3CR3A

Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
192
Chain Sequence
LLTIDTTIEWLGKFNEKIQENKAYLSELDGPIGDGDHGANMARGMSETMKALEVSNFGNVSEIFKKVAMTLMSKVGGASGPLYGSAFLAMSKTAIETLDTSELIYAGLEAIQKRGKAQVGEKTMVDIWSAFLNDLQTDSASKDNLEKVVKASAGLLATKGRASYLGERSIGHIDPGTQSSAYLFETLLEVVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PTS-dependent dihydroxyacetone kinase, ADP-binding subunit d
publication title X-ray Structures of the Three Lactococcus lactis Dihydroxyacetone Kinase Subunits and of a Transient Intersubunit Complex.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
total genus 69
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cr3A00
1UN8A 3PNLB 1UN9A 4LRZA 2BTDA 3CR3A
chains in the Genus database with same CATH superfamily
5H7PA 4RSYA 2PL2A 4K5AB 2X6JA 3UKUG 2JEKA 2I1KA 3FHEA 1QZ2A 2VSYA 1DNPA 1Z3XA 3SBSA 3ZKJA 3FH5A 2L0TB 3D9JA 4A63B 2XZTG 4DJAA 1BD8A 2RD0A 4XKCA 1FT2A 3RK6A 4WWOA 5T3RA 2FO1E 1X5BA 4GTRA 3DSSA 3EIQC 1A17A 1HS6A 4I6GA 3PZ4A 4KVOA 4LNGA 1N4PA 3JXIA 4U0UA 1INZA 3KSQA 3TWTA 4YDWA 3QKYA 2R5SA 3CHSA 3AG4E 4HI8A 1ZU2A 3U3WA 2FULA 2XENA 1D8EA 2YQ8A 4PDXA 3ZYKA 1SW6A 2X6IA 3FTWA 3OXGA 4UWHA 5ARFA 3RRUA 4J8DA 3GZ1A 4DX7D 3SFXA 2YHEA 2VQ2A 4JHJA 5BV0A 1K3ZD 4R7LA 3SGHA 3LS8A 3DWLG 1OWPA 3UM2A 2VGXB 3DSUA 5FQ4A 2OEWA 2AXUA 2GGFA 4FU3A 2VSXE 4HLLA 3NZSA 1LF8A 5FQ6A 4O1OA 4BTAA 3KAEA 2CG3A 3LDZA 5LCWJ 5CEAA 4A3VA 1OWOA 2CG2A 3UI2A 3EJNA 1OY3D 3E33A 4GCOA 4ANWA 2LAIA 4DK5A 3L08A 4L23A 3PNLB 4UQZA 2L9BA 5AJLA 4N39A 3SFYA 4IRUA 5G04C 4C9BB 2J49A 4I2ZA 2PZIA 2QC9A 3ZNGA 4HLEA 3CVXA 3CR3A 3ONKA 3PZ2A 2I2OA 3G2UA 3QWVA 4GA1A 3B7UX 4DLOA 3OXLA 3FU5A 2VTBA 3JCKC 1Z3YA 4L1BA 1E8WA 4KVMA 4HRMB 3I3NA 3AS5A 2IFUA 1D8DA 3TWUA 4LG6A 4B89A 1TJFA 4EBAA 3B7TA 2DWZA 3ESKA 3HXBA 4GZDA 4XIFA 3ZEFA 3MKQA 4G1TA 2E0IA 3LJ3A 1EF1C 3JQ0A 1L5JA 2I6HA 5ARGA 4CDMA 4HQDA 3CHMA 3D9HA 5T8IA 5AIJA 4FHKA 3HHMA 1EDUA 4U07A 3L82A 3C3QA 4ILGA 3FU0A 4LSZE 4ANXA 5LOZA 2P9UG 2LNIA 4HOUA 3AJIA 1UG3A 3PH0C 4CRWA 3RRMB 3QWPA 2IQCA 1H2UA 1TNOA 4XI9A 4JL0A 2WQ7A 2OV8A 4ABNA 3IKOB 1PAQA 3AG3E 2IJGX 4JC8A 4MLPA 1TN7A 1A5EA 4BFRA 4L2YA 4GTSA 4AJWA 1IHGA 3AG1E 3AS8A 4UWFA 3CHPA 5KJLA 5HQ8A 3SI5A 3J5QB 1QNFA 4NQ0A 5HKPA 4KT6B 4AOFA 3AU5A 2BEDA 3RO2A 1IYGA 4MKTA 3ASHA 4Q94A 3E32A 4LEUA 5CMYA 3DSVA 3MV3B 2XCCA 1W3BA 4TUUA 1NZNA 4PUCA 3IBEA 4U0ZA 5AYWD 3MKRA 4GA2A 2MOWA 4ATZD 3LVRE 3ZHEA 2WMNA 1H0AA 2GRRB 4OYSA 4Z68A 2I9CA 3NF1A 3UT7A 3B7RL 2DYSE 3VLDA 2IO3C 1HXIA 1DCEA 2WXFA 4U63A 3DXMG 2EQXA 1HH8A 4J6IA 3FTZA 3EIJA 3DEPA 2VTBB 3QWWA 4DPRA 5CHEE 3L54A 1E90A 4I2WA 4N5QA 2XPZA 2Y3AA 2HR2A 3KEAA 2KXPC 2XCBA 4E6HA 5BXOA 2OCCE 2RFAA 1K8KG 2R59A 5AQ7A 3TWRA 3R9AB 4AM9A 3APDA 3FH8A 3ZW3A 3ZVVA 2MHKA 2MYOA 1E8XA 2HO1A 5BT1A 4YDOA 4DX6D 4K03A 3MEKA 2V0PA 3BUAA 2J08A 4W9RA 5G2NA 1HG5A 2QFCA 3ML8A 5A23A 4TXPA 3Q79A 3UIOC 3UT8A 2C2LA 4NRHB 2XEVA 2RKKA 4ILIA 2DIWA 4DX1A 3JXJA 3PE4A 2UY1A 4FLBA 1N94A 3W9FA 4U95D 4FADA 3NQPA 2J9QA 4TXQA 1BLXB 1ELRA 2LXLA 1IXVA 4U7EB 1MZCA 5CRVA 1E7VA 3V2XA 2Y0BG 1OWMA 4MRUA 4M7CA 4CCAA 4KBQA 3IEGA 4I17A 3RAUA 3UINC 4GB9A 3TXNA 1E8YA 3S2AA 3ML9A 2P9SG 4FJYA 5AENA 3UM1A 4BT8A 3B7BA 3PUKA 4JPSA 4FHJA 2OEVA 3ZXSA 4CZ2D 4RVBA 4I9EA 3PNTB 3UUXA 2A5UA 3V30A 2WM9A 3K9IA 2XGOA 1D9SA 1U3CA 3PDNA 4URKA 2VGEA 4A1SA 3HXFA 3L9TA 2EIJE 4FULA 3R9MA 2Y1LE 3CVVA 4OVVA 2R17C 3BG1B 3B7SA 3CLJA 1RW2A 3RKVA 3BG0B 3GZSA 1O1SA 2V4LA 2OVBA 3UKRG 2LUHA 2DZOA 3Q9NC 1O1RA 3SO8A 3PZDA 3D9PA 5DBKA 1VDYA 1UJKA 1QBQA 1EPUA 3CIAA 3LYAA 4F1PA 3D9IA 3ZRHA 4O6FA 2CHXA 4O60A 4ATGA 1V54E 3ISMC 5EYPF 1H2TC 2MRIA 2F8YA 3CVYA 1BI7B 1S64A 2PM7A 5AJDA 4JZYA 5FWQA 5ANRA 3ABME 5CCMA 1WDYA 1ELKA 3UX4A 1N52A 1HE8A 1V55E 2KCVA 3BEEA 3R7QA 2ZU6B 4A3TA 1MX6A 3U66A 5G04J 4ANUA 3S7DA 3CQCB 5B1BE 2QYUA 3CK8A 4L7TA 5FZQA 4I1AA 3W9GA 2AXVA 2CHZA 3P1UA 3FUJA 4AEZC 1H2VC 4BERA 1OCZE 2UY1B 3RIBA 2XHEA 4LRZA 3JUEA 4YDEA 5KJNA 4AP2A 4KYOB 4TV3A 3MYVA 5BW8C 2V5QC 2X38A 4U04A 3ZN3A 3T8MA 3FFLA 2WXHA 4WNGA 3EHNA 4F7AA 4WWNA 4PH4B 2BKGA 3L6AA 2P9IG 4U0SA 4BESA 4IULA 2XQ0A 1BPOA 3DBSA 3U4TA 5KJMA 4BX9A 2PQRA 4UWKA 5BPPA 2XS1A 5IY5E 3CK7A 3MV2B 2IY0C 4WNDA 2DBAA 3FTUA 4GTOA 4GTTA 5BUZA 4JXTA 1IQRA 3CVUA 3E34A 3LCAA 2XGSA 4FC8A 1G3NB 2P9KG 2C0MA 3PZ3A 1JWFA 2R02A 4FP7A 2QY7A 5FQ8A 5M72A 4JEHA 2WXOA 2WXRA 3FUHA 4F6RD 1KT0A 3TWQA 3D9OA 4CYMD 1MQSA 1GW6A 2YINA 4I6EA 3EHMA 4C0MA 4EPZA 3ZUVB 3KSLA 4ZFHA 2L6JA 3VTXA 3QC1A 3DSWA 5J90A 1X81A 1KLXA 2CFUA 2J07A 4AV7A 4J8FA 1MX2A 3L22A 3QDNA 1KZOA 3CVNA 3HIZA 3P2BA 5AQBA 1OT8A 3FTSA 5D0OD 3FUIA 1H6OA 4GYYA 3WXXA 3S7FA 5AQ9A 4AVXA 3L17A 2DZNA 1S63A 4X8QA 4G23A 3LY9A 3TXMA 4UQXA 5KNGA 3Q15A 2P58C 5CBNA 1KPSB 2QYJA 3GYZA 1N4SA 4A1GA 5D2MC 1DVPA 1TR4A 