3CR3A

Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
192
Chain Sequence
LLTIDTTIEWLGKFNEKIQENKAYLSELDGPIGDGDHGANMARGMSETMKALEVSNFGNVSEIFKKVAMTLMSKVGGASGPLYGSAFLAMSKTAIETLDTSELIYAGLEAIQKRGKAQVGEKTMVDIWSAFLNDLQTDSASKDNLEKVVKASAGLLATKGRASYLGERSIGHIDPGTQSSAYLFETLLEVVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structures of the Three Lactococcus lactis Dihydroxyacetone Kinase Subunits and of a Transient Intersubunit Complex.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transferase
molecule keywords PTS-dependent dihydroxyacetone kinase, ADP-binding subunit d
total genus 69
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cr3A00
1UN8A 2BTDA 3PNLB 3CR3A 4LRZA 1UN9A
chains in the Genus database with same CATH superfamily
3QKYA 3B7SA 3E34A 4MBGA 2Q7FA 4ATZD 2IOSA 1OT8A 2LAIA 1N95A 5KNGA 2PM6A 2UWJG 5JMND 2IO2C 5ARFA 2FI7A 1ZB1A 2PQRA 3AAAC 1TYQG 5FZSA 4CEMA 2IJGX 1TN7A 2B6CA 1TNBA 1NA0A 2HYZA 4ZHBA 3RAUA 4TUUA 4YDEA 2WXQA 4GTQA 4G8KA 1XNFA 2VSNA 3MZLB 2HR2A 3L6AA 3IBEA 1Z3YA 2WXHA 3L82A 3HIZA 4J8FA 4TUMA 1TJFA 2P9NG 2QZAA 3C3QA 3D9MA 4ACKA 1XGWA 2YQ8A 3LY7A 3HXCA 3ONKA 5B3SE 4FJZA 3AS8A 5EKQD 4F1SA 2ETCA 5ENRD 3APCA 3KEZA 3B7RL 4JHKA 4FA6A 3Q15A 2WXFA 1H6OA 4O60A 3FUJA 4G24A 1N11A 4GA0A 2BF0X 4U0ZA 2J08A 4CCAA 3P2BA 4KT6B 1SW6A 2QC9A 3ZRHA 1DVPA 1SA5A 1K3ZD 3S2AA 2NC9A 4BT9A 4JVSA 1G3NB 3RU0A 1DC2A 3MKRA 5BNWA 4K5BA 1HU3A 5T4YA 1GW6A 2QYUA 3UMVA 3EHNA 2PQNA 2YHCA 4NIKA 4GTVA 4JHRA 1NP7A 5E76A 5BUZA 4IRUA 2CHXA 3AG4E 2DVWA 2ZISA 3HHMA 2P58C 3S7FA 3UM2A 1E8XA 3ASHA 4F7AA 4NQ0A 3FU3A 3CK7A 1HO8A 1IQUA 3SGHA 2X6FA 1WY6A 2J8SD 5ENNA 3ESKA 4U0UA 4C0EA 1IQRA 4GTMA 2V5FA 2BTDA 4P29A 2UY1A 5G04J 2GRMA 4MRUA 3AG3E 3CVQA 5FQ6A 1SQMA 2XENA 3SO8A 3P1UA 3OXLA 2KBXA 2Y4UA 5AAOA 3V79K 4Q69A 4F53A 2H6HA 1N52A 4CDNA 1E7UA 3C5RA 4DX1A 3VLFA 3ABME 1H19A 2VSXE 3DPDA 2WXOA 1ZBPA 4QQIA 3FTWA 2AWIA 3HYMB 4B89A 3ASOE 3D9HA 3ULYA 2AVPA 4AXHA 4A1GA 2X6HA 4U63A 4C48B 2I1JA 1UN9A 4I17A 5FQ7A 5C2YA 3PH0C 3Q5MA 1MZCA 2RG8A 3FP3A 4O1OA 4LNGA 3CHOA 1OUVA 3KEAA 2ONDA 3LYAA 1H6PA 3EJNA 2WXPA 3Q4AB 1KZPA 2I1KA 3CKBA 2Y4TA 2GRPB 5BW8C 3CVLA 2WPVA 1HXIA 3R7RA 4ANWA 2J49A 2XGMA 4J8DA 5FIOA 4J0UA 3UT8A 2IO3C 4A55A 5KBAA 3CVUA 3PUJA 4ANUA 1TNOA 1E90A 4ZFHA 4AY5A 3PRZA 2IU1A 3ZGQA 4AM9A 1E8WA 2EINE 2I6HA 3AJIA 4IULA 1IKND 4LERA 4F1PA 5G04C 3ZNGA 3DWLG 4GZ5A 3SI5A 3ASGA 1E96B 1DNPA 2V4LA 3PEUB 3E4BA 2XGOA 4H7XA 3QAQA 2DYSE 1OCOE 3E30A 4GYWA 2P9UG 3CVVA 4UWGA 4GAAA 3Q49B 3BQOA 4L9PA 2E0IA 4U8HA 4PH4B 3EUVA 2DCPA 1TNUA 2XRYA 3C72A 3DXKG 4GZ6A 4ILHB 3Q79A 4GU5A 5DBKA 4J6IA 1OXJA 2UY1B 2PM7A 2V5QC 4HLEA 1WG0A 2LXMA 4BTAA 2QY7A 4PUCA 3IHVA 4HI8A 1UOHA 3DBSA 2IF4A 5EILA 2DZNA 4EZKA 4JL0A 2KCVA 2EIME 3FDHA 2EQXA 2R17C 3UINC 1LTXA 4FJYA 3SZ7A 5CERB 3PE3A 2WMNA 2R05A 4A3TA 3CVWA 3LJNA 2H6IA 2LUHA 1DCEA 4AOFA 2WVIA 2L0TB 5FZRA 4EHMA 3UT7A 2H6GA 2OVBA 3DRAA 2F37A 2V4HC 3EHMA 3UPVA 5FJYA 4J8YA 3UM0A 1EDUA 5A7DB 5LCWJ 5CRUA 4KYOB 3SD5A 2OV8A 3FH8A 4FLBA 4PS8A 1V54E 4WWOA 3GW4A 3CHPA 4K5AB 4HNAD 3FU6A 1TEZA 1Z3XA 1H0AA 3FUHA 5CEDB 1IHGA 3CK8A 2FO1E 1S0PA 3HVEB 3LY8A 3K9IA 4WNFA 2KATA 4U0SA 1H2VC 4XI0A 1OCZE 2PNNA 3ULEG 3EDTB 3UT4A 4G11A 3GZ1A 1TNZA 1TR4A 2DIWA 1EPUA 3JCKC 4BY6A 1MX4A 3UKUG 3GZSA 3ISMC 1H6KA 3SNXA 2IQCA 1O1TA 3R9AB 5KJLA 3D3MA 4JPSA 2XQ0A 2RKKA 2XCCA 3KS2A 3SFXA 1SA4A 2GGFA 4E85A 2OEWA 3D9JA 4N3AA 1BU9A 5LP0A 2HM8A 5G05J 5EYLA 2NYJA 1B89A 3TL5A 4GA1A 3DSSA 4KXKB 3PZ1A 2X3MA 3OTNA 4AJWA 2XZTG 4DK5A 4HRMB 4JA7A 3LDZA 5E75A 1JPLA 3B95A 3S7JA 4CT4A 5CCMA 5KWDA 4MKTA 3FY4A 4UI9K 2LSUA 5B1AE 2KCKA 4GTTA 4ME2A 4HI9A 3E37A 3EIQC 5ENPD 4APOA 2L9BA 3G2WA 3VTXA 1HE8A 4FHJA 4I6EA 4OAUC 3D9OA 3QWPA 4GTOA 3HXFA 3QWWA 1MHQA 4WNEA 5D0OD 3MKQA 3E33A 3V2XA 3C98A 3DSXA 5A6CA 5IY5E 3IKOB 3OAWA 4N2QA 4N39A 2J09A 2VYIA 3Q7AA 4CYMD 2BEDA 2MRIA 3ZIMA 3O48A 4J8SA 3DEOA 3NOGD 4W9RA 1HX8A 1OY3D 4JD2G 5DIZA 1ELRA 4FADA 3RRUA 3TAXA 1HG5A 2Y1LE 2Y3AA 3V31A 5H7PA 3UIOC 2ZXWE 4LNBA 4HOSA 2XPZA 4N3CA 3KSLA 1UJJA 1UG3A 3EU9A 2R2LA 3CHQA 4HRLA 1PY1A 1HF8A 2LO6A 1KLXA 3TGOA 4AEZC 4GPKA 1N0RA 1U2VG 1N4PA 2WQHA 3ZYMA 4CDRA 3TWTA 2V8SE 5ENOD 4HBDA 1QNFA 4ATGA 2OEVA 2NXPA 1N4QA 3D9LA 1N4RA 3U66A 5FT9A 3QK0A 4GTPA 5BXOA 1PC2A 1N4SA 3MA5A 4GZDA 3X2QE 3G2TA 3LVRE 4GB9A 1BLXB 3JQ0A 3MYVA 5JHAA 4UI9C 1K1AA 4DPRA 3FTXA 4HOTA 3LJ3A 3PE4A 3T5XA 2VGXA 3BG1B 4BFRA 4DRXE 2J07A 4UWKA 1HH8A 3T9KA 2XEVA 3AS5A 3NOCD 3D9PA 4MS6A 2KZTA 2IOLA 1E8ZA 4HS2A 4XX5A 2CFZA 4XI9A 4YNDA 2EIJE 1KZOA 2R5SA 1E7VA 2WQ7A 5AJDA 1JWGA 2L6BA 5EN5D 1NI1A 4AV7A 3FUFA 1D8DA 1FT2A 2P9PG 4IN3B 1YCSB 3B7TA 1LF8A 2F0YA 3QOUA 3WG7E 4WNDA 4HXIA 2WXLA 4FLHA 3ZEFA 3ZXSA 4BWRA 3AU5A 3FH7A 4BX8A 5J08A 3AG2E 4YDWA 3J5QB 