2PNNA

Crystal structure of the ankyrin repeat domain of trpv1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
248
Chain Sequence
LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title The Ankyrin Repeats of TRPV1 Bind Multiple Ligands and Modulate Channel Sensitivity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 73
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2pnnA00
1K1BA 3LJNA 3EU9A 2NYJA 5CBOA 1D9SA 2QYJA 5HS0A 2KBXA 3NOGD 4HRMB 3ZU7B 2XEEA 2Y0BG 3SO8A 5AQ9A 5ENPD 4LNUD 3J5QB 1YMPA 3F6QA 1MJ0A 5KWDA 4HI9A 1IXVA 4K5AB 3Q9UC 3B7BA 5EN5D 1WDYA 2KXPC 3TWVA 4ZFHA 5CECB 4YDWA 4DUIA 5EYLA 1MX4A 3TWXA 4DX1A 5EYPF 3W9GA 5JA4D 1OY3D 4LG6A 3ZNGA 5CEDB 2DWZA 4GPMA 1TR4A 4HLLA 4O1PA 2B0OE 3TWQA 3AJIA 1N11A 2VGEA 2XZTG 3IXEA 5JMND 4CZ2D 5AARA 2JABA 3NOCD 5AN8A 5D66A 3V31A 4N5QA 5BXUA 2ETBA 4QFVA 4U95D 5BXOA 3AAAC 4C48B 4J7WA 3ZKJA 2DZOA 3V79K 1BD8A 2RFAA 2A5EA 4HI8A 2AJAA 1SW6A 4DX6D 5AQAA 4G8LA 4DX5D 1YYHA 3JXJA 3ZUVB 4Z68A 5KNHD 4GMRA 3J5PA 2V4HC 4F6RD 1S70B 3JUEA 4A63B 5ENRD 2DVWA 4HRNA 3HRAA 3TWWA 3T8KA 5EIBE 3V2XA 1OT8A 4OAVB 3T9KA 3TWRA 3W9FA 4DX2A 4J8YA 4CYMD 5ENOD 1K1AA 4F1PA 5AQBA 1N0QA 2L6BA 2PNNA 2V5QC 2ZGDA 1MX2A 5FINA 2F37A 5KNGA 2Y1LE 1YCSB 4ZHBA 1A5EA 5AQ7A 3JXIA 5EIDA 1SVXA 5ENSD 3KEAA 3EHRA 5CEAA 4K5CA 4RLYA 2ZGGA 4U8VD 5ITZF 1IHBA 1QYMA 3TWSA 2XENA 2QC9A 2FO1E 1AP7A 2HE0A 1BI7B 1IKND 1BI8B 4LSZE 5HKPA 1K3ZD 3DEPA 1MX6A 2XZDG 3Q9NC 3C5RA 3UI2A 4ATZD 5CBNA 3D9HA 1N0RA 1BLXB 4BSZB 5CERB 1BU9A 4O60A 5AAOA 3V30A 3EHQA 2ETAA 5HRYA 1DCQA 4DX7D 1DC2A 5KBAA 4UUCA 3B95A 1NFIE 1WG0A 4U8YD 4O1OA 4HB5A 3TWTA 4TUMA 2BKKB 3DEOA 2MYOA 4G8KA 5ENTD 4BESA 4HBDA 2P2CP 4JB8P 4OAUC 2BKGA 2F8YA 3HG0D 5FIOA 2DZNA 4HNAD 3UTMA 2F8XK 4U96D 4QQIA 4BEPA 2ETCA 5EILA 3NBNB 4BETA 1MYOA 3UXGA 1G3NB 1UOHA 4K5BA 4DRXE 2RFMA 4NIKA 4B93B 1AWCB 4HQDA 4YDYA 3TWUA 2J8SD 3V2OA 4HRLA 2XEHA 5ENQD 4BERA
chains in the Genus database with same CATH superfamily
4KBQA 3AG2E 3MYVA 3EU9A 5A7DB 1NZNA 2ZIRA 2FULA 4GTVA 3R9MA 4GYWA 4XX5A 3ESLA 3PVLA 4JHKA 5ENNA 2EINE 2YINA 3CQGB 3CKCA 2ONDA 2LSUA 3Q9UC 4HXIA 1OWNA 3HXCA 5FQ8A 4JD2G 2VYIA 4W9RA 3NOCD 4JEUA 3JQ1A 4I1OB 4GA2A 1NA0A 4ATGA 3JXJA 3J5PA 1HU3A 3QB2A 5A6CA 4UWGA 1H6OA 4YVOA 3UQ3A 3FH5A 3EIJA 4GYOA 3FUFA 3JXIA 3OXLA 4GA1A 4RLYA 4FLBA 1IHBA 4HFGA 2Q7FA 1N4QA 2X6FA 3QWVA 5EX3A 4XE0A 1HF8A 2WQ6A 1OCZE 4O1OA 3DSWA 2EQXA 3DSUA 3HXFA 4JB8P 4CEMA 3DXKG 4TXPA 2BF0X 1U3DA 2ETCA 1TN7A 2XGMA 2J9QA 5EDSA 1UG3A 3EUVA 4BTAA 3ESKA 3I5PA 3PZ2A 5BT1A 3PREA 3ZRHA 4EZLA 1D9SA 2QYJA 5ARGA 2JEKA 3E32A 3F6QA 2DCPA 4MKTA 2GRQB 3FU3A 3ONKA 5CRUA 3ZNGA 3EHNA 3UM1A 4O6FA 3Q79A 2WXQA 4XEIG 4N5QA 3HVEB 5LCWJ 4I1MA 5BXOA 3FTXA 3ZKJA 4UI9C 4G23A 5AQAA 5T8IA 4UWFA 4WWNA 2UY1B 1V54E 3L9TA 2DIWA 4GMRA 3PDNA 4Y6WA 4AEZC 4HRNA 1JUQA 2WB2A 2X6HA 3TWRA 3MA5A 4DX2A 4J8YA 5ENOD 1N52A 1TN6A 2WVIA 3UIOC 4GTPA 1FT2A 5KNGA 2WXOA 2WXGA 4L9PA 3FEYA 3CHSA 4LSZE 3KSQA 2L6JA 1U3CA 1OCRE 3UPVA 2PL2A 4JZYA 5LFAA 1WG0A 3FFLA 4HB5A 4N2QA 1Z3YA 4BT8A 1TNYA 3UTMA 3KEZA 5FWQA 3RSEG 3KD7A 1KPSB 2WPVA 4JL0A 4RSYA 2F0YA 3RKVA 2GRMA 3HIZA 2C0LA 1SZ9A 3ZYLA 3ZU7B 4PS7A 2LXMA 1O1TA 3NB2A 1H2VC 4GMLA 1IXVA 4K5AB 1HS6A 3LPZA 3ULEG 4JA9A 4DI4A 4GTSA 3FUIA 3GW4A 3SFZA 4LG6A 1TNBA 2BUGA 4HLLA 3RRMB 4XI0A 4XKBA 3DXMG 3ZVVA 1PAQA 1EPUA 5AN8A 3DSSA 3T5VA 3ONLA 3X2QE 3ZPJA 3L82A 5JJ7A 5ENRD 4WNFA 3TWWA 2XHEA 1WY6A 3QARA 1MX2A 3SBTB 3UT8A 4EZKA 3EHRA 2GGFA 2WXNA 4KZCA 3ULYA 2BEDA 3UI2A 5CBNA 3NZSA 4BSZB 3RO2A 4R7LA 4CT0A 5KJLA 1IYGA 3WXXA 3HYMB 2KC7A 4HLEA 3Q5MA 4WUYA 2X3MA 1UOHA 4NIKA 3ASDA 4GTOA 4Q69A 2HYZA 4OVUA 4BERA 3LJNA 3B7RL 3FDHA 4N2SA 3AG1E 1JCRA 5CCMA 2P9IG 3VLDA 4GB9A 4LNUD 3FHEA 5FT9A 3L17A 3PE4A 3ABKE 3TWVA 5JA4D 4EBAG 2CFZA 2IFUA 3RU0A 2QY7A 