3TWUA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 52
structure length 160
sequence length 160
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twuA00
4U96D 3J5QB 1MJ0A 1MX2A 1SW6A 2XEHA 2P2CP 2MYOA 5BXOA 4OAVB 2J8SD 4DX1A 5D66A 2KBXA 4G8KA 4HRMB 3T8KA 2ZGDA 5HKPA 2NYJA 1NFIE 4BERA 3TWQA 1K3ZD 4O1OA 4ZHBA 3Q9NC 4DX7D 1IXVA 4G8LA 5KBAA 5JA4D 1BI7B 4HI8A 5AQ9A 3D9HA 3J5PA 3B7BA 5KNGA 2F8YA 5CBNA 5AQ7A 4GPMA 4BEPA 1BLXB 2F37A 2ZGGA 4N5QA 1UOHA 5ENRD 5EYLA 3W9GA 5ENSD 5EIBE 2RFMA 1IKND 1WG0A 3DEPA 2ETAA 1WDYA 1YMPA 4F1PA 4LSZE 4YDWA 2XZDG 5JMND 4DUIA 2ETBA 5CEAA 2HE0A 2QC9A 2QYJA 1OY3D 4CZ2D 2XEEA 5FIOA 3V31A 3JXJA 1G3NB 3NOCD 2BKGA 3JUEA 4BETA 5ENQD 5AQAA 4DX6D 4K5BA 2PNNA 5CERB 1BU9A 4NIKA 4U8VD 5EYPF 4DX2A 4U95D 4BSZB 1QYMA 4LNUD 3ZNGA 3HRAA 5ENOD 2VGEA 2A5EA 4O1PA 5EILA 5EIDA 5AARA 4Z68A 2F8XK 5AAOA 5ITZF 1AWCB 4JB8P 4O60A 2RFAA 3TWVA 2XENA 2Y1LE 1K1BA 5AQBA 1N0RA 4QFVA 1MX6A 4OAUC 3UXGA 3TWWA 3JXIA 4CYMD 5HS0A 4GMRA 4LG6A 3W9FA 2Y0BG 1BD8A 4HRLA 3DEOA 4BESA 5FINA 4HLLA 3NBNB 3ZKJA 2JABA 3B95A 2ETCA 3IXEA 1D9SA 3UTMA 2FO1E 2L6BA 3C5RA 3TWRA 4ATZD 4J8YA 1AP7A 1DCQA 4HQDA 2DVWA 3EU9A 4QQIA 4UUCA 1K1AA 3EHQA 4HRNA 4U8YD 3F6QA 3TWTA 4DX5D 5AN8A 3V2OA 4B93B 3V79K 2BKKB 5ENTD 3TWXA 3EHRA 2KXPC 3T9KA 3LJNA 4HNAD 1YCSB 4RLYA 1N11A 5KNHD 4ZFHA 2V4HC 3AAAC 3TWUA 1DC2A 1MYOA 1OT8A 2XZTG 4HBDA 5HRYA 3HG0D 1S70B 1BI8B 4J7WA 4A63B 2B0OE 3SO8A 3Q9UC 4F6RD 3NOGD 5BXUA 3ZU7B 1TR4A 3V30A 3UI2A 5EN5D 2DZOA 4HI9A 1A5EA 5CEDB 5KWDA 1IHBA 1YYHA 4C48B 1N0QA 3AJIA 5ENPD 3V2XA 5CBOA 4YDYA 1SVXA 2DZNA 3TWSA 3ZUVB 2DWZA 5CECB 4K5CA 4HB5A 4DRXE 1MX4A 2V5QC 4TUMA 2AJAA 3KEAA 4K5AB
chains in the Genus database with same CATH superfamily
2R02A 3AU4A 3HVEA 5LP0A 3LEWA 4XEIG 4RVBA 4L23A 3IHVA 2L6JA 3ABLE 2BEDA 5JA4D 1U3DA 3ESLA 3G2SA 1HF8A 4G26A 1BLXB 4N3CA 2GRPB 2LAIA 4F1PA 2ETBA 1LF8A 2AXZA 3ONKA 3PNTB 5HI7A 4TV3A 3MKQB 2R2LA 1KZOA 1N4QA 4I1OB 2EIKE 2RFAA 3JYSA 3TG4A 3DPYA 1GW6A 2WQHA 4HOTA 5KJLA 1BD8A 3DEOA 4GCNA 4URKA 5FTPA 4FU3A 3B95A 3E30A 3FTUA 4B94A 3CEQA 4APFA 1E7VA 3MZLB 4XI0A 4MLPA 5AIJA 3HYMB 5G04C 4H7XA 2CFZA 3LJNA 2DCPA 3CSFA 3JQ1A 1OT8A 3UKRG 3MGBA 3AG3E 3PS6A 4GTSA 2H6HA 4XKCA 3I3NA 1W3BA 3UI2A 3ONLA 4GPKA 1YYHA 2WB2A 1OWNA 1HH8A 2WPVA 2AW6A 4RG9A 2VGYA 2PQNA 4G8KA 4OVUA 3DWLG 4DLQA 3E37A 2EQXA 4DX1A 2QYUA 3QOUA 4Q94A 2CG2A 5G04J 2Q7FA 4UI9K 4NQ0A 5LCWJ 1S64A 1TN8A 1WDYA 2XQ0A 4A1SA 2ZU6B 5EYPF 1H6OA 2A5EA 1JPLA 4ANWA 5FZSA 4GU5A 3CIAA 3CVLA 3B7TA 2Y3AA 4APOA 4LG6A 1UJJA 2IONA 1NI1A 1JWFA 2X6JA 2WMNA 5EX0A 3SFYA 4JHKA 2BKKB 4GMJA 2KXPC 1MYOA 2CG3A 2GROB 2IJGX 1VDYA 3WG7E 5HRYA 4N3BA 1YA0A 5CRUA 3GZ1A 3G2VA 3CHQA 4GZ6A 2P9LG 5EN5D 5KJNA 4CT4A 3MYVA 4I1MA 3CV0A 3V2XA 2OVFA 3B13A 3KSQA 3ULEG 3U64A 2V5QC 1SW6A 4U96D 4JD2G 5JHBA 2WQ6A 3Q47B 4HVBA 4WNFA 5E75A 5FQ6A 4FLHA 5KBAA 3J5PA 3Q5MA 5CBNA 2X38A 2RFMA 4LSZE 5FJYA 2QC9A 3KEZA 4AY5A 2XEEA 2FO7A 4WNEA 5ENQD 1ZB1A 4UWHA 3AS5A 3SF4A 3Q15A 2J4DA 2OCCE 4G24A 4JHRA 5B1BE 3JXIA 2J07A 1LTXA 4HLLA 2XHEA 3WXXA 1TNYA 2XPYA 4DJAA 4C0MA 4N3AA 3HVEB 4ANXA 5ARFA 5JJTA 2PM7A 2C2LA 2C0LA 2I1KA 3EHQA 4TXPA 2XS8A 2VTBB 3FTZA 4J8EA 3EHRA 4I6JA 1QBQA 3O48A 1MHQA 2PL2A 3LDZA 3FUDA 3OXLA 4GA2A 3CVWA 2VTBA 3PZDA 5G2NA 5C2YA 5ENPD 3Q73A 2ILRA 2LSVA 1HS6A 2R05A 4DI4A 2DWZA 4HB5A 4I1AA 5CHEE 3VTXA 3CVPA 4EPZA 3APDA 4OAVB 3S7FA 3E34A 1XNFA 3NB2A 4Y6CA 2XGOA 4FULA 1RZ4A 1QQEA 1TN6A 3EJNA 2P9SG 5FT9A 3QB2A 3QKYA 5AQ7A 4N5QA 4Y6WA 4NACA 5G05C 5ENSD 3FTYA 2LO6A 3QJZA 3GZ2A 2F0YA 3MV2B 3JUEA 4BETA 4K5BA 1BU9A 4NIKA 4DK5A 2IY0C 1A17A 3D9JA 4XZ4A 1UG3A 4Z68A 3FH7A 2XENA 3KS2A 4J0UA 3HXEA 5B1AE 4CYMD 2E2EA 3FEYA 4U8HA 1XGWA 3W9FA 5H7PA 2V0PA 3RRNB 3ZKJA 2J08A 1L5JA 3DBSA 4UQZA 3QNKA 1PC2A 