3TWUA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 52
structure length 160
sequence length 160
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twuA00
3LJNA 3NOGD 3ZNGA 4BESA 4HRLA 4G8KA 4HI8A 3TWTA 4DX7D 5HS0A 3V79K 2P2CP 3DEPA 3B7BA 2V4HC 3JUEA 4NIKA 5ENQD 4U96D 3HRAA 2KXPC 4HB5A 4HQDA 5D66A 3V2OA 3JXJA 2PNNA 5HRYA 1BU9A 5CBNA 4OAVB 2RFAA 4HI9A 1MX6A 2RFMA 5AQ7A 2BKGA 2XZTG 4LSZE 2Y1LE 1NFIE 5ITZF 4HNAD 4ZFHA 1SVXA 1YYHA 3NOCD 4U95D 3TWVA 2FO1E 5AAOA 5CEDB 1IKND 4YDYA 1N0QA 4ZHBA 3TWSA 4J8YA 3UTMA 4DX5D 2HE0A 4HRNA 4GPMA 4BERA 1BI8B 2XZDG 5EYPF 3V31A 2A5EA 2ZGDA 4C48B 4N5QA 2JABA 4O60A 3V30A 4DUIA 2DZNA 1DCQA 3J5PA 5AQ9A 2XEHA 1OY3D 4QQIA 2VGEA 5KWDA 1A5EA 3Q9UC 5ENPD 1K3ZD 5CEAA 4U8YD 1BI7B 5FINA 4BEPA 2V5QC 3EHRA 2B0OE 4J7WA 4K5CA 4O1OA 4YDWA 3SO8A 3T9KA 4DRXE 2F8YA 2F37A 3HG0D 2MYOA 5EIBE 1BLXB 5EIDA 3T8KA 2BKKB 4CYMD 2J8SD 2KBXA 1QYMA 4K5BA 2Y0BG 3W9GA 4BSZB 2DWZA 1TR4A 2L6BA 4GMRA 4K5AB 4A63B 5ENTD 1AWCB 1MX2A 5AQBA 5CBOA 3D9HA 2QC9A 3ZKJA 3ZUVB 4BETA 4HRMB 4O1PA 4U8VD 2AJAA 1IHBA 3C5RA 1YMPA 2DVWA 3IXEA 5ENOD 4F6RD 3W9FA 1BD8A 3JXIA 3F6QA 4LNUD 2DZOA 3KEAA 4QFVA 1MJ0A 4DX2A 5AN8A 1YCSB 3DEOA 5AARA 3NBNB 2XENA 1G3NB 5KNGA 5EYLA 4G8LA 1OT8A 1D9SA 5BXOA 1MX4A 1UOHA 2F8XK 3TWQA 5AQAA 2ZGGA 4RLYA 4JB8P 1MYOA 1SW6A 1K1AA 3Q9NC 1N11A 1DC2A 4CZ2D 4OAUC 2ETAA 3UI2A 5FIOA 5CERB 3V2XA 4B93B 5KNHD 5JMND 4Z68A 5HKPA 4ATZD 4TUMA 3EU9A 4HBDA 4DX1A 3UXGA 1WG0A 2ETBA 5ENSD 1WDYA 4LG6A 5EILA 3ZU7B 1K1BA 3TWWA 5CECB 1AP7A 5ENRD 3TWXA 3AJIA 3AAAC 3EHQA 4F1PA 5EN5D 1IXVA 2ETCA 2QYJA 3B95A 3J5QB 3TWUA 3TWRA 4DX6D 5BXUA 1S70B 5KBAA 4HLLA 1N0RA 5JA4D 4UUCA 2XEEA 2NYJA
chains in the Genus database with same CATH superfamily
3JUIA 2ILRA 5A23A 3V79K 2I1KA 5ENQD 3KS2A 4GU5A 4ANXA 4V3IA 3KAEA 1QQEA 2H6FA 3PZDA 2BKGA 4BSXA 4LSZE 2JEKA 2V8SE 1E7VA 3Q7FA 2LSUA 1BI8B 3FUMA 1OCOE 3MV3B 4DUIA 4I2ZA 2L6JA 3CHMA 4I17A 1LD7A 4AY6A 5CRVA 1A5EA 2XPZA 4XI0A 3I5PA 3L54A 3EHRA 2XRYA 3MKQA 4YDWA 2QZAA 3T9KA 4N3AA 3IV0A 2YQ8A 2NC9A 3DSVA 3NAWA 2XGOA 3FY4A 5AENA 2IO2C 1UJKA 4RG9A 2P9IG 4DX2A 1KT0A 1YCSB 2H6IA 1E90A 3QKYA 3EDTB 2PM7A 4GYWA 2XPYA 1Y6IA 4DLOA 1TNUA 1E96B 2GRNB 3R7QA 3ASGA 3FUIA 4B93B 3KSQA 3S2AA 1H0AA 1PC2A 4MKTA 1INZA 1N9AA 2WXMA 4F7AA 3B95A 4JW1A 2L0TB 1ZB1A 3SHFA 2X3MA 3GZSA 5A6CA 4NIKA 4WNDA 3ML8A 4I1MA 3AU5A 2BEDA 3JXJA 4XZ4A 2PM6A 4ILHB 4E85A 2HYZA 1U3DA 2I6HA 5G04C 1O1TA 4N3CA 4JEHA 3DRAA 1EYHA 4O60A 2VTBA 3V30A 3Q78A 4I1AA 2FF4A 3DXKG 3UUXA 3MCXA 2R17C 3AS5A 3BEEA 4FC8A 3N71A 4ILIA 4IRUA 4BX8A 5BPPA 3SY2A 4XKCA 3UQ3A 1WM5A 5B1BE 5E75A 3Q7AA 3DSUA 3KEAA 2WXFA 1MJ0A 1H19A 2XPIA 1EF1C 2VJ8A 1OWLA 4CT4A 5AQAA 3FUHA 4RLYA 4A3TA 2IJGX 1SW6A 4XE0A 4OVUA 3ZW3A 5FTPA 4L1BA 4FA6A 2R5SA 4G24A 3LY9A 5JHBA 2ETBA 5EDSA 3RK6A 4G25A 4I9EA 1TNOA 3FP3A 3I4RB 2BTDA 3IBEA 4HLLA 3MEKA 4GZ6A 3S7FA 1DCEA 4I9CA 4OAVB 5AQ7A 3TWVA 3C98A 1SZ9A 3CK8A 4G26A 4FU3A 3UX4A 1VDYA 4XI9A 2ZGDA 1OCCE 3NF1A 2JABA 4DK5A 2FBNA 2XEHA 1IQUA 3QWPA 4PUCA 2R05A 4L2YA 1TN7A 4JA7A 4GTVA 3MKRA 4MS6A 4ANWA 4P29A 2J09A 3ASOE 5HQ8A 5JJ7A 1UN9A 4BFRA 4HOTA 5FJYA 3CGHA 5A7DB 3FDHA 5AN8A 3SBTB 1ZBPA 3EU5A 3D9JA 4ATGA 3E33A 2FULA 2UY1B 3Q9NC 4CZ2D 1NA3A 3C72A 5FIOA 4C0EA 2ONDA 4LERA 5ENSD 4NACA 1WDYA 4UWFA 3L22A 2L9BA 3EHQA 4L9PA 2HM8A 2IU1A 1N54A 4FHJA 3G2TA 1SZAA 2H6HA 4GYYA 3FTYA 3CVNA 5ENOD 3KEZA 3LJNA 1O5MA 3BG0B 4HI8A 2P2CP 3HXDA 1HF8A 3DWLG 3CKBA 1H2VC 4PS8A 4AY5A 4U07A 1EDUA 1MZCA 4L23A 1KZPA 3B7UX 2XS1A 4HI9A 3WG7E 4LCTA 4EZKA 5H7PA 1HS6A 3UKRG 3NOCD 3RSEG 4G1TA 4EQFA 3OTNA 1N0QA 3GZ1A 1JUQA 2GW1A 2IFUA 2KZTB 3UTMA 4DX5D 4I6GA 2WXJA 4HORA 3IEGA 2C2LA 1H2UA 3J5PA 3GZ2A 2VGEA 2WQ6A 2VYIA 3FU3A 5CMWA 4GTSA 3FU5A 2CHXA 2X6HA 3BUAA 5EIBE 5AYWD 1IYGA 