1NA0A 3Q4AB 2J09A 5EN5D 4FA6A 1TEZA 4C0EA 4WWPA 3ASOE 4XE0A 4EZLA 5EIBE 1FT1A 4BSXA 3FUDA 1YYHA 3UT4A 3PREA 2GRQB 2J8SD 4JD2G 4YDYA 1QQEA 3Q9UC 2XRYA 2PQNA 2IONA 2XGMA 4U8YD 2VGYA 4NACA 4NIKA 4GPKA 4WNEA 2ETCA 1Y6IA 2VSNA 3AS4A 3IHVA 4HNAD 4JA9A 1WY6A 3CK9A 2GRMA 1OCOE 1H19A 4F1SA 4HOTA 4G26A 2L6BA 3C5RA 4BEPA 2F8XK 4F53A 3ZFWA 1E7UA 4LNUD 1HU3A 4CDRA 1OWLA 3APFA 3FEYA 3QJZA 4KMOA 2DVWA 4UI9K 3FULA 3SNXA 3KD7A 2PM6A 3Q7AA 5JHBA 3DSTA 2BF0X 1UN9A 1XNFA 3U64A 1DC2A 2AVPA 4UI9C 3ULQA 3GW4A 3JUIA 2WXKA 1QYMA 5AAOA 2AWIA 3SFZA 4G8LA 4BT9A 5JJTA 5EDSA 5ENQD 4CDNA 2RFMA 3BQOA 3HG0D 4U96D 4GCNA 4YVQC 4HBDA 1DCQA 3Q7FA 1KZPA 5FZRA 1FVFA 1PY1A 4EZJA 3T9KA 3KS2A 2X6KA 2NYJA 4GTPA 2YNQA 3VTYA 4U8HA 3FH7A 3SD5A 5CECB 1N11A 4UQYA 5DIZA 3B95A 3C3OA 1LTXA 3ASNE 1B89A 3SHFA 3E4BA 4FJZA 5B1AE 3NOCD 3CSTA 4Q96A 5CMWA 4CT4A 3FEXA 3CKCA 3SF4A 3V2OA 4GMRA 2WQHA 3LY7A 4PS7A 4UUCA 2X6FA 2P9LG 1WAO1 2FF4A 3RO3A 1ZBPA 4CGVA 1Z5SC 2XS8A 1HG2A 3PUJA 4XKBA 2NSZA 2ZGGA 1N0RA 2ZXWE 3BU8A 4TXRA 3SZ7A 5HRYA 2DYRE 3V31A 1K1BA 3E37A 4J8YA 5G05J 2GRLA 2OOEA 1N54A 3TL5A 3EHQA 4N3BA 3T5VA 3TJPA 1WG0A 4KXKB 3T5XA 5KWDA 2HM8A 3LPZA 4ILHB 1U2VG 3G2VA 5EX3A 2FO7A 4B8CB 5A6CA 5A7DB 1N4RA 2KC7A 5FIOA 3Q5MA 4WUYA 3HVEA 1UJJA 5ENNA 2FEZA 4E85A 2CFZA 1OCCE 2R2LA 3RJVA 3FDHA 2GRNB 3S7JA 5EYLA 3DPDA 3NOGD 4A55A 2IO2C 3SBTB 3ZGQA 4PS8A 3TG4A 2LO6A 4I1OB 4CT0A 1UW4B 2EIKE 3RSEG 2WQ6A 1H6PA 3HXEA 2WXIA 3D9NA 5CEDB 4GMLA 4F3VA 3CHRA 3AU4A 1OWNA 2ETBA 5FZSA 1ZB1A 3C72A 4JB8P 3HXCA 4LNBA 4I6JA 3OXFA 1JUQA 2XEEA 2KZTA 1IKND 4ANVA 2P9PG 1TN6A 3CVLA 5KCMA 4GZCA 3EU9A 5FINA 4N3AA 2ILRA 1HF8A 2IOLA 3IHYA 5G05C 3NB2A 4LCTA 4GMJA 4OVUA 4U8VD 1IHBA 5E75A 4QQIA 1TNYA 4ACLA 3D9LA 4HXIA 3EUVA 4DI4A 4CEMA 5BXUA 4RG9A 2FBNA 4MBGA 2VYIA 3MCXA 2WXNA 3QARA 3JQ1A 3QAQA 3PVLA 4APFA 3PZ1A 2V8SE 3QNKA 4J8SA 3NZUA 4OAUC 3C3RA 2BUGA 4G11A 1N4QA 4KZ0A 2ETAA 2GW1A 3AAAC 3LVQE 2Y69E 3TWVA 3CKBA 3LXUX 4ACKA 2A4ZA 1NI1A 3HDXA 3QK0A 3ULEG 3LJNA 4NURA 2X3MA 1SQMA 4BSZB 4GA0A 3PS6A 3O48A 3Q47B 4LERA 1OUVA 5BNWA 4DX5D 1WM5A 4GPMA 2XPIA 2JLBA 2EINE 3D9MA 4HVBA 1EYHA 3FUEA 4JHRA 4UWLA 1H6KA 3ZU7B 1S70B 3SY2A 1SZAA 2JABA 2H6FA 5HS0A 3ZXPA 2FI7A 3HRAA 5KBAA 2XZDG 3DRAA 5D0QD 3NBNB 4JVSA 1IQUA 3HVEB 1ELWA 3N71A 2KM4A 2PNNA 3MZLB 1BU9A 5KJKA 4GTVA 2OVFA 5ENSD 3LEWA 4Q69A 3TGOA 4QFVA 3CVWA 1Y8MA 4K5BA 1TNZA 4K0RA 3URZA 3FTYA 4KZCA 2IU1A 2KCKA 4I43A 3I4RB 5EKQD 5ENTD 5LFAA 4J7WA 2LXMA 3CGHA 4TUMA 3Q73A 4IN3B 5EIDA 3ONLA 2AW6A 5FJYA 1JPLA 4YVOA 2EIME 2WB2A 4HOQA 2VSOE 5C2YA 1U3DA 3UQ3A 5JHAA 3FUFA 3FTXA 4GZ6A 2NC9A 4B8AA 3I5PA 2IEJA 1JCSA 3CVQA 2ONDA 3CHQA 3HYMB 1TNBA 2KZTB 3FU6A 4WNFA 4DRXE 3CVPA 4HB5A 3WG7E 3G2WA 4GZ3A 1E8ZA 3MX3A 2C0LA 3D3MA 1TJCA 2BKKB 4GYWA 3F6QA 3CV0A 1S0PA 1XGWA 3FWVA 3Q49B 1JCRA 4N2QA 2L0IA 4L2LA 4V3IA 5C1DA 5JA4D 5ENRD 2VJ8A 2H6GA 4DLQA 2J4BA 3EHRA 2HE0A 3ZPJA 4UI9J 3VLEA 4LUNU 3EDTB 4AY6A 2WXJA 3UIPC 1BI8B 1MJ0A 4ME2A 3DEOA 4EZKA 2RG8A 3T8KA 3UM0A 5KNHD 5T4YA 3ULYA 3CQGB 3ASFA 1YCSB 2XRZA 4GU5A 4HORA 4BY6A 3FUNA 4BWRA 3KEZA 3Q78A 4XEIG 4G25A 3TWSA 4B94A 5AN8A 4XI0A 5LP0A 2WPVA 1NL4A 3Q75A 5CRUA 4O1PA 5LCWC 4G2VA 2YHCA 3DXKG 4K5CA 1N0QA 3AG2E 4L9PA 4TRQA 2EILE 4Y6WA 3IV0A 4YNDA 3OAWA 3ZYQA 4DI3A 2LSUA 3TAXA 2F37A 1JWGA 5G55A 3V79K 3TG5A 4JW1A 1FCHA 4H7XA 3RU0A 1HX8A 3UTMA 1UN8A 2ZISA 4C48B 4RQIA 1N9AA 4JHKA 2LAHA 3SQVA 1SVXA 4N5CA 2WVIA 5FQ7A 5CCLA 2KATA 3QB2A 4BETA 4FLHA 3CSFA 3S7BA 2V5FA 1O1TA 4M3OA 2XEHA 1NP7A 5B3SE 1UOHA 1LD8A 1TYQG 3L16A 3CHOA 3ABKE 3ZYMA 4B93B 2R03A 5EILA 5BV1A 5E76A 1HZ4A 2QZAA 4WAFA 2Y4TA 1PC2A 3ZIMA 4I1MA 2P9NG 4RG6A 4ZHBA 1O5MA 3QOUA 3ASGA 4GTMA 2F0YA 5AQAA 1FPPA 4J8EA 1OXJA 4DX2A 4HOSA 1K1AA 2J4DA 1YMPA 1FVHA 2B6CA 2WXMA 3X2QE 1MHQA 4JEUA 4HRLA 1E96B 3G2TA 4G24A 3HXDA 3MA5A 3UMVA 3FU3A 5EX0A 1HO8A 2E2EA 2X6HA 2GROB 2HYZA 1MX4A 4GTQA 2WXGA 3JYSA 4AXHA 3ESLA 1KT1A 3PEVB 2GRPB 1AWCB 2H6HA 3VLFA 3E30A 4HS2A 3OTNA 3UXGA 4I9CA 3ASDA 3DPYA 1Q2ZA 5J08A 3PE3A 1HFAA 1SA5A 4N3CA 3MKQB 1JCQA 2Y4UA 5JJ6A 3FUMA 4HI9A 1YA0A 4RLYA 3U9WA 2R05A 2WMOA 3O4ZA 4N2SA 4MS6A 1Z6TA 4PS3A 3ABLE 2WXLA 3GZ2A 2Q7FA 2XPYA 3RRNB 3NAWA 3LKUA 2AJAA 3UM3A 4P29A 1NFIE 4AIFA 2B0OE 5JMND 3ENEA 4CGWA 4EQFA 4OAVB 2VGXA 3L13A 2V4HC 3B13A 4HFGA 4EECA 3D9KA 4DUIA 5AARA 3TWXA 3IXEA 3DSXA 2P2CP 2AXZA 5D66A 4IYPA 3FTVA 2LSVA 3LY8A 2IOSA 4GYOA 3G2SA 4JA7A 3APCA 3UPVA 3FUKA 2CHWA 3ZYLA 4G8KA 4UWGA 1N95A 2WXPA 2KCLA 3CEQA 2I1JA 2UWJG 2IF4A 3MJWA 2NXPA 2ZGDA 4J0UA 5LX8A 1SA4A 4H7YA 5HI7A 2WXQA 3FP3A 4GZ5A 1NA3A 4Y6CA 4EHMA 4HRNA 4BTBA 1MYOA 3FY4A 3J5PA 4XX5A 1TN8A 2M63A 5ENPD 5ANLA 5JJ7A 4B0ZA 3R7RA 2BTDA 5CBOA 2DCPA 1SZ9A 2KBXA 1P5QA 4AY5A 3MGBA 3ZHEB 3PRZA 1OCRE 5FTPA 1AP7A 4EBAG 5ITZF 1RZ4A 5CERB 3C98A 3TWWA 5ENOD 2ZIRA 1TNUA 5FT9A 4D10C 2H6IA 4BX8A 3EU5A 2A5EA 3PEUB 3I4GA 4XZ4A 1LD7A 4APOA 4GAAA
