2PNNA

Crystal structure of the ankyrin repeat domain of trpv1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
248
Chain Sequence
LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title The Ankyrin Repeats of TRPV1 Bind Multiple Ligands and Modulate Channel Sensitivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 73
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2pnnA00
4ZHBA 4C48B 3NBNB 3HRAA 1MX6A 2DVWA 3ZNGA 4BETA 1AP7A 1IHBA 1G3NB 1WG0A 4U95D 5HKPA 5AAOA 3J5QB 3AAAC 2BKGA 5HS0A 3HG0D 5EN5D 4J7WA 4GMRA 1TR4A 1OY3D 2ETAA 4GPMA 4HRMB 5EYLA 5EYPF 4DX1A 1BU9A 3ZUVB 4RLYA 4G8LA 5JA4D 2ETBA 4HLLA 1SVXA 5AQAA 3V2XA 5KBAA 1D9SA 2XEHA 3TWUA 2VGEA 3W9GA 4HNAD 2KXPC 4HRNA 2F37A 1QYMA 4DUIA 3AJIA 4DX6D 5EILA 4K5CA 2P2CP 4O60A 5ENQD 4ZFHA 4K5AB 4YDYA 2RFMA 1UOHA 5ITZF 2AJAA 4CYMD 3UTMA 4DRXE 4QFVA 2MYOA 4BEPA 4CZ2D 2BKKB 3UXGA 1K1BA 1S70B 4O1OA 3C5RA 5CERB 2ZGDA 1K3ZD 3B95A 4F6RD 1N11A 5ENTD 1WDYA 3T8KA 1IXVA 5KNHD 2JABA 1AWCB 1MYOA 3SO8A 1BLXB 1N0RA 3LJNA 4JB8P 5EIDA 3TWQA 4N5QA 4UUCA 4U8VD 2V5QC 2XEEA 3DEPA 3F6QA 2V4HC 1DC2A 2DZOA 2L6BA 3DEOA 1N0QA 1BI8B 2Y1LE 2PNNA 2ETCA 5CEDB 4HRLA 1MX4A 4LG6A 2FO1E 4Z68A 3EU9A 1K1AA 3KEAA 5AQBA 5ENRD 3TWWA 1NFIE 4BERA 3V79K 1IKND 4BESA 2F8XK 4U8YD 5FINA 4TUMA 4K5BA 3Q9NC 3TWRA 4F1PA 2F8YA 2XZDG 2Y0BG 2DZNA 3EHRA 4HB5A 4NIKA 2B0OE 4YDWA 3V31A 5BXUA 3J5PA 2DWZA 2RFAA 5AQ7A 3TWXA 5CEAA 1MX2A 1MJ0A 4J8YA 1A5EA 2J8SD 3W9FA 3ZKJA 5AQ9A 5CECB 4HQDA 4U96D 3JXIA 5CBOA 4LSZE 4A63B 1OT8A 1SW6A 5KWDA 4QQIA 5FIOA 2A5EA 5HRYA 4B93B 4ATZD 5D66A 5KNGA 5CBNA 2QYJA 4OAUC 4OAVB 3TWSA 4LNUD 3TWVA 4G8KA 2XENA 3V2OA 5BXOA 5ENOD 2XZTG 5EIBE 2ZGGA 4HI9A 3T9KA 3IXEA 1YMPA 3EHQA 4BSZB 1BD8A 2HE0A 3JXJA 5ENSD 3JUEA 1BI7B 4HBDA 1DCQA 3V30A 2NYJA 4DX5D 4DX2A 3D9HA 3TWTA 3UI2A 2KBXA 5AARA 4HI8A 3Q9UC 1YCSB 4DX7D 5AN8A 2QC9A 3NOGD 4O1PA 5JMND 3ZU7B 5ENPD 3NOCD 3B7BA 1YYHA
chains in the Genus database with same CATH superfamily
4Q94A 4U0ZA 2WXNA 2FF4A 4P29A 3ZGQA 2ETAA 4HRMB 5EYLA 2ZXWE 3P2BA 3ZIMA 2RFMA 4XZ4A 4EBAG 3AS4A 4GZ6A 2HYZA 3CIAA 3RRNB 1HE8A 3BQOA 3L9TA 3CHRA 4YVQC 5FZSA 1EDUA 2L6BA 3VLDA 1ZU2A 3Q7FA 1WAO1 3T5VA 2LSUA 1NFIE 5G05J 4TUMA 1HH8A 4YVOA 4GPKA 3E32A 2Y0BG 3B7UX 1FVHA 3U4TA 4JW1A 1FVFA 2GROB 2V4LA 2BTDA 3ML9A 2XPIA 4TXRA 3G2WA 3E37A 2JEKA 4I2ZA 4OAUC 2XGMA 2R02A 1TEZA 3JCKC 2VSNA 1S0PA 2J9QA 4IULA 4CEMA 2IONA 2Y4TA 1OWMA 3UI2A 2NC9A 4JEHA 4HS2A 1LTXA 3UKRG 4AY5A 2A4ZA 2QYUA 2M63A 2R59A 2PQRA 4B89A 2R2LA 3I4RB 2P9PG 4GMRA 4CDNA 2XEHA 4CGVA 3CSTA 4WNDA 2GW1A 3PUJA 3Q4AB 2MYOA 4U07A 3SZ7A 1WDYA 4JB8P 1HS6A 3RRUA 2JLBA 3RO3A 3CGHA 3HIZA 1E8XA 1Y8MA 2PNNA 3GYZA 3JQ1A 3EUVA 1N95A 3V79K 3AG3E 3DXKG 2AWIA 3MEKA 4BESA 3APDA 2E0IA 3AU4A 4G24A 4ANXA 4GTRA 4W9RA 3J5PA 2P9NG 3U66A 4XI9A 2J8SD 4HQDA 2X38A 3FTXA 1K8KG 5KWDA 3I4GA 4B8AA 3PZ1A 2V8SE 5D66A 3ESLA 1OXJA 2VJ8A 3T9KA 4GTMA 3EIJA 1BI7B 2LAIA 3CVNA 3Q5MA 5G04J 1E7UA 1NP7A 4UWHA 2DCPA 2VGXA 3DPDA 3HXFA 4J6IA 1JWFA 2KATA 4WNFA 1D8DA 2WQ7A 1H19A 3MKQB 3R9MA 3T8MA 3PEVB 3Q7AA 2CG2A 4G8LA 4G25A 4DUIA 2KXPC 1SZAA 2WXRA 4XEIG 2QY7A 3IBEA 4KT6B 2AXVA 4WWPA 2IFUA 3TWQA 4H7YA 3TG4A 4TV3A 3CKCA 4UWKA 3CHPA 3D9MA 1NA0A 3S7FA 3PH0C 4ILIA 4NURA 4I1AA 5CMWA 4HOTA 3KAEA 3LY8A 4YDWA 3CK7A 2KCVA 3TWXA 1RW2A 3HXCA 4GMJA 4KZ0A 4JHRA 3D3MA 3NF1A 1SW6A 2WQ6A 3B7RL 3ABME 1S64A 3SNXA 2A5EA 2LAHA 3T5XA 4YDOA 3HHMA 4FJYA 2J08A 3UKUG 2IQCA 1OCZE 4JHKA 4Y6WA 3ASDA 4J8EA 2I2OA 3WG7E 1HG5A 2NYJA 2KZTA 2QZAA 3SD5A 3QWPA 3SFXA 1LD8A 3APCA 1OUVA 5ENPD 4BFRA 2WXGA 3KD7A 4C48B 2WXKA 2I9CA 5DBKA 2I6HA 5IY5E 2X6KA 2UY1A 3CHMA 4GPMA 4RLYA 2WXHA 4HLLA 2XCBA 3CVPA 3EDTB 5BT1A 1TN6A 4GA0A 4A3VA 3MYVA 3NZSA 3C98A 4XKCA 4N3CA 4N5CA 1WY6A 5EDSA 4N5QA 2XEEA 1HZ4A 2Y1LE 4I17A 3FH8A 3TXNA 