1H6OA 3E37A 4ME2A 5EKQD 2Y69E 1TEZA 2EILE 4ABNA 3ONKA 2V5FA 1HZ4A 4JA9A 3NBNB 4WNFA 1H6KA 1OT8A 2EIME 3S7JA 5LOZA 1LTXA 2MOWA 2EIJE 4XKBA 1LD8A 3CK9A 2OEWA 3TG4A 5J90A 4RQIA 3SQVA 3B7TA 3Q47B 3FWVA 3PZ1A 2ETCA 3L6AA 2KCKA 3LY7A 3PVLA 2LNIA 4GCNA 1GW6A 3NOGD 3UKUG 3TWTA 2XHEA 3B7BA 3C3QA 2PL2A 3V2OA 5DIZA 3FTSA 5CHEE 2QYUA 4MLPA 2GRRB 1Z5SC 3E30A 1HFAA 2VGXA 3RU0A 2MRIA 4F53A 3T8MA 2WXRA 1QNFA 3SFYA 4HRNA 2C0MA 3CSFA 3QDNA 4PS3A 4GPKA 1Z6TA 1H6PA 3LJ3A 4M3OA 1D8EA 5ENPD 3PE3A 4U8YD 3QB2A 4U0UA 3U9WA 3CVXA 4N2SA 1KPSB 4GTMA 1BLXB 2FEZA 4FLHA 2GRQB 4EHMA 1TR4A 4LRZA 5D2MC 3PE4A 3E32A 4JHRA 4UWLA 4U8VD 1WAO1 2IY0C 4FJZA 3CK7A 2WVIA 1V55E 3JXIA 1FCHA 1UOHA 3FTXA 4XX5A 1FT1A 4YVQC 1DC2A 3UIPC 3JYSA 4HS2A 3ZRHA 5BW8C 3ZXPA 3EIQC 3CV0A 1PY1A 3LEWA 4JD2G 2WMOA 5EX3A 2MHKA 3FTWA 4EZLA 4GA2A 3ZN3A 3PREA 2XQ0A 2NYJA 4J8EA 2P9NG 4FHKA 4HOUA 3VLDA 2CG3A 4XIFA 3PH0C 3B7RL 2KCLA 3QAQA 1H2TC 3LYAA 3LS8A 5IY5E 2L0IA 4A3VA 2WXLA 3TAXA 4JXTA 1IKND 2VSOE 4YDYA 3HXBA 3UT8A 1X81A 3CVWA 3ASNE 3ULYA 2OCCE 2GRLA 5BNWA 1DCQA 2J07A 4QQIA 3U66A 4AM9A 3Q5MA 1BI7B 4O6FA 3FHEA 4J7WA 2B0OE 4O1OA 4DRXE 4N5CA 4LNGA 4U0SA 3NZUA 4JHJA 1KZOA 1D8DA 4L7TA 3R9MA 1OCZE 2QC9A 2DCPA 3TJPA 1YMPA 5KJLA 4GZ3A 4AVXA 1TN6A 3S7DA 3DEOA 4R7LA 2PZIA 2ZGGA 2Y4TA 4JVSA 1K1AA 2I9CA 4OAUC 3ESLA 1OWOA 2X6IA 4Y6CA 2CG2A 5CCLA 2LXMA 4UI9J 2XEVA 3HYMB 4I1OB 1QZ2A 3ZNGA 1YA0A 1E8ZA 3CHSA 4WAFA 3SGHA 4Q96A 4ACKA 4GTPA 1MX6A 2RFMA 3HIZA 4CGVA 5ITZF 5CCMA 3RAUA 3E4BA 2IO3C 5AJLA 3VTYA 2X6FA 5AIJA 2YNQA 3AG2E 1OWPA 5C2YA 4AXHA 4Q94A 5AQ9A 3Q4AB 2AXVA 2YHEA 2EIKE 4BEPA 4RSYA 4Y6WA 3PEVB 4NURA 1N94A 5C1DA 3HG0D 5M72A 4APOA 1EPUA 2WXKA 1AWCB 1MX2A 4AOFA 4WWOA 4HRMB 4EBAG 4MRUA 3ZFWA 2LUHA 1U3CA 2DVWA 1SA5A 3MGBA 3LPZA 5E76A 3Q75A 1P5QA 5D0OD 2P9UG 1JWFA 3MYVA 1D9SA 1HU3A 4UQXA 4JZYA 2HR2A 3OXGA 2AWIA 3UMVA 5LCWJ 5CERB 4FJYA 3V2XA 1TNZA 3FU0A 4PH4B 5EILA 3JCKC 1K1BA 5CECB 3UM0A 3I3NA 3R7RA 4WWPA 3G2UA 1N0RA 4U0ZA 1MHQA 2AW6A 2NXPA 1JCSA 1K8KG 3DSXA 5KJMA 5B3SE 4NQ0A 2WXHA 2UWJG 3RRUA 1BU9A 1S64A 2M63A 2DYRE 3HDXA 1UJJA 2Y1LE 3FU6A 1SVXA 4U95D 2GROB 3EJNA 2A5EA 4GMJA 4N5QA 4YDEA 5BV0A 5KWDA 3ZYMA 1N4SA 4K0RA 1HO8A 3SO8A 2DYSE 3GW4A 2UY1A 4G23A 3D9LA 3T8KA 1OXJA 3ZYLA 3OAWA 2OVBA 4JHKA 3C5RA 2Y4UA 3W9FA 3CVUA 2XCBA 4ANUA 1DNPA 3RIBA 2ZIRA 5KNGA 3EHNA 5BXOA 2P58C 2WXIA 1A17A 1OWMA 2ZU6B 3PZ4A 2DBAA 5T3RA 5KNHD 4BX9A 3DPDA 5B1AE 1XNFA 4GTRA 3WXXA 3QK0A 1FPPA 2KZTA 3AU4A 1IXVA 4GAAA 1FT2A 3CVPA 1S70B 5KBAA 4U63A 3APDA 5EX0A 5LP0A 3KSLA 3AG3E 5FQ8A 2WXPA 4KZCA 2KXPC 3ULQA 4GMLA 3TGOA 3D9KA 1TJCA 5KJKA 3MV2B 2J4BA 5CRUA 2E0IA 3CQCB 2XZTG 4ZFHA 1RZ4A 1UW4B 4UQYA 5CEDB 3EIJA 5CMYA 2XZDG 3U4TA 5BUZA 2H6GA 1TNYA 4E6HA 1K3ZD 3FTZA 3Q73A 2V5QC 3TL5A 1FVFA 2F8YA 4UQZA 4GA1A 2J8SD 2FO1E 3W9GA 3ZKJA 3D3MA 2I1JA 4F6RD 3QARA 3DBSA 3F6QA 4A1SA 4QFVA 1SQMA 3U64A 1TJFA 4BT9A 3ZGQA 4IULA 1KLXA 1N52A 1HXIA 3UXGA 3VTXA 2OVFA 1ELRA 3APFA 3ZU7B 2R03A 4HOQA 4FADA 3RKVA 2XEEA 4HRLA 4G8KA 2VSNA 3FUDA 5ARFA 4Q69A 2PNNA 5ENNA 2IONA 5G05J 5BV1A 4YNDA 3U3WA 4HNAD 5FWQA 3LKUA 4C9BB 2NSZA 2GGFA 4L2LA 1JCRA 4GPMA 3S7BA 2DZNA 2P9PG 3DSTA 1L5JA 4B8AA 3Q15A 3RJVA 3ZYQA 4URKA 1OCRE 3PZ2A 2WXQA 3AG4E 2GRMA 2BF0X 1HX8A 3ONLA 2DWZA 3L13A 4X8QA 2I2OA 2XGSA 2XCCA 4RVBA 4O1PA 3ABLE 3FUNA 1HE8A 3ASDA 4LEUA 4LUNU 1MX4A 5T8IA 4N2QA 4IN3B 3FH7A 3ZHEB 5T4YA 3FUKA 1N11A 4HVBA 3I4GA 3QC1A 5JJ6A 3URZA 4WWNA 3QOUA 4CDMA 4U8HA 3IKOB 1AP7A 1BPOA 4AP2A 2AXZA 4TRQA 3BQOA 3L08A 3P2BA 2P9KG 4GYOA 3J5QB 5BXUA 5JA4D 1RW2A 3G2SA 2OV8A 4OVVA 4IYPA 4DX7D 3DEPA 5ARGA 3CQGB 3B7SA 2J4DA 2R59A 2IOSA 1OWNA 4DI3A 3CR3A 4KYOB 4GB9A 5CBNA 5FZQA 4YVOA 2RFAA 3APCA 4AEZC 1YYHA 3NQPA 4CDNA 4EBAA 5DBKA 1SA4A 2AXUA 5FT9A 2HE0A 2KM4A 4CDRA 