4G25A 3FUHA 4LRZA 4TXRA 3IV0A 3TWXA 1PAQA 4FJYA 4JVSA 3ASFA 3T9KA 2DBAA 1YCSB 5G05J 1MZCA 5AJLA 4ILIA 1DC2A 2YNQA 1NP7A 2IQCA 2X3MA 4F6RD 4E6HA 5BUZA 3UPVA 3SZ7A 2DZOA 2A5UA 3AJIA 3TXNA 4O6FA 3ZYMA 3S2AA 3KEAA 2WXGA 1HO8A 2LNIA 4JPSA 4JEUA 5KCMA 4BERA 4JEHA 3IEGA 4L1BA 4GYYA 3FU3A 5EIBE 5ENRD 3SQVA 3UT8A 3SNXA 4DUIA 2HE0A 1OY3D 3VLFA 1D8EA 1P5QA 3Q7AA 3ABME 2LAHA 4A3TA 4LEUA 1TJFA 1SA4A 4CDMA 3HIZA 3OAWA 3Q4AB 1SQMA 4O60A 2E0IA 4I2WA 3FP3A 2RKKA 3RSEG 4LERA 2EIJE 2QFCA 4AJWA 3EHNA 5B3SE 1U2VG 1DVPA 3L08A 3MV3B 4K03A 2Y69E 1WY6A 1O1SA 4I17A 3CSTA 5BW8C 3C3RA 3NZUA 2WXOA 2L9BA 3S7JA 4ILHB 1E8ZA 4B8CB 3E33A 4LNGA 3ZU7B 2ZISA 2OEWA 1A5EA 2P9UG 4C48B 3B7UX 3RU0A 1H19A 3LKUA 3I4RB 1U3CA 3PVLA 4G8LA 4B0ZA 2XCCA 2XCBA 3AG4E 1Y8MA 3PREA 4JA9A 2LXLA 3SFXA 3UUXA 1N95A 3RK6A 5J08A 2XPZA 4U7EB 3TWQA 4WWOA 3ASGA 3ZHEA 3PZ4A 4OVVA 4F53A 5DBKA 1WG0A 1OWOA 5JMND 3PEVB 3ZVVA 4CT0A 4GTRA 3TXMA 5CERB 4TXQA 3T5XA 4I6EA 4WAFA 4I43A 5AQBA 2I6HA 4GTMA 3UXGA 1HZ4A 1KZPA 1H0AA 4ABNA 4JZYA 4J8YA 4M7CA 1H2TC 2UWJG 2VSOE 4PDXA 4U8YD 4JA7A 4YDOA 4B93B 3D9NA 3LS8A 1N52A 1HG5A 1EDUA 5J90A 4N39A 3BQOA 1N11A 4J8FA 3BG0B 1FVHA 4BT8A 3FTVA 3PE4A 4GZCA 1H6KA 5KWDA 3QWWA 1DCEA 4DRXE 1HX8A 2AVPA 1ZBPA 3ABKE 4EZLA 2KBXA 2A4ZA 5T3RA 3T8KA 3PEUB 5D0QD 2IOSA 4GTVA 5CCLA 3LYAA 4O1OA 3U66A 4L9PA 5EKQD 4KZ0A 4F1SA 1JCSA 4WNGA 4GPMA 3SFZA 3W9GA 2WQ7A 2WXMA 1YMPA 2V8SE 4ME2A 3SY2A 4CZ2D 4EBAA 5FQ7A 3D9IA 3HDXA 1B89A 4I6GA 3DXKG 2XEVA 3CHMA 5KJMA 3ZNGA 5ENOD 3FHEA 5ITZF 2P9NG 4UQYA 1QNFA 3BG1B 4KMOA 4U04A 3QDNA 1HFAA 2IEJA 2HR2A 3CKCA 1N4SA 3FH8A 3UIOC 3KD7A 2P9PG 2ETCA 3IXEA 4AIFA 3CKBA 3LY8A 1TN7A 4GZ3A 4ACKA 4B8AA 4UUCA 4CCAA 3NQPA 3CQCB 3FTSA 1E8WA 2RG8A 1NA0A 2KZTA 2IF4A 4RLYA 3HHMA 3TWUA 2XGSA 2VQ2A 4C9BB 1S70B 4R7LA 2NSZA 3Q9UC 4HXIA 3V30A 5JHAA 4BX8A 1H2VC 3QC1A 3CLJA 1UJKA 1QZ2A 3EU5A 2WXHA 3CK8A 4ATGA 3ULQA 2XEHA 3T5VA 2MYOA 2QY7A 4YVQC 3ASHA 3Q78A 5BPPA 5E76A 3D9MA 5IY5E 2WXLA 5CMYA 4BTBA 2F8YA 3CVVA 4V3IA 2KCVA 4XI9A 2IOLA 5AENA 1N94A 1JWGA 3LXUX 5AQAA 1DNPA 4BSZB 5BNWA 1LD7A 4RG6A 5EILA 3D9LA 5ARGA 2I1JA 3I5PA 5AAOA 4E85A 3LPZA 4IULA 5CRVA 3ASDA 2Y1LE 4AEZC 4GZ5A 3NAWA 3SHFA 3ASOE 4ILGA 3AG2E 1LD8A 1K1AA 2OVBA 3MA5A 3Q75A 3OXFA 1Y6IA 1NL4A 3MEKA 5ENTD 3RO3A 4L2LA 3R9MA 3ZHEB 3ULYA 2H6FA 3APFA 3IHYA 2YHCA 2AWIA 2V5FA 5BV1A 3CK9A 3FUNA 4X8QA 1IHGA 5C1DA 4EZKA 4UWLA 2YQ8A 2GRQB 2EINE 4FJZA 4PH4B 3ZYQA 2MRIA 2AJAA 1MJ0A 2P58C 3R9AB 1MX2A 2P2CP 1N9AA 4BX9A 3L17A 4C0EA 2OEVA 4WWNA 4GAAA 4MKTA 3RRMB 4JXTA 2BTDA 3B7BA 4BEPA 1UOHA 2BUGA 4PUCA 3VTYA 2BF0X 2P9IG 1IQRA 1KPSB 3PH0C 2WXNA 2CHWA 4DX6D 1QYMA 1Z6TA 4JHJA 3ZFWA 1HXIA 1H6PA 1KT1A 3SBTB 3UM0A 3G2TA 4CEMA 3FULA 3NBNB 4XE0A 2X6KA 1D9SA 3I4GA 4G2VA 4QQIA 5D2MC 3CHRA 1ELRA 4U07A 2I2OA 1O1RA 3UKUG 4A1GA 1Z3XA 3CVXA 1WM5A 1ELWA 2P9KG 3FDHA 2EILE 1EYHA 3CVNA 4GTTA 4YDYA 4CDRA 2J9QA 4K5AB 3J5QB 5A6CA 2C0MA 2FF4A 3C3OA 3EIJA 2R17C 3ZXSA 1EF1C 4GTOA 3PUJA 3ZGQA 4HRMB 3TG5A 5D0OD 4CDNA 4GA0A 4ZHBA 2GRMA 2WXQA 2VJ8A 3BEEA 3UMVA 4GB9A 3UQ3A 1OCOE 1MQSA 2QZAA 1JCRA 5JJ7A 3S7BA 1E8XA 3K9IA 3DEPA 1IKND 1TNZA 5CEAA 3OTNA 4ANUA 4W9RA 3PZ2A 3MKQA 4GCOA 4A55A 2NC9A 3NOCD 4I2ZA 3FTXA 4XX5A 5FQ4A 4U8VD 4U95D 2VGEA 2PQRA 5EDSA 3TWVA 2L0IA 4P29A 1IQUA 4CRWA 1OXJA 3KAEA 3ZEFA 2PZIA 4GTPA 2L6BA 1DCQA 3HXFA 3NF1A 4HQDA 3EU9A 2IO2C 1O1TA 4EBAG 3F6QA 4YDEA 2KATA 4BY6A 3V2OA 4JW1A 4HFGA 3DSUA 4EHMA 3HXDA 3RJVA 4ZFHA 4KYOB 3HG0D 4A63B 3ZW3A 4LNBA 3SO8A 2FEZA 1TNUA 3RIBA 4GYOA 5KJKA 4HORA 1E90A 4EQFA 3FH5A 4CGVA 2YHEA 1TNOA 2X6HA 5CBOA 3BUAA 4TRQA 3DSSA 4L2YA 5BV0A 3QWPA 3MX3A 3SI5A 1NFIE 4XIFA 5CCMA 5AQ9A 4LUNU 3ZRHA 3L22A 2LXMA 3CHOA 2WVIA 2F37A 2OOEA 3CHPA 3FFLA 2J49A 4WUYA 4GTQA 2GRLA 5LOZA 2PNNA 3R7QA 2H6GA 