1Z3YA 2VTBA 5KJMA 3ZHEA 5AYWD 4B94A 1HX8A 3MA5A 4UWGA 1OCCE 3OTNA 4FLHA 2WXPA 3HXBA 2WVIA 4HORA 3WXXA 4I1MA 3FU6A 4Y6CA 4B8CB 4HI9A 3QJZA 3B7TA 3HXEA 3FUHA 3QWWA 1OWPA 2E2EA 4M7CA 3UM1A 3KSLA 3S7JA 3NOGD 2WXIA 4O1PA 2VSXE 2XS8A 2H6HA 1YYHA 1JUQA 4C0EA 2J49A 1MX6A 1V54E 3AG4E 2LO6A 3UTMA 2H6FA 5HI7A 1H2VC 3B7SA 4BTAA 2VGXB 3R9AB 3UIPC 2IOLA 5C2YA 4N2SA 1U3DA 5FQ4A 1N11A 3LVQE 3IHVA 5EIDA 4ACLA 5JHBA 2EQXA 1XNFA 1NL4A 3TXMA 3EU9A 3KEAA 2NSZA 3Q73A 4KZCA 2GRPB 3ULYA 5BXUA 1MQSA 2DWZA 5AQ7A 1UG3A 5FJYA 2OEVA 1N4QA 4GTOA 3ZKJA 3FP3A 4LERA 4YDEA 3DWLG 4HXIA 1MZCA 2R05A 2ILRA 3GZ1A 1Z3XA 1O1RA 1OWLA 3UT7A 1NZNA 4DX2A 3QKYA 3CVQA 1U3CA 2PQNA 4N3BA 3NOCD 4A1SA 3C3OA 3NBNB 5FQ6A 3L17A 2OV8A 3UT4A 3FWVA 2KZTB 2B6CA 4BETA 1IHBA 4GYWA 5AAOA 1OY3D 5EYPF 4B0ZA 2XS1A 4AIFA 3CVWA 1INZA 2H6IA 3ZXPA 3LJ3A 2UY1B 4F6RD 5D0OD 2YINA 3O48A 2LXLA 1DC2A 3CR3A 5H7PA 4XKBA 4G1TA 1HG2A 5AQBA 2LSVA 4GZDA 4RVBA 3D9NA 5AIJA 1PC2A 1JCQA 4J8YA 1TNUA 5AJLA 3SI5A 3JXIA 4LSZE 2WPVA 2VTBB 3ZHEB 1O5MA 3D9KA 5G2NA 3CVUA 5BXOA 4AVXA 3FUJA 4GZ5A 5EX3A 4BSZB 1BD8A 4J8SA 4U8HA 5BUZA 3Q49B 4FJZA 2RD0A 3CEQA 3TWTA 3ZFWA 2IOSA 4LRZA 2QFCA 1TNBA 4LCTA 3ESKA 3B7BA 2IO3C 1NA3A 5ENNA 4ZHBA 3NB2A 3FH5A 2MOWA 3C3RA 1EF1C 2C0LA 3KSQA 3PE3A 3ZEFA 5FZQA 4FU3A 1JCSA 2GRMA 5M72A 5HS0A 4U63A 3ONKA 2FI7A 4G11A 1D9SA 3Q15A 1SZ9A 4DLOA 1N9AA 4HFGA 4PS3A 1QYMA 2P2CP 3G2UA 3UINC 1UOHA 3LY9A 3UT8A 2AJAA 4AP2A 4O1OA 5CERB 2PM6A 1K3ZD 3PZ2A 4LNGA 3S7DA 5KNHD 1QZ2A 1N0RA 4EECA 3ZVVA 1W3BA 5JJ7A 3ISMC 2AVPA 4K0RA 2LXMA 3RO2A 2J4BA 3C72A 1MX4A 3SHFA 5FWQA 5T8IA 4CT4A 4APOA 3CVVA 4ANUA 4CDRA 1GW6A 3L13A 2ZISA 2X6HA 1QNFA 3FHEA 3QC1A 4PUCA 5J90A 3OXGA 3CVXA 3HYMB 4DI3A 1L5JA 1QBQA 3MX3A 4G26A 3RK6A 4UI9C 2Y3AA 4FHJA 4I9EA 3LVRE 3HXDA 3DSVA 3FTYA 3FFLA 4JZYA 3QWVA 4MRUA 3CHOA 1JCRA 1JPLA 4L9PA 1KPSB 4RQIA 2KBXA 4DX7D 3OXFA 5BV0A 4HVBA 1D8EA 1H6KA 3URZA 2DVWA 2FBNA 4J8DA 1G3NB 4CRWA 3HG0D 3ZW3A 2R17C 2UWJG 4H7XA 5KBAA 3CVLA 5ANLA 1TN8A 2KCKA 1H2UA 2F37A 3VLEA 1K1BA 3RAUA 4EZJA 3CK8A 1KT1A 3B95A 1ELWA 3ZN3A 3LJNA 3Q78A 2ZIRA 2XHEA 3R7RA 1FT1A 2WB2A 4AM9A 4N3AA 4ME2A 4JPSA 1MHQA 4FLBA 3VTXA 3QNKA 2RFAA 4DJAA 5CCLA 4JHJA 3DSTA 3U64A 3LCAA 3ABLE 4L1BA 4A55A 3RSEG 3ULEG 1DNPA 2DIWA 2YQ8A 3B13A 3TWSA 4G8KA 3DXMG 3FEYA 5EIBE 4DK5A 3IXEA 4JA9A 3CHSA 1SQMA 4URKA 3MGBA 2EIKE 1N4SA 3V30A 4GZCA 4EQFA 5E76A 4XIFA 3HDXA 2Q7FA 4IN3B 5AN8A 3MKRA 4XE0A 4I1OB 2I1JA 3PZ4A 3FUDA 4O6FA 1WG0A 4U95D 2XGSA 3OXLA 1TR4A 1BU9A 5JA4D 2ETBA 3ZYKA 3EU5A 2H6GA 4I6EA 3W9GA 1N54A 4O60A 3FU5A 2OEWA 5C1DA 4TRQA 1HF8A 4BT8A 4ABNA 3T8KA 4OVUA 3LEWA 5CCMA 4CT0A 3QAQA 3ZYMA 3QOUA 4GCOA 3EIQC 4EPZA 1FT2A 2CFUA 3EHNA 5EX0A 3CK9A 5BV1A 2CFZA 4L7TA 2BF0X 1HU3A 1E7VA 5LCWC 2DZNA 3NAWA 4GTPA 3V31A 4IYPA 2YHEA 1RZ4A 3ULQA 1KZOA 1LF8A 4J0UA 3LS8A 2L0TB 4U7EB 2GGFA 1H2TC 1O1TA 3PEUB 2V0PA 2XZTG 3ML8A 3IV0A 4LUNU 3D9LA 3UQ3A 4OVVA 3PE4A 4PS7A 4DI4A 3JUEA 1QQEA 1JWGA 3Q9UC 4FHKA 4U0UA 2EINE 3V2OA 5KCMA 3EJNA 3DBSA 3LPZA 3ZNGA 4E85A 4N39A 1FCHA 4WWOA 3AAAC 4UI9J 3L08A 3CV0A 2OVFA 3S2AA 3CQCB 4MBGA 4K5CA 1U2VG 4BY6A 4K5AB 2CHWA 4Q69A 4GYOA 5BPPA 3E30A 4QFVA 2MRIA 5D2MC 3FULA 2CG3A 1E96B 5ENTD 4TXQA 1MYOA 3SO8A 1EPUA 4GB9A 1N94A 5AJDA 3FUMA 2OOEA 2AXZA 3TWWA 1EYHA 1E8ZA 4GA1A 3E34A 1YA0A 4F1PA 2PZIA 4IRUA 5FQ8A 5E75A 1VDYA 3ONLA 4F3VA 1B89A 3DPYA 5BNWA 5HRYA 5KJLA 4KMOA 2XRZA 3OAWA 3MZLB 2NXPA 2VQ2A 1N4PA 3CHQA 5B1BE 2P9UG 3FY4A 4GAAA 4UI9K 3SY2A 2WXLA 5CRUA 3G2VA 4U0SA 3PUKA 3L22A 2LUHA 3FEXA 1X5BA 3ZRHA 2BKGA 4EZLA 2DYSE 3ZUVB 3HVEB 4KXKB 5AQAA 1DVPA 4HRNA 4DX6D 4KVMA 1BPOA 4HOUA 4CYMD 2P9LG 3LXUX 3CSFA 5JJ6A 2ZGDA 1IYGA 2WQHA 4FP7A 1SA4A 1PY1A 3JYSA 1BLXB 2C2LA 4MKTA 1OCOE 4WWNA 2WXQA 4AEZC 3BU8A 2ZU6B 2A5UA 4F1SA 3EHRA 3U9WA 5EKQD 5A7DB 4KBQA 