5FINA

Darpins as a new tool for experimental phasing in protein crystallography
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
SDLGRKLLEAARAGQDDECRILMANGADVNAADNTGTTPLHLAAYSGHLEIVECLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Darpins as a New Tool for Experimental Phasing in Protein Crystallography
rcsb
source organism Synthetic construct
molecule tags Metal binding protein
molecule keywords NI3C DARPIN MUTANT5 HG-SITE N1
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5finA00
4DUIA 5EN5D 1BU9A 1UOHA 3D9HA 5FINA 3TWXA 4BERA 5CERB 1K1AA 1OT8A 2F8YA 5ENTD 5AQ7A 2XEEA 4U8YD 1MX6A 4G8LA 4HRMB 5ENQD 2ETAA 5ENRD 3JXIA 4ZHBA 5JMND 2A5EA 3F6QA 3KEAA 5CEDB 5AARA 5AQBA 3W9GA 5CECB 4OAUC 2F8XK 1N0QA 2Y0BG 3Q9UC 1K1BA 4NIKA 1BI7B 3IXEA 1N11A 1YYHA 3DEOA 3ZU7B 2HE0A 4HQDA 3V2OA 1DCQA 4TUMA 5EYLA 1YCSB 2ETCA 4ATZD 2B0OE 4BEPA 1QYMA 5BXUA 4O60A 4BETA 4G8KA 1A5EA 4QFVA 2QC9A 1MX2A 4O1OA 2ZGGA 2ZGDA 2Y1LE 4YDWA 4Z68A 1WG0A 4C48B 2F37A 3JUEA 4GMRA 3HRAA 4QQIA 4JB8P 2V5QC 3HG0D 3TWTA 5AAOA 1K3ZD 5HKPA 5CBOA 2XENA 3TWVA 1MX4A 5ENPD 1AP7A 4GPMA 3EHRA 1WDYA 4K5CA 4DX6D 3SO8A 1BLXB 4F1PA 4U95D 5D66A 3V31A 4F6RD 5BXOA 3B7BA 4LNUD 4B93B 4U96D 2DZOA 5FIOA 3J5PA 4K5BA 5HRYA 3V30A 3EU9A 4HB5A 4DX1A 2P2CP 2PNNA 1TR4A 3J5QB 2BKGA 4UUCA 4RLYA 2QYJA 4O1PA 3B95A 2DVWA 1BI8B 1BD8A 3T8KA 4BSZB 3TWWA 4CZ2D 4HRLA 4DX5D 5ENSD 1DC2A 4J7WA 3V79K 1S70B 3UTMA 1D9SA 2DZNA 1SW6A 4LG6A 5JA4D 2JABA 4N5QA 5ENOD 5AQAA 2J8SD 4DX2A 5KNGA 2KXPC 3JXJA 1SVXA 5EILA 3TWQA 2XEHA 4DRXE 4CYMD 2XZTG 5EIBE 2DWZA 3LJNA 5KWDA 3ZNGA 5AQ9A 3UI2A 4A63B 1IXVA 2ETBA 3TWRA 4HBDA 5CBNA 3TWUA 1YMPA 4HRNA 3ZUVB 1IKND 4DX7D 4J8YA 2KBXA 3DEPA 2FO1E 3NBNB 4U8VD 4HLLA 1G3NB 2RFMA 5EIDA 4ZFHA 2XZDG 4HI9A 2MYOA 4OAVB 3NOGD 1OY3D 2RFAA 3NOCD 1IHBA 2AJAA 4LSZE 4YDYA 5ITZF 3W9FA 3AJIA 2NYJA 3T9KA 3ZKJA 5EYPF 3C5RA 1NFIE 5KBAA 2V4HC 4K5AB 3V2XA 4HNAD 2BKKB 2L6BA 4BESA 4HI8A 2VGEA 5CEAA 3EHQA 3Q9NC 3UXGA 3TWSA 1AWCB 1N0RA 1MJ0A 5KNHD 5AN8A 5HS0A 1MYOA 3AAAC
chains in the Genus database with same CATH superfamily
2J9QA 5ENTD 5ENRD 4WUYA 3U9WA 2HE0A 4HQDA 5AYWD 4GZCA 2GW1A 1DCQA 3HXCA 3RU0A 2PQRA 3AS4A 1A5EA 3RIBA 1V54E 4I1MA 4YDWA 2WXMA 4C48B 5KJLA 1EDUA 2I1KA 4XIFA 1MX4A 3E37A 3CK7A 2J08A 3SI5A 1P5QA 3RJVA 3CSFA 2EINE 1E8ZA 2HYZA 3V31A 1H19A 1OCOE 4HB5A 1TN8A 3VLFA 2L9BA 3Q73A 4WNFA 1A17A 5EIBE 2OCCE 2M63A 2FULA 3QKYA 1U3CA 3CHQA 5FT9A 3Q7FA 3U64A 2LAHA 1H6PA 4D10C 3HVEA 4A3TA 4U8VD 4KVMA 1D8EA 2WVIA 5FQ7A 4RVBA 1IHGA 3RK6A 3ASGA 3W9FA 4GTPA 4Y6CA 1LTXA 5D2MC 3QOUA 3FULA 5FQ4A 4BESA 4HI8A 5B3SE 3ASNE 3QNKA 3EU5A 3TWSA 3IEGA 3E33A 2CG2A 3O4ZA 4FHKA 4ACKA 2OVBA 2IJGX 5A23A 4CDNA 1HXIA 1TN7A 1E7VA 5AARA 3TL5A 4GYOA 3Q15A 2WXHA 3ZU7B 1QZ2A 2B0OE 2BEDA 4BEPA 2WQHA 1ZB1A 