3G2WA 4LNUD 1BPOA 5LCWC 2ONDA 3VLDA 3ESKA 1K1BA 2R59A 3PUKA 3L82A 3AU5A 1V54E 4HRLA 1FPPA 2WXRA 3CVQA 3UTMA 2XGMA 3AS8A 3FWVA 4ATZD 1K8KG 4UI9C 4YNDA 2XS1A 3CR3A 4CGWA 2VYIA 4GA1A 3C98A 4J8SA 4L7TA 5EX3A 2MHKA 3MCXA 2V4HC 3HXBA 4IYPA 3SBSA 4J7WA 3JUIA 5LFAA 2VSXE 5CEDB 2X6IA 3EDTB 2JEKA 3NZSA 1TJCA 4AV7A 4UQXA 2YINA 4MBGA 3Q7FA 4PS7A 2J8SD 5D66A 4H7YA 1OWPA 2AXUA 3EUVA 3D9OA 2GRNB 4DX7D 2H6IA 4NURA 3UINC 1TYQG 1JUQA 2Y4UA 5FQ8A 2XRZA 4U63A 2QYJA 4G11A 3JXJA 2ZXWE 3TAXA 3UM1A 3RAUA 4JC8A 1E96B 4EZJA 4M3OA 1Q2ZA 2F8XK 2CFUA 1AWCB 4QFVA 1MX6A 4FLBA 4OAUC 2FBNA 3DPDA 2R03A 3ASNE 3APCA 2FO1E 3C5RA 3P2BA 2FI7A 5DIZA 2DVWA 4HRNA 2XRYA 3PRZA 2LSUA 4AOFA 1X5BA 3Q79A 1UN8A 4G23A 4RSYA 4KZCA 3SGHA 2PM6A 3NOGD 3B7RL 4I9EA 2VGXA 2B6CA 3D3MA 1N4RA 1JCQA 4KT6B 4UI9J 1FT1A 2DZNA 3LJ3A 3L16A 3URZA 1TNBA 4FHJA 1PY1A 5BXOA 3ML8A 3VLEA 5HKPA 2NYJA 2CHXA 3RKVA 2HM8A 3L9TA 3CQGB 3U3WA 3RO2A 3UIPC 4AY6A 3LVRE 2J4BA 3C3QA 5EYLA 4U0SA 1X81A 2ETAA 4BWRA 1V55E 4YDWA 2XZDG 1ELKA 3FUFA 1EPUA 3DXMG 3TJPA 1OWLA 1Z5SC 4FHKA 3QWVA 5AARA 4O1PA 3PE3A 3JQ0A 3UT4A 3TWWA 5HS0A 5ENNA 2Y0BG 1SZAA 1HG2A 5ANLA 3CHSA 3FU0A 3L54A 2JABA 1S0PA 4GMLA 3AG1E 2VSNA 5ANRA 3GYZA 4GYWA 3JCKC 4DX5D 4K0RA 3ZPJA 3L13A 2M63A 4N5CA 2KCKA 4XKBA 4LCTA 3MKRA 4HI9A 1Z3YA 1N0QA 4RQIA 3ZUVB 4UWFA 3FUJA 1N4PA 2IFUA 5FWQA 4Q69A 2HO1A 3AS4A 1IXVA 3ML9A 3U9WA 3E32A 3UM2A 1FT2A 1KT0A 4HLEA 4J6IA 2LUHA 2KM4A 3QK0A 1N54A 3PDNA 2WXPA 3EHMA 3L6AA 4AXHA 3ENEA 4GZDA 4BFRA 1E7UA 1INZA 3FEXA 4DX2A 4I9CA 3RRUA 5EIDA 3EIQC 4F3VA 3FUEA 1OUVA 3IBEA 3TL5A 2GRRB 2JLBA 1UW4B 4BESA 1HE8A 3LVQE 2FULA 2HYZA 1UN9A 3Q49B 1HU3A 3LY7A 4AVXA 3TWTA 3V79K 2GW1A 2VSYA 3KSLA 5BT1A 4DLOA 5HQ8A 5KNHD 2R5SA 1OCCE 2WXIA 3BU8A 2XZTG 4YVOA 2KZTB 2OV8A 3E4BA 5M72A 2ZIRA 3D9KA 3MJWA 3D9PA 1IHBA 2UY1A 3HXCA 3ZYKA 4A3VA 3ISMC 1WAO1 4DI3A 4FP7A 1OCZE 2WXFA 2I9CA 3DSVA 5CECB 1H2UA 4TUMA 1SZ9A 1OWMA 3UX4A 2UY1B 2ZGDA 1FCHA 3ZXPA 1K3ZD 2J09A 3CK7A 2DIWA 3LCAA 3T8MA 4BSXA 1BI7B 2AXVA 4HI8A 3D9HA 3S7DA 5KNGA 2X6FA 3CVYA 4NRHB 5LX8A 3DSTA 1E8YA 2NXPA 5FIOA 3DRAA 2BKGA 3QARA 2DYRE 4BTAA 1S63A 4D10C 3HRAA 4F7AA 3QAQA 2EIME 2KC7A 4JB8P 3U4TA 3FUKA 2VGXB 2WMOA 5AJDA 3FU6A 4WWPA 3FTWA 5T8IA 2IU1A 4U0UA 3FUIA 3PNLB 4N2QA 3TGOA 3TWRA 4HS2A 4IRUA 5A7DB 2V4LA 2DYSE 1NA3A 1SA5A 1KLXA 4UWGA 3CGHA 2MOWA 4KXKB 2WXKA 4ACLA 3B7SA 4HNAD 3O4ZA 3GZSA 3AAAC 4HBDA 1BI8B 4MS6A 3ZIMA 5BXUA 3IKOB 4N2SA 5JJ6A 4KVOA 1D8DA 1SVXA 3TWSA 3CVUA 4WNDA 3C72A 1MX4A 3ZN3A 4G1TA 2RD0A 3Q9NC 4IN3B 3X2QE 4FC8A 1O5MA 2WXJA 3UM3A 4AP2A 1OCRE 2ZGGA 5FZQA 4TUUA 4KVMA 4FA6A 4U0ZA 4PS3A 4FADA 1IYGA 3V31A 4KBQA 1G3NB 4JL0A 3OXGA 3G2UA 2WM9A 1ZU2A 3P1UA 5A23A 4HOUA 2L0TB 5T4YA 3FU5A 4OYSA 1NZNA 3UT7A 3FY4A 1N0RA 3DSWA 1RW2A 2Y4TA 4GMRA 3PZ3A 3N71A 4DPRA 4UWKA 5CMWA 4J8DA 5FINA 5G55A 4AM9A 4BT9A 3R7RA 1TEZA 1AP7A 2CHZA 4HOQA 4B89A 1FVFA 2IO3C 4HOSA 2XPIA 2KCLA 5FZRA 5AN8A 3LY9A 4Q96A 3GW4A 4PS8A 2GGFA 3ZYLA 4ANVA 2B0OE 4EECA 1TR4A 3SD5A 3PZ1A 5AYWD 3FUMA 3DSXA 4K5CA 4MRUA
chains in the Genus database with same CATH topology
4U96D 3J5QB 1MJ0A 1MX2A 1SW6A 2XEHA 2P2CP 2MYOA 5BXOA 4OAVB 2J8SD 4DX1A 5D66A 2KBXA 4G8KA 4HRMB 3T8KA 2ZGDA 5HKPA 2NYJA 1NFIE 4BERA 3TWQA 1K3ZD 4O1OA 4ZHBA 3Q9NC 4DX7D 1IXVA 4G8LA 5KBAA 5JA4D 1BI7B 4HI8A 5AQ9A 3D9HA 3J5PA 3B7BA 5KNGA 2F8YA 5CBNA 5AQ7A 4GPMA 4BEPA 1BLXB 2F37A 2ZGGA 4N5QA 1UOHA 5ENRD 5EYLA 3W9GA 5ENSD 5EIBE 2RFMA 1IKND 1WG0A 3DEPA 2ETAA 1WDYA 1YMPA 4F1PA 4LSZE 4YDWA 2XZDG 5JMND 4DUIA 2ETBA 5CEAA 2HE0A 2QC9A 2QYJA 1OY3D 4CZ2D 2XEEA 5FIOA 3V31A 3JXJA 1G3NB 3NOCD 2BKGA 3JUEA 4BETA 5ENQD 5AQAA 4DX6D 4K5BA 2PNNA 5CERB 1BU9A 4NIKA 4U8VD 5EYPF 4DX2A 4U95D 4BSZB 1QYMA 4LNUD 3ZNGA 3HRAA 5ENOD 2VGEA 2A5EA 4O1PA 5EILA 5EIDA 