4DLQA 1HFAA 1E90A 3B7UX 5G04J 4PS8A 5CMWA 3V79K 2V0PA 2KZTB 4U0ZA 4U63A 3MEKA 5G04C 3G2UA 4F1SA 2XGSA 4KVOA 3RJVA 3T9KA 4B94A 4GA0A 2V4LA 3CEQA 1TJCA 3ASNE 1Y8MA 1UN9A 2FF4A 4IN3B 3TG5A 3BEEA 4LRZA 1HX8A 4YDEA 3JQ0A 4D10C 1HH8A 1BI7B 4BWRA 3ZFWA 5BUZA 4RVBA 3UM2A 5AAOA 3AS8A 3EHMA 5HRYA 4A1SA 1LTXA 1ZU2A 1Q2ZA 4U96D 1FT1A 4B8AA 4KT6B 3KS2A 2RFMA 3CLJA 3TWUA 4U8HA 3V2OA 4BT9A 4HOSA 4ACKA 3D9MA 5KWDA 2EIME 3FUNA 5EN5D 3PH0C 2LUHA 1MX4A 3MX3A 4TRQA 5CEDB 1SA4A 1ZBPA 3ABLE 2B0OE 1FVHA 4IULA 1S64A 1V55E 1N11A 3ZXPA 2XS1A 4YDOA 2A5EA 3Q73A 1OUVA 3OAWA 1YYHA 2DYRE 5KNHD 4ILHB 4ILIA 3I3NA 2DVWA 1B89A 3V2XA 1E7UA 3FULA 1K1AA 1D8EA 1KLXA 2L6BA 1JCQA 3GZ1A 3G2VA 1DVPA 2VSYA 2P58C 5ITZF 4I9EA 3S7JA 5HKPA 2WM9A 3FY4A 4YNDA 4KVMA 1MZCA 3PNLB 5FQ6A 3CVUA 4U04A 1DCEA 4KXKB 3JCKC 3SNXA 1PY1A 4EPZA 3UMVA 3PZ1A 2AVPA 2XEHA 2MRIA 4LEUA 3CVPA 5CMYA 3MV3B 5JHAA 1TNZA 4G24A 5ENPD 1E8XA 3ZHEA 4FC8A 4HI9A 3U4TA 2KXPC 4GMJA 4A1GA 4AJWA 3ZW3A 4GTMA 2WXIA 3CSFA 4CRWA 1HO8A 3AJIA 2XZTG 3ABME 2ETBA 4J8SA 4DK5A 3ULQA 3DSVA 4Z68A 2VGXB 5T3RA 2CHXA 1H6PA 3LY9A 2VQ2A 2P9SG 2OEWA 3S7BA 3CSTA 4AP2A 4GZDA 1NI1A 3PRZA 3PNTB 3U9WA 4U8VD 2WQ7A 3FTYA 2XENA 3OTNA 3QOUA 3CV0A 4M7CA 5BPPA 4UWHA 3PEVB 3E33A 3VLEA 3D9HA 5G2NA 3TAXA 3L54A 3FU6A 4ANUA 4AIFA 1DCQA 3O48A 3MV2B 3DPYA 1A17A 1S63A 4BX9A 3CHPA 1H2TC 1DNPA 2OEVA 2IO2C 1ELRA 2DYSE 5D0OD 5JHBA 2WXRA 4GZCA 2NYJA 1L5JA 3NOGD 3B7SA 1N4PA 2X6IA 3D9LA 4TXRA 5B3SE 2AXVA 3FTSA 3LYAA 2ZISA 4GCNA 3QKYA 5AENA 3D9NA 1FCHA 2NXPA 3CGHA 3Q7AA 1X5BA 2VGEA 2JABA 4RQIA 4Q94A 4B0ZA 4UI9K 2LO6A 2R05A 4L2YA 2LNIA 4N39A 4DX6D 4F7AA 2LAHA 2VGYA 1N9AA 2ZXWE 3AS4A 3LDZA 1Y6IA 4I6JA 3SGHA 1OT8A 3LXUX 4CYMD 1NP7A 4FHJA 2XQ0A 4ANVA 2KM4A 1N4RA 3IBEA 4L2LA 4CCAA 2EIJE 5LCWC 1SQMA 3FUEA 4O60A 5C1DA 3N71A 3U64A 3HG0D 4G11A 2F8XK 2XRZA 1HXIA 1BPOA 4HQDA 3AU5A 4B89A 5B1BE 1IHGA 1N4SA 3IV0A 4JA7A 4AY6A 2X38A 5KCMA 2YQ8A 3CHQA 4LNBA 2Y0BG 3SO8A 1OWMA 3B7BA 1H0AA 3L6AA 1LD8A 3W9GA 1XGWA 3R7QA 3CVNA 3FH7A 3VLFA 1TR4A 2HM8A 4YVQC 3ASHA 2IJGX 3BG0B 3MKQA 2Y4TA 3QJZA 1SA5A 2B6CA 3HHMA 3CK7A 4U07A 3RO3A 3CVWA 1Z3XA 4MLPA 3DBSA 1INZA 4PUCA 1N54A 5AYWD 2J4DA 3HRAA 3IEGA 3W9FA 3PUKA 2ZGDA 4BX8A 3APFA 3S7DA 2L0TB 3CK8A 2F37A 3PZDA 1RW2A 2VTBA 1A5EA 2P9PG 1SVXA 1XNFA 4WWOA 1JWFA 4C9BB 2R03A 4M3OA 3CVVA 3ZYQA 4GTQA 1NFIE 4G8KA 5KJMA 1O5MA 4I1AA 3SF4A 3CVXA 4CDRA 5FJYA 3NBNB 1MYOA 3U3WA 3CK9A 3IKOB 4LNGA 4JEHA 1TN8A 2J8SD 3DSTA 3D9OA 3UM3A 3D9JA 2R2LA 1D8DA 1JCSA 4C0EA 5JJTA 2RD0A 2J09A 3B13A 2XEEA 3AS5A 3GZ2A 3TXNA 4B8CB 2RKKA 1TEZA 1LF8A 2P9NG 2WXJA 3UM0A 3APDA 4HOUA 2CG3A 2QFCA 3UIPC 3TWQA 3IXEA 3UT4A 4OVVA 2OV8A 4IRUA 2FEZA 2IONA 2WMOA 5J90A 4F6RD 3QC1A 4DPRA 4KZ0A 2J08A 5E76A 2L9BA 4FU3A 4FJYA 3E4BA 5AQ7A 3C3QA 2HO1A 2WXMA 1QYMA 2FO1E 3MGBA 4WAFA 4ME2A 5KJKA 4OYSA 3RRUA 3U66A 3V30A 2ETAA 3HVEA 5DIZA 2KCVA 5FIOA 3NZUA 4WNDA 3QAQA 4AY5A 3Q75A 2UY1A 2LXLA 4EHMA 4DRXE 3KAEA 4ATZD 3Q47B 4EBAA 4CGWA 4NQ0A 2V5FA 3J5QB 4TUUA 2XPIA 1MJ0A 2IU1A 4YDWA 1NL4A 3TWXA 2HR2A 2GRLA 4JHJA 4O1PA 2RG8A 3ASOE 2Y4UA 4CZ2D 3T5XA 4Q96A 1HE8A 5D66A 2IQCA 4QFVA 2FI7A 4U0SA 3SI5A 2QYUA 5G55A 2DZOA 1MQSA 3ENEA 2PM7A 2JLBA 2XCCA 3QDNA 5M72A 4EECA 4JW1A 4ILGA 2OVBA 3BG1B 5FQ7A 2YHEA 3EIQC 3UINC 4GZ5A 2I2OA 4XIFA 2ZGGA 2QC9A 5BNWA 4C0MA 2XZDG 5FTPA 3FTZA 3B7TA 1BU9A 2KCLA 5LP0A 4RG9A 4LUNU 4G1TA 4NURA 3ZYKA 3FUHA 5KJNA 3FTUA 4GCOA 4L1BA 2BKKB 2MYOA 4HBDA 4X8QA 5HQ8A 4HNAD 3G2TA 4CDNA 3R9AB 3SZ7A 1KZOA 4UWLA 3CVYA 4J8DA 1LD7A 4YDYA 2YNQA 2AW6A 3BUAA 4URKA 1TYQG 5EKQD 4GZ3A 3VTYA 3UKUG 3S7FA 5B1AE 4G26A 4JHRA 2VJ8A 4I17A 3LKUA 4ZFHA 4DUIA 1P5QA 2WXKA 2GRRB 5EYPF 3HXBA 4WNGA 3FH8A 2DWZA 3ZYMA 2AXUA 3CR3A 3PZ4A 2NSZA 2LAIA 2WXFA 1UW4B 2GROB 3ASGA 3OXGA 4K0RA 4DLOA 5JMND 4LERA 1UN8A 4DI3A 