4I6EA 3ZYQA 2ZGGA 4KZCA 4Z68A 3ASFA 3ZFWA 3FFLA 4JD2G 5T3RA 2VTBB 3DPDA 4GTSA 2MRIA 2I2OA 1K3ZD 3I5PA 5BXOA 1PAQA 2FEZA 4U63A 3ONLA 4DX1A 2YHCA 3BU8A 3BG0B 3G2UA 4J0UA 3PVLA 2X6IA 5B1AE 4G26A 4N5QA 5J08A 4HOQA 3TWUA 4J8YA 3NBNB 4WAFA 2RFMA 2WM9A 3LYAA 2XGOA 3UMVA 3NAWA 4TUUA 4KYOB 3C5RA 3C72A 2LSVA 4ILIA 4M3OA 3PZ1A 4PUCA 5CHEE 5T8IA 3EHQA 4O6FA 5J90A 3HYMB 2CFZA 1UOHA 2X38A 2XEEA 3ULYA 5ENQD 4I17A 4BSXA 4RQIA 1ELRA 1HF8A 1NA3A 4JW1A 2AW6A 1TNUA 2DBAA 3IXEA 1O1SA 3V2OA 3ENEA 2VTBA 5ANLA 3D9NA 3AS8A 1YCSB 5C1DA 3FTXA 2GRPB 2HR2A 3MV2B 3G2VA 1OWLA 4DK5A 3CVVA 2YNQA 1X5BA 3I3NA 1FCHA 2WXJA 2P9KG 1OUVA 4UWLA 3EIJA 3ZXPA 4JHKA 3OTNA 4HLEA 3APCA 4I6GA 4H7XA 1SQMA 4CGWA 4BY6A 1BD8A 3MA5A 4DX5D 5ENSD 2WXQA 4BX9A 3V79K 3UTMA 1QBQA 1U2VG 2J49A 3DRAA 4YDEA 2C2LA 4BTBA 5EX0A 4AVXA 3PH0C 4HRNA 3SBTB 2VYIA 3ZIMA 3MGBA 4TXQA 5C2YA 4YDYA 2X6JA 4CT4A 5G04J 2Y3AA 3GW4A 2P9LG 3D3MA 4UQYA 3MKRA 4N2QA 3UINC 4M7CA 3HVEB 4BERA 4U8YD 3FUEA 2P9SG 2VSOE 1Y8MA 1LD7A 2BTDA 4FP7A 1O1RA 2F8XK 3G2SA 4JA7A 2LUHA 4RSYA 4DLOA 5M72A 4JPSA 4ATZD 4GZ3A 5BXUA 2VSYA 4JHJA 3UIOC 4I6JA 3NQPA 4LNGA 4EHMA 4GMRA 3ZYKA 1UJJA 4GYWA 4K0RA 5FQ6A 4UI9K 5ENPD 3RAUA 4GCOA 3ULEG 5G04C 4U96D 3S7DA 3LS8A 1E90A 2PNNA 4L2YA 1E8YA 1O5MA 4UWGA 2XRYA 4FC8A 5BNWA 4CZ2D 4ABNA 4FADA 2DZNA 4LG6A 5EILA 2DWZA 3PZ2A 3Q78A 3CHOA 1RZ4A 3DSSA 4MBGA 4HBDA 1N95A 2DCPA 4GTOA 5LCWJ 3QWWA 5EIDA 4GCNA 4LSZE 5ARGA 3PNLB 2AXVA 1DNPA 3MCXA 3DPYA 4U8HA 4GPKA 4HNAD 2XEVA 3UXGA 4G11A 3RRMB 3KS2A 3HXDA 2F8YA 4I9EA 2ZIRA 2DIWA 3QDNA 5JMND 3LXUX 5CCLA 1H2UA 3CKCA 2ZXWE 2DYSE 1W3BA 1H6OA 3LPZA 4L2LA 4GAAA 4WWOA 3RRUA 1V55E 4B8CB 1O1TA 3IHVA 3PE4A 4AY6A 4L9PA 1GW6A 1H2VC 4V3IA 3B7TA 1WG0A 1Z6TA 2WMOA 3SF4A 1AP7A 3QAQA 2IY0C 4EZLA 4J6IA 3QK0A 3UKRG 3BUAA 4B93B 3BQOA 4K5BA 3UM0A 3VLDA 4E6HA 4WNEA 3CVPA 3VTXA 3UUXA 4J7WA 1D9SA 1SW6A 1UW4B 4CGVA 4UWFA 2XEHA 4JZYA 1SZAA 1ZU2A 3N71A 3RO2A 1SZ9A 4GTRA 3AJIA 3UT8A 3OXFA 3G2WA 3CK9A 2I6HA 3ABME 5A6CA 2KCVA 5JHBA 1MYOA 2HM8A 4FJYA 1BU9A 3D9HA 1HG2A 2ILRA 2VSNA 1MX6A 4G8LA 4HRMB 5DBKA 5IY5E 5CEDB 3UM1A 5LOZA 2CFUA 1EF1C 3DEOA 2XCBA 3FP3A 3FUNA 4N3AA 2YQ8A 3RO3A 4IYPA 3B7UX 4NURA 4TXPA 4QFVA 4AOFA 2FO7A 2X3MA 3IBEA 5FZRA 3UIPC 2E2EA 4G23A 2DYRE 5ANRA 4IULA 3D9MA 3TWVA 2XHEA 1N4QA 3AG1E 3CVUA 3Q79A 2R59A 2J09A 4LNUD 5CMWA 4JXTA 2IOLA 4APFA 4UUCA 4RLYA 3LEWA 3B95A 1HU3A 3T8KA 4PS8A 3PE3A 1DC2A 4LRZA 3MKQB 3FTYA 2CHXA 2V5FA 4EPZA 4FA6A 1MHQA 2KBXA 5BV1A 1JWGA 2OVFA 2MYOA 1OCZE 4U0UA 4BX8A 3HXFA 5CCMA 4N5CA 1MZCA 4GMLA 4XKBA 3FUDA 4Y6WA 3LVRE 5G55A 1OT8A 3APDA 2FI7A 3U4TA 4RG9A 4MKTA 1WM5A 3ZYMA 3FU6A 3P1UA 3Q75A 5AQBA 4EQFA 4DJAA 3Q9UC 2ONDA 3MJWA 1HE8A 2IU1A 4GTVA 2P9NG 4AY5A 2WB2A 2XGMA 2NXPA 3CV0A 2L6JA 4FU3A 4JEHA 4KXKB 3Q47B 3NZSA 3ASHA 5AAOA 5HKPA 