5AARA 4Z68A 2F8XK 5AAOA 5ITZF 1AWCB 4JB8P 4O60A 2RFAA 3TWVA 2XENA 2Y1LE 1K1BA 5AQBA 1N0RA 4QFVA 1MX6A 4OAUC 3UXGA 3TWWA 3JXIA 4CYMD 5HS0A 4GMRA 4LG6A 3W9FA 2Y0BG 1BD8A 4HRLA 3DEOA 4BESA 5FINA 4HLLA 3NBNB 3ZKJA 2JABA 3B95A 2ETCA 3IXEA 1D9SA 3UTMA 2FO1E 2L6BA 3C5RA 3TWRA 4ATZD 4J8YA 1AP7A 1DCQA 4HQDA 2DVWA 3EU9A 4QQIA 4UUCA 1K1AA 3EHQA 4HRNA 4U8YD 3F6QA 3TWTA 4DX5D 5AN8A 3V2OA 4B93B 3V79K 2BKKB 5ENTD 3TWXA 3EHRA 2KXPC 3T9KA 3LJNA 4HNAD 1YCSB 4RLYA 1N11A 5KNHD 4ZFHA 2V4HC 3AAAC 3TWUA 1DC2A 1MYOA 1OT8A 2XZTG 4HBDA 5HRYA 3HG0D 1S70B 1BI8B 4J7WA 4A63B 2B0OE 3SO8A 3Q9UC 4F6RD 3NOGD 5BXUA 3ZU7B 1TR4A 3V30A 3UI2A 5EN5D 2DZOA 4HI9A 1A5EA 5CEDB 5KWDA 1IHBA 1YYHA 4C48B 1N0QA 3AJIA 5ENPD 3V2XA 5CBOA 4YDYA 1SVXA 2DZNA 3TWSA 3ZUVB 2DWZA 5CECB 4K5CA 4HB5A 4DRXE 1MX4A 2V5QC 4TUMA 2AJAA 3KEAA 4K5AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U96 D;  3J5Q B;  1MJ0 A;  1MX2 A;  1SW6 A;  2XEH A;  2P2C P;  2MYO A;  5BXO A;  4OAV B;  2J8S D;  4DX1 A;  5D66 A;  2KBX A;  4G8K A;  4HRM B;  3T8K A;  2ZGD A;  5HKP A;  2NYJ A;  1NFI E;  4BER A;  3TWQ A;  1K3Z D;  4O1O A;  4ZHB A;  3Q9N C;  4DX7 D;  1IXV A;  4G8L A;  5KBA A;  5JA4 D;  1BI7 B;  4HI8 A;  5AQ9 A;  3D9H A;  3J5P A;  3B7B A;  5KNG A;  2F8Y A;  5CBN A;  5AQ7 A;  4GPM A;  4BEP A;  1BLX B;  2F37 A;  2ZGG A;  4N5Q A;  1UOH A;  5ENR D;  5EYL A;  3W9G A;  5ENS D;  5EIB E;  2RFM A;  1IKN D;  1WG0 A;  3DEP A;  2ETA A;  1WDY A;  1YMP A;  4F1P A;  4LSZ E;  4YDW A;  2XZD G;  5JMN D;  4DUI A;  2ETB A;  5CEA A;  2HE0 A;  2QC9 A;  2QYJ A;  1OY3 D;  4CZ2 D;  2XEE A;  5FIO A;  3V31 A;  3JXJ A;  1G3N B;  3NOC D;  2BKG A;  3JUE A;  4BET A;  5ENQ D;  5AQA A;  4DX6 D;  4K5B A;  2PNN A;  5CER B;  1BU9 A;  4NIK A;  4U8V D;  5EYP F;  4DX2 A;  4U95 D;  4BSZ B;  1QYM A;  4LNU D;  3ZNG A;  3HRA A;  5ENO D;  2VGE A;  2A5E A;  4O1P A;  5EIL A;  5EID A;  5AAR A;  4Z68 A;  2F8X K;  5AAO A;  5ITZ F;  1AWC B;  4JB8 P;  4O60 A;  2RFA A;  3TWV A;  2XEN A;  2Y1L E;  1K1B A;  5AQB A;  1N0R A;  4QFV A;  1MX6 A;  4OAU C;  3UXG A;  3TWW A;  3JXI A;  4CYM D;  5HS0 A;  4GMR A;  4LG6 A;  3W9F A;  2Y0B G;  1BD8 A;  4HRL A;  3DEO A;  4BES A;  5FIN A;  4HLL A;  3NBN B;  3ZKJ A;  2JAB A;  3B95 A;  2ETC A;  3IXE A;  1D9S A;  3UTM A;  2FO1 E;  2L6B A;  3C5R A;  3TWR A;  4ATZ D;  4J8Y A;  1AP7 A;  1DCQ A;  4HQD A;  2DVW A;  3EU9 A;  4QQI A;  4UUC A;  1K1A A;  3EHQ A;  4HRN A;  4U8Y D;  3F6Q A;  3TWT A;  4DX5 D;  5AN8 A;  3V2O A;  4B93 B;  3V79 K;  2BKK B;  5ENT D;  3TWX A;  3EHR A;  2KXP C;  3T9K A;  3LJN A;  4HNA D;  1YCS B;  4RLY A;  1N11 A;  5KNH D;  4ZFH A;  2V4H C;  3AAA C;  3TWU A;  1DC2 A;  1MYO A;  1OT8 A;  2XZT G;  4HBD A;  5HRY A;  3HG0 D;  1S70 B;  1BI8 B;  4J7W A;  4A63 B;  2B0O E;  3SO8 A;  3Q9U C;  4F6R D;  3NOG D;  5BXU A;  3ZU7 B;  1TR4 A;  3V30 A;  3UI2 A;  5EN5 D;  2DZO A;  4HI9 A;  1A5E A;  5CED B;  5KWD A;  1IHB A;  1YYH A;  4C48 B;  1N0Q A;  3AJI A;  5ENP D;  3V2X A;  5CBO A;  4YDY A;  1SVX A;  2DZN A;  3TWS A;  3ZUV B;  2DWZ A;  5CEC B;  4K5C A;  4HB5 A;  4DRX E;  1MX4 A;  2V5Q C;  4TUM A;  2AJA A;  3KEA A;  4K5A B; 
#chains in the Genus database with same CATH topology
