3TWUA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 160
sequence length 160
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twuA00
5AQ7A 5ENPD 4CZ2D 5EIBE 4G8LA 3JUEA 2F8XK 4BERA 2L6BA 2V4HC 3JXJA 5D66A 5AN8A 4YDWA 3TWQA 3Q9UC 5AQAA 4O60A 5AARA 1MJ0A 4DX1A 5ENTD 2F8YA 4JB8P 2HE0A 3J5PA 4HB5A 5ITZF 1SW6A 2RFMA 2AJAA 3HRAA 4HLLA 3TWUA 5KWDA 1YCSB 1OY3D 3J5QB 3ZUVB 4BETA 4DRXE 4ATZD 1MYOA 2XZTG 2DZNA 5KNGA 5FINA 1BU9A 1D9SA 1SVXA 2BKGA 1QYMA 4HI9A 3TWRA 3EHQA 3V31A 5CECB 4QFVA 2Y0BG 3V2XA 5CEDB 5AQ9A 4C48B 1IHBA 4J7WA 4N5QA 2XENA 4U95D 5ENSD 2F37A 3SO8A 3F6QA 5EN5D 4HI8A 4RLYA 4K5AB 5AQBA 3V30A 4BESA 5KBAA 4OAUC 3TWSA 2DZOA 5HKPA 4HNAD 1N11A 1YYHA 3DEOA 3T9KA 3ZNGA 2XEHA 2ZGGA 3B95A 4DX7D 1K1AA 3IXEA 4TUMA 4ZHBA 3UI2A 1BD8A 4F1PA 2JABA 1OT8A 5EIDA 1BLXB 4DX2A 1AP7A 5CERB 4LSZE 1MX4A 1K3ZD 2QC9A 2MYOA 5ENRD 2ETAA 4O1OA 3V79K 4NIKA 5BXUA 2J8SD 4OAVB 4UUCA 4U8VD 1IKND 1MX2A 4F6RD 4U8YD 2B0OE 1DCQA 1TR4A 1BI8B 5ENQD 4DX6D 4DUIA 3UXGA 3C5RA 1S70B 4G8KA 2A5EA 3NOGD 3ZU7B 3AAAC 1YMPA 2P2CP 2V5QC 3W9FA 4BEPA 2ETBA 1AWCB 1UOHA 3TWWA 1WDYA 4YDYA 2FO1E 5EYPF 2VGEA 4K5BA 5CEAA 3EU9A 5HS0A 4O1PA 3V2OA 4ZFHA 1BI7B 4A63B 4HRLA 3DEPA 3TWTA 3UTMA 2XZDG 1NFIE 2RFAA 1DC2A 2KBXA 4QQIA 3NBNB 2DWZA 4U96D 1MX6A 1N0QA 3KEAA 3W9GA 3ZKJA 2KXPC 5ENOD 5JMND 5BXOA 4B93B 4BSZB 5JA4D 3EHRA 2Y1LE 2NYJA 4GMRA 4GPMA 2PNNA 5EILA 2DVWA 2QYJA 1IXVA 3HG0D 5HRYA 3NOCD 4LNUD 3D9HA 4CYMD 5EYLA 3AJIA 5CBOA 3JXIA 5AAOA 4LG6A 1K1BA 2ETCA 3LJNA 4HRNA 4HRMB 3T8KA 5KNHD 3TWXA 4Z68A 2ZGDA 3TWVA 2XEEA 3B7BA 1A5EA 1WG0A 4HQDA 4J8YA 4DX5D 5CBNA 5FIOA 4HBDA 1G3NB 3Q9NC 2BKKB 1N0RA 4K5CA
chains in the Genus database with same CATH superfamily
4PS7A 4CZ2D 4GTQA 3CSFA 4BERA 3ENEA 4DPRA 3Q15A 5AARA 4CGVA 5BPPA 2NC9A 1D8DA 2J49A 4FC8A 1OY3D 4FHKA 4KYOB 3E34A 2MOWA 2WQ7A 4X8QA 1N4PA 4JEHA 1OCCE 4L2LA 2ZGGA 3U64A 1FT1A 1MX4A 3NQPA 2FULA 3WXXA 2J8SD 2R05A 1Z3XA 4N39A 1OWPA 2XS1A 3FTYA 2A5EA 5EKQD 5CCMA 2RKKA 3SHFA 3DEPA 5ENNA 3L54A 1NFIE 2RFAA 3UT8A 2F0YA 3DSUA 3L6AA 3UUXA 5D0OD 3E32A 1PY1A 1V55E 3OTNA 5HRYA 2CG3A 5EYLA 4LG6A 2KATA 4HRNA 4WWPA 5BV0A 4H7XA 5E76A 3KAEA 3CVNA 3E33A 2KZTA 5D2MC 4AJWA 5FTPA 5EIBE 1O1SA 4RQIA 1HE8A 3J5PA 1P5QA 1GW6A 2OCCE 2WXNA 4APOA 3IEGA 3ZUVB 5BW8C 2IOSA 2IONA 2AW6A 3G2TA 3CVWA 3Q47B 5G2NA 5CECB 2XGMA 2Y0BG 1N4SA 1OXJA 4C48B 3TAXA 1NA0A 4J8SA 1ELWA 3F6QA 4CT4A 3BU8A 3C72A 1JWGA 4GTVA 4EBAG 2WXQA 5T8IA 3DRAA 4DLQA 3FUHA 3L13A 1NZNA 4CGWA 2IU1A 4U8VD 4FLBA 3S7FA 3UXGA 4UI9K 4K03A 2X3MA 5FZRA 4XKBA 1QZ2A 3GW4A 1FVHA 3EU9A 5HS0A 4ZFHA 3U66A 1BI7B 1TN7A 2X6KA 4MBGA 3NBNB 4ANXA 2Y4UA 5JMND 2OV8A 3U4TA 4J6IA 4BT9A 3ASDA 3CQGB 1HX8A 4HRMB 4Z68A 3TWVA 2VSNA 2L0TB 5AQ7A 4HOSA 4A3VA 3ONKA 1LTXA 1K8KG 4RG6A 2IFUA 4GTOA 2DYSE 1KZOA 3EHQA 3V31A 4A55A 3OXLA 3PNLB 4KZCA 1IHBA 4N5QA 2XENA 4UWGA 2J9QA 3UMVA 2F37A 2GRPB 5EN5D 3SBSA 4ILIA 1N11A 3ZNGA 1E96B 3Q7FA 4AM9A 4GCOA 3LXUX 4WAFA 3R9MA 1K3ZD 3RU0A 4JXTA 3CK9A 3MKRA 3AU5A 3D9NA 4F6RD 4HLEA 1MHQA 5ENQD 3AG4E 2LAIA 1AWCB 1TJFA 2BF0X 5CEAA 4N5CA 1DC2A 3UT7A 5JJ6A 4JHRA 4B0ZA 3KEAA 2A4ZA 1X81A 1N4QA 3TGOA 3CVLA 1HG5A 3LCAA 2ETCA 4LNGA 2MHKA 4I6GA 3T8KA 4IULA 5KNHD 4JVSA 1WG0A 4U7EB 1N54A 2KCVA 4K5CA 4ILHB 2F8XK 4DJAA 3CVUA 5FQ8A 4FJYA 3S2AA 2R03A 2P58C 3HVEA 2WVIA 3CR3A 1FCHA 3APFA 1ZB1A 3LYAA 4CDMA 2WXPA 4ILGA 3EHMA 2LAHA 4QFVA 1A17A 4P29A 5KJLA 3ZHEB 3X2QE 4UWHA 5KBAA 4J8FA 4YNDA 3V30A 3FU6A 4U0ZA 2C0MA 3D9LA 3UIOC 4FA6A 3DEOA 4EZJA 1K1AA 3L17A 4L23A 4F1PA 2MYOA 3O4ZA 3QOUA 2ETAA 2XPYA 4CRWA 4U8YD 3B7RL 3CV0A 2CFZA 4XZ4A 4WUYA 4LUNU 2IO2C 4APFA 1EF1C 2ETBA 4Q69A 4TXPA 3LVRE 4O1PA 4ANUA 1VDYA 3AG3E 3UX4A 3OXFA 4YVQC 4U96D 2L6JA 1E8WA 4XX5A 1OWNA 3VLDA 5EX0A 4HXIA 4HFGA 2PNNA 