5JA4D

Crystal structure of human tonsl and mcm2 hbds binding to a histone h3-h4 tetramer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
KWNRRNDMGETLLHRACIEGQLRRVQDLVRQGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGGQGCEGITPLHDALNCGHFEVAELLLERGASVTLRTRKGLSPLETLQQWVKLYRRDLDLETRQKARAMEMLLQAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Histone H3.3
publication title H4K20me0 marks post-replicative chromatin and recruits the TONSL-MMS22L DNA repair complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5ja4D00
2JABA 5AQ7A 1MX6A 3UI2A 3ZNGA 5ENOD 2V4HC 1AP7A 4LNUD 5AN8A 3UTMA 3AAAC 3ZUVB 4BEPA 5CECB 1MJ0A 2QYJA 4LSZE 4U8YD 2KBXA 3W9GA 3J5QB 4JB8P 4QFVA 4DX6D 5CEAA 3NBNB 5FIOA 4Z68A 2AJAA 4CZ2D 2ZGDA 4ZHBA 2ETCA 3KEAA 1SVXA 3Q9NC 5HS0A 4HLLA 4YDYA 1MX2A 2ETBA 3TWUA 5EN5D 1MX4A 4HI8A 3W9FA 4A63B 2XEHA 3TWXA 5CBOA 2DZNA 5AQ9A 3LJNA 4U95D 1K3ZD 3ZU7B 3TWQA 5KNHD 1WDYA 1YYHA 5CERB 2XZDG 3V2XA 3B7BA 3B95A 2L6BA 2RFAA 3C5RA 3SO8A 1YCSB 2HE0A 2J8SD 3NOCD 2Y1LE 3V30A 4DX2A 4F1PA 4ZFHA 4HB5A 2Y0BG 5ENQD 1K1BA 3IXEA 3JXIA 2F8YA 1N0RA 2RFMA 3EU9A 3J5PA 3F6QA 4C48B 4DUIA 3V79K 3TWTA 4O1PA 4DX1A 3TWVA 5CBNA 4ATZD 2A5EA 3JUEA 5CEDB 2FO1E 2ETAA 4BESA 4HBDA 5ITZF 2V5QC 4NIKA 4O60A 3EHQA 1K1AA 4N5QA 4G8LA 5D66A 5FINA 4BERA 1UOHA 3NOGD 4K5BA 2MYOA 4U8VD 3T9KA 4DRXE 2XEEA 4DX7D 4GMRA 4RLYA 3TWWA 3Q9UC 5HRYA 1IXVA 5ENTD 1QYMA 2B0OE 1TR4A 4GPMA 1NFIE 1N11A 2XENA 1WG0A 3DEOA 2DZOA 5JMND 5KBAA 4HI9A 4BETA 3T8KA 4TUMA 5ENRD 3TWRA 5KWDA 5AAOA 5ENSD 5EYLA 5EYPF 3ZKJA 1G3NB 4F6RD 4HRLA 1MYOA 1BI7B 2NYJA 5HKPA 5KNGA 3HRAA 5EIDA 4UUCA 3TWSA 1DCQA 2P2CP 2ZGGA 4J7WA 4OAUC 2VGEA 1DC2A 2KXPC 2DWZA 3AJIA 4DX5D 4K5AB 4YDWA 1YMPA 1BI8B 4HNAD 3EHRA 1IHBA 3JXJA 5AARA 4QQIA 4LG6A 5EIBE 5AQBA 4O1OA 3V2OA 4BSZB 5AQAA 2F37A 1S70B 3D9HA 4HRMB 5EILA 1D9SA 1BU9A 4B93B 1SW6A 3DEPA 4U96D 3V31A 4CYMD 2QC9A 4HQDA 2PNNA 1N0QA 1AWCB 4OAVB 2BKKB 4K5CA 1BLXB 1BD8A 5ENPD 2DVWA 4G8KA 5JA4D 1OY3D 2BKGA 3HG0D 1IKND 4HRNA 4J8YA 5BXOA 5BXUA 1A5EA 2XZTG 2F8XK 3UXGA 1OT8A
chains in the Genus database with same CATH superfamily
3LCAA 5D2MC 1OCOE 2XPIA 1UG3A 4QFVA 3MEKA 4FJYA 5FIOA 4I1OB 4WNDA 3DSVA 4GZ6A 2WMNA 2WXFA 4KBQA 2VSXE 3ABLE 4APOA 1JUQA 3UT4A 4RVBA 2WXIA 3LJNA 4I6JA 3OXGA 3SFZA 2IONA 3UKRG 1DNPA 3ISMC 5C2YA 4YVOA 2L6JA 4C48B 1N52A 1QZ2A 2FO1E 3URZA 5FQ6A 4NIKA 4N3BA 2J9QA 4O60A 2LAHA 2YHEA 3K9IA 5BPPA 4N2QA 1IQRA 5G2NA 3GZ2A 3R9AB 4BTBA 5KJMA 4FLBA 1VDYA 2WXRA 4GPMA 3T5VA 3CVQA 2J09A 3DEOA 4L2YA 5AAOA 3L08A 2WXPA 4TUUA 4UQZA 4GTPA 4HORA 3FUNA 2PL2A 4GCNA 2XS8A 4EPZA 3PNTB 4FP7A 2OVFA 4BX9A 3UM3A 1DCQA 1E96B 1LD7A 3ASDA 4XEIG 2F0YA 4MLPA 1IHBA 3FTYA 2IEJA 1MHQA 3V2OA 3S7BA 4IRUA 3ZPJA 2E2EA 3V31A 3IV0A 5HI7A 3CVWA 5JA4D 3Q75A 3HG0D 3BQOA 4FULA 5AQ7A 1UJKA 3TJPA 3RRNB 3FTSA 2OVBA 2UWJG 5H7PA 4I9CA 5HS0A 3FWVA 2XHEA 1KLXA 1ELWA 4CEMA 3BUAA 3L9TA 4TXQA 3NZSA 1ZB1A 4F1PA 1NI1A 1JPLA 3NF1A 2F8YA 1HX8A 4UQXA 3UM0A 3L17A 3JUEA 4YDEA 3RK6A 3ZYQA 2PM7A 1K1AA 4GYWA 2YINA 2XEEA 3U66A 3HVEB 2J4BA 1Z3XA 2IJGX 3R7QA 2VTBA 3MV2B 4F7AA 1TN6A 3CVPA 2ILRA 3DWLG 2NYJA 2IOLA 2C2LA 4OAUC 5FQ8A 4OVVA 4AV7A 1UJJA 4KZCA 5G04J 4AY5A 4BTAA 3FU5A 2F37A 4G26A 3ZHEA 3P1UA 3FH7A 3P2BA 5DIZA 1EDUA 4NQ0A 2ZIRA 2Q7FA 4EZJA 4J8YA 2KCKA 3E34A 3CVUA 1HZ4A 3FUFA 2A5UA 2QYJA 2KZTA 4J8EA 2L0IA 4DX6D 5KJLA 4J8DA 4KVMA 3DRAA 1SVXA 3RJVA 4U63A 4A55A 1E90A 3NB2A 1MX2A 4PS8A 1H6KA 2EIJE 5AQ9A 1D8DA 2VSYA 3PE4A 1K3ZD 3ZU7B 1YYHA 1L5JA 2ZXWE 1Y6IA 1OCZE 4TXPA 2NXPA 1K1BA 1Q2ZA 4EECA 2VGXA 3V79K 3PREA 3TWTA 1O1SA 3ZGQA 3PEVB 3PUKA 4HOUA 4WWOA 4BERA 4K5BA 4G23A 2BUGA 3KD7A 3EUVA 4B8CB 1IXVA 1TR4A 1N11A 5ENNA 4JA9A 2A4ZA 2CG3A 4JD2G 4BFRA 2JEKA 3O48A 2WXKA 2OV8A 2ZGGA 1BI8B 1H19A 4I43A 4I2WA 4L1BA 2X3MA 4U8HA 4CGWA 4JZYA 