chains in the Genus database with same CATH topology
2ONDA 3CHQA 3HYMB 3SNXA 4RSYA 3KD7A 2KZTB 3FU6A 2PL2A 3PE4A 2UY1A 2X6JA 2PM6A 4FLBA 4WNFA 3CVPA 5JHBA 3G2WA 2BF0X 4GZ3A 2JEKA 1E8ZA 1UN9A 2I1KA 3MX3A 1XNFA 4FADA 3FHEA 2C0LA 3D3MA 1QZ2A 3U64A 3NQPA 2VSYA 1DNPA 1TJCA 1Z3XA 4GYWA 3SBSA 2AVPA 2J9QA 3CV0A 1S0PA 3FH5A 1ELRA 4UI9C 2L0TB 3D9JA 3ULQA 3GW4A 1XGWA 3FWVA 3JUIA 2WXKA 3Q49B 4DJAA 2AWIA 3SFZA 4N2QA 2RD0A 2L0IA 4L2LA 4V3IA 4XKCA 3RK6A 4BT9A 4WWOA 5T3RA 5C1DA 5JJTA 1X5BA 5EDSA 3EIQC 1A17A 4CDNA 1HS6A 2VJ8A 1E7VA 4I6GA 4GCNA 4DLQA 4YVQC 4KVOA 1OWMA 2J4BA 4MRUA 4U0UA 3ZPJA 4UI9J 3VLEA 1INZA 4LUNU 4CCAA 3EDTB 4KBQA 4AY6A 2WXJA 3IEGA 3QKYA 4I17A 5FZRA 4GB9A 4ME2A 3TXNA 1E8YA 1FVFA 1PY1A 2R5SA 4EZJA 3S2AA 3CHSA 4EZKA 3KS2A 2RG8A 3ML9A 2X6KA 5T4YA 3CQGB 1ZU2A 3U3WA 2FULA 2YQ8A 3ASFA 2YNQA 3VTYA 4U8HA 2XRZA 3FH7A 4PDXA 3ZYKA 3SD5A 4GU5A 4FJYA 4HORA 4BY6A 2X6IA 3FUNA 4UQYA 5DIZA 4BWRA 5AENA 3KEZA 3FTWA 3OXGA 4BT8A 3PUKA 4G25A 1B89A 4UWHA 5ARFA 4B94A 4JPSA 4FHJA 3SHFA 3RRUA 4J8DA 3ZXSA 3GZ1A 3E4BA 4FJZA 4XI0A 4RVBA 4I9EA 5LP0A 2YHEA 2WPVA 3PNTB 2VQ2A 3UUXA 2A5UA 4JHJA 3CSTA 5BV0A 5LCWC 4Q96A 4R7LA 4G2VA 2YHCA 5CMWA 2WM9A 3K9IA 2XGOA 3SGHA 3LS8A 4CT4A 1U3CA 3FEXA 1OWPA 3PDNA 3CKCA 4URKA 4TRQA 4A1SA 2VGXB 5FQ4A 3SF4A 4Y6WA 3IV0A 2AXUA 2WQHA 3LY7A 4PS7A 2GGFA 4FU3A 2X6FA 4FULA 2VSXE 4YNDA 3OAWA 3CVVA 4OVVA 1WAO1 3NZSA 3ZYQA 2R17C 4DI3A 2FF4A 3RO3A 1ZBPA 3BG1B 2LSUA 3B7SA 1LF8A 3CLJA 5FQ6A 4CGVA 1HG2A 3PUJA 4BTAA 3RKVA 3KAEA 4XKBA 2NSZA 2CG3A 3LDZA 3BG0B 3GZSA 1JWGA 3TAXA 5G55A 2V4LA 5LCWJ 2OVBA 3SZ7A 4A3VA 3TG5A 1OWOA 2CG2A 4JW1A 1FCHA 3EJNA 4H7XA 3PZDA 3D9PA 3RU0A 1HX8A 1UN8A 4GCOA 5DBKA 4ANWA 1VDYA 4JHKA 1UJKA 2LAHA 1EPUA 2LAIA 3CIAA 3LYAA 4DK5A 5G05J 3D9IA 2GRLA 3L08A 2OOEA 3ZRHA 1N54A 4N5CA 4L23A 2WVIA 3TL5A 5FQ7A 3PNLB 5CCLA 4O6FA 4UQZA 2CHXA 2KATA 3QB2A 4N3BA 4FLHA 2L9BA 3T5VA 3CSFA 3S7BA 5AJLA 4ATGA 4N39A 3TJPA 2V5FA 4IRUA 4KXKB 5G04C 4C9BB 3T5XA 2HM8A 2J49A 3LPZA 4I2ZA 4ILHB 4M3OA 3G2VA 5EX3A 2FO7A 1NP7A 4B8CB 2PZIA 1H2TC 5A6CA 5A7DB 2MRIA 3L16A 2KC7A 4HLEA 3CVYA 3CHOA 2PM7A 5AJDA 4JZYA 5FWQA 3Q5MA 4WUYA 5ANRA 3CVXA 3CR3A 3ZYMA 3HVEA 1UJJA 3ONKA 5ENNA 5CCMA 2FEZA 4B8AA 1ELKA 2I2OA 4E85A 3UX4A 5BV1A 1N52A 2CFZA 3G2UA 1HE8A 5E76A 3BEEA 2KCVA 3QWVA 4GA1A 3R7QA 2ZU6B 4A3TA 3U66A 3B7UX 5G04J 3RJVA 3FDHA 4DLOA 4ANUA 1HZ4A 3OXLA 3S7DA 3CQCB 3FU5A 3S7JA 4WAFA 2VTBA 2Y4TA 3JCKC 3CK8A 3DPDA 4L7TA 1PC2A 3ZIMA 1Z3YA 5FZQA 4I1MA 4I1AA 4L1BA 4A55A 1E8WA 4RG6A 4KVMA 2AXVA 3SBTB 2CHZA 3QOUA 3P1UA 3ZGQA 4PS8A 3FUJA 3ASGA 4AEZC 3I3NA 3TG4A 2LO6A 4I1OB 1H2VC 3AS5A 4CT0A 2IFUA 1UW4B 4J8EA 2WQ6A 2UY1B 3RIBA 2XHEA 4LRZA 5KJNA 4AP2A 4HOSA 4B89A 4KYOB 1TJFA 4EBAA 4TV3A 2J4DA 3B7TA 2WXIA 3MYVA 3ESKA 4GZDA 4XIFA 3D9NA 5BW8C 4GMLA 1FVHA 3ZEFA 2X38A 2WXMA 4F3VA 4U04A 3CHRA 3MKQA 3T8MA 3FFLA 4G1TA 2E0IA 2WXHA 1MHQA 3LJ3A 3ZN3A 1EF1C 3AU4A 4JEUA 4WNGA 3JQ0A 3EHNA 1E96B 1OWNA 4F7AA 5FZSA 1L5JA 2I6HA 5ARGA 3G2TA 4WWNA 4G24A 4PH4B 3MA5A 3L6AA 3CHMA 4U0SA 3UMVA 4CDMA 4IULA 3FU3A 5EX0A 1HO8A 2XQ0A 1BPOA 2E2EA 2X6HA 3DBSA 4FHKA 4I6JA 5T8IA 5AIJA 3HHMA 3OXFA 3U4TA 5KJMA 1JUQA 4BX9A 2PQRA 1EDUA 4U07A 4UWKA 5BPPA 2KZTA 4ANVA 3CK7A 3CVLA 3MV2B 2HYZA 5KCMA 4WNDA 4ILGA 4GZCA 3FU0A 2WXGA 3JYSA 4AXHA 4ANXA 4N3AA 2DBAA 2ILRA 3ESLA 1KT1A 3FTUA 1HF8A 5LOZA 2IOLA 3IHYA 3PEVB 5BUZA 5G05C 4JXTA 4LCTA 4GMJA 1IQRA 3CVUA 3LCAA 2LNIA 4OVUA 2XGSA 5E75A 4HOUA 3VLFA 1UG3A 3PH0C 4FC8A 4CRWA 4HS2A 4ACLA 3OTNA 4I9CA 2C0MA 3ASDA 3RRMB 1JWFA 3D9LA 4HXIA 4FP7A 4DI4A 2QY7A 4CEMA 3QWPA 5J08A 2IQCA 3PE3A 4RG9A 1H2UA 2FBNA 4XI9A 5FQ8A 4JL0A 4JEHA 5M72A 2WXOA 1HFAA 2VYIA 3MCXA 2WXNA 3QARA 2WQ7A 4N3CA 2WXRA 3FUHA 2OV8A 3JQ1A 3MKQB 4ABNA 3QAQA 3PVLA 4APFA 1KT0A 3IKOB 3D9OA 1PAQA 2V8SE 2IJGX 3QNKA 2Y4UA 1MQSA 3NZUA 4J8SA 4JC8A 5JJ6A 1GW6A 3FUMA 1YA0A 4MLPA 3U9WA 2BUGA 4G11A 4L2YA 4BFRA 2YINA 2WMOA 4I6EA 3O4ZA 3EHMA 4KZ0A 4C0MA 4AJWA 4N2SA 4MS6A 1Z6TA 4PS3A 2GW1A 4EPZA 2WXLA 3LVQE 2L6JA 3GZ2A 3VTXA 2Q7FA 3QC1A 3CKBA 2XPYA 3LXUX 3RRNB 1IHGA 5J90A 1KLXA 2CFUA 3AS8A 4ACKA 2A4ZA 2J07A 3LKUA 3HDXA 4UWFA 4AV7A 3CHPA 5KJLA 4J8FA 3L22A 3QDNA 3QK0A 5HQ8A 3SI5A 1QNFA 4NQ0A 3CVNA 3HIZA 4KT6B 4P29A 4AOFA 3P2BA 4NURA 2X3MA 3AU5A 1SQMA 4AIFA 4GA0A 3FTSA 5D0OD 3FUIA 3PS6A 4GYYA 3RO2A 3WXXA 3S7FA 3ENEA 3O48A 3Q47B 4AVXA 4MKTA 3L17A 3ASHA 4Q94A 4CGWA 1IYGA 4EQFA 4LERA 1OUVA 5BNWA 2VGXA 3L13A 4LEUA 4G23A 3LY9A 5CMYA 3B13A 1WM5A 3MV3B 4HFGA 3TXMA 2XPIA 2JLBA 3D9MA 4UQXA 4HVBA 3Q15A 2P58C 1W3BA 1EYHA 2XCCA 3D9KA 4EECA 4TUUA 1NZNA 3FUEA 4JHRA 4PUCA 4UWLA 3IBEA 4U0ZA 5AYWD 3MKRA 4GA2A 1H6KA 2MOWA 2AXZA 