3BG1B 1IQRA 5CECB 1ZBPA 2ONDA 4JC8A 2C0MA 2R03A 3MV2B 3RU0A 4I9CA 4ATZD 4V3IA 4I6JA 4OAVB 4UQZA 3IHYA 4GA2A 4KYOB 5FT9A 4NACA 5FZRA 2GRQB 3TG5A 4HBDA 4F53A 5ARGA 2VGYA 2CHXA 5LCWJ 4DPRA 3KS2A 3AG1E 4HLEA 5HQ8A 4BX9A 3ZPJA 1HO8A 2X3MA 4JVSA 4F7AA 3UM2A 1TNOA 3ZYLA 5HKPA 4G23A 3QK0A 4PH4B 1SVXA 1KZPA 3V2XA 3FTVA 4WNGA 4R7LA 2VGEA 3LYAA 2L6JA 3AJIA 4LNBA 3ABKE 4WAFA 2BKKB 4EZKA 3C5RA 4D10C 4I2WA 4ACKA 4N2QA 4XX5A 2EILE 3L6AA 4UUCA 4L2LA 3DEPA 1KLXA 1NI1A 2WXOA 2HM8A 3MJWA 4L2YA 5JJTA 4U8YD 4RG9A 5FINA 1OCRE 2XZDG 4Q96A 2WXMA 2MHKA 2KM4A 5B3SE 4UWFA 4ILGA 2FO7A 5AQ9A 2PM7A 4U96D 4X8QA 1E90A 4CDMA 4ATGA 4WNEA 2VSYA 3BG0B 3GW4A 4LNUD 3RKVA 4JEUA 3E33A 3D9PA 3FU3A 2HE0A 1DCEA 3JXJA 5ENSD 3P1UA 2J4DA 3PNLB 3PNTB 4GZ3A 3PS6A 4I6GA 3ASHA 2P58C 1X81A 2BEDA 2QC9A 5JMND 3VLFA 1XGWA 4GTSA 1IHGA 2WXJA 5B1AE 2AXUA 4TUUA 4UQXA 4LEUA 2WMNA 1ELKA 3LY7A 4DX1A 3MCXA 3Q79A 1O1SA 3TAXA 3SF4A 3FTZA 3FTSA 5EILA 3UPVA 2LNIA 3RJVA 4CZ2D 4BWRA 1S70B 4HOQA 4C0MA 1KT0A 1IXVA 4E6HA 4JA7A 3FUNA 1A17A 3D9JA 4GTQA 3BEEA 2V5QC 3Q47B 1N52A 5G55A 3EHMA 2DZOA 4WUYA 1N0QA 3FDHA 4LG6A 3AS5A 3ENEA 1PAQA 3JUIA 2GRRB 3GZSA 2WXFA 5LP0A 3FUKA 3TWRA 2F8YA 4HB5A 4UQYA 5CEAA 4C9BB 5CRVA 3W9FA 2YNQA 4BX8A 3LDZA 3FUIA 4CCAA 3LKUA 2P9KG 2XENA 5ENOD 1YMPA 1TYQG 3EHQA 3L16A 2P9IG 4U04A 3QARA 4DX5D 5AENA 3GZ2A 4HI8A 5T3RA 5LX8A 2EIJE 3UM0A 1LD7A 3UMVA 3CQGB 3AG2E 4J8FA 2FEZA 3DSUA 1ELRA 4GYYA 2XEVA 2R5SA 4FC8A 3MV3B 4MS6A 4NQ0A 1P5QA 3TL5A 1N4RA 2IF4A 3I3NA 1IQUA 3PZDA 5DIZA 5LFAA 2X6FA 1Q2ZA 3PZ3A 3RIBA 3FUFA 2IJGX 5ENQD 2HO1A 4GMLA 1S63A 3FTWA 4OYSA 3HVEA 2XCCA 2WMOA 1HXIA 3UIOC 4K03A 3NZUA 3VTYA 3QB2A 4FADA 5J08A 5KJNA 4NRHB 1SA5A 2EIME 2IY0C 4U8VD 1Y6IA 2V4HC 3DEOA 3SFYA 2XQ0A 4AJWA 2ETCA 3TGOA 2J09A 3ASNE 3FU0A 4HRLA 4RSYA 1K1AA 4BERA 4AY6A 2WM9A 5FQ7A 4AXHA 1TNZA 1E8YA 1TJCA 2GRLA 5CHEE 1UJJA 2J07A 1A5EA 1E8WA 4A63B 1OT8A 3DSXA 3R7QA 4B93B 5KNGA 4GTTA 3FH7A 3IKOB 3TWVA 2I1KA 3PRZA 3C3QA 4HOSA 3CKBA 2IEJA 3PREA 4GTVA 5LOZA 1FPPA 4PDXA 3ZYQA 3L54A 3D9HA 2X6JA 5FTPA 3QDNA 4FA6A 3ZU7B 4XI0A 3UUXA 3HRAA 2RKKA 3S7BA 2L9BA 1AP7A 3DRAA 4GU5A 3J5QB 4MLPA 4FULA 5G05C 5EN5D 4J7WA 4G2VA 4JD2G 3PVLA 1HFAA 3TWUA 1ZB1A 3G2TA 4HNAD 3PDNA 4ZFHA 4YDYA 1OWNA 3SBTB 5ITZF 4DRXE 4BEPA 2X6IA 2GRNB 4AOFA 4APFA 4CGWA 3IEGA 3DSWA 4EHMA 1H6OA 1BI8B 5CEDB 5D0QD 2IU1A 2FO1E 3ZXSA 4Z68A 5ENRD 4A3TA 1UN8A 4K5BA 3UX4A 3Q9NC 2L0IA 2B0OE 4PS8A 1MX2A 4AV7A 3E4BA 5BW8C 2RG8A 5CBOA 2IO2C 5ANRA 4A1GA 4QQIA 3K9IA 2DBAA 3APFA 4BSXA 4ILHB 2BUGA 4BT9A 2ZGGA 1TN7A 2VSOE 1UJKA 2HR2A 3SFZA 4GCNA 3AU5A 4YNDA 1Z6TA 2YHCA 3CVYA 2PL2A 3I5PA 3FTUA 3AS8A 3D9IA 3Q75A 3FUEA 3NQPA 4L23A 4UWLA 1TNYA 1V55E 3KEZA 3DSSA 3ASGA 2XPZA 3UM3A 1WM5A 2KCLA 5CMYA 2DYRE 2V5FA 3UXGA 1OWOA 4I43A 3SQVA 1TJFA 1H6PA 1UN9A 2XGOA 4EBAA 2JABA 1AWCB 2XRYA 2XPYA 3F6QA 4BTBA 4KVOA 3SBSA 3ASOE 3U3WA 2OVBA 1IKND 3CLJA 2Y4UA 5G04C 3O4ZA 5A6CA 3SGHA 4NIKA 5A23A 4JXTA 5ARFA 3RRMB 4RG6A 3BUAA 1MJ0A 3ASFA 3L82A 3N71A 1H0AA 2KC7A 4ANVA 2F0YA 2Y69E 5FIOA 4TXPA 5CBNA 2QYJA 4M3OA 2OCCE 5KJKA 4JL0A 2P9SG 2VYIA 3X2QE 3D9OA 3G2SA 4DLQA 1UW4B 1Z5SC 5T4YA 1DCQA 2CHZA 4ANWA 5AARA 5JHAA 3TJPA 1YCSB 3MKQA 2AW6A 2FULA 3JQ0A 2F8XK
chains in the Genus database with same CATH topology