3FTUA 4B93B 3FUHA 1FPPA 2CHWA 2CHXA 3E37A 1BD8A 3LJ3A 3ABKE 3PS6A 3QAQA 3SGHA 3MZLB 4WWNA 4WNEA 2GRPB 2XGMA 3HXEA 3LKUA 1V54E 4BT9A 2WXNA 3TWUA 4XKCA 3RRUA 3TG4A 5AENA 3PVLA 3SI5A 3B95A 2HE0A 1INZA 3PEUB 2P9IG 3APFA 3D9PA 2CHZA 2YHCA 4W9RA 3UUXA 4GMLA 4DUIA 1HG2A 4UQYA 2PQRA 3CKBA 5JJ6A 3I3NA 3FH8A 1KZPA 3ZXSA 1UOHA 1EF1C 5J08A 4GMRA 3PZ3A 2WXJA 5BW8C 1ELKA 1QYMA 1YA0A 1TEZA 2DZOA 4J8FA 4TUMA 3B13A 2M63A 3JCKC 4XZ4A 4B0ZA 3BG0B 2VGEA 3AJIA 3AG1E 2IOSA 3CR3A 2XGOA 3LY9A 4BSZB 2P9NG 3CVLA 3LVQE 3OAWA 3ESLA 2IY0C 4KT6B 3RRMB 1AWCB 3CKCA 4J8SA 2DVWA 4YDOA 4LRZA 4JHRA 1UN8A 3E4BA 2KATA 5FQ4A 5CECB 2VGYA 4CT0A 2PQNA 4I17A 3PZ4A 4A3VA 2RG8A 2LSUA 5CBOA 3MKRA 5KNHD 4N3AA 2YQ8A 3V2XA 2PZIA 1SQMA 5KCMA 4GYOA 3RO2A 3FY4A 3HDXA 1IYGA 4TV3A 4FADA 4WUYA 2I9CA 4C9BB 1H2UA 3QJZA 2V5QC 3QARA 3PRZA 4LNBA 1BPOA 3AU5A 3FHEA 2QFCA 4NRHB 4DRXE 4RLYA 4B94A 4XIFA 1N4QA 2BF0X 4F53A 3CV0A 1FVFA 3G2WA 3D9MA 3L54A 1SA4A 4GA0A 2DYRE 3ZKJA 4CRWA 4DPRA 5KNGA 3CVYA 4XI9A 3UT7A 4TRQA 3B7TA 4DX5D 4K5AB 3OXFA 3D9KA 2I1KA 4O1OA 3UPVA 4A3TA 3VLEA 3CSFA 5CRVA 3TXNA 3ULQA 1H0AA 4PS3A 2BKKB 3E30A 2GRQB 3Q15A 5FZRA 1TN7A 2QZAA 3D9OA 5M72A 3C98A 4Z68A 3APCA 3L22A 3TGOA 1X81A 3KS2A 1MX4A 1DVPA 4D10C 5CERB 3B7UX 3CHOA 3ZYLA 3EIQC 1ELRA 2RFAA 5ARFA 1N4PA 3SFYA 2J8SD 3SD5A 2P9UG 1E7UA 3GZ1A 3QNKA 3NAWA 2LSVA 3IXEA 5JHAA 4B89A 5CBNA 4AJWA 4N5QA 3ASOE 1JCQA 3ABME 3CQGB 2GRMA 5AYWD 4ANWA 1UW4B 2XENA 3GW4A 4RSYA 3G2SA 3T8KA 2NSZA 5EYPF 3O4ZA 5AIJA 3IHVA 3UKUG 4GZDA 2FO7A 4HOSA 3AS4A 3MKQA 3LXUX 3ULYA 2V5FA 3X2QE 3D9NA 2AW6A 2VJ8A 3HYMB 3MV3B 2GRNB 2BKGA 4HRNA 4HS2A 3PZDA 2XZTG 4I6GA 1Z3YA 2KBXA 3SQVA 3NBNB 2WPVA 4GTQA 3CHSA 4I6EA 4J6IA 2GW1A 4HLLA 2ETBA 3VLDA 3FTXA 1NL4A 4UI9K 3QWPA 3NZUA 1HS6A 3ASNE 4C0EA 3E32A 1A17A 4PS7A 4X8QA 4N3CA 4ANVA 4ANXA 1NP7A 3DSTA 5LCWC 5JHBA 4E6HA 3UX4A 3JYSA 5KJNA 4H7YA 4HBDA 3S7FA 5A7DB 2XCBA 3LDZA 4G8LA 5FINA 3ZN3A 4DX7D 3ONKA 4A1GA 3ZRHA 5ENTD 2VTBB 3NQPA 5JMND 4I2ZA 4AEZC 4A1SA 1ZBPA 5BNWA 3FUIA 4URKA 4WWPA 4AIFA 3FULA 4GYYA 3CK8A 4YVQC 3ZHEB 1HXIA 3OXLA 4MRUA 3L6AA 2EIKE 2CFZA 2LO6A 4GCOA 3ZYMA 3MA5A 1TNUA 5B3SE 5EDSA 1OY3D 1IKND 5BXOA 3ZIMA 4AXHA 2KZTB 2WM9A 2H6GA 4BT8A 4U0SA 5EX0A 2XRZA 3FTZA 3PNLB 4XX5A 1JWGA 5HQ8A 3S7DA 2P9SG 2AJAA 4K03A 4FA6A 2ETCA 5DBKA 3RU0A 3ML9A 1H2TC 3FEXA 3VTYA 3W9FA 2J08A 2WXMA 3Q5MA 5G05C 5CMYA 3FU0A 3TWQA 2FI7A 1HG5A 3JQ1A 2WMOA 5ANLA 3V30A 2VGXB 2R03A 3ML8A 1UN9A 1MZCA 3ASFA 1JCSA 3TWVA 2A5EA 5CCMA 4BESA 1HFAA 2NC9A 1OWOA 1H2VC 3FUJA 1HF8A 4Q94A 1E8WA 3HIZA 3UM1A 3L16A 3OTNA 4F1SA 3MYVA 2XGSA 1WG0A 2OOEA 4ME2A 1QQEA 2HO1A 1Z5SC 3KSLA 4UI9C 2EILE 3APDA 4GU5A 4G1TA 2EIME 3HXDA 5AJDA 3Q7AA 1H6OA 4APFA 4XKBA 4R7LA 4GZCA 2AVPA 3ASGA 3FFLA 5FZQA 4QQIA 3U64A 3R9MA 2AXUA 2KCVA 2WXOA 3WG7E 1NZNA 4Y6CA 2PNNA 4OAVB 5B1AE 1Z6TA 5EKQD 5ENPD 2J49A 4G8KA 5E75A 5BXUA 1A5EA 3Q73A 3EHNA 3JUIA 2L0TB 1TN8A 5J90A 3CVVA 4ANUA 3SBSA 4HOTA 3SNXA 4CZ2D 4GZ3A 2FF4A 3MGBA 2Y4TA 1HO8A 1SZ9A 4JL0A 4O6FA 4A63B 4OVUA 4CCAA 1NA0A 4HVBA 2LAIA 2I2OA 4UWFA 4JPSA 2XPZA 3C3QA 3DBSA 4UWKA 2Y0BG 2BTDA 1LF8A 1N9AA 3EU9A 4MBGA 3F6QA 4DX1A 1QNFA 3AG3E 4XI0A 2ZU6B 3FU3A 4N2SA 3Q9UC 3B7SA 4BETA 3SHFA 2X6JA 2IO2C 3LVRE 2X6HA 2XQ0A 2VYIA 1MYOA 3BU8A 3EJNA 2WXHA 3GZSA 5BV1A 2ZISA 3IHYA 1E8XA 2WQHA 1DC2A 1RW2A 2MOWA 3IKOB 5AARA 2IQCA 4UWHA 5AQAA 2X6FA 3AG2E 3CGHA 2P9LG 1IQUA 3ZXPA 5D0OD 5CMWA 1OCRE 3N71A 3QOUA 1EPUA 5D0QD 3VLFA 3LS8A 2V0PA 4M3OA 2UY1A 2IF4A 3Q7FA 5FWQA 4KMOA 1GW6A 2E0IA 5FQ7A 5AN8A 1JWFA 4GA1A 3UT8A 3T5XA 3J5QB 1FVHA 3D3MA 1H6PA 4JHKA 4ZHBA 1N4RA 2MHKA 3UMVA 1WDYA 4WNFA 4BX8A 3ONLA 3DPYA 4IN3B 2X6KA 3PH0C 2LXLA 5T4YA 3KAEA 4ZFHA 1OUVA 3EU5A 3T8MA 2J4DA 3L13A 3CHQA 4UWGA 2KCLA 4U0ZA 4EBAG 4AY6A 3NOGD 2PM6A 1WAO1 4HLEA 1FT2A 3I4RB 5T3RA 3TWRA 3EIJA 2DCPA 