3LVRE 3GYZA 3ZHEA 4IYPA 3FTVA 2LSVA 2WMNA 3LY8A 1SZAA 4A1GA 2IOSA 1DVPA 2FI7A 1H0AA 4GYOA 3G2SA 4JA7A 3APCA 4OYSA 3UPVA 1NA0A 3Q4AB 5D0QD 3FUKA 2J09A 2CHWA 2I9CA 3NF1A 3ZYLA 4JVSA 4UWGA 1IQUA 4FA6A 2WXPA 1TEZA 3UT7A 4C0EA 2KCLA 3CEQA 3B7RL 3HVEB 4WWPA 4XE0A 4EZLA 2I1JA 2UWJG 1ELWA 3N71A 3VLDA 2IF4A 2KM4A 1HXIA 2WXFA 3MJWA 4U63A 2NXPA 2EQXA 1HH8A 4BSXA 4J6IA 3FTZA 3FUDA 3MZLB 4J0UA 3EIJA 5LX8A 3UT4A 5KJKA 3PREA 2OVFA 2VTBB 3QWWA 4DPRA 4H7YA 5CHEE 3LEWA 2WXQA 3L54A 3FP3A 4GZ5A 1E90A 4I2WA 1QQEA 2XPZA 5HI7A 4Q69A 1NA3A 3TGOA 4QFVA 4Y6CA 2Y3AA 2HR2A 2XRYA 4BTBA 3CVWA 2XCBA 4E6HA 1Y8MA 4K0RA 3FY4A 4XX5A 2PQNA 2IONA 2XGMA 2M63A 3URZA 3FTYA 4KZCA 2VGYA 5ANLA 4NACA 2R59A 5JJ7A 3R9AB 2IU1A 4AM9A 4GPKA 4WNEA 3APDA 3FH8A 3ZW3A 3ZVVA 4B0ZA 2MHKA 2KCKA 1E8XA 3R7RA 2HO1A 5BT1A 1Y6IA 2BTDA 2VSNA 3I4RB 4I43A 3AS4A 3IHVA 2DCPA 4JA9A 1SZ9A 1P5QA 4AY5A 1WY6A 3MGBA 5EKQD 3CK9A 3MEKA 4K03A 2V0PA 5LFAA 3ZHEB 2J08A 2GRMA 3PRZA 4W9RA 5G2NA 3CGHA 1HG5A 2QFCA 1H19A 5FTPA 4IN3B 4F1SA 3ML8A 4HOTA 4EBAG 5A23A 4G26A 3ONLA 3C98A 2AW6A 5FJYA 1JPLA 4F53A 3ZFWA 1E7UA 4YVOA 5FT9A 2WB2A 4D10C 4HOQA 1HU3A 2VSOE 4CDRA 5C2YA 1U3DA 3UQ3A 4BX8A 3FUFA 5JHAA 3UT8A 1OWLA 3FTXA 2C2LA 2NC9A 4GZ6A 3APFA 3FEYA 3PEUB 3QJZA 2XEVA 4KMOA 3I5PA 3I4GA 4NRHB 4XZ4A 4APOA 3CVQA 4UI9K 4ILIA 4GAAA 2DIWA 3FULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN8 A;  3PNL B;  1UN9 A;  4LRZ A;  2BTD A;  3CR3 A; 
#chains in the Genus database with same CATH topology
 5H7P A;  4RSY A;  2PL2 A;  4K5A B;  2X6J A;  3UKU G;  2JEK A;  2I1K A;  3FHE A;  1QZ2 A;  2VSY A;  1DNP A;  1Z3X A;  3SBS A;  3ZKJ A;  3FH5 A;  2L0T B;  3D9J A;  4A63 B;  2XZT G;  4DJA A;  1BD8 A;  2RD0 A;  4XKC A;  1FT2 A;  3RK6 A;  4WWO A;  5T3R A;  2FO1 E;  1X5B A;  4GTR A;  3DSS A;  3EIQ C;  1A17 A;  1HS6 A;  4I6G A;  3PZ4 A;  4KVO A;  4LNG A;  1N4P A;  3JXI A;  4U0U A;  1INZ A;  3KSQ A;  3TWT A;  4YDW A;  3QKY A;  2R5S A;  3CHS A;  3AG4 E;  4HI8 A;  1ZU2 A;  3U3W A;  2FUL A;  2XEN A;  1D8E A;  2YQ8 A;  4PDX A;  3ZYK A;  1SW6 A;  2X6I A;  3FTW A;  3OXG A;  4UWH A;  5ARF A;  3RRU A;  4J8D A;  3GZ1 A;  4DX7 D;  3SFX A;  2YHE A;  2VQ2 A;  4JHJ A;  5BV0 A;  1K3Z D;  4R7L A;  3SGH A;  3LS8 A;  3DWL G;  1OWP A;  3UM2 A;  2VGX B;  3DSU A;  5FQ4 A;  2OEW A;  2AXU A;  2GGF A;  4FU3 A;  2VSX E;  4HLL A;  3NZS A;  1LF8 A;  5FQ6 A;  4O1O A;  4BTA A;  3KAE A;  2CG3 A;  3LDZ A;  5LCW J;  5CEA A;  4A3V A;  1OWO A;  2CG2 A;  3UI2 A;  3EJN A;  1OY3 D;  3E33 A;  4GCO A;  4ANW A;  2LAI A;  4DK5 A;  3L08 A;  4L23 A;  3PNL B;  4UQZ A;  2L9B A;  5AJL A;  4N39 A;  3SFY A;  4IRU A;  5G04 C;  4C9B B;  2J49 A;  4I2Z A;  2PZI A;  2QC9 A;  3ZNG A;  4HLE A;  3CVX A;  3CR3 A;  3ONK A;  3PZ2 A;  2I2O A;  3G2U A;  3QWV A;  4GA1 A;  3B7U X;  4DLO A;  3OXL A;  3FU5 A;  2VTB A;  3JCK C;  1Z3Y A;  4L1B A;  1E8W A;  4KVM A;  4HRM B;  3I3N A;  3AS5 A;  2IFU A;  1D8D A;  3TWU A;  4LG6 A;  4B89 A;  1TJF A;  4EBA A;  3B7T A;  2DWZ A;  3ESK A;  3HXB A;  4GZD A;  4XIF A;  3ZEF A;  3MKQ A;  4G1T A;  2E0I A;  3LJ3 A;  1EF1 C;  3JQ0 A;  1L5J A;  2I6H A;  5ARG A;  4CDM A;  4HQD A;  3CHM A;  3D9H A;  5T8I A;  5AIJ A;  4FHK A;  3HHM A;  1EDU A;  4U07 A;  3L82 A;  3C3Q A;  4ILG A;  3FU0 A;  4LSZ E;  4ANX A;  5LOZ A;  2P9U G;  2LNI A;  4HOU A;  3AJI A;  1UG3 A;  3PH0 C;  4CRW A;  3RRM B;  3QWP A;  2IQC A;  1H2U A;  1TNO A;  4XI9 A;  4JL0 A;  2WQ7 A;  2OV8 A;  4ABN A;  3IKO B;  1PAQ A;  3AG3 E;  2IJG X;  4JC8 A;  4MLP A;  1TN7 A;  1A5E A;  4BFR A;  4L2Y A;  4GTS A;  4AJW A;  1IHG A;  3AG1 E;  3AS8 A;  4UWF A;  3CHP A;  5KJL A;  5HQ8 A;  3SI5 A;  3J5Q B;  1QNF A;  4NQ0 A;  5HKP A;  4KT6 B;  4AOF A;  3AU5 A;  2BED A;  3RO2 A;  1IYG A;  4MKT A;  3ASH A;  4Q94 A;  3E32 A;  4LEU A;  5CMY A;  3DSV A;  3MV3 B;  2XCC A;  1W3B A;  4TUU A;  1NZN A;  4PUC A;  3IBE A;  4U0Z A;  5AYW D;  3MKR A;  4GA2 A;  2MOW A;  4ATZ D;  3LVR E;  3ZHE A;  2WMN A;  1H0A A;  2GRR B;  4OYS A;  4Z68 A;  2I9C A;  3NF1 A;  3UT7 A;  3B7R L;  2DYS E;  3VLD A;  2IO3 C;  1HXI A;  1DCE A;  2WXF A;  4U63 A;  3DXM G;  2EQX A;  1HH8 A;  4J6I A;  3FTZ A;  3EIJ A;  3DEP A;  2VTB B;  3QWW A;  4DPR A;  5CHE E;  3L54 A;  1E90 A;  4I2W A;  4N5Q A;  2XPZ A;  2Y3A A;  2HR2 A;  3KEA A;  2KXP C;  2XCB A;  4E6H A;  5BXO A;  2OCC E;  2RFA A;  1K8K G;  2R59 A;  5AQ7 A;  3TWR A;  3R9A B;  4AM9 A;  3APD A;  3FH8 A;  3ZW3 A;  3ZVV A;  2MHK A;  2MYO A;  1E8X A;  2HO1 A;  5BT1 A;  4YDO A;  4DX6 D;  4K03 A;  3MEK A;  2V0P A;  3BUA A;  2J08 A;  4W9R A;  5G2N A;  1HG5 A;  2QFC A;  3ML8 A;  5A23 A;  4TXP A;  3Q79 A;  3UIO C;  3UT8 A;  2C2L A;  4NRH B;  2XEV A;  2RKK A;  4ILI A;  2DIW A;  4DX1 A;  3JXJ A;  3PE4 A;  