2KCKA 4FULA 3TG4A 1WDYA 3TJPA 3SO8A 2E0IA 1WAO1 3EDTB 3ZRHA 3CVXA 4AEZC 3L17A 1BPOA 3J5PA 5AENA 4MLPA 1ELKA 3L22A 5HI7A 5JJ7A 4O1PA 2AXZA 4OVUA 4DX2A 2KXPC 3CSTA 3FU3A 4CYMD 2VJ8A 3DSUA 5BW8C 4X8QA 1NI1A 3UI2A 2C0MA 2V4LA 2IQCA 4DI3A 3PZ3A 1G3NB 4J8DA 5G2NA 4WWNA 3U3WA 3ESLA 2PM6A 1E8WA 3HXEA 2LO6A 4N3BA 4CDRA 2IEJA 5HS0A 3RSEG 3AAAC 5FWQA 5FINA 3OXLA 5ARFA 3SQVA 5AQ7A 4L7TA 3HIZA 2X6HA 2J4BA 2XPYA 3W9GA 1K1BA 3FY4A 3FU0A 4XKCA 2FF4A 3D9OA 5CRVA 5LCWC 2ETCA 3R7RA 3GZSA 1IQRA 4I1AA 4G8KA 3QC1A 3MX3A 4HS2A 2VGYA 3TWTA 3DXKG 4IN3B 4B89A 1S63A 3X2QE 1IQUA 3SY2A 1NL4A 4GTMA 4GMJA 3PUJA 3ZHEB 1MQSA 3CHSA 2PL2A 4L23A 2MHKA 3RRNB 1SA4A 4FJZA 2DVWA 4BT9A 4GYYA 3PNTB 3TWWA 1OCCE 3HDXA 1S70B 1KT1A 4GZDA 3CGHA 4ANXA 4UI9C 2LSUA 1SVXA 1B89A 1KPSB 1HO8A 1IXVA 2VGXA 4PDXA 1IKND 1UN9A 2LXLA 1FVHA 4U0SA 1IHBA 2AJAA 3G2TA 3E32A 4RG6A 1X81A 4YVQC 3MKQA 5KBAA 2H6IA 4KT6B 4AIFA 4UWHA 3I4RB 5LFAA 1JWFA 3S7BA 1AWCB 5EN5D 3TWXA 3B13A 2PQNA 2WXGA 4TXRA 2P9UG 5CECB 1TJFA 3TXNA 3ML9A 3O48A 2LNIA 5JJTA 3Q7AA 1N9AA 4O1OA 4JEUA 3FTUA 3BG1B 3MEKA 3FWVA 3Q4AB 5EX3A 4U95D 5KJMA 5HRYA 4AM9A 2BKGA 4EZKA 2WXNA 3LY7A 5G05C 5D0QD 3PEVB 3URZA 4JA9A 2NC9A 2BUGA 5ENOD 2VSXE 1E8XA 2A5UA 2LAIA 3SD5A 3LJNA 4OYSA 2OOEA 4EECA 4HOSA 2FBNA 2I1JA 1NA0A 5LX8A 4G24A 3ZKJA 2V4HC 3CVYA 3EHMA 4I43A 2BKKB 2J4DA 2AXUA 3S2AA 4WWPA 1TYQG 4GTQA 5ENNA 4I9CA 3FH8A 4ZHBA 2L0IA 3CLJA 2WQ6A 4XZ4A 2X6FA 3DSXA 4XI0A 2Y0BG 2WMNA 1INZA 5A7DB 2WXOA 4TUMA 1FT2A 3NF1A 5BT1A 4ANVA 3AG4E 4GA0A 1XNFA 4WNGA 3JUIA 4BFRA 2V5QC 3HG0D 1U3DA 4J8FA 5FTPA 4WNDA 4GPMA 3ESKA 4GZ6A 1BLXB 4F1PA 2Y4UA 2YINA 4BWRA 3FTZA 3L13A 4EBAG 2QYJA 3ML8A 3FUHA 3CEQA 4HRLA 1NZNA 3SGHA 2IO3C 3ISMC 5KNGA 3K9IA 3TWQA 1Y6IA 4LCTA 3JQ0A 3PEUB 4XI9A 4KVOA 1JCRA 2QYUA 3FHEA 2HO1A 4AXHA 1OWPA 3VTYA 3GZ1A 4NQ0A 5AIJA 3Q49B 4CRWA 3ZVVA 2OV8A 2H6HA 3D9IA 4OVVA 5FJYA 3Q5MA 4IRUA 5FZQA 3TGOA 2IF4A 2WXKA 2XRZA 3ZGQA 1ELWA 1KLXA 4N3CA 3S7FA 2KZTB 2BF0X 2R03A 1BI7B 2P58C 4Q69A 5EYLA 3QARA 4FLBA 3AS5A 4G25A 2XQ0A 1DCEA 5CRUA 1TNZA 3T5XA 2ZGDA 2GRLA 2Y1LE 3LDZA 4G1TA 1D8DA 3HRAA 4UQXA 3LY9A 1N4RA 4ANUA 3EHRA 1N52A 4AJWA 5D66A 3R9AB 4F6RD 3E4BA 4A3VA 4YDOA 2P2CP 3DSWA 2V0PA 1ZBPA 3QWPA 4BSZB 3C98A 4PS7A 1KT0A 5JA4D 2J8SD 4F1SA 3PS6A 3DXMG 1JCQA 3CKBA 1YMPA 2EIKE 4DX7D 4HXIA 2FO1E 3UKUG 2CHZA 1PY1A 3FUMA 2XZDG 4I2ZA 3OAWA 5HQ8A 4DPRA 2RG8A 5BPPA 2I9CA 3SNXA 1Z5SC 3UT7A 4I2WA 1NFIE 3E34A 5KJKA 3V2XA 1OWNA 4HOTA 2EQXA 2IFUA 4UQZA 3ZPJA 3D9KA 3ULQA 3QB2A 3CQCB 2V8SE 5CERB 4ME2A 4C0EA 3UPVA 2ETAA 3QWVA 2J07A 3KEAA 3FTVA 1TJCA 3DSTA 1YYHA 3BEEA 5EKQD 4U07A 3ONKA 4CDMA 5KJNA 4ACLA 4EZJA 2F0YA 3SZ7A 3T8MA 5EDSA 5KCMA 3GYZA 3UM3A 3FDHA 2F37A 2IOSA 2KM4A 1HFAA 3L08A 3L82A 2RD0A 2OEVA 4DX6D 4JL0A 5BUZA 5FIOA 3SFYA 5T4YA 5CMYA 1VDYA 2A4ZA 