3E33A 4F6RD 3SBTB 5HKPA 3TWSA 1TNYA 3SFXA 2KXPC 4YDWA 2WVIA 1ZU2A 4KXKB 4CDRA 2P9KG 4FU3A 3FEYA 1KZOA 1D9SA 2ONDA 1BU9A 1SW6A 4FJZA 4GMJA 2XEVA 4PH4B 1N0QA 3UIOC 1XGWA 2X38A 5A6CA 4GTSA 4JW1A 3S7JA 4ACKA 2QY7A 3ULEG 3CVXA 1AP7A 3FH5A 4JEUA 5CEAA 2IU1A 2P9PG 4ACLA 5B1BE 4KVOA 1RZ4A 2VSNA 4HOQA 4U95D 3Q47B 4AM9A 4ILGA 2FULA 4GAAA 4I1AA 4O1PA 3DSSA 1N94A 2JLBA 2YNQA 2R17C 1N54A 1FCHA 4Y6WA 3FP3A 4HXIA 2QYUA 1S0PA 1HU3A 4HFGA 3TWWA 3U9WA 4PUCA 3MJWA 3TAXA 3FTVA 5KWDA 3DSUA 5AJLA 3BG1B 4BSXA 3C3RA 4ILIA 4M7CA 5KJKA 3MKQB 4L2LA 2KM4A 3DSXA 3CHPA 4EZKA 5AQBA 2R05A 4JA7A 5IY5E 4K0RA 2VSOE 4C0MA 5FT9A 5FZSA 3DEPA 5G04C 3C3OA 1BLXB 1OXJA 4JVSA 4JHJA 1HH8A 3HHMA 3HXCA 2JABA 1MX6A 3B7RL 4BEPA 1FT1A 4U7EB 4LSZE 4JB8P 2WXGA 3SZ7A 2Y3AA 4BWRA 3CHMA 3FUDA 1TNBA 4HI8A 2XEHA 3PE3A 1N4SA 4TXRA 2I1JA 3PZ2A 3QWWA 2CFUA 3RO3A 3ZYKA 3ESKA 3FUKA 5C1DA 1MQSA 4IYPA 2R5SA 4PDXA 1OWLA 2DIWA 3CSTA 4DI3A 2WXQA 5ITZF 2R59A 3ZFWA 3FUEA 1B89A 3FDHA 3UINC 3I5PA 1S63A 4ILHB 4CDMA 4EZLA 3U4TA 3LPZA 3CK9A 4HI9A 3KSQA 2FBNA 4U07A 5ENSD 2HM8A 3AS5A 1TNZA 1BI7B 1WY6A 2Y69E 3C72A 1K8KG 3U3WA 3ZEFA 3QDNA 2MRIA 4I9EA 3CIAA 1PAQA 1S70B 2VQ2A 3GYZA 1TNOA 3CEQA 4U96D 4CYMD 4DK5A 4DX2A 4WAFA 4H7XA 5ENQD 1OT8A 4U0UA 5E76A 3UI2A 3DSWA 5ENOD 1OWMA 4LNUD 3UTMA 5JJ7A 1KPSB 2GRRB 4RG9A 2ZGDA 3AG4E 3KEAA 2H6IA 3RIBA 5EN5D 3D9IA 4CGVA 2B6CA 2XZDG 4LNGA 3B7BA 5A23A 2L6BA 3WXXA 2XPYA 1SZAA 4V3IA 3TXMA 4GPKA 3Q79A 3JXIA 4ATZD 5CEDB 2AWIA 3CVNA 3LEWA 4KYOB 3T9KA 2LXMA 2AXVA 2IO3C 4MKTA 4N5CA 4E85A 5HRYA 2B0OE 3DPDA 2WQ7A 1NFIE 3ENEA 1KT0A 2HR2A 4B8AA 3HVEA 2EINE 3UIPC 4YNDA 1WM5A 3BEEA 3HRAA 4KZ0A 2P2CP 4J7WA 2J07A 3D9JA 4CDNA 5LFAA 4ABNA 3HXBA 4HNAD 3EHRA 3JXJA 4DLQA 2L9BA 5ANRA 3LYAA 5EILA 3EHMA 4N39A 2P58C 2V8SE 2WQ6A 2Y4UA 2F8XK 4L9PA 4BY6A 2XS1A 2EQXA 2FEZA 3RKVA 3FTWA 3AAAC 3ZUVB 4U8YD 3I4GA 3W9GA 4FC8A 3ZVVA 5BUZA 5FTPA 5ARGA 2LUHA 2GGFA 3R7RA 2DZNA 5LCWJ 3IEGA 5EX3A 4RG6A 2Y1LE 3Q4AB 1D8EA 3RAUA 2RFMA 5T8IA 1NA3A 2GROB 2ETAA 2R02A 2OEWA 3LY8A 4I1MA 4GB9A 4AP2A 1XNFA 2MYOA 4U8VD 1LD8A 2KC7A 5FJYA 5KBAA 5G55A 4G11A 2H6FA 4NACA 4G24A 4HRLA 2WXLA 3ZW3A 5JJTA 3D9LA 3UQ3A 1U2VG 1O5MA 2XRYA 1W3BA 4GTTA 3G2VA 5EIBE 2C0LA 3G2UA 3AS8A 3UM2A 4G25A 3QKYA 2UY1B 3IBEA 4K5CA 4NURA 2RD0A 4LERA 3S2AA 2WB2A 2AXZA 3ZNGA 1EYHA 1MJ0A 5G05J 1S64A 1E7VA 3SF4A 1P5QA 3QWVA 3Q49B 3QC1A 4IULA 4CT4A 4FHKA 1SA5A 3RSEG 1U3CA 3G2TA 3DXKG 1Y8MA 3QB2A 4FHJA 1V55E 4Q69A 3C5RA 3SO8A 1YCSB 4L7TA 2IFUA 4DI4A 3NOCD 4HB5A 3FU6A 1O1RA 2DBAA 1N0RA 3J5PA 4AOFA 3SY2A 4EQFA 5D66A 4XE0A 2GRLA 4GTOA 3AU4A 4UI9J 3CHRA 4L23A 1PC2A 1OWPA 3PDNA 4J0UA 1HE8A 1TYQG 4F3VA 2H6HA 4WNGA 1TJFA 5BV0A 4Q96A 1E8ZA 2I6HA 4LCTA 4EHMA 1IHGA 3KEZA 1TJCA 4P29A 4GA2A 2DWZA 1YMPA 2V4LA 5CRUA 4LG6A 1E8YA 3EDTB 1JCRA 3LY7A 4JEHA 3D9HA 4HRMB 5CCLA 1OCCE 4GTRA 3ASHA 2QC9A 4RQIA 1LTXA 3UXGA 3CQCB 3JQ0A 2V4HC 1KT1A 4JXTA 2RKKA 4GZ5A 5LOZA 3QK0A 5BT1A 4LEUA 2XCCA 3FUMA 3Q9NC 4YDYA 3TWXA 3TL5A 1QBQA 1DCEA 4MS6A 5LP0A 2OCCE 3PUJA 3DXMG 4GTMA 1X5BA 3MX3A 3PZ1A 4FLHA 3MCXA 4LUNU 4AVXA 2DYSE 4UWLA 2CG2A 2BEDA 3EHQA 4OYSA 3Q78A 4ATGA 3VTXA 4GTVA 1O1TA 1N95A 2X6IA 5ENRD 3TG5A 2R2LA 5EYLA 2OEVA 4EBAA 1G3NB 4DLOA 2LNIA 5CHEE 5EIDA 4UUCA 3CK7A 5LX8A 3L82A 2C0MA 1U3DA 1PY1A 2HYZA 1OWNA 4DJAA 4G2VA 4U04A 3CLJA 4HQDA 4JC8A 3HXFA
chains in the Genus database with same CATH topology