4ZHBA 4C48B 3NBNB 3HRAA 1MX6A 2DVWA 3ZNGA 4BETA 1AP7A 1IHBA 1G3NB 1WG0A 4U95D 5HKPA 5AAOA 3J5QB 3AAAC 2BKGA 5HS0A 3HG0D 5EN5D 4J7WA 4GMRA 1TR4A 1OY3D 2ETAA 4GPMA 4HRMB 5EYLA 5EYPF 4DX1A 1BU9A 3ZUVB 4RLYA 4G8LA 5JA4D 2ETBA 4HLLA 1SVXA 5AQAA 3V2XA 5KBAA 1D9SA 2XEHA 3TWUA 2VGEA 3W9GA 4HNAD 2KXPC 4HRNA 2F37A 1QYMA 4DUIA 3AJIA 4DX6D 5EILA 4K5CA 2P2CP 4O60A 5ENQD 4ZFHA 4K5AB 4YDYA 2RFMA 1UOHA 5ITZF 2AJAA 4CYMD 3UTMA 4DRXE 4QFVA 2MYOA 4BEPA 4CZ2D 2BKKB 3UXGA 1K1BA 1S70B 4O1OA 3C5RA 5CERB 2ZGDA 1K3ZD 3B95A 4F6RD 1N11A 5ENTD 1WDYA 3T8KA 1IXVA 5KNHD 2JABA 1AWCB 1MYOA 3SO8A 1BLXB 1N0RA 3LJNA 4JB8P 5EIDA 3TWQA 4N5QA 4UUCA 4U8VD 2V5QC 2XEEA 3DEPA 3F6QA 2V4HC 1DC2A 2DZOA 2L6BA 3DEOA 1N0QA 1BI8B 2Y1LE 2PNNA 2ETCA 5CEDB 4HRLA 1MX4A 4LG6A 2FO1E 4Z68A 3EU9A 1K1AA 3KEAA 5AQBA 5ENRD 3TWWA 1NFIE 4BERA 3V79K 1IKND 4BESA 2F8XK 4U8YD 5FINA 4TUMA 4K5BA 3Q9NC 3TWRA 4F1PA 2F8YA 2XZDG 2Y0BG 2DZNA 3EHRA 4HB5A 4NIKA 2B0OE 4YDWA 3V31A 5BXUA 3J5PA 2DWZA 2RFAA 5AQ7A 3TWXA 5CEAA 1MX2A 1MJ0A 4J8YA 1A5EA 2J8SD 3W9FA 3ZKJA 5AQ9A 5CECB 4HQDA 4U96D 3JXIA 5CBOA 4LSZE 4A63B 1OT8A 1SW6A 5KWDA 4QQIA 5FIOA 2A5EA 5HRYA 4B93B 4ATZD 5D66A 5KNGA 5CBNA 2QYJA 4OAUC 4OAVB 3TWSA 4LNUD 3TWVA 4G8KA 2XENA 3V2OA 5BXOA 5ENOD 2XZTG 5EIBE 2ZGGA 4HI9A 3T9KA 3IXEA 1YMPA 3EHQA 4BSZB 1BD8A 2HE0A 3JXJA 5ENSD 3JUEA 1BI7B 4HBDA 1DCQA 3V30A 2NYJA 4DX5D 4DX2A 3D9HA 3TWTA 3UI2A 2KBXA 5AARA 4HI8A 3Q9UC 1YCSB 4DX7D 5AN8A 2QC9A 3NOGD 4O1PA 5JMND 3ZU7B 5ENPD 3NOCD 3B7BA 1YYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHB A;  4C48 B;  3NBN B;  3HRA A;  1MX6 A;  2DVW A;  3ZNG A;  4BET A;  1AP7 A;  1IHB A;  1G3N B;  1WG0 A;  4U95 D;  5HKP A;  5AAO A;  3J5Q B;  3AAA C;  2BKG A;  5HS0 A;  3HG0 D;  5EN5 D;  4J7W A;  4GMR A;  1TR4 A;  1OY3 D;  2ETA A;  4GPM A;  4HRM B;  5EYL A;  5EYP F;  4DX1 A;  1BU9 A;  3ZUV B;  4RLY A;  4G8L A;  5JA4 D;  2ETB A;  4HLL A;  1SVX A;  5AQA A;  3V2X A;  5KBA A;  1D9S A;  2XEH A;  3TWU A;  2VGE A;  3W9G A;  4HNA D;  2KXP C;  4HRN A;  2F37 A;  1QYM A;  4DUI A;  3AJI A;  4DX6 D;  5EIL A;  4K5C A;  2P2C P;  4O60 A;  5ENQ D;  4ZFH A;  4K5A B;  4YDY A;  2RFM A;  1UOH A;  5ITZ F;  2AJA A;  4CYM D;  3UTM A;  4DRX E;  4QFV A;  2MYO A;  4BEP A;  4CZ2 D;  2BKK B;  3UXG A;  1K1B A;  1S70 B;  4O1O A;  3C5R A;  5CER B;  2ZGD A;  1K3Z D;  3B95 A;  4F6R D;  1N11 A;  5ENT D;  1WDY A;  3T8K A;  1IXV A;  5KNH D;  2JAB A;  1AWC B;  1MYO A;  3SO8 A;  1BLX B;  1N0R A;  3LJN A;  4JB8 P;  5EID A;  3TWQ A;  4N5Q A;  4UUC A;  4U8V D;  2V5Q C;  2XEE A;  3DEP A;  3F6Q A;  2V4H C;  1DC2 A;  2DZO A;  2L6B A;  3DEO A;  1N0Q A;  1BI8 B;  2Y1L E;  2PNN A;  2ETC A;  5CED B;  4HRL A;  1MX4 A;  4LG6 A;  2FO1 E;  4Z68 A;  3EU9 A;  1K1A A;  3KEA A;  5AQB A;  5ENR D;  3TWW A;  1NFI E;  4BER A;  3V79 K;  1IKN D;  4BES A;  2F8X K;  4U8Y D;  5FIN A;  4TUM A;  4K5B A;  3Q9N C;  3TWR A;  4F1P A;  2F8Y A;  2XZD G;  2Y0B G;  2DZN A;  3EHR A;  4HB5 A;  4NIK A;  2B0O E;  4YDW A;  3V31 A;  5BXU A;  3J5P A;  2DWZ A;  2RFA A;  5AQ7 A;  3TWX A;  5CEA A;  1MX2 A;  1MJ0 A;  4J8Y A;  1A5E A;  2J8S D;  3W9F A;  3ZKJ A;  5AQ9 A;  5CEC B;  4HQD A;  4U96 D;  3JXI A;  5CBO A;  4LSZ E;  4A63 B;  1OT8 A;  1SW6 A;  5KWD A;  4QQI A;  5FIO A;  2A5E A;  5HRY A;  4B93 B;  4ATZ D;  5D66 A;  5KNG A;  5CBN A;  2QYJ A;  4OAU C;  4OAV B;  3TWS A;  4LNU D;  3TWV A;  4G8K A;  2XEN A;  3V2O A;  5BXO A;  5ENO D;  2XZT G;  5EIB E;  2ZGG A;  4HI9 A;  3T9K A;  3IXE A;  1YMP A;  3EHQ A;  4BSZ B;  1BD8 A;  2HE0 A;  3JXJ A;  5ENS D;  3JUE A;  1BI7 B;  4HBD A;  1DCQ A;  3V30 A;  2NYJ A;  4DX5 D;  4DX2 A;  3D9H A;  3TWT A;  3UI2 A;  2KBX A;  5AAR A;  4HI8 A;  3Q9U C;  1YCS B;  4DX7 D;  5AN8 A;  2QC9 A;  3NOG D;  4O1P A;  5JMN D;  3ZU7 B;  5ENP D;  3NOC D;  3B7B A;  1YYH A; 
#chains in the Genus database with same CATH topology