3SQVA 5ANRA 2M63A 4HI8A 5CCLA 4E6HA 3Q7FA 4NACA 4KYOB 4CGVA 4GZ6A 3T8KA 2WXLA 4OAVB 1OCCE 4GYYA 2PNNA 1E7VA 1U2VG 1FVFA 4ZHBA 5EIDA 3KEAA 3AG3E 3ML9A 4CDMA 2KCKA 4JXTA 2ILRA 4N3BA 4PDXA 4HOQA 5DBKA 3EU5A 3I4GA 4AM9A 3GYZA 3ZXSA 2EILE 4NRHB 4A3TA 1BLXB 1JWGA 2C0MA 5J08A 3TXMA 5EX0A 4J8EA 3CIAA 5ENTD 2P2CP 2BKGA 2BTDA 3WG7E 3D3MA 2KZTA 1S0PA 4BEPA 5EILA 3NAWA 2VTBB 4N3AA 3FP3A 4G2VA 1O1RA 4GTRA 2WQHA 3SD5A 2GRNB 2AWIA 5FZSA 3NF1A 3ZN3A 2J4BA 4JVSA 3LS8A 5D2MC 1JPLA 1HG5A 2CHZA 2X6KA 3Q49B 2J07A 4DJAA 1KZPA 1OY3D 1OXJA 1E8ZA 3L13A 4GPMA 3CQCB 5FQ4A 3RRNB 2XEVA 3PS6A 2EIKE 4ABNA 2A5UA 4GPKA 2I1JA 1PC2A 1WAO1 3FUKA 4DX5D 3ZUVB 5A23A 3ML8A 1H19A 4A63B 3TGOA 5EIBE 4F3VA 1QQEA 4F1PA 2H6HA 3ZEFA 2A4ZA 3TG4A 2KATA 5FZQA 4P29A 3LVRE 4AV7A 5AJDA 1YCSB 4FJZA 2P9KG 3CKBA 1ZB1A 2IOSA 1AP7A 4IYPA 1BI8B 5D0QD 2UWJG 1YA0A 5CHEE 4MBGA 4N5CA 3URZA 3E34A 3SY2A 4U8YD 3QK0A 1EYHA 3SFYA 2F8YA 2FBNA 2LSVA 3UX4A 3RK6A 4APOA 4BFRA 3MJWA 3LVQE 4TUMA 5ENQD 1ELWA 5BW8C 4UI9J 5CBOA 1O1SA 2XPYA 4LCTA 2GRPB 4I6GA 4U7EB 1TJFA 2X6JA 4F53A 4HORA 2E0IA 3PZ3A 1TNUA 2DBAA 3JUIA 4UQYA 4N3CA 1OCOE 3L16A 3GZSA 5BXUA 2WXPA 2V8SE 1BD8A 4G8LA 4H7XA 2OCCE 1S70B 1MHQA 3Q78A 1TNOA 4I9CA 3P2BA 3HXDA 4MRUA 1UJJA 1N0QA 3I4RB 5BV1A 3DSXA 2MOWA 3HXEA 5ENSD 2J49A 2HE0A 4HS2A 2XRYA 3DEPA 3Q9NC 3D9PA 3FUDA 2IOLA 5H7PA 4AVXA 3JYSA 5KBAA 4UUCA 3LEWA 2XS8A 3B95A 4AXHA 2C2LA 1EDUA 3BQOA 5ANLA 4QQIA 2VGXA 3CHMA 4FLHA 1KT1A 5FZRA 3SBSA 2FO7A 4H7YA 1GW6A 5BV0A 1FPPA 3RIBA 4GU5A 3D9IA 4GAAA 3G2WA 2YHCA 4V3IA 1K8KG 1HG2A 4AOFA 1H6KA 2R5SA 5AQ9A 3T8MA 1W3BA 3L08A 1YMPA 3UUXA 3HDXA 2NC9A 1WDYA 4DX1A 1Z6TA 1N94A 5C2YA 4GTTA 5AARA 3V31A 2WMNA 4APFA 3ZIMA 2ZU6B 4BY6A 3APCA 4UQZA 3PE3A 4L23A 1X81A 3C98A 5G05J 4I2WA 3FEXA 3JUEA 3ISMC 3C3RA 4G25A 3NQPA 3Q15A 5AJLA 5G05C 5FINA 2MHKA 4EQFA 3CHOA 3G2SA 5CEAA 3DPDA 1KT0A 2CHWA 2R17C 3R7RA 4ACLA 3TJPA 3PUJA 3ZHEB 2XGOA 3QWPA 3C5RA 2WXHA 3SHFA 2IEJA 2OVFA 3EHQA 3C3OA 3RAUA 4PH4B 4DX7D 1DC2A 3TWTA 1E8YA 1N95A 2H6IA 4FADA 2DZNA 4XI9A 4BETA 4XZ4A 3UXGA 1G3NB 4K5BA 3QWWA 4J0UA 3QNKA 4B93B 4HOTA 2CFUA 2H6FA 2GW1A 5CRVA 2I9CA 4UQXA 3FTWA 3O4ZA 1IQUA 1K1BA 1H2UA 3SFXA 4CT4A 2KBXA 2I1KA 1QZ2A 3EJNA 4BTBA 4J6IA 5ARFA 1WM5A 5EYLA 3TL5A 4I2ZA 3Q4AB 3PEUB 1UJKA 1E8WA 3VTXA 2R59A 4FA6A 3CVQA 4JC8A 2PQNA 2AXZA 2PM6A 4U95D 3AAAC 3BU8A 3L22A 4J7WA 3UKRG 4ANWA 3OXFA 3EDTB 3MZLB 1E96B 5LOZA 3ZGQA 4UWKA 4K03A 4J8FA 3UT7A 4E85A 3E30A 4Y6CA 2Y1LE 3FUJA 4FHKA 2XCBA 2PZIA 3LY8A 1IKND 1K3ZD 1QBQA 1MX6A 4U0UA 1N0RA 4XKCA 3IHYA 4FP7A 4OAUC 4TV3A 3AU4A 2IY0C 1OWOA 5E75A 5JJ6A 2PQRA 4I6EA 4JPSA 4HRLA 1Z5SC 3E37A 3CHRA 5HS0A 4A3VA 3IHVA 4HRMB 1RZ4A 2P9LG 3AG4E 3S2AA 4HVBA 4WWPA 1VDYA 3FU0A 2Y69E 4BSXA 4FULA 3DRAA 3CVLA 2IO3C 5CECB 3D9KA 4ANXA 2L0IA 3C72A 1OWLA 3K9IA 5IY5E 3LJ3A 4TXQA 2VSNA 5HI7A 4C48B 3FU5A 5AIJA 2RFAA 2AJAA 1SW6A 4MS6A 2CG2A 2OOEA 3MCXA 2P9UG 4KMOA 2V4HC 2Y3AA 2R02A 2VSXE 3LCAA 2VSOE 3ASFA 4RG6A 1QNFA 5AQBA 2V5QC 4A55A 3P1UA 3FTVA 3KSLA 4K5CA 1OWPA 1HZ4A 3TWSA 4I43A 1ELKA 1NA3A 4L7TA 5CERB 2IF4A 5LX8A 1SZAA 3MKRA 3FUMA 3DEOA 2H6GA 4BESA 4PS3A 2QZAA 2XPZA 4WNEA 2E2EA 1IQRA 3FWVA 1EF1C 3MKQB 4EZJA 1AWCB 2I6HA 3DWLG 5T4YA 3LY7A
chains in the Genus database with same CATH topology
1K1BA 3LJNA 3EU9A 2NYJA 5CBOA 1D9SA 2QYJA 5HS0A 2KBXA 3NOGD 4HRMB 3ZU7B 2XEEA 2Y0BG 3SO8A 5AQ9A 5ENPD 4LNUD 3J5QB 1YMPA 3F6QA 1MJ0A 5KWDA 4HI9A 1IXVA 4K5AB 3Q9UC 3B7BA 5EN5D 1WDYA 2KXPC 3TWVA 4ZFHA 5CECB 4YDWA 4DUIA 5EYLA 1MX4A 3TWXA 4DX1A 5EYPF 3W9GA 5JA4D 1OY3D 4LG6A 3ZNGA 5CEDB 2DWZA 4GPMA 1TR4A 4HLLA 4O1PA 2B0OE 3TWQA 3AJIA 1N11A 2VGEA 2XZTG 3IXEA 5JMND 4CZ2D 5AARA 2JABA 3NOCD 5AN8A 5D66A 3V31A 4N5QA 5BXUA 2ETBA 4QFVA 4U95D 5BXOA 3AAAC 4C48B 4J7WA 3ZKJA 2DZOA 3V79K 1BD8A 2RFAA 2A5EA 4HI8A 2AJAA 1SW6A 4DX6D 5AQAA 4G8LA 4DX5D 1YYHA 3JXJA 3ZUVB 4Z68A 5KNHD 4GMRA 3J5PA 2V4HC 4F6RD 1S70B 3JUEA 4A63B 5ENRD 2DVWA 4HRNA 3HRAA 3TWWA 3T8KA 5EIBE 3V2XA 1OT8A 4OAVB 3T9KA 3TWRA 3W9FA 4DX2A 4J8YA 4CYMD 5ENOD 1K1AA 4F1PA 5AQBA 1N0QA 2L6BA 2PNNA 2V5QC 2ZGDA 1MX2A 5FINA 2F37A 5KNGA 2Y1LE 1YCSB 4ZHBA 1A5EA 5AQ7A 3JXIA 5EIDA 1SVXA 5ENSD 3KEAA 3EHRA 5CEAA 4K5CA 4RLYA 2ZGGA 4U8VD 5ITZF 1IHBA 1QYMA 3TWSA 2XENA 2QC9A 2FO1E 1AP7A 2HE0A 1BI7B 1IKND 1BI8B 4LSZE 5HKPA 1K3ZD 3DEPA 1MX6A 2XZDG 3Q9NC 3C5RA 3UI2A 4ATZD 5CBNA 3D9HA 1N0RA 1BLXB 4BSZB 5CERB 1BU9A 4O60A 5AAOA 3V30A 3EHQA 2ETAA 5HRYA 1DCQA 4DX7D 1DC2A 5KBAA 4UUCA 3B95A 1NFIE 1WG0A 4U8YD 4O1OA 4HB5A 3TWTA 4TUMA 2BKKB 3DEOA 2MYOA 4G8KA 5ENTD 4BESA 4HBDA 2P2CP 4JB8P 4OAUC 2BKGA 2F8YA 3HG0D 5FIOA 2DZNA 4HNAD 3UTMA 2F8XK 4U96D 4QQIA 4BEPA 2ETCA 5EILA 3NBNB 4BETA 1MYOA 3UXGA 1G3NB 1UOHA 4K5BA 4DRXE 2RFMA 4NIKA 4B93B 1AWCB 4HQDA 4YDYA 3TWUA 2J8SD 3V2OA 4HRLA 2XEHA 5ENQD 4BERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K1B A;  3LJN A;  3EU9 A;  2NYJ A;  5CBO A;  1D9S A;  2QYJ A;  5HS0 A;  2KBX A;  3NOG D;  4HRM B;  3ZU7 B;  2XEE A;  2Y0B G;  3SO8 A;  5AQ9 A;  5ENP D;  4LNU D;  3J5Q B;  1YMP A;  3F6Q A;  1MJ0 A;  5KWD A;  4HI9 A;  1IXV A;  4K5A B;  3Q9U C;  3B7B A;  5EN5 D;  1WDY A;  2KXP C;  3TWV A;  4ZFH A;  5CEC B;  4YDW A;  4DUI A;  5EYL A;  1MX4 A;  3TWX A;  4DX1 A;  5EYP F;  3W9G A;  5JA4 D;  1OY3 D;  4LG6 A;  3ZNG A;  5CED B;  2DWZ A;  4GPM A;  1TR4 A;  4HLL A;  4O1P A;  2B0O E;  3TWQ A;  3AJI A;  1N11 A;  2VGE A;  2XZT G;  3IXE A;  5JMN D;  4CZ2 D;  5AAR A;  2JAB A;  3NOC D;  5AN8 A;  5D66 A;  3V31 A;  4N5Q A;  5BXU A;  2ETB A;  4QFV A;  4U95 D;  5BXO A;  3AAA C;  4C48 B;  4J7W A;  3ZKJ A;  2DZO A;  3V79 K;  1BD8 A;  2RFA A;  2A5E A;  4HI8 A;  2AJA A;  1SW6 A;  4DX6 D;  5AQA A;  4G8L A;  4DX5 D;  1YYH A;  3JXJ A;  3ZUV B;  4Z68 A;  5KNH D;  4GMR A;  3J5P A;  2V4H C;  4F6R D;  1S70 B;  3JUE A;  4A63 B;  5ENR D;  2DVW A;  4HRN A;  3HRA A;  3TWW A;  3T8K A;  5EIB E;  3V2X A;  1OT8 A;  4OAV B;  3T9K A;  3TWR A;  3W9F A;  4DX2 A;  4J8Y A;  4CYM D;  5ENO D;  1K1A A;  4F1P A;  5AQB A;  1N0Q A;  2L6B A;  2PNN A;  2V5Q C;  2ZGD A;  1MX2 A;  5FIN A;  2F37 A;  5KNG A;  2Y1L E;  1YCS B;  4ZHB A;  1A5E A;  5AQ7 A;  3JXI A;  5EID A;  1SVX A;  5ENS D;  3KEA A;  3EHR A;  5CEA A;  4K5C A;  4RLY A;  2ZGG A;  4U8V D;  5ITZ F;  1IHB A;  1QYM A;  3TWS A;  2XEN A;  2QC9 A;  2FO1 E;  1AP7 A;  2HE0 A;  1BI7 B;  1IKN D;  1BI8 B;  4LSZ E;  5HKP A;  1K3Z D;  3DEP A;  1MX6 A;  2XZD G;  3Q9N C;  3C5R A;  3UI2 A;  4ATZ D;  5CBN A;  3D9H A;  1N0R A;  1BLX B;  4BSZ B;  5CER B;  1BU9 A;  4O60 A;  5AAO A;  3V30 A;  3EHQ A;  2ETA A;  5HRY A;  1DCQ A;  4DX7 D;  1DC2 A;  5KBA A;  4UUC A;  3B95 A;  1NFI E;  1WG0 A;  4U8Y D;  4O1O A;  4HB5 A;  3TWT A;  4TUM A;  2BKK B;  3DEO A;  2MYO A;  4G8K A;  5ENT D;  4BES A;  4HBD A;  2P2C P;  4JB8 P;  4OAU C;  2BKG A;  2F8Y A;  3HG0 D;  5FIO A;  2DZN A;  4HNA D;  3UTM A;  2F8X K;  4U96 D;  4QQI A;  4BEP A;  2ETC A;  5EIL A;  3NBN B;  4BET A;  1MYO A;  3UXG A;  1G3N B;  1UOH A;  4K5B A;  4DRX E;  2RFM A;  4NIK A;  4B93 B;  1AWC B;  4HQD A;  4YDY A;  3TWU A;  2J8S D;  3V2O A;  4HRL A;  2XEH A;  5ENQ D;  4BER A; 
#chains in the Genus database with same CATH topology