5G05C 4AIFA 3F6QA 3KD7A 4LCTA 4OYSA 3BUAA 4ACLA 5CHEE 4LUNU 4DX6D 4F6RD 3UX4A 4B8AA 4GA2A 1U3DA 5HS0A 1TJCA 4MLPA 2CG2A 4XIFA 2AW6A 3RRNB 4AP2A 5CBOA 4Z68A 2WB2A 1RZ4A 4JZYA 3Q7FA 4HOQA 4JC8A 5LX8A 3L22A 2GROB 2VQ2A 3FTUA 4N5QA 5CRVA 4L1BA 4RLYA 2CFUA 3AG1E 3R7QA 3Q9NC 4BETA 2YINA 4TRQA 4AVXA 4GMLA 3PNLB 1TN8A 3TWUA 2A5EA 3UI2A 4GYYA 1Y6IA 4BX9A 3L08A 3JXJA 2F8YA 2EIKE 2GRNB 3CGHA 3JUEA 2P9IG 5C1DA 3UQ3A 5CEAA 3PUKA 3U3WA 3TWVA 1NL4A 1IYGA 4HFGA 5FQ4A 3RJVA 5HKPA 4KVMA 4URKA 1U3CA 3S7BA 1N94A 2P9LG 3G2UA 2E2EA 3MCXA 2XZDG 5AYWD 1O1RA 3FTVA 4Y6CA 5M72A 2CHWA 1EF1C 3RO2A 4DX7D 5FWQA 2JABA 5J90A 2Y69E 3IXEA 1JCSA 4G25A 5EYPF 3CQCB 3ZUVB 3APDA 3D9NA 3FUMA 5LFAA 1QZ2A 2I2OA 4Q94A 3FTZA 3IHYA 2KM4A 5EX3A 3DXMG 5ARGA 2L6JA 3PNTB 4DUIA 4XE0A 3N71A 2L0IA 4GCNA 5KJMA 5BXUA 3QC1A 4FC8A 1FT1A 2F8XK 3DPYA 3LVQE 3L54A 3OXGA 3RKVA 3ZN3A 3B7UX 1FVFA 2IFUA 4GYOA 4XZ4A 5EIDA 1LD7A 3QARA 3UKRG 2OCCE 5A23A 4ILIA 4DX2A 4YVQC 1L5JA 5HRYA 3FUKA 3TWQA 3SY2A 3CIAA 2NSZA 3ONLA 5CECB 2P9KG 2AXZA 2B0OE 2IONA 5G2NA 2XGSA 3FU5A 3U4TA 2FEZA 4CDMA 2DZOA 2J9QA 2KC7A 3ZYKA 3J5PA 3W9GA 4BSZB 3RIBA 3FEXA 1O1SA 3HXEA 5G55A 4ABNA 5AQ7A 3KAEA 4I9EA 4XEIG 3SBSA 3LEWA 1MJ0A 1BI8B 4U04A 1BI7B 3TWSA 3ASFA 3CVYA 4U07A 1AWCB 1PAQA 3BU8A 3DEPA 4EQFA 4RSYA 3CVNA 2X6IA 5CMWA 1YMPA 2ZU6B 3C3OA 4UWFA 4E6HA 3V30A 2AXUA 4JA9A 2P2CP 2OOEA 5AQBA 1LD8A 4YVOA 4GTSA 3JUIA 5JA4D 4QFVA 4UQZA 4K03A 1A5EA 1D9SA 2Y0BG 5CBNA 2MOWA 1OCCE 2MYOA 3FFLA 1Q2ZA 3ZXPA 3FH5A 3EIJA 4TXRA 2OVFA 3DSWA 4WWNA 4ILGA 1IXVA 3ZKJA 3VLDA 1HS6A 5FZQA 3ZHEB 1OWOA 3L9TA 4UUCA 1YYHA 2XEHA 2WM9A 2LNIA 4RG9A 1ZU2A 3RK6A 3MKQB 4LNUD 3QB2A 5AIJA 4GZ3A 3DSVA 4I6GA 3OXFA 2V0PA 5AENA 2C0LA 5CCLA 3B13A 3CHSA 4KZ0A 3D9IA 3MJWA 3CR3A 4C0MA 2QYJA 4OAVB 4EBAA 1NZNA 3FWVA 1JWFA 3G2SA 4I1OB 4N5CA 2ZGGA 2ILRA 2RD0A 4Y6WA 1OCRE 4CT0A 4J7WA 3PS6A 2XPYA 4HB5A 2FO7A 2CG3A 2A5UA 4FHKA 4I2WA 3UTMA 4FP7A 3UUXA 2EILE 1Z5SC 3SF4A 4EECA 3ASNE 4O6FA 1H2TC 1KPSB 2ETAA 3NZSA 4EPZA 3AS4A 4NACA 3SBTB 3RSEG 5ANLA 2WMOA 4BESA 1UN8A 4UWHA 3LXUX 5D0QD 4U7EB 1INZA 1MX2A 1E8YA 4BTBA 2H6FA 1SZ9A 5AN8A 1Y8MA 3JQ1A 3HXDA 2XS8A 3V2OA 2MHKA 1TNYA 4PS7A 4CRWA 2VSYA 4BT8A 4HVBA 4I43A 3ZW3A 4DI3A 3ML9A 4HQDA 1MX6A 3EHQA 2XHEA 3E32A 5D66A 4JHJA 5HI7A 1Z6TA 3EHRA 5B1BE 4GMJA 3SHFA 5ANRA 3C3RA 4UI9J 4EZLA 3ABLE 2PL2A 4N3BA 5T8IA 1EYHA 3W9FA 1QYMA 4A3VA 4GZCA 4PS3A 1JCRA 3SQVA 1NFIE 1RW2A 2HE0A 4M7CA 1D8EA 2C0MA 4DI4A 3U64A 1OWNA 3AU4A 3KSQA 3URZA 4ANXA 3PREA 3PDNA 2VTBB 3L17A 3S7DA 4TXQA 1OWPA 2WXRA 3QWVA 4A63B 4BSXA 3ZYQA 4KMOA 3CVPA 4U96D 4GTRA 3ZVVA 5JHBA 3ENEA 4YDOA 2VGEA 3PVLA 2KXPC 3FUDA 3ESLA 3IV0A 1DCQA 3IEGA 4G26A 4JB8P 3ZU7B 4G2VA 4GCOA 4JEHA 4FULA 3MX3A 3ABKE 3CKCA 4NRHB 4I1AA 1YA0A 4RVBA 2JEKA 2A4ZA 4TV3A 3TWRA 4JXTA 5JJ7A 3CVXA 3CEQA 2VSOE 2M63A 1UW4B 3CLJA 3G2VA 3FHEA 2JLBA 3Q75A 1X5BA 3RO3A 2P9SG 3Q47B 4X8QA 2KZTB 2WXJA 3ZHEA 1IHBA 3HRAA 1ELKA 5FTPA 1SVXA 2AJAA 5BT1A 3CSTA 3UM1A 4CGVA 4OVUA 4PDXA 1WM5A 4B94A 2AXVA 3FTSA 4DLOA 2XCBA 4A1SA 1MYOA 2YNQA 3U9WA 3TJPA 3SFYA 4U95D 4V3IA 5AQAA 5EX0A 4IYPA 4RQIA 3Q78A 5FINA 4U8VD 2R59A 3LKUA 4BEPA 2RFAA 4H7YA 2ZIRA 4L2LA 4DLQA 3PZ2A 3GYZA 3T8MA 5ENSD 4NURA 4UQXA 3TWXA 3NZUA 2PZIA 2VGYA 4AY6A 2FF4A 5EIBE 1JUQA 2CHZA 4D10C 2WXKA 4L2YA 2VJ8A 5LCWC 3ZYLA 2WXMA 1FCHA 2J4DA 4DX5D 4I9CA 3R9MA 3HVEA 4WWPA 3D9KA 3ZFWA 2GRLA 5BPPA 3I3NA 2WQ6A 3ZPJA 3I4RB 5KCMA 2DBAA 4LEUA 1ELWA 4CGWA 2GRRB 3Q9UC 3T5VA 4B0ZA 3NBNB 3O4ZA 4APFA 3LCAA 2R03A 1JCQA 2GW1A 2ETBA 2BUGA 2WXGA 3VTYA 2LSVA 1KT0A 1TN6A 3ASDA 5ENQD 4HORA 3JYSA 2I9CA 4RG6A 4O1PA 1N54A 2KCLA 1BD8A 3TXMA 2XS1A 4TXPA 1KT1A 3Q73A 3CHMA 3UM3A 4JEUA 3L16A 1HZ4A 3LPZA 1FPPA 4U8YD 3PZ4A 1N0QA 2QFCA 1P5QA 3JXIA 4UQYA 4YDYA 4LRZA 2YHEA 1W3BA 2IEJA 1SZAA 3HXBA 3CK9A 4L7TA 1OWLA 4GMRA 3PZDA 1S63A 4J8EA 1S70B 3FUEA 2J4BA 3I4GA 1UJKA 3TG5A 3EU5A 1BPOA 5AARA 2X6JA 2GRQB 3RRMB 2X38A 3BEEA 3NAWA 1S64A 2LAHA 5T3RA 3MV2B 4C9BB 2IY0C 3I5PA 1AP7A 1X81A 3ML8A 5EDSA 3UXGA 4GPMA 4L23A 1V55E 4Q96A 1A17A 4HOUA 3SFZA 3MEKA 1HG2A 5LOZA 4N2SA 4M3OA 3FEYA 4JW1A 4B8CB 4XKCA 4UWLA 4OVVA 2XRZA 1N9AA 5CMYA 2C2LA 1NA3A 3MV3B 4R7LA 4G1TA 3LS8A 4WUYA 2WXNA 3NQPA 2WXIA 5KJKA 4K5CA 5KJNA 4FU3A 4KZCA 3B7BA 2ZGDA 3L13A 1K1BA 3HDXA 2HO1A 5ITZF 4LG6A 4F3VA 2X6KA 1VDYA 4KBQA 1MQSA 1QQEA 4ANVA 1O5MA 5D2MC 2VGXB 4WAFA 4I2ZA 3DSTA 2FBNA 3CSFA 3QNKA 4EZJA 2LXLA 1K8KG 1OWMA 2BKGA 4G23A 1HFAA 3FU0A 5BV1A 4HLLA 4G8LA 5AQ9A 4HRNA 5JJTA 5AJLA 5HQ8A 3TWWA 3PZ3A 2RFMA 1WAO1 1QBQA 4K0RA 3TXNA 1WDYA 4XKBA 3UIPC 3APFA 5FQ8A 1H2UA 3FUNA 4I6JA 4I1MA 3ULQA 4LSZE 4BERA 3CQGB 1FVHA 2VTBA 3CV0A 4KVOA 3TG4A 3LY9A 3HG0D 4EBAG 2XEEA 3FULA 4WNGA 3BG0B 3MGBA 3DSUA 3FUIA 3FTYA 3VLEA 2R02A 3GZ2A 5KNHD 3NB2A 3NF1A 2XPIA 5JJ6A 2DYRE 2BKKB 4DJAA 2FULA 3CHRA 3PEVB 5ENTD 5BV0A 3WXXA 4B93B 4CZ2D 3QJZA 2DWZA 3QDNA 3T8KA