2WQ7A 4EECA 4I6EA 3Q9UC 1Y8MA 5J08A 1ELWA 3FTUA 4KMOA 4GCOA 2F37A 2MYOA 2WXOA 4YDOA 4CYMD 3PZ3A 4CRWA 1QBQA 5CBOA 1U2VG 2LSVA 2WPVA 4CGWA 1BD8A 3LVRE 3L17A 4MBGA 2QFCA 3HXFA 2X6JA 4RG6A 4JB8P 1DVPA 4UWHA 3VLFA 1IQRA 4Z68A 3HVEB 4NRHB 3EU9A 3FULA 4W9RA 1N4PA 3C3OA 3SZ7A 3TWXA 3AJIA 4F3VA 4U7EB 2B6CA 4UWKA 2QYJA 3ESKA 3QNKA 1NI1A 3CVYA 2FO7A 2DIWA 3TXNA 3GYZA 5D0QD 4BTAA 4A55A 3VLEA 1ZU2A 3C3RA 4PDXA 4DPRA 4I2WA 4BTBA 3ML9A 2EQXA 1TNBA 1TYQG 3ZXSA 3X2QE 2CHZA 2XGMA 1X5BA 1B89A 5G04J 3AG1E 3JQ1A 4ZHBA 3ASHA 4AV7A 4KVMA 3Q49B 1TN8A 3PNTB 3ULEG 1NL4A 2AVPA 4GA0A 2P9SG 5KCMA 4BWRA 2EINE 3R9AB 2CFUA 3ABKE 2KBXA 2PQNA 4BSZB 2L6BA 4AJWA 3ZIMA 1E8YA 4H7XA 4M7CA 4U04A 3FTVA 4J8DA 4WNGA 4TXRA 4H7YA 4TXPA 3MX3A 5JJTA 3IXEA 3SI5A 3P1UA 4HFGA 2IEJA 3D9MA 3EUVA 2DZOA 4OYSA 2KCVA 3TWQA 4G11A 1Q2ZA 3TG5A 3MKQB 3CIAA 3L82A 3QWVA 2ETAA 1Z3XA 5FQ7A 4D10C 5FQ4A 1Z3YA 3PRZA 3O4ZA 4B8CB 1O1SA 2RG8A 2XRZA 4LG6A 4HXIA 3BU8A 1HH8A 3T5VA 1O1RA 2R2LA 4UI9C 5AJDA 1FVHA 1N95A 2HO1A 3DXMG 3HXCA 4U96D 4CEMA 4HQDA 5D66A 4TUUA 2ZISA 1JPLA 3MA5A 3PEUB 3UPVA 3B13A 2IQCA 4N3BA 5KJNA 3CKCA 2GRPB 2ZXWE 3FUJA 5ANRA 1V54E 3RRNB 1HG2A 1LF8A 4EPZA 4EZJA 5JHAA 4LNBA 1E8XA 1QYMA 3SBSA 5ENTD 2IOLA 3ZUVB 2BUGA 3ZYKA 4DLQA 1PAQA 3E34A 2VTBB 3CHPA 1WY6A 2VSYA 3CEQA 4JC8A 3FEYA 5HI7A 2KATA 3RO3A 3AS4A 3UI2A 3LCAA 5LCWC 4ATZD 4TUMA 1S0PA 4HBDA 4I43A 5G55A 3SFXA 3JQ0A 3NB2A 3LY8A 4B94A 1W3BA 2LXLA 3NZSA 3ZVVA 4APFA 3TWUA 3BG1B 4DX6D 1KT1A 4UUCA 4DJAA 3CHOA 5HS0A 1OUVA 5HRYA 3L16A 3RO2A 1JWGA 4BY6A 3PS6A 3TXMA 1NFIE 3FEXA 3CLJA 4FP7A 4KXKB 3EHMA 5AAOA 2A5UA 3TWSA 2LO6A 2CFZA 2J08A 2R02A 2LAIA 5FINA 3UM3A 3G2VA 1IHGA 1UN8A 2V4LA 4K5BA 2Y3AA 4GMRA 4WNEA 2VSXE 5AQBA 3CHQA 3KD7A 4B89A 1IHBA 1NA0A 4GTQA 2JLBA 3UM1A 1E8WA 4CT0A 4XEIG 3MJWA 2F8XK 4I6JA 4KZ0A 1MYOA 3UINC 3CVLA 2F0YA 4B0ZA 4ANVA 5JMND 3CVQA 3FH5A 4DI4A 1N4QA 4KBQA 5ENRD 2LAHA 3AAAC 4F1PA 4J0UA 3PUJA 2P9LG 5FZRA 4JL0A 2QY7A 4UI9K 3HRAA 4HB5A 3SF4A 4JPSA 1E7UA 3FH8A 4J6IA 3DPYA 3SFZA 2IF4A 5G2NA 3ISMC 2YHCA 3D9IA 4G2VA 4BERA 3V31A 1MQSA 5EYPF 4C48B 3LVQE 4J8FA 1OY3D 5CEAA 1N4RA 3ZHEA 3UIOC 4AIFA 2BKKB 3FUEA 4TV3A 3CSTA 3AS8A 4K5AB 3PDNA 3D9HA 2E2EA 2C0LA 3SD5A 3OXLA 4LNUD 5LFAA 2KC7A 5AARA 1G3NB 4FLBA 3D9OA 4G8LA 3O48A 3OXFA 3CVVA 4J8SA 3FFLA 4PS7A 3DSSA 2RKKA 3PNLB 3PUKA 3HXEA 3L9TA 1JCQA 4C0MA 3G2WA 5HKPA 4DX1A 3LXUX 4GZCA 3CHRA 2FI7A 3TWRA 1S63A 4GZ5A 2WXNA 2RD0A 4BT8A 2V0PA 2YINA 4BESA 4WUYA 2V4HC 3JUEA 4N39A 4KT6B 2X6KA 3MZLB 5FQ6A 1XGWA 2PQRA 4F1SA 4HLEA 5G05C 3IHVA 3LDZA 2J49A 2XS8A 3ZEFA 3ZPJA 4J8YA 2X38A 2WMNA 4FULA 4JEUA 3ASFA 2WM9A 3QJZA 4K5CA 4ILGA 3D9NA 3ABME 2CHWA 3ENEA 5EIDA 2WQHA 4KVOA 3UT4A 3T5XA 3HVEA 2Y0BG 2VQ2A 2VGXB 4A63B 2WXGA 5BT1A 4GTTA 4BETA 3IHYA 1UG3A 3K9IA 2AJAA 5ANLA 2WB2A 4ACLA 4UWGA 3RRMB 2OEVA 2XENA 3Q79A 4GTOA 5EYLA 4HOSA 3UM2A 2VGYA 3D9PA 1NZNA 4TXQA 3SNXA 1ELKA 4GZDA 1WG0A 2A4ZA 3FUFA 3TWWA 5FZSA 2J9QA 4CCAA 1HG5A 5EN5D 3DSWA 4K03A 1NP7A 3UT7A 5LX8A 2OOEA 3HHMA 3QWWA 4A1GA 2Q7FA
chains in the Genus database with same CATH topology
3LJNA 3NOGD 3ZNGA 4BESA 4HRLA 4G8KA 4HI8A 3TWTA 4DX7D 5HS0A 3V79K 2P2CP 3DEPA 3B7BA 2V4HC 3JUEA 4NIKA 5ENQD 4U96D 3HRAA 2KXPC 4HB5A 4HQDA 5D66A 3V2OA 3JXJA 2PNNA 5HRYA 1BU9A 5CBNA 4OAVB 2RFAA 4HI9A 1MX6A 2RFMA 5AQ7A 2BKGA 2XZTG 4LSZE 2Y1LE 1NFIE 5ITZF 4HNAD 4ZFHA 1SVXA 1YYHA 3NOCD 4U95D 3TWVA 2FO1E 5AAOA 5CEDB 1IKND 4YDYA 1N0QA 4ZHBA 3TWSA 4J8YA 3UTMA 4DX5D 2HE0A 4HRNA 4GPMA 4BERA 1BI8B 2XZDG 5EYPF 3V31A 2A5EA 2ZGDA 4C48B 4N5QA 2JABA 4O60A 3V30A 4DUIA 2DZNA 1DCQA 3J5PA 5AQ9A 2XEHA 1OY3D 4QQIA 2VGEA 5KWDA 1A5EA 3Q9UC 5ENPD 1K3ZD 5CEAA 4U8YD 1BI7B 5FINA 4BEPA 2V5QC 3EHRA 2B0OE 4J7WA 4K5CA 4O1OA 4YDWA 3SO8A 3T9KA 4DRXE 2F8YA 2F37A 