3D9LA 1JCSA 4A1SA 2CHWA 4U04A 2QY7A 5AQAA 1KZOA 4DRXE 4ATGA 4EBAA 3JYSA 3FUFA 2X6KA 5B1BE 1OXJA 1FT1A 4A55A 2NSZA 4LUNU 4NRHB 3T9KA 3KAEA 3L9TA 2XPZA 2GRQB 2L6BA 3AU5A 1Q2ZA 3Q9NC 2VGXB 1K8KG 4XEIG 3SBSA 3C3QA 4DUIA 1FVFA 4CEMA 5JJ6A 4U0ZA 3JXIA 3FEXA 4OAUC 1N0QA 3EHNA 1TNBA 3B7RL 2R2LA 4NIKA 3PZ4A 3R9MA 1TN6A 3CHMA 3TAXA 2GGFA 2KCLA 2Y4TA 3APFA 2WPVA 4BTAA 3ZN3A 2QC9A 1LD8A 2GRRB 3CVNA 3S7JA 2KATA 5E76A 4QQIA 3JQ1A 1WY6A 2XENA 2PM7A 5JHAA 4K5CA 4MS6A 1IYGA 4P29A 4A1GA 3UX4A 4ILHB 5BV0A 3V30A 4FHJA 2XS8A 2IONA 2GRNB 2EIJE 1L5JA 2MOWA 4N39A 3FUIA 4URKA 1N94A 3QJZA 3L16A 4B94A 2RKKA 3EUVA 5FZSA 5AQ9A 1JUQA 2ZU6B 1QNFA 4DI4A 3ZUVB 2KC7A 3NZUA 5AJDA 1HX8A 4W9RA 4OAVB 1HG5A 1OY3D 3NOCD 3EIQC 3E30A 2WQ7A 3PUKA 5ITZF 1QQEA 1N4PA 4GB9A 4G2VA 2QFCA 5EYPF 2WXIA 1JPLA 1TNYA 3PZDA 3LCAA 4HOUA 1EPUA 1EYHA 5CEAA 2VGEA 5AJLA 3FU5A 4LERA 4XX5A 1HS6A 3CHPA 1Z3XA 2A5EA 3F6QA 1S0PA 3FTWA 3JCKC 4Q96A 3HXBA 1H6KA 1OWOA 2H6FA 3UT4A 2XCCA 3TG5A 3I4GA 3KD7A 2Y69E 2P9IG 4GZ5A 4C9BB 2JEKA 1S64A 3ZXSA 1UJKA 3L6AA 3FTSA 2R05A 4H7YA 5D0OD 3JUEA 4TRQA 3MV3B 3PREA 4R7LA 3ZEFA 4B0ZA 2AWIA 4BT8A 3KSQA 3ABLE 3B7BA 3EU9A 3P2BA 4N2SA 3J5QB 4JHRA 4UI9J 1H0AA 3FH5A 3AU4A 2XPIA 1BI8B 3SHFA 3NB2A 3ASOE 2CG3A 2JABA 3B7SA 2OEWA 4U7EB 3ZNGA 3D9PA 3T5VA 1TEZA 2ETBA 3IV0A 4UWKA 2R5SA 2EILE 3IKOB 4HI9A 3ZW3A 4K03A 4GTTA 2RFAA 2UY1A 5H7PA 1KZPA 4TV3A 4YVOA 2VQ2A 2GRMA 3CVWA 3ABKE 1NP7A 4JVSA 1MJ0A 1SA5A 4YNDA 3CHRA 3AG2E 1E96B 3CR3A 3LKUA 3L54A 2UWJG 1H2TC 3D9JA 1OCRE 2LXMA 1PC2A 2H6GA 3KEZA 4GA1A 4GA2A 2R02A 3HHMA 1QYMA 3UM2A 3MYVA 4BETA 2XS1A 4LEUA 1FPPA 2PZIA 4Q94A 4GU5A 2EIME 3ZHEA 3ZYLA 2WXLA 2ZISA 3KSLA 2KZTA 4J8EA 1UN8A 4FLHA 3VLEA 1OWMA 1UG3A 2YHEA 2WXRA 4B8AA 4CCAA 3C3RA 2C0LA 2JLBA 4MRUA 3CVLA 5LP0A 4PH4B 3FEYA 3MZLB 3UQ3A 4LNBA 2WXFA 4F53A 3LVQE 5KWDA 3EJNA 3CVQA 5FQ8A 3R7QA 4AP2A 3TWRA 1HH8A 5CBNA 3DEPA 3CQGB 2B6CA 4HLLA 2Q7FA 2QZAA 5DIZA 3FUKA 1E7UA 4E85A 4L1BA 2XGSA 4K5AB 3DBSA 3ASDA 3CK8A 2UY1B 5KNHD 4F7AA 4C0MA 1TNOA 5AN8A 4J8SA 3U66A 3IHYA 1K1AA 1Z3YA 3SFZA 3AG3E 1N11A 4PS3A 5G05J 2GROB 1N4SA 4O60A 5E75A 1MX2A 2R17C 4ILGA 4DLQA 3RKVA 3CIAA 4JB8P 3C3OA 5CBOA 1HZ4A 4XE0A 3DSVA 3LJ3A 4I1OB 3TXMA 2DZOA 4AV7A 1TR4A 3DWLG 3SFXA 3WXXA 4F3VA 2IO2C 4ANWA 4KZ0A 1YA0A 2P9PG 4APOA 3PDNA 1XGWA 3JXJA 2WXPA 4NACA 2XZTG 3PRZA 4KMOA 4A63B 3FH7A 3GZ2A 4HORA 3WG7E 4ZFHA 3OXGA 1RW2A 3NOGD 3LY8A 4CT0A 2NYJA 1DVPA 4HVBA 2L0TB 4KBQA 3FUJA 2AVPA 1N54A 4JC8A 1N0RA 4HFGA 1LF8A
chains in the Genus database with same CATH topology
