3TWUA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
b'NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 52
structure length 160
sequence length 160
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twuA00
3ZUVB 1YMPA 2F8YA 4O60A 2ZGGA 3D9HA 4F1PA 2VGEA 2DZOA 3TWRA 3TWVA 5EYPF 1SW6A 1G3NB 4HI9A 4LG6A 1K1AA 3TWWA 4K5AB 4BEPA 3W9FA 5JMND 3NBNB 4BESA 2P2CP 4DX6D 3NOGD 4N5QA 3V2XA 1N0RA 4A63B 3TWQA 4OAVB 5AQ7A 4DX7D 1N0QA 4HNAD 3EHQA 4DX1A 3UXGA 3EU9A 2XENA 1TR4A 4GPMA 4HBDA 3KEAA 4HRLA 5ENRD 5EIBE 2B0OE 5AN8A 5HKPA 5KNGA 1BU9A 5EN5D 3F6QA 2AJAA 3SO8A 2XEEA 2PNNA 3B7BA 4ZFHA 1BLXB 3ZU7B 1K1BA 1BI8B 2F37A 5EIDA 5CERB 1NFIE 5AARA 1MJ0A 2XZDG 1IHBA 1WDYA 5ENOD 4CZ2D 3HG0D 4OAUC 1MYOA 1IXVA 1SVXA 2L6BA 4HI8A 5EYLA 3DEPA 3JUEA 3JXJA 4G8LA 3V79K 2QYJA 1UOHA 4J8YA 4O1PA 4YDWA 5ENPD 4LNUD 4F6RD 4HLLA 5FIOA 5BXUA 3TWUA 3B95A 4G8KA 1MX2A 3J5PA 2ETAA 5AQBA 4UUCA 1N11A 5HS0A 4HB5A 5CBOA 5ITZF 1S70B 3C5RA 4J7WA 2BKGA 4JB8P 4U95D 4U96D 2RFAA 5KNHD 4HRMB 4K5BA 5AAOA 2HE0A 2BKKB 4GMRA 2F8XK 5JA4D 1BD8A 2ETBA 5D66A 2RFMA 4ZHBA 5CEAA 2XEHA 2V4HC 1IKND 1WG0A 1MX6A 4TUMA 1K3ZD 4K5CA 5EILA 4O1OA 1A5EA 2KBXA 2Y0BG 5BXOA 5KBAA 2XZTG 1BI7B 2DWZA 4NIKA 3ZKJA 3HRAA 4RLYA 3EHRA 5ENSD 3LJNA 2DVWA 1OT8A 2ETCA 3Q9NC 3TWXA 3W9GA 3V30A 4B93B 5AQAA 3TWTA 3ZNGA 2DZNA 1OY3D 5KWDA 2KXPC 3JXIA 3IXEA 4DX5D 2FO1E 3UI2A 2ZGDA 4ATZD 5CEDB 3J5QB 2JABA 4U8VD 5ENQD 3TWSA 3Q9UC 1D9SA 1MX4A 4BETA 1DCQA 3T9KA 3V31A 4QQIA 4BERA 2A5EA 5AQ9A 4CYMD 4DRXE 1QYMA 1YCSB 1AWCB 3NOCD 4QFVA 4HQDA 2J8SD 1YYHA 3AJIA 4HRNA 4DX2A 3V2OA 4Z68A 1DC2A 4U8YD 3AAAC 2QC9A 4LSZE 5FINA 3UTMA 5HRYA 2V5QC 3T8KA 2Y1LE 5ENTD 4BSZB 4YDYA 4DUIA 1AP7A 4C48B 5CBNA 3DEOA 5CECB 2NYJA 2MYOA
chains in the Genus database with same CATH superfamily
2HM8A 4RVBA 3WXXA 3ZIMA 2ZISA 2H6FA 1WM5A 3D9OA 2VSXE 3NQPA 1G3NB 3ASHA 4MBGA 4N5QA 4A63B 4DLQA 4IN3B 2XRZA 3RU0A 4R7LA 4I17A 3Q79A 3U9WA 2DYSE 4FADA 3DPDA 1BU9A 3LCAA 3UM0A 3R9MA 5FWQA 4JA7A 5CMWA 1IHBA 3L22A 3IHVA 5EYLA 4JL0A 2EIME 3K9IA 3EIJA 1N11A 3C5RA 4JB8P 4U96D 3SQVA 4EZKA 3LY7A 4O1OA 4TXQA 1E8ZA 4JA9A 2DWZA 3G2SA 2A4ZA 5G05J 5G04C 3V30A 3PVLA 3ZYQA 2KXPC 3PDNA 1SA4A 1ZB1A 3T9KA 1UJKA 4MRUA 4G24A 3L16A 1RZ4A 2ZXWE 5FINA 5LP0A 3G2TA 3CHPA 3HYMB 1SZ9A 3LJ3A 3BG1B 4GTTA 5KJKA 2WMOA 2B6CA 4RQIA 3FU0A 3JQ0A 1DNPA 3PZ4A 2XENA 4FLBA 4XX5A 3DSWA 4GU5A 3U64A 3F6QA 3PEUB 3PUJA 3DBSA 1JUQA 1HS6A 1MJ0A 4AY6A 1FT2A 3FY4A 4N2QA 3S2AA 1EDUA 4G8LA 3FUFA 4U7EB 4G8KA 1N4RA 2I2OA 2WXGA 2BKGA 3CVQA 4GTSA 5AAOA 2HE0A 2OVFA 1Z5SC 2L0TB 3PS6A 4HOUA 4RLYA 3MYVA 1JWGA 1JCRA 5EX0A 2ZU6B 3HIZA 3JUIA 2V8SE 3CVLA 2XS1A 4IRUA 3J5QB 2YHEA 3KS2A 3VLEA 1YCSB 3UIPC 4QFVA 1YYHA 3CKCA 4U0SA 3LY9A 1N54A 4U8YD 3U66A 3O4ZA 2Y1LE 3SF4A 4GTQA 4F7AA 2WXOA 3D9HA 3S7JA 2DYRE 5LOZA 5T8IA 2C0LA 1JWFA 1SW6A 3UT4A 2CG3A 4MLPA 1H0AA 1H2TC 4IYPA 4YNDA 3ZN3A 5FQ6A 2PM7A 3NOGD 1N0RA 3CV0A 3TG4A 5LCWJ 4BFRA 2GROB 4I9EA 4GPMA 4HRLA 2J9QA 5AN8A 5EN5D 4PH4B 2XEEA 2UWJG 3MV2B 3RK6A 2CFZA 3Q47B 2NC9A 4GB9A 5D0OD 4JVSA 3HVEB 1HFAA 4KZCA 5ITZF 4U95D 1E7VA 1KZPA 1IYGA 4UQYA 5JJTA 3L13A 5T4YA 2L0IA 4UI9J 4I2ZA 1TN7A 2ETCA 2KZTB 4B93B 3QB2A 3RO3A 3JXIA 2PQNA 4DX5D 3IKOB 4H7XA 5FZRA 2LUHA 4EHMA 4BETA 4DRXE 3FUJA 4AEZC 4C0EA 5BUZA 4RSYA 4CT0A 4Z68A 4J8FA 2FULA 2VQ2A 2VSOE 5ENTD 4G25A 1UN9A 5HI7A 3CLJA 2VGEA 5BW8C 1H6OA 4MKTA 4JW1A 3L08A 2P2CP 3AS8A 5KCMA 4WAFA 4OAVB 1HH8A 2OEWA 4GA2A 4L2LA 2OCCE 4EBAG 5KNGA 3CVNA 3CEQA 1SQMA 2XZDG 2KC7A 4V3IA 2FO7A 2WXIA 1SVXA 4GCOA 4HI8A 2IO3C 3JUEA 3V79K 4LNUD 3RAUA 4HLLA 4NQ0A 2LO6A 3J5PA 3FTWA 3DSTA 2WXLA 2EILE 1FVHA 2IO2C 2KCKA 3DRAA 3CVVA 3FU3A 3ESLA 2H6IA 2WQHA 3B7RL 2IY0C 1S64A 5ARGA 2BF0X 2GRNB 3DWLG 3NAWA 3QAQA 1UW4B 4F1SA 3MEKA 3FUHA 1ELKA 