2UY1 A;  4FLB A;  1N94 A;  3W9F A;  4U95 D;  4FAD A;  3NQP A;  2J9Q A;  4TXQ A;  1BLX B;  1ELR A;  2LXL A;  1IXV A;  4U7E B;  1MZC A;  5CRV A;  1E7V A;  3V2X A;  2Y0B G;  1OWM A;  4MRU A;  4M7C A;  4CCA A;  4KBQ A;  3IEG A;  4I17 A;  3RAU A;  3UIN C;  4GB9 A;  3TXN A;  1E8Y A;  3S2A A;  3ML9 A;  2P9S G;  4FJY A;  5AEN A;  3UM1 A;  4BT8 A;  3B7B A;  3PUK A;  4JPS A;  4FHJ A;  2OEV A;  3ZXS A;  4CZ2 D;  4RVB A;  4I9E A;  3PNT B;  3UUX A;  2A5U A;  3V30 A;  2WM9 A;  3K9I A;  2XGO A;  1D9S A;  1U3C A;  3PDN A;  4URK A;  2VGE A;  4A1S A;  3HXF A;  3L9T A;  2EIJ E;  4FUL A;  3R9M A;  2Y1L E;  3CVV A;  4OVV A;  2R17 C;  3BG1 B;  3B7S A;  3CLJ A;  1RW2 A;  3RKV A;  3BG0 B;  3GZS A;  1O1S A;  2V4L A;  2OVB A;  3UKR G;  2LUH A;  2DZO A;  3Q9N C;  1O1R A;  3SO8 A;  3PZD A;  3D9P A;  5DBK A;  1VDY A;  1UJK A;  1QBQ A;  1EPU A;  3CIA A;  3LYA A;  4F1P A;  3D9I A;  3ZRH A;  4O6F A;  2CHX A;  4O60 A;  4ATG A;  1V54 E;  3ISM C;  5EYP F;  1H2T C;  2MRI A;  2F8Y A;  3CVY A;  1BI7 B;  1S64 A;  2PM7 A;  5AJD A;  4JZY A;  5FWQ A;  5ANR A;  3ABM E;  5CCM A;  1WDY A;  1ELK A;  3UX4 A;  1N52 A;  1HE8 A;  1V55 E;  2KCV A;  3BEE A;  3R7Q A;  2ZU6 B;  4A3T A;  1MX6 A;  3U66 A;  5G04 J;  4ANU A;  3S7D A;  3CQC B;  5B1B E;  2QYU A;  3CK8 A;  4L7T A;  5FZQ A;  4I1A A;  3W9G A;  2AXV A;  2CHZ A;  3P1U A;  3FUJ A;  4AEZ C;  1H2V C;  4BER A;  1OCZ E;  2UY1 B;  3RIB A;  2XHE A;  4LRZ A;  3JUE A;  4YDE A;  5KJN A;  4AP2 A;  4KYO B;  4TV3 A;  3MYV A;  5BW8 C;  2V5Q C;  2X38 A;  4U04 A;  3ZN3 A;  3T8M A;  3FFL A;  2WXH A;  4WNG A;  3EHN A;  4F7A A;  4WWN A;  4PH4 B;  2BKG A;  3L6A A;  2P9I G;  4U0S A;  4BES A;  4IUL A;  2XQ0 A;  1BPO A;  3DBS A;  3U4T A;  5KJM A;  4BX9 A;  2PQR A;  4UWK A;  5BPP A;  2XS1 A;  5IY5 E;  3CK7 A;  3MV2 B;  2IY0 C;  4WND A;  2DBA A;  3FTU A;  4GTO A;  4GTT A;  5BUZ A;  4JXT A;  1IQR A;  3CVU A;  3E34 A;  3LCA A;  2XGS A;  4FC8 A;  1G3N B;  2P9K G;  2C0M A;  3PZ3 A;  1JWF A;  2R02 A;  4FP7 A;  2QY7 A;  5FQ8 A;  5M72 A;  4JEH A;  2WXO A;  2WXR A;  3FUH A;  4F6R D;  1KT0 A;  3TWQ A;  3D9O A;  4CYM D;  1MQS A;  1GW6 A;  2YIN A;  4I6E A;  3EHM A;  4C0M A;  4EPZ A;  3ZUV B;  3KSL A;  4ZFH A;  2L6J A;  3VTX A;  3QC1 A;  3DSW A;  5J90 A;  1X81 A;  1KLX A;  2CFU A;  2J07 A;  4AV7 A;  4J8F A;  1MX2 A;  3L22 A;  3QDN A;  1KZO A;  3CVN A;  3HIZ A;  3P2B A;  5AQB A;  1OT8 A;  3FTS A;  5D0O D;  3FUI A;  1H6O A;  4GYY A;  3WXX A;  3S7F A;  5AQ9 A;  4AVX A;  3L17 A;  2DZN A;  1S63 A;  4X8Q A;  4G23 A;  3LY9 A;  3TXM A;  4UQX A;  5KNG A;  3Q15 A;  2P58 C;  5CBN A;  1KPS B;  2QYJ A;  3GYZ A;  1N4S A;  4A1G A;  5D2M C;  1DVP A;  1TR4 A;  1NA0 A;  3Q4A B;  2J09 A;  5EN5 D;  4FA6 A;  1TEZ A;  4C0E A;  4WWP A;  3ASO E;  4XE0 A;  4EZL A;  5EIB E;  1FT1 A;  4BSX A;  3FUD A;  1YYH A;  3UT4 A;  3PRE A;  2GRQ B;  2J8S D;  4JD2 G;  4YDY A;  1QQE A;  3Q9U C;  2XRY A;  2PQN A;  2ION A;  2XGM A;  4U8Y D;  2VGY A;  4NAC A;  4NIK A;  4GPK A;  4WNE A;  2ETC A;  1Y6I A;  2VSN A;  3AS4 A;  3IHV A;  4HNA D;  4JA9 A;  1WY6 A;  3CK9 A;  2GRM A;  1OCO E;  1H19 A;  4F1S A;  4HOT A;  4G26 A;  2L6B A;  3C5R A;  4BEP A;  2F8X K;  4F53 A;  3ZFW A;  1E7U A;  4LNU D;  1HU3 A;  4CDR A;  1OWL A;  3APF A;  3FEY A;  3QJZ A;  4KMO A;  2DVW A;  4UI9 K;  3FUL A;  3SNX A;  3KD7 A;  2PM6 A;  3Q7A A;  5JHB A;  3DST A;  2BF0 X;  1UN9 A;  1XNF A;  3U64 A;  1DC2 A;  2AVP A;  4UI9 C;  3ULQ A;  3GW4 A;  3JUI A;  2WXK A;  1QYM A;  5AAO A;  2AWI A;  3SFZ A;  4G8L A;  4BT9 A;  5JJT A;  5EDS A;  5ENQ D;  4CDN A;  2RFM A;  3BQO A;  3HG0 D;  4U96 D;  4GCN A;  4YVQ C;  4HBD A;  1DCQ A;  3Q7F A;  1KZP A;  5FZR A;  1FVF A;  1PY1 A;  4EZJ A;  3T9K A;  3KS2 A;  2X6K A;  2NYJ A;  4GTP A;  2YNQ A;  3VTY A;  4U8H A;  3FH7 A;  3SD5 A;  5CEC B;  1N11 A;  4UQY A;  5DIZ A;  3B95 A;  3C3O A;  1LTX A;  3ASN E;  1B89 A;  3SHF A;  3E4B A;  4FJZ A;  5B1A E;  3NOC D;  3CST A;  4Q96 A;  5CMW A;  4CT4 A;  3FEX A;  3CKC A;  3SF4 A;  3V2O A;  4GMR A;  2WQH A;  3LY7 A;  4PS7 A;  4UUC A;  2X6F A;  2P9L G;  1WAO 1;  2FF4 A;  3RO3 A;  1ZBP A;  4CGV A;  1Z5S C;  2XS8 A;  1HG2 A;  3PUJ A;  4XKB A;  2NSZ A;  2ZGG A;  1N0R A;  2ZXW E;  3BU8 A;  4TXR A;  3SZ7 A;  5HRY A;  2DYR E;  3V31 A;  1K1B A;  3E37 A;  4J8Y A;  5G05 J;  2GRL A;  2OOE A;  1N54 A;  3TL5 A;  3EHQ A;  4N3B A;  3T5V A;  3TJP A;  1WG0 A;  4KXK B;  3T5X A;  5KWD A;  2HM8 A;  3LPZ A;  4ILH B;  1U2V G;  3G2V A;  5EX3 A;  2FO7 A;  4B8C B;  5A6C A;  5A7D B;  1N4R A;  2KC7 A;  5FIO A;  3Q5M A;  4WUY A;  3HVE A;  1UJJ A;  5ENN A;  2FEZ A;  4E85 A;  2CFZ A;  1OCC E;  2R2L A;  3RJV A;  3FDH A;  2GRN B;  3S7J A;  5EYL A;  3DPD A;  3NOG D;  4A55 A;  2IO2 C;  3SBT