5BUZA 5AAOA 1KPSB 4ATGA 3FTVA 2YINA 3QAQA 1DCEA 4Q96A 1IQRA 4FHJA 3E30A 4L1BA 2UY1B 3R7RA 3DPDA 3UM3A 3ZXPA 1Y8MA 3D9IA 2LSVA 2M63A 4ATZD 2L0IA 2DZNA 3SI5A 3FUFA 3TWRA 3FTUA 2WXGA 4TUUA 3V2XA 3CQCB 3DXKG 2VJ8A 3U3WA 2PQRA 4IRUA 5G04J 3T8MA 2P9NG 2NSZA 3MV2B 4XKCA 4GZ6A 2FF4A 2H6HA 3UPVA 1OCZE 3AS4A 4J8EA 4KXKB 3G2VA 2B0OE 4NRHB 3G2WA 5AIJA 4BEPA 1QQEA 3W9FA 2WQ6A 5B3SE 3UM0A 4K5BA 3R9AB 2LUHA 3CHMA 4PS8A 3W9GA 4F53A 5ENOD 1JCQA 1H6OA 3CKCA 1FVFA 5JA4D 2HO1A 4HOQA 4CT0A 3DSSA 5CCLA 5CBNA 3PUKA 1SA4A 3PZ1A 3CK8A 2WXMA 2L6BA 2IOLA 1S63A 3Q9UC 2KCLA 5ANRA 2RFMA 4HLLA 2X6HA 3SD5A 1MYOA 2QZAA 5C1DA 3ABKE 4U04A 4I1MA 1BU9A 2JLBA 1D9SA 4F7AA 5KJMA 4J7WA 5ENSD 4HI8A 4YDOA 2WB2A 2WXOA 2P9IG 4LCTA 4FJZA 2XGSA 1TNOA 4TUMA 3LS8A 4U0UA 3BG0B 3EU5A 5CRUA 2X6IA 4JC8A 3TG5A 3DWLG 2XCCA 3WG7E 4BTAA 3IBEA 3QC1A 1TR4A 3PDNA 1X5BA 1S70B 2FBNA 2XPIA 2R59A 3ZVVA 2FEZA 1INZA 5A7DB 3CGHA 3UTMA 5DBKA 3ZXSA 1Y6IA 2GROB 2CFUA 1MX6A 5BNWA 2IF4A 2X38A 4HS2A 3IKOB 3LY8A 1IXVA 2BUGA 1E90A 3FUJA 1D8EA 2FO7A 4DX5D 5FIOA 5A23A 3URZA 5BT1A 2A5UA 4EZLA 4JEUA 5BV1A 5B1AE 1HU3A 3SFYA 4GYYA 3FUKA 3ZEFA 3ZYKA 3FHEA 5JJ7A 3O48A 5ITZF 1LF8A 1Q2ZA 3DSVA 1UN9A 3NAWA 1UJJA 4GZ5A 3VTYA 3QDNA 1UW4B 2FI7A 2XRYA 2BKGA 3ML8A 3RIBA 3Q79A 3AG1E 2PQNA 3HXFA 4FADA 3CHQA 1OWLA 4K5AB 5G04C 3JQ0A 1IYGA 3HXDA 4GTRA 3QWVA 5JHBA 3PZ3A 5CERB 2YHCA 3KSQA 3Q7AA 2I6HA 5KJKA 4EHMA 3IV0A 4AP2A 4EZKA 1U3DA 3CHPA 4JD2G 4E6HA 1N52A 3LVQE 4OYSA 1E8YA 2V5QC 3TWWA 3CEQA 2CG2A 2XZDG 4F3VA 2RG8A 4G11A 4GYOA 5FT9A 3QK0A 4IYPA 2KXPC 3CSTA 3LY9A 2KZTB 2PL2A 3FUDA 3LY7A 3ULEG 3UKRG 3D9HA 4CYMD 2X6FA 2IO3C 1QBQA 5AJLA 4GZ3A 1HZ4A 2ZGDA 3JQ1A 1ZBPA 4HBDA 3KEZA 2XQ0A 4ACLA 3IHVA 3S7JA 1O1RA 3TJPA 2H6IA 3CVQA 3LPZA 1FPPA 3TXNA 5AQAA 2IEJA 4HB5A 3NZSA 3TWUA 5KWDA 4FULA 4RG9A 4F1SA 4JHJA 3CHRA 4GTSA 1TN8A 3OAWA 3FU3A 1JUQA 3Q5MA 5FQ7A 4U95D 2WXIA 3BG1B 4G23A 3SQVA 1XGWA 2XEHA 4GCNA 3UI2A 1OT8A 4AY6A 4WWOA 2EIJE 4LEUA 3RRMB 2VGXA 1TNYA 2WM9A 4R7LA 5LP0A 3C5RA 3ULYA 3DSTA 3FY4A 5J08A 5JHAA 3PS6A 2WQHA 1SZ9A 3GYZA 3PEVB 1TJCA 3V2OA 4NACA 4NURA 4PUCA 2QY7A 1N0QA 1TEZA 4U07A 4B93B 3EHRA 4BWRA 3MJWA 3BUAA 3AJIA 3PZ4A 1K1BA 5JJTA 3PRZA 3C3QA 3PZ2A 3MA5A 1H19A 2VTBA 3S7DA 5G55A 3ISMC 3Q73A 5FZQA 4ME2A 1Z5SC 1MJ0A 1B89A 3RKVA 2CHZA 2LXLA 4M7CA 3CHSA 3SGHA 3BEEA 3MGBA 3LDZA 3UIPC 4GA1A 1SA5A 3FULA 3Q49B 3FUIA 1JPLA 3SO8A 5AQBA 3C3RA 3TWSA 4I2WA 4GYWA 3FH5A 5HKPA 1YYHA 3HXEA 3B95A 2DBAA 5CMYA 1BD8A 3QNKA 5J90A 4GA0A 1OUVA 2H6GA 3PREA 4V3IA 3TL5A 3CVVA 4B89A 3AG2E 3L08A 3SY2A 1HFAA 1DCQA 2VYIA 4DUIA 3VLEA 1YA0A 4JHKA 1OWOA 2AXZA 2NXPA 4L2YA 2XRZA 2VGEA 4G25A 3UQ3A 4LRZA 2DYRE 3L82A 5EDSA 4EBAA 4BT8A 4UWFA 1WM5A 4JL0A 1RZ4A 2DWZA 2WMOA 3LKUA 5LOZA 5C2YA 2VSOE 5BXOA 5E75A 2X6JA 3MZLB 4ANVA 5LX8A 3JXIA 3NB2A 2XCBA 3APCA 3HVEB 3ASFA 3ZRHA 2DCPA 1WAO1 2XEVA 3D9JA 4BY6A 4YDEA 4I9EA 3T5VA 4HORA 1O5MA 4G8LA 1KT0A 2I2OA 2XGOA 2BTDA 3JYSA 4WNGA 2F8YA 5M72A 4I17A 3EDTB 2V5FA 4DK5A 4U0SA 3I3NA 2C2LA 3MKQA 2Y4TA 3PE3A 4MRUA 1H0AA 3PVLA 4PS3A 1L5JA 4NQ0A 3B13A 4HI9A 5CRVA 1WY6A 4CDNA 3LEWA 5HQ8A 1U2VG 2OEWA 1H6KA 4I1AA 4RVBA 3Q78A 4ACKA 2UWJG 2QC9A 4AV7A 3FUNA 2HR2A 3ASHA 5LFAA 1EYHA 3ULQA 2I9CA 1Z3YA 3Q75A 4KT6B 3ZYQA 1HF8A 3ZU7B 3B7SA 3CKBA 1HH8A 3MYVA 2E0IA 3UT4A 3SNXA 2P9UG 3HXBA 3FU0A 3D9KA 4WNEA 1KLXA 4XIFA 1HS6A 3JUIA 4GZDA 2DVWA 4LNUD 5CBOA 3B7BA 5FQ6A 5G05J 2R17C 2HM8A 3CVYA 3QJZA 2BKKB 3RK6A 3HDXA 3EIJA 3JUEA 3QARA 4MLPA 4XI0A 3KSLA 3CLJA 4JB8P 2HE0A 3ZGQA 3BQOA 4J0UA 4MS6A 3QKYA 3PUJA 3EHNA 2MRIA 1SVXA 2WXKA 2XHEA 3ZN3A 1DNPA 2YQ8A 2EIME 2OVFA 1TNUA 4TRQA 2E2EA 3FEXA 3HXCA 4AXHA 4PDXA 3PNTB 2XPZA 4HNAD 1TNBA 1TNZA 1JCRA 3ML9A 1ELRA 4DX7D 1XNFA 3UM1A 1BLXB 3ASGA 2V8SE 4A3TA 2OVBA 3PE4A 2LXMA 