2JABA 5AQ7A 1MX6A 3UI2A 3ZNGA 5ENOD 2V4HC 1AP7A 4LNUD 5AN8A 3UTMA 3AAAC 3ZUVB 4BEPA 5CECB 1MJ0A 2QYJA 4LSZE 4U8YD 2KBXA 3W9GA 3J5QB 4JB8P 4QFVA 4DX6D 5CEAA 3NBNB 5FIOA 4Z68A 2AJAA 4CZ2D 2ZGDA 4ZHBA 2ETCA 3KEAA 1SVXA 3Q9NC 5HS0A 4HLLA 4YDYA 1MX2A 2ETBA 3TWUA 5EN5D 1MX4A 4HI8A 3W9FA 4A63B 2XEHA 3TWXA 5CBOA 2DZNA 5AQ9A 3LJNA 4U95D 1K3ZD 3ZU7B 3TWQA 5KNHD 1WDYA 1YYHA 5CERB 2XZDG 3V2XA 3B7BA 3B95A 2L6BA 2RFAA 3C5RA 3SO8A 1YCSB 2HE0A 2J8SD 3NOCD 2Y1LE 3V30A 4DX2A 4F1PA 4ZFHA 4HB5A 2Y0BG 5ENQD 1K1BA 3IXEA 3JXIA 2F8YA 1N0RA 2RFMA 3EU9A 3J5PA 3F6QA 4C48B 4DUIA 3V79K 3TWTA 4O1PA 4DX1A 3TWVA 5CBNA 4ATZD 2A5EA 3JUEA 5CEDB 2FO1E 2ETAA 4BESA 4HBDA 5ITZF 2V5QC 4NIKA 4O60A 3EHQA 1K1AA 4N5QA 4G8LA 5D66A 5FINA 4BERA 1UOHA 3NOGD 4K5BA 2MYOA 4U8VD 3T9KA 4DRXE 2XEEA 4DX7D 4GMRA 4RLYA 3TWWA 3Q9UC 5HRYA 1IXVA 5ENTD 1QYMA 2B0OE 1TR4A 4GPMA 1NFIE 1N11A 2XENA 1WG0A 3DEOA 2DZOA 5JMND 5KBAA 4HI9A 4BETA 3T8KA 4TUMA 5ENRD 3TWRA 5KWDA 5AAOA 5ENSD 5EYLA 5EYPF 3ZKJA 1G3NB 4F6RD 4HRLA 1MYOA 1BI7B 2NYJA 5HKPA 5KNGA 3HRAA 5EIDA 4UUCA 3TWSA 1DCQA 2P2CP 2ZGGA 4J7WA 4OAUC 2VGEA 1DC2A 2KXPC 2DWZA 3AJIA 4DX5D 4K5AB 4YDWA 1YMPA 1BI8B 4HNAD 3EHRA 1IHBA 3JXJA 5AARA 4QQIA 4LG6A 5EIBE 5AQBA 4O1OA 3V2OA 4BSZB 5AQAA 2F37A 1S70B 3D9HA 4HRMB 5EILA 1D9SA 1BU9A 4B93B 1SW6A 3DEPA 4U96D 3V31A 4CYMD 2QC9A 4HQDA 2PNNA 1N0QA 1AWCB 4OAVB 2BKKB 4K5CA 1BLXB 1BD8A 5ENPD 2DVWA 4G8KA 5JA4D 1OY3D 2BKGA 3HG0D 1IKND 4HRNA 4J8YA 5BXOA 5BXUA 1A5EA 2XZTG 2F8XK 3UXGA 1OT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAB A;  5AQ7 A;  1MX6 A;  3UI2 A;  3ZNG A;  5ENO D;  2V4H C;  1AP7 A;  4LNU D;  5AN8 A;  3UTM A;  3AAA C;  3ZUV B;  4BEP A;  5CEC B;  1MJ0 A;  2QYJ A;  4LSZ E;  4U8Y D;  2KBX A;  3W9G A;  3J5Q B;  4JB8 P;  4QFV A;  4DX6 D;  5CEA A;  3NBN B;  5FIO A;  4Z68 A;  2AJA A;  4CZ2 D;  2ZGD A;  4ZHB A;  2ETC A;  3KEA A;  1SVX A;  3Q9N C;  5HS0 A;  4HLL A;  4YDY A;  1MX2 A;  2ETB A;  3TWU A;  5EN5 D;  1MX4 A;  4HI8 A;  3W9F A;  4A63 B;  2XEH A;  3TWX A;  5CBO A;  2DZN A;  5AQ9 A;  3LJN A;  4U95 D;  1K3Z D;  3ZU7 B;  3TWQ A;  5KNH D;  1WDY A;  1YYH A;  5CER B;  2XZD G;  3V2X A;  3B7B A;  3B95 A;  2L6B A;  2RFA A;  3C5R A;  3SO8 A;  1YCS B;  2HE0 A;  2J8S D;  3NOC D;  2Y1L E;  3V30 A;  4DX2 A;  4F1P A;  4ZFH A;  4HB5 A;  2Y0B G;  5ENQ D;  1K1B A;  3IXE A;  3JXI A;  2F8Y A;  1N0R A;  2RFM A;  3EU9 A;  3J5P A;  3F6Q A;  4C48 B;  4DUI A;  3V79 K;  3TWT A;  4O1P A;  4DX1 A;  3TWV A;  5CBN A;  4ATZ D;  2A5E A;  3JUE A;  5CED B;  2FO1 E;  2ETA A;  4BES A;  4HBD A;  5ITZ F;  2V5Q C;  4NIK A;  4O60 A;  3EHQ A;  1K1A A;  4N5Q A;  4G8L A;  5D66 A;  5FIN A;  4BER A;  1UOH A;  3NOG D;  4K5B A;  2MYO A;  4U8V D;  3T9K A;  4DRX E;  2XEE A;  4DX7 D;  4GMR A;  4RLY A;  3TWW A;  3Q9U C;  5HRY A;  1IXV A;  5ENT D;  1QYM A;  2B0O E;  1TR4 A;  4GPM A;  1NFI E;  1N11 A;  2XEN A;  1WG0 A;  3DEO A;  2DZO A;  5JMN D;  5KBA A;  4HI9 A;  4BET A;  3T8K A;  4TUM A;  5ENR D;  3TWR A;  5KWD A;  5AAO A;  5ENS D;  5EYL A;  5EYP F;  3ZKJ A;  1G3N B;  4F6R D;  4HRL A;  1MYO A;  1BI7 B;  2NYJ A;  5HKP A;  5KNG A;  3HRA A;  5EID A;  4UUC A;  3TWS A;  1DCQ A;  2P2C P;  2ZGG A;  4J7W A;  4OAU C;  2VGE A;  1DC2 A;  2KXP C;  2DWZ A;  3AJI A;  4DX5 D;  4K5A B;  4YDW A;  1YMP A;  1BI8 B;  4HNA D;  3EHR A;  1IHB A;  3JXJ A;  5AAR A;  4QQI A;  4LG6 A;  5EIB E;  5AQB A;  4O1O A;  3V2O A;  4BSZ B;  5AQA A;  2F37 A;  1S70 B;  3D9H A;  4HRM B;  5EIL A;  1D9S A;  1BU9 A;  4B93 B;  1SW6 A;  3DEP A;  4U96 D;  3V31 A;  4CYM D;  2QC9 A;  4HQD A;  2PNN A;  1N0Q A;  1AWC B;  4OAV B;  2BKK B;  4K5C A;  1BLX B;  1BD8 A;  5ENP D;  2DVW A;  4G8K A;  5JA4 D;  1OY3 D;  2BKG A;  3HG0 D;  1IKN D;  4HRN A;  4J8Y A;  5BXO A;  5BXU A;  1A5E A;  2XZT G;  2F8X K;  3UXG A;  1OT8 A; 
#chains in the Genus database with same CATH topology