 2R02 A;  3AU4 A;  3HVE A;  5LP0 A;  3LEW A;  4XEI G;  4RVB A;  4L23 A;  3IHV A;  2L6J A;  3ABL E;  2BED A;  5JA4 D;  1U3D A;  3ESL A;  3G2S A;  1HF8 A;  4G26 A;  1BLX B;  4N3C A;  2GRP B;  2LAI A;  4F1P A;  2ETB A;  1LF8 A;  2AXZ A;  3ONK A;  3PNT B;  5HI7 A;  4TV3 A;  3MKQ B;  2R2L A;  1KZO A;  1N4Q A;  4I1O B;  2EIK E;  2RFA A;  3JYS A;  3TG4 A;  3DPY A;  1GW6 A;  2WQH A;  4HOT A;  5KJL A;  1BD8 A;  3DEO A;  4GCN A;  4URK A;  5FTP A;  4FU3 A;  3B95 A;  3E30 A;  3FTU A;  4B94 A;  3CEQ A;  4APF A;  1E7V A;  3MZL B;  4XI0 A;  4MLP A;  5AIJ A;  3HYM B;  5G04 C;  4H7X A;  2CFZ A;  3LJN A;  2DCP A;  3CSF A;  3JQ1 A;  1OT8 A;  3UKR G;  3MGB A;  3AG3 E;  3PS6 A;  4GTS A;  2H6H A;  4XKC A;  3I3N A;  1W3B A;  3UI2 A;  3ONL A;  4GPK A;  1YYH A;  2WB2 A;  1OWN A;  1HH8 A;  2WPV A;  2AW6 A;  4RG9 A;  2VGY A;  2PQN A;  4G8K A;  4OVU A;  3DWL G;  4DLQ A;  3E37 A;  2EQX A;  4DX1 A;  2QYU A;  3QOU A;  4Q94 A;  2CG2 A;  5G04 J;  2Q7F A;  4UI9 K;  4NQ0 A;  5LCW J;  1S64 A;  1TN8 A;  1WDY A;  2XQ0 A;  4A1S A;  2ZU6 B;  5EYP F;  1H6O A;  2A5E A;  1JPL A;  4ANW A;  5FZS A;  4GU5 A;  3CIA A;  3CVL A;  3B7T A;  2Y3A A;  4APO A;  4LG6 A;  1UJJ A;  2ION A;  1NI1 A;  1JWF A;  2X6J A;  2WMN A;  5EX0 A;  3SFY A;  4JHK A;  2BKK B;  4GMJ A;  2KXP C;  1MYO A;  2CG3 A;  2GRO B;  2IJG X;  1VDY A;  3WG7 E;  5HRY A;  4N3B A;  1YA0 A;  5CRU A;  3GZ1 A;  3G2V A;  3CHQ A;  4GZ6 A;  2P9L G;  5EN5 D;  5KJN A;  4CT4 A;  3MYV A;  4I1M A;  3CV0 A;  3V2X A;  2OVF A;  3B13 A;  3KSQ A;  3ULE G;  3U64 A;  2V5Q C;  1SW6 A;  4U96 D;  4JD2 G;  5JHB A;  2WQ6 A;  3Q47 B;  4HVB A;  4WNF A;  5E75 A;  5FQ6 A;  4FLH A;  5KBA A;  3J5P A;  3Q5M A;  5CBN A;  2X38 A;  2RFM A;  4LSZ E;  5FJY A;  2QC9 A;  3KEZ A;  4AY5 A;  2XEE A;  2FO7 A;  4WNE A;  5ENQ D;  1ZB1 A;  4UWH A;  3AS5 A;  3SF4 A;  3Q15 A;  2J4D A;  2OCC E;  4G24 A;  4JHR A;  5B1B E;  3JXI A;  2J07 A;  1LTX A;  4HLL A;  2XHE A;  3WXX A;  1TNY A;  2XPY A;  4DJA A;  4C0M A;  4N3A A;  3HVE B;  4ANX A;  5ARF A;  5JJT A;  2PM7 A;  2C2L A;  2C0L A;  2I1K A;  3EHQ A;  4TXP A;  2XS8 A;  2VTB B;  3FTZ A;  4J8E A;  3EHR A;  4I6J A;  1QBQ A;  3O48 A;  1MHQ A;  2PL2 A;  3LDZ A;  3FUD A;  3OXL A;  4GA2 A;  3CVW A;  2VTB A;  3PZD A;  5G2N A;  5C2Y A;  5ENP D;  3Q73 A;  2ILR A;  2LSV A;  1HS6 A;  2R05 A;  4DI4 A;  2DWZ A;  4HB5 A;  4I1A A;  5CHE E;  3VTX A;  3CVP A;  4EPZ A;  3APD A;  4OAV B;  3S7F A;  3E34 A;  1XNF A;  3NB2 A;  4Y6C A;  2XGO A;  4FUL A;  1RZ4 A;  1QQE A;  1TN6 A;  3EJN A;  2P9S G;  5FT9 A;  3QB2 A;  3QKY A;  5AQ7 A;  4N5Q A;  4Y6W A;  4NAC A;  5G05 C;  5ENS D;  3FTY A;  2LO6 A;  3QJZ A;  3GZ2 A;  2F0Y A;  3MV2 B;  3JUE A;  4BET A;  4K5B A;  1BU9 A;  4NIK A;  4DK5 A;  2IY0 C;  1A17 A;  3D9J A;  4XZ4 A;  1UG3 A;  4Z68 A;  3FH7 A;  2XEN A;  3KS2 A;  4J0U A;  3HXE A;  5B1A E;  4CYM D;  2E2E A;  3FEY A;  4U8H A;  1XGW A;  3W9F A;  5H7P A;  2V0P A;  3RRN B;  3ZKJ A;  2J08 A;  1L5J A;  3DBS A;  4UQZ A;  3QNK A;  1PC2 A;  4G25 A;  3FUH A;  4LRZ A;  4TXR A;  3IV0 A;  3TWX A;  1PAQ A;  4FJY A;  4JVS A;  3ASF A;  3T9K A;  2DBA A;  1YCS B;  5G05 J;  1MZC A;  5AJL A;  4ILI A;  1DC2 A;  2YNQ A;  1NP7 A;  2IQC A;  2X3M A;  4F6R D;  4E6H A;  5BUZ A;  3UPV A;  3SZ7 A;  2DZO A;  2A5U A;  3AJI A;  3TXN A;  4O6F A;  3ZYM A;  3S2A A;  3KEA A;  2WXG A;  1HO8 A;  2LNI A;  4JPS A;  4JEU A;  5KCM A;  4BER A;  4JEH A;  3IEG A;  4L1B A;  4GYY A;  3FU3 A;  5EIB E;  5ENR D;  3SQV A;  3UT8 A;  3SNX A;  4DUI A;  2HE0 A;  1OY3 D;  3VLF A;  1D8E A;  1P5Q A;  3Q7A A;  3ABM E;  2LAH A;  4A3T A;  4LEU A;  1TJF A;  1SA4 A;  4CDM A;  3HIZ A;  3OAW A;  3Q4A B;  1SQM A;  4O60 A;  2E0I A;  4I2W A;  3FP3 A;  2RKK A;  3RSE G;  4LER A;  2EIJ E;  2QFC A;  4AJW A;  3EHN A;  5B3S E;  1U2V G;  1DVP A;  3L08 A;  3MV3 B;  4K03 A;  2Y69 E;  1WY6 A;  1O1S A;  4I17 A;  3CST A;  5BW8 C;  3C3R A;  3NZU A;  2WXO A;  2L9B A;  3S7J A;  4ILH B;  1E8Z A;  4B8C B;  3E33 A;  4LNG A;  3ZU7 B;  2ZIS A;  2OEW A;  1A5E A;  2P9U G;  4C48 B;  3B7U X;  3RU0 A;  1H19 A;  3LKU A;  3I4R B;  1U3C A;  3PVL A;  4G8L A;  4B0Z A;  2XCC A;  2XCB A;  3AG4 E;  1Y8M A;  3PRE A;  4JA9 A;  2LXL A;  3SFX A;  3UUX A;  1N95 A;  3RK6 A;  5J08 A;  2XPZ A;  4U7E B;  3TWQ A;  4WWO A;  3ASG