3CVXA 5BXUA 4UUCA 2PZIA 3AAAC 3FTSA 5EYPF 1OCOE 1MZCA 2YNQA 1PAQA 2AVPA 3QWWA 2OEVA 3TWTA 4GAAA 1UN8A 2J4DA 1EPUA 4XEIG 4PH4B 2Y1LE 5EILA 5B1BE 4GMJA 3DBSA 3LJNA 3D3MA 4HOTA 4J8YA 1RW2A 3I4RB 4YVOA 1N4RA 1JCSA 2VQ2A 5LCWJ 3L16A 1N0RA 4BX8A 2WMNA 2J08A 1MQSA 4I6JA 2GRRB 4AY5A 3E37A 3TWQA 4DX1A 5FZSA 5ENTD 2HYZA 3TXMA 3K9IA 4I1OB 4WNFA 2AXVA 2AJAA 3ASOE 4GTTA 5EX3A 4KVMA 3FP3A 2XZTG 3HHMA 2EIKE 4N2QA 1QYMA 3EIQC 5KJNA 4UI9J 5CEDB 1LD7A 3EJNA 1N9AA 4RLYA 5A6CA 3FDHA 2JEKA 3IXEA 1H6PA 4DLOA 2OOEA 1AP7A 1W3BA 4WWNA 2VSXE 4N3CA 5ENRD 4O1OA 2WPVA 4G2VA 3RRNB 3GZ2A 4DI3A 2WXFA 4GU5A 3DSXA 1N94A 2R2LA 5D0QD 2GGFA 3FWVA 4URKA 3NOGD 4GTMA 2P9KG 2P9SG 3DSWA 2FO1E 1UG3A 1SZAA 2EQXA 4G1TA 2QYJA 4UQYA 5HI7A 4GPKA 4EECA 3B7TA 1NP7A 2AWIA 3D9MA 3N71A 2XEEA 5G05C 4EQFA 3R7QA 2Y69E 3JXJA 4ABNA 2LSUA 1OWMA 3E4BA 4CCAA 4TXRA 2WXHA 4C0EA 4AEZC 5FQ4A 3TG4A 1JWFA 3T5XA 4Y6WA 3Q4AB 5AQ9A 3RSEG 4I2ZA 4BSXA 2P9LG 4BX9A 3C98A 2DZOA 5T3RA 4JZYA 3T9KA 2YHEA 4GB9A 2V4LA 3NZUA 5ARFA 4AIFA 4GTPA 5AENA 2VGYA 1KT1A 1NL4A 1E8ZA 5T4YA 4JW1A 3GZ1A 3FH7A 3QB2A 1BI8B 3HYMB 4BTBA 4DX6D 3UKUG 2IJGX 1SQMA 1YMPA 2DIWA 3JCKC 5CMWA 1UOHA 2RD0A 3EUVA 4B94A 4WNDA 3ZYLA 3CK7A 4HRLA 2KM4A 2PM7A 4QQIA 1PC2A 1TYQG 3AS5A 4LNBA 4FLHA 3FTZA 3SFZA 2BEDA 3NOCD 4AOFA 3KD7A 1E7VA 3DPYA 3RO2A 3HIZA 2IY0C 3Q9NC 3ONLA 2C0LA 5LCWC 1HXIA 4DI4A 1E7UA 3G2SA 3VLFA 4KZ0A 4HVBA 4UQZA 2EINE 3I4GA 4RSYA 5D66A 3SZ7A 5AN8A 3PH0C 4O60A 4M3OA 2V0PA 1SW6A 3PZDA 1YCSB 4BETA 2J07A 2QYUA 3RO3A 4UWLA 3VTXA 4UI9C 3FH8A 4N3AA 2VGXB 5IY5E 3L9TA 1H2VC 4TXQA 1EDUA 2L9BA 4Y6CA 4DX2A 4LSZE 3ASNE 4LERA 2GRLA 5AJDA 3V79K 3RAUA 3ZHEA 3SF4A 3MV3B 4OAVB 1U3CA 1H2TC 1IKND 2IQCA 4L7TA 4BFRA 2WXLA 4G8KA 3ZIMA 2P2CP 3ZW3A 2WXJA 1NI1A 3ABLE 4ANWA 1ELKA 2AXUA 1NA3A 3FTWA 3DXMG 5DIZA 1DVPA 2VTBB 3MEKA 4A1GA 4BSZB 4I9CA 4GMRA 4GPMA 4UWKA 5ANLA 3CHOA 2GRQB 5AYWD 2P9PG 3QWPA 4G26A 4EPZA 3FU5A 3TWXA 4HQDA 4AVXA 2J4BA 2KC7A 3FUMA 1G3NB 4C9BB 3AU4A 2ILRA 5FWQA 4U63A 3MX3A 2ZU6B 4FP7A 2ZIRA 1HO8A 3CVPA 2GRNB 4KVOA 4N3BA 3FFLA 4DRXE 1S64A 5KNGA 5FINA 3MCXA 2LO6A 3CIAA 4CDRA 2UY1A 3L22A 2KCKA 3FEYA 4O6FA 4OVVA 4BESA 3PEUB 4C0MA 4N2SA 2I1KA 4ZHBA 5EIDA 1TN6A 4W9RA 2CHWA 3G2UA 3OXGA 3NF1A 4B8AA 4XE0A 4UQXA 4Q94A 5CHEE 3IHYA 3P1UA 2J09A 2QFCA 2Q7FA 2CHXA 2LNIA 4L9PA 1FT2A 4YDYA 3ESLA 4I6EA 3S7BA 3AS8A 5KCMA 2VSYA 4MKTA 2WXRA 3ZKJA 3LJ3A 3HG0D 1IQUA 1LD8A 4A1SA 2PM6A 4CEMA 3SFXA 4D10C 3B7UX 4G24A 1A5EA 3FTXA 3MKQB 5ENPD 3C3OA 3RRUA 4H7YA 3D9OA 2ZISA 2GW1A 4GMLA 2EILE 3SBTB 3ZFWA 2V4HC 4YDWA 1UJKA 2Y3AA 1ZU2A 3GZSA 2GRMA 2ONDA 3HRAA 3ZYMA 2ZXWE 3J5QB 4IN3B 2XS8A 4GA2A 4JA9A 4JA7A 2R5SA 3ZPJA 3ABME 1O1TA 3RJVA 3D9PA 4OAUC 5H7PA 2R02A 1V54E 2I1JA 4GZCA 2JABA 1E8XA 2H6FA 4TV3A 3I5PA 3FUEA 4NIKA 1MX2A 3APDA 3UM2A 1QNFA 3U9WA 1Z6TA 5ARGA 5FJYA 4I43A 1BPOA 1IHGA 1KZPA 3UINC 3ESKA 4J8DA 1WDYA 4KBQA 4HOUA 2B6CA 4KMOA 4A63B 4XI9A 4U8HA 1H2UA 2KBXA 1N95A 1S0PA 1HG2A 4JPSA 4K0RA 1OCRE 3P2BA 2NYJA 4FU3A 4OVUA 3KS2A 4B8CB 4E85A
chains in the Genus database with same CATH topology
5AQ7A 5ENPD 4CZ2D 5EIBE 4G8LA 3JUEA 2F8XK 4BERA 2L6BA 2V4HC 3JXJA 5D66A 5AN8A 4YDWA 3TWQA 3Q9UC 5AQAA 4O60A 5AARA 1MJ0A 4DX1A 5ENTD 2F8YA 4JB8P 2HE0A 3J5PA 4HB5A 5ITZF 1SW6A 2RFMA 2AJAA 3HRAA 4HLLA 3TWUA 5KWDA 1YCSB 1OY3D 3J5QB 3ZUVB 4BETA 4DRXE 4ATZD 1MYOA 2XZTG 2DZNA 5KNGA 5FINA 1BU9A 1D9SA 1SVXA 2BKGA 1QYMA 4HI9A 3TWRA 3EHQA 3V31A 5CECB 4QFVA 2Y0BG 3V2XA 5CEDB 5AQ9A 4C48B 1IHBA 4J7WA 4N5QA 2XENA 4U95D 5ENSD 2F37A 3SO8A 3F6QA 5EN5D 4HI8A 4RLYA 4K5AB 5AQBA 3V30A 4BESA 5KBAA 4OAUC 3TWSA 2DZOA 5HKPA 4HNAD 1N11A 1YYHA 3DEOA 3T9KA 3ZNGA 2XEHA 2ZGGA 3B95A 4DX7D 1K1AA 3IXEA 4TUMA 4ZHBA 3UI2A 1BD8A 4F1PA 2JABA 1OT8A 5EIDA 1BLXB 4DX2A 1AP7A 5CERB 