4DUIA 5EN5D 1BU9A 1UOHA 3D9HA 5FINA 3TWXA 4BERA 5CERB 1K1AA 1OT8A 2F8YA 5ENTD 5AQ7A 2XEEA 4U8YD 1MX6A 4G8LA 4HRMB 5ENQD 2ETAA 5ENRD 3JXIA 4ZHBA 5JMND 2A5EA 3F6QA 3KEAA 5CEDB 5AARA 5AQBA 3W9GA 5CECB 4OAUC 2F8XK 1N0QA 2Y0BG 3Q9UC 1K1BA 4NIKA 1BI7B 3IXEA 1N11A 1YYHA 3DEOA 3ZU7B 2HE0A 4HQDA 3V2OA 1DCQA 4TUMA 5EYLA 1YCSB 2ETCA 4ATZD 2B0OE 4BEPA 1QYMA 5BXUA 4O60A 4BETA 4G8KA 1A5EA 4QFVA 2QC9A 1MX2A 4O1OA 2ZGGA 2ZGDA 2Y1LE 4YDWA 4Z68A 1WG0A 4C48B 2F37A 3JUEA 4GMRA 3HRAA 4QQIA 4JB8P 2V5QC 3HG0D 3TWTA 5AAOA 1K3ZD 5HKPA 5CBOA 2XENA 3TWVA 1MX4A 5ENPD 1AP7A 4GPMA 3EHRA 1WDYA 4K5CA 4DX6D 3SO8A 1BLXB 4F1PA 4U95D 5D66A 3V31A 4F6RD 5BXOA 3B7BA 4LNUD 4B93B 4U96D 2DZOA 5FIOA 3J5PA 4K5BA 5HRYA 3V30A 3EU9A 4HB5A 4DX1A 2P2CP 2PNNA 1TR4A 3J5QB 2BKGA 4UUCA 4RLYA 2QYJA 4O1PA 3B95A 2DVWA 1BI8B 1BD8A 3T8KA 4BSZB 3TWWA 4CZ2D 4HRLA 4DX5D 5ENSD 1DC2A 4J7WA 3V79K 1S70B 3UTMA 1D9SA 2DZNA 1SW6A 4LG6A 5JA4D 2JABA 4N5QA 5ENOD 5AQAA 2J8SD 4DX2A 5KNGA 2KXPC 3JXJA 1SVXA 5EILA 3TWQA 2XEHA 4DRXE 4CYMD 2XZTG 5EIBE 2DWZA 3LJNA 5KWDA 3ZNGA 5AQ9A 3UI2A 4A63B 1IXVA 2ETBA 3TWRA 4HBDA 5CBNA 3TWUA 1YMPA 4HRNA 3ZUVB 1IKND 4DX7D 4J8YA 2KBXA 3DEPA 2FO1E 3NBNB 4U8VD 4HLLA 1G3NB 2RFMA 5EIDA 4ZFHA 2XZDG 4HI9A 2MYOA 4OAVB 3NOGD 1OY3D 2RFAA 3NOCD 1IHBA 2AJAA 4LSZE 4YDYA 5ITZF 3W9FA 3AJIA 2NYJA 3T9KA 3ZKJA 5EYPF 3C5RA 1NFIE 5KBAA 2V4HC 4K5AB 3V2XA 4HNAD 2BKKB 2L6BA 4BESA 4HI8A 2VGEA 5CEAA 3EHQA 3Q9NC 3UXGA 3TWSA 1AWCB 1N0RA 1MJ0A 5KNHD 5AN8A 5HS0A 1MYOA 3AAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUI A;  5EN5 D;  1BU9 A;  1UOH A;  3D9H A;  5FIN A;  3TWX A;  4BER A;  5CER B;  1K1A A;  1OT8 A;  2F8Y A;  5ENT D;  5AQ7 A;  2XEE A;  4U8Y D;  1MX6 A;  4G8L A;  4HRM B;  5ENQ D;  2ETA A;  5ENR D;  3JXI A;  4ZHB A;  5JMN D;  2A5E A;  3F6Q A;  3KEA A;  5CED B;  5AAR A;  5AQB A;  3W9G A;  5CEC B;  4OAU C;  2F8X K;  1N0Q A;  2Y0B G;  3Q9U C;  1K1B A;  4NIK A;  1BI7 B;  3IXE A;  1N11 A;  1YYH A;  3DEO A;  3ZU7 B;  2HE0 A;  4HQD A;  3V2O A;  1DCQ A;  4TUM A;  5EYL A;  1YCS B;  2ETC A;  4ATZ D;  2B0O E;  4BEP A;  1QYM A;  5BXU A;  4O60 A;  4BET A;  4G8K A;  1A5E A;  4QFV A;  2QC9 A;  1MX2 A;  4O1O A;  2ZGG A;  2ZGD A;  2Y1L E;  4YDW A;  4Z68 A;  1WG0 A;  4C48 B;  2F37 A;  3JUE A;  4GMR A;  3HRA A;  4QQI A;  4JB8 P;  2V5Q C;  3HG0 D;  3TWT A;  5AAO A;  1K3Z D;  5HKP A;  5CBO A;  2XEN A;  3TWV A;  1MX4 A;  5ENP D;  1AP7 A;  4GPM A;  3EHR A;  1WDY A;  4K5C A;  4DX6 D;  3SO8 A;  1BLX B;  4F1P A;  4U95 D;  5D66 A;  3V31 A;  4F6R D;  5BXO A;  3B7B A;  4LNU D;  4B93 B;  4U96 D;  2DZO A;  5FIO A;  3J5P A;  4K5B A;  5HRY A;  3V30 A;  3EU9 A;  4HB5 A;  4DX1 A;  2P2C P;  2PNN A;  1TR4 A;  3J5Q B;  2BKG A;  4UUC A;  4RLY A;  2QYJ A;  4O1P A;  3B95 A;  2DVW A;  1BI8 B;  1BD8 A;  3T8K A;  4BSZ B;  3TWW A;  4CZ2 D;  4HRL A;  4DX5 D;  5ENS D;  1DC2 A;  4J7W A;  3V79 K;  1S70 B;  3UTM A;  1D9S A;  2DZN A;  1SW6 A;  4LG6 A;  5JA4 D;  2JAB A;  4N5Q A;  5ENO D;  5AQA A;  2J8S D;  4DX2 A;  5KNG A;  2KXP C;  3JXJ A;  