chains in the Genus database with same CATH topology
3CKCA 3QKYA 3B7SA 4KVMA 4NRHB 2Q7FA 4I1AA 2IOSA 4KYOB 3SD5A 4URKA 1YA0A 2OV8A 3FH8A 2LAIA 4RVBA 1U3CA 3S7BA 4FLBA 2PM6A 2JEKA 2A4ZA 4PS8A 4TV3A 3G2UA 2E2EA 4JXTA 2UWJG 4WWOA 5JJ7A 3GW4A 3CVXA 3CHPA 5ARFA 3MCXA 2FI7A 3FU6A 2PQRA 3CEQA 1TEZA 1Z3XA 1H0AA 2VSOE 3FUHA 2M63A 5AYWD 1UW4B 3CLJA 3G2VA 3FHEA 5FZSA 4CEMA 1IHGA 2JLBA 3CK8A 1X5BA 3FTVA 2IJGX 4Y6CA 1S0PA 3HVEB 3LY8A 3K9IA 4WNFA 5M72A 3RO3A 2CHWA 3Q47B 1NA0A 2HYZA 2KATA 1EF1C 2KZTB 4U0SA 1H2VC 3RO2A 5FWQA 5J90A 4XI0A 2WXJA 3ZHEA 3EDTB 4TUUA 3UT4A 4G11A 3GZ1A 2WXQA 4G25A 1ELKA 1XNFA 2DIWA 2VSNA 3MZLB 3CQCB 2HR2A 3L6AA 5FTPA 1EPUA 3JCKC 4BY6A 3IBEA 3APDA 3D9NA 1Z3YA 3FUMA 5BT1A 3GZSA 3CSTA 5LFAA 1QZ2A 1H6KA 2I2OA 4Q94A 3FTZA 4OVUA 3SNXA 2WXHA 4CGVA 4PDXA 3HIZA 1WM5A 4B94A 2IQCA 3IHYA 4J8FA 2AXVA 2KM4A 3R9AB 5EX3A 1TJFA 3FTSA 5ARGA 5KJLA 4DLOA 3D3MA 4JPSA 2L6JA 2XQ0A 3PNTB 2XCCA 3N71A 4XE0A 2L0IA 2XCBA 3D9MA 4ACKA 3KS2A 4A1SA 4GCNA 5KJMA 1XGWA 2YQ8A 2YNQA 3U9WA 3TJPA 2GGFA 3LY7A 3QC1A 4E85A 3D9JA 3ONKA 4N3AA 4V3IA 5LP0A 5EX0A 4IYPA 4FC8A 4FJZA 3AS8A 2HM8A 5G05J 5EKQD 4F1SA 1B89A 3TL5A 4GA1A 3LVQE 4KXKB 3APCA 3L54A 3KEZA 3B7RL 2X3MA 4JHKA 3OXGA 4FA6A 3Q15A 3RKVA 2WXFA 3OTNA 3ZN3A 4AJWA 3FUJA 3B7UX 2R59A 3LKUA 4G24A 1FVFA 2IFUA 4GA0A 4GYOA 4XZ4A 4H7YA 4DK5A 2BF0X 4U0ZA 4L2LA 4DLQA 4JA7A 2J08A 3QARA 3P2BA 4KT6B 4CCAA 3LDZA 5E75A 1JPLA 3S7JA 4CT4A 5CCMA 4MKTA 3GYZA 3ZRHA 5A23A 4ILIA 1DVPA 3T8MA 3FY4A 4YVQC 1L5JA 4NURA 4UQXA 3FUKA 4UI9K 3S2AA 2LSUA 2NC9A 4BT9A 3CIAA 3NZUA 4JVSA 2PZIA 2KCKA 2NSZA 3RU0A 3ONLA 2VGYA 4ME2A 2AXZA 4AY6A 2IONA 2FF4A 2XGSA 3FU5A 5G2NA 3MKRA 3U4TA 5BNWA 2FEZA 3EIQC 1JUQA 1HU3A 2CHZA 4D10C 4CDMA 4APOA 5T4YA 2J9QA 2L9BA 1GW6A 2VJ8A 2WXKA 2KC7A 4L2YA 3UMVA 3ZYKA 3G2WA 5LCWC 3ZYLA 2WXMA 3EHNA 1FCHA 2J4DA 4I9CA 3RIBA 3VTXA 1HE8A 3HVEA 4WWPA 3D9KA 3FEXA 2PQNA 4FHJA 4I6EA 3ZFWA 2GRLA 5BPPA 3I3NA 3D9OA 5G55A 2YHCA 4ABNA 2WQ6A 3QWPA 3ZPJA 3KAEA 4I9EA 3QWWA 4JHRA 3SBSA 3LEWA 1MHQA 1NP7A 4WNEA 3I4RB 5KCMA 2DBAA 5D0OD 3MKQA 4LEUA 5E76A 1ELWA 4U04A 3ASFA 4CGWA 3CVYA 3C98A 5BUZA 4IRUA 2CHXA 4U07A 5A6CA 3IKOB 1PAQA 3T5VA 3OAWA 4B0ZA 3O4ZA 4N2QA 4EQFA 4RSYA 3HHMA 3CVNA 4N39A 2X6IA 2J09A 4APFA 5CMWA 2VYIA 2ZU6B 4UWFA 4E6HA 3LCAA 2P58C 2MRIA 3ZIMA 2GW1A 3O48A 2BUGA 2WXGA 4J8SA 3S7FA 2AXUA 4JA9A 3VTYA 4W9RA 1HX8A 2OOEA 1E8XA 4YVOA 3ASHA 4F7AA 4NQ0A 3FU3A 3JUIA 5DIZA 2LSVA 3CK7A 1HO8A 1IQUA 1KT0A 4QFVA 3SGHA 2X6FA 1WY6A 1ELRA 4UQZA 4FADA 3ASDA 4K03A 5ENNA 3JYSA 4HORA 2I9CA 3RRUA 2MOWA 3ESKA 4U0UA 4RG6A 3FFLA 4C0EA 3TAXA 1HG5A 3FH5A 1IQRA 1N54A 2KCLA 2Y3AA 3EIJA 2OVFA 3TXMA 2V5FA 4WWNA 2BTDA 4HOSA 1KT1A 4ILGA 4P29A 2UY1A 2XPZA 4N3CA 3CHMA 1UJJA 4JEUA 1UG3A 3L16A 2GRMA 5G04J 1HZ4A 1HS6A 3VLDA 3LPZA 4MRUA 5FZQA 3ZHEB 1OWOA 3CHQA 3CVQA 2QFCA 1PY1A 1P5QA 5FQ6A 1HF8A 4UQYA 2LO6A 2WM9A 1KLXA 1SQMA 2LNIA 4LRZA 2YHEA 1ZU2A 3P1UA 4RG9A 4AEZC 3OXLA 3RK6A 3MKQB 1W3BA 1SZAA 3CK9A 2Y4UA 4GPKA 3QB2A 5AIJA 4GZ3A 4L7TA 4I6GA 3OXFA 2V0PA 1OWLA 4Q69A 4F53A 3PZDA 5AENA 2C0LA 1N52A 4CDNA 2WQHA 5CCLA 1E7UA 3B13A 4J8EA 3ZYMA 3CHSA 4KZ0A 4CDRA 3VLFA 3D9IA 3FUEA 3MJWA 4ANWA 2J4BA 1H19A 2V8SE 3CR3A 3I4GA 2VSXE 1UJKA 4C0MA 3TG5A 3DPDA 2WXOA 1ZBPA 4EBAA 1NZNA 1QNFA 1BPOA 3FWVA 4ATGA 3FTWA 1JWFA 2AWIA 2X6JA 3G2SA 3HYMB 2NXPA 4B89A 4I1OB 3D9LA 3RRMB 3U66A 4N5CA 2X38A 5FT9A 2AVPA 4AXHA 3QK0A 4A1GA 2X6HA 3BEEA 2ILRA 4U63A 2I1JA 2LAHA 1UN9A 2RD0A 4I17A 4Y6WA 5T3RA 4CT0A 3PS6A 5FQ7A 5C2YA 2XPYA 3PH0C 2FO7A 1PC2A 3MV2B 3MA5A 3Q5MA 4GZDA 4C9BB 2CG3A 3G2TA 2A5UA 4FHKA 3LVRE 4I2WA 4GB9A 2RG8A 3FP3A 3I5PA 4FP7A 3UUXA 3JQ0A 3CHOA 3MYVA 4UI9C 1OUVA 3ML8A 5EDSA 5JHAA 3SF4A 4EECA 4L23A 2ONDA 3LYAA 4Q96A 1A17A 3EJNA 4O6FA 2WXPA 4DPRA 3FTXA 4HOTA 3LJ3A 1H2TC 3PE4A 3Q4AB 3T5XA 2VGXA 2I1KA 4HOUA 3CKBA 2Y4TA 3SFZA 5BW8C 3BG1B 3CVLA 2WPVA 3NZSA 1HXIA 4BFRA 4EPZA 2J07A 4UWKA 3R7RA 1HH8A 2XEVA 3AS4A 3AS5A 2J49A 3MEKA 4NACA 1HG2A 3D9PA 5LOZA 3SBTB 4MS6A 5ANLA 4M3OA 2KZTA 2XGMA 3FEYA 4N2SA 2IOLA 2WMOA 4J8DA 1E8ZA 4HS2A 4J0UA 4JW1A 4XX5A 4B8CB 3UT8A 2CFZA 4XI9A 4YNDA 4XKCA 4UWLA 1UN8A 4UWHA 4A55A 3LXUX 2R5SA 3PUJA 3CVUA 1E7VA 5D0QD 2WQ7A 5AJDA 4ANUA 1INZA 1E8YA 1JWGA 4OVVA 4BTBA 3TGOA 2XRZA 5CMYA 1E90A 2C2LA 3FUFA 4AV7A 1SZ9A 1NA3A 3MV3B 4R7LA 4IN3B 4G1TA 3B7TA 3LS8A 1LF8A 4WUYA 4AY5A 2WXNA 3PRZA 1Y8MA 3QOUA 3JQ1A 2IU1A 3NQPA 4WNDA 2WXIA 4HXIA 3ZGQA 5KJKA 2WXLA 4FLHA 4AM9A 3ZEFA 1E8WA 2I6HA 5KJNA 4FU3A 4KZCA 4IULA 2MHKA 3ZXSA 4LERA 4PS7A 4BWRA 4CRWA 3AU5A 5G04C 2VSYA 3FH7A 4BT8A 4HVBA 4I43A 4BX8A 3L13A 5J08A 3ZW3A 4DI3A 3ML9A 3HDXA 2HO1A 4GZ5A 3SI5A 3ASGA 