4LSZE 1MX4A 1K3ZD 2QC9A 2MYOA 5ENRD 2ETAA 4O1OA 3V79K 4NIKA 5BXUA 2J8SD 4OAVB 4UUCA 4U8VD 1IKND 1MX2A 4F6RD 4U8YD 2B0OE 1DCQA 1TR4A 1BI8B 5ENQD 4DX6D 4DUIA 3UXGA 3C5RA 1S70B 4G8KA 2A5EA 3NOGD 3ZU7B 3AAAC 1YMPA 2P2CP 2V5QC 3W9FA 4BEPA 2ETBA 1AWCB 1UOHA 3TWWA 1WDYA 4YDYA 2FO1E 5EYPF 2VGEA 4K5BA 5CEAA 3EU9A 5HS0A 4O1PA 3V2OA 4ZFHA 1BI7B 4A63B 4HRLA 3DEPA 3TWTA 3UTMA 2XZDG 1NFIE 2RFAA 1DC2A 2KBXA 4QQIA 3NBNB 2DWZA 4U96D 1MX6A 1N0QA 3KEAA 3W9GA 3ZKJA 2KXPC 5ENOD 5JMND 5BXOA 4B93B 4BSZB 5JA4D 3EHRA 2Y1LE 2NYJA 4GMRA 4GPMA 2PNNA 5EILA 2DVWA 2QYJA 1IXVA 3HG0D 5HRYA 3NOCD 4LNUD 3D9HA 4CYMD 5EYLA 3AJIA 5CBOA 3JXIA 5AAOA 4LG6A 1K1BA 2ETCA 3LJNA 4HRNA 4HRMB 3T8KA 5KNHD 3TWXA 4Z68A 2ZGDA 3TWVA 2XEEA 3B7BA 1A5EA 1WG0A 4HQDA 4J8YA 4DX5D 5CBNA 5FIOA 4HBDA 1G3NB 3Q9NC 2BKKB 1N0RA 4K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQ7 A;  5ENP D;  4CZ2 D;  5EIB E;  4G8L A;  3JUE A;  2F8X K;  4BER A;  2L6B A;  2V4H C;  3JXJ A;  5D66 A;  5AN8 A;  4YDW A;  3TWQ A;  3Q9U C;  5AQA A;  4O60 A;  5AAR A;  1MJ0 A;  4DX1 A;  5ENT D;  2F8Y A;  4JB8 P;  2HE0 A;  3J5P A;  4HB5 A;  5ITZ F;  1SW6 A;  2RFM A;  2AJA A;  3HRA A;  4HLL A;  3TWU A;  5KWD A;  1YCS B;  1OY3 D;  3J5Q B;  3ZUV B;  4BET A;  4DRX E;  4ATZ D;  1MYO A;  2XZT G;  2DZN A;  5KNG A;  5FIN A;  1BU9 A;  1D9S A;  1SVX A;  2BKG A;  1QYM A;  4HI9 A;  3TWR A;  3EHQ A;  3V31 A;  5CEC B;  4QFV A;  2Y0B G;  3V2X A;  5CED B;  5AQ9 A;  4C48 B;  1IHB A;  4J7W A;  4N5Q A;  2XEN A;  4U95 D;  5ENS D;  2F37 A;  3SO8 A;  3F6Q A;  5EN5 D;  4HI8 A;  4RLY A;  4K5A B;  5AQB A;  3V30 A;  4BES A;  5KBA A;  4OAU C;  3TWS A;  2DZO A;  5HKP A;  4HNA D;  1N11 A;  1YYH A;  3DEO A;  3T9K A;  3ZNG A;  2XEH A;  2ZGG A;  3B95 A;  4DX7 D;  1K1A A;  3IXE A;  4TUM A;  4ZHB A;  3UI2 A;  1BD8 A;  4F1P A;  2JAB A;  1OT8 A;  5EID A;  1BLX B;  4DX2 A;  1AP7 A;  5CER B;  4LSZ E;  1MX4 A;  1K3Z D;  2QC9 A;  2MYO A;  5ENR D;  2ETA A;  4O1O A;  3V79 K;  4NIK A;  5BXU A;  2J8S D;  4OAV B;  4UUC A;  4U8V D;  1IKN D;  1MX2 A;  4F6R D;  4U8Y D;  2B0O E;  1DCQ A;  1TR4 A;  1BI8 B;  5ENQ D;  4DX6 D;  4DUI A;  3UXG A;  3C5R A;  1S70 B;  4G8K A;  2A5E A;  3NOG D;  3ZU7 B;  3AAA C;  1YMP A;  2P2C P;  2V5Q C;  3W9F A;  4BEP A;  2ETB A;  1AWC B;  1UOH A;  3TWW A;  1WDY A;  4YDY A;  2FO1 E;  5EYP F;  2VGE A;  4K5B A;  5CEA A;  3EU9 A;  5HS0 A;  4O1P A;  3V2O A;  4ZFH A;  1BI7 B;  4A63 B;  4HRL A;  3DEP A;  3TWT A;  3UTM A;  2XZD G;  1NFI E;  2RFA A;  1DC2 A;  2KBX A;  4QQI A;  3NBN B;  2DWZ A;  4U96 D;  1MX6 A;  1N0Q A;  3KEA A;  3W9G A;  3ZKJ A;  2KXP C;  5ENO D;  5JMN D;  5BXO A;  4B93 B;  4BSZ B;  5JA4 D;  3EHR A;  2Y1L E;  2NYJ A;  4GMR A;  4GPM A;  2PNN A;  5EIL A;  2DVW A;  2QYJ A;  1IXV A;  3HG0 D;  5HRY A;  3NOC D;  4LNU D;  3D9H A;  4CYM D;  5EYL A;  3AJI A;  5CBO A;  3JXI A;  5AAO A;  4LG6 A;  1K1B A;  2ETC A;  3LJN A;  4HRN A;  4HRM B;  3T8K A;  5KNH D;  3TWX A;  4Z68 A;  2ZGD A;  3TWV A;  2XEE A;  3B7B A;  1A5E A;  1WG0 A;  4HQD A;  4J8Y A;  4DX5 D;  5CBN A;  5FIO A;  4HBD A;  1G3N B;  3Q9N C;  2BKK B;  1N0R A;  4K5C A; 
#chains in the Genus database with same CATH topology