3HG0D 2MYOA 5EIBE 1BLXB 5EIDA 3T8KA 2BKKB 4CYMD 2J8SD 2KBXA 1QYMA 4K5BA 2Y0BG 3W9GA 4BSZB 2DWZA 1TR4A 2L6BA 4GMRA 4K5AB 4A63B 5ENTD 1AWCB 1MX2A 5AQBA 5CBOA 3D9HA 2QC9A 3ZKJA 3ZUVB 4BETA 4HRMB 4O1PA 4U8VD 2AJAA 1IHBA 3C5RA 1YMPA 2DVWA 3IXEA 5ENOD 4F6RD 3W9FA 1BD8A 3JXIA 3F6QA 4LNUD 2DZOA 3KEAA 4QFVA 1MJ0A 4DX2A 5AN8A 1YCSB 3DEOA 5AARA 3NBNB 2XENA 1G3NB 5KNGA 5EYLA 4G8LA 1OT8A 1D9SA 5BXOA 1MX4A 1UOHA 2F8XK 3TWQA 5AQAA 2ZGGA 4RLYA 4JB8P 1MYOA 1SW6A 1K1AA 3Q9NC 1N11A 1DC2A 4CZ2D 4OAUC 2ETAA 3UI2A 5FIOA 5CERB 3V2XA 4B93B 5KNHD 5JMND 4Z68A 5HKPA 4ATZD 4TUMA 3EU9A 4HBDA 4DX1A 3UXGA 1WG0A 2ETBA 5ENSD 1WDYA 4LG6A 5EILA 3ZU7B 1K1BA 3TWWA 5CECB 1AP7A 5ENRD 3TWXA 3AJIA 3AAAC 3EHQA 4F1PA 5EN5D 1IXVA 2ETCA 2QYJA 3B95A 3J5QB 3TWUA 3TWRA 4DX6D 5BXUA 1S70B 5KBAA 4HLLA 1N0RA 5JA4D 4UUCA 2XEEA 2NYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJN A;  3NOG D;  3ZNG A;  4BES A;  4HRL A;  4G8K A;  4HI8 A;  3TWT A;  4DX7 D;  5HS0 A;  3V79 K;  2P2C P;  3DEP A;  3B7B A;  2V4H C;  3JUE A;  4NIK A;  5ENQ D;  4U96 D;  3HRA A;  2KXP C;  4HB5 A;  4HQD A;  5D66 A;  3V2O A;  3JXJ A;  2PNN A;  5HRY A;  1BU9 A;  5CBN A;  4OAV B;  2RFA A;  4HI9 A;  1MX6 A;  2RFM A;  5AQ7 A;  2BKG A;  2XZT G;  4LSZ E;  2Y1L E;  1NFI E;  5ITZ F;  4HNA D;  4ZFH A;  1SVX A;  1YYH A;  3NOC D;  4U95 D;  3TWV A;  2FO1 E;  5AAO A;  5CED B;  1IKN D;  4YDY A;  1N0Q A;  4ZHB A;  3TWS A;  4J8Y A;  3UTM A;  4DX5 D;  2HE0 A;  4HRN A;  4GPM A;  4BER A;  1BI8 B;  2XZD G;  5EYP F;  3V31 A;  2A5E A;  2ZGD A;  4C48 B;  4N5Q A;  2JAB A;  4O60 A;  3V30 A;  4DUI A;  2DZN A;  1DCQ A;  3J5P A;  5AQ9 A;  2XEH A;  1OY3 D;  4QQI A;  2VGE A;  5KWD A;  1A5E A;  3Q9U C;  5ENP D;  1K3Z D;  5CEA A;  4U8Y D;  1BI7 B;  5FIN A;  4BEP A;  2V5Q C;  3EHR A;  2B0O E;  4J7W A;  4K5C A;  4O1O A;  4YDW A;  3SO8 A;  3T9K A;  4DRX E;  2F8Y A;  2F37 A;  3HG0 D;  2MYO A;  5EIB E;  1BLX B;  5EID A;  3T8K A;  2BKK B;  4CYM D;  2J8S D;  2KBX A;  1QYM A;  4K5B A;  2Y0B G;  3W9G A;  4BSZ B;  2DWZ A;  1TR4 A;  2L6B A;  4GMR A;  4K5A B;  4A63 B;  5ENT D;  1AWC B;  1MX2 A;  5AQB A;  5CBO A;  3D9H A;  2QC9 A;  3ZKJ A;  3ZUV B;  4BET A;  4HRM B;  4O1P A;  4U8V D;  2AJA A;  1IHB A;  3C5R A;  1YMP A;  2DVW A;  3IXE A;  5ENO D;  4F6R D;  3W9F A;  1BD8 A;  3JXI A;  3F6Q A;  4LNU D;  2DZO A;  3KEA A;  4QFV A;  1MJ0 A;  4DX2 A;  5AN8 A;  1YCS B;  3DEO A;  5AAR A;  3NBN B;  2XEN A;  1G3N B;  5KNG A;  5EYL A;  4G8L A;  1OT8 A;  1D9S A;  5BXO A;  1MX4 A;  1UOH A;  2F8X K;  3TWQ A;  5AQA A;  2ZGG A;  4RLY A;  4JB8 P;  1MYO A;  1SW6 A;  1K1A A;  3Q9N C;  1N11 A;  1DC2 A;  4CZ2 D;  4OAU C;  2ETA A;  3UI2 A;  5FIO A;  5CER B;  3V2X A;  4B93 B;  5KNH D;  5JMN D;  4Z68 A;  5HKP A;  4ATZ D;  4TUM A;  3EU9 A;  4HBD A;  4DX1 A;  3UXG A;  1WG0 A;  2ETB A;  5ENS D;  1WDY A;  4LG6 A;  5EIL A;  3ZU7 B;  1K1B A;  3TWW A;  5CEC B;  1AP7 A;  5ENR D;  3TWX A;  3AJI A;  3AAA C;  3EHQ A;  4F1P A;  5EN5 D;  1IXV A;  2ETC A;  2QYJ A;  3B95 A;  3J5Q B;  3TWU A;  3TWR A;  4DX6 D;  5BXU A;  1S70 B;  5KBA A;  4HLL A;  1N0R A;  5JA4 D;  4UUC A;  2XEE A;  2NYJ A; 
#chains in the Genus database with same CATH topology