 4Q94 A;  4U0Z A;  2WXN A;  2FF4 A;  4P29 A;  3ZGQ A;  2ETA A;  4HRM B;  5EYL A;  2ZXW E;  3P2B A;  3ZIM A;  2RFM A;  4XZ4 A;  4EBA G;  3AS4 A;  4GZ6 A;  2HYZ A;  3CIA A;  3RRN B;  1HE8 A;  3BQO A;  3L9T A;  3CHR A;  4YVQ C;  5FZS A;  1EDU A;  2L6B A;  3VLD A;  1ZU2 A;  3Q7F A;  1WAO 1;  3T5V A;  2LSU A;  1NFI E;  5G05 J;  4TUM A;  1HH8 A;  4YVO A;  4GPK A;  3E32 A;  2Y0B G;  3B7U X;  1FVH A;  3U4T A;  4JW1 A;  1FVF A;  2GRO B;  2V4L A;  2BTD A;  3ML9 A;  2XPI A;  4TXR A;  3G2W A;  3E37 A;  2JEK A;  4I2Z A;  4OAU C;  2XGM A;  2R02 A;  1TEZ A;  3JCK C;  2VSN A;  1S0P A;  2J9Q A;  4IUL A;  4CEM A;  2ION A;  2Y4T A;  1OWM A;  3UI2 A;  2NC9 A;  4JEH A;  4HS2 A;  1LTX A;  3UKR G;  4AY5 A;  2A4Z A;  2QYU A;  2M63 A;  2R59 A;  2PQR A;  4B89 A;  2R2L A;  3I4R B;  2P9P G;  4GMR A;  4CDN A;  2XEH A;  4CGV A;  3CST A;  4WND A;  2GW1 A;  3PUJ A;  3Q4A B;  2MYO A;  4U07 A;  3SZ7 A;  1WDY A;  4JB8 P;  1HS6 A;  3RRU A;  2JLB A;  3RO3 A;  3CGH A;  3HIZ A;  1E8X A;  1Y8M A;  2PNN A;  3GYZ A;  3JQ1 A;  3EUV A;  1N95 A;  3V79 K;  3AG3 E;  3DXK G;  2AWI A;  3MEK A;  4BES A;  3APD A;  2E0I A;  3AU4 A;  4G24 A;  4ANX A;  4GTR A;  4W9R A;  3J5P A;  2P9N G;  3U66 A;  4XI9 A;  2J8S D;  4HQD A;  2X38 A;  3FTX A;  1K8K G;  5KWD A;  3I4G A;  4B8A A;  3PZ1 A;  2V8S E;  5D66 A;  3ESL A;  1OXJ A;  2VJ8 A;  3T9K A;  4GTM A;  3EIJ A;  1BI7 B;  2LAI A;  3CVN A;  3Q5M A;  5G04 J;  1E7U A;  1NP7 A;  4UWH A;  2DCP A;  2VGX A;  3DPD A;  3HXF A;  4J6I A;  1JWF A;  2KAT A;  4WNF A;  1D8D A;  2WQ7 A;  1H19 A;  3MKQ B;  3R9M A;  3T8M A;  3PEV B;  3Q7A A;  2CG2 A;  4G8L A;  4G25 A;  4DUI A;  2KXP C;  1SZA A;  2WXR A;  4XEI G;  2QY7 A;  3IBE A;  4KT6 B;  2AXV A;  4WWP A;  2IFU A;  3TWQ A;  4H7Y A;  3TG4 A;  4TV3 A;  3CKC A;  4UWK A;  3CHP A;  3D9M A;  1NA0 A;  3S7F A;  3PH0 C;  4ILI A;  4NUR A;  4I1A A;  5CMW A;  4HOT A;  3KAE A;  3LY8 A;  4YDW A;  3CK7 A;  2KCV A;  3TWX A;  1RW2 A;  3HXC A;  4GMJ A;  4KZ0 A;  4JHR A;  3D3M A;  3NF1 A;  1SW6 A;  2WQ6 A;  3B7R L;  3ABM E;  1S64 A;  3SNX A;  2A5E A;  2LAH A;  3T5X A;  4YDO A;  3HHM A;  4FJY A;  2J08 A;  3UKU G;  2IQC A;  1OCZ E;  4JHK A;  4Y6W A;  3ASD A;  4J8E A;  2I2O A;  3WG7 E;  1HG5 A;  2NYJ A;  2KZT A;  2QZA A;  3SD5 A;  3QWP A;  3SFX A;  1LD8 A;  3APC A;  1OUV A;  5ENP D;  4BFR A;  2WXG A;  3KD7 A;  4C48 B;  2WXK A;  2I9C A;  5DBK A;  2I6H A;  5IY5 E;  2X6K A;  2UY1 A;  3CHM A;  4GPM A;  4RLY A;  2WXH A;  4HLL A;  2XCB A;  3CVP A;  3EDT B;  5BT1 A;  1TN6 A;  4GA0 A;  4A3V A;  3MYV A;  3NZS A;  3C98 A;  4XKC A;  4N3C A;  4N5C A;  1WY6 A;  5EDS A;  4N5Q A;  2XEE A;  1HZ4 A;  2Y1L E;  4I17 A;  3FH8 A;  3TXN A;  1Z3Y A;  2VTB A;  5KJM A;  3ZHE A;  5AYW D;  4B94 A;  1HX8 A;  3MA5 A;  4UWG A;  1OCC E;  3OTN A;  4FLH A;  2WXP A;  3HXB A;  2WVI A;  4HOR A;  3WXX A;  4I1M A;  3FU6 A;  4Y6C A;  4B8C B;  4HI9 A;  3QJZ A;  3B7T A;  3HXE A;  3FUH A;  3QWW A;  1OWP A;  2E2E A;  4M7C A;  3UM1 A;  3KSL A;  3S7J A;  3NOG D;  2WXI A;  4O1P A;  2VSX E;  2XS8 A;  2H6H A;  1YYH A;  1JUQ A;  4C0E A;  2J49 A;  1MX6 A;  1V54 E;  3AG4 E;  2LO6 A;  3UTM A;  2H6F A;  5HI7 A;  1H2V C;  3B7S A;  4BTA A;  2VGX B;  3R9A B;  3UIP C;  2IOL A;  5C2Y A;  4N2S A;  1U3D A;  5FQ4 A;  1N11 A;  3LVQ E;  3IHV A;  5EID A;  4ACL A;  5JHB A;  2EQX A;  1XNF A;  1NL4 A;  3TXM A;  3EU9 A;  3KEA A;  2NSZ A;  3Q73 A;  4KZC A;  2GRP B;  3ULY A;  5BXU A;  1MQS A;  2DWZ A;  5AQ7 A;  1UG3 A;  5FJY A;  2OEV A;  1N4Q A;  4GTO A;  3ZKJ A;  3FP3 A;  4LER A;  4YDE A;  3DWL G;  4HXI A;  1MZC A;  2R05 A;  2ILR A;  3GZ1 A;  1Z3X A;  1O1R A;  1OWL A;  3UT7 A;  1NZN A;  4DX2 A;  3QKY A;  3CVQ A;  1U3C A;  2PQN A;  4N3B A;  3NOC D;  4A1S A;  3C3O A;  3NBN B;  5FQ6 A;  3L17 A;  2OV8 A;  3UT4 A;  3FWV A;  2KZT B;  2B6C A;  4BET A;  1IHB A;  4GYW A;  5AAO A;  1OY3 D;  5EYP F;  4B0Z A;  2XS1 A;  4AIF A;  3CVW A;  1INZ A;  2H6I A;  3ZXP A;  3LJ3 A;  2UY1 B;  4F6R D;  5D0O D;  2YIN A;  3O48 A;  2LXL A;  1DC2 A;  3CR3 A;  5H7P A;  4XKB A;  4G1T A;  1HG2 A;  5AQB A;  2LSV A;  4GZD A;  4RVB A;  3D9N A;  5AIJ A;  1PC2 A;  1JCQ A;  4J8Y A;  1TNU A;  5AJL A;  3SI5 A;  3JXI A;  4LSZ E;  