 4PS7 A;  4CZ2 D;  4GTQ A;  3CSF A;  4BER A;  3ENE A;  4DPR A;  3Q15 A;  5AAR A;  4CGV A;  5BPP A;  2NC9 A;  1D8D A;  2J49 A;  4FC8 A;  1OY3 D;  4FHK A;  4KYO B;  3E34 A;  2MOW A;  2WQ7 A;  4X8Q A;  1N4P A;  4JEH A;  1OCC E;  4L2L A;  2ZGG A;  3U64 A;  1FT1 A;  1MX4 A;  3NQP A;  2FUL A;  3WXX A;  2J8S D;  2R05 A;  1Z3X A;  4N39 A;  1OWP A;  2XS1 A;  3FTY A;  2A5E A;  5EKQ D;  5CCM A;  2RKK A;  3SHF A;  3DEP A;  5ENN A;  3L54 A;  1NFI E;  2RFA A;  3UT8 A;  2F0Y A;  3DSU A;  3L6A A;  3UUX A;  5D0O D;  3E32 A;  1PY1 A;  1V55 E;  3OTN A;  5HRY A;  2CG3 A;  5EYL A;  4LG6 A;  2KAT A;  4HRN A;  4WWP A;  5BV0 A;  4H7X A;  5E76 A;  3KAE A;  3CVN A;  3E33 A;  2KZT A;  5D2M C;  4AJW A;  5FTP A;  5EIB E;  1O1S A;  4RQI A;  1HE8 A;  3J5P A;  1P5Q A;  1GW6 A;  2OCC E;  2WXN A;  4APO A;  3IEG A;  3ZUV B;  5BW8 C;  2IOS A;  2ION A;  2AW6 A;  3G2T A;  3CVW A;  3Q47 B;  5G2N A;  5CEC B;  2XGM A;  2Y0B G;  1N4S A;  1OXJ A;  4C48 B;  3TAX A;  1NA0 A;  4J8S A;  1ELW A;  3F6Q A;  4CT4 A;  3BU8 A;  3C72 A;  1JWG A;  4GTV A;  4EBA G;  2WXQ A;  5T8I A;  3DRA A;  4DLQ A;  3FUH A;  3L13 A;  1NZN A;  4CGW A;  2IU1 A;  4U8V D;  4FLB A;  3S7F A;  3UXG A;  4UI9 K;  4K03 A;  2X3M A;  5FZR A;  4XKB A;  1QZ2 A;  3GW4 A;  1FVH A;  3EU9 A;  5HS0 A;  4ZFH A;  3U66 A;  1BI7 B;  1TN7 A;  2X6K A;  4MBG A;  3NBN B;  4ANX A;  2Y4U A;  5JMN D;  2OV8 A;  3U4T A;  4J6I A;  4BT9 A;  3ASD A;  3CQG B;  1HX8 A;  4HRM B;  4Z68 A;  3TWV A;  2VSN A;  2L0T B;  5AQ7 A;  4HOS A;  4A3V A;  3ONK A;  1LTX A;  1K8K G;  4RG6 A;  2IFU A;  4GTO A;  2DYS E;  1KZO A;  3EHQ A;  3V31 A;  4A55 A;  3OXL A;  3PNL B;  4KZC A;  1IHB A;  4N5Q A;  2XEN A;  4UWG A;  2J9Q A;  3UMV A;  2F37 A;  2GRP B;  5EN5 D;  3SBS A;  4ILI A;  1N11 A;  3ZNG A;  1E96 B;  3Q7F A;  4AM9 A;  4GCO A;  3LXU X;  4WAF A;  3R9M A;  1K3Z D;  3RU0 A;  4JXT A;  3CK9 A;  3MKR A;  3AU5 A;  3D9N A;  4F6R D;  4HLE A;  1MHQ A;  5ENQ D;  3AG4 E;  2LAI A;  1AWC B;  1TJF A;  2BF0 X;  5CEA A;  4N5C A;  1DC2 A;  3UT7 A;  5JJ6 A;  4JHR A;  4B0Z A;  3KEA A;  2A4Z A;  1X81 A;  1N4Q A;  3TGO A;  3CVL A;  1HG5 A;  3LCA A;  2ETC A;  4LNG A;  2MHK A;  4I6G A;  3T8K A;  4IUL A;  5KNH D;  4JVS A;  1WG0 A;  4U7E B;  1N54 A;  2KCV A;  4K5C A;  4ILH B;  2F8X K;  4DJA A;  3CVU A;  5FQ8 A;  4FJY A;  3S2A A;  2R03 A;  2P58 C;  3HVE A;  2WVI A;  3CR3 A;  1FCH A;  3APF A;  1ZB1 A;  3LYA A;  4CDM A;  2WXP A;  4ILG A;  3EHM A;  2LAH A;  4QFV A;  1A17 A;  4P29 A;  5KJL A;  3ZHE B;  3X2Q E;  4UWH A;  5KBA A;  4J8F A;  4YND A;  3V30 A;  3FU6 A;  4U0Z A;  2C0M A;  3D9L A;  3UIO C;  4FA6 A;  3DEO A;  4EZJ A;  1K1A A;  3L17 A;  4L23 A;  4F1P A;  2MYO A;  3O4Z A;  3QOU A;  2ETA A;  2XPY A;  4CRW A;  4U8Y D;  3B7R L;  3CV0 A;  2CFZ A;  4XZ4 A;  4WUY A;  4LUN U;  2IO2 C;  4APF A;  1EF1 C;  2ETB A;  4Q69 A;  4TXP A;  3LVR E;  4O1P A;  4ANU A;  1VDY A;  3AG3 E;  3UX4 A;  3OXF A;  4YVQ C;  4U96 D;  2L6J A;  1E8W A;  4XX5 A;  1OWN A;  3VLD A;  5EX0 A;  4HXI A;  4HFG A;  2PNN A;  5BUZ A;  5AAO A;  1KPS B;  4ATG A;  3FTV A;  2YIN A;  3QAQ A;  1DCE A;  4Q96 A;  1IQR A;  4FHJ A;  3E30 A;  4L1B A;  2UY1 B;  3R7R A;  3DPD A;  3UM3 A;  3ZXP A;  1Y8M A;  3D9I A;  2LSV A;  2M63 A;  4ATZ D;  2L0I A;  2DZN A;  3SI5 A;  3FUF A;  3TWR A;  3FTU A;  2WXG A;  4TUU A;  3V2X A;  3CQC B;  3DXK G;  2VJ8 A;  3U3W A;  2PQR A;  4IRU A;  5G04 J;  3T8M A;  2P9N G;  2NSZ A;  3MV2 B;  4XKC A;  4GZ6 A;  2FF4 A;  2H6H A;  3UPV A;  1OCZ E;  3AS4 A;  4J8E A;  4KXK B;  3G2V A;  2B0O E;  4NRH B;  3G2W A;  5AIJ A;  4BEP A;  1QQE A;  3W9F A;  2WQ6 A;  5B3S E;  3UM0 A;  4K5B A;  3R9A B;  2LUH A;  3CHM A;  4PS8 A;  3W9G A;  4F53 A;  5ENO D;  1JCQ A;  1H6O A;  3CKC A;  1FVF A;  5JA4 D;  2HO1 A;  4HOQ A;  4CT0 A;  3DSS A;  5CCL A;  5CBN A;  3PUK A;  1SA4 A;  3PZ1 A;  3CK8 A;  2WXM A;  2L6B A;  2IOL A;  1S63 A;  3Q9U C;  2KCL A;  5ANR A;  2RFM A;  4HLL A;  2X6H A;  3SD5 A;  1MYO A;  2QZA A;  5C1D A;  3ABK E;  4U04 A;  4I1M A;  1BU9 A;  2JLB A;  1D9S A;  4F7A A;  5KJM A;  4J7W A;  5ENS D;  4HI8 A;  4YDO A;  2WB2 A;  2WXO A;  2P9I G;  4LCT A;  4FJZ A;  2XGS A;  1TNO A;  4TUM A;  3LS8 A;  4U0U A;  3BG0 B;  3EU5 A;  5CRU A;  2X6I A;  4JC8 A;  3TG5 A;  3DWL G;  2XCC A;  3WG7 E;  4BTA A;  3IBE A;  