5J08A 3E37A 3TG5A 4AY5A 3UT7A 3VTXA 3I3NA 2HO1A 2ZGDA 3FTSA 3Q9UC 4IULA 1TJCA 4GZDA 3CK8A 4GZ3A 3AAAC 3OXLA 2R05A 4F53A 4FHKA 1MHQA 3APFA 3VLFA 4BSZB 4DUIA 4MS6A 3FDHA 3ZUVB 2F8YA 3ZYLA 5BPPA 2VTBA 4UWLA 3CHMA 1OCOE 4BT8A 2GRPB 1L5JA 1EYHA 2BEDA 4TXRA 5CRUA 2PL2A 3R7RA 3RIBA 3SZ7A 5FJYA 5G2NA 3UXGA 3D9NA 2EIKE 3CKBA 4ANUA 4FP7A 2IOSA 2PNNA 3APDA 1Y6IA 1WDYA 3DXKG 2I1KA 3EJNA 2L6BA 4ANXA 1N95A 4XZ4A 5FQ4A 4O1PA 1TYQG 2J09A 4F6RD 2AVPA 4H7YA 2IJGX 5HS0A 4J7WA 3JQ1A 3JCKC 2IEJA 4GMRA 4HOTA 2FBNA 2X6IA 4CCAA 3I4GA 3NF1A 1H2UA 1NI1A 1OWPA 1BI7B 5BNWA 2L9BA 1OT8A 3Q9NC 3W9GA 1HU3A 3ZW3A 4BTAA 3KD7A 4AP2A 3ZFWA 2WQ6A 2NXPA 2J4BA 3U3WA 4K03A 4GAAA 5ENQD 4FJYA 3KAEA 4BERA 2Y3AA 2DCPA 2CHWA 4K0RA 3CQGB 2J8SD 3NZUA 1UN8A 3V2OA 2KM4A 3HXFA 2RKKA 4FHJA 3ULQA 2XPIA 3D9JA 1FVFA 3ML8A 1AP7A 4C48B 3LS8A 5CECB 2P9IG 3CQCB 4DLOA 2X6HA 4AV7A 2R2LA 1K1AA 1UJJA 3KSLA 3CIAA 5LX8A 1N4SA 4Q94A 1HO8A 3LEWA 4XKCA 1OUVA 2C0MA 2OV8A 4L23A 2P9UG 3AG3E 5B1AE 4EZLA 5B3SE 3ZPJA 3CHQA 4GZCA 4JEUA 3HXBA 4U8HA 2XGOA 1E8YA 3CHSA 1H6PA 3PH0C 3Q73A 2QY7A 1ZU2A 4N3CA 2YQ8A 1BPOA 3Q78A 3ASOE 1EPUA 4FJZA 2OVBA 3CR3A 4C0MA 3I4RB 4GZ5A 3BQOA 3LJNA 4HS2A 4KXKB 5JHBA 3TWXA 3IHYA 4AVXA 3CVWA 1KLXA 4AIFA 2WXJA 1S63A 4JHRA 5AYWD 3BG0B 5HRYA 5CMYA 3D9LA 1HE8A 4BX9A 4YDYA 3RRNB 3ZVVA 3E30A 1TEZA 4ILIA 3QWPA 2GRQB 1JPLA 3QKYA 4HNAD 3EHQA 4JHJA 3QWVA 3Q75A 1W3BA 3AG4E 3AU5A 2B0OE 2UY1A 5JJ7A 4GZ6A 5IY5E 2XCCA 4I6EA 3FTUA 4CZ2D 3Q15A 3CK9A 1OWLA 3R9AB 1UOHA 4JC8A 3LY8A 1YA0A 3P2BA 3TWUA 1N52A 2LSVA 5AQBA 1JCSA 3ZYKA 3ZXSA 1KPSB 3CSFA 3UIOC 2DBAA 2V0PA 2H6GA 4I6JA 3CGHA 5FZQA 4N5CA 3FUDA 1B89A 3ZNGA 1KT0A 3LYAA 4GYOA 3UI2A 1TN6A 2XPYA 1P5QA 3SNXA 3SFZA 4Q69A 1QBQA 1QQEA 3PREA 3IBEA 3UPVA 3CVUA 5FQ7A 2PZIA 3C72A 3C98A 1DC2A 2R17C 3ZRHA 1H19A 3RKVA 2XS8A 4P29A 3EUVA 4O60A 4Y6WA 3ZXPA 3TWVA 3ABME 1OWNA 3LVRE 4PS3A 3HXEA 3RO2A 3KEAA 3CHRA 3SO8A 2H6HA 4ZFHA 1HG2A 1K1BA 5FT9A 5CERB 4B8CB 3ASGA 4OAUC 3UINC 1IXVA 3G2VA 4LEUA 3MX3A 3EU5A 4ANVA 1O1RA 5E75A 3ZYMA 4BY6A 3DSUA 3LKUA 5E76A 2VYIA 3RRUA 4WWPA 5CRVA 2WXRA 2VTBB 1QZ2A 1E90A 1Z6TA 4UWFA 4L7TA 1TNUA 4B94A 4PDXA 3EHRA 3SI5A 2QZAA 2DVWA 3FUNA 4U63A 5AQAA 1OY3D 2AW6A 2MHKA 4YDOA 4LNGA 2L6JA 3FWVA 4TUUA 5CEDB 3Q7FA 4CDMA 1QYMA 1IHGA 3MKRA 3UTMA 2MOWA 4ABNA 4XKBA 3D9MA 4KVMA 5KJLA 2YINA 3TGOA 3EDTB 2E0IA 4DX7D 1O5MA 4JEHA 3ASNE 2F37A 2XHEA 5BT1A 3PZ2A 4EBAA 4LNBA 3C3OA 2P9SG 3CVXA 4J8DA 2HR2A 2R02A 2QYJA 1MX2A 1OCCE 5DBKA 5AJLA 3OAWA 5BV0A 3E32A 4HRMB 4I43A 1NZNA 3MGBA 3D9IA 5JA4D 1LD8A 5CEAA 3E34A 2V4HC 1IKND 4TUMA 3HXCA 3PZ3A 1Y8MA 5G05C 4HFGA 3URZA 4Q96A 5G04J 1N94A 3SD5A 5KWDA 4GPKA 3ULYA 1V54E 1WY6A 5CHEE 3T5VA 3G2WA 4N39A 4I6GA 4GA0A 4A55A 2V4LA 2IONA 5ANRA 1U2VG 2X6JA 3DEOA 2PQRA 4HVBA 3JYSA 4I2WA 4DK5A 3W9FA 2WPVA 1NL4A 4HORA 4DJAA 4UQZA 4B8AA 4HOSA 4LERA 5EX3A 3T8MA 5AQ7A 2XRYA 4KVOA 1FPPA 3QWWA 3ZEFA 4M3OA 3S7FA 2VSNA 1TR4A 3ISMC 1HG5A 3B7UX 4EECA 4G26A 4WNEA 4GYWA 4A1SA 4HLEA 4JXTA 3DXMG 1MYOA 1X81A 2IU1A 4WNFA 3RSEG 3JXJA 2CHZA 1N4PA 4FULA 3D9KA 3TXMA 5ENPD 2V5FA 1XNFA 4EZJA 5D2MC 4DPRA 4G2VA 2LSUA 3SHFA 4WNGA 4DI4A 4Y6CA 4GTRA 1ELRA 1BD8A 5D66A 2R5SA 2X3MA 2Y0BG 3EIQC 4I1AA 5KBAA 2VSYA 5FTPA 2R59A 5B1BE 2YNQA 3FTZA 4NRHB 3IXEA 2UY1B 3TWSA 3VLDA 2VGYA 3ASFA 1AWCB 4JPSA 4CRWA 1DCEA 4DX2A 3L17A 2WXFA 2Y69E 3O48A 4CDNA 5KJMA 4DI3A 5CBNA 2NYJA 1Z3XA 3FP3A 2FEZA 4J8EA 5FZSA 4I9CA 3TWWA 3GZ1A 5G55A 4BT9A 5M72A 2I1JA 5ENNA 4LUNU 4BESA 3HHMA 3PZ1A 4U0UA 4CDRA 3V2XA 3C3RA 5LCWC 5JJ6A 4APFA 1TNBA 2P9KG 2C2LA 1OXJA 4RG6A 3QNKA 4KZ0A 5EIBE 2XQ0A 2VGXA 3UM3A 1TN8A 3FTVA 4N3AA 2WXKA 2Q7FA 3Q7AA 3L54A 4HOQA 5ENOD 3Q49B 3FULA 5C1DA 3DSVA 4YDWA 4RG9A 3PRZA 3FU6A 3NZSA 4G11A 1OCRE 1FT1A 3DSXA 4A3TA 1HXIA 3UM1A 4PS7A 2BKKB 