 3JUI A;  2ILR A;  5A23 A;  3V79 K;  2I1K A;  5ENQ D;  3KS2 A;  4GU5 A;  4ANX A;  4V3I A;  3KAE A;  1QQE A;  2H6F A;  3PZD A;  2BKG A;  4BSX A;  4LSZ E;  2JEK A;  2V8S E;  1E7V A;  3Q7F A;  2LSU A;  1BI8 B;  3FUM A;  1OCO E;  3MV3 B;  4DUI A;  4I2Z A;  2L6J A;  3CHM A;  4I17 A;  1LD7 A;  4AY6 A;  5CRV A;  1A5E A;  2XPZ A;  4XI0 A;  3I5P A;  3L54 A;  3EHR A;  2XRY A;  3MKQ A;  4YDW A;  2QZA A;  3T9K A;  4N3A A;  3IV0 A;  2YQ8 A;  2NC9 A;  3DSV A;  3NAW A;  2XGO A;  3FY4 A;  5AEN A;  2IO2 C;  1UJK A;  4RG9 A;  2P9I G;  4DX2 A;  1KT0 A;  1YCS B;  2H6I A;  1E90 A;  3QKY A;  3EDT B;  2PM7 A;  4GYW A;  2XPY A;  1Y6I A;  4DLO A;  1TNU A;  1E96 B;  2GRN B;  3R7Q A;  3ASG A;  3FUI A;  4B93 B;  3KSQ A;  3S2A A;  1H0A A;  1PC2 A;  4MKT A;  1INZ A;  1N9A A;  2WXM A;  4F7A A;  3B95 A;  4JW1 A;  2L0T B;  1ZB1 A;  3SHF A;  2X3M A;  3GZS A;  5A6C A;  4NIK A;  4WND A;  3ML8 A;  4I1M A;  3AU5 A;  2BED A;  3JXJ A;  4XZ4 A;  2PM6 A;  4ILH B;  4E85 A;  2HYZ A;  1U3D A;  2I6H A;  5G04 C;  1O1T A;  4N3C A;  4JEH A;  3DRA A;  1EYH A;  4O60 A;  2VTB A;  3V30 A;  3Q78 A;  4I1A A;  2FF4 A;  3DXK G;  3UUX A;  3MCX A;  2R17 C;  3AS5 A;  3BEE A;  4FC8 A;  3N71 A;  4ILI A;  4IRU A;  4BX8 A;  5BPP A;  3SY2 A;  4XKC A;  3UQ3 A;  1WM5 A;  5B1B E;  5E75 A;  3Q7A A;  3DSU A;  3KEA A;  2WXF A;  1MJ0 A;  1H19 A;  2XPI A;  1EF1 C;  2VJ8 A;  1OWL A;  4CT4 A;  5AQA A;  3FUH A;  4RLY A;  4A3T A;  2IJG X;  1SW6 A;  4XE0 A;  4OVU A;  3ZW3 A;  5FTP A;  4L1B A;  4FA6 A;  2R5S A;  4G24 A;  3LY9 A;  5JHB A;  2ETB A;  5EDS A;  3RK6 A;  4G25 A;  4I9E A;  1TNO A;  3FP3 A;  3I4R B;  2BTD A;  3IBE A;  4HLL A;  3MEK A;  4GZ6 A;  3S7F A;  1DCE A;  4I9C A;  4OAV B;  5AQ7 A;  3TWV A;  3C98 A;  1SZ9 A;  3CK8 A;  4G26 A;  4FU3 A;  3UX4 A;  1VDY A;  4XI9 A;  2ZGD A;  1OCC E;  3NF1 A;  2JAB A;  4DK5 A;  2FBN A;  2XEH A;  1IQU A;  3QWP A;  4PUC A;  2R05 A;  4L2Y A;  1TN7 A;  4JA7 A;  4GTV A;  3MKR A;  4MS6 A;  4ANW A;  4P29 A;  2J09 A;  3ASO E;  5HQ8 A;  5JJ7 A;  1UN9 A;  4BFR A;  4HOT A;  5FJY A;  3CGH A;  5A7D B;  3FDH A;  5AN8 A;  3SBT B;  1ZBP A;  3EU5 A;  3D9J A;  4ATG A;  3E33 A;  2FUL A;  2UY1 B;  3Q9N C;  4CZ2 D;  1NA3 A;  3C72 A;  5FIO A;  4C0E A;  2OND A;  4LER A;  5ENS D;  4NAC A;  1WDY A;  4UWF A;  3L22 A;  2L9B A;  3EHQ A;  4L9P A;  2HM8 A;  2IU1 A;  1N54 A;  4FHJ A;  3G2T A;  1SZA A;  2H6H A;  4GYY A;  3FTY A;  3CVN A;  5ENO D;  3KEZ A;  3LJN A;  1O5M A;  3BG0 B;  4HI8 A;  2P2C P;  3HXD A;  1HF8 A;  3DWL G;  3CKB A;  1H2V C;  4PS8 A;  4AY5 A;  4U07 A;  1EDU A;  1MZC A;  4L23 A;  1KZP A;  3B7U X;  2XS1 A;  4HI9 A;  3WG7 E;  4LCT A;  4EZK A;  5H7P A;  1HS6 A;  3UKR G;  3NOC D;  3RSE G;  4G1T A;  4EQF A;  3OTN A;  1N0Q A;  3GZ1 A;  1JUQ A;  2GW1 A;  2IFU A;  2KZT B;  3UTM A;  4DX5 D;  4I6G A;  2WXJ A;  4HOR A;  3IEG A;  2C2L A;  1H2U A;  3J5P A;  3GZ2 A;  2VGE A;  2WQ6 A;  2VYI A;  3FU3 A;  5CMW A;  4GTS A;  3FU5 A;  2CHX A;  2X6H A;  3BUA A;  5EIB E;  5AYW D;  1IYG A;  1H6O A;  3E37 A;  4ME2 A;  5EKQ D;  2Y69 E;  1TEZ A;  2EIL E;  4ABN A;  3ONK A;  2V5F A;  1HZ4 A;  4JA9 A;  3NBN B;  4WNF A;  1H6K A;  1OT8 A;  2EIM E;  3S7J A;  5LOZ A;  1LTX A;  2MOW A;  2EIJ E;  4XKB A;  1LD8 A;  3CK9 A;  2OEW A;  3TG4 A;  5J90 A;  4RQI A;  3SQV A;  3B7T A;  3Q47 B;  3FWV A;  3PZ1 A;  2ETC A;  3L6A A;  2KCK A;  3LY7 A;  3PVL A;  2LNI A;  4GCN A;  1GW6 A;  3NOG D;  3UKU G;  3TWT A;  2XHE A;  3B7B A;  3C3Q A;  2PL2 A;  3V2O A;  5DIZ A;  3FTS A;  5CHE E;  2QYU A;  4MLP A;  2GRR B;  1Z5S C;  3E30 A;  1HFA A;  2VGX A;  3RU0 A;  2MRI A;  4F53 A;  3T8M A;  2WXR A;  1QNF A;  3SFY A;  4HRN A;  2C0M A;  3CSF A;  3QDN A;  4PS3 A;  4GPK A;  1Z6T A;  1H6P A;  3LJ3 A;  4M3O A;  1D8E A;  5ENP D;  3PE3 A;  4U8Y D;  3QB2 A;  4U0U A;  3U9W A;  3CVX A;  4N2S A;  1KPS B;  4GTM A;  1BLX B;  2FEZ A;  4FLH A;  2GRQ B;  4EHM A;  1TR4 A;  4LRZ A;  5D2M C;  3PE4 A;  3E32 A;  4JHR A;  4UWL A;  4U8V D;  1WAO 1;  2IY0 C;  4FJZ A;  3CK7 A;  2WVI A;  1V55 E;  3JXI A;  1FCH A;  1UOH A;  3FTX A;  4XX5 A;  1FT1 A;  4YVQ C;  1DC2 A;  3UIP C;  3JYS A;  4HS2 A;  3ZRH A;  5BW8 C;  3ZXP A;  3EIQ C;  3CV0 A;  1PY1 A;  3LEW A;  4JD2 G;  2WMO A;  5EX3 A;  2MHK A;  3FTW A;  4EZL A;  4GA2 A;  3ZN3 A;  3PRE A;  2XQ0 