2WPV A;  2VTB B;  3ZHE B;  1O5M A;  3D9K A;  5G2N A;  3CVU A;  5BXO A;  4AVX A;  3FUJ A;  4GZ5 A;  5EX3 A;  4BSZ B;  1BD8 A;  4J8S A;  4U8H A;  5BUZ A;  3Q49 B;  4FJZ A;  2RD0 A;  3CEQ A;  3TWT A;  3ZFW A;  2IOS A;  4LRZ A;  2QFC A;  1TNB A;  4LCT A;  3ESK A;  3B7B A;  2IO3 C;  1NA3 A;  5ENN A;  4ZHB A;  3NB2 A;  3FH5 A;  2MOW A;  3C3R A;  1EF1 C;  2C0L A;  3KSQ A;  3PE3 A;  3ZEF A;  5FZQ A;  4FU3 A;  1JCS A;  2GRM A;  5M72 A;  5HS0 A;  4U63 A;  3ONK A;  2FI7 A;  4G11 A;  1D9S A;  3Q15 A;  1SZ9 A;  4DLO A;  1N9A A;  4HFG A;  4PS3 A;  1QYM A;  2P2C P;  3G2U A;  3UIN C;  1UOH A;  3LY9 A;  3UT8 A;  2AJA A;  4AP2 A;  4O1O A;  5CER B;  2PM6 A;  1K3Z D;  3PZ2 A;  4LNG A;  3S7D A;  5KNH D;  1QZ2 A;  1N0R A;  4EEC A;  3ZVV A;  1W3B A;  5JJ7 A;  3ISM C;  2AVP A;  4K0R A;  2LXM A;  3RO2 A;  2J4B A;  3C72 A;  1MX4 A;  3SHF A;  5FWQ A;  5T8I A;  4CT4 A;  4APO A;  3CVV A;  4ANU A;  4CDR A;  1GW6 A;  3L13 A;  2ZIS A;  2X6H A;  1QNF A;  3FHE A;  3QC1 A;  4PUC A;  5J90 A;  3OXG A;  3CVX A;  3HYM B;  4DI3 A;  1L5J A;  1QBQ A;  3MX3 A;  4G26 A;  3RK6 A;  4UI9 C;  2Y3A A;  4FHJ A;  4I9E A;  3LVR E;  3HXD A;  3DSV A;  3FTY A;  3FFL A;  4JZY A;  3QWV A;  4MRU A;  3CHO A;  1JCR A;  1JPL A;  4L9P A;  1KPS B;  4RQI A;  2KBX A;  4DX7 D;  3OXF A;  5BV0 A;  4HVB A;  1D8E A;  1H6K A;  3URZ A;  2DVW A;  2FBN A;  4J8D A;  1G3N B;  4CRW A;  3HG0 D;  3ZW3 A;  2R17 C;  2UWJ G;  4H7X A;  5KBA A;  3CVL A;  5ANL A;  1TN8 A;  2KCK A;  1H2U A;  2F37 A;  3VLE A;  1K1B A;  3RAU A;  4EZJ A;  3CK8 A;  1KT1 A;  3B95 A;  1ELW A;  3ZN3 A;  3LJN A;  3Q78 A;  2ZIR A;  2XHE A;  3R7R A;  1FT1 A;  2WB2 A;  4AM9 A;  4N3A A;  4ME2 A;  4JPS A;  1MHQ A;  4FLB A;  3VTX A;  3QNK A;  2RFA A;  4DJA A;  5CCL A;  4JHJ A;  3DST A;  3U64 A;  3LCA A;  3ABL E;  4L1B A;  4A55 A;  3RSE G;  3ULE G;  1DNP A;  2DIW A;  2YQ8 A;  3B13 A;  3TWS A;  4G8K A;  3DXM G;  3FEY A;  5EIB E;  4DK5 A;  3IXE A;  4JA9 A;  3CHS A;  1SQM A;  4URK A;  3MGB A;  2EIK E;  1N4S A;  3V30 A;  4GZC A;  4EQF A;  5E76 A;  4XIF A;  3HDX A;  2Q7F A;  4IN3 B;  5AN8 A;  3MKR A;  4XE0 A;  4I1O B;  2I1J A;  3PZ4 A;  3FUD A;  4O6F A;  1WG0 A;  4U95 D;  2XGS A;  3OXL A;  1TR4 A;  1BU9 A;  5JA4 D;  2ETB A;  3ZYK A;  3EU5 A;  2H6G A;  4I6E A;  3W9G A;  1N54 A;  4O60 A;  3FU5 A;  2OEW A;  5C1D A;  4TRQ A;  1HF8 A;  4BT8 A;  4ABN A;  3T8K A;  4OVU A;  3LEW A;  5CCM A;  4CT0 A;  3QAQ A;  3ZYM A;  3QOU A;  4GCO A;  3EIQ C;  4EPZ A;  1FT2 A;  2CFU A;  3EHN A;  5EX0 A;  3CK9 A;  5BV1 A;  2CFZ A;  4L7T A;  2BF0 X;  1HU3 A;  1E7V A;  5LCW C;  2DZN A;  3NAW A;  4GTP A;  3V31 A;  4IYP A;  2YHE A;  1RZ4 A;  3ULQ A;  1KZO A;  1LF8 A;  4J0U A;  3LS8 A;  2L0T B;  4U7E B;  2GGF A;  1H2T C;  1O1T A;  3PEU B;  2V0P A;  2XZT G;  3ML8 A;  3IV0 A;  4LUN U;  3D9L A;  3UQ3 A;  4OVV A;  3PE4 A;  4PS7 A;  4DI4 A;  3JUE A;  1QQE A;  1JWG A;  3Q9U C;  4FHK A;  4U0U A;  2EIN E;  3V2O A;  5KCM A;  3EJN A;  3DBS A;  3LPZ A;  3ZNG A;  4E85 A;  4N39 A;  1FCH A;  4WWO A;  3AAA C;  4UI9 J;  3L08 A;  3CV0 A;  2OVF A;  3S2A A;  3CQC B;  4MBG A;  4K5C A;  1U2V G;  4BY6 A;  4K5A B;  2CHW A;  4Q69 A;  4GYO A;  5BPP A;  3E30 A;  4QFV A;  2MRI A;  5D2M C;  3FUL A;  2CG3 A;  1E96 B;  5ENT D;  4TXQ A;  1MYO A;  3SO8 A;  1EPU A;  4GB9 A;  1N94 A;  5AJD A;  3FUM A;  2OOE A;  2AXZ A;  3TWW A;  1EYH A;  1E8Z A;  4GA1 A;  3E34 A;  1YA0 A;  4F1P A;  2PZI A;  4IRU A;  5FQ8 A;  5E75 A;  1VDY A;  3ONL A;  4F3V A;  1B89 A;  3DPY A;  5BNW A;  5HRY A;  5KJL A;  4KMO A;  2XRZ A;  3OAW A;  3MZL B;  2NXP A;  2VQ2 A;  1N4P A;  3CHQ A;  5B1B E;  2P9U G;  3FY4 A;  4GAA A;  4UI9 K;  3SY2 A;  2WXL A;  5CRU A;  3G2V A;  4U0S A;  3PUK A;  3L22 A;  2LUH A;  3FEX A;  1X5B A;  3ZRH A;  2BKG