2F8XK 2R03A 3ONLA 4KYOB 2RFMA 1MX6A 3FHEA 5BXOA 1X5BA 4YVOA 4UI9C 2QYUA 3IEGA 3RJVA 4AM9A 3GYZA 2CG2A 5T3RA 5ANLA 3D3MA 1FCHA 2AWIA 4L1BA 4PS8A 1DCQA 4F3VA 2A5UA 5AQ9A 1GW6A 3PNTB 2P58C 3HDXA 2EINE 2LXLA 3LVQE 4LSZE 3ENEA 4GMLA 4J6IA 2Y4TA 4FU3A 3ZHEA 2WXMA 2J08A 3OTNA 3PZDA 4HI9A 2GRMA 5JMND 1Q2ZA 1TNOA 1H2VC 4KT6B 3SFXA 3QOUA 1OWOA 4JHKA 3MZLB 4U04A 4JD2G 3SBSA 4FLHA 3PE4A 3EU9A 3UM2A 2P9NG 3Q4AB 3LDZA 2AJAA 2RD0A 1BLXB 4X8QA 1NFIE 1V55E 4CGVA 3ABKE 2KCVA 2CFUA 4BSXA 3X2QE 3ONKA 1XGWA 4OVUA 4GCNA 5BXUA 3SBTB 3C3QA 2AXVA 4GTPA 5CBOA 4PUCA 3SGHA 3PUKA 1NP7A 4K5BA 5HQ8A 2RG8A 1N9AA 3UQ3A 1NA3A 2XEHA 3PNLB 4U0ZA 4EPZA 4ATGA 1D8DA 2JLBA 4I1OB 2XGSA 3MJWA 2P9PG 3CK7A 3FH5A 4OVVA 3GW4A 5AENA 3V31A 3QDNA 5H7PA 3UUXA 5FQ8A 3D9PA 3NOCD 4E85A 4I1MA 4HRNA 1ELWA 2QC9A 1NA0A 4ANWA 4N3BA 3N71A 2GGFA 4W9RA 2DZOA 5A7DB 3TWRA 2P9LG 2E2EA 4AXHA 4ACKA 3NBNB 4L9PA 5DIZA 4DX6D 2F0YA 2X6FA 4D10C 3MKQA 4FC8A 3OXFA 4EQFA 3CVYA 3Q5MA 4NURA 2GW1A 2FI7A 3QARA 4OYSA 3PE3A 3L6AA 4ILGA 2WXNA 2JEKA 2KCLA 3S7BA 3TL5A 2WXPA 2YHCA 1D8EA 3DEPA 4J8YA 3UKUG 2LNIA 5FIOA 2I9CA 4U07A 5CCLA 2ETAA 4LCTA 1S70B 3B7TA 3AG1E 4ZHBA 5EILA 1H6KA 2ZIRA 1E96B 3UMVA 4WUYA 4C9BB 2AXZA 2DZNA 2HYZA 4BX8A 1LTXA 2ILRA 5EKQD 1SZAA 1D9SA 1MX4A 4QQIA 2A5EA 3ULEG 1LF8A 4KBQA 4XIFA 5J90A 3R7QA 4HQDA 4TXPA 1LD7A 2IFUA 5ARFA 3CHOA 1KZOA 5A6CA 4APOA 2LAHA 1HF8A 1TNZA 2MRIA 3SFYA 3CSTA 4F1PA 4FA6A 5LFAA 5EYPF 4E6HA 2WM9A 2IF4A 4GTMA 3OXGA 1IQRA 2FF4A 2EQXA 3L82A 3KSQA 5AJDA 4UWHA 4GA1A 4DX1A 2J49A 3FTXA 3NB2A 4UI9K 4WNDA 2WMNA 5ENRD 4XE0A 3B7BA 3ASDA 1E8XA 1TNYA 1HX8A 5AARA 1A17A 3B13A 4G23A 3E4BA 4GTOA 2QFCA 3ML9A 4A3VA 1UG3A 1PC2A 2I6HA 3EHMA 2XEVA 4B0ZA 4UUCA 2LAIA 4XI9A 5KNHD 1RW2A 3T5XA 4GTVA 1PAQA 2XCBA 1WG0A 2GRRB 2KBXA 2WXQA 4N2SA 1KT1A 3B7SA 3GZSA 1MZCA 3MA5A 3ZKJA 2WXHA 5ENSD 3FUKA 2DIWA 3U4TA 3TJPA 1SA5A 3WG7E 1E7UA 3FUEA 4YVQC 3FUMA 1TJFA 4J8SA 2VGXB 3AS4A 3ZGQA 2Y4UA 2ONDA 2OEVA 2VJ8A 3FFLA 4TV3A 3AJIA 4J0UA 3BU8A 2IOLA 2PM6A 4G1TA 3FH7A 2V5QC 3T8KA 3RRMB 3S7DA 1OCZE 3UX4A 2MYOA 1YMPA 3AS5A 2ZGGA 3BEEA 3UKRG 3APCA 4UQXA 3KEZA 4ME2A 4B89A 3MV3B 4XEIG 3UT8A 1U3DA 2X6KA 1QNFA 1N0QA 3EHNA 3ESKA 4LRZA 4O6FA 4XI0A 2J4DA 4UWKA 1MQSA 3ZU7B 1BI8B 5EIDA 3HG0D 3QK0A 2EIJE 2WQ7A 4AJWA 3TXNA 5KJNA 3AU4A 3B95A 3L9TA 3LXUX 2J07A 4HB5A 3ZHEB 3G2UA 3GZ2A 3I5PA 5C2YA 3AG2E 4WWNA 4BWRA 5EDSA 2XZTG 3HRAA 4M7CA 3TWTA 3VTYA 4GMJA 4YDEA 1PY1A 3FU5A 2JABA 3LPZA 4JZYA 4U8VD 2M63A 2NSZA 3ABLE 2IQCA 2LXMA 4UWGA 3HVEA 4CT4A 1E8WA 1N4QA 3FEXA 1Z3YA 3FEYA 2XPZA 1O1SA 4ACLA 4LG6A 4BEPA 4K5AB 3TAXA 4A1GA 1WAO1 1HZ4A 3PEVB 3TWQA 3E33A 5A23A 2KZTA 3DSSA 4L2YA 2GRLA 4ILHB 4GYYA 2CHXA 1EF1C 3FUIA 4HBDA 2WVIA 3IV0A 1K8KG 2BUGA 5D0QD 2X38A 5HKPA 5AIJA 4WWOA 1JCQA 2AXUA 1S0PA 4BTBA 3MCXA 4CEMA 4NACA 3BUAA 2OOEA 3P1UA 3FH8A 5BV1A 1IQUA 2KATA 4KMOA 2RFAA 2BTDA 3DPYA 3QJZA 2ETBA 4URKA 1K3ZD 4K5CA 1A5EA 2WB2A 5JHAA 1OWMA 1INZA 3FTYA 1VDYA 4NIKA 2XGMA 5CCMA 3MKQB 1ZBPA 2FO1E 1U3CA 4ATZD 3SY2A 1DVPA 4TRQA 4CYMD 4HXIA 4AOFA 4CGWA 3HXDA 3CVPA 1O1TA 3QC1A
chains in the Genus database with same CATH topology
3ZUVB 1YMPA 2F8YA 4O60A 2ZGGA 3D9HA 4F1PA 2VGEA 2DZOA 3TWRA 3TWVA 5EYPF 1SW6A 1G3NB 4HI9A 4LG6A 1K1AA 3TWWA 4K5AB 4BEPA 3W9FA 5JMND 3NBNB 4BESA 2P2CP 4DX6D 3NOGD 4N5QA 3V2XA 1N0RA 4A63B 3TWQA 4OAVB 5AQ7A 4DX7D 1N0QA 4HNAD 3EHQA 4DX1A 3UXGA 3EU9A 2XENA 1TR4A 4GPMA 4HBDA 3KEAA 4HRLA 5ENRD 5EIBE 2B0OE 5AN8A 5HKPA 5KNGA 1BU9A 5EN5D 3F6QA 2AJAA 3SO8A 2XEEA 2PNNA 3B7BA 4ZFHA 1BLXB 3ZU7B 1K1BA 1BI8B 2F37A 5EIDA 5CERB 1NFIE 5AARA 1MJ0A 2XZDG 1IHBA 1WDYA 5ENOD 4CZ2D 3HG0D 4OAUC 1MYOA 1IXVA 1SVXA 2L6BA 4HI8A 5EYLA 3DEPA 3JUEA 3JXJA 4G8LA 3V79K 2QYJA 1UOHA 4J8YA 4O1PA 4YDWA 5ENPD 4LNUD 4F6RD 4HLLA 5FIOA 