5G05C 4AIFA 1E96B 2X6KA 4F3VA 1DNPA 3KD7A 4LCTA 1VDYA 2V4LA 3PEUB 4KBQA 1MQSA 2XHEA 1QQEA 4JHJA 4OYSA 5HI7A 4ANVA 1Z6TA 3E4BA 2XGOA 4H7XA 4ACLA 5CHEE 3QAQA 2VGXB 4GMJA 4GYWA 4WAFA 3SHFA 4I2ZA 4LUNU 4UWGA 5ANRA 2FBNA 3CVVA 3CSFA 3QNKA 4GAAA 4UI9J 4EZJA 3UX4A 4B8AA 4EZLA 4GA2A 1OWMA 1U3DA 1TJCA 4MLPA 2CG2A 3Q49B 4XIFA 2PL2A 4N3BA 5T8IA 4G23A 1EYHA 2AW6A 3RRNB 2E0IA 4A3VA 4AP2A 1HFAA 3FU0A 4GZCA 4PS3A 5BV1A 4U8HA 4PH4B 2DCPA 2XRYA 4ILHB 4GZ6A 2WB2A 4GU5A 4JZYA 4HOQA 4JC8A 5DBKA 4J6IA 5JJTA 3L22A 5LX8A 5AJLA 2UY1B 2PM7A 2VQ2A 5HQ8A 3FTUA 2C0MA 4DI4A 3U64A 4HLEA 4L1BA 1OWNA 2CFUA 1WAO1 3AU4A 4BTAA 2QY7A 3URZA 4ANXA 3R7QA 4K0RA 3PREA 3PDNA 4PUCA 2YINA 4TRQA 3TXNA 4XKBA 4AVXA 3IHVA 4GMLA 2VTBB 3DBSA 3L17A 3APFA 5FQ8A 3S7DA 2IF4A 1H2UA 4EZKA 1OWPA 3FUNA 4JL0A 4I6JA 2KCVA 4I1MA 3ULQA 3FDHA 2WXRA 3PNLB 3QWVA 2EQXA 2R17C 3CQGB 1FVHA 4FJYA 4BSXA 3CV0A 3ZYQA 2VTBA 4GYYA 1Y6IA 4KMOA 4KVOA 3SZ7A 3PE3A 4BX9A 2WMNA 3TG4A 3LY9A 4A3TA 3CVWA 3CVPA 3L08A 4EBAG 3ZVVA 3FULA 4WNGA 4AOFA 3CGHA 2WVIA 2L0TB 3BG0B 5FZRA 3MGBA 5JHBA 3FUIA 3UT7A 3FTYA 3VLEA 3ENEA 5C1DA 2OVBA 3UQ3A 3U3WA 3PUKA 3GZ2A 3PVLA 3FUDA 3NF1A 2XPIA 1IYGA 5JJ6A 3ESLA 4DJAA 3EHMA 2FULA 3UPVA 5FJYA 3IV0A 3CHRA 3PEVB 3IEGA 5BV0A 3WXXA 4G26A 1EDUA 3QJZA 5A7DB 5LCWJ 4HFGA 4G2VA 4GCOA 4JEHA 3QDNA 5FQ4A 3RJVA 4FULA 3MX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN8 A;  2BTD A;  3PNL B;  3CR3 A;  4LRZ A;  1UN9 A; 
#chains in the Genus database with same CATH topology
 3QKY A;  3B7S A;  3E34 A;  4MBG A;  2Q7F A;  4ATZ D;  2IOS A;  1OT8 A;  2LAI A;  1N95 A;  5KNG A;  2PM6 A;  2UWJ G;  5JMN D;  2IO2 C;  5ARF A;  2FI7 A;  1ZB1 A;  2PQR A;  3AAA C;  1TYQ G;  5FZS A;  4CEM A;  2IJG X;  1TN7 A;  2B6C A;  1TNB A;  1NA0 A;  2HYZ A;  4ZHB A;  3RAU A;  4TUU A;  4YDE A;  2WXQ A;  4GTQ A;  4G8K A;  1XNF A;  2VSN A;  3MZL B;  2HR2 A;  3L6A A;  3IBE A;  1Z3Y A;  2WXH A;  3L82 A;  3HIZ A;  4J8F A;  4TUM A;  1TJF A;  2P9N G;  2QZA A;  3C3Q A;  3D9M A;  4ACK A;  1XGW A;  2YQ8 A;  3LY7 A;  3HXC A;  3ONK A;  5B3S E;  4FJZ A;  3AS8 A;  5EKQ D;  4F1S A;  2ETC A;  5ENR D;  3APC A;  3KEZ A;  3B7R L;  4JHK A;  4FA6 A;  3Q15 A;  2WXF A;  1H6O A;  4O60 A;  3FUJ A;  4G24 A;  1N11 A;  4GA0 A;  2BF0 X;  4U0Z A;  2J08 A;  4CCA A;  3P2B A;  4KT6 B;  1SW6 A;  2QC9 A;  3ZRH A;  1DVP A;  1SA5 A;  1K3Z D;  3S2A A;  2NC9 A;  4BT9 A;  4JVS A;  1G3N B;  3RU0 A;  1DC2 A;  3MKR A;  5BNW A;  4K5B A;  1HU3 A;  5T4Y A;  1GW6 A;  2QYU A;  3UMV A;  3EHN A;  2PQN A;  2YHC A;  4NIK A;  4GTV A;  4JHR A;  1NP7 A;  5E76 A;  5BUZ A;  4IRU A;  2CHX A;  3AG4 E;  2DVW A;  2ZIS A;  3HHM A;  2P58 C;  3S7F A;  3UM2 A;  1E8X A;  3ASH A;  4F7A A;  4NQ0 A;  3FU3 A;  3CK7 A;  1HO8 A;  1IQU A;  3SGH A;  2X6F A;  1WY6 A;  2J8S D;  5ENN A;  3ESK A;  4U0U A;  4C0E A;  1IQR A;  4GTM A;  2V5F A;  2BTD A;  4P29 A;  2UY1 A;  5G04 J;  2GRM A;  4MRU A;  3AG3 E;  3CVQ A;  5FQ6 A;  1SQM A;  2XEN A;  3SO8 A;  3P1U A;  3OXL A;  2KBX A;  2Y4U A;  5AAO A;  3V79 K;  4Q69 A;  4F53 A;  2H6H A;  1N52 A;  4CDN A;  1E7U A;  3C5R A;  4DX1 A;  3VLF A;  3ABM E;  1H19 A;  2VSX E;  3DPD A;  2WXO A;  1ZBP A;  4QQI A;  3FTW A;  2AWI A;  3HYM B;  4B89 A;  3ASO E;  3D9H A;  3ULY A;  2AVP A;  4AXH A;  4A1G A;  2X6H A;  4U63 A;  4C48 B;  2I1J A;  1UN9 A;  4I17 A;  5FQ7 A;  5C2Y A;  3PH0 C;  3Q5M A;  1MZC A;  2RG8 A;  3FP3 A;  4O1O A;  4LNG A;  3CHO A;  1OUV A;  3KEA A;  2OND A;  3LYA A;  1H6P A;  3EJN A;  2WXP A;  3Q4A B;  1KZP A;  2I1K A;  3CKB A;  2Y4T A;  2GRP B;  5BW8 C;  3CVL A;  2WPV A;  1HXI A;  3R7R A;  4ANW A;  2J49 A;  2XGM A;  4J8D A;  5FIO A;  4J0U A;  3UT8 A;  2IO3 C;  4A55 A;  5KBA A;  3CVU A;  3PUJ A;  4ANU A;  1TNO A;  1E90 A;  4ZFH A;  4AY5 A;  3PRZ A;  2IU1 A;  3ZGQ A;  4AM9 A;  1E8W A;  2EIN E;  2I6H A;  3AJI A;  4IUL A;  1IKN D;  4LER A;  4F1P A;  5G04 C;  3ZNG A;  3DWL G;  4GZ5 A;  3SI5 A;  3ASG A;  1E96 B;  1DNP A;  2V4L A;  3PEU B;  3E4B A;  2XGO A;  4H7X A;  3QAQ A;  2DYS E;  1OCO E;  3E30 A;  4GYW A;  2P9U G;  3CVV A;  4UWG A;  4GAA A;  3Q49 B;  3BQO A;  4L9P A;  2E0I A;  4U8H A;  4PH4 B;  3EUV A;  2DCP A;  1TNU A;  2XRY A;  3C72 A;  3DXK G;  4GZ6 A;  4ILH B;  3Q79 A;  4GU5 A;  5DBK A;  4J6I A;  1OXJ A;  2UY1 B;  2PM7 A;  2V5Q C;  4HLE A;  1WG0 A;  2LXM A;  4BTA A;  2QY7 A;  4PUC A;  3IHV A;  4HI8 A;  1UOH A;  3DBS A;  2IF4 A;  5EIL A;  2DZN A;  4EZK A;  4JL0 A;  2KCV A;  2EIM E;  3FDH A;  2EQX A;  2R17 C;  3UIN C;  1LTX A;  4FJY A;  3SZ7 A;  5CER B;  3PE3 A;  2WMN A;  2R05 A;  4A3T A;  3CVW A;  3LJN A;  2H6I A;  2LUH A;  1DCE A;  4AOF A;  2WVI A;  2L0T B;  5FZR A;  4EHM A;  3UT7 A;  2H6G A;  2OVB A;  3DRA A;  2F37 A;  2V4H C;  3EHM A;  