1SVX A;  5EIL A;  3TWQ A;  2XEH A;  4DRX E;  4CYM D;  2XZT G;  5EIB E;  2DWZ A;  3LJN A;  5KWD A;  3ZNG A;  5AQ9 A;  3UI2 A;  4A63 B;  1IXV A;  2ETB A;  3TWR A;  4HBD A;  5CBN A;  3TWU A;  1YMP A;  4HRN A;  3ZUV B;  1IKN D;  4DX7 D;  4J8Y A;  2KBX A;  3DEP A;  2FO1 E;  3NBN B;  4U8V D;  4HLL A;  1G3N B;  2RFM A;  5EID A;  4ZFH A;  2XZD G;  4HI9 A;  2MYO A;  4OAV B;  3NOG D;  1OY3 D;  2RFA A;  3NOC D;  1IHB A;  2AJA A;  4LSZ E;  4YDY A;  5ITZ F;  3W9F A;  3AJI A;  2NYJ A;  3T9K A;  3ZKJ A;  5EYP F;  3C5R A;  1NFI E;  5KBA A;  2V4H C;  4K5A B;  3V2X A;  4HNA D;  2BKK B;  2L6B A;  4BES A;  4HI8 A;  2VGE A;  5CEA A;  3EHQ A;  3Q9N C;  3UXG A;  3TWS A;  1AWC B;  1N0R A;  1MJ0 A;  5KNH D;  5AN8 A;  5HS0 A;  1MYO A;  3AAA C; 
#chains in the Genus database with same CATH topology
 2J9Q A;  5ENT D;  5ENR D;  4WUY A;  3U9W A;  2HE0 A;  4HQD A;  5AYW D;  4GZC A;  2GW1 A;  1DCQ A;  3HXC A;  3RU0 A;  2PQR A;  3AS4 A;  1A5E A;  3RIB A;  1V54 E;  4I1M A;  4YDW A;  2WXM A;  4C48 B;  5KJL A;  1EDU A;  2I1K A;  4XIF A;  1MX4 A;  3E37 A;  3CK7 A;  2J08 A;  3SI5 A;  1P5Q A;  3RJV A;  3CSF A;  2EIN E;  1E8Z A;  2HYZ A;  3V31 A;  1H19 A;  1OCO E;  4HB5 A;  1TN8 A;  3VLF A;  2L9B A;  3Q73 A;  4WNF A;  1A17 A;  5EIB E;  2OCC E;  2M63 A;  2FUL A;  3QKY A;  1U3C A;  3CHQ A;  5FT9 A;  3Q7F A;  3U64 A;  2LAH A;  1H6P A;  4D10 C;  3HVE A;  4A3T A;  4U8V D;  4KVM A;  1D8E A;  2WVI A;  5FQ7 A;  4RVB A;  1IHG A;  3RK6 A;  3ASG A;  3W9F A;  4GTP A;  4Y6C A;  1LTX A;  5D2M C;  3QOU A;  3FUL A;  5FQ4 A;  4BES A;  4HI8 A;  5B3S E;  3ASN E;  3QNK A;  3EU5 A;  3TWS A;  3IEG A;  3E33 A;  2CG2 A;  3O4Z A;  4FHK A;  4ACK A;  2OVB A;  2IJG X;  5A23 A;  4CDN A;  1HXI A;  1TN7 A;  1E7V A;  5AAR A;  3TL5 A;  4GYO A;  3Q15 A;  2WXH A;  3ZU7 B;  1QZ2 A;  2B0O E;  2BED A;  4BEP A;  2WQH A;  1ZB1 A;  4I6E A;  3ZYQ A;  2ZGG A;  4KZC A;  4Z68 A;  3ASF A;  3ZFW A;  3FFL A;  4JD2 G;  5T3R A;  2VTB B;  3DPD A;  4GTS A;  2MRI A;  2I2O A;  1K3Z D;  3I5P A;  5BXO A;  1PAQ A;  2FEZ A;  4U63 A;  3ONL A;  4DX1 A;  2YHC A;  3BU8 A;  3BG0 B;  3G2U A;  4J0U A;  3PVL A;  2X6I A;  5B1A E;  4G26 A;  4N5Q A;  5J08 A;  4HOQ A;  3TWU A;  4J8Y A;  3NBN B;  4WAF A;  2RFM A;  2WM9 A;  3LYA A;  2XGO A;  3UMV A;  3NAW A;  4TUU A;  4KYO B;  3C5R A;  3C72 A;  2LSV A;  4ILI A;  4M3O A;  3PZ1 A;  4PUC A;  5CHE E;  5T8I A;  3EHQ A;  4O6F A;  5J90 A;  3HYM B;  2CFZ A;  1UOH A;  2X38 A;  2XEE A;  3ULY A;  5ENQ D;  4I17 A;  4BSX A;  4RQI A;  1ELR A;  1HF8 A;  1NA3 A;  4JW1 A;  2AW6 A;  1TNU A;  2DBA A;  3IXE A;  1O1S A;  3V2O A;  3ENE A;  2VTB A;  5ANL A;  3D9N A;  3AS8 A;  1YCS B;  5C1D A;  3FTX A;  2GRP B;  2HR2 A;  3MV2 B;  3G2V A;  1OWL A;  4DK5 A;  3CVV A;  2YNQ A;  1X5B A;  3I3N