 3LCA A;  5D2M C;  1OCO E;  2XPI A;  1UG3 A;  4QFV A;  3MEK A;  4FJY A;  5FIO A;  4I1O B;  4WND A;  3DSV A;  4GZ6 A;  2WMN A;  2WXF A;  4KBQ A;  2VSX E;  3ABL E;  4APO A;  1JUQ A;  3UT4 A;  4RVB A;  2WXI A;  3LJN A;  4I6J A;  3OXG A;  3SFZ A;  2ION A;  3UKR G;  1DNP A;  3ISM C;  5C2Y A;  4YVO A;  2L6J A;  4C48 B;  1N52 A;  1QZ2 A;  2FO1 E;  3URZ A;  5FQ6 A;  4NIK A;  4N3B A;  2J9Q A;  4O60 A;  2LAH A;  2YHE A;  3K9I A;  5BPP A;  4N2Q A;  1IQR A;  5G2N A;  3GZ2 A;  3R9A B;  4BTB A;  5KJM A;  4FLB A;  1VDY A;  2WXR A;  4GPM A;  3T5V A;  3CVQ A;  2J09 A;  3DEO A;  4L2Y A;  5AAO A;  3L08 A;  2WXP A;  4TUU A;  4UQZ A;  4GTP A;  4HOR A;  3FUN A;  2PL2 A;  4GCN A;  2XS8 A;  4EPZ A;  3PNT B;  4FP7 A;  2OVF A;  4BX9 A;  3UM3 A;  1DCQ A;  1E96 B;  1LD7 A;  3ASD A;  4XEI G;  2F0Y A;  4MLP A;  1IHB A;  3FTY A;  2IEJ A;  1MHQ A;  3V2O A;  3S7B A;  4IRU A;  3ZPJ A;  2E2E A;  3V31 A;  3IV0 A;  5HI7 A;  3CVW A;  5JA4 D;  3Q75 A;  3HG0 D;  3BQO A;  4FUL A;  5AQ7 A;  1UJK A;  3TJP A;  3RRN B;  3FTS A;  2OVB A;  2UWJ G;  5H7P A;  4I9C A;  5HS0 A;  3FWV A;  2XHE A;  1KLX A;  1ELW A;  4CEM A;  3BUA A;  3L9T A;  4TXQ A;  3NZS A;  1ZB1 A;  4F1P A;  1NI1 A;  1JPL A;  3NF1 A;  2F8Y A;  1HX8 A;  4UQX A;  3UM0 A;  3L17 A;  3JUE A;  4YDE A;  3RK6 A;  3ZYQ A;  2PM7 A;  1K1A A;  4GYW A;  2YIN A;  2XEE A;  3U66 A;  3HVE B;  2J4B A;  1Z3X A;  2IJG X;  3R7Q A;  2VTB A;  3MV2 B;  4F7A A;  1TN6 A;  3CVP A;  2ILR A;  3DWL G;  2NYJ A;  2IOL A;  2C2L A;  4OAU C;  5FQ8 A;  4OVV A;  4AV7 A;  1UJJ A;  4KZC A;  5G04 J;  4AY5 A;  4BTA A;  3FU5 A;  2F37 A;  4G26 A;  3ZHE A;  3P1U A;  3FH7 A;  3P2B A;  5DIZ A;  1EDU A;  4NQ0 A;  2ZIR A;  2Q7F A;  4EZJ A;  4J8Y A;  2KCK A;  3E34 A;  3CVU A;  1HZ4 A;  3FUF A;  2A5U A;  2QYJ A;  2KZT A;  4J8E A;  2L0I A;  4DX6 D;  5KJL A;  4J8D A;  4KVM A;  3DRA A;  1SVX A;  3RJV A;  4U63 A;  4A55 A;  1E90 A;  3NB2 A;  1MX2 A;  4PS8 A;  1H6K A;  2EIJ E;  5AQ9 A;  1D8D A;  2VSY A;  3PE4 A;  1K3Z D;  3ZU7 B;  1YYH A;  1L5J A;  2ZXW E;  1Y6I A;  1OCZ E;  4TXP A;  2NXP A;  1K1B A;  1Q2Z A;  4EEC A;  2VGX A;  3V79 K;  3PRE A;  3TWT A;  1O1S A;  3ZGQ A;  3PEV B;  3PUK A;  4HOU A;  4WWO A;  4BER A;  4K5B A;  4G23 A;  2BUG A;  3KD7 A;  3EUV A;  4B8C B;  1IXV A;  1TR4 A;  1N11 A;  5ENN A;  4JA9 A;  2A4Z A;  2CG3 A;  4JD2 G;  4BFR A;  2JEK A;  3O48 A;  2WXK A;  2OV8 A;  2ZGG A;  1BI8 B;  1H19 A;  4I43 A;  4I2W A;  4L1B A;  2X3M A;  4U8H A;  4CGW A;  4JZY A;  3FTU A;  4B93 B;  3FUH A;  1FPP A;  2CHW A;  2CHX A;  3E37 A;  1BD8 A;  3LJ3 A;  3ABK E;  3PS6 A;  3QAQ A;  3SGH A;  3MZL B;  4WWN A;  4WNE A;  2GRP B;  2XGM A;  3HXE A;  3LKU A;  1V54 E;  4BT9 A;  2WXN A;  3TWU A;  4XKC A;  3RRU A;  3TG4 A;  5AEN A;  3PVL A;  3SI5 A;  3B95 A;  2HE0 A;  1INZ A;  3PEU B;  2P9I G;  3APF A;  3D9P A;  2CHZ A;  2YHC A;  4W9R A;  3UUX A;  4GML A;  4DUI A;  1HG2 A;  4UQY A;  2PQR A;  3CKB A;  5JJ6 A;  3I3N A;  3FH8 A;  1KZP A;  3ZXS A;  1UOH A;  1EF1 C;  5J08 A;  4GMR A;  3PZ3 A;  2WXJ A;  5BW8 C;  1ELK A;  1QYM A;  1YA0 A;  1TEZ A;  2DZO A;  4J8F A;  4TUM A;  3B13 A;  2M63 A;  3JCK C;  4XZ4 A;  4B0Z A;  3BG0 B;  2VGE A;  3AJI A;  3AG1 E;  2IOS A;  3CR3 A;  2XGO A;  3LY9 A;  4BSZ B;  2P9N G;  3CVL A;  3LVQ E;  3OAW A;  3ESL A;  2IY0 C;  4KT6 B;  3RRM B;  1AWC B;  3CKC A;  4J8S A;  2DVW A;  4YDO A;  4LRZ A;  4JHR A;  1UN8 A;  3E4B A;  2KAT A;  5FQ4 A;  5CEC B;  2VGY A;  4CT0 A;  2PQN A;  4I17 A;  3PZ4 A;  4A3V A;  2RG8 A;  2LSU A;  5CBO A;  3MKR A;  5KNH D;  4N3A A;  2YQ8 A;  3V2X A;  2PZI A;  1SQM A;  5KCM A;  4GYO A;  3RO2 A;  3FY4 A;  3HDX A;  1IYG A;  4TV3 A;  4FAD A;  4WUY A;  2I9C A;  4C9B B;  1H2U A;  3QJZ A;  2V5Q C;  3QAR A;  3PRZ A;  4LNB A;  1BPO A;  3AU5 A;  3FHE A;  2QFC A;  4NRH B;  4DRX E;  4RLY A;  4B94 A;  4XIF A;  1N4Q A;  2BF0 X;  4F53 A;  3CV0 A;  1FVF A;  3G2W A;  3D9M A;  3L54 A;  1SA4 A;  4GA0 A;  2DYR E;  3ZKJ A;  4CRW A;  4DPR A;  5KNG A;  3CVY A;  4XI9 A;  3UT7 A;  4TRQ A;  3B7T A;  4DX5 D;  4K5A B;  3OXF A;  3D9K A;  2I1K A;  4O1O A;  3UPV A;  4A3T A;  3VLE A;  3CSF A;  5CRV A;  3TXN A;  