3QC1 A;  1TR4 A;  3PDN A;  1X5B A;  1S70 B;  2FBN A;  2XPI A;  2R59 A;  3ZVV A;  2FEZ A;  1INZ A;  5A7D B;  3CGH A;  3UTM A;  5DBK A;  3ZXS A;  1Y6I A;  2GRO B;  2CFU A;  1MX6 A;  5BNW A;  2IF4 A;  2X38 A;  4HS2 A;  3IKO B;  3LY8 A;  1IXV A;  2BUG A;  1E90 A;  3FUJ A;  1D8E A;  2FO7 A;  4DX5 D;  5FIO A;  5A23 A;  3URZ A;  5BT1 A;  2A5U A;  4EZL A;  4JEU A;  5BV1 A;  5B1A E;  1HU3 A;  3SFY A;  4GYY A;  3FUK A;  3ZEF A;  3ZYK A;  3FHE A;  5JJ7 A;  3O48 A;  5ITZ F;  1LF8 A;  1Q2Z A;  3DSV A;  1UN9 A;  3NAW A;  1UJJ A;  4GZ5 A;  3VTY A;  3QDN A;  1UW4 B;  2FI7 A;  2XRY A;  2BKG A;  3ML8 A;  3RIB A;  3Q79 A;  3AG1 E;  2PQN A;  3HXF A;  4FAD A;  3CHQ A;  1OWL A;  4K5A B;  5G04 C;  3JQ0 A;  1IYG A;  3HXD A;  4GTR A;  3QWV A;  5JHB A;  3PZ3 A;  5CER B;  2YHC A;  3KSQ A;  3Q7A A;  2I6H A;  5KJK A;  4EHM A;  3IV0 A;  4AP2 A;  4EZK A;  1U3D A;  3CHP A;  4JD2 G;  4E6H A;  1N52 A;  3LVQ E;  4OYS A;  1E8Y A;  2V5Q C;  3TWW A;  3CEQ A;  2CG2 A;  2XZD G;  4F3V A;  2RG8 A;  4G11 A;  4GYO A;  5FT9 A;  3QK0 A;  4IYP A;  2KXP C;  3CST A;  3LY9 A;  2KZT B;  2PL2 A;  3FUD A;  3LY7 A;  3ULE G;  3UKR G;  3D9H A;  4CYM D;  2X6F A;  2IO3 C;  1QBQ A;  5AJL A;  4GZ3 A;  1HZ4 A;  2ZGD A;  3JQ1 A;  1ZBP A;  4HBD A;  3KEZ A;  2XQ0 A;  4ACL A;  3IHV A;  3S7J A;  1O1R A;  3TJP A;  2H6I A;  3CVQ A;  3LPZ A;  1FPP A;  3TXN A;  5AQA A;  2IEJ A;  4HB5 A;  3NZS A;  3TWU A;  5KWD A;  4FUL A;  4RG9 A;  4F1S A;  4JHJ A;  3CHR A;  4GTS A;  1TN8 A;  3OAW A;  3FU3 A;  1JUQ A;  3Q5M A;  5FQ7 A;  4U95 D;  2WXI A;  3BG1 B;  4G23 A;  3SQV A;  1XGW A;  2XEH A;  4GCN A;  3UI2 A;  1OT8 A;  4AY6 A;  4WWO A;  2EIJ E;  4LEU A;  3RRM B;  2VGX A;  1TNY A;  2WM9 A;  4R7L A;  5LP0 A;  3C5R A;  3ULY A;  3DST A;  3FY4 A;  5J08 A;  5JHA A;  3PS6 A;  2WQH A;  1SZ9 A;  3GYZ A;  3PEV B;  1TJC A;  3V2O A;  4NAC A;  4NUR A;  4PUC A;  2QY7 A;  1N0Q A;  1TEZ A;  4U07 A;  4B93 B;  3EHR A;  4BWR A;  3MJW A;  3BUA A;  3AJI A;  3PZ4 A;  1K1B A;  5JJT A;  3PRZ A;  3C3Q A;  3PZ2 A;  3MA5 A;  1H19 A;  2VTB A;  3S7D A;  5G55 A;  3ISM C;  3Q73 A;  5FZQ A;  4ME2 A;  1Z5S C;  1MJ0 A;  1B89 A;  3RKV A;  2CHZ A;  2LXL A;  4M7C A;  3CHS A;  3SGH A;  3BEE A;  3MGB A;  3LDZ A;  3UIP C;  4GA1 A;  1SA5 A;  3FUL A;  3Q49 B;  3FUI A;  1JPL A;  3SO8 A;  5AQB A;  3C3R A;  3TWS A;  4I2W A;  4GYW A;  3FH5 A;  5HKP A;  1YYH A;  3HXE A;  3B95 A;  2DBA A;  5CMY A;  1BD8 A;  3QNK A;  5J90 A;  4GA0 A;  1OUV A;  2H6G A;  3PRE A;  4V3I A;  3TL5 A;  3CVV A;  4B89 A;  3AG2 E;  3L08 A;  3SY2 A;  1HFA A;  1DCQ A;  2VYI A;  4DUI A;  3VLE A;  1YA0 A;  4JHK A;  1OWO A;  2AXZ A;  2NXP A;  4L2Y A;  2XRZ A;  2VGE A;  4G25 A;  3UQ3 A;  4LRZ A;  2DYR E;  3L82 A;  5EDS A;  4EBA A;  4BT8 A;  4UWF A;  1WM5 A;  4JL0 A;  1RZ4 A;  2DWZ A;  2WMO A;  3LKU A;  5LOZ A;  5C2Y A;  2VSO E;  5BXO A;  5E75 A;  2X6J A;  3MZL B;  4ANV A;  5LX8 A;  3JXI A;  3NB2 A;  2XCB A;  3APC A;  3HVE B;  3ASF A;  3ZRH A;  2DCP A;  1WAO 1;  2XEV A;  3D9J A;  4BY6 A;  4YDE A;  4I9E A;  3T5V A;  4HOR A;  1O5M A;  4G8L A;  1KT0 A;  2I2O A;  2XGO A;  2BTD A;  3JYS A;  4WNG A;  2F8Y A;  5M72 A;  4I17 A;  3EDT B;  2V5F A;  4DK5 A;  4U0S A;  3I3N A;  2C2L A;  3MKQ A;  2Y4T A;  3PE3 A;  4MRU A;  1H0A A;  3PVL A;  4PS3 A;  1L5J A;  4NQ0 A;  3B13 A;  4HI9 A;  5CRV A;  1WY6 A;  4CDN A;  3LEW A;  5HQ8 A;  1U2V G;  2OEW A;  1H6K A;  4I1A A;  4RVB A;  3Q78 A;  4ACK A;  2UWJ G;  2QC9 A;  4AV7 A;  3FUN A;  2HR2 A;  3ASH A;  5LFA A;  1EYH A;  3ULQ A;  2I9C A;  1Z3Y A;  3Q75 A;  4KT6 B;  3ZYQ A;  1HF8 A;  3ZU7 B;  3B7S A;  3CKB A;  1HH8 A;  3MYV A;  2E0I A;  3UT4 A;  3SNX A;  2P9U G;  3HXB A;  3FU0 A;  3D9K A;  4WNE A;  1KLX A;  4XIF A;  1HS6 A;  3JUI