B;  3ZGQ A;  4PS8 A;  3TG4 A;  2LO6 A;  4I1O B;  4CT0 A;  1UW4 B;  2EIK E;  3RSE G;  2WQ6 A;  1H6P A;  3HXE A;  2WXI A;  3D9N A;  5CED B;  4GML A;  4F3V A;  3CHR A;  3AU4 A;  1OWN A;  2ETB A;  5FZS A;  1ZB1 A;  3C72 A;  4JB8 P;  3HXC A;  4LNB A;  4I6J A;  3OXF A;  1JUQ A;  2XEE A;  2KZT A;  1IKN D;  4ANV A;  2P9P G;  1TN6 A;  3CVL A;  5KCM A;  4GZC A;  3EU9 A;  5FIN A;  4N3A A;  2ILR A;  1HF8 A;  2IOL A;  3IHY A;  5G05 C;  3NB2 A;  4LCT A;  4GMJ A;  4OVU A;  4U8V D;  1IHB A;  5E75 A;  4QQI A;  1TNY A;  4ACL A;  3D9L A;  4HXI A;  3EUV A;  4DI4 A;  4CEM A;  5BXU A;  4RG9 A;  2FBN A;  4MBG A;  2VYI A;  3MCX A;  2WXN A;  3QAR A;  3JQ1 A;  3QAQ A;  3PVL A;  4APF A;  3PZ1 A;  2V8S E;  3QNK A;  4J8S A;  3NZU A;  4OAU C;  3C3R A;  2BUG A;  4G11 A;  1N4Q A;  4KZ0 A;  2ETA A;  2GW1 A;  3AAA C;  3LVQ E;  2Y69 E;  3TWV A;  3CKB A;  3LXU X;  4ACK A;  2A4Z A;  1NI1 A;  3HDX A;  3QK0 A;  3ULE G;  3LJN A;  4NUR A;  2X3M A;  1SQM A;  4BSZ B;  4GA0 A;  3PS6 A;  3O48 A;  3Q47 B;  4LER A;  1OUV A;  5BNW A;  4DX5 D;  1WM5 A;  4GPM A;  2XPI A;  2JLB A;  2EIN E;  3D9M A;  4HVB A;  1EYH A;  3FUE A;  4JHR A;  4UWL A;  1H6K A;  3ZU7 B;  1S70 B;  3SY2 A;  1SZA A;  2JAB A;  2H6F A;  5HS0 A;  3ZXP A;  2FI7 A;  3HRA A;  5KBA A;  2XZD G;  3DRA A;  5D0Q D;  3NBN B;  4JVS A;  1IQU A;  3HVE B;  1ELW A;  3N71 A;  2KM4 A;  2PNN A;  3MZL B;  1BU9 A;  5KJK A;  4GTV A;  2OVF A;  5ENS D;  3LEW A;  4Q69 A;  3TGO A;  4QFV A;  3CVW A;  1Y8M A;  4K5B A;  1TNZ A;  4K0R A;  3URZ A;  3FTY A;  4KZC A;  2IU1 A;  2KCK A;  4I43 A;  3I4R B;  5EKQ D;  5ENT D;  5LFA A;  4J7W A;  2LXM A;  3CGH A;  4TUM A;  3Q73 A;  4IN3 B;  5EID A;  3ONL A;  2AW6 A;  5FJY A;  1JPL A;  4YVO A;  2EIM E;  2WB2 A;  4HOQ A;  2VSO E;  5C2Y A;  1U3D A;  3UQ3 A;  5JHA A;  3FUF A;  3FTX A;  4GZ6 A;  2NC9 A;  4B8A A;  3I5P A;  2IEJ A;  1JCS A;  3CVQ A;  2OND A;  3CHQ A;  3HYM B;  1TNB A;  2KZT B;  3FU6 A;  4WNF A;  4DRX E;  3CVP A;  4HB5 A;  3WG7 E;  3G2W A;  4GZ3 A;  1E8Z A;  3MX3 A;  2C0L A;  3D3M A;  1TJC A;  2BKK B;  4GYW A;  3F6Q A;  3CV0 A;  1S0P A;  1XGW A;  3FWV A;  3Q49 B;  1JCR A;  4N2Q A;  2L0I A;  4L2L A;  4V3I A;  5C1D A;  5JA4 D;  5ENR D;  2VJ8 A;  2H6G A;  4DLQ A;  2J4B A;  3EHR A;  2HE0 A;  3ZPJ A;  4UI9 J;  3VLE A;  4LUN U;  3EDT B;  4AY6 A;  2WXJ A;  3UIP C;  1BI8 B;  1MJ0 A;  4ME2 A;  3DEO A;  4EZK A;  2RG8 A;  3T8K A;  3UM0 A;  5KNH D;  5T4Y A;  3ULY A;  3CQG B;  3ASF A;  1YCS B;  2XRZ A;  4GU5 A;  4HOR A;  4BY6 A;  3FUN A;  4BWR A;  3KEZ A;  3Q78 A;  4XEI G;  4G25 A;  3TWS A;  4B94 A;  5AN8 A;  4XI0 A;  5LP0 A;  2WPV A;  1NL4 A;  3Q75 A;  5CRU A;  4O1P A;  5LCW C;  4G2V A;  2YHC A;  3DXK G;  4K5C A;  1N0Q A;  3AG2 E;  4L9P A;  4TRQ A;  2EIL E;  4Y6W A;  3IV0 A;  4YND A;  3OAW A;  3ZYQ A;  4DI3 A;  2LSU A;  3TAX A;  2F37 A;  1JWG A;  5G55 A;  3V79 K;  3TG5 A;  4JW1 A;  1FCH A;  4H7X A;  3RU0 A;  1HX8 A;  3UTM A;  1UN8 A;  2ZIS A;  4C48 B;  4RQI A;  1N9A A;  4JHK A;  2LAH A;  3SQV A;  1SVX A;  4N5C A;  2WVI A;  5FQ7 A;  5CCL A;  2KAT A;  3QB2 A;  4BET A;  4FLH A;  3CSF A;  3S7B A;  2V5F A;  1O1T A;  4M3O A;  2XEH A;  1NP7 A;  5B3S E;  1UOH A;  1LD8 A;  1TYQ G;  3L16 A;  3CHO A;  3ABK E;  3ZYM A;  4B93 B;  2R03 A;  5EIL A;  5BV1 A;  5E76 A;  1HZ4 A;  2QZA A;  4WAF A;  2Y4T A;  1PC2 A;  3ZIM A;  4I1M A;  2P9N G;  4RG6 A;  4ZHB A;  1O5M A;  3QOU A;  3ASG A;  4GTM A;  2F0Y A;  5AQA A;  1FPP A;  4J8E A;  1OXJ A;  4DX2 A;  4HOS A;  1K1A A;  2J4D A;  1YMP A;  1FVH A;  2B6C A;  2WXM A;  3X2Q E;  1MHQ A;  4JEU A;  4HRL A;  1E96 B;  3G2T A;  4G24 A;  3HXD A;  3MA5 A;  3UMV A;  3FU3 A;  5EX0 A;  1HO8 A;  2E2E A;  2X6H A;  2GRO B;  2HYZ A;  1MX4 A;  4GTQ A;  2WXG A;  3JYS A;  4AXH A;  3ESL A;  1KT1 A;  3PEV B;  2GRP B;  1AWC B;  2H6H A;  3VLF A;  3E30 A;  4HS2 A;  3OTN A;  3UXG A;  4I9C A;  3ASD A;  3DPY A;  1Q2Z A;  5J08 A;  3PE3 A;  1HFA A;  1SA5 A;  4N3C A;  3MKQ B;  1JCQ A;  2Y4U A;  5JJ6 A;  3FUM A;  4HI9 A;  1YA0 A;  4RLY A;  3U9W A;  2R05 A;  2WMO A;  3O4Z A;  4N2S A;  4MS6 A;  1Z6T A;  4PS3 A;  3ABL E;  2WXL A;  3GZ2 A;  2Q7F A;  2XPY A;  3RRN B;  3NAW A;  3LKU A;  2AJA A;  3UM3 A;  4P29 A;  1NFI E;  4AIF A;  2B0O E;  5JMN D;  3ENE A;  4CGW A;  4EQF A;  4OAV B;  2VGX A;  3L13 A;  2V4H C;  3B13 A;  4HFG A;  4EEC A;  3D9K A;  4DUI A;  5AAR A;  3TWX A;  3IXE A;  3DSX A;  2P2C P;  2AXZ A;  5D66 A;  4IYP A;  3FTV A;  2LSV A;  3LY8 A;  2IOS A;  4GYO A;  3G2S A;  4JA7 A;  3APC A;  3UPV A;  3FUK A;  2CHW A;  3ZYL A;  4G8K A;  4UWG A;  1N95 A;  2WXP A;  2KCL A;  3CEQ A;  2I1J A;  2UWJ G;  2IF4 A;  3MJW A;  2NXP A;  2ZGD A;  4J0U A;  5LX8 A;  1SA4 A;  4H7Y A;  5HI7 A;  2WXQ A;  3FP3 A;  4GZ5 A;  1NA3 A;  4Y6C A;  4EHM A;  4HRN A;  4BTB A;  1MYO A;  3FY4 A;  3J5P A;  4XX5 A;  1TN8 A;  2M63 A;  5ENP D;  5ANL A;  5JJ7 A;  4B0Z A;  3R7R A;  2BTD A;  5CBO A;  2DCP A;  1SZ9 A;  2KBX A;  1P5Q A;  4AY5 A;  3MGB A;  3ZHE B;  3PRZ A;  1OCR E;  5FTP A;  1AP7 A;  4EBA G;  5ITZ F;  1RZ4 A;  5CER B;  3C98 A;  3TWW A;  5ENO D;  2ZIR A;  1TNU A;  5FT9 A;  4D10 C;  2H6I A;  4BX8 A;  3EU5 A;  2A5E A;  3PEU B;  3I4G A;  4XZ4 A;  1LD7 A;  4APO A;  4GAA A; 