A;  4EZL A;  2DYS E;  3ZUV B;  3HVE B;  4KXK B;  5AQA A;  1DVP A;  4HRN A;  4DX6 D;  4KVM A;  1BPO A;  4HOU A;  4CYM D;  2P9L G;  3LXU X;  3CSF A;  5JJ6 A;  2ZGD A;  1IYG A;  2WQH A;  4FP7 A;  1SA4 A;  1PY1 A;  3JYS A;  1BLX B;  2C2L A;  4MKT A;  1OCO E;  4WWN A;  2WXQ A;  4AEZ C;  3BU8 A;  2ZU6 B;  2A5U A;  4F1S A;  3EHR A;  3U9W A;  5EKQ D;  5A7D B;  4KBQ A;  3BG1 B;  1IQR A;  5CEC B;  1ZBP A;  2OND A;  4JC8 A;  2C0M A;  2R03 A;  3MV2 B;  3RU0 A;  4I9C A;  4ATZ D;  4V3I A;  4I6J A;  4OAV B;  4UQZ A;  3IHY A;  4GA2 A;  4KYO B;  5FT9 A;  4NAC A;  5FZR A;  2GRQ B;  3TG5 A;  4HBD A;  4F53 A;  5ARG A;  2VGY A;  2CHX A;  5LCW J;  4DPR A;  3KS2 A;  3AG1 E;  4HLE A;  5HQ8 A;  4BX9 A;  3ZPJ A;  1HO8 A;  2X3M A;  4JVS A;  4F7A A;  3UM2 A;  1TNO A;  3ZYL A;  5HKP A;  4G23 A;  3QK0 A;  4PH4 B;  1SVX A;  1KZP A;  3V2X A;  3FTV A;  4WNG A;  4R7L A;  2VGE A;  3LYA A;  2L6J A;  3AJI A;  4LNB A;  3ABK E;  4WAF A;  2BKK B;  4EZK A;  3C5R A;  4D10 C;  4I2W A;  4ACK A;  4N2Q A;  4XX5 A;  2EIL E;  3L6A A;  4UUC A;  4L2L A;  3DEP A;  1KLX A;  1NI1 A;  2WXO A;  2HM8 A;  3MJW A;  4L2Y A;  5JJT A;  4U8Y D;  4RG9 A;  5FIN A;  1OCR E;  2XZD G;  4Q96 A;  2WXM A;  2MHK A;  2KM4 A;  5B3S E;  4UWF A;  4ILG A;  2FO7 A;  5AQ9 A;  2PM7 A;  4U96 D;  4X8Q A;  1E90 A;  4CDM A;  4ATG A;  4WNE A;  2VSY A;  3BG0 B;  3GW4 A;  4LNU D;  3RKV A;  4JEU A;  3E33 A;  3D9P A;  3FU3 A;  2HE0 A;  1DCE A;  3JXJ A;  5ENS D;  3P1U A;  2J4D A;  3PNL B;  3PNT B;  4GZ3 A;  3PS6 A;  4I6G A;  3ASH A;  2P58 C;  1X81 A;  2BED A;  2QC9 A;  5JMN D;  3VLF A;  1XGW A;  4GTS A;  1IHG A;  2WXJ A;  5B1A E;  2AXU A;  4TUU A;  4UQX A;  4LEU A;  2WMN A;  1ELK A;  3LY7 A;  4DX1 A;  3MCX A;  3Q79 A;  1O1S A;  3TAX A;  3SF4 A;  3FTZ A;  3FTS A;  5EIL A;  3UPV A;  2LNI A;  3RJV A;  4CZ2 D;  4BWR A;  1S70 B;  4HOQ A;  4C0M A;  1KT0 A;  1IXV A;  4E6H A;  4JA7 A;  3FUN A;  1A17 A;  3D9J A;  4GTQ A;  3BEE A;  2V5Q C;  3Q47 B;  1N52 A;  5G55 A;  3EHM A;  2DZO A;  4WUY A;  1N0Q A;  3FDH A;  4LG6 A;  3AS5 A;  3ENE A;  1PAQ A;  3JUI A;  2GRR B;  3GZS A;  2WXF A;  5LP0 A;  3FUK A;  3TWR A;  2F8Y A;  4HB5 A;  4UQY A;  5CEA A;  4C9B B;  5CRV A;  3W9F A;  2YNQ A;  4BX8 A;  3LDZ A;  3FUI A;  4CCA A;  3LKU A;  2P9K G;  2XEN A;  5ENO D;  1YMP A;  1TYQ G;  3EHQ A;  3L16 A;  2P9I G;  4U04 A;  3QAR A;  4DX5 D;  5AEN A;  3GZ2 A;  4HI8 A;  5T3R A;  5LX8 A;  2EIJ E;  3UM0 A;  1LD7 A;  3UMV A;  3CQG B;  3AG2 E;  4J8F A;  2FEZ A;  3DSU A;  1ELR A;  4GYY A;  2XEV A;  2R5S A;  4FC8 A;  3MV3 B;  4MS6 A;  4NQ0 A;  1P5Q A;  3TL5 A;  1N4R A;  2IF4 A;  3I3N A;  1IQU A;  3PZD A;  5DIZ A;  5LFA A;  2X6F A;  1Q2Z A;  3PZ3 A;  3RIB A;  3FUF A;  2IJG X;  5ENQ D;  2HO1 A;  4GML A;  1S63 A;  3FTW A;  4OYS A;  3HVE A;  2XCC A;  2WMO A;  1HXI A;  3UIO C;  4K03 A;  3NZU A;  3VTY A;  3QB2 A;  4FAD A;  5J08 A;  5KJN A;  4NRH B;  1SA5 A;  2EIM E;  2IY0 C;  4U8V D;  1Y6I A;  2V4H C;  3DEO A;  3SFY A;  2XQ0 A;  4AJW A;  2ETC A;  3TGO A;  2J09 A;  3ASN E;  3FU0 A;  4HRL A;  4RSY A;  1K1A A;  4BER A;  4AY6 A;  2WM9 A;  5FQ7 A;  4AXH A;  1TNZ A;  1E8Y A;  1TJC A;  2GRL A;  5CHE E;  1UJJ A;  2J07 A;  1A5E A;  1E8W A;  4A63 B;  1OT8 A;  3DSX A;  3R7Q A;  4B93 B;  5KNG A;  4GTT A;  3FH7 A;  3IKO B;  3TWV A;  2I1K A;  3PRZ A;  3C3Q A;  4HOS A;  3CKB A;  2IEJ A;  3PRE A;  4GTV A;  5LOZ A;  1FPP A;  4PDX A;  3ZYQ A;  3L54 A;  3D9H A;  2X6J A;  5FTP A;  3QDN A;  4FA6 A;  3ZU7 B;  4XI0 A;  3UUX A;  3HRA A;  2RKK A;  3S7B A;  2L9B A;  1AP7 A;  3DRA A;  4GU5 A;  3J5Q B;  4MLP A;  4FUL A;  5G05 C;  5EN5 D;  4J7W A;  4G2V A;  4JD2 G;  3PVL A;  1HFA A;  3TWU A;  1ZB1 A;  3G2T A;  4HNA D;  3PDN A;  4ZFH A;  4YDY A;  1OWN A;  3SBT B;  5ITZ F;  4DRX E;  