3UPV A;  5FJY A;  4J8Y A;  3UM0 A;  1EDU A;  5A7D B;  5LCW J;  5CRU A;  4KYO B;  3SD5 A;  2OV8 A;  3FH8 A;  4FLB A;  4PS8 A;  1V54 E;  4WWO A;  3GW4 A;  3CHP A;  4K5A B;  4HNA D;  3FU6 A;  1TEZ A;  1Z3X A;  1H0A A;  3FUH A;  5CED B;  1IHG A;  3CK8 A;  2FO1 E;  1S0P A;  3HVE B;  3LY8 A;  3K9I A;  4WNF A;  2KAT A;  4U0S A;  1H2V C;  4XI0 A;  1OCZ E;  2PNN A;  3ULE G;  3EDT B;  3UT4 A;  4G11 A;  3GZ1 A;  1TNZ A;  1TR4 A;  2DIW A;  1EPU A;  3JCK C;  4BY6 A;  1MX4 A;  3UKU G;  3GZS A;  3ISM C;  1H6K A;  3SNX A;  2IQC A;  1O1T A;  3R9A B;  5KJL A;  3D3M A;  4JPS A;  2XQ0 A;  2RKK A;  2XCC A;  3KS2 A;  3SFX A;  1SA4 A;  2GGF A;  4E85 A;  2OEW A;  3D9J A;  4N3A A;  1BU9 A;  5LP0 A;  2HM8 A;  5G05 J;  5EYL A;  2NYJ A;  1B89 A;  3TL5 A;  4GA1 A;  3DSS A;  4KXK B;  3PZ1 A;  2X3M A;  3OTN A;  4AJW A;  2XZT G;  4DK5 A;  4HRM B;  4JA7 A;  3LDZ A;  5E75 A;  1JPL A;  3B95 A;  3S7J A;  4CT4 A;  5CCM A;  5KWD A;  4MKT A;  3FY4 A;  4UI9 K;  2LSU A;  5B1A E;  2KCK A;  4GTT A;  4ME2 A;  4HI9 A;  3E37 A;  3EIQ C;  5ENP D;  4APO A;  2L9B A;  3G2W A;  3VTX A;  1HE8 A;  4FHJ A;  4I6E A;  4OAU C;  3D9O A;  3QWP A;  4GTO A;  3HXF A;  3QWW A;  1MHQ A;  4WNE A;  5D0O D;  3MKQ A;  3E33 A;  3V2X A;  3C98 A;  3DSX A;  5A6C A;  5IY5 E;  3IKO B;  3OAW A;  4N2Q A;  4N39 A;  2J09 A;  2VYI A;  3Q7A A;  4CYM D;  2BED A;  2MRI A;  3ZIM A;  3O48 A;  4J8S A;  3DEO A;  3NOG D;  4W9R A;  1HX8 A;  1OY3 D;  4JD2 G;  5DIZ A;  1ELR A;  4FAD A;  3RRU A;  3TAX A;  1HG5 A;  2Y1L E;  2Y3A A;  3V31 A;  5H7P A;  3UIO C;  2ZXW E;  4LNB A;  4HOS A;  2XPZ A;  4N3C A;  3KSL A;  1UJJ A;  1UG3 A;  3EU9 A;  2R2L A;  3CHQ A;  4HRL A;  1PY1 A;  1HF8 A;  2LO6 A;  1KLX A;  3TGO A;  4AEZ C;  4GPK A;  1N0R A;  1U2V G;  1N4P A;  2WQH A;  3ZYM A;  4CDR A;  3TWT A;  2V8S E;  5ENO D;  4HBD A;  1QNF A;  4ATG A;  2OEV A;  2NXP A;  1N4Q A;  3D9L A;  1N4R A;  3U66 A;  5FT9 A;  3QK0 A;  4GTP A;  5BXO A;  1PC2 A;  1N4S A;  3MA5 A;  4GZD A;  3X2Q E;  3G2T A;  3LVR E;  4GB9 A;  1BLX B;  3JQ0 A;  3MYV A;  5JHA A;  4UI9 C;  1K1A A;  4DPR A;  3FTX A;  4HOT A;  3LJ3 A;  3PE4 A;  3T5X A;  2VGX A;  3BG1 B;  4BFR A;  4DRX E;  2J07 A;  4UWK A;  1HH8 A;  3T9K A;  2XEV A;  3AS5 A;  3NOC D;  3D9P A;  4MS6 A;  2KZT A;  2IOL A;  1E8Z A;  4HS2 A;  4XX5 A;  2CFZ A;  4XI9 A;  4YND A;  2EIJ E;  1KZO A;  2R5S A;  1E7V A;  2WQ7 A;  5AJD A;  1JWG A;  2L6B A;  5EN5 D;  1NI1 A;  4AV7 A;  3FUF A;  1D8D A;  1FT2 A;  2P9P G;  4IN3 B;  1YCS B;  3B7T A;  1LF8 A;  2F0Y A;  3QOU A;  3WG7 E;  4WND A;  4HXI A;  2WXL A;  4FLH A;  3ZEF A;  3ZXS A;  4BWR A;  3AU5 A;  3FH7 A;  4BX8 A;  5J08 A;  3AG2 E;  4YDW A;  3J5Q B;  5G05 C;  4AIF A;  3F6Q A;  3KD7 A;  4LCT A;  4OYS A;  3BUA A;  4ACL A;  5CHE E;  4LUN U;  4DX6 D;  4F6R D;  3UX4 A;  4B8A A;  4GA2 A;  1U3D A;  5HS0 A;  1TJC A;  4MLP A;  2CG2 A;  4XIF A;  2AW6 A;  3RRN B;  4AP2 A;  5CBO A;  4Z68 A;  2WB2 A;  1RZ4 A;  4JZY A;  3Q7F A;  4HOQ A;  4JC8 A;  5LX8 A;  3L22 A;  2GRO B;  2VQ2 A;  3FTU A;  4N5Q A;  5CRV A;  4L1B A;  4RLY A;  2CFU A;  3AG1 E;  3R7Q A;  3Q9N C;  4BET A;  2YIN A;  4TRQ A;  4AVX A;  4GML A;  3PNL B;  1TN8 A;  3TWU A;  2A5E A;  3UI2 A;  4GYY A;  1Y6I A;  4BX9 A;  3L08 A;  3JXJ A;  2F8Y A;  2EIK E;  2GRN B;  3CGH A;  3JUE A;  2P9I G;  5C1D A;  3UQ3 A;  5CEA A;  3PUK A;  3U3W A;  3TWV A;  1NL4 A;  1IYG A;  4HFG A;  5FQ4 A;  3RJV A;  5HKP A;  4KVM A;  4URK A;  1U3C A;  3S7B A;  1N94 A;  2P9L G;  3G2U A;  2E2E A;  3MCX A;  2XZD G;  5AYW D;  1O1R A;  3FTV A;  4Y6C A;  5M72 A;  2CHW A;  1EF1 C;  3RO2 A;  4DX7 D;  5FWQ A;  2JAB A;  5J90 A;  2Y69 E;  3IXE A;  1JCS A;  4G25 A;  5EYP F;  3CQC B;  3ZUV B;  3APD A;  3D9N A;  3FUM A;  5LFA A;  1QZ2 A;  2I2O A;  4Q94 A;  3FTZ A;  3IHY A;  2KM4 A;  5EX3 A;  3DXM G;  5ARG A;  2L6J A;  3PNT B;  4DUI A;  4XE0 A;  3N71 A;  2L0I A;  4GCN A;  5KJM A;  5BXU A;  3QC1 A;  4FC8 A;  1FT1 A;  2F8X K;  3DPY A;  3LVQ E;  3L54 A;  3OXG A;  3RKV A;  3ZN3 A;  3B7U X;  1FVF A;  2IFU A;  4GYO A;  4XZ4 A;  5EID A;  1LD7 A;  3QAR A;  3UKR G;  2OCC E;  5A23 A;  4ILI A;  4DX2 A;  4YVQ C;  1L5J A;  5HRY A;  3FUK A;  3TWQ A;  3SY2 A;  3CIA A;  2NSZ A;  3ONL A;  5CEC B;  2P9K G;  2AXZ A;  2B0O E;  2ION A;  5G2N A;  2XGS A;  3FU5 A;  3U4T A;  2FEZ A;  4CDM A;  2DZO A;  2J9Q A;  2KC7 A;  3ZYK A;  3J5P A;  3W9G A;  4BSZ B;  3RIB A;  3FEX A;  1O1S A;  3HXE A;  5G55 A;  4ABN A;  5AQ7 A;  3KAE A;  4I9E A;  4XEI G;  3SBS A;  3LEW A;  1MJ0 A;  1BI8 B;  4U04 A;  1BI7 B;  3TWS A;  3ASF A;  3CVY A;  4U07 A;  1AWC B;  1PAQ A;  3BU8 A;  3DEP A;  4EQF A;  4RSY A;  3CVN A;  2X6I A;  5CMW A;  1YMP A;  2ZU6 B;  3C3O A;  4UWF A;  4E6H A;  3V30 A;  2AXU A;  