 4KBQ A;  3AG2 E;  3MYV A;  3EU9 A;  5A7D B;  1NZN A;  2ZIR A;  2FUL A;  4GTV A;  3R9M A;  4GYW A;  4XX5 A;  3ESL A;  3PVL A;  4JHK A;  5ENN A;  2EIN E;  2YIN A;  3CQG B;  3CKC A;  2OND A;  2LSU A;  3Q9U C;  4HXI A;  1OWN A;  3HXC A;  5FQ8 A;  4JD2 G;  2VYI A;  4W9R A;  3NOC D;  4JEU A;  3JQ1 A;  4I1O B;  4GA2 A;  1NA0 A;  4ATG A;  3JXJ A;  3J5P A;  1HU3 A;  3QB2 A;  5A6C A;  4UWG A;  1H6O A;  4YVO A;  3UQ3 A;  3FH5 A;  3EIJ A;  4GYO A;  3FUF A;  3JXI A;  3OXL A;  4GA1 A;  4RLY A;  4FLB A;  1IHB A;  4HFG A;  2Q7F A;  1N4Q A;  2X6F A;  3QWV A;  5EX3 A;  4XE0 A;  1HF8 A;  2WQ6 A;  1OCZ E;  4O1O A;  3DSW A;  2EQX A;  3DSU A;  3HXF A;  4JB8 P;  4CEM A;  3DXK G;  4TXP A;  2BF0 X;  1U3D A;  2ETC A;  1TN7 A;  2XGM A;  2J9Q A;  5EDS A;  1UG3 A;  3EUV A;  4BTA A;  3ESK A;  3I5P A;  3PZ2 A;  5BT1 A;  3PRE A;  3ZRH A;  4EZL A;  1D9S A;  2QYJ A;  5ARG A;  2JEK A;  3E32 A;  3F6Q A;  2DCP A;  4MKT A;  2GRQ B;  3FU3 A;  3ONK A;  5CRU A;  3ZNG A;  3EHN A;  3UM1 A;  4O6F A;  3Q79 A;  2WXQ A;  4XEI G;  4N5Q A;  3HVE B;  5LCW J;  4I1M A;  5BXO A;  3FTX A;  3ZKJ A;  4UI9 C;  4G23 A;  5AQA A;  5T8I A;  4UWF A;  4WWN A;  2UY1 B;  1V54 E;  3L9T A;  2DIW A;  4GMR A;  3PDN A;  4Y6W A;  4AEZ C;  4HRN A;  1JUQ A;  2WB2 A;  2X6H A;  3TWR A;  3MA5 A;  4DX2 A;  4J8Y A;  5ENO D;  1N52 A;  1TN6 A;  2WVI A;  3UIO C;  4GTP A;  1FT2 A;  5KNG A;  2WXO A;  2WXG A;  4L9P A;  3FEY A;  3CHS A;  4LSZ E;  3KSQ A;  2L6J A;  1U3C A;  1OCR E;  3UPV A;  2PL2 A;  4JZY A;  5LFA A;  1WG0 A;  3FFL A;  4HB5 A;  4N2Q A;  1Z3Y A;  4BT8 A;  1TNY A;  3UTM A;  3KEZ A;  5FWQ A;  3RSE G;  3KD7 A;  1KPS B;  2WPV A;  4JL0 A;  4RSY A;  2F0Y A;  3RKV A;  2GRM A;  3HIZ A;  2C0L A;  1SZ9 A;  3ZYL A;  3ZU7 B;  4PS7 A;  2LXM A;  1O1T A;  3NB2 A;  1H2V C;  4GML A;  1IXV A;  4K5A B;  1HS6 A;  3LPZ A;  3ULE G;  4JA9 A;  4DI4 A;  4GTS A;  3FUI A;  3GW4 A;  3SFZ A;  4LG6 A;  1TNB A;  2BUG A;  4HLL A;  3RRM B;  4XI0 A;  4XKB A;  3DXM G;  3ZVV A;  1PAQ A;  1EPU A;  5AN8 A;  3DSS A;  3T5V A;  3ONL A;  3X2Q E;  3ZPJ A;  3L82 A;  5JJ7 A;  5ENR D;  4WNF A;  3TWW A;  2XHE A;  1WY6 A;  3QAR A;  1MX2 A;  3SBT B;  3UT8 A;  4EZK A;  3EHR A;  2GGF A;  2WXN A;  4KZC A;  3ULY A;  2BED A;  3UI2 A;  5CBN A;  3NZS A;  4BSZ B;  3RO2 A;  4R7L A;  4CT0 A;  5KJL A;  1IYG A;  3WXX A;  3HYM B;  2KC7 A;  4HLE A;  3Q5M A;  4WUY A;  2X3M A;  1UOH A;  4NIK A;  3ASD A;  4GTO A;  4Q69 A;  2HYZ A;  4OVU A;  4BER A;  3LJN A;  3B7R L;  3FDH A;  4N2S A;  3AG1 E;  1JCR A;  5CCM A;  2P9I G;  3VLD A;  4GB9 A;  4LNU D;  3FHE A;  5FT9 A;  3L17 A;  3PE4 A;  3ABK E;  3TWV A;  5JA4 D;  4EBA G;  2CFZ A;  2IFU A;  3RU0 A;  2QY7 A;  4DLQ A;  1HFA A;  1E90 A;  3B7U X;  5G04 J;  4PS8 A;  5CMW A;  3V79 K;  2V0P A;  2KZT B;  4U0Z A;  4U63 A;  3MEK A;  5G04 C;  3G2U A;  4F1S A;  2XGS A;  4KVO A;  3RJV A;  3T9K A;  4B94 A;  4GA0 A;  2V4L A;  3CEQ A;  1TJC A;  3ASN E;  1Y8M A;  1UN9 A;  2FF4 A;  4IN3 B;  3TG5 A;  3BEE A;  4LRZ A;  1HX8 A;  4YDE A;  3JQ0 A;  4D10 C;  1HH8 A;  1BI7 B;  4BWR A;  3ZFW A;  5BUZ A;  4RVB A;  3UM2 A;  5AAO A;  3AS8 A;  3EHM A;  5HRY A;  4A1S A;  1LTX A;  1ZU2 A;  1Q2Z A;  4U96 D;  1FT1 A;  4B8A A;  4KT6 B;  3KS2 A;  2RFM A;  3CLJ A;  3TWU A;  4U8H A;  3V2O A;  4BT9 A;  4HOS A;  4ACK A;  3D9M A;  5KWD A;  2EIM E;  3FUN A;  5EN5 D;  3PH0 C;  2LUH A;  1MX4 A;  3MX3 A;  4TRQ A;  5CED B;  1SA4 A;  1ZBP A;  3ABL E;  2B0O E;  1FVH A;  4IUL A;  1S64 A;  1V55 E;  1N11 A;  3ZXP A;  2XS1 A;  4YDO A;  2A5E A;  3Q73 A;  1OUV A;  3OAW A;  1YYH A;  2DYR E;  5KNH D;  4ILH B;  4ILI A;  3I3N A;  2DVW A;  1B89 A;  3V2X A;  1E7U A;  3FUL A;  1K1A A;  1D8E A;  1KLX A;  2L6B A;  1JCQ A;  3GZ1 A;  3G2V A;  1DVP A;  2VSY A;  2P58 C;  5ITZ F;  4I9E A;  3S7J A;  5HKP A;  2WM9 A;  3FY4 A;  4YND A;  4KVM A;  1MZC A;  3PNL B;  5FQ6 A;  3CVU A;  4U04 A;  1DCE A;  4KXK B;  3JCK C;  3SNX A;  1PY1 A;  4EPZ A;  3UMV A;  3PZ1 A;  2AVP A;  2XEH A;  2MRI A;  4LEU A;  3CVP A;  5CMY A;  3MV3 B;  5JHA A;  1TNZ A;  4G24 A;  5ENP D;  1E8X A;  3ZHE A;  4FC8 A;  4HI9 A;  3U4T A;  2KXP C;  4GMJ A;  4A1G A;  4AJW A;  3ZW3 A;  4GTM A;  2WXI A;  3CSF A;  4CRW