A;  1FCH A;  2WXJ A;  2P9K G;  1OUV A;  4UWL A;  3EIJ A;  3ZXP A;  4JHK A;  3OTN A;  4HLE A;  3APC A;  4I6G A;  4H7X A;  1SQM A;  4CGW A;  4BY6 A;  1BD8 A;  3MA5 A;  4DX5 D;  5ENS D;  2WXQ A;  4BX9 A;  3V79 K;  3UTM A;  1QBQ A;  1U2V G;  2J49 A;  3DRA A;  4YDE A;  2C2L A;  4BTB A;  5EX0 A;  4AVX A;  3PH0 C;  4HRN A;  3SBT B;  2VYI A;  3ZIM A;  3MGB A;  4TXQ A;  5C2Y A;  4YDY A;  2X6J A;  4CT4 A;  5G04 J;  2Y3A A;  3GW4 A;  2P9L G;  3D3M A;  4UQY A;  3MKR A;  4N2Q A;  3UIN C;  4M7C A;  3HVE B;  4BER A;  4U8Y D;  3FUE A;  2P9S G;  2VSO E;  1Y8M A;  1LD7 A;  2BTD A;  4FP7 A;  1O1R A;  2F8X K;  3G2S A;  4JA7 A;  2LUH A;  4RSY A;  4DLO A;  5M72 A;  4JPS A;  4ATZ D;  4GZ3 A;  5BXU A;  2VSY A;  4JHJ A;  3UIO C;  4I6J A;  3NQP A;  4LNG A;  4EHM A;  4GMR A;  3ZYK A;  1UJJ A;  4GYW A;  4K0R A;  5FQ6 A;  4UI9 K;  5ENP D;  3RAU A;  4GCO A;  3ULE G;  5G04 C;  4U96 D;  3S7D A;  3LS8 A;  1E90 A;  2PNN A;  4L2Y A;  1E8Y A;  1O5M A;  4UWG A;  2XRY A;  4FC8 A;  5BNW A;  4CZ2 D;  4ABN A;  4FAD A;  2DZN A;  4LG6 A;  5EIL A;  2DWZ A;  3PZ2 A;  3Q78 A;  3CHO A;  1RZ4 A;  3DSS A;  4MBG A;  4HBD A;  1N95 A;  2DCP A;  4GTO A;  5LCW J;  3QWW A;  5EID A;  4GCN A;  4LSZ E;  5ARG A;  3PNL B;  2AXV A;  1DNP A;  3MCX A;  3DPY A;  4U8H A;  4GPK A;  4HNA D;  2XEV A;  3UXG A;  4G11 A;  3RRM B;  3KS2 A;  3HXD A;  2F8Y A;  4I9E A;  2ZIR A;  2DIW A;  3QDN A;  5JMN D;  3LXU X;  5CCL A;  1H2U A;  3CKC A;  2ZXW E;  2DYS E;  1W3B A;  1H6O A;  3LPZ A;  4L2L A;  4GAA A;  4WWO A;  3RRU A;  1V55 E;  4B8C B;  1O1T A;  3IHV A;  3PE4 A;  4AY6 A;  4L9P A;  1GW6 A;  1H2V C;  4V3I A;  3B7T A;  1WG0 A;  1Z6T A;  2WMO A;  3SF4 A;  1AP7 A;  3QAQ A;  2IY0 C;  4EZL A;  4J6I A;  3QK0 A;  3UKR G;  3BUA A;  4B93 B;  3BQO A;  4K5B A;  3UM0 A;  3VLD A;  4E6H A;  4WNE A;  3CVP A;  3VTX A;  3UUX A;  4J7W A;  1D9S A;  1SW6 A;  1UW4 B;  4CGV A;  4UWF A;  2XEH A;  4JZY A;  1SZA A;  1ZU2 A;  3N71 A;  3RO2 A;  1SZ9 A;  4GTR A;  3AJI A;  3UT8 A;  3OXF A;  3G2W A;  3CK9 A;  2I6H A;  3ABM E;  5A6C A;  2KCV A;  5JHB A;  1MYO A;  2HM8 A;  4FJY A;  1BU9 A;  3D9H A;  1HG2 A;  2ILR A;  2VSN A;  1MX6 A;  4G8L A;  4HRM B;  5DBK A;  5IY5 E;  5CED B;  3UM1 A;  5LOZ A;  2CFU A;  1EF1 C;  3DEO A;  2XCB A;  3FP3 A;  3FUN A;  4N3A A;  2YQ8 A;  3RO3 A;  4IYP A;  3B7U X;  4NUR A;  4TXP A;  4QFV A;  4AOF A;  2FO7 A;  2X3M A;  3IBE A;  5FZR A;  3UIP C;  2E2E A;  4G23 A;  2DYR E;  5ANR A;  4IUL A;  3D9M A;  3TWV A;  2XHE A;  1N4Q A;  3AG1 E;  3CVU A;  3Q79 A;  2R59 A;  2J09 A;  4LNU D;  5CMW A;  4JXT A;  2IOL A;  4APF A;  4UUC A;  4RLY A;  3LEW A;  3B95 A;  1HU3 A;  3T8K A;  4PS8 A;  3PE3 A;  1DC2 A;  4LRZ A;  3MKQ B;  3FTY A;  2CHX A;  2V5F A;  4EPZ A;  4FA6 A;  1MHQ A;  2KBX A;  5BV1 A;  1JWG