3ULQ A;  1H0A A;  4PS3 A;  2BKK B;  3E30 A;  2GRQ B;  3Q15 A;  5FZR A;  1TN7 A;  2QZA A;  3D9O A;  5M72 A;  3C98 A;  4Z68 A;  3APC A;  3L22 A;  3TGO A;  1X81 A;  3KS2 A;  1MX4 A;  1DVP A;  4D10 C;  5CER B;  3B7U X;  3CHO A;  3ZYL A;  3EIQ C;  1ELR A;  2RFA A;  5ARF A;  1N4P A;  3SFY A;  2J8S D;  3SD5 A;  2P9U G;  1E7U A;  3GZ1 A;  3QNK A;  3NAW A;  2LSV A;  3IXE A;  5JHA A;  4B89 A;  5CBN A;  4AJW A;  4N5Q A;  3ASO E;  1JCQ A;  3ABM E;  3CQG B;  2GRM A;  5AYW D;  4ANW A;  1UW4 B;  2XEN A;  3GW4 A;  4RSY A;  3G2S A;  3T8K A;  2NSZ A;  5EYP F;  3O4Z A;  5AIJ A;  3IHV A;  3UKU G;  4GZD A;  2FO7 A;  4HOS A;  3AS4 A;  3MKQ A;  3LXU X;  3ULY A;  2V5F A;  3X2Q E;  3D9N A;  2AW6 A;  2VJ8 A;  3HYM B;  3MV3 B;  2GRN B;  2BKG A;  4HRN A;  4HS2 A;  3PZD A;  2XZT G;  4I6G A;  1Z3Y A;  2KBX A;  3SQV A;  3NBN B;  2WPV A;  4GTQ A;  3CHS A;  4I6E A;  4J6I A;  2GW1 A;  4HLL A;  2ETB A;  3VLD A;  3FTX A;  1NL4 A;  4UI9 K;  3QWP A;  3NZU A;  1HS6 A;  3ASN E;  4C0E A;  3E32 A;  1A17 A;  4PS7 A;  4X8Q A;  4N3C A;  4ANV A;  4ANX A;  1NP7 A;  3DST A;  5LCW C;  5JHB A;  4E6H A;  3UX4 A;  3JYS A;  5KJN A;  4H7Y A;  4HBD A;  3S7F A;  5A7D B;  2XCB A;  3LDZ A;  4G8L A;  5FIN A;  3ZN3 A;  4DX7 D;  3ONK A;  4A1G A;  3ZRH A;  5ENT D;  2VTB B;  3NQP A;  5JMN D;  4I2Z A;  4AEZ C;  4A1S A;  1ZBP A;  5BNW A;  3FUI A;  4URK A;  4WWP A;  4AIF A;  3FUL A;  4GYY A;  3CK8 A;  4YVQ C;  3ZHE B;  1HXI A;  3OXL A;  4MRU A;  3L6A A;  2EIK E;  2CFZ A;  2LO6 A;  4GCO A;  3ZYM A;  3MA5 A;  1TNU A;  5B3S E;  5EDS A;  1OY3 D;  1IKN D;  5BXO A;  3ZIM A;  4AXH A;  2KZT B;  2WM9 A;  2H6G A;  4BT8 A;  4U0S A;  5EX0 A;  2XRZ A;  3FTZ A;  3PNL B;  4XX5 A;  1JWG A;  5HQ8 A;  3S7D A;  2P9S G;  2AJA A;  4K03 A;  4FA6 A;  2ETC A;  5DBK A;  3RU0 A;  3ML9 A;  1H2T C;  3FEX A;  3VTY A;  3W9F A;  2J08 A;  2WXM A;  3Q5M A;  5G05 C;  5CMY A;  3FU0 A;  3TWQ A;  2FI7 A;  1HG5 A;  3JQ1 A;  2WMO A;  5ANL A;  3V30 A;  2VGX B;  2R03 A;  3ML8 A;  1UN9 A;  1MZC A;  3ASF A;  1JCS A;  3TWV A;  2A5E A;  5CCM A;  4BES A;  1HFA A;  2NC9 A;  1OWO A;  1H2V C;  3FUJ A;  1HF8 A;  4Q94 A;  1E8W A;  3HIZ A;  3UM1 A;  3L16 A;  3OTN A;  4F1S A;  3MYV A;  2XGS A;  1WG0 A;  2OOE A;  4ME2 A;  1QQE A;  2HO1 A;  1Z5S C;  3KSL A;  4UI9 C;  2EIL E;  3APD A;  4GU5 A;  4G1T A;  2EIM E;  3HXD A;  5AJD A;  3Q7A A;  1H6O A;  4APF A;  4XKB A;  4R7L A;  4GZC A;  2AVP A;  3ASG A;  3FFL A;  5FZQ A;  4QQI A;  3U64 A;  3R9M A;  2AXU A;  2KCV A;  2WXO A;  3WG7 E;  1NZN A;  4Y6C A;  2PNN A;  4OAV B;  5B1A E;  1Z6T A;  5EKQ D;  5ENP D;  2J49 A;  4G8K A;  5E75 A;  5BXU A;  1A5E A;  3Q73 A;  3EHN A;  3JUI A;  2L0T B;  1TN8 A;  5J90 A;  3CVV A;  4ANU A;  3SBS A;  4HOT A;  3SNX A;  4CZ2 D;  4GZ3 A;  2FF4 A;  3MGB A;  2Y4T A;  1HO8 A;  1SZ9 A;  4JL0 A;  4O6F A;  4A63 B;  4OVU A;  4CCA A;  1NA0 A;  4HVB A;  2LAI A;  2I2O A;  4UWF A;  4JPS A;  2XPZ A;  3C3Q A;  3DBS A;  4UWK A;  2Y0B G;  2BTD A;  1LF8 A;  1N9A A;  3EU9 A;  4MBG A;  3F6Q A;  4DX1 A;  1QNF A;  3AG3 E;  4XI0 A;  2ZU6 B;  3FU3 A;  4N2S A;  3Q9U C;  3B7S A;  4BET A;  3SHF A;  2X6J A;  2IO2 C;  3LVR E;  2X6H A;  2XQ0 A;  2VYI A;  1MYO A;  3BU8 A;  3EJN A;  2WXH A;  3GZS A;  5BV1 A;  2ZIS A;  3IHY A;  1E8X A;  2WQH A;  1DC2 A;  1RW2 A;  2MOW A;  3IKO B;  5AAR A;  2IQC A;  4UWH A;  5AQA A;  2X6F A;  3AG2 E;  3CGH A;  2P9L G;  1IQU A;  3ZXP A;  5D0O D;  5CMW A;  1OCR E;  3N71 A;  3QOU A;  1EPU A;  5D0Q D;  3VLF A;  3LS8 A;  2V0P A;  4M3O A;  2UY1 A;  2IF4 A;  3Q7F A;  5FWQ A;  4KMO A;  1GW6 A;  2E0I A;  5FQ7 A;  5AN8 A;  1JWF A;  4GA1 A;  3UT8 A;  3T5X A;  3J5Q B;  1FVH A;  3D3M A;  1H6P A;  4JHK A;  4ZHB A;  1N4R A;  2MHK A;  3UMV A;  1WDY A;  4WNF A;  4BX8 A;  3ONL A;  3DPY A;  4IN3 B;  2X6K