A;  2NYJ A;  4J8E A;  2P9N G;  4FHK A;  4HOU A;  3VLD A;  2CG3 A;  4XIF A;  3PH0 C;  3B7R L;  2KCL A;  3QAQ A;  1H2T C;  3LYA A;  3LS8 A;  5IY5 E;  2L0I A;  4A3V A;  2WXL A;  3TAX A;  4JXT A;  1IKN D;  2VSO E;  4YDY A;  3HXB A;  3UT8 A;  1X81 A;  3CVW A;  3ASN E;  3ULY A;  2OCC E;  2GRL A;  5BNW A;  1DCQ A;  2J07 A;  4QQI A;  3U66 A;  4AM9 A;  3Q5M A;  1BI7 B;  4O6F A;  3FHE A;  4J7W A;  2B0O E;  4O1O A;  4DRX E;  4N5C A;  4LNG A;  4U0S A;  3NZU A;  4JHJ A;  1KZO A;  1D8D A;  4L7T A;  3R9M A;  1OCZ E;  2QC9 A;  2DCP A;  3TJP A;  1YMP A;  5KJL A;  4GZ3 A;  4AVX A;  1TN6 A;  3S7D A;  3DEO A;  4R7L A;  2PZI A;  2ZGG A;  2Y4T A;  4JVS A;  1K1A A;  2I9C A;  4OAU C;  3ESL A;  1OWO A;  2X6I A;  4Y6C A;  2CG2 A;  5CCL A;  2LXM A;  4UI9 J;  2XEV A;  3HYM B;  4I1O B;  1QZ2 A;  3ZNG A;  1YA0 A;  1E8Z A;  3CHS A;  4WAF A;  3SGH A;  4Q96 A;  4ACK A;  4GTP A;  1MX6 A;  2RFM A;  3HIZ A;  4CGV A;  5ITZ F;  5CCM A;  3RAU A;  3E4B A;  2IO3 C;  5AJL A;  3VTY A;  2X6F A;  5AIJ A;  2YNQ A;  3AG2 E;  1OWP A;  5C2Y A;  4AXH A;  4Q94 A;  5AQ9 A;  3Q4A B;  2AXV A;  2YHE A;  2EIK E;  4BEP A;  4RSY A;  4Y6W A;  3PEV B;  4NUR A;  1N94 A;  5C1D A;  3HG0 D;  5M72 A;  4APO A;  1EPU A;  2WXK A;  1AWC B;  1MX2 A;  4AOF A;  4WWO A;  4HRM B;  4EBA G;  4MRU A;  3ZFW A;  2LUH A;  1U3C A;  2DVW A;  1SA5 A;  3MGB A;  3LPZ A;  5E76 A;  3Q75 A;  1P5Q A;  5D0O D;  2P9U G;  1JWF A;  3MYV A;  1D9S A;  1HU3 A;  4UQX A;  4JZY A;  2HR2 A;  3OXG A;  2AWI A;  3UMV A;  5LCW J;  5CER B;  4FJY A;  3V2X A;  1TNZ A;  3FU0 A;  4PH4 B;  5EIL A;  3JCK C;  1K1B A;  5CEC B;  3UM0 A;  3I3N A;  3R7R A;  4WWP A;  3G2U A;  1N0R A;  4U0Z A;  1MHQ A;  2AW6 A;  2NXP A;  1JCS A;  1K8K G;  3DSX A;  5KJM A;  5B3S E;  4NQ0 A;  2WXH A;  2UWJ G;  3RRU A;  1BU9 A;  1S64 A;  2M63 A;  2DYR E;  3HDX A;  1UJJ A;  2Y1L E;  3FU6 A;  1SVX A;  4U95 D;  2GRO B;  3EJN A;  2A5E A;  4GMJ A;  4N5Q A;  4YDE A;  5BV0 A;  5KWD A;  3ZYM A;  1N4S A;  4K0R A;  1HO8 A;  3SO8 A;  2DYS E;  3GW4 A;  2UY1 A;  4G23 A;  3D9L A;  3T8K A;  1OXJ A;  3ZYL A;  3OAW A;  2OVB A;  4JHK A;  3C5R A;  2Y4U A;  3W9F A;  3CVU A;  2XCB A;  4ANU A;  1DNP A;  3RIB A;  2ZIR A;  5KNG A;  3EHN A;  5BXO A;  2P58 C;  2WXI A;  1A17 A;  1OWM A;  2ZU6 B;  3PZ4 A;  2DBA A;  5T3R A;  5KNH D;  4BX9 A;  3DPD A;  5B1A E;  1XNF A;  4GTR A;  3WXX A;  3QK0 A;  1FPP A;  2KZT A;  3AU4 A;  1IXV A;  4GAA A;  1FT2 A;  3CVP A;  1S70 B;  5KBA A;  4U63 A;  3APD A;  5EX0 A;  5LP0 A;  3KSL A;  3AG3 E;  5FQ8 A;  2WXP A;  4KZC A;  2KXP C;  3ULQ A;  4GML A;  3TGO A;  3D9K A;  1TJC A;  5KJK A;  3MV2 B;  2J4B A;  5CRU A;  2E0I A;  3CQC B;  2XZT G;  4ZFH A;  1RZ4 A;  1UW4 B;  4UQY A;  5CED B;  3EIJ A;  5CMY A;  2XZD G;  3U4T A;  5BUZ A;  2H6G A;  1TNY A;  4E6H A;  1K3Z D;  3FTZ A;  3Q73 A;  2V5Q C;  3TL5 A;  1FVF A;  2F8Y A;  4UQZ A;  4GA1 A;  2J8S D;  2FO1 E;  3W9G A;  3ZKJ A;  3D3M A;  2I1J A;  4F6R D;  3QAR A;  3DBS A;  3F6Q A;  4A1S A;  4QFV A;  1SQM A;  3U64 A;  1TJF A;  4BT9 A;  3ZGQ A;  4IUL A;  1KLX A;  1N52 A;  1HXI A;  3UXG A;  3VTX A;  2OVF A;  1ELR A;  3APF A;  3ZU7 B;  2R03 A;  4HOQ A;  4FAD A;  3RKV A;  2XEE A;  4HRL A;  4G8K A;  2VSN A;  3FUD A;  5ARF A;  4Q69 A;  2PNN A;  5ENN A;  2ION A;  5G05 J;  5BV1 A;  4YND A;  3U3W A;  4HNA D;  5FWQ A;  3LKU A;  4C9B B;  2NSZ A;  2GGF A;  4L2L A;  1JCR A;  4GPM A;  3S7B A;  2DZN A;  2P9P G;  3DST A;  1L5J A;  4B8A A;  3Q15 A;  3RJV A;  3ZYQ A;  4URK A;  1OCR E;  3PZ2 A;  2WXQ A;  3AG4 E;  2GRM A;  2BF0 X;  1HX8 A;  3ONL A;  2DWZ A;  3L13 A;  4X8Q A;  2I2O A;  2XGS A;  2XCC A;  4RVB A;  4O1P A;  3ABL E;  3FUN A;  1HE8 A;  3ASD A;  4LEU A;  4LUN U;  1MX4 A;  5T8I A;  4N2Q A;  4IN3 B;  