A;  3ZHE A;  3PZ4 A;  4OVV A;  4F53 A;  5DBK A;  1WG0 A;  1OWO A;  5JMN D;  3PEV B;  3ZVV A;  4CT0 A;  4GTR A;  3TXM A;  5CER B;  4TXQ A;  3T5X A;  4I6E A;  4WAF A;  4I43 A;  5AQB A;  2I6H A;  4GTM A;  3UXG A;  1HZ4 A;  1KZP A;  1H0A A;  4ABN A;  4JZY A;  4J8Y A;  4M7C A;  1H2T C;  2UWJ G;  2VSO E;  4PDX A;  4U8Y D;  4JA7 A;  4YDO A;  4B93 B;  3D9N A;  3LS8 A;  1N52 A;  1HG5 A;  1EDU A;  5J90 A;  4N39 A;  3BQO A;  1N11 A;  4J8F A;  3BG0 B;  1FVH A;  4BT8 A;  3FTV A;  3PE4 A;  4GZC A;  1H6K A;  5KWD A;  3QWW A;  1DCE A;  4DRX E;  1HX8 A;  2AVP A;  1ZBP A;  3ABK E;  4EZL A;  2KBX A;  2A4Z A;  5T3R A;  3T8K A;  3PEU B;  5D0Q D;  2IOS A;  4GTV A;  5CCL A;  3LYA A;  4O1O A;  3U66 A;  4L9P A;  5EKQ D;  4KZ0 A;  4F1S A;  1JCS A;  4WNG A;  4GPM A;  3SFZ A;  3W9G A;  2WQ7 A;  2WXM A;  1YMP A;  2V8S E;  4ME2 A;  3SY2 A;  4CZ2 D;  4EBA A;  5FQ7 A;  3D9I A;  3HDX A;  1B89 A;  4I6G A;  3DXK G;  2XEV A;  3CHM A;  5KJM A;  3ZNG A;  5ENO D;  3FHE A;  5ITZ F;  2P9N G;  4UQY A;  1QNF A;  3BG1 B;  4KMO A;  4U04 A;  3QDN A;  1HFA A;  2IEJ A;  2HR2 A;  3CKC A;  1N4S A;  3FH8 A;  3UIO C;  3KD7 A;  2P9P G;  2ETC A;  3IXE A;  4AIF A;  3CKB A;  3LY8 A;  1TN7 A;  4GZ3 A;  4ACK A;  4B8A A;  4UUC A;  4CCA A;  3NQP A;  3CQC B;  3FTS A;  1E8W A;  2RG8 A;  1NA0 A;  2KZT A;  2IF4 A;  4RLY A;  3HHM A;  3TWU A;  2XGS A;  2VQ2 A;  4C9B B;  1S70 B;  4R7L A;  2NSZ A;  3Q9U C;  4HXI A;  3V30 A;  5JHA A;  4BX8 A;  1H2V C;  3QC1 A;  3CLJ A;  1UJK A;  1QZ2 A;  3EU5 A;  2WXH A;  3CK8 A;  4ATG A;  3ULQ A;  2XEH A;  3T5V A;  2MYO A;  2QY7 A;  4YVQ C;  3ASH A;  3Q78 A;  5BPP A;  5E76 A;  3D9M A;  5IY5 E;  2WXL A;  5CMY A;  4BTB A;  2F8Y A;  3CVV A;  4V3I A;  2KCV A;  4XI9 A;  2IOL A;  5AEN A;  1N94 A;  1JWG A;  3LXU X;  5AQA A;  1DNP A;  4BSZ B;  5BNW A;  1LD7 A;  4RG6 A;  5EIL A;  3D9L A;  5ARG A;  2I1J A;  3I5P A;  5AAO A;  4E85 A;  3LPZ A;  4IUL A;  5CRV A;  3ASD A;  2Y1L E;  4AEZ C;  4GZ5 A;  3NAW A;  3SHF A;  3ASO E;  4ILG A;  3AG2 E;  1LD8 A;  1K1A A;  2OVB A;  3MA5 A;  3Q75 A;  3OXF A;  1Y6I A;  1NL4 A;  3MEK A;  5ENT D;  3RO3 A;  4L2L A;  3R9M A;  3ZHE B;  3ULY A;  2H6F A;  3APF A;  3IHY A;  2YHC A;  2AWI A;  2V5F A;  5BV1 A;  3CK9 A;  3FUN A;  4X8Q A;  1IHG A;  5C1D A;  4EZK A;  4UWL A;  2YQ8 A;  2GRQ B;  2EIN E;  4FJZ A;  4PH4 B;  3ZYQ A;  2MRI A;  2AJA A;  1MJ0 A;  2P58 C;  3R9A B;  1MX2 A;  2P2C P;  1N9A A;  4BX9 A;  3L17 A;  4C0E A;  2OEV A;  4WWN A;  4GAA A;  4MKT A;  3RRM B;  4JXT A;  2BTD A;  3B7B A;  4BEP A;  1UOH A;  2BUG A;  4PUC A;  3VTY A;  2BF0 X;  2P9I G;  1IQR A;  1KPS B;  3PH0 C;  2WXN A;  2CHW A;  4DX6 D;  1QYM A;  1Z6T A;  4JHJ A;  3ZFW A;  1HXI A;  1H6P A;  1KT1 A;  3SBT B;  3UM0 A;  3G2T A;  4CEM A;  3FUL A;  3NBN B;  4XE0 A;  2X6K A;  1D9S A;  3I4G A;  4G2V A;  4QQI A;  5D2M C;  3CHR A;  1ELR A;  4U07 A;  2I2O A;  1O1R A;  3UKU G;  4A1G A;  1Z3X A;  3CVX A;  1WM5 A;  1ELW A;  2P9K G;  3FDH A;  2EIL E;  1EYH A;  3CVN A;  4GTT A;  4YDY A;  4CDR A;  2J9Q A;  4K5A B;  3J5Q B;  5A6C A;  2C0M A;  2FF4 A;  3C3O A;  3EIJ A;  2R17 C;  3ZXS A;  1EF1 C;  4GTO A;  3PUJ A;  3ZGQ A;  4HRM B;  3TG5 A;  5D0O D;  4CDN A;  4GA0 A;  4ZHB A;  2GRM A;  2WXQ A;  2VJ8 A;  3BEE A;  3UMV A;  4GB9 A;  3UQ3 A;  1OCO E;  1MQS A;  2QZA A;  1JCR A;  5JJ7 A;  3S7B A;  1E8X A;  3K9I A;  3DEP A;  1IKN D;  1TNZ A;  5CEA A;  3OTN A;  4ANU A;  4W9R A;  3PZ2 A;  3MKQ A;  4GCO A;  4A55 A;  2NC9 A;  3NOC D;  4I2Z A;  3FTX A;  4XX5 A;  5FQ4 A;  4U8V D;  4U95 D;  2VGE A;  2PQR A;  5EDS A;  3TWV A;  2L0I A;  4P29 A;  1IQU A;  4CRW A;  1OXJ A;  3KAE A;  3ZEF A;  2PZI A;  4GTP A;  2L6B A;  1DCQ A;  3HXF A;  3NF1 A;  4HQD A;  3EU9 A;  2IO2 C;  1O1T A;  