A;  3PH0 C;  2LXL A;  5T4Y A;  3KAE A;  4ZFH A;  1OUV A;  3EU5 A;  3T8M A;  2J4D A;  3L13 A;  3CHQ A;  4UWG A;  2KCL A;  4U0Z A;  4EBA G;  4AY6 A;  3NOG D;  2PM6 A;  1WAO 1;  4HLE A;  1FT2 A;  3I4R B;  5T3R A;  3TWR A;  3EIJ A;  2DCP A;  3E33 A;  4F6R D;  3SBT B;  5HKP A;  3TWS A;  1TNY A;  3SFX A;  2KXP C;  4YDW A;  2WVI A;  1ZU2 A;  4KXK B;  4CDR A;  2P9K G;  4FU3 A;  3FEY A;  1KZO A;  1D9S A;  2OND A;  1BU9 A;  1SW6 A;  4FJZ A;  4GMJ A;  2XEV A;  4PH4 B;  1N0Q A;  3UIO C;  1XGW A;  2X38 A;  5A6C A;  4GTS A;  4JW1 A;  3S7J A;  4ACK A;  2QY7 A;  3ULE G;  3CVX A;  1AP7 A;  3FH5 A;  4JEU A;  5CEA A;  2IU1 A;  2P9P G;  4ACL A;  5B1B E;  4KVO A;  1RZ4 A;  2VSN A;  4HOQ A;  4U95 D;  3Q47 B;  4AM9 A;  4ILG A;  2FUL A;  4GAA A;  4I1A A;  4O1P A;  3DSS A;  1N94 A;  2JLB A;  2YNQ A;  2R17 C;  1N54 A;  1FCH A;  4Y6W A;  3FP3 A;  4HXI A;  2QYU A;  1S0P A;  1HU3 A;  4HFG A;  3TWW A;  3U9W A;  4PUC A;  3MJW A;  3TAX A;  3FTV A;  5KWD A;  3DSU A;  5AJL A;  3BG1 B;  4BSX A;  3C3R A;  4ILI A;  4M7C A;  5KJK A;  3MKQ B;  4L2L A;  2KM4 A;  3DSX A;  3CHP A;  4EZK A;  5AQB A;  2R05 A;  4JA7 A;  5IY5 E;  4K0R A;  2VSO E;  4C0M A;  5FT9 A;  5FZS A;  3DEP A;  5G04 C;  3C3O A;  1BLX B;  1OXJ A;  4JVS A;  4JHJ A;  1HH8 A;  3HHM A;  3HXC A;  2JAB A;  1MX6 A;  3B7R L;  4BEP A;  1FT1 A;  4U7E B;  4LSZ E;  4JB8 P;  2WXG A;  3SZ7 A;  2Y3A A;  4BWR A;  3CHM A;  3FUD A;  1TNB A;  4HI8 A;  2XEH A;  3PE3 A;  1N4S A;  4TXR A;  2I1J A;  3PZ2 A;  3QWW A;  2CFU A;  3RO3 A;  3ZYK A;  3ESK A;  3FUK A;  5C1D A;  1MQS A;  4IYP A;  2R5S A;  4PDX A;  1OWL A;  2DIW A;  3CST A;  4DI3 A;  2WXQ A;  5ITZ F;  2R59 A;  3ZFW A;  3FUE A;  1B89 A;  3FDH A;  3UIN C;  3I5P A;  1S63 A;  4ILH B;  4CDM A;  4EZL A;  3U4T A;  3LPZ A;  3CK9 A;  4HI9 A;  3KSQ A;  2FBN A;  4U07 A;  5ENS D;  2HM8 A;  3AS5 A;  1TNZ A;  1BI7 B;  1WY6 A;  2Y69 E;  3C72 A;  1K8K G;  3U3W A;  3ZEF A;  3QDN A;  2MRI A;  4I9E A;  3CIA A;  1PAQ A;  1S70 B;  2VQ2 A;  3GYZ A;  1TNO A;  3CEQ A;  4U96 D;  4CYM D;  4DK5 A;  4DX2 A;  4WAF A;  4H7X A;  5ENQ D;  1OT8 A;  4U0U A;  5E76 A;  3UI2 A;  3DSW A;  5ENO D;  1OWM A;  4LNU D;  3UTM A;  5JJ7 A;  1KPS B;  2GRR B;  4RG9 A;  2ZGD A;  3AG4 E;  3KEA A;  2H6I A;  3RIB A;  5EN5 D;  3D9I A;  4CGV A;  2B6C A;  2XZD G;  4LNG A;  3B7B A;  5A23 A;  2L6B A;  3WXX A;  2XPY A;  1SZA A;  4V3I A;  3TXM A;  4GPK A;  3Q79 A;  3JXI A;  4ATZ D;  5CED B;  2AWI A;  3CVN A;  3LEW A;  4KYO B;  3T9K A;  2LXM A;  2AXV A;  2IO3 C;  4MKT A;  4N5C A;  4E85 A;  5HRY A;  2B0O E;  3DPD A;  2WQ7 A;  1NFI E;  3ENE A;  1KT0 A;  2HR2 A;  4B8A A;  3HVE A;  2EIN E;  3UIP C;  4YND A;  1WM5 A;  3BEE A;  3HRA A;  4KZ0 A;  2P2C P;  4J7W A;  2J07 A;  3D9J A;  4CDN A;  5LFA A;  4ABN A;  3HXB A;  4HNA D;  3EHR A;  3JXJ A;  4DLQ A;  2L9B A;  5ANR A;  3LYA A;  5EIL A;  3EHM A;  4N39 A;  2P58 C;  2V8S E;  2WQ6 A;  2Y4U A;  2F8X K;  4L9P A;  4BY6 A;  2XS1 A;  2EQX A;  2FEZ A;  3RKV A;  3FTW A;  3AAA C;  3ZUV B;  4U8Y D;  3I4G A;  3W9G A;  4FC8 A;  3ZVV A;  5BUZ A;  5FTP A;  5ARG A;  2LUH A;  2GGF A;  3R7R A;  2DZN A;  5LCW J;  3IEG A;  5EX3 A;  4RG6 A;  2Y1L E;  3Q4A B;  1D8E A;  3RAU A;  2RFM A;  5T8I A;  1NA3 A;  2GRO B;  2ETA A;  2R02 A;  2OEW A;  3LY8 A;  4I1M A;  4GB9 A;  4AP2 A;  1XNF A;  2MYO A;  4U8V D;  1LD8 A;  2KC7 A;  5FJY A;  5KBA A;  5G55 A;  4G11 A;  2H6F A;  4NAC A;  4G24 A;  4HRL A;  2WXL A;  3ZW3 A;  5JJT A;  3D9L A;  3UQ3 A;  1U2V G;  1O5M A;  2XRY A;  1W3B A;  4GTT A;  3G2V A;  5EIB E;  2C0L A;  3G2U A;  3AS8 A;  3UM2 A;  4G25 A;  3QKY A;  2UY1 B;  3IBE A;  4K5C A;  4NUR A;  2RD0 A;  4LER A;  3S2A A;  2WB2 A;  2AXZ A;  3ZNG A;  1EYH A;  1MJ0 A;  5G05 J;  1S64 A;  1E7V A;  3SF4 A;  1P5Q A;  3QWV A;  3Q49 B;  