5BXUA 3TWUA 3B95A 4G8KA 1MX2A 3J5PA 2ETAA 5AQBA 4UUCA 1N11A 5HS0A 4HB5A 5CBOA 5ITZF 1S70B 3C5RA 4J7WA 2BKGA 4JB8P 4U95D 4U96D 2RFAA 5KNHD 4HRMB 4K5BA 5AAOA 2HE0A 2BKKB 4GMRA 2F8XK 5JA4D 1BD8A 2ETBA 5D66A 2RFMA 4ZHBA 5CEAA 2XEHA 2V4HC 1IKND 1WG0A 1MX6A 4TUMA 1K3ZD 4K5CA 5EILA 4O1OA 1A5EA 2KBXA 2Y0BG 5BXOA 5KBAA 2XZTG 1BI7B 2DWZA 4NIKA 3ZKJA 3HRAA 4RLYA 3EHRA 5ENSD 3LJNA 2DVWA 1OT8A 2ETCA 3Q9NC 3TWXA 3W9GA 3V30A 4B93B 5AQAA 3TWTA 3ZNGA 2DZNA 1OY3D 5KWDA 2KXPC 3JXIA 3IXEA 4DX5D 2FO1E 3UI2A 2ZGDA 4ATZD 5CEDB 3J5QB 2JABA 4U8VD 5ENQD 3TWSA 3Q9UC 1D9SA 1MX4A 4BETA 1DCQA 3T9KA 3V31A 4QQIA 4BERA 2A5EA 5AQ9A 4CYMD 4DRXE 1QYMA 1YCSB 1AWCB 3NOCD 4QFVA 4HQDA 2J8SD 1YYHA 3AJIA 4HRNA 4DX2A 3V2OA 4Z68A 1DC2A 4U8YD 3AAAC 2QC9A 4LSZE 5FINA 3UTMA 5HRYA 2V5QC 3T8KA 2Y1LE 5ENTD 4BSZB 4YDYA 4DUIA 1AP7A 4C48B 5CBNA 3DEOA 5CECB 2NYJA 2MYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUV B;  1YMP A;  2F8Y A;  4O60 A;  2ZGG A;  3D9H A;  4F1P A;  2VGE A;  2DZO A;  3TWR A;  3TWV A;  5EYP F;  1SW6 A;  1G3N B;  4HI9 A;  4LG6 A;  1K1A A;  3TWW A;  4K5A B;  4BEP A;  3W9F A;  5JMN D;  3NBN B;  4BES A;  2P2C P;  4DX6 D;  3NOG D;  4N5Q A;  3V2X A;  1N0R A;  4A63 B;  3TWQ A;  4OAV B;  5AQ7 A;  4DX7 D;  1N0Q A;  4HNA D;  3EHQ A;  4DX1 A;  3UXG A;  3EU9 A;  2XEN A;  1TR4 A;  4GPM A;  4HBD A;  3KEA A;  4HRL A;  5ENR D;  5EIB E;  2B0O E;  5AN8 A;  5HKP A;  5KNG A;  1BU9 A;  5EN5 D;  3F6Q A;  2AJA A;  3SO8 A;  2XEE A;  2PNN A;  3B7B A;  4ZFH A;  1BLX B;  3ZU7 B;  1K1B A;  1BI8 B;  2F37 A;  5EID A;  5CER B;  1NFI E;  5AAR A;  1MJ0 A;  2XZD G;  1IHB A;  1WDY A;  5ENO D;  4CZ2 D;  3HG0 D;  4OAU C;  1MYO A;  1IXV A;  1SVX A;  2L6B A;  4HI8 A;  5EYL A;  3DEP A;  3JUE A;  3JXJ A;  4G8L A;  3V79 K;  2QYJ A;  1UOH A;  4J8Y A;  4O1P A;  4YDW A;  5ENP D;  4LNU D;  4F6R D;  4HLL A;  5FIO A;  5BXU A;  3TWU A;  3B95 A;  4G8K A;  1MX2 A;  3J5P A;  2ETA A;  5AQB A;  4UUC A;  1N11 A;  5HS0 A;  4HB5 A;  5CBO A;  5ITZ F;  1S70 B;  3C5R A;  4J7W A;  2BKG A;  4JB8 P;  4U95 D;  4U96 D;  2RFA A;  5KNH D;  4HRM B;  4K5B A;  5AAO A;  2HE0 A;  2BKK B;  4GMR A;  2F8X K;  5JA4 D;  1BD8 A;  2ETB A;  5D66 A;  2RFM A;  4ZHB A;  5CEA A;  2XEH A;  2V4H C;  1IKN D;  1WG0 A;  1MX6 A;  4TUM A;  1K3Z D;  4K5C A;  5EIL A;  4O1O A;  1A5E A;  2KBX A;  2Y0B G;  5BXO A;  5KBA A;  2XZT G;  1BI7 B;  2DWZ A;  4NIK A;  3ZKJ A;  3HRA A;  4RLY A;  3EHR A;  5ENS D;  3LJN A;  2DVW A;  1OT8 A;  2ETC A;  3Q9N C;  3TWX A;  3W9G A;  3V30 A;  4B93 B;  5AQA A;  3TWT A;  3ZNG A;  2DZN A;  1OY3 D;  5KWD A;  2KXP C;  3JXI A;  3IXE A;  4DX5 D;  2FO1 E;  3UI2 A;  2ZGD A;  4ATZ D;  5CED B;  3J5Q B;  2JAB A;  4U8V D;  5ENQ D;  3TWS A;  3Q9U C;  1D9S A;  1MX4 A;  4BET A;  1DCQ A;  3T9K A;  3V31 A;  4QQI A;  4BER A;  2A5E A;  5AQ9 A;  4CYM D;  4DRX E;  1QYM A;  1YCS B;  1AWC B;  3NOC D;  4QFV A;  4HQD A;  2J8S D;  1YYH A;  3AJI A;  4HRN A;  4DX2 A;  3V2O A;  4Z68 A;  1DC2 A;  4U8Y D;  3AAA C;  2QC9 A;  4LSZ E;  5FIN A;  3UTM A;  5HRY A;  2V5Q C;  3T8K A;  2Y1L E;  5ENT D;  4BSZ B;  4YDY A;  4DUI A;  1AP7 A;  4C48 B;  5CBN A;  3DEO A;  5CEC B;  2NYJ A;  2MYO A; 
#chains in the Genus database with same CATH topology