4EBA G;  3F6Q A;  4YDE A;  2KAT A;  4BY6 A;  3V2O A;  4JW1 A;  4HFG A;  3DSU A;  4EHM A;  3HXD A;  3RJV A;  4ZFH A;  4KYO B;  3HG0 D;  4A63 B;  3ZW3 A;  4LNB A;  3SO8 A;  2FEZ A;  1TNU A;  3RIB A;  4GYO A;  5KJK A;  4HOR A;  1E90 A;  4EQF A;  3FH5 A;  4CGV A;  2YHE A;  1TNO A;  2X6H A;  5CBO A;  3BUA A;  4TRQ A;  3DSS A;  4L2Y A;  5BV0 A;  3QWP A;  3MX3 A;  3SI5 A;  1NFI E;  4XIF A;  5CCM A;  5AQ9 A;  4LUN U;  3ZRH A;  3L22 A;  2LXM A;  3CHO A;  2WVI A;  2F37 A;  2OOE A;  3CHP A;  3FFL A;  2J49 A;  4WUY A;  4GTQ A;  2GRL A;  5LOZ A;  2PNN A;  3R7Q A;  2H6G A;  3G2W A;  4LNU D;  1BPO A;  5LCW C;  2OND A;  3VLD A;  3ESK A;  1K1B A;  2R59 A;  3PUK A;  3L82 A;  3AU5 A;  1V54 E;  4HRL A;  1FPP A;  2WXR A;  3CVQ A;  3UTM A;  2XGM A;  3AS8 A;  3FWV A;  4ATZ D;  1K8K G;  4UI9 C;  4YND A;  2XS1 A;  3CR3 A;  4CGW A;  2VYI A;  4GA1 A;  3C98 A;  4J8S A;  4L7T A;  5EX3 A;  2MHK A;  3MCX A;  2V4H C;  3HXB A;  4IYP A;  3SBS A;  4J7W A;  3JUI A;  5LFA A;  2VSX E;  5CED B;  2X6I A;  3EDT B;  2JEK A;  3NZS A;  1TJC A;  4AV7 A;  4UQX A;  2YIN A;  4MBG A;  3Q7F A;  4PS7 A;  2J8S D;  5D66 A;  4H7Y A;  1OWP A;  2AXU A;  3EUV A;  3D9O A;  2GRN B;  4DX7 D;  2H6I A;  4NUR A;  3UIN C;  1TYQ G;  1JUQ A;  2Y4U A;  5FQ8 A;  2XRZ A;  4U63 A;  2QYJ A;  4G11 A;  3JXJ A;  2ZXW E;  3TAX A;  3UM1 A;  3RAU A;  4JC8 A;  1E96 B;  4EZJ A;  4M3O A;  1Q2Z A;  2F8X K;  2CFU A;  1AWC B;  4QFV A;  1MX6 A;  4FLB A;  4OAU C;  2FBN A;  3DPD A;  2R03 A;  3ASN E;  3APC A;  2FO1 E;  3C5R A;  3P2B A;  2FI7 A;  5DIZ A;  2DVW A;  4HRN A;  2XRY A;  3PRZ A;  2LSU A;  4AOF A;  1X5B A;  3Q79 A;  1UN8 A;  4G23 A;  4RSY A;  4KZC A;  3SGH A;  2PM6 A;  3NOG D;  3B7R L;  4I9E A;  2VGX A;  2B6C A;  3D3M A;  1N4R A;  1JCQ A;  4KT6 B;  4UI9 J;  1FT1 A;  2DZN A;  3LJ3 A;  3L16 A;  3URZ A;  1TNB A;  4FHJ A;  1PY1 A;  5BXO A;  3ML8 A;  3VLE A;  5HKP A;  2NYJ A;  2CHX A;  3RKV A;  2HM8 A;  3L9T A;  3CQG B;  3U3W A;  3RO2 A;  3UIP C;  4AY6 A;  3LVR E;  2J4B A;  3C3Q A;  5EYL A;  4U0S A;  1X81 A;  2ETA A;  4BWR A;  1V55 E;  4YDW A;  2XZD G;  1ELK A;  3FUF A;  1EPU A;  3DXM G;  3TJP A;  1OWL A;  1Z5S C;  4FHK A;  3QWV A;  5AAR A;  4O1P A;  3PE3 A;  3JQ0 A;  3UT4 A;  3TWW A;  5HS0 A;  5ENN A;  2Y0B G;  1SZA A;  1HG2 A;  5ANL A;  3CHS A;  3FU0 A;  3L54 A;  2JAB A;  1S0P A;  4GML A;  3AG1 E;  2VSN A;  5ANR A;  3GYZ A;  4GYW A;  3JCK C;  4DX5 D;  4K0R A;  3ZPJ A;  3L13 A;  2M63 A;  4N5C A;  2KCK A;  4XKB A;  4LCT A;  3MKR A;  4HI9 A;  1Z3Y A;  1N0Q A;  4RQI A;  3ZUV B;  4UWF A;  3FUJ A;  1N4P A;  2IFU A;  5FWQ A;  4Q69 A;  2HO1 A;  3AS4 A;  1IXV A;  3ML9 A;  3U9W A;  3E32 A;  3UM2 A;  1FT2 A;  1KT0 A;  4HLE A;  4J6I A;  2LUH A;  2KM4 A;  3QK0 A;  1N54 A;  3PDN A;  2WXP A;  3EHM A;  3L6A A;  4AXH A;  3ENE A;  4GZD A;  4BFR A;  1E7U A;  1INZ A;  3FEX A;  4DX2 A;  4I9C A;  3RRU A;  5EID A;  3EIQ C;  4F3V A;  3FUE A;  1OUV A;  3IBE A;  3TL5 A;  2GRR B;  2JLB A;  1UW4 B;  4BES A;  1HE8 A;  3LVQ E;  2FUL A;  2HYZ A;  1UN9 A;  3Q49 B;  1HU3 A;  3LY7 A;  4AVX A;  3TWT A;  3V79 K;  2GW1 A;  2VSY A;  3KSL A;  5BT1 A;  4DLO A;  5HQ8 A;  5KNH D;  2R5S A;  1OCC E;  2WXI A;  3BU8 A;  2XZT G;  4YVO A;  2KZT B;  2OV8 A;  3E4B A;  5M72 A;  2ZIR A;  3D9K A;  3MJW A;  3D9P A;  1IHB A;  2UY1 A;  3HXC A;  3ZYK A;  4A3V A;  3ISM C;  1WAO 1;  4DI3 A;  4FP7 A;  1OCZ E;  2WXF A;  2I9C A;  3DSV A;  5CEC B;  1H2U A;  4TUM A;  1SZ9 A;  1OWM A;  3UX4 A;  2UY1 B;  2ZGD A;  1FCH A;  3ZXP A;  1K3Z D;  2J09 A;  3CK7 A;  2DIW A;  3LCA A;  3T8M A;  4BSX A;  1BI7 B;  2AXV A;  4HI8 A;  3D9H A;  3S7D A;  5KNG A;  2X6F A;  3CVY A;  4NRH B;  5LX8 A;  3DST A;  1E8Y A;  2NXP A;  5FIO A;  3DRA A;  2BKG A;  3QAR