4JA9 A;  2P2C P;  2OOE A;  5AQB A;  1LD8 A;  4YVO A;  4GTS A;  3JUI A;  5JA4 D;  4QFV A;  4UQZ A;  4K03 A;  1A5E A;  1D9S A;  2Y0B G;  5CBN A;  2MOW A;  1OCC E;  2MYO A;  3FFL A;  1Q2Z A;  3ZXP A;  3FH5 A;  3EIJ A;  4TXR A;  2OVF A;  3DSW A;  4WWN A;  4ILG A;  1IXV A;  3ZKJ A;  3VLD A;  1HS6 A;  5FZQ A;  3ZHE B;  1OWO A;  3L9T A;  4UUC A;  1YYH A;  2XEH A;  2WM9 A;  2LNI A;  4RG9 A;  1ZU2 A;  3RK6 A;  3MKQ B;  4LNU D;  3QB2 A;  5AIJ A;  4GZ3 A;  3DSV A;  4I6G A;  3OXF A;  2V0P A;  5AEN A;  2C0L A;  5CCL A;  3B13 A;  3CHS A;  4KZ0 A;  3D9I A;  3MJW A;  3CR3 A;  4C0M A;  2QYJ A;  4OAV B;  4EBA A;  1NZN A;  3FWV A;  1JWF A;  3G2S A;  4I1O B;  4N5C A;  2ZGG A;  2ILR A;  2RD0 A;  4Y6W A;  1OCR E;  4CT0 A;  4J7W A;  3PS6 A;  2XPY A;  4HB5 A;  2FO7 A;  2CG3 A;  2A5U A;  4FHK A;  4I2W A;  3UTM A;  4FP7 A;  3UUX A;  2EIL E;  1Z5S C;  3SF4 A;  4EEC A;  3ASN E;  4O6F A;  1H2T C;  1KPS B;  2ETA A;  3NZS A;  4EPZ A;  3AS4 A;  4NAC A;  3SBT B;  3RSE G;  5ANL A;  2WMO A;  4BES A;  1UN8 A;  4UWH A;  3LXU X;  5D0Q D;  4U7E B;  1INZ A;  1MX2 A;  1E8Y A;  4BTB A;  2H6F A;  1SZ9 A;  5AN8 A;  1Y8M A;  3JQ1 A;  3HXD A;  2XS8 A;  3V2O A;  2MHK A;  1TNY A;  4PS7 A;  4CRW A;  2VSY A;  4BT8 A;  4HVB A;  4I43 A;  3ZW3 A;  4DI3 A;  3ML9 A;  4HQD A;  1MX6 A;  3EHQ A;  2XHE A;  3E32 A;  5D66 A;  4JHJ A;  5HI7 A;  1Z6T A;  3EHR A;  5B1B E;  4GMJ A;  3SHF A;  5ANR A;  3C3R A;  4UI9 J;  4EZL A;  3ABL E;  2PL2 A;  4N3B A;  5T8I A;  1EYH A;  3W9F A;  1QYM A;  4A3V A;  4GZC A;  4PS3 A;  1JCR A;  3SQV A;  1NFI E;  1RW2 A;  2HE0 A;  4M7C A;  1D8E A;  2C0M A;  4DI4 A;  3U64 A;  1OWN A;  3AU4 A;  3KSQ A;  3URZ A;  4ANX A;  3PRE A;  3PDN A;  2VTB B;  3L17 A;  3S7D A;  4TXQ A;  1OWP A;  2WXR A;  3QWV A;  4A63 B;  4BSX A;  3ZYQ A;  4KMO A;  3CVP A;  4U96 D;  4GTR A;  3ZVV A;  5JHB A;  3ENE A;  4YDO A;  2VGE A;  3PVL A;  2KXP C;  3FUD A;  3ESL A;  3IV0 A;  1DCQ A;  3IEG A;  4G26 A;  4JB8 P;  3ZU7 B;  4G2V A;  4GCO A;  4JEH A;  4FUL A;  3MX3 A;  3ABK E;  3CKC A;  4NRH B;  4I1A A;  1YA0 A;  4RVB A;  2JEK A;  2A4Z A;  4TV3 A;  3TWR A;  4JXT A;  5JJ7 A;  3CVX A;  3CEQ A;  2VSO E;  2M63 A;  1UW4 B;  3CLJ A;  3G2V A;  3FHE A;  2JLB A;  3Q75 A;  1X5B A;  3RO3 A;  2P9S G;  3Q47 B;  4X8Q A;  2KZT B;  2WXJ A;  3ZHE A;  1IHB A;  3HRA A;  1ELK A;  5FTP A;  1SVX A;  2AJA A;  5BT1 A;  3CST A;  3UM1 A;  4CGV A;  4OVU A;  4PDX A;  1WM5 A;  4B94 A;  2AXV A;  3FTS A;  4DLO A;  2XCB A;  4A1S A;  1MYO A;  2YNQ A;  3U9W A;  3TJP A;  3SFY A;  4U95 D;  4V3I A;  5AQA A;  5EX0 A;  4IYP A;  4RQI A;  3Q78 A;  5FIN A;  4U8V D;  2R59 A;  3LKU A;  4BEP A;  2RFA A;  4H7Y A;  2ZIR A;  4L2L A;  4DLQ A;  3PZ2 A;  3GYZ A;  3T8M A;  5ENS D;  4NUR A;  4UQX A;  3TWX A;  3NZU A;  2PZI A;  2VGY A;  4AY6 A;  2FF4 A;  5EIB E;  1JUQ A;  2CHZ A;  4D10 C;  2WXK A;  4L2Y A;  2VJ8 A;  5LCW C;  3ZYL A;  2WXM A;  1FCH A;  2J4D A;  4DX5 D;  4I9C A;  3R9M A;  3HVE A;  4WWP A;  3D9K A;  3ZFW A;  2GRL A;  5BPP A;  3I3N A;  2WQ6 A;  3ZPJ A;  3I4R B;  5KCM A;  2DBA A;  4LEU A;  1ELW A;  4CGW A;  2GRR B;  3Q9U C;  3T5V A;  4B0Z A;  3NBN B;  3O4Z A;  4APF A;  3LCA A;  2R03 A;  1JCQ A;  2GW1 A;  2ETB A;  2BUG A;  2WXG A;  3VTY A;  2LSV A;  1KT0 A;  1TN6 A;  3ASD A;  5ENQ D;  4HOR A;  3JYS A;  2I9C A;  4RG6 A;  4O1P A;  1N54 A;  2KCL A;  1BD8 A;  3TXM A;  2XS1 A;  4TXP A;  1KT1 A;  3Q73 A;  3CHM A;  3UM3 A;  4JEU A;  3L16 A;  1HZ4 A;  3LPZ A;  1FPP A;  4U8Y D;  3PZ4 A;  1N0Q A;  2QFC A;  1P5Q A;  3JXI A;  4UQY A;  4YDY A;  4LRZ A;  2YHE A;  1W3B A;  2IEJ A;  1SZA A;  3HXB A;  3CK9 A;  4L7T A;  1OWL A;  4GMR A;  3PZD A;  1S63 A;  4J8E A;  1S70 B;  3FUE A;  2J4B A;  3I4G A;  1UJK A;  3TG5 A;  3EU5 A;  1BPO A;  5AAR A;  2X6J A;  2GRQ B;  3RRM B;  2X38 A;  3BEE A;  3NAW A;  1S64 A;  2LAH A;  5T3R A;  3MV2 B;  4C9B B;  2IY0 C;  3I5P A;  1AP7 A;  1X81 A;  3ML8 A;  5EDS A;  3UXG A;  4GPM A;  4L23 A;  1V55 E;  4Q96 A;  1A17 A;  4HOU A;  3SFZ A;  3MEK A;  1HG2 A;  5LOZ A;  4N2S A;  4M3O A;  3FEY A;  4JW1 A;  4B8C B;  4XKC A;  4UWL A;  4OVV A;  2XRZ A;  1N9A A;  5CMY A;  2C2L A;  1NA3 A;  3MV3 B;  4R7L A;  4G1T A;  3LS8 A;  4WUY A;  2WXN A;  3NQP A;  2WXI A;  5KJK A;  4K5C A;  5KJN A;  4FU3 A;  4KZC A;  3B7B A;  2ZGD A;  3L13 A;  1K1B A;  3HDX A;  2HO1 A;  5ITZ F;  4LG6 A;  4F3V A;  2X6K A;  1VDY A;  4KBQ A;  1MQS A;  1QQE A;  4ANV A;  1O5M A;  5D2M C;  2VGX B;  4WAF A;  4I2Z A;  3DST A;  2FBN A;  3CSF A;  3QNK A;  4EZJ A;  2LXL A;  1K8K G;  1OWM A;  2BKG A;  4G23 A;  1HFA A;  3FU0 A;  5BV1 A;  4HLL A;  4G8L A;  5AQ9 A;  4HRN A;  5JJT A;  5AJL A;  5HQ8 A;  3TWW A;  3PZ3 A;  2RFM A;  1WAO 1;  1QBQ A;  4K0R A;  3TXN A;  1WDY A;  4XKB A;  3UIP C;  3APF A;  5FQ8 A;  1H2U A;  3FUN A;  4I6J A;  4I1M A;  3ULQ A;  4LSZ E;  4BER A;  3CQG B;  1FVH A;  2VTB A;  3CV0 A;  4KVO A;  3TG4 A;  3LY9 A;  3HG0 D;  4EBA G;  2XEE A;  3FUL A;  4WNG A;  3BG0 B;  3MGB A;  3DSU A;  3FUI A;  3FTY A;  3VLE A;  2R02 A;  3GZ2 A;  5KNH D;  3NB2 A;  3NF1 A;  2XPI A;  5JJ6 A;  2DYR E;  2BKK B;  4DJA A;  2FUL A;  3CHR A;  3PEV B;  5ENT D;  5BV0 A;  3WXX A;  4B93 B;  4CZ2 D;  3QJZ A;  2DWZ A;  3QDN A;  3T8K A; 
