2RD0 A;  4ACK A;  1HU3 A;  1HS6 A;  4BX9 A;  4PS7 A;  5D0O D;  2A5U A;  4GZ6 A;  4WNG A;  4B89 A;  4AEZ C;  3EJN A;  4BY6 A;  4FHJ A;  4MKT A;  4FC8 A;  2KZT B;  4PH4 B;  1PC2 A;  2LO6 A;  3LS8 A;  1KLX A;  2WXL A;  2V5F A;  4FJY A;  3ZXS A;  4HVB A;  4RG9 A;  2I1J A;  3HDX A;  4KBQ A;  3LXU X;  4C0M A;  3U4T A;  3OAW A;  4Q94 A;  3FUN A;  4WWP A;  1JUQ A;  3RKV A;  2I2O A;  1Y8M A;  3ENE A;  4B0Z A;  3LY9 A;  4U0S A;  2LSV A;  4UWF A;  4N3C A;  4FUL A;  4AY5 A;  3ZRH A;  1KT0 A;  4G25 A;  1H2U A;  3GZS A;  4JL0 A;  5EX0 A;  3ZYQ A;  4JZY A;  3CVX A;  2VSX E;  5DBK A;  3TJP A;  1DVP A;  3QWP A;  3Q5M A;  3ONK A;  4FLB A;  3B13 A;  4A55 A;  2GRM A;  5AIJ A;  5BV1 A;  2PQR A;  2OVF A;  4NRH B;  3CR3 A;  3RK6 A;  4GPK A;  1GW6 A;  3ZPJ A;  5FTP A;  4APO A;  5FQ6 A;  1YA0 A;  3FH7 A;  3ZHE B;  1X5B A;  2L9B A;  5G05 C;  4L23 A;  1UG3 A;  4Q69 A;  4XKB A;  2WVI A;  3EHN A;  5HQ8 A;  3ASG A;  3QJZ A;  3LPZ A;  5FZR A;  3MZL B;  1FCH A;  2XPZ A;  4YND A;  4WAF A;  5ARF A;  1SZ9 A;  1PY1 A;  2VGX B;  3I3N A;  4YVO A;  4EZJ A;  4J0U A;  4DK5 A;  4UI9 K;  2WM9 A;  3ASF A;  3UUX A;  4ANV A;  3VTY A;  5M72 A;  4L7T A;  3SD5 A;  4KXK B;  5JHA A;  3IEG A;  3ASD A;  3FDH A;  1OWN A;  2GRL A;  2V0P A;  4P29 A;  3DBS A;  5C2Y A;  2FEZ A;  2JEK A;  4DLQ A;  3LJ3 A;  3ML8 A;  4DI3 A;  4H7Y A;  1OWL A;  4UWK A;  1HG2 A;  5CCM A;  3FEY A;  2VSO E;  3CVQ A;  4FHK A;  3FUI A;  2WXI A;  4OVV A;  2J4B A;  3LDZ A;  1XNF A;  3D9M A;  3LVQ E;  3MKR A;  2PM6 A;  2WXG A;  4TUU A;  2C2L A;  4FLH A;  5BW8 C;  2C0M A;  3AU4 A;  3CHQ A;  5JJ6 A;  3D9K A;  2FBN A;  4K03 A;  4KYO B;  1EF1 C;  3T5V A;  4U07 A;  5BNW A;  4JXT A;  2I9C A;  4CEM A;  4R7L A;  2ILR A;  1QNF A;  1FVF A;  2WXF A;  4AIF A;  5EKQ D;  3NQP A;  4FP7 A;  5FWQ A;  4URK A;  3OTN A;  2VTB A;  3EDT B;  1N54 A;  1H2V C;  2L0T B;  3FU3 A;  4U63 A;  2WPV A;  2PQN A;  4H7X A;  4UI9 C;  2WXR A;  5HI7 A;  3OXF A;  4N2Q A;  4GZD A;  2J9Q A;  4KZ0 A;  4JHJ A;  4AJW A;  3FU6 A;  4N5C A;  3HHM A;  1EYH A;  4HOQ A;  3ONL A;  1OWO A;  3CQG B;  2AW6 A;  2LAH A;  2P58 C;  3TG5 A;  1UN9 A;  5KCM A;  3TG4 A;  1ZU2 A;  3TAX A;  3QNK A;  3LVR E;  3SGH A;  2HO1 A;  3FUD A;  4OYS A;  4W9R A;  4HOT A;  5D0Q D;  1HF8 A;  2J49 A;  1VDY A;  4XZ4 A;  5LCW C;  3CVY A;  1E90 A;  4LRZ A;  4A3T A;  5FZQ A;  2CG3 A;  2FF4 A;  4A1G A;  2RG8 A;  2MRI A;  1HG5 A;  2KCK A;  2VSN A;  4HXI A;  3IKO B;  4PUC A;  3FTV A;  4BTA A;  4IRU A;  2WXQ A;  4I6E A;  3ASH A;  3FTZ A;  4MRU A;  4N3A A;  4HOR A;  3L17 A;  4EPZ A;  1TEZ A;  2J07 A;  3QK0 A;  5FJY A;  3ZEF A;  4LUN U;  2GGF A;  3ZYL A;  3IHV A;  2XCB A;  3D9L A;  3S7F A;  2ZU6 B;  2NXP A;  3AS4 A;  4GYO A;  4PS3 A;  4ABN A;  4GU5 A;  4DLO A;  1E8X A;  2WMO A;  3ULQ A;  5BT1 A;  3RO2 A;  4JC8 A;  2PZI A;  3B7S A;  4F7A A;  3NF1 A;  3PNL B;  3FWV A;  4U0Z A;  1BPO A;  1HXI A;  1MQS A;  4GML A;  4KZC A;  3UMV A;  2VYI A;  5J90 A;  4WWO A;  2IF4 A;  3TXN A;  1L5J A;  4CGV A;  3FTW A;  4AV7 A;  4C0E A;  4ILI A;  5AYW D;  4HOS A;  3TL5 A;  4FU3 A;  4DI4 A;  3CK7 A;  3QWV A;  2BUG A;  3IV0 A;  4I43 A;  4IYP A;  4Y6W A;  4AVX A;  5T8I A;  2WMN A;  2VSY A;  4UWG A;  3SI5 A;  3I5P A;  4U8H A;  1WAO 1;  3ZGQ A;  1W3B A;  1WM5 A;  3ZW3 A;  1N52 A;  2FI7 A;  2KCV A;  4ANX A;  4E85 A;  2E2E A;  3JYS A;  3CGH A;  4AOF A;  3CK8 A;  3TGO A;  1NP7 A;  2PM7 A;  1NA0 A;  3CV0 A;  4ILG A;  2XRY A;  2PL2 A;  1XGW A;  4JPS A;  4RSY A;  3ZYM A;  3CVU A;  4A3V A;  3U3W A;  2X6F A;  4EQF A;  2LAI A;  3CHS A;  3QOU A;  4N39 A;  3QDN A;  3ZN3 A;  3G2W A;  4NUR A;  2AWI A;  2E0I A;  3RJV A;  4F53 A;  2AVP A;  5G05 J;  5EDS A;  1U3D A;  3FFL A;  4BT8 A;  3LY8 A;  4GB9 A;  2Y3A A;  4G1T A;  3CVP A;  3FH8 A;  2L6J A;  3D9O A;  1HFA A;  2VTB B;  2KM4 A;  4WWN A;  3FH5 A;  1INZ A;  4XI0 A;  2CHX A;  4YVQ C;  1QQE A;  2FO7 A;  3FUL A;  2XHE A;  3MCX A;  3PUJ A;  3U9W A;  2IQC A;  2IU1 A;  4GYW A;  3KEZ A;  5KJM A;  5LX8 A;  4MS6 A;  3QC1 A;  4GCO A;  3UT4 A;  2X3M A;  2CHW A;  4I9E A;  3Q49 B;  2WB2 A;  3G2V A;  4DPR A;  4APF A;  4G2V A;  3APC A;  4I2Z A;  5ARG A;  4XE0 A;  3FEX A;  4BTB A;  4L2L A;  2YHE A;  3ZFW A;  4L2Y A;  2WQ6 A;  3AU5 A;  3PEU B;  2VGY A;  3DPD A;  3VLF A;  2EQX A;  2WXK A;  4Y6C A;  3CKC A;  3AS5 A;  3U64 A;  3CVW A;  3ML9 A;  4WUY A;  3RU0 A;  4I1A A;  3UT8 A;  2QY7 A;  2V4L A;  4BX8 A;  3FTS A;  3G2T A;  2Q7F A;  5FQ7 A;  1JWG A;  3FUH A;  2X6J A;  3N71 A;  3QB2 A;  4CDR A;  4KT6 B;  3AS8 A;  5KJL A;  4FAD A;  2HYZ A;  3B7U X;  1Z3Y A;  4GA0 A;  1UN8 A;  2DBA A;  2YIN A;  3PH0 C;  4GA2 A;  4I6J A;  4B8A A;  3ESL A;  2XGO A;  4IUL A;  2DIW A;  3JQ1 A;  4I2W A;  4QFV A;  