A;  4GZD A;  2DVW A;  4LNU D;  5CBO A;  3B7B A;  5FQ6 A;  5G05 J;  2R17 C;  2HM8 A;  3CVY A;  3QJZ A;  2BKK B;  3RK6 A;  3HDX A;  3EIJ A;  3JUE A;  3QAR A;  4MLP A;  4XI0 A;  3KSL A;  3CLJ A;  4JB8 P;  2HE0 A;  3ZGQ A;  3BQO A;  4J0U A;  4MS6 A;  3QKY A;  3PUJ A;  3EHN A;  2MRI A;  1SVX A;  2WXK A;  2XHE A;  3ZN3 A;  1DNP A;  2YQ8 A;  2EIM E;  2OVF A;  1TNU A;  4TRQ A;  2E2E A;  3FEX A;  3HXC A;  4AXH A;  4PDX A;  3PNT B;  2XPZ A;  4HNA D;  1TNB A;  1TNZ A;  1JCR A;  3ML9 A;  1ELR A;  4DX7 D;  1XNF A;  3UM1 A;  1BLX B;  3ASG A;  2V8S E;  4A3T A;  2OVB A;  3PE4 A;  2LXM A;  3CVX A;  5BXU A;  4UUC A;  2PZI A;  3AAA C;  3FTS A;  5EYP F;  1OCO E;  1MZC A;  2YNQ A;  1PAQ A;  2AVP A;  3QWW A;  2OEV A;  3TWT A;  4GAA A;  1UN8 A;  2J4D A;  1EPU A;  4XEI G;  4PH4 B;  2Y1L E;  5EIL A;  5B1B E;  4GMJ A;  3DBS A;  3LJN A;  3D3M A;  4HOT A;  4J8Y A;  1RW2 A;  3I4R B;  4YVO A;  1N4R A;  1JCS A;  2VQ2 A;  5LCW J;  3L16 A;  1N0R A;  4BX8 A;  2WMN A;  2J08 A;  1MQS A;  4I6J A;  2GRR B;  4AY5 A;  3E37 A;  3TWQ A;  4DX1 A;  5FZS A;  5ENT D;  2HYZ A;  3TXM A;  3K9I A;  4I1O B;  4WNF A;  2AXV A;  2AJA A;  3ASO E;  4GTT A;  5EX3 A;  4KVM A;  3FP3 A;  2XZT G;  3HHM A;  2EIK E;  4N2Q A;  1QYM A;  3EIQ C;  5KJN A;  4UI9 J;  5CED B;  1LD7 A;  3EJN A;  1N9A A;  4RLY A;  5A6C A;  3FDH A;  2JEK A;  3IXE A;  1H6P A;  4DLO A;  2OOE A;  1AP7 A;  1W3B A;  4WWN A;  2VSX E;  4N3C A;  5ENR D;  4O1O A;  2WPV A;  4G2V A;  3RRN B;  3GZ2 A;  4DI3 A;  2WXF A;  4GU5 A;  3DSX A;  1N94 A;  2R2L A;  5D0Q D;  2GGF A;  3FWV A;  4URK A;  3NOG D;  4GTM A;  2P9K G;  2P9S G;  3DSW A;  2FO1 E;  1UG3 A;  1SZA A;  2EQX A;  4G1T A;  2QYJ A;  4UQY A;  5HI7 A;  4GPK A;  4EEC A;  3B7T A;  1NP7 A;  2AWI A;  3D9M A;  3N71 A;  2XEE A;  5G05 C;  4EQF A;  3R7Q A;  2Y69 E;  3JXJ A;  4ABN A;  2LSU A;  1OWM A;  3E4B A;  4CCA A;  4TXR A;  2WXH A;  4C0E A;  4AEZ C;  5FQ4 A;  3TG4 A;  1JWF A;  3T5X A;  4Y6W A;  3Q4A B;  5AQ9 A;  3RSE G;  4I2Z A;  4BSX A;  2P9L G;  4BX9 A;  3C98 A;  2DZO A;  5T3R A;  4JZY A;  3T9K A;  2YHE A;  4GB9 A;  2V4L A;  3NZU A;  5ARF A;  4AIF A;  4GTP A;  5AEN A;  2VGY A;  1KT1 A;  1NL4 A;  1E8Z A;  5T4Y A;  4JW1 A;  3GZ1 A;  3FH7 A;  3QB2 A;  1BI8 B;  3HYM B;  4BTB A;  4DX6 D;  3UKU G;  2IJG X;  1SQM A;  1YMP A;  2DIW A;  3JCK C;  5CMW A;  1UOH A;  2RD0 A;  3EUV A;  4B94 A;  4WND A;  3ZYL A;  3CK7 A;  4HRL A;  2KM4 A;  2PM7 A;  4QQI A;  1PC2 A;  1TYQ G;  3AS5 A;  4LNB A;  4FLH A;  3FTZ A;  3SFZ A;  2BED A;  3NOC D;  4AOF A;  3KD7 A;  1E7V A;  3DPY A;  3RO2 A;  3HIZ A;  2IY0 C;  3Q9N C;  3ONL A;  2C0L A;  5LCW C;  1HXI A;  4DI4 A;  1E7U A;  3G2S A;  3VLF A;  4KZ0 A;  4HVB A;  4UQZ A;  2EIN E;  3I4G A;  4RSY A;  5D66 A;  3SZ7 A;  5AN8 A;  3PH0 C;  4O60 A;  4M3O A;  2V0P A;  1SW6 A;  3PZD A;  1YCS B;  4BET A;  2J07 A;  2QYU A;  3RO3 A;  4UWL A;  3VTX A;  4UI9 C;  3FH8 A;  4N3A A;  2VGX B;  5IY5 E;  3L9T A;  1H2V C;  4TXQ A;  1EDU A;  2L9B A;  4Y6C A;  4DX2 A;  4LSZ E;  3ASN E;  4LER A;  2GRL A;  5AJD A;  3V79 K;  3RAU A;  3ZHE A;  3SF4 A;  3MV3 B;  4OAV B;  1U3C A;  1H2T C;  1IKN D;  2IQC A;  4L7T A;  4BFR A;  2WXL A;  4G8K A;  3ZIM A;  2P2C P;  3ZW3 A;  2WXJ A;  1NI1 A;  3ABL E;  4ANW A;  1ELK A;  2AXU A;  1NA3 A;  3FTW A;  3DXM G;  5DIZ A;  1DVP A;  2VTB B;  3MEK A;  4A1G A;  4BSZ B;  4I9C A;  4GMR A;  4GPM A;  4UWK A;  5ANL A;  3CHO A;  2GRQ B;  5AYW D;  2P9P G;  3QWP A;  4G26 A;  4EPZ A;  3FU5 A;  3TWX A;  4HQD A;  4AVX A;  2J4B A;  2KC7 A;  3FUM A;  1G3N B;  4C9B B;  3AU4 A;  2ILR A;  5FWQ A;  4U63 A;  3MX3 A;  2ZU6 B;  4FP7 A;  2ZIR A;  1HO8 A;  3CVP A;  2GRN B;  4KVO A;  4N3B A;  3FFL A;  4DRX E;  1S64 A;  5KNG A;  5FIN A;  3MCX