A;  2DYR E;  4BTA A;  1S63 A;  4D10 C;  3HRA A;  4F7A A;  3QAQ A;  2EIM E;  2KC7 A;  4JB8 P;  3U4T A;  3FUK A;  2VGX B;  2WMO A;  5AJD A;  3FU6 A;  4WWP A;  3FTW A;  5T8I A;  2IU1 A;  4U0U A;  3FUI A;  3PNL B;  4N2Q A;  3TGO A;  3TWR A;  4HS2 A;  4IRU A;  5A7D B;  2V4L A;  2DYS E;  1NA3 A;  1SA5 A;  1KLX A;  4UWG A;  3CGH A;  2MOW A;  4KXK B;  2WXK A;  4ACL A;  3B7S A;  4HNA D;  3O4Z A;  3GZS A;  3AAA C;  4HBD A;  1BI8 B;  4MS6 A;  3ZIM A;  5BXU A;  3IKO B;  4N2S A;  5JJ6 A;  4KVO A;  1D8D A;  1SVX A;  3TWS A;  3CVU A;  4WND A;  3C72 A;  1MX4 A;  3ZN3 A;  4G1T A;  2RD0 A;  3Q9N C;  4IN3 B;  3X2Q E;  4FC8 A;  1O5M A;  2WXJ A;  3UM3 A;  4AP2 A;  1OCR E;  2ZGG A;  5FZQ A;  4TUU A;  4KVM A;  4FA6 A;  4U0Z A;  4PS3 A;  4FAD A;  1IYG A;  3V31 A;  4KBQ A;  1G3N B;  4JL0 A;  3OXG A;  3G2U A;  2WM9 A;  1ZU2 A;  3P1U A;  5A23 A;  4HOU A;  2L0T B;  5T4Y A;  3FU5 A;  4OYS A;  1NZN A;  3UT7 A;  3FY4 A;  1N0R A;  3DSW A;  1RW2 A;  2Y4T A;  4GMR A;  3PZ3 A;  3N71 A;  4DPR A;  4UWK A;  5CMW A;  4J8D A;  5FIN A;  5G55 A;  4AM9 A;  4BT9 A;  3R7R A;  1TEZ A;  1AP7 A;  2CHZ A;  4HOQ A;  4B89 A;  1FVF A;  2IO3 C;  4HOS A;  2XPI A;  2KCL A;  5FZR A;  5AN8 A;  3LY9 A;  4Q96 A;  3GW4 A;  4PS8 A;  2GGF A;  3ZYL A;  4ANV A;  2B0O E;  4EEC A;  1TR4 A;  3SD5 A;  3PZ1 A;  5AYW D;  3FUM A;  3DSX A;  4K5C A;  4MRU A; 
#chains in the Genus database with same CATH homology
 4U96 D;  3J5Q B;  1MJ0 A;  1MX2 A;  1SW6 A;  2XEH A;  2P2C P;  2MYO A;  5BXO A;  4OAV B;  2J8S D;  4DX1 A;  5D66 A;  2KBX A;  4G8K A;  4HRM B;  3T8K A;  2ZGD A;  5HKP A;  2NYJ A;  1NFI E;  4BER A;  3TWQ A;  1K3Z D;  4O1O A;  4ZHB A;  3Q9N C;  4DX7 D;  1IXV A;  4G8L A;  5KBA A;  5JA4 D;  1BI7 B;  4HI8 A;  5AQ9 A;  3D9H A;  3J5P A;  3B7B A;  5KNG A;  2F8Y A;  5CBN A;  5AQ7 A;  4GPM A;  4BEP A;  1BLX B;  2F37 A;  2ZGG A;  4N5Q A;  1UOH A;  5ENR D;  5EYL A;  3W9G A;  5ENS D;  5EIB E;  2RFM A;  1IKN D;  1WG0 A;  3DEP A;  2ETA A;  1WDY A;  1YMP A;  4F1P A;  4LSZ E;  4YDW A;  2XZD G;  5JMN D;  4DUI A;  2ETB A;  5CEA A;  2HE0 A;  2QC9 A;  2QYJ A;  1OY3 D;  4CZ2 D;  2XEE A;  5FIO A;  3V31 A;  3JXJ A;  1G3N B;  3NOC D;  2BKG A;  3JUE A;  4BET A;  5ENQ D;  5AQA A;  4DX6 D;  4K5B A;  2PNN A;  5CER B;  1BU9 A;  4NIK A;  4U8V D;  5EYP F;  4DX2 A;  4U95 D;  4BSZ B;  1QYM A;  4LNU D;  3ZNG A;  3HRA A;  5ENO D;  2VGE A;  2A5E A;  4O1P A;  5EIL A;  5EID A;  5AAR A;  4Z68 A;  2F8X K;  5AAO A;  5ITZ F;  1AWC B;  4JB8 P;  4O60 A;  2RFA A;  3TWV A;  2XEN A;  2Y1L E;  1K1B A;  5AQB A;  1N0R A;  4QFV A;  1MX6 A;  4OAU C;  3UXG A;  3TWW A;  3JXI A;  4CYM D;  5HS0 A;  4GMR A;  4LG6 A;  3W9F A;  2Y0B G;  1BD8 A;  4HRL A;  3DEO A;  4BES A;  5FIN A;  4HLL A;  3NBN B;  3ZKJ A;  2JAB A;  3B95 A;  2ETC A;  3IXE A;  1D9S A;  3UTM A;  2FO1 E;  2L6B A;  3C5R A;  3TWR A;  4ATZ D;  4J8Y A;  1AP7 A;  1DCQ A;  4HQD A;  2DVW A;  3EU9 A;  4QQI A;  4UUC A;  1K1A A;  3EHQ A;  4HRN A;  4U8Y D;  3F6Q A;  3TWT A;  4DX5 D;  5AN8 A;  3V2O A;  4B93 B;  3V79 K;  2BKK B;  5ENT D;  3TWX A;  3EHR A;  2KXP C;  3T9K A;  3LJN A;  4HNA D;  1YCS B;  4RLY A;  1N11 A;  5KNH D;  4ZFH A;  2V4H C;  3AAA C;  3TWU A;  1DC2 A;  1MYO A;  1OT8 A;  2XZT G;  4HBD A;  5HRY A;  3HG0 D;  1S70 B;  1BI8 B;  4J7W A;  4A63 B;  2B0O E;  3SO8 A;  3Q9U C;  4F6R D;  3NOG D;  5BXU A;  3ZU7 B;  1TR4 A;  3V30 A;  3UI2 A;  5EN5 D;  2DZO A;  4HI9 A;  1A5E A;  5CED B;  5KWD A;  1IHB A;  1YYH A;  4C48 B;  1N0Q A;  3AJI A;  5ENP D;  3V2X A;  5CBO A;  4YDY A;  1SVX A;  2DZN A;  3TWS A;  3ZUV B;  2DWZ A;  5CEC B;  4K5C A;  4HB5 A;  4DRX E;  1MX4 A;  2V5Q C;  4TUM A;  2AJA A;  3KEA A;  4K5A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...