A;  1HO8 A;  3AJI A;  2XZT G;  3ABM E;  2ETB A;  4J8S A;  4DK5 A;  3ULQ A;  3DSV A;  4Z68 A;  2VGX B;  5T3R A;  2CHX A;  1H6P A;  3LY9 A;  2VQ2 A;  2P9S G;  2OEW A;  3S7B A;  3CST A;  4AP2 A;  4GZD A;  1NI1 A;  3PRZ A;  3PNT B;  3U9W A;  4U8V D;  2WQ7 A;  3FTY A;  2XEN A;  3OTN A;  3QOU A;  3CV0 A;  4M7C A;  5BPP A;  4UWH A;  3PEV B;  3E33 A;  3VLE A;  3D9H A;  5G2N A;  3TAX A;  3L54 A;  3FU6 A;  4ANU A;  4AIF A;  1DCQ A;  3O48 A;  3MV2 B;  3DPY A;  1A17 A;  1S63 A;  4BX9 A;  3CHP A;  1H2T C;  1DNP A;  2OEV A;  2IO2 C;  1ELR A;  2DYS E;  5D0O D;  5JHB A;  2WXR A;  4GZC A;  2NYJ A;  1L5J A;  3NOG D;  3B7S A;  1N4P A;  2X6I A;  3D9L A;  4TXR A;  5B3S E;  2AXV A;  3FTS A;  3LYA A;  2ZIS A;  4GCN A;  3QKY A;  5AEN A;  3D9N A;  1FCH A;  2NXP A;  3CGH A;  3Q7A A;  1X5B A;  2VGE A;  2JAB A;  4RQI A;  4Q94 A;  4B0Z A;  4UI9 K;  2LO6 A;  2R05 A;  4L2Y A;  2LNI A;  4N39 A;  4DX6 D;  4F7A A;  2LAH A;  2VGY A;  1N9A A;  2ZXW E;  3AS4 A;  3LDZ A;  1Y6I A;  4I6J A;  3SGH A;  1OT8 A;  3LXU X;  4CYM D;  1NP7 A;  4FHJ A;  2XQ0 A;  4ANV A;  2KM4 A;  1N4R A;  3IBE A;  4L2L A;  4CCA A;  2EIJ E;  5LCW C;  1SQM A;  3FUE A;  4O60 A;  5C1D A;  3N71 A;  3U64 A;  3HG0 D;  4G11 A;  2F8X K;  2XRZ A;  1HXI A;  1BPO A;  4HQD A;  3AU5 A;  4B89 A;  5B1B E;  1IHG A;  1N4S A;  3IV0 A;  4JA7 A;  4AY6 A;  2X38 A;  5KCM A;  2YQ8 A;  3CHQ A;  4LNB A;  2Y0B G;  3SO8 A;  1OWM A;  3B7B A;  1H0A A;  3L6A A;  1LD8 A;  3W9G A;  1XGW A;  3R7Q A;  3CVN A;  3FH7 A;  3VLF A;  1TR4 A;  2HM8 A;  4YVQ C;  3ASH A;  2IJG X;  3BG0 B;  3MKQ A;  2Y4T A;  3QJZ A;  1SA5 A;  2B6C A;  3HHM A;  3CK7 A;  4U07 A;  3RO3 A;  3CVW A;  1Z3X A;  4MLP A;  3DBS A;  1INZ A;  4PUC A;  1N54 A;  5AYW D;  2J4D A;  3HRA A;  3IEG A;  3W9F A;  3PUK A;  2ZGD A;  4BX8 A;  3APF A;  3S7D A;  2L0T B;  3CK8 A;  2F37 A;  3PZD A;  1RW2 A;  2VTB A;  1A5E A;  2P9P G;  1SVX A;  1XNF A;  4WWO A;  1JWF A;  4C9B B;  2R03 A;  4M3O A;  3CVV A;  3ZYQ A;  4GTQ A;  1NFI E;  4G8K A;  5KJM A;  1O5M A;  4I1A A;  3SF4 A;  3CVX A;  4CDR A;  5FJY A;  3NBN B;  1MYO A;  3U3W A;  3CK9 A;  3IKO B;  4LNG A;  4JEH A;  1TN8 A;  2J8S D;  3DST A;  3D9O A;  3UM3 A;  3D9J A;  2R2L A;  1D8D A;  1JCS A;  4C0E A;  5JJT A;  2RD0 A;  2J09 A;  3B13 A;  2XEE A;  3AS5 A;  3GZ2 A;  3TXN A;  4B8C B;  2RKK A;  1TEZ A;  1LF8 A;  2P9N G;  2WXJ A;  3UM0 A;  3APD A;  4HOU A;  2CG3 A;  2QFC A;  3UIP C;  3TWQ A;  3IXE A;  3UT4 A;  4OVV A;  2OV8 A;  4IRU A;  2FEZ A;  2ION A;  2WMO A;  5J90 A;  4F6R D;  3QC1 A;  4DPR A;  4KZ0 A;  2J08 A;  5E76 A;  2L9B A;  4FU3 A;  4FJY A;  3E4B A;  5AQ7 A;  3C3Q A;  2HO1 A;  2WXM A;  1QYM A;  2FO1 E;  3MGB A;  4WAF A;  4ME2 A;  5KJK A;  4OYS A;  3RRU A;  3U66 A;  3V30 A;  2ETA A;  3HVE A;  5DIZ A;  2KCV A;  5FIO A;  3NZU A;  4WND A;  3QAQ A;  4AY5 A;  3Q75 A;  2UY1 A;  2LXL A;  4EHM A;  4DRX E;  3KAE A;  4ATZ D;  3Q47 B;  4EBA A;  4CGW A;  4NQ0 A;  2V5F A;  3J5Q B;  4TUU A;  2XPI A;  1MJ0 A;  2IU1 A;  4YDW A;  1NL4 A;  3TWX A;  2HR2 A;  2GRL A;  4JHJ A;  4O1P A;  2RG8 A;  3ASO E;  2Y4U A;  4CZ2 D;  3T5X A;  4Q96 A;  1HE8 A;  5D66 A;  2IQC A;  4QFV A;  2FI7 A;  4U0S A;  3SI5 A;  2QYU A;  5G55 A;  2DZO A;  1MQS A;  3ENE A;  2PM7 A;  2JLB A;  2XCC A;  3QDN A;  5M72 A;  4EEC A;  4JW1 A;  4ILG A;  2OVB A;  3BG1 B;  5FQ7 A;  2YHE A;  3EIQ C;  3UIN C;  4GZ5 A;  2I2O A;  4XIF A;  2ZGG A;  2QC9 A;  5BNW A;  4C0M A;  2XZD G;  5FTP A;  3FTZ A;  3B7T A;  1BU9 A;  2KCL A;  5LP0 A;  4RG9 A;  4LUN U;  4G1T A;  4NUR A;  3ZYK A;  3FUH A;  5KJN A;  3FTU A;  4GCO A;  4L1B A;  2BKK B;  2MYO A;  4HBD A;  4X8Q A;  5HQ8 A;  4HNA D;  3G2T A;  4CDN A;  3R9A B;  3SZ7 A;  1KZO A;  4UWL A;  3CVY A;  4J8D A;  1LD7 A;  4YDY A;  2YNQ A;  2AW6 A;  3BUA