 2HM8 A;  4RVB A;  3WXX A;  3ZIM A;  2ZIS A;  2H6F A;  1WM5 A;  3D9O A;  2VSX E;  3NQP A;  1G3N B;  3ASH A;  4MBG A;  4N5Q A;  4A63 B;  4DLQ A;  4IN3 B;  2XRZ A;  3RU0 A;  4R7L A;  4I17 A;  3Q79 A;  3U9W A;  2DYS E;  4FAD A;  3DPD A;  1BU9 A;  3LCA A;  3UM0 A;  3R9M A;  5FWQ A;  4JA7 A;  5CMW A;  1IHB A;  3L22 A;  3IHV A;  5EYL A;  4JL0 A;  2EIM E;  3K9I A;  3EIJ A;  1N11 A;  3C5R A;  4JB8 P;  4U96 D;  3SQV A;  4EZK A;  3LY7 A;  4O1O A;  4TXQ A;  1E8Z A;  4JA9 A;  2DWZ A;  3G2S A;  2A4Z A;  5G05 J;  5G04 C;  3V30 A;  3PVL A;  3ZYQ A;  2KXP C;  3PDN A;  1SA4 A;  1ZB1 A;  3T9K A;  1UJK A;  4MRU A;  4G24 A;  3L16 A;  1RZ4 A;  2ZXW E;  5FIN A;  5LP0 A;  3G2T A;  3CHP A;  3HYM B;  1SZ9 A;  3LJ3 A;  3BG1 B;  4GTT A;  5KJK A;  2WMO A;  2B6C A;  4RQI A;  3FU0 A;  3JQ0 A;  1DNP A;  3PZ4 A;  2XEN A;  4FLB A;  4XX5 A;  3DSW A;  4GU5 A;  3U64 A;  3F6Q A;  3PEU B;  3PUJ A;  3DBS A;  1JUQ A;  1HS6 A;  1MJ0 A;  4AY6 A;  1FT2 A;  3FY4 A;  4N2Q A;  3S2A A;  1EDU A;  4G8L A;  3FUF A;  4U7E B;  4G8K A;  1N4R A;  2I2O A;  2WXG A;  2BKG A;  3CVQ A;  4GTS A;  5AAO A;  2HE0 A;  2OVF A;  1Z5S C;  2L0T B;  3PS6 A;  4HOU A;  4RLY A;  3MYV A;  1JWG A;  1JCR A;  5EX0 A;  2ZU6 B;  3HIZ A;  3JUI A;  2V8S E;  3CVL A;  2XS1 A;  4IRU A;  3J5Q B;  2YHE A;  3KS2 A;  3VLE A;  1YCS B;  3UIP C;  4QFV A;  1YYH A;  3CKC A;  4U0S A;  3LY9 A;  1N54 A;  4U8Y D;  3U66 A;  3O4Z A;  2Y1L E;  3SF4 A;  4GTQ A;  4F7A A;  2WXO A;  3D9H A;  3S7J A;  2DYR E;  5LOZ A;  5T8I A;  2C0L A;  1JWF A;  1SW6 A;  3UT4 A;  2CG3 A;  4MLP A;  1H0A A;  1H2T C;  4IYP A;  4YND A;  3ZN3 A;  5FQ6 A;  2PM7 A;  3NOG D;  1N0R A;  3CV0 A;  3TG4 A;  5LCW J;  4BFR A;  2GRO B;  4I9E A;  4GPM A;  4HRL A;  2J9Q A;  5AN8 A;  5EN5 D;  4PH4 B;  2XEE A;  2UWJ G;  3MV2 B;  3RK6 A;  2CFZ A;  3Q47 B;  2NC9 A;  4GB9 A;  5D0O D;  4JVS A;  3HVE B;  1HFA A;  4KZC A;  5ITZ F;  4U95 D;  1E7V A;  1KZP A;  1IYG A;  4UQY A;  5JJT A;  3L13 A;  5T4Y A;  2L0I A;  4UI9 J;  4I2Z A;  1TN7 A;  2ETC A;  2KZT B;  4B93 B;  3QB2 A;  3RO3 A;  3JXI A;  2PQN A;  4DX5 D;  3IKO B;  4H7X A;  5FZR A;  2LUH A;  4EHM A;  4BET A;  4DRX E;  3FUJ A;  4AEZ C;  4C0E A;  5BUZ A;  4RSY A;  4CT0 A;  4Z68 A;  4J8F A;  2FUL A;  2VQ2 A;  2VSO E;  5ENT D;  4G25 A;  1UN9 A;  5HI7 A;  3CLJ A;  2VGE A;  5BW8 C;  1H6O A;  4MKT A;  4JW1 A;  3L08 A;  2P2C P;  3AS8 A;  5KCM A;  4WAF A;  4OAV B;  1HH8 A;  2OEW A;  4GA2 A;  4L2L A;  2OCC E;  4EBA G;  5KNG A;  3CVN A;  3CEQ A;  1SQM A;  2XZD G;  2KC7 A;  4V3I A;  2FO7 A;  2WXI A;  1SVX A;  4GCO A;  4HI8 A;  2IO3 C;  3JUE A;  3V79 K;  4LNU D;  3RAU A;  4HLL A;  4NQ0 A;  2LO6 A;  3J5P A;  3FTW A;  3DST A;  2WXL A;  2EIL E;  1FVH A;  2IO2 C;  2KCK A;  3DRA A;  3CVV A;  3FU3 A;  3ESL A;  2H6I A;  2WQH A;  3B7R L;  2IY0 C;  1S64 A;  5ARG A;  2BF0 X;  2GRN B;  3DWL G;  3NAW A;  3QAQ A;  1UW4 B;  4F1S A;  3MEK A;  3FUH A;  1ELK A;  5J08 A;  3E37 A;  3TG5 A;  4AY5 A;  3UT7 A;  3VTX A;  3I3N A;  2HO1 A;  2ZGD A;  3FTS A;  3Q9U C;  4IUL A;  1TJC A;  4GZD A;  3CK8 A;  4GZ3 A;  3AAA C;  3OXL A;  2R05 A;  4F53 A;  4FHK A;  1MHQ A;  3APF A;  3VLF A;  4BSZ B;  4DUI A;  4MS6 A;  3FDH A;  3ZUV B;  2F8Y A;  3ZYL A;  5BPP A;  2VTB A;  4UWL A;  3CHM A;  1OCO E;  4BT8 A;  2GRP B;  1L5J A;  1EYH A;  2BED A;  4TXR A;  5CRU A;  2PL2 A;  3R7R A;  3RIB A;  3SZ7 A;  5FJY A;  5G2N A;  3UXG A;  3D9N A;  2EIK E;  3CKB A;  4ANU A;  4FP7 A;  2IOS A;  2PNN A;  3APD A;  1Y6I A;  1WDY A;  3DXK G;  2I1K A;  3EJN A;  2L6B A;  4ANX A;  1N95 A;  4XZ4 A;  5FQ4 A;  4O1P A;  1TYQ G;  2J09 A;  4F6R D;  2AVP A;  4H7Y A;  2IJG X;  5HS0 A;  4J7W A;  3JQ1 A;  3JCK C;  2IEJ A;  4GMR A;  4HOT A;  2FBN A;  2X6I A;  4CCA A;  3I4G A;  3NF1 A;  1H2U A;  1NI1 A;  1OWP A;  1BI7 B;  5BNW A;  2L9B A;  1OT8 A;  3Q9N C;  3W9G A;  1HU3 A;  3ZW3 A;  4BTA A;  3KD7 A;  4AP2 A;  3ZFW A;  2WQ6 A;  2NXP A;  2J4B A;  3U3W A;  4K03 A;  4GAA A;  5ENQ D;  4FJY A;  3KAE A;  4BER A;  2Y3A A;  2DCP A;  2CHW A;  4K0R A;  3CQG B;  2J8S D;  3NZU A;  1UN8 A;  3V2O A;  2KM4 A;  3HXF A;  2RKK A;  4FHJ A;  3ULQ A;  2XPI A;  3D9J A;  1FVF A;  3ML8 A;  1AP7 A;  4C48 B;  3LS8 A;  5CEC B;  2P9I G;  3CQC B;  4DLO A;  2X6H A;  4AV7 A;  2R2L A;  1K1A A;  