A;  2LO6 A;  3CIA A;  4CDR A;  2UY1 A;  3L22 A;  2KCK A;  3FEY A;  4O6F A;  4OVV A;  4BES A;  3PEU B;  4C0M A;  4N2S A;  2I1K A;  4ZHB A;  5EID A;  1TN6 A;  4W9R A;  2CHW A;  3G2U A;  3OXG A;  3NF1 A;  4B8A A;  4XE0 A;  4UQX A;  4Q94 A;  5CHE E;  3IHY A;  3P1U A;  2J09 A;  2QFC A;  2Q7F A;  2CHX A;  2LNI A;  4L9P A;  1FT2 A;  4YDY A;  3ESL A;  4I6E A;  3S7B A;  3AS8 A;  5KCM A;  2VSY A;  4MKT A;  2WXR A;  3ZKJ A;  3LJ3 A;  3HG0 D;  1IQU A;  1LD8 A;  4A1S A;  2PM6 A;  4CEM A;  3SFX A;  4D10 C;  3B7U X;  4G24 A;  1A5E A;  3FTX A;  3MKQ B;  5ENP D;  3C3O A;  3RRU A;  4H7Y A;  3D9O A;  2ZIS A;  2GW1 A;  4GML A;  2EIL E;  3SBT B;  3ZFW A;  2V4H C;  4YDW A;  1UJK A;  2Y3A A;  1ZU2 A;  3GZS A;  2GRM A;  2OND A;  3HRA A;  3ZYM A;  2ZXW E;  3J5Q B;  4IN3 B;  2XS8 A;  4GA2 A;  4JA9 A;  4JA7 A;  2R5S A;  3ZPJ A;  3ABM E;  1O1T A;  3RJV A;  3D9P A;  4OAU C;  5H7P A;  2R02 A;  1V54 E;  2I1J A;  4GZC A;  2JAB A;  1E8X A;  2H6F A;  4TV3 A;  3I5P A;  3FUE A;  4NIK A;  1MX2 A;  3APD A;  3UM2 A;  1QNF A;  3U9W A;  1Z6T A;  5ARG A;  5FJY A;  4I43 A;  1BPO A;  1IHG A;  1KZP A;  3UIN C;  3ESK A;  4J8D A;  1WDY A;  4KBQ A;  4HOU A;  2B6C A;  4KMO A;  4A63 B;  4XI9 A;  4U8H A;  1H2U A;  2KBX A;  1N95 A;  1S0P A;  1HG2 A;  4JPS A;  4K0R A;  1OCR E;  3P2B A;  2NYJ A;  4FU3 A;  4OVU A;  3KS2 A;  4B8C B;  4E85 A; 
#chains in the Genus database with same CATH homology
 5AQ7 A;  5ENP D;  4CZ2 D;  5EIB E;  4G8L A;  3JUE A;  2F8X K;  4BER A;  2L6B A;  2V4H C;  3JXJ A;  5D66 A;  5AN8 A;  4YDW A;  3TWQ A;  3Q9U C;  5AQA A;  4O60 A;  5AAR A;  1MJ0 A;  4DX1 A;  5ENT D;  2F8Y A;  4JB8 P;  2HE0 A;  3J5P A;  4HB5 A;  5ITZ F;  1SW6 A;  2RFM A;  2AJA A;  3HRA A;  4HLL A;  3TWU A;  5KWD A;  1YCS B;  1OY3 D;  3J5Q B;  3ZUV B;  4BET A;  4DRX E;  4ATZ D;  1MYO A;  2XZT G;  2DZN A;  5KNG A;  5FIN A;  1BU9 A;  1D9S A;  1SVX A;  2BKG A;  1QYM A;  4HI9 A;  3TWR A;  3EHQ A;  3V31 A;  5CEC B;  4QFV A;  2Y0B G;  3V2X A;  5CED B;  5AQ9 A;  4C48 B;  1IHB A;  4J7W A;  4N5Q A;  2XEN A;  4U95 D;  5ENS D;  2F37 A;  3SO8 A;  3F6Q A;  5EN5 D;  4HI8 A;  4RLY A;  4K5A B;  5AQB A;  3V30 A;  4BES A;  5KBA A;  4OAU C;  3TWS A;  2DZO A;  5HKP A;  4HNA D;  1N11 A;  1YYH A;  3DEO A;  3T9K A;  3ZNG A;  2XEH A;  2ZGG A;  3B95 A;  4DX7 D;  1K1A A;  3IXE A;  4TUM A;  4ZHB A;  3UI2 A;  1BD8 A;  4F1P A;  2JAB A;  1OT8 A;  5EID A;  1BLX B;  4DX2 A;  1AP7 A;  5CER B;  4LSZ E;  1MX4 A;  1K3Z D;  2QC9 A;  2MYO A;  5ENR D;  2ETA A;  4O1O A;  3V79 K;  4NIK A;  5BXU A;  2J8S D;  4OAV B;  4UUC A;  4U8V D;  1IKN D;  1MX2 A;  4F6R D;  4U8Y D;  2B0O E;  1DCQ A;  1TR4 A;  1BI8 B;  5ENQ D;  4DX6 D;  4DUI A;  3UXG A;  3C5R A;  1S70 B;  4G8K A;  2A5E A;  3NOG D;  3ZU7 B;  3AAA C;  1YMP A;  2P2C P;  2V5Q C;  3W9F A;  4BEP A;  2ETB A;  1AWC B;  1UOH A;  3TWW A;  1WDY A;  4YDY A;  2FO1 E;  5EYP F;  2VGE A;  4K5B A;  5CEA A;  3EU9 A;  5HS0 A;  4O1P A;  3V2O A;  4ZFH A;  1BI7 B;  4A63 B;  4HRL A;  3DEP A;  3TWT A;  3UTM A;  2XZD G;  1NFI E;  2RFA A;  1DC2 A;  2KBX A;  4QQI A;  3NBN B;  2DWZ A;  4U96 D;  1MX6 A;  1N0Q A;  3KEA A;  3W9G A;  3ZKJ A;  2KXP C;  5ENO D;  5JMN D;  5BXO A;  4B93 B;  4BSZ B;  5JA4 D;  3EHR A;  2Y1L E;  2NYJ A;  4GMR A;  4GPM A;  2PNN A;  5EIL A;  2DVW A;  2QYJ A;  1IXV A;  3HG0 D;  5HRY A;  3NOC D;  4LNU D;  3D9H A;  4CYM D;  5EYL A;  3AJI A;  5CBO A;  3JXI A;  5AAO A;  4LG6 A;  1K1B A;  2ETC A;  3LJN A;  4HRN A;  4HRM B;  3T8K A;  5KNH D;  3TWX A;  4Z68 A;  2ZGD A;  3TWV A;  2XEE A;  3B7B A;  1A5E A;  1WG0 A;  4HQD A;  4J8Y A;  4DX5 D;  5CBN A;  5FIO A;  4HBD A;  1G3N B;  3Q9N C;  2BKK B;  1N0R A;  4K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...