#chains in the Genus database with same CATH homology
 3CKC A;  3QKY A;  3B7S A;  4KVM A;  4NRH B;  2Q7F A;  4I1A A;  2IOS A;  4KYO B;  3SD5 A;  4URK A;  1YA0 A;  2OV8 A;  3FH8 A;  2LAI A;  4RVB A;  1U3C A;  3S7B A;  4FLB A;  2PM6 A;  2JEK A;  2A4Z A;  4PS8 A;  4TV3 A;  3G2U A;  2E2E A;  4JXT A;  2UWJ G;  4WWO A;  5JJ7 A;  3GW4 A;  3CVX A;  3CHP A;  5ARF A;  3MCX A;  2FI7 A;  3FU6 A;  2PQR A;  3CEQ A;  1TEZ A;  1Z3X A;  1H0A A;  2VSO E;  3FUH A;  2M63 A;  5AYW D;  1UW4 B;  3CLJ A;  3G2V A;  3FHE A;  5FZS A;  4CEM A;  1IHG A;  2JLB A;  3CK8 A;  1X5B A;  3FTV A;  2IJG X;  4Y6C A;  1S0P A;  3HVE B;  3LY8 A;  3K9I A;  4WNF A;  5M72 A;  3RO3 A;  2CHW A;  3Q47 B;  1NA0 A;  2HYZ A;  2KAT A;  1EF1 C;  2KZT B;  4U0S A;  1H2V C;  3RO2 A;  5FWQ A;  5J90 A;  4XI0 A;  2WXJ A;  3ZHE A;  3EDT B;  4TUU A;  3UT4 A;  4G11 A;  3GZ1 A;  2WXQ A;  4G25 A;  1ELK A;  1XNF A;  2DIW A;  2VSN A;  3MZL B;  3CQC B;  2HR2 A;  3L6A A;  5FTP A;  1EPU A;  3JCK C;  4BY6 A;  3IBE A;  3APD A;  3D9N A;  1Z3Y A;  3FUM A;  5BT1 A;  3GZS A;  3CST A;  5LFA A;  1QZ2 A;  1H6K A;  2I2O A;  4Q94 A;  3FTZ A;  4OVU A;  3SNX A;  2WXH A;  4CGV A;  4PDX A;  3HIZ A;  1WM5 A;  4B94 A;  2IQC A;  3IHY A;  4J8F A;  2AXV A;  2KM4 A;  3R9A B;  5EX3 A;  1TJF A;  3FTS A;  5ARG A;  5KJL A;  4DLO A;  3D3M A;  4JPS A;  2L6J A;  2XQ0 A;  3PNT B;  2XCC A;  3N71 A;  4XE0 A;  2L0I A;  2XCB A;  3D9M A;  4ACK A;  3KS2 A;  4A1S A;  4GCN A;  5KJM A;  1XGW A;  2YQ8 A;  2YNQ A;  3U9W A;  3TJP A;  2GGF A;  3LY7 A;  3QC1 A;  4E85 A;  3D9J A;  3ONK A;  4N3A A;  4V3I A;  5LP0 A;  5EX0 A;  4IYP A;  4FC8 A;  4FJZ A;  3AS8 A;  2HM8 A;  5G05 J;  5EKQ D;  4F1S A;  1B89 A;  3TL5 A;  4GA1 A;  3LVQ E;  4KXK B;  3APC A;  3L54 A;  3KEZ A;  3B7R L;  2X3M A;  4JHK A;  3OXG A;  4FA6 A;  3Q15 A;  3RKV A;  2WXF A;  3OTN A;  3ZN3 A;  4AJW A;  3FUJ A;  3B7U X;  2R59 A;  3LKU A;  4G24 A;  1FVF A;  2IFU A;  4GA0 A;  4GYO A;  4XZ4 A;  4H7Y A;  4DK5 A;  2BF0 X;  4U0Z A;  4L2L A;  4DLQ A;  4JA7 A;  2J08 A;  3QAR A;  3P2B A;  4KT6 B;  4CCA A;  3LDZ A;  5E75 A;  1JPL A;  3S7J A;  4CT4 A;  5CCM A;  4MKT A;  3GYZ A;  3ZRH A;  5A23 A;  4ILI A;  1DVP A;  3T8M A;  3FY4 A;  4YVQ C;  1L5J A;  4NUR A;  4UQX A;  3FUK A;  4UI9 K;  3S2A A;  2LSU A;  2NC9 A;  4BT9 A;  3CIA A;  3NZU A;  4JVS A;  2PZI A;  2KCK A;  2NSZ A;  3RU0 A;  3ONL A;  2VGY A;  4ME2 A;  2AXZ A;  4AY6 A;  2ION A;  2FF4 A;  2XGS A;  3FU5 A;  5G2N A;  3MKR A;  3U4T A;  5BNW A;  2FEZ A;  3EIQ C;  1JUQ A;  1HU3 A;  2CHZ A;  4D10 C;  4CDM A;  4APO A;  5T4Y A;  2J9Q A;  2L9B A;  1GW6 A;  2VJ8 A;  2WXK A;  2KC7 A;  4L2Y A;  3UMV A;  3ZYK A;  3G2W A;  5LCW C;  3ZYL A;  2WXM A;  3EHN A;  1FCH A;  2J4D A;  4I9C A;  3RIB A;  3VTX A;  1HE8 A;  3HVE A;  4WWP A;  3D9K A;  3FEX A;  2PQN A;  4FHJ A;  4I6E A;  3ZFW A;  2GRL A;  5BPP A;  3I3N A;  3D9O A;  5G55 A;  2YHC A;  4ABN A;  2WQ6 A;  3QWP A;  3ZPJ A;  3KAE A;  4I9E A;  3QWW A;  4JHR A;  3SBS A;  3LEW A;  1MHQ A;  1NP7 A;  4WNE A;  3I4R B;  5KCM A;  2DBA A;  5D0O D;  3MKQ A;  4LEU A;  5E76 A;  1ELW A;  4U04 A;  3ASF A;  4CGW A;  3CVY A;  3C98 A;  5BUZ A;  4IRU A;  2CHX A;  4U07 A;  5A6C A;  3IKO B;  1PAQ A;  3T5V A;  3OAW A;  4B0Z A;  3O4Z A;  4N2Q A;  4EQF A;  4RSY A;  3HHM A;  3CVN A;  4N39 A;  2X6I A;  2J09 A;  4APF A;  5CMW A;  2VYI A;  2ZU6 B;  4UWF A;  4E6H A;  3LCA A;  2P58 C;  2MRI A;  3ZIM A;  2GW1 A;  3O48 A;  2BUG A;  2WXG A;  4J8S A;  3S7F A;  2AXU A;  4JA9 A;  3VTY A;  4W9R A;  1HX8 A;  2OOE A;  1E8X A;  4YVO A;  3ASH A;  4F7A A;  4NQ0 A;  3FU3 A;  3JUI A;  5DIZ A;  2LSV A;  3CK7 A;  1HO8 A;  1IQU A;  1KT0 A;  4QFV A;  3SGH A;  2X6F A;  1WY6 A;  1ELR A;  4UQZ A;  4FAD A;  3ASD A;  4K03 A;  5ENN A;  3JYS A;  4HOR A;  2I9C A;  3RRU A;  2MOW A;  3ESK A;  4U0U A;  4RG6 A;  3FFL A;  4C0E A;  3TAX A;  1HG5 A;  3FH5 A;  1IQR A;  1N54 A;  2KCL A;  2Y3A A;  3EIJ A;  2OVF A;  3TXM A;  2V5F A;  4WWN A;  2BTD A;  4HOS A;  1KT1 A;  4ILG A;  4P29 A;  2UY1 A;  2XPZ A;  4N3C A;  3CHM A;  1UJJ A;  4JEU A;  1UG3 A;  3L16 A;  2GRM A;  5G04 J;  1HZ4 A;  1HS6 A;  3VLD A;  3LPZ A;  4MRU A;  5FZQ A;  3ZHE B;  1OWO A;  3CHQ A;  3CVQ A;  2QFC A;  1PY1 A;  1P5Q A;  5FQ6 