1UJJ A;  3KSL A;  3CIA A;  5LX8 A;  1N4S A;  4Q94 A;  1HO8 A;  3LEW A;  4XKC A;  1OUV A;  2C0M A;  2OV8 A;  4L23 A;  2P9U G;  3AG3 E;  5B1A E;  4EZL A;  5B3S E;  3ZPJ A;  3CHQ A;  4GZC A;  4JEU A;  3HXB A;  4U8H A;  2XGO A;  1E8Y A;  3CHS A;  1H6P A;  3PH0 C;  3Q73 A;  2QY7 A;  1ZU2 A;  4N3C A;  2YQ8 A;  1BPO A;  3Q78 A;  3ASO E;  1EPU A;  4FJZ A;  2OVB A;  3CR3 A;  4C0M A;  3I4R B;  4GZ5 A;  3BQO A;  3LJN A;  4HS2 A;  4KXK B;  5JHB A;  3TWX A;  3IHY A;  4AVX A;  3CVW A;  1KLX A;  4AIF A;  2WXJ A;  1S63 A;  4JHR A;  5AYW D;  3BG0 B;  5HRY A;  5CMY A;  3D9L A;  1HE8 A;  4BX9 A;  4YDY A;  3RRN B;  3ZVV A;  3E30 A;  1TEZ A;  4ILI A;  3QWP A;  2GRQ B;  1JPL A;  3QKY A;  4HNA D;  3EHQ A;  4JHJ A;  3QWV A;  3Q75 A;  1W3B A;  3AG4 E;  3AU5 A;  2B0O E;  2UY1 A;  5JJ7 A;  4GZ6 A;  5IY5 E;  2XCC A;  4I6E A;  3FTU A;  4CZ2 D;  3Q15 A;  3CK9 A;  1OWL A;  3R9A B;  1UOH A;  4JC8 A;  3LY8 A;  1YA0 A;  3P2B A;  3TWU A;  1N52 A;  2LSV A;  5AQB A;  1JCS A;  3ZYK A;  3ZXS A;  1KPS B;  3CSF A;  3UIO C;  2DBA A;  2V0P A;  2H6G A;  4I6J A;  3CGH A;  5FZQ A;  4N5C A;  3FUD A;  1B89 A;  3ZNG A;  1KT0 A;  3LYA A;  4GYO A;  3UI2 A;  1TN6 A;  2XPY A;  1P5Q A;  3SNX A;  3SFZ A;  4Q69 A;  1QBQ A;  1QQE A;  3PRE A;  3IBE A;  3UPV A;  3CVU A;  5FQ7 A;  2PZI A;  3C72 A;  3C98 A;  1DC2 A;  2R17 C;  3ZRH A;  1H19 A;  3RKV A;  2XS8 A;  4P29 A;  3EUV A;  4O60 A;  4Y6W A;  3ZXP A;  3TWV A;  3ABM E;  1OWN A;  3LVR E;  4PS3 A;  3HXE A;  3RO2 A;  3KEA A;  3CHR A;  3SO8 A;  2H6H A;  4ZFH A;  1HG2 A;  1K1B A;  5FT9 A;  5CER B;  4B8C B;  3ASG A;  4OAU C;  3UIN C;  1IXV A;  3G2V A;  4LEU A;  3MX3 A;  3EU5 A;  4ANV A;  1O1R A;  5E75 A;  3ZYM A;  4BY6 A;  3DSU A;  3LKU A;  5E76 A;  2VYI A;  3RRU A;  4WWP A;  5CRV A;  2WXR A;  2VTB B;  1QZ2 A;  1E90 A;  1Z6T A;  4UWF A;  4L7T A;  1TNU A;  4B94 A;  4PDX A;  3EHR A;  3SI5 A;  2QZA A;  2DVW A;  3FUN A;  4U63 A;  5AQA A;  1OY3 D;  2AW6 A;  2MHK A;  4YDO A;  4LNG A;  2L6J A;  3FWV A;  4TUU A;  5CED B;  3Q7F A;  4CDM A;  1QYM A;  1IHG A;  3MKR A;  3UTM A;  2MOW A;  4ABN A;  4XKB A;  3D9M A;  4KVM A;  5KJL A;  2YIN A;  3TGO A;  3EDT B;  2E0I A;  4DX7 D;  1O5M A;  4JEH A;  3ASN E;  2F37 A;  2XHE A;  5BT1 A;  3PZ2 A;  4EBA A;  4LNB A;  3C3O A;  2P9S G;  3CVX A;  4J8D A;  2HR2 A;  2R02 A;  2QYJ A;  1MX2 A;  1OCC E;  5DBK A;  5AJL A;  3OAW A;  5BV0 A;  3E32 A;  4HRM B;  4I43 A;  1NZN A;  3MGB A;  3D9I A;  5JA4 D;  1LD8 A;  5CEA A;  3E34 A;  2V4H C;  1IKN D;  4TUM A;  3HXC A;  3PZ3 A;  1Y8M A;  5G05 C;  4HFG A;  3URZ A;  4Q96 A;  5G04 J;  1N94 A;  3SD5 A;  5KWD A;  4GPK A;  3ULY A;  1V54 E;  1WY6 A;  5CHE E;  3T5V A;  3G2W A;  4N39 A;  4I6G A;  4GA0 A;  4A55 A;  2V4L A;  2ION A;  5ANR A;  1U2V G;  2X6J A;  3DEO A;  2PQR A;  4HVB A;  3JYS A;  4I2W A;  4DK5 A;  3W9F A;  2WPV A;  1NL4 A;  4HOR A;  4DJA A;  4UQZ A;  4B8A A;  4HOS A;  4LER A;  5EX3 A;  3T8M A;  5AQ7 A;  2XRY A;  4KVO A;  1FPP A;  3QWW A;  3ZEF A;  4M3O A;  3S7F A;  2VSN A;  1TR4 A;  3ISM C;  1HG5 A;  3B7U X;  4EEC A;  4G26 A;  4WNE A;  4GYW A;  4A1S A;  4HLE A;  4JXT A;  3DXM G;  1MYO A;  1X81 A;  2IU1 A;  4WNF A;  3RSE G;  3JXJ A;  2CHZ A;  1N4P A;  4FUL A;  3D9K A;  3TXM A;  5ENP D;  2V5F A;  1XNF A;  4EZJ A;  5D2M C;  4DPR A;  4G2V A;  2LSU A;  3SHF A;  4WNG A;  4DI4 A;  4Y6C A;  4GTR A;  1ELR A;  1BD8 A;  5D66 A;  2R5S A;  2X3M A;  2Y0B G;  3EIQ C;  4I1A A;  5KBA A;  2VSY A;  5FTP A;  2R59 A;  5B1B E;  2YNQ A;  3FTZ A;  4NRH B;  3IXE A;  2UY1 B;  3TWS A;  3VLD A;  2VGY A;  3ASF A;  1AWC B;  4JPS A;  4CRW A;  1DCE A;  4DX2 A;  3L17 A;  2WXF A;  2Y69 E;  3O48 A;  4CDN A;  5KJM A;  4DI3 A;  5CBN A;  2NYJ A;  1Z3X A;  3FP3 A;  2FEZ A;  4J8E A;  