4BEP A;  2X6I A;  2GRN B;  4AOF A;  4APF A;  4CGW A;  3IEG A;  3DSW A;  4EHM A;  1H6O A;  1BI8 B;  5CED B;  5D0Q D;  2IU1 A;  2FO1 E;  3ZXS A;  4Z68 A;  5ENR D;  4A3T A;  1UN8 A;  4K5B A;  3UX4 A;  3Q9N C;  2L0I A;  2B0O E;  4PS8 A;  1MX2 A;  4AV7 A;  3E4B A;  5BW8 C;  2RG8 A;  5CBO A;  2IO2 C;  5ANR A;  4A1G A;  4QQI A;  3K9I A;  2DBA A;  3APF A;  4BSX A;  4ILH B;  2BUG A;  4BT9 A;  2ZGG A;  1TN7 A;  2VSO E;  1UJK A;  2HR2 A;  3SFZ A;  4GCN A;  3AU5 A;  4YND A;  1Z6T A;  2YHC A;  3CVY A;  2PL2 A;  3I5P A;  3FTU A;  3AS8 A;  3D9I A;  3Q75 A;  3FUE A;  3NQP A;  4L23 A;  4UWL A;  1TNY A;  1V55 E;  3KEZ A;  3DSS A;  3ASG A;  2XPZ A;  3UM3 A;  1WM5 A;  2KCL A;  5CMY A;  2DYR E;  2V5F A;  3UXG A;  1OWO A;  4I43 A;  3SQV A;  1TJF A;  1H6P A;  1UN9 A;  2XGO A;  4EBA A;  2JAB A;  1AWC B;  2XRY A;  2XPY A;  3F6Q A;  4BTB A;  4KVO A;  3SBS A;  3ASO E;  3U3W A;  2OVB A;  1IKN D;  3CLJ A;  2Y4U A;  5G04 C;  3O4Z A;  5A6C A;  3SGH A;  4NIK A;  5A23 A;  4JXT A;  5ARF A;  3RRM B;  4RG6 A;  3BUA A;  1MJ0 A;  3ASF A;  3L82 A;  3N71 A;  1H0A A;  2KC7 A;  4ANV A;  2F0Y A;  2Y69 E;  5FIO A;  4TXP A;  5CBN A;  2QYJ A;  4M3O A;  2OCC E;  5KJK A;  4JL0 A;  2P9S G;  2VYI A;  3X2Q E;  3D9O A;  3G2S A;  4DLQ A;  1UW4 B;  1Z5S C;  5T4Y A;  1DCQ A;  2CHZ A;  4ANW A;  5AAR A;  5JHA A;  3TJP A;  1YCS B;  3MKQ A;  2AW6 A;  2FUL A;  3JQ0 A;  2F8X K; 
#chains in the Genus database with same CATH homology
 4ZHB A;  4C48 B;  3NBN B;  3HRA A;  1MX6 A;  2DVW A;  3ZNG A;  4BET A;  1AP7 A;  1IHB A;  1G3N B;  1WG0 A;  4U95 D;  5HKP A;  5AAO A;  3J5Q B;  3AAA C;  2BKG A;  5HS0 A;  3HG0 D;  5EN5 D;  4J7W A;  4GMR A;  1TR4 A;  1OY3 D;  2ETA A;  4GPM A;  4HRM B;  5EYL A;  5EYP F;  4DX1 A;  1BU9 A;  3ZUV B;  4RLY A;  4G8L A;  5JA4 D;  2ETB A;  4HLL A;  1SVX A;  5AQA A;  3V2X A;  5KBA A;  1D9S A;  2XEH A;  3TWU A;  2VGE A;  3W9G A;  4HNA D;  2KXP C;  4HRN A;  2F37 A;  1QYM A;  4DUI A;  3AJI A;  4DX6 D;  5EIL A;  4K5C A;  2P2C P;  4O60 A;  5ENQ D;  4ZFH A;  4K5A B;  4YDY A;  2RFM A;  1UOH A;  5ITZ F;  2AJA A;  4CYM D;  3UTM A;  4DRX E;  4QFV A;  2MYO A;  4BEP A;  4CZ2 D;  2BKK B;  3UXG A;  1K1B A;  1S70 B;  4O1O A;  3C5R A;  5CER B;  2ZGD A;  1K3Z D;  3B95 A;  4F6R D;  1N11 A;  5ENT D;  1WDY A;  3T8K A;  1IXV A;  5KNH D;  2JAB A;  1AWC B;  1MYO A;  3SO8 A;  1BLX B;  1N0R A;  3LJN A;  4JB8 P;  5EID A;  3TWQ A;  4N5Q A;  4UUC A;  4U8V D;  2V5Q C;  2XEE A;  3DEP A;  3F6Q A;  2V4H C;  1DC2 A;  2DZO A;  2L6B A;  3DEO A;  1N0Q A;  1BI8 B;  2Y1L E;  2PNN A;  2ETC A;  5CED B;  4HRL A;  1MX4 A;  4LG6 A;  2FO1 E;  4Z68 A;  3EU9 A;  1K1A A;  3KEA A;  5AQB A;  5ENR D;  3TWW A;  1NFI E;  4BER A;  3V79 K;  1IKN D;  4BES A;  2F8X K;  4U8Y D;  5FIN A;  4TUM A;  4K5B A;  3Q9N C;  3TWR A;  4F1P A;  2F8Y A;  2XZD G;  2Y0B G;  2DZN A;  3EHR A;  4HB5 A;  4NIK A;  2B0O E;  4YDW A;  3V31 A;  5BXU A;  3J5P A;  2DWZ A;  2RFA A;  5AQ7 A;  3TWX A;  5CEA A;  1MX2 A;  1MJ0 A;  4J8Y A;  1A5E A;  2J8S D;  3W9F A;  3ZKJ A;  5AQ9 A;  5CEC B;  4HQD A;  4U96 D;  3JXI A;  5CBO A;  4LSZ E;  4A63 B;  1OT8 A;  1SW6 A;  5KWD A;  4QQI A;  5FIO A;  2A5E A;  5HRY A;  4B93 B;  4ATZ D;  5D66 A;  5KNG A;  5CBN A;  2QYJ A;  4OAU C;  4OAV B;  3TWS A;  4LNU D;  3TWV A;  4G8K A;  2XEN A;  3V2O A;  5BXO A;  5ENO D;  2XZT G;  5EIB E;  2ZGG A;  4HI9 A;  3T9K A;  3IXE A;  1YMP A;  3EHQ A;  4BSZ B;  1BD8 A;  2HE0 A;  3JXJ A;  5ENS D;  3JUE A;  1BI7 B;  4HBD A;  1DCQ A;  3V30 A;  2NYJ A;  4DX5 D;  4DX2 A;  3D9H A;  3TWT A;  3UI2 A;  2KBX A;  5AAR A;  4HI8 A;  3Q9U C;  1YCS B;  4DX7 D;  5AN8 A;  2QC9 A;  3NOG D;  4O1P A;  5JMN D;  3ZU7 B;  5ENP D;  3NOC D;  3B7B A;  1YYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...