A;  1HF8 A;  4UQY A;  2LO6 A;  2WM9 A;  1KLX A;  1SQM A;  2LNI A;  4LRZ A;  2YHE A;  1ZU2 A;  3P1U A;  4RG9 A;  4AEZ C;  3OXL A;  3RK6 A;  3MKQ B;  1W3B A;  1SZA A;  3CK9 A;  2Y4U A;  4GPK A;  3QB2 A;  5AIJ A;  4GZ3 A;  4L7T A;  4I6G A;  3OXF A;  2V0P A;  1OWL A;  4Q69 A;  4F53 A;  3PZD A;  5AEN A;  2C0L A;  1N52 A;  4CDN A;  2WQH A;  5CCL A;  1E7U A;  3B13 A;  4J8E A;  3ZYM A;  3CHS A;  4KZ0 A;  4CDR A;  3VLF A;  3D9I A;  3FUE A;  3MJW A;  4ANW A;  2J4B A;  1H19 A;  2V8S E;  3CR3 A;  3I4G A;  2VSX E;  1UJK A;  4C0M A;  3TG5 A;  3DPD A;  2WXO A;  1ZBP A;  4EBA A;  1NZN A;  1QNF A;  1BPO A;  3FWV A;  4ATG A;  3FTW A;  1JWF A;  2AWI A;  2X6J A;  3G2S A;  3HYM B;  2NXP A;  4B89 A;  4I1O B;  3D9L A;  3RRM B;  3U66 A;  4N5C A;  2X38 A;  5FT9 A;  2AVP A;  4AXH A;  3QK0 A;  4A1G A;  2X6H A;  3BEE A;  2ILR A;  4U63 A;  2I1J A;  2LAH A;  1UN9 A;  2RD0 A;  4I17 A;  4Y6W A;  5T3R A;  4CT0 A;  3PS6 A;  5FQ7 A;  5C2Y A;  2XPY A;  3PH0 C;  2FO7 A;  1PC2 A;  3MV2 B;  3MA5 A;  3Q5M A;  4GZD A;  4C9B B;  2CG3 A;  3G2T A;  2A5U A;  4FHK A;  3LVR E;  4I2W A;  4GB9 A;  2RG8 A;  3FP3 A;  3I5P A;  4FP7 A;  3UUX A;  3JQ0 A;  3CHO A;  3MYV A;  4UI9 C;  1OUV A;  3ML8 A;  5EDS A;  5JHA A;  3SF4 A;  4EEC A;  4L23 A;  2OND A;  3LYA A;  4Q96 A;  1A17 A;  3EJN A;  4O6F A;  2WXP A;  4DPR A;  3FTX A;  4HOT A;  3LJ3 A;  1H2T C;  3PE4 A;  3Q4A B;  3T5X A;  2VGX A;  2I1K A;  4HOU A;  3CKB A;  2Y4T A;  3SFZ A;  5BW8 C;  3BG1 B;  3CVL A;  2WPV A;  3NZS A;  1HXI A;  4BFR A;  4EPZ A;  2J07 A;  4UWK A;  3R7R A;  1HH8 A;  2XEV A;  3AS4 A;  3AS5 A;  2J49 A;  3MEK A;  4NAC A;  1HG2 A;  3D9P A;  5LOZ A;  3SBT B;  4MS6 A;  5ANL A;  4M3O A;  2KZT A;  2XGM A;  3FEY A;  4N2S A;  2IOL A;  2WMO A;  4J8D A;  1E8Z A;  4HS2 A;  4J0U A;  4JW1 A;  4XX5 A;  4B8C B;  3UT8 A;  2CFZ A;  4XI9 A;  4YND A;  4XKC A;  4UWL A;  1UN8 A;  4UWH A;  4A55 A;  3LXU X;  2R5S A;  3PUJ A;  3CVU A;  1E7V A;  5D0Q D;  2WQ7 A;  5AJD A;  4ANU A;  1INZ A;  1E8Y A;  1JWG A;  4OVV A;  4BTB A;  3TGO A;  2XRZ A;  5CMY A;  1E90 A;  2C2L A;  3FUF A;  4AV7 A;  1SZ9 A;  1NA3 A;  3MV3 B;  4R7L A;  4IN3 B;  4G1T A;  3B7T A;  3LS8 A;  1LF8 A;  4WUY A;  4AY5 A;  2WXN A;  3PRZ A;  1Y8M A;  3QOU A;  3JQ1 A;  2IU1 A;  3NQP A;  4WND A;  2WXI A;  4HXI A;  3ZGQ A;  5KJK A;  2WXL A;  4FLH A;  4AM9 A;  3ZEF A;  1E8W A;  2I6H A;  5KJN A;  4FU3 A;  4KZC A;  4IUL A;  2MHK A;  3ZXS A;  4LER A;  4PS7 A;  4BWR A;  4CRW A;  3AU5 A;  5G04 C;  2VSY A;  3FH7 A;  4BT8 A;  4HVB A;  4I43 A;  4BX8 A;  3L13 A;  5J08 A;  3ZW3 A;  4DI3 A;  3ML9 A;  3HDX A;  2HO1 A;  4GZ5 A;  3SI5 A;  3ASG A;  5G05 C;  4AIF A;  1E96 B;  2X6K A;  4F3V A;  1DNP A;  3KD7 A;  4LCT A;  1VDY A;  2V4L A;  3PEU B;  4KBQ A;  1MQS A;  2XHE A;  1QQE A;  4JHJ A;  4OYS A;  5HI7 A;  4ANV A;  1Z6T A;  3E4B A;  2XGO A;  4H7X A;  4ACL A;  5CHE E;  3QAQ A;  2VGX B;  4GMJ A;  4GYW A;  4WAF A;  3SHF A;  4I2Z A;  4LUN U;  4UWG A;  5ANR A;  2FBN A;  3CVV A;  3CSF A;  3QNK A;  4GAA A;  4UI9 J;  4EZJ A;  3UX4 A;  4B8A A;  4EZL A;  4GA2 A;  1OWM A;  1U3D A;  1TJC A;  4MLP A;  2CG2 A;  3Q49 B;  4XIF A;  2PL2 A;  4N3B A;  5T8I A;  4G23 A;  1EYH A;  2AW6 A;  3RRN B;  2E0I A;  4A3V A;  4AP2 A;  1HFA A;  3FU0 A;  4GZC A;  4PS3 A;  5BV1 A;  4U8H A;  4PH4 B;  2DCP A;  2XRY A;  4ILH B;  4GZ6 A;  2WB2 A;  4GU5 A;  4JZY A;  4HOQ A;  4JC8 A;  5DBK A;  4J6I A;  5JJT A;  3L22 A;  5LX8 A;  5AJL A;  2UY1 B;  2PM7 A;  2VQ2 A;  5HQ8 A;  3FTU A;  2C0M A;  4DI4 A;  3U64 A;  4HLE A;  4L1B A;  1OWN A;  2CFU A;  1WAO 1;  3AU4 A;  4BTA A;  2QY7 A;  3URZ A;  4ANX A;  3R7Q A;  4K0R A;  3PRE A;  3PDN A;  4PUC A;  2YIN A;  4TRQ A;  3TXN A;  4XKB A;  4AVX A;  3IHV A;  4GML A;  2VTB B;  3DBS A;  3L17 A;  3APF A;  5FQ8 A;  3S7D A;  2IF4 A;  1H2U A;  4EZK A;  1OWP A;  3FUN A;  4JL0 A;  4I6J A;  2KCV A;  4I1M A;  3ULQ A;  3FDH A;  2WXR A;  3PNL B;  3QWV A;  2EQX A;  2R17 C;  3CQG B;  1FVH A;  4FJY A;  4BSX A;  3CV0 A;  3ZYQ A;  2VTB A;  4GYY A;  1Y6I A;  4KMO A;  4KVO A;  3SZ7 A;  3PE3 A;  4BX9 A;  2WMN A;  3TG4 A;  3LY9 A;  4A3T A;  3CVW A;  3CVP A;  3L08 A;  4EBA G;  3ZVV A;  3FUL A;  4WNG A;  4AOF A;  3CGH A;  2WVI A;  2L0T B;  3BG0 B;  5FZR A;  3MGB A;  5JHB A;  3FUI A;  3UT7 A;  3FTY A;  3VLE A;  3ENE A;  5C1D A;  2OVB A;  3UQ3 A;  3U3W A;  3PUK A;  3GZ2 A;  3PVL A;  3FUD A;  3NF1 A;  2XPI A;  1IYG A;  5JJ6 A;  3ESL A;  4DJA A;  3EHM A;  2FUL A;  3UPV A;  5FJY A;  3IV0 A;  3CHR A;  3PEV B;  3IEG A;  5BV0 A;  3WXX A;  4G26 A;  1EDU A;  3QJZ A;  5A7D B;  5LCW J;  4HFG A;  4G2V A;  4GCO A;  4JEH A;  3QDN A;  5FQ4 A;  3RJV A;  4FUL A;  3MX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...