2KAT A;  4UQY A;  1WY6 A;  5G2N A;  2AXU A;  5DIZ A;  3RO3 A;  3L54 A;  3G2S A;  3Q15 A;  4I17 A;  3PE3 A;  3FTX A;  1P5Q A;  1H0A A;  4UWL A;  1ZBP A;  2OVB A;  2R5S A;  4NQ0 A;  4UI9 J;  3D9J A;  3D9I A;  2VGX A;  5A23 A;  3D3M A;  3MJW A;  3WXX A;  5BUZ A;  4KVO A;  3I4R B;  4EZK A;  4G11 A;  3S7J A;  3CLJ A;  1NA3 A;  3LEW A;  5CHE E;  3CEQ A;  3CVL A;  4WND A;  5KJN A;  2NSZ A;  2R59 A;  3MX3 A;  4C9B B;  4GMJ A;  4CRW A;  4CT4 A;  5J08 A;  4GCN A;  2WXO A;  2UWJ G;  3K9I A;  3UX4 A;  5AJD A;  4KMO A;  3RIB A;  4I6G A;  1NZN A;  3JCK C;  4LER A;  2KC7 A;  4TRQ A;  2YQ8 A;  2GW1 A;  4DJA A;  4ANW A;  5FQ4 A;  3Q47 B;  4BT9 A;  5G04 C;  1Y6I A;  4G26 A;  2XPY A;  4ATG A;  5KJK A;  4KVM A;  2MHK A;  1IQR A;  1E7U A;  2IOL A;  5JJ7 A;  1KT1 A;  3QKY A;  4PDX A;  3R9A B;  4A1S A;  3Q4A B;  1H19 A;  4WNE A;  3CQC B;  1U3C A;  3UQ3 A;  3PUK A;  4LEU A;  5AEN A;  2BTD A;  2WXP A;  4XI9 A;  1HO8 A;  4FA6 A;  1UJK A;  2OND A;  3D9N A;  3HYM B;  3L22 A;  3QWW A;  2XPI A;  3CKB A;  3U66 A;  3LY7 A;  4U0U A;  2I6H A;  2WQH A;  4MLP A;  3HIZ A;  3L6A A;  4GZ5 A;  3R7R A;  3PZD A;  4TV3 A;  3SBS A;  4CCA A;  3PEV B;  2I1K A;  5BPP A;  3LKU A;  4O6F A;  3VLD A;  3JUI A;  2XGS A;  3BEE A;  1IHG A;  2XGM A;  4XIF A;  3L08 A;  1HE8 A;  2XCC A;  1OWM A;  3SBT B;  5ENN A;  4B8C B;  4CDN A;  3R7Q A;  4UQZ A;  2JLB A;  2Y4U A;  4XX5 A;  4J8D A;  4JA7 A;  3APD A;  4UWH A;  4V3I A;  1FVH A;  1HZ4 A;  1Z3X A;  3NZU A;  4AXH A;  2VJ8 A;  5LFA A;  1IYG A;  1OUV A;  4ANU A;  3IHY A;  5JJT A;  2UY1 A;  5LP0 A;  3SNX A;  2YNQ A;  2FUL A;  3MA5 A;  2CFU A;  4JHK A;  1TJF A;  4RVB A;  4F1S A;  2OV8 A;  4I1M A;  3GYZ A;  1E8Y A;  2IFU A;  3IBE A;  3L13 A;  4BSX A;  3NZS A;  4J8S A;  5T3R A;  1E8Z A;  2ION A;  2WXJ A;  3RRU A;  4D10 C;  4XKC A;  2HR2 A;  1TJC A;  3BG1 B;  3UT7 A;  3GZ2 A;  4RG6 A;  3EHM A;  1HH8 A;  3HVE A;  1ELW A;  4WNF A;  4PS8 A;  5FQ8 A;  3FUM A;  3TXM A;  3CVV A;  3MKQ A;  3SF4 A;  4JEU A;  4HOU A;  3PS6 A;  3LYA A;  1HX8 A;  3UPV A;  3CIA A;  2J4D A;  3CHO A;  3D9P A;  3CK9 A;  3PRE A;  3T5X A;  4ACL A;  4CT0 A;  2X6H A;  1MHQ A;  2LSU A;  2HM8 A;  2R17 C;  2X6I A;  3L16 A;  1SQM A;  2CFZ A;  1QZ2 A;  4JVS A;  4ME2 A;  5G55 A;  4AP2 A;  3GW4 A;  3CHP A;  2KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...