#chains in the Genus database with same CATH homology
 2OND A;  3CHQ A;  3HYM B;  3SNX A;  4RSY A;  3KD7 A;  2KZT B;  3FU6 A;  2PL2 A;  3PE4 A;  2UY1 A;  2X6J A;  2PM6 A;  4FLB A;  4WNF A;  3CVP A;  5JHB A;  3G2W A;  2BF0 X;  4GZ3 A;  2JEK A;  1E8Z A;  1UN9 A;  2I1K A;  3MX3 A;  1XNF A;  4FAD A;  3FHE A;  2C0L A;  3D3M A;  1QZ2 A;  3U64 A;  3NQP A;  2VSY A;  1DNP A;  1TJC A;  1Z3X A;  4GYW A;  3SBS A;  2AVP A;  2J9Q A;  3CV0 A;  1S0P A;  3FH5 A;  1ELR A;  4UI9 C;  2L0T B;  3D9J A;  3ULQ A;  3GW4 A;  1XGW A;  3FWV A;  3JUI A;  2WXK A;  3Q49 B;  4DJA A;  2AWI A;  3SFZ A;  4N2Q A;  2RD0 A;  2L0I A;  4L2L A;  4V3I A;  4XKC A;  3RK6 A;  4BT9 A;  4WWO A;  5T3R A;  5C1D A;  5JJT A;  1X5B A;  5EDS A;  3EIQ C;  1A17 A;  4CDN A;  1HS6 A;  2VJ8 A;  1E7V A;  4I6G A;  4GCN A;  4DLQ A;  4YVQ C;  4KVO A;  1OWM A;  2J4B A;  4MRU A;  4U0U A;  3ZPJ A;  4UI9 J;  3VLE A;  1INZ A;  4LUN U;  4CCA A;  3EDT B;  4KBQ A;  4AY6 A;  2WXJ A;  3IEG A;  3QKY A;  4I17 A;  5FZR A;  4GB9 A;  4ME2 A;  3TXN A;  1E8Y A;  1FVF A;  1PY1 A;  2R5S A;  4EZJ A;  3S2A A;  3CHS A;  4EZK A;  3KS2 A;  2RG8 A;  3ML9 A;  2X6K A;  5T4Y A;  3CQG B;  1ZU2 A;  3U3W A;  2FUL A;  2YQ8 A;  3ASF A;  2YNQ A;  3VTY A;  4U8H A;  2XRZ A;  3FH7 A;  4PDX A;  3ZYK A;  3SD5 A;  4GU5 A;  4FJY A;  4HOR A;  4BY6 A;  2X6I A;  3FUN A;  4UQY A;  5DIZ A;  4BWR A;  5AEN A;  3KEZ A;  3FTW A;  3OXG A;  4BT8 A;  3PUK A;  4G25 A;  1B89 A;  4UWH A;  5ARF A;  4B94 A;  4JPS A;  4FHJ A;  3SHF A;  3RRU A;  4J8D A;  3ZXS A;  3GZ1 A;  3E4B A;  4FJZ A;  4XI0 A;  4RVB A;  4I9E A;  5LP0 A;  2YHE A;  2WPV A;  3PNT B;  2VQ2 A;  3UUX A;  2A5U A;  4JHJ A;  3CST A;  5BV0 A;  5LCW C;  4Q96 A;  4R7L A;  4G2V A;  2YHC A;  5CMW A;  2WM9 A;  3K9I A;  2XGO A;  3SGH A;  3LS8 A;  4CT4 A;  1U3C A;  3FEX A;  1OWP A;  3PDN A;  3CKC A;  4URK A;  4TRQ A;  4A1S A;  2VGX B;  5FQ4 A;  3SF4 A;  4Y6W A;  3IV0 A;  2AXU A;  2WQH A;  3LY7 A;  4PS7 A;  2GGF A;  4FU3 A;  2X6F A;  4FUL A;  2VSX E;  4YND A;  3OAW A;  3CVV A;  4OVV A;  1WAO 1;  3NZS A;  3ZYQ A;  2R17 C;  4DI3 A;  2FF4 A;  3RO3 A;  1ZBP A;  3BG1 B;  2LSU A;  3B7S A;  1LF8 A;  3CLJ A;  5FQ6 A;  4CGV A;  1HG2 A;  3PUJ A;  4BTA A;  3RKV A;  3KAE A;  4XKB A;  2NSZ A;  2CG3 A;  3LDZ A;  3BG0 B;  3GZS A;  1JWG A;  3TAX A;  5G55 A;  2V4L A;  5LCW J;  2OVB A;  3SZ7 A;  4A3V A;  3TG5 A;  1OWO A;  2CG2 A;  4JW1 A;  1FCH A;  3EJN A;  4H7X A;  3PZD A;  3D9P A;  3RU0 A;  1HX8 A;  1UN8 A;  4GCO A;  5DBK A;  4ANW A;  1VDY A;  4JHK A;  1UJK A;  2LAH A;  1EPU A;  2LAI A;  3CIA A;  3LYA A;  4DK5 A;  5G05 J;  3D9I A;  2GRL A;  3L08 A;  2OOE A;  3ZRH A;  1N54 A;  4N5C A;  4L23 A;  2WVI A;  3TL5 A;  5FQ7 A;  3PNL B;  5CCL A;  4O6F A;  4UQZ A;  2CHX A;  2KAT A;  3QB2 A;  4N3B A;  4FLH A;  2L9B A;  3T5V A;  3CSF A;  3S7B A;  5AJL A;  4ATG A;  4N39 A;  3TJP A;  2V5F A;  4IRU A;  4KXK B;  5G04 C;  4C9B B;  3T5X A;  2HM8 A;  2J49 A;  3LPZ A;  4I2Z A;  4ILH B;  4M3O A;  3G2V A;  5EX3 A;  2FO7 A;  1NP7 A;  4B8C B;  2PZI A;  1H2T C;  5A6C A;  5A7D B;  2MRI A;  3L16 A;  2KC7 A;  4HLE A;  3CVY A;  3CHO A;  2PM7 A;  5AJD A;  4JZY A;  5FWQ A;  3Q5M A;  4WUY A;  5ANR A;  3CVX A;  3CR3 A;  3ZYM A;  3HVE A;  1UJJ A;  3ONK A;  5ENN A;  5CCM A;  2FEZ A;  4B8A A;  1ELK A;  2I2O A;  4E85 A;  3UX4 A;  5BV1 A;  1N52 A;  2CFZ A;  3G2U A;  1HE8 A;  5E76 A;  3BEE A;  2KCV A;  3QWV A;  4GA1 A;  3R7Q A;  2ZU6 B;  4A3T A;  3U66 A;  3B7U X;  5G04 J;  3RJV A;  3FDH A;  4DLO A;  4ANU A;  1HZ4 A;  3OXL A;  3S7D A;  3CQC B;  3FU5 A;  3S7J A;  4WAF A;  2VTB A;  2Y4T A;  3JCK C;  3CK8 A;  3DPD A;  4L7T A;  1PC2 A;  3ZIM A;  1Z3Y A;  5FZQ A;  4I1M A;  4I1A A;  4L1B A;  4A55 A;  1E8W A;  4RG6 A;  4KVM A;  2AXV A;  3SBT B;  2CHZ A;  3QOU A;  3P1U A;  3ZGQ A;  4PS8 A;  3FUJ A;  3ASG A;  4AEZ C;  3I3N A;  3TG4 A;  2LO6 A;  4I1O B;  1H2V C;  3AS5 A;  4CT0 A;  2IFU A;  1UW4 B;  4J8E A;  2WQ6 A;  2UY1 B;  3RIB A;  2XHE A;  4LRZ A;  5KJN A;  4AP2 A;  4HOS A;  4B89 A;  4KYO B;  1TJF A;  4EBA A;  4TV3 A;  2J4D A;  3B7T A;  2WXI A;  3MYV A;  3ESK A;  4GZD A;  4XIF A;  3D9N A;  5BW8 C;  4GML A;  1FVH A;  3ZEF A;  2X38 A;  2WXM A;  4F3V A;  4U04 A;  3CHR A;  3MKQ A;  3T8M