5FZS A;  4I9C A;  3TWW A;  3GZ1 A;  5G55 A;  4BT9 A;  5M72 A;  2I1J A;  5ENN A;  4LUN U;  4BES A;  3HHM A;  3PZ1 A;  4U0U A;  4CDR A;  3V2X A;  3C3R A;  5LCW C;  5JJ6 A;  4APF A;  1TNB A;  2P9K G;  2C2L A;  1OXJ A;  4RG6 A;  3QNK A;  4KZ0 A;  5EIB E;  2XQ0 A;  2VGX A;  3UM3 A;  1TN8 A;  3FTV A;  4N3A A;  2WXK A;  2Q7F A;  3Q7A A;  3L54 A;  4HOQ A;  5ENO D;  3Q49 B;  3FUL A;  5C1D A;  3DSV A;  4YDW A;  4RG9 A;  3PRZ A;  3FU6 A;  3NZS A;  4G11 A;  1OCR E;  1FT1 A;  3DSX A;  4A3T A;  1HXI A;  3UM1 A;  4PS7 A;  2BKK B;  2F8X K;  2R03 A;  3ONL A;  4KYO B;  2RFM A;  1MX6 A;  3FHE A;  5BXO A;  1X5B A;  4YVO A;  4UI9 C;  2QYU A;  3IEG A;  3RJV A;  4AM9 A;  3GYZ A;  2CG2 A;  5T3R A;  5ANL A;  3D3M A;  1FCH A;  2AWI A;  4L1B A;  4PS8 A;  1DCQ A;  4F3V A;  2A5U A;  5AQ9 A;  1GW6 A;  3PNT B;  2P58 C;  3HDX A;  2EIN E;  2LXL A;  3LVQ E;  4LSZ E;  3ENE A;  4GML A;  4J6I A;  2Y4T A;  4FU3 A;  3ZHE A;  2WXM A;  2J08 A;  3OTN A;  3PZD A;  4HI9 A;  2GRM A;  5JMN D;  1Q2Z A;  1TNO A;  1H2V C;  4KT6 B;  3SFX A;  3QOU A;  1OWO A;  4JHK A;  3MZL B;  4U04 A;  4JD2 G;  3SBS A;  4FLH A;  3PE4 A;  3EU9 A;  3UM2 A;  2P9N G;  3Q4A B;  3LDZ A;  2AJA A;  2RD0 A;  1BLX B;  4X8Q A;  1NFI E;  1V55 E;  4CGV A;  3ABK E;  2KCV A;  2CFU A;  4BSX A;  3X2Q E;  3ONK A;  1XGW A;  4OVU A;  4GCN A;  5BXU A;  3SBT B;  3C3Q A;  2AXV A;  4GTP A;  5CBO A;  4PUC A;  3SGH A;  3PUK A;  1NP7 A;  4K5B A;  5HQ8 A;  2RG8 A;  1N9A A;  3UQ3 A;  1NA3 A;  2XEH A;  3PNL B;  4U0Z A;  4EPZ A;  4ATG A;  1D8D A;  2JLB A;  4I1O B;  2XGS A;  3MJW A;  2P9P G;  3CK7 A;  3FH5 A;  4OVV A;  3GW4 A;  5AEN A;  3V31 A;  3QDN A;  5H7P A;  3UUX A;  5FQ8 A;  3D9P A;  3NOC D;  4E85 A;  4I1M A;  4HRN A;  1ELW A;  2QC9 A;  1NA0 A;  4ANW A;  4N3B A;  3N71 A;  2GGF A;  4W9R A;  2DZO A;  5A7D B;  3TWR A;  2P9L G;  2E2E A;  4AXH A;  4ACK A;  3NBN B;  4L9P A;  5DIZ A;  4DX6 D;  2F0Y A;  2X6F A;  4D10 C;  3MKQ A;  4FC8 A;  3OXF A;  4EQF A;  3CVY A;  3Q5M A;  4NUR A;  2GW1 A;  2FI7 A;  3QAR A;  4OYS A;  3PE3 A;  3L6A A;  4ILG A;  2WXN A;  2JEK A;  2KCL A;  3S7B A;  3TL5 A;  2WXP A;  2YHC A;  1D8E A;  3DEP A;  4J8Y A;  3UKU G;  2LNI A;  5FIO A;  2I9C A;  4U07 A;  5CCL A;  2ETA A;  4LCT A;  1S70 B;  3B7T A;  3AG1 E;  4ZHB A;  5EIL A;  1H6K A;  2ZIR A;  1E96 B;  3UMV A;  4WUY A;  4C9B B;  2AXZ A;  2DZN A;  2HYZ A;  4BX8 A;  1LTX A;  2ILR A;  5EKQ D;  1SZA A;  1D9S A;  1MX4 A;  4QQI A;  2A5E A;  3ULE G;  1LF8 A;  4KBQ A;  4XIF A;  5J90 A;  3R7Q A;  4HQD A;  4TXP A;  1LD7 A;  2IFU A;  5ARF A;  3CHO A;  1KZO A;  5A6C A;  4APO A;  2LAH A;  1HF8 A;  1TNZ A;  2MRI A;  3SFY A;  3CST A;  4F1P A;  4FA6 A;  5LFA A;  5EYP F;  4E6H A;  2WM9 A;  2IF4 A;  4GTM A;  3OXG A;  1IQR A;  2FF4 A;  2EQX A;  3L82 A;  3KSQ A;  5AJD A;  4UWH A;  4GA1 A;  4DX1 A;  2J49 A;  3FTX A;  3NB2 A;  4UI9 K;  4WND A;  2WMN A;  5ENR D;  4XE0 A;  3B7B A;  3ASD A;  1E8X A;  1TNY A;  1HX8 A;  5AAR A;  1A17 A;  3B13 A;  4G23 A;  3E4B A;  4GTO A;  2QFC A;  3ML9 A;  4A3V A;  1UG3 A;  1PC2 A;  2I6H A;  3EHM A;  2XEV A;  4B0Z A;  4UUC A;  2LAI A;  4XI9 A;  5KNH D;  1RW2 A;  3T5X A;  4GTV A;  1PAQ A;  2XCB A;  1WG0 A;  2GRR B;  2KBX A;  2WXQ A;  4N2S A;  1KT1 A;  3B7S A;  3GZS A;  1MZC A;  3MA5 A;  3ZKJ A;  2WXH A;  5ENS D;  3FUK A;  2DIW A;  3U4T A;  3TJP A;  1SA5 A;  3WG7 E;  1E7U A;  3FUE A;  4YVQ C;  3FUM A;  1TJF A;  4J8S A;  2VGX B;  3AS4 A;  3ZGQ A;  2Y4U A;  2OND A;  2OEV A;  2VJ8 A;  3FFL A;  4TV3 A;  3AJI A;  4J0U A;  3BU8 A;  2IOL A;  2PM6 A;  4G1T A;  3FH7 A;  2V5Q C;  3T8K A;  3RRM B;  3S7D A;  1OCZ E;  3UX4 A;  2MYO A;  1YMP A;  3AS5 A;  2ZGG A;  3BEE A;  3UKR G;  3APC A;  4UQX A;  3KEZ A;  4ME2 A;  4B89 A;  3MV3 B;  4XEI