3FH7 A;  3ZHE B;  5T4Y A;  3FUK A;  1N11 A;  4HVB A;  3I4G A;  3QC1 A;  5JJ6 A;  3URZ A;  4WWN A;  3QOU A;  4CDM A;  4U8H A;  3IKO B;  1AP7 A;  1BPO A;  4AP2 A;  2AXZ A;  4TRQ A;  3BQO A;  3L08 A;  3P2B A;  2P9K G;  4GYO A;  3J5Q B;  5BXU A;  5JA4 D;  1RW2 A;  3G2S A;  2OV8 A;  4OVV A;  4IYP A;  4DX7 D;  3DEP A;  5ARG A;  3CQG B;  3B7S A;  2J4D A;  2R59 A;  2IOS A;  1OWN A;  4DI3 A;  3CR3 A;  4KYO B;  4GB9 A;  5CBN A;  5FZQ A;  4YVO A;  2RFA A;  3APC A;  4AEZ C;  1YYH A;  3NQP A;  4CDN A;  4EBA A;  5DBK A;  1SA4 A;  2AXU A;  5FT9 A;  2HE0 A;  2KM4 A;  4CDR A;  2WQ7 A;  4EEC A;  4I6E A;  3Q9U C;  1Y8M A;  5J08 A;  1ELW A;  3FTU A;  4KMO A;  4GCO A;  2F37 A;  2MYO A;  2WXO A;  4YDO A;  4CYM D;  3PZ3 A;  4CRW A;  1QBQ A;  5CBO A;  1U2V G;  2LSV A;  2WPV A;  4CGW A;  1BD8 A;  3LVR E;  3L17 A;  4MBG A;  2QFC A;  3HXF A;  2X6J A;  4RG6 A;  4JB8 P;  1DVP A;  4UWH A;  3VLF A;  1IQR A;  4Z68 A;  3HVE B;  4NRH B;  3EU9 A;  3FUL A;  4W9R A;  1N4P A;  3C3O A;  3SZ7 A;  3TWX A;  3AJI A;  4F3V A;  4U7E B;  2B6C A;  4UWK A;  2QYJ A;  3ESK A;  3QNK A;  1NI1 A;  3CVY A;  2FO7 A;  2DIW A;  3TXN A;  3GYZ A;  5D0Q D;  4BTA A;  4A55 A;  3VLE A;  1ZU2 A;  3C3R A;  4PDX A;  4DPR A;  4I2W A;  4BTB A;  3ML9 A;  2EQX A;  1TNB A;  1TYQ G;  3ZXS A;  3X2Q E;  2CHZ A;  2XGM A;  1X5B A;  1B89 A;  5G04 J;  3AG1 E;  3JQ1 A;  4ZHB A;  3ASH A;  4AV7 A;  4KVM A;  3Q49 B;  1TN8 A;  3PNT B;  3ULE G;  1NL4 A;  2AVP A;  4GA0 A;  2P9S G;  5KCM A;  4BWR A;  2EIN E;  3R9A B;  2CFU A;  3ABK E;  2KBX A;  2PQN A;  4BSZ B;  2L6B A;  4AJW A;  3ZIM A;  1E8Y A;  4H7X A;  4M7C A;  4U04 A;  3FTV A;  4J8D A;  4WNG A;  4TXR A;  4H7Y A;  4TXP A;  3MX3 A;  5JJT A;  3IXE A;  3SI5 A;  3P1U A;  4HFG A;  2IEJ A;  3D9M A;  3EUV A;  2DZO A;  4OYS A;  2KCV A;  3TWQ A;  4G11 A;  1Q2Z A;  3TG5 A;  3MKQ B;  3CIA A;  3L82 A;  3QWV A;  2ETA A;  1Z3X A;  5FQ7 A;  4D10 C;  5FQ4 A;  1Z3Y A;  3PRZ A;  3O4Z A;  4B8C B;  1O1S A;  2RG8 A;  2XRZ A;  4LG6 A;  4HXI A;  3BU8 A;  1HH8 A;  3T5V A;  1O1R A;  2R2L A;  4UI9 C;  5AJD A;  1FVH A;  1N95 A;  2HO1 A;  3DXM G;  3HXC A;  4U96 D;  4CEM A;  4HQD A;  5D66 A;  4TUU A;  2ZIS A;  1JPL A;  3MA5 A;  3PEU B;  3UPV A;  3B13 A;  2IQC A;  4N3B A;  5KJN A;  3CKC A;  2GRP B;  2ZXW E;  3FUJ A;  5ANR A;  1V54 E;  3RRN B;  1HG2 A;  1LF8 A;  4EPZ A;  4EZJ A;  5JHA A;  4LNB A;  1E8X A;  1QYM A;  3SBS A;  5ENT D;  2IOL A;  3ZUV B;  2BUG A;  3ZYK A;  4DLQ A;  1PAQ A;  3E34 A;  2VTB B;  3CHP A;  1WY6 A;  2VSY A;  3CEQ A;  4JC8 A;  3FEY A;  5HI7 A;  2KAT A;  3RO3 A;  3AS4 A;  3UI2 A;  3LCA A;  5LCW C;  4ATZ D;  4TUM A;  1S0P A;  4HBD A;  4I43 A;  5G55 A;  3SFX A;  3JQ0 A;  3NB2 A;  3LY8 A;  4B94 A;  1W3B A;  2LXL A;  3NZS A;  3ZVV A;  4APF A;  3TWU A;  3BG1 B;  4DX6 D;  1KT1 A;  4UUC A;  4DJA A;  3CHO A;  5HS0 A;  1OUV A;  5HRY A;  3L16 A;  3RO2 A;  1JWG A;  4BY6 A;  3PS6 A;  3TXM A;  1NFI E;  3FEX A;  3CLJ A;  4FP7 A;  4KXK B;  3EHM A;  5AAO A;  2A5U A;  3TWS A;  2LO6 A;  2CFZ A;  2J08 A;  2R02 A;  2LAI A;  5FIN A;  3UM3 A;  3G2V A;  1IHG A;  1UN8 A;  2V4L A;  4K5B A;  2Y3A A;  4GMR A;  4WNE A;  2VSX E;  5AQB A;  3CHQ A;  3KD7 A;  4B89 A;  1IHB A;  1NA0 A;  4GTQ A;  2JLB A;  3UM1 A;  1E8W A;  4CT0 A;  4XEI G;  3MJW A;  2F8X K;  4I6J A;  4KZ0 A;  1MYO A;  3UIN C;  3CVL A;  2F0Y A;  4B0Z A;  4ANV A;  5JMN D;  3CVQ A;  3FH5 A;  4DI4 A;  1N4Q A;  4KBQ A;  5ENR D;  2LAH A;  3AAA C;  4F1P A;  4J0U A;  3PUJ A;  2P9L G;  5FZR A;  4JL0 A;  2QY7 A;  4UI9 K;  3HRA A;  4HB5 A;  3SF4 A;  4JPS A;  1E7U A;  3FH8 A;  4J6I A;  3DPY A;  3SFZ A;  2IF4 A;  5G2N A;  3ISM C;  2YHC A;  3D9I A;  4G2V A;  4BER A;  3V31 A;  1MQS A;  5EYP F;  4C48 B;  3LVQ E;  