A;  4URK A;  1TYQ G;  5EKQ D;  4GZ3 A;  3VTY A;  3UKU G;  3S7F A;  5B1A E;  4G26 A;  4JHR A;  2VJ8 A;  4I17 A;  3LKU A;  4ZFH A;  4DUI A;  1P5Q A;  2WXK A;  2GRR B;  5EYP F;  3HXB A;  4WNG A;  3FH8 A;  2DWZ A;  3ZYM A;  2AXU A;  3CR3 A;  3PZ4 A;  2NSZ A;  2LAI A;  2WXF A;  1UW4 B;  2GRO B;  3ASG A;  3OXG A;  4K0R A;  4DLO A;  5JMN D;  4LER A;  1UN8 A;  4DI3 A;  3SQV A;  5ANR A;  2M63 A;  4HI8 A;  5CCL A;  4E6H A;  3Q7F A;  4NAC A;  4KYO B;  4CGV A;  4GZ6 A;  3T8K A;  2WXL A;  4OAV B;  1OCC E;  4GYY A;  2PNN A;  1E7V A;  1U2V G;  1FVF A;  4ZHB A;  5EID A;  3KEA A;  3AG3 E;  3ML9 A;  4CDM A;  2KCK A;  4JXT A;  2ILR A;  4N3B A;  4PDX A;  4HOQ A;  5DBK A;  3EU5 A;  3I4G A;  4AM9 A;  3GYZ A;  3ZXS A;  2EIL E;  4NRH B;  4A3T A;  1BLX B;  1JWG A;  2C0M A;  5J08 A;  3TXM A;  5EX0 A;  4J8E A;  3CIA A;  5ENT D;  2P2C P;  2BKG A;  2BTD A;  3WG7 E;  3D3M A;  2KZT A;  1S0P A;  4BEP A;  5EIL A;  3NAW A;  2VTB B;  4N3A A;  3FP3 A;  4G2V A;  1O1R A;  4GTR A;  2WQH A;  3SD5 A;  2GRN B;  2AWI A;  5FZS A;  3NF1 A;  3ZN3 A;  2J4B A;  4JVS A;  3LS8 A;  5D2M C;  1JPL A;  1HG5 A;  2CHZ A;  2X6K A;  3Q49 B;  2J07 A;  4DJA A;  1KZP A;  1OY3 D;  1OXJ A;  1E8Z A;  3L13 A;  4GPM A;  3CQC B;  5FQ4 A;  3RRN B;  2XEV A;  3PS6 A;  2EIK E;  4ABN A;  2A5U A;  4GPK A;  2I1J A;  1PC2 A;  1WAO 1;  3FUK A;  4DX5 D;  3ZUV B;  5A23 A;  3ML8 A;  1H19 A;  4A63 B;  3TGO A;  5EIB E;  4F3V A;  1QQE A;  4F1P A;  2H6H A;  3ZEF A;  2A4Z A;  3TG4 A;  2KAT A;  5FZQ A;  4P29 A;  3LVR E;  4AV7 A;  5AJD A;  1YCS B;  4FJZ A;  2P9K G;  3CKB A;  1ZB1 A;  2IOS A;  1AP7 A;  4IYP A;  1BI8 B;  5D0Q D;  2UWJ G;  1YA0 A;  5CHE E;  4MBG A;  4N5C A;  3URZ A;  3E34 A;  3SY2 A;  4U8Y D;  3QK0 A;  1EYH A;  3SFY A;  2F8Y A;  2FBN A;  2LSV A;  3UX4 A;  3RK6 A;  4APO A;  4BFR A;  3MJW A;  3LVQ E;  4TUM A;  5ENQ D;  1ELW A;  5BW8 C;  4UI9 J;  5CBO A;  1O1S A;  2XPY A;  4LCT A;  2GRP B;  4I6G A;  4U7E B;  1TJF A;  2X6J A;  4F53 A;  4HOR A;  2E0I A;  3PZ3 A;  1TNU A;  2DBA A;  3JUI A;  4UQY A;  4N3C A;  1OCO E;  3L16 A;  3GZS A;  5BXU A;  2WXP A;  2V8S E;  1BD8 A;  4G8L A;  4H7X A;  2OCC E;  1S70 B;  1MHQ A;  3Q78 A;  1TNO A;  4I9C A;  3P2B A;  3HXD A;  4MRU A;  1UJJ A;  1N0Q A;  3I4R B;  5BV1 A;  3DSX A;  2MOW A;  3HXE A;  5ENS D;  2J49 A;  2HE0 A;  4HS2 A;  2XRY A;  3DEP A;  3Q9N C;  3D9P A;  3FUD A;  2IOL A;  5H7P A;  4AVX A;  3JYS A;  5KBA A;  4UUC A;  3LEW A;  2XS8 A;  3B95 A;  4AXH A;  2C2L A;  1EDU A;  3BQO A;  5ANL A;  4QQI A;  2VGX A;  3CHM A;  4FLH A;  1KT1 A;  5FZR A;  3SBS A;  2FO7 A;  4H7Y A;  1GW6 A;  5BV0 A;  1FPP A;  3RIB A;  4GU5 A;  3D9I A;  4GAA A;  3G2W A;  2YHC A;  4V3I A;  1K8K G;  1HG2 A;  4AOF A;  1H6K A;  2R5S A;  5AQ9 A;  3T8M A;  1W3B A;  3L08 A;  1YMP A;  3UUX A;  3HDX A;  2NC9 A;  1WDY A;  4DX1 A;  1Z6T A;  1N94 A;  5C2Y A;  4GTT A;  5AAR A;  3V31 A;  2WMN A;  4APF A;  3ZIM A;  2ZU6 B;  4BY6 A;  3APC A;  4UQZ A;  3PE3 A;  4L23 A;  1X81 A;  3C98 A;  5G05 J;  4I2W A;  3FEX A;  3JUE A;  3ISM C;  3C3R A;  4G25 A;  3NQP A;  3Q15 A;  5AJL A;  5G05 C;  5FIN A;  2MHK A;  4EQF A;  3CHO A;  3G2S A;  5CEA A;  3DPD A;  1KT0 A;  2CHW A;  2R17 C;  3R7R A;  4ACL A;  3TJP A;  3PUJ A;  3ZHE B;  2XGO A;  3QWP A;  3C5R A;  2WXH A;  3SHF A;  2IEJ A;  2OVF A;  3EHQ A;  3C3O A;  3RAU A;  4PH4 B;  4DX7 D;  1DC2 A;  3TWT A;  1E8Y A;  1N95 A;  2H6I A;  4FAD A;  2DZN A;  4XI9 A;  4BET A;  4XZ4 A;  3UXG A;  1G3N B;  4K5B A;  3QWW A;  4J0U A;  3QNK A;  4B93 B;  4HOT A;  2CFU A;  2H6F A;  2GW1 A;  5CRV A;  2I9C A;  4UQX A;  3FTW A;  3O4Z A;  1IQU A;  1K1B A;  1H2U A;  3SFX A;  4CT4 A;  2KBX A;  2I1K A;  1QZ2 A;  3EJN A;  4BTB A;  4J6I A;  5ARF A;  1WM5 A;  5EYL A;  3TL5 A;  4I2Z A;  3Q4A B;  