G;  3UT8 A;  1U3D A;  2X6K A;  1QNF A;  1N0Q A;  3EHN A;  3ESK A;  4LRZ A;  4O6F A;  4XI0 A;  2J4D A;  4UWK A;  1MQS A;  3ZU7 B;  1BI8 B;  5EID A;  3HG0 D;  3QK0 A;  2EIJ E;  2WQ7 A;  4AJW A;  3TXN A;  5KJN A;  3AU4 A;  3B95 A;  3L9T A;  3LXU X;  2J07 A;  4HB5 A;  3ZHE B;  3G2U A;  3GZ2 A;  3I5P A;  5C2Y A;  3AG2 E;  4WWN A;  4BWR A;  5EDS A;  2XZT G;  3HRA A;  4M7C A;  3TWT A;  3VTY A;  4GMJ A;  4YDE A;  1PY1 A;  3FU5 A;  2JAB A;  3LPZ A;  4JZY A;  4U8V D;  2M63 A;  2NSZ A;  3ABL E;  2IQC A;  2LXM A;  4UWG A;  3HVE A;  4CT4 A;  1E8W A;  1N4Q A;  3FEX A;  1Z3Y A;  3FEY A;  2XPZ A;  1O1S A;  4ACL A;  4LG6 A;  4BEP A;  4K5A B;  3TAX A;  4A1G A;  1WAO 1;  1HZ4 A;  3PEV B;  3TWQ A;  3E33 A;  5A23 A;  2KZT A;  3DSS A;  4L2Y A;  2GRL A;  4ILH B;  4GYY A;  2CHX A;  1EF1 C;  3FUI A;  4HBD A;  2WVI A;  3IV0 A;  1K8K G;  2BUG A;  5D0Q D;  2X38 A;  5HKP A;  5AIJ A;  4WWO A;  1JCQ A;  2AXU A;  1S0P A;  4BTB A;  3MCX A;  4CEM A;  4NAC A;  3BUA A;  2OOE A;  3P1U A;  3FH8 A;  5BV1 A;  1IQU A;  2KAT A;  4KMO A;  2RFA A;  2BTD A;  3DPY A;  3QJZ A;  2ETB A;  4URK A;  1K3Z D;  4K5C A;  1A5E A;  2WB2 A;  5JHA A;  1OWM A;  1INZ A;  3FTY A;  1VDY A;  4NIK A;  2XGM A;  5CCM A;  3MKQ B;  1ZBP A;  2FO1 E;  1U3C A;  4ATZ D;  3SY2 A;  1DVP A;  4TRQ A;  4CYM D;  4HXI A;  4AOF A;  4CGW A;  3HXD A;  3CVP A;  1O1T A;  3QC1 A; 
#chains in the Genus database with same CATH homology
 3ZUV B;  1YMP A;  2F8Y A;  4O60 A;  2ZGG A;  3D9H A;  4F1P A;  2VGE A;  2DZO A;  3TWR A;  3TWV A;  5EYP F;  1SW6 A;  1G3N B;  4HI9 A;  4LG6 A;  1K1A A;  3TWW A;  4K5A B;  4BEP A;  3W9F A;  5JMN D;  3NBN B;  4BES A;  2P2C P;  4DX6 D;  3NOG D;  4N5Q A;  3V2X A;  1N0R A;  4A63 B;  3TWQ A;  4OAV B;  5AQ7 A;  4DX7 D;  1N0Q A;  4HNA D;  3EHQ A;  4DX1 A;  3UXG A;  3EU9 A;  2XEN A;  1TR4 A;  4GPM A;  4HBD A;  3KEA A;  4HRL A;  5ENR D;  5EIB E;  2B0O E;  5AN8 A;  5HKP A;  5KNG A;  1BU9 A;  5EN5 D;  3F6Q A;  2AJA A;  3SO8 A;  2XEE A;  2PNN A;  3B7B A;  4ZFH A;  1BLX B;  3ZU7 B;  1K1B A;  1BI8 B;  2F37 A;  5EID A;  5CER B;  1NFI E;  5AAR A;  1MJ0 A;  2XZD G;  1IHB A;  1WDY A;  5ENO D;  4CZ2 D;  3HG0 D;  4OAU C;  1MYO A;  1IXV A;  1SVX A;  2L6B A;  4HI8 A;  5EYL A;  3DEP A;  3JUE A;  3JXJ A;  4G8L A;  3V79 K;  2QYJ A;  1UOH A;  4J8Y A;  4O1P A;  4YDW A;  5ENP D;  4LNU D;  4F6R D;  4HLL A;  5FIO A;  5BXU A;  3TWU A;  3B95 A;  4G8K A;  1MX2 A;  3J5P A;  2ETA A;  5AQB A;  4UUC A;  1N11 A;  5HS0 A;  4HB5 A;  5CBO A;  5ITZ F;  1S70 B;  3C5R A;  4J7W A;  2BKG A;  4JB8 P;  4U95 D;  4U96 D;  2RFA A;  5KNH D;  4HRM B;  4K5B A;  5AAO A;  2HE0 A;  2BKK B;  4GMR A;  2F8X K;  5JA4 D;  1BD8 A;  2ETB A;  5D66 A;  2RFM A;  4ZHB A;  5CEA A;  2XEH A;  2V4H C;  1IKN D;  1WG0 A;  1MX6 A;  4TUM A;  1K3Z D;  4K5C A;  5EIL A;  4O1O A;  1A5E A;  2KBX A;  2Y0B G;  5BXO A;  5KBA A;  2XZT G;  1BI7 B;  2DWZ A;  4NIK A;  3ZKJ A;  3HRA A;  4RLY A;  3EHR A;  5ENS D;  3LJN A;  2DVW A;  1OT8 A;  2ETC A;  3Q9N C;  3TWX A;  3W9G A;  3V30 A;  4B93 B;  5AQA A;  3TWT A;  3ZNG A;  2DZN A;  1OY3 D;  5KWD A;  2KXP C;  3JXI A;  3IXE A;  4DX5 D;  2FO1 E;  3UI2 A;  2ZGD A;  4ATZ D;  5CED B;  3J5Q B;  2JAB A;  4U8V D;  5ENQ D;  3TWS A;  3Q9U C;  1D9S A;  1MX4 A;  4BET A;  1DCQ A;  3T9K A;  3V31 A;  4QQI A;  4BER A;  2A5E A;  5AQ9 A;  4CYM D;  4DRX E;  1QYM A;  1YCS B;  1AWC B;  3NOC D;  4QFV A;  4HQD A;  2J8S D;  1YYH A;  3AJI A;  4HRN A;  4DX2 A;  3V2O A;  4Z68 A;  1DC2 A;  4U8Y D;  3AAA C;  2QC9 A;  4LSZ E;  5FIN A;  3UTM A;  5HRY A;  2V5Q C;  3T8K A;  2Y1L E;  5ENT D;  4BSZ B;  4YDY A;  4DUI A;  1AP7 A;  4C48 B;  5CBN A;  3DEO A;  5CEC B;  2NYJ A;  2MYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...