A;  3FFL A;  4G1T A;  2E0I A;  2WXH A;  1MHQ A;  3LJ3 A;  3ZN3 A;  1EF1 C;  3AU4 A;  4JEU A;  4WNG A;  3JQ0 A;  3EHN A;  1E96 B;  1OWN A;  4F7A A;  5FZS A;  1L5J A;  2I6H A;  5ARG A;  3G2T A;  4WWN A;  4G24 A;  4PH4 B;  3MA5 A;  3L6A A;  3CHM A;  4U0S A;  3UMV A;  4CDM A;  4IUL A;  3FU3 A;  5EX0 A;  1HO8 A;  2XQ0 A;  1BPO A;  2E2E A;  2X6H A;  3DBS A;  4FHK A;  4I6J A;  5T8I A;  5AIJ A;  3HHM A;  3OXF A;  3U4T A;  5KJM A;  1JUQ A;  4BX9 A;  2PQR A;  1EDU A;  4U07 A;  4UWK A;  5BPP A;  2KZT A;  4ANV A;  3CK7 A;  3CVL A;  3MV2 B;  2HYZ A;  5KCM A;  4WND A;  4ILG A;  4GZC A;  3FU0 A;  2WXG A;  3JYS A;  4AXH A;  4ANX A;  4N3A A;  2DBA A;  2ILR A;  3ESL A;  1KT1 A;  3FTU A;  1HF8 A;  5LOZ A;  2IOL A;  3IHY A;  3PEV B;  5BUZ A;  5G05 C;  4JXT A;  4LCT A;  4GMJ A;  1IQR A;  3CVU A;  3LCA A;  2LNI A;  4OVU A;  2XGS A;  5E75 A;  4HOU A;  3VLF A;  1UG3 A;  3PH0 C;  4FC8 A;  4CRW A;  4HS2 A;  4ACL A;  3OTN A;  4I9C A;  2C0M A;  3ASD A;  3RRM B;  1JWF A;  3D9L A;  4HXI A;  4FP7 A;  4DI4 A;  2QY7 A;  4CEM A;  3QWP A;  5J08 A;  2IQC A;  3PE3 A;  4RG9 A;  1H2U A;  2FBN A;  4XI9 A;  5FQ8 A;  4JL0 A;  4JEH A;  5M72 A;  2WXO A;  1HFA A;  2VYI A;  3MCX A;  2WXN A;  3QAR A;  2WQ7 A;  4N3C A;  2WXR A;  3FUH A;  2OV8 A;  3JQ1 A;  3MKQ B;  4ABN A;  3QAQ A;  3PVL A;  4APF A;  1KT0 A;  3IKO B;  3D9O A;  1PAQ A;  2V8S E;  2IJG X;  3QNK A;  2Y4U A;  1MQS A;  3NZU A;  4J8S A;  4JC8 A;  5JJ6 A;  1GW6 A;  3FUM A;  1YA0 A;  4MLP A;  3U9W A;  2BUG A;  4G11 A;  4L2Y A;  4BFR A;  2YIN A;  2WMO A;  4I6E A;  3O4Z A;  3EHM A;  4KZ0 A;  4C0M A;  4AJW A;  4N2S A;  4MS6 A;  1Z6T A;  4PS3 A;  2GW1 A;  4EPZ A;  2WXL A;  3LVQ E;  2L6J A;  3GZ2 A;  3VTX A;  2Q7F A;  3QC1 A;  3CKB A;  2XPY A;  3LXU X;  3RRN B;  1IHG A;  5J90 A;  1KLX A;  2CFU A;  3AS8 A;  4ACK A;  2A4Z A;  2J07 A;  3LKU A;  3HDX A;  4UWF A;  4AV7 A;  3CHP A;  5KJL A;  4J8F A;  3L22 A;  3QDN A;  3QK0 A;  5HQ8 A;  3SI5 A;  1QNF A;  4NQ0 A;  3CVN A;  3HIZ A;  4KT6 B;  4P29 A;  4AOF A;  3P2B A;  4NUR A;  2X3M A;  3AU5 A;  1SQM A;  4AIF A;  4GA0 A;  3FTS A;  5D0O D;  3FUI A;  3PS6 A;  4GYY A;  3RO2 A;  3WXX A;  3S7F A;  3ENE A;  3O48 A;  3Q47 B;  4AVX A;  4MKT A;  3L17 A;  3ASH A;  4Q94 A;  4CGW A;  1IYG A;  4EQF A;  4LER A;  1OUV A;  5BNW A;  2VGX A;  3L13 A;  4LEU A;  4G23 A;  3LY9 A;  5CMY A;  3B13 A;  1WM5 A;  3MV3 B;  4HFG A;  3TXM A;  2XPI A;  2JLB A;  3D9M A;  4UQX A;  4HVB A;  3Q15 A;  2P58 C;  1W3B A;  1EYH A;  2XCC A;  3D9K A;  4EEC A;  4TUU A;  1NZN A;  3FUE A;  4JHR A;  4PUC A;  4UWL A;  3IBE A;  4U0Z A;  5AYW D;  3MKR A;  4GA2 A;  1H6K A;  2MOW A;  2AXZ A;  3LVR E;  3GYZ A;  3ZHE A;  4IYP A;  3FTV A;  2LSV A;  2WMN A;  3LY8 A;  1SZA A;  4A1G A;  2IOS A;  1DVP A;  2FI7 A;  1H0A A;  4GYO A;  3G2S A;  4JA7 A;  3APC A;  4OYS A;  3UPV A;  1NA0 A;  3Q4A B;  5D0Q D;  3FUK A;  2J09 A;  2CHW A;  2I9C A;  3NF1 A;  3ZYL A;  4JVS A;  4UWG A;  1IQU A;  4FA6 A;  2WXP A;  1TEZ A;  3UT7 A;  4C0E A;  2KCL A;  3CEQ A;  3B7R L;  3HVE B;  4WWP A;  4XE0 A;  4EZL A;  2I1J A;  2UWJ G;  1ELW A;  3N71 A;  3VLD A;  2IF4 A;  2KM4 A;  1HXI A;  2WXF A;  3MJW A;  4U63 A;  2NXP A;  2EQX A;  1HH8 A;  4BSX A;  4J6I A;  3FTZ A;  3FUD A;  3MZL B;  4J0U A;  3EIJ A;  5LX8 A;  3UT4 A;  5KJK A;  3PRE A;  2OVF A;  2VTB B;  3QWW A;  4DPR A;  4H7Y A;  5CHE E;  3LEW A;  2WXQ A;  3L54 A;  3FP3 A;  4GZ5 A;  1E90 A;  4I2W A;  1QQE A;  2XPZ A;  5HI7 A;  4Q69 A;  1NA3 A;  3TGO A;  4QFV A;  4Y6C A;  2Y3A A;  2HR2 A;  2XRY A;  4BTB A;  3CVW A;  2XCB A;  4E6H A;  1Y8M A;  4K0R A;  3FY4 A;  4XX5 A;  2PQN A;  2ION A;  2XGM A;  2M63 A;  3URZ A;  3FTY A;  4KZC A;  2VGY A;  5ANL A;  4NAC A;  2R59 A;  5JJ7 A;  3R9A B;  2IU1 A;  4AM9 A;  4GPK A;  4WNE A;  3APD A;  3FH8 A;  3ZW3 A;  3ZVV A;  4B0Z A;  2MHK A;  2KCK A;  1E8X A;  3R7R A;  2HO1 A;  5BT1 A;  1Y6I A;  2BTD A;  2VSN A;  3I4R B;  4I43 A;  3AS4 A;  3IHV A;  2DCP A;  4JA9 A;  1SZ9 A;  1P5Q A;  4AY5 A;  1WY6 A;  3MGB A;  5EKQ D;  3CK9 A;  3MEK A;  4K03 A;  2V0P A;  5LFA A;  3ZHE B;  2J08 A;  2GRM A;  3PRZ A;  4W9R A;  5G2N A;  3CGH A;  1HG5 A;  2QFC A;  1H19 A;  5FTP A;  4IN3 B;  4F1S A;  3ML8 A;  4HOT A;  4EBA G;  5A23 A;  4G26 A;  3ONL A;  3C98 A;  2AW6 A;  5FJY A;  1JPL A;  4F53 A;  3ZFW A;  1E7U A;  4YVO A;  5FT9 A;  2WB2 A;  4D10 C;  4HOQ A;  1HU3 A;  2VSO E;  4CDR A;  5C2Y A;  1U3D A;  3UQ3 A;  4BX8 A;  3FUF A;  5JHA A;  3UT8 A;  1OWL A;  3FTX A;  2C2L A;  2NC9 A;  4GZ6 A;  3APF A;  3FEY A;  3PEU B;  3QJZ A;  2XEV A;  4KMO A;  3I5P A;  3I4G A;  4NRH B;  4XZ4 A;  4APO A;  3CVQ A;  4UI9 K;  4ILI A;  4GAA A;  2DIW A;  3FUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...