3PEU B;  1UJK A;  1E8W A;  3VTX A;  2R59 A;  4FA6 A;  3CVQ A;  4JC8 A;  2PQN A;  2AXZ A;  2PM6 A;  4U95 D;  3AAA C;  3BU8 A;  3L22 A;  4J7W A;  3UKR G;  4ANW A;  3OXF A;  3EDT B;  3MZL B;  1E96 B;  5LOZ A;  3ZGQ A;  4UWK A;  4K03 A;  4J8F A;  3UT7 A;  4E85 A;  3E30 A;  4Y6C A;  2Y1L E;  3FUJ A;  4FHK A;  2XCB A;  2PZI A;  3LY8 A;  1IKN D;  1K3Z D;  1QBQ A;  1MX6 A;  4U0U A;  1N0R A;  4XKC A;  3IHY A;  4FP7 A;  4OAU C;  4TV3 A;  3AU4 A;  2IY0 C;  1OWO A;  5E75 A;  5JJ6 A;  2PQR A;  4I6E A;  4JPS A;  4HRL A;  1Z5S C;  3E37 A;  3CHR A;  5HS0 A;  4A3V A;  3IHV A;  4HRM B;  1RZ4 A;  2P9L G;  3AG4 E;  3S2A A;  4HVB A;  4WWP A;  1VDY A;  3FU0 A;  2Y69 E;  4BSX A;  4FUL A;  3DRA A;  3CVL A;  2IO3 C;  5CEC B;  3D9K A;  4ANX A;  2L0I A;  3C72 A;  1OWL A;  3K9I A;  5IY5 E;  3LJ3 A;  4TXQ A;  2VSN A;  5HI7 A;  4C48 B;  3FU5 A;  5AIJ A;  2RFA A;  2AJA A;  1SW6 A;  4MS6 A;  2CG2 A;  2OOE A;  3MCX A;  2P9U G;  4KMO A;  2V4H C;  2Y3A A;  2R02 A;  2VSX E;  3LCA A;  2VSO E;  3ASF A;  4RG6 A;  1QNF A;  5AQB A;  2V5Q C;  4A55 A;  3P1U A;  3FTV A;  3KSL A;  4K5C A;  1OWP A;  1HZ4 A;  3TWS A;  4I43 A;  1ELK A;  1NA3 A;  4L7T A;  5CER B;  2IF4 A;  5LX8 A;  1SZA A;  3MKR A;  3FUM A;  3DEO A;  2H6G A;  4BES A;  4PS3 A;  2QZA A;  2XPZ A;  4WNE A;  2E2E A;  1IQR A;  3FWV A;  1EF1 C;  3MKQ B;  4EZJ A;  1AWC B;  2I6H A;  3DWL G;  5T4Y A;  3LY7 A; 
#chains in the Genus database with same CATH homology
 1K1B A;  3LJN A;  3EU9 A;  2NYJ A;  5CBO A;  1D9S A;  2QYJ A;  5HS0 A;  2KBX A;  3NOG D;  4HRM B;  3ZU7 B;  2XEE A;  2Y0B G;  3SO8 A;  5AQ9 A;  5ENP D;  4LNU D;  3J5Q B;  1YMP A;  3F6Q A;  1MJ0 A;  5KWD A;  4HI9 A;  1IXV A;  4K5A B;  3Q9U C;  3B7B A;  5EN5 D;  1WDY A;  2KXP C;  3TWV A;  4ZFH A;  5CEC B;  4YDW A;  4DUI A;  5EYL A;  1MX4 A;  3TWX A;  4DX1 A;  5EYP F;  3W9G A;  5JA4 D;  1OY3 D;  4LG6 A;  3ZNG A;  5CED B;  2DWZ A;  4GPM A;  1TR4 A;  4HLL A;  4O1P A;  2B0O E;  3TWQ A;  3AJI A;  1N11 A;  2VGE A;  2XZT G;  3IXE A;  5JMN D;  4CZ2 D;  5AAR A;  2JAB A;  3NOC D;  5AN8 A;  5D66 A;  3V31 A;  4N5Q A;  5BXU A;  2ETB A;  4QFV A;  4U95 D;  5BXO A;  3AAA C;  4C48 B;  4J7W A;  3ZKJ A;  2DZO A;  3V79 K;  1BD8 A;  2RFA A;  2A5E A;  4HI8 A;  2AJA A;  1SW6 A;  4DX6 D;  5AQA A;  4G8L A;  4DX5 D;  1YYH A;  3JXJ A;  3ZUV B;  4Z68 A;  5KNH D;  4GMR A;  3J5P A;  2V4H C;  4F6R D;  1S70 B;  3JUE A;  4A63 B;  5ENR D;  2DVW A;  4HRN A;  3HRA A;  3TWW A;  3T8K A;  5EIB E;  3V2X A;  1OT8 A;  4OAV B;  3T9K A;  3TWR A;  3W9F A;  4DX2 A;  4J8Y A;  4CYM D;  5ENO D;  1K1A A;  4F1P A;  5AQB A;  1N0Q A;  2L6B A;  2PNN A;  2V5Q C;  2ZGD A;  1MX2 A;  5FIN A;  2F37 A;  5KNG A;  2Y1L E;  1YCS B;  4ZHB A;  1A5E A;  5AQ7 A;  3JXI A;  5EID A;  1SVX A;  5ENS D;  3KEA A;  3EHR A;  5CEA A;  4K5C A;  4RLY A;  2ZGG A;  4U8V D;  5ITZ F;  1IHB A;  1QYM A;  3TWS A;  2XEN A;  2QC9 A;  2FO1 E;  1AP7 A;  2HE0 A;  1BI7 B;  1IKN D;  1BI8 B;  4LSZ E;  5HKP A;  1K3Z D;  3DEP A;  1MX6 A;  2XZD G;  3Q9N C;  3C5R A;  3UI2 A;  4ATZ D;  5CBN A;  3D9H A;  1N0R A;  1BLX B;  4BSZ B;  5CER B;  1BU9 A;  4O60 A;  5AAO A;  3V30 A;  3EHQ A;  2ETA A;  5HRY A;  1DCQ A;  4DX7 D;  1DC2 A;  5KBA A;  4UUC A;  3B95 A;  1NFI E;  1WG0 A;  4U8Y D;  4O1O A;  4HB5 A;  3TWT A;  4TUM A;  2BKK B;  3DEO A;  2MYO A;  4G8K A;  5ENT D;  4BES A;  4HBD A;  2P2C P;  4JB8 P;  4OAU C;  2BKG A;  2F8Y A;  3HG0 D;  5FIO A;  2DZN A;  4HNA D;  3UTM A;  2F8X K;  4U96 D;  4QQI A;  4BEP A;  2ETC A;  5EIL A;  3NBN B;  4BET A;  1MYO A;  3UXG A;  1G3N B;  1UOH A;  4K5B A;  4DRX E;  2RFM A;  4NIK A;  4B93 B;  1AWC B;  4HQD A;  4YDY A;  3TWU A;  2J8S D;  3V2O A;  4HRL A;  2XEH A;  5ENQ D;  4BER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...