3QC1 A;  4IUL A;  4CT4 A;  4FHK A;  1SA5 A;  3RSE G;  1U3C A;  3G2T A;  3DXK G;  1Y8M A;  3QB2 A;  4FHJ A;  1V55 E;  4Q69 A;  3C5R A;  3SO8 A;  1YCS B;  4L7T A;  2IFU A;  4DI4 A;  3NOC D;  4HB5 A;  3FU6 A;  1O1R A;  2DBA A;  1N0R A;  3J5P A;  4AOF A;  3SY2 A;  4EQF A;  5D66 A;  4XE0 A;  2GRL A;  4GTO A;  3AU4 A;  4UI9 J;  3CHR A;  4L23 A;  1PC2 A;  1OWP A;  3PDN A;  4J0U A;  1HE8 A;  1TYQ G;  4F3V A;  2H6H A;  4WNG A;  1TJF A;  5BV0 A;  4Q96 A;  1E8Z A;  2I6H A;  4LCT A;  4EHM A;  1IHG A;  3KEZ A;  1TJC A;  4P29 A;  4GA2 A;  2DWZ A;  1YMP A;  2V4L A;  5CRU A;  4LG6 A;  1E8Y A;  3EDT B;  1JCR A;  3LY7 A;  4JEH A;  3D9H A;  4HRM B;  5CCL A;  1OCC E;  4GTR A;  3ASH A;  2QC9 A;  4RQI A;  1LTX A;  3UXG A;  3CQC B;  3JQ0 A;  2V4H C;  1KT1 A;  4JXT A;  2RKK A;  4GZ5 A;  5LOZ A;  3QK0 A;  5BT1 A;  4LEU A;  2XCC A;  3FUM A;  3Q9N C;  4YDY A;  3TWX A;  3TL5 A;  1QBQ A;  1DCE A;  4MS6 A;  5LP0 A;  2OCC E;  3PUJ A;  3DXM G;  4GTM A;  1X5B A;  3MX3 A;  3PZ1 A;  4FLH A;  3MCX A;  4LUN U;  4AVX A;  2DYS E;  4UWL A;  2CG2 A;  2BED A;  3EHQ A;  4OYS A;  3Q78 A;  4ATG A;  3VTX A;  4GTV A;  1O1T A;  1N95 A;  2X6I A;  5ENR D;  3TG5 A;  2R2L A;  5EYL A;  2OEV A;  4EBA A;  1G3N B;  4DLO A;  2LNI A;  5CHE E;  5EID A;  4UUC A;  3CK7 A;  5LX8 A;  3L82 A;  2C0M A;  1U3D A;  1PY1 A;  2HYZ A;  1OWN A;  4DJA A;  4G2V A;  4U04 A;  3CLJ A;  4HQD A;  4JC8 A;  3HXF A; 
#chains in the Genus database with same CATH homology
 2JAB A;  5AQ7 A;  1MX6 A;  3UI2 A;  3ZNG A;  5ENO D;  2V4H C;  1AP7 A;  4LNU D;  5AN8 A;  3UTM A;  3AAA C;  3ZUV B;  4BEP A;  5CEC B;  1MJ0 A;  2QYJ A;  4LSZ E;  4U8Y D;  2KBX A;  3W9G A;  3J5Q B;  4JB8 P;  4QFV A;  4DX6 D;  5CEA A;  3NBN B;  5FIO A;  4Z68 A;  2AJA A;  4CZ2 D;  2ZGD A;  4ZHB A;  2ETC A;  3KEA A;  1SVX A;  3Q9N C;  5HS0 A;  4HLL A;  4YDY A;  1MX2 A;  2ETB A;  3TWU A;  5EN5 D;  1MX4 A;  4HI8 A;  3W9F A;  4A63 B;  2XEH A;  3TWX A;  5CBO A;  2DZN A;  5AQ9 A;  3LJN A;  4U95 D;  1K3Z D;  3ZU7 B;  3TWQ A;  5KNH D;  1WDY A;  1YYH A;  5CER B;  2XZD G;  3V2X A;  3B7B A;  3B95 A;  2L6B A;  2RFA A;  3C5R A;  3SO8 A;  1YCS B;  2HE0 A;  2J8S D;  3NOC D;  2Y1L E;  3V30 A;  4DX2 A;  4F1P A;  4ZFH A;  4HB5 A;  2Y0B G;  5ENQ D;  1K1B A;  3IXE A;  3JXI A;  2F8Y A;  1N0R A;  2RFM A;  3EU9 A;  3J5P A;  3F6Q A;  4C48 B;  4DUI A;  3V79 K;  3TWT A;  4O1P A;  4DX1 A;  3TWV A;  5CBN A;  4ATZ D;  2A5E A;  3JUE A;  5CED B;  2FO1 E;  2ETA A;  4BES A;  4HBD A;  5ITZ F;  2V5Q C;  4NIK A;  4O60 A;  3EHQ A;  1K1A A;  4N5Q A;  4G8L A;  5D66 A;  5FIN A;  4BER A;  1UOH A;  3NOG D;  4K5B A;  2MYO A;  4U8V D;  3T9K A;  4DRX E;  2XEE A;  4DX7 D;  4GMR A;  4RLY A;  3TWW A;  3Q9U C;  5HRY A;  1IXV A;  5ENT D;  1QYM A;  2B0O E;  1TR4 A;  4GPM A;  1NFI E;  1N11 A;  2XEN A;  1WG0 A;  3DEO A;  2DZO A;  5JMN D;  5KBA A;  4HI9 A;  4BET A;  3T8K A;  4TUM A;  5ENR D;  3TWR A;  5KWD A;  5AAO A;  5ENS D;  5EYL A;  5EYP F;  3ZKJ A;  1G3N B;  4F6R D;  4HRL A;  1MYO A;  1BI7 B;  2NYJ A;  5HKP A;  5KNG A;  3HRA A;  5EID A;  4UUC A;  3TWS A;  1DCQ A;  2P2C P;  2ZGG A;  4J7W A;  4OAU C;  2VGE A;  1DC2 A;  2KXP C;  2DWZ A;  3AJI A;  4DX5 D;  4K5A B;  4YDW A;  1YMP A;  1BI8 B;  4HNA D;  3EHR A;  1IHB A;  3JXJ A;  5AAR A;  4QQI A;  4LG6 A;  5EIB E;  5AQB A;  4O1O A;  3V2O A;  4BSZ B;  5AQA A;  2F37 A;  1S70 B;  3D9H A;  4HRM B;  5EIL A;  1D9S A;  1BU9 A;  4B93 B;  1SW6 A;  3DEP A;  4U96 D;  3V31 A;  4CYM D;  2QC9 A;  4HQD A;  2PNN A;  1N0Q A;  1AWC B;  4OAV B;  2BKK B;  4K5C A;  1BLX B;  1BD8 A;  5ENP D;  2DVW A;  4G8K A;  5JA4 D;  1OY3 D;  2BKG A;  3HG0 D;  1IKN D;  4HRN A;  4J8Y A;  5BXO A;  5BXU A;  1A5E A;  2XZT G;  2F8X K;  3UXG A;  1OT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...