4J8F A;  1OY3 D;  5CEA A;  1N4R A;  3ZHE A;  3UIO C;  4AIF A;  2BKK B;  3FUE A;  4TV3 A;  3CST A;  3AS8 A;  4K5A B;  3PDN A;  3D9H A;  2E2E A;  2C0L A;  3SD5 A;  3OXL A;  4LNU D;  5LFA A;  2KC7 A;  5AAR A;  1G3N B;  4FLB A;  3D9O A;  4G8L A;  3O48 A;  3OXF A;  3CVV A;  4J8S A;  3FFL A;  4PS7 A;  3DSS A;  2RKK A;  3PNL B;  3PUK A;  3HXE A;  3L9T A;  1JCQ A;  4C0M A;  3G2W A;  5HKP A;  4DX1 A;  3LXU X;  4GZC A;  3CHR A;  2FI7 A;  3TWR A;  1S63 A;  4GZ5 A;  2WXN A;  2RD0 A;  4BT8 A;  2V0P A;  2YIN A;  4BES A;  4WUY A;  2V4H C;  3JUE A;  4N39 A;  4KT6 B;  2X6K A;  3MZL B;  5FQ6 A;  1XGW A;  2PQR A;  4F1S A;  4HLE A;  5G05 C;  3IHV A;  3LDZ A;  2J49 A;  2XS8 A;  3ZEF A;  3ZPJ A;  4J8Y A;  2X38 A;  2WMN A;  4FUL A;  4JEU A;  3ASF A;  2WM9 A;  3QJZ A;  4K5C A;  4ILG A;  3D9N A;  3ABM E;  2CHW A;  3ENE A;  5EID A;  2WQH A;  4KVO A;  3UT4 A;  3T5X A;  3HVE A;  2Y0B G;  2VQ2 A;  2VGX B;  4A63 B;  2WXG A;  5BT1 A;  4GTT A;  4BET A;  3IHY A;  1UG3 A;  3K9I A;  2AJA A;  5ANL A;  2WB2 A;  4ACL A;  4UWG A;  3RRM B;  2OEV A;  2XEN A;  3Q79 A;  4GTO A;  5EYL A;  4HOS A;  3UM2 A;  2VGY A;  3D9P A;  1NZN A;  4TXQ A;  3SNX A;  1ELK A;  4GZD A;  1WG0 A;  2A4Z A;  3FUF A;  3TWW A;  5FZS A;  2J9Q A;  4CCA A;  1HG5 A;  5EN5 D;  3DSW A;  4K03 A;  1NP7 A;  3UT7 A;  5LX8 A;  2OOE A;  3HHM A;  3QWW A;  4A1G A;  2Q7F A; 
#chains in the Genus database with same CATH homology
 3LJN A;  3NOG D;  3ZNG A;  4BES A;  4HRL A;  4G8K A;  4HI8 A;  3TWT A;  4DX7 D;  5HS0 A;  3V79 K;  2P2C P;  3DEP A;  3B7B A;  2V4H C;  3JUE A;  4NIK A;  5ENQ D;  4U96 D;  3HRA A;  2KXP C;  4HB5 A;  4HQD A;  5D66 A;  3V2O A;  3JXJ A;  2PNN A;  5HRY A;  1BU9 A;  5CBN A;  4OAV B;  2RFA A;  4HI9 A;  1MX6 A;  2RFM A;  5AQ7 A;  2BKG A;  2XZT G;  4LSZ E;  2Y1L E;  1NFI E;  5ITZ F;  4HNA D;  4ZFH A;  1SVX A;  1YYH A;  3NOC D;  4U95 D;  3TWV A;  2FO1 E;  5AAO A;  5CED B;  1IKN D;  4YDY A;  1N0Q A;  4ZHB A;  3TWS A;  4J8Y A;  3UTM A;  4DX5 D;  2HE0 A;  4HRN A;  4GPM A;  4BER A;  1BI8 B;  2XZD G;  5EYP F;  3V31 A;  2A5E A;  2ZGD A;  4C48 B;  4N5Q A;  2JAB A;  4O60 A;  3V30 A;  4DUI A;  2DZN A;  1DCQ A;  3J5P A;  5AQ9 A;  2XEH A;  1OY3 D;  4QQI A;  2VGE A;  5KWD A;  1A5E A;  3Q9U C;  5ENP D;  1K3Z D;  5CEA A;  4U8Y D;  1BI7 B;  5FIN A;  4BEP A;  2V5Q C;  3EHR A;  2B0O E;  4J7W A;  4K5C A;  4O1O A;  4YDW A;  3SO8 A;  3T9K A;  4DRX E;  2F8Y A;  2F37 A;  3HG0 D;  2MYO A;  5EIB E;  1BLX B;  5EID A;  3T8K A;  2BKK B;  4CYM D;  2J8S D;  2KBX A;  1QYM A;  4K5B A;  2Y0B G;  3W9G A;  4BSZ B;  2DWZ A;  1TR4 A;  2L6B A;  4GMR A;  4K5A B;  4A63 B;  5ENT D;  1AWC B;  1MX2 A;  5AQB A;  5CBO A;  3D9H A;  2QC9 A;  3ZKJ A;  3ZUV B;  4BET A;  4HRM B;  4O1P A;  4U8V D;  2AJA A;  1IHB A;  3C5R A;  1YMP A;  2DVW A;  3IXE A;  5ENO D;  4F6R D;  3W9F A;  1BD8 A;  3JXI A;  3F6Q A;  4LNU D;  2DZO A;  3KEA A;  4QFV A;  1MJ0 A;  4DX2 A;  5AN8 A;  1YCS B;  3DEO A;  5AAR A;  3NBN B;  2XEN A;  1G3N B;  5KNG A;  5EYL A;  4G8L A;  1OT8 A;  1D9S A;  5BXO A;  1MX4 A;  1UOH A;  2F8X K;  3TWQ A;  5AQA A;  2ZGG A;  4RLY A;  4JB8 P;  1MYO A;  1SW6 A;  1K1A A;  3Q9N C;  1N11 A;  1DC2 A;  4CZ2 D;  4OAU C;  2ETA A;  3UI2 A;  5FIO A;  5CER B;  3V2X A;  4B93 B;  5KNH D;  5JMN D;  4Z68 A;  5HKP A;  4ATZ D;  4TUM A;  3EU9 A;  4HBD A;  4DX1 A;  3UXG A;  1WG0 A;  2ETB A;  5ENS D;  1WDY A;  4LG6 A;  5EIL A;  3ZU7 B;  1K1B A;  3TWW A;  5CEC B;  1AP7 A;  5ENR D;  3TWX A;  3AJI A;  3AAA C;  3EHQ A;  4F1P A;  5EN5 D;  1IXV A;  2ETC A;  2QYJ A;  3B95 A;  3J5Q B;  3TWU A;  3TWR A;  4DX6 D;  5BXU A;  1S70 B;  5KBA A;  4HLL A;  1N0R A;  5JA4 D;  4UUC A;  2XEE A;  2NYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...