A;  2OVF A;  2MYO A;  1OCZ E;  4U0U A;  4BX8 A;  3HXF A;  5CCM A;  4N5C A;  1MZC A;  4GML A;  4XKB A;  3FUD A;  4Y6W A;  3LVR E;  5G55 A;  1OT8 A;  3APD A;  2FI7 A;  3U4T A;  4RG9 A;  4MKT A;  1WM5 A;  3ZYM A;  3FU6 A;  3P1U A;  3Q75 A;  5AQB A;  4EQF A;  4DJA A;  3Q9U C;  2OND A;  3MJW A;  1HE8 A;  2IU1 A;  4GTV A;  2P9N G;  4AY5 A;  2WB2 A;  2XGM A;  2NXP A;  3CV0 A;  2L6J A;  4FU3 A;  4JEH A;  4KXK B;  3Q47 B;  3NZS A;  3ASH A;  5AAO A;  5HKP A;  2KCK A;  4FUL A;  3TG4 A;  1WDY A;  3TJP A;  3SO8 A;  2E0I A;  1WAO 1;  3EDT B;  3ZRH A;  3CVX A;  4AEZ C;  3L17 A;  1BPO A;  3J5P A;  5AEN A;  4MLP A;  1ELK A;  3L22 A;  5HI7 A;  5JJ7 A;  4O1P A;  2AXZ A;  4OVU A;  4DX2 A;  2KXP C;  3CST A;  3FU3 A;  4CYM D;  2VJ8 A;  3DSU A;  5BW8 C;  4X8Q A;  1NI1 A;  3UI2 A;  2C0M A;  2V4L A;  2IQC A;  4DI3 A;  3PZ3 A;  1G3N B;  4J8D A;  5G2N A;  4WWN A;  3U3W A;  3ESL A;  2PM6 A;  1E8W A;  3HXE A;  2LO6 A;  4N3B A;  4CDR A;  2IEJ A;  5HS0 A;  3RSE G;  3AAA C;  5FWQ A;  5FIN A;  3OXL A;  5ARF A;  3SQV A;  5AQ7 A;  4L7T A;  3HIZ A;  2X6H A;  2J4B A;  2XPY A;  3W9G A;  1K1B A;  3FY4 A;  3FU0 A;  4XKC A;  2FF4 A;  3D9O A;  5CRV A;  5LCW C;  2ETC A;  3R7R A;  3GZS A;  1IQR A;  4I1A A;  4G8K A;  3QC1 A;  3MX3 A;  4HS2 A;  2VGY A;  3TWT A;  3DXK G;  4IN3 B;  4B89 A;  1S63 A;  3X2Q E;  1IQU A;  3SY2 A;  1NL4 A;  4GTM A;  4GMJ A;  3PUJ A;  3ZHE B;  1MQS A;  3CHS A;  2PL2 A;  4L23 A;  2MHK A;  3RRN B;  1SA4 A;  4FJZ A;  2DVW A;  4BT9 A;  4GYY A;  3PNT B;  3TWW A;  1OCC E;  3HDX A;  1S70 B;  1KT1 A;  4GZD A;  3CGH A;  4ANX A;  4UI9 C;  2LSU A;  1SVX A;  1B89 A;  1KPS B;  1HO8 A;  1IXV A;  2VGX A;  4PDX A;  1IKN D;  1UN9 A;  2LXL A;  1FVH A;  4U0S A;  1IHB A;  2AJA A;  3G2T A;  3E32 A;  4RG6 A;  1X81 A;  4YVQ C;  3MKQ A;  5KBA A;  2H6I A;  4KT6 B;  4AIF A;  4UWH A;  3I4R B;  5LFA A;  1JWF A;  3S7B A;  1AWC B;  5EN5 D;  3TWX A;  3B13 A;  2PQN A;  2WXG A;  4TXR A;  2P9U G;  5CEC B;  1TJF A;  3TXN A;  3ML9 A;  3O48 A;  2LNI A;  5JJT A;  3Q7A A;  1N9A A;  4O1O A;  4JEU A;  3FTU A;  3BG1 B;  3MEK A;  3FWV A;  3Q4A B;  5EX3 A;  4U95 D;  5KJM A;  5HRY A;  4AM9 A;  2BKG A;  4EZK A;  2WXN A;  3LY7 A;  5G05 C;  5D0Q D;  3PEV B;  3URZ A;  4JA9 A;  2NC9 A;  2BUG A;  5ENO D;  2VSX E;  1E8X A;  2A5U A;  2LAI A;  3SD5 A;  3LJN A;  4OYS A;  2OOE A;  4EEC A;  4HOS A;  2FBN A;  2I1J A;  1NA0 A;  5LX8 A;  4G24 A;  3ZKJ A;  2V4H C;  3CVY A;  3EHM A;  4I43 A;  2BKK B;  2J4D A;  2AXU A;  3S2A A;  4WWP A;  1TYQ G;  4GTQ A;  5ENN A;  4I9C A;  3FH8 A;  4ZHB A;  2L0I A;  3CLJ A;  2WQ6 A;  4XZ4 A;  2X6F A;  3DSX A;  4XI0 A;  2Y0B G;  2WMN A;  1INZ A;  5A7D B;  2WXO A;  4TUM A;  1FT2 A;  3NF1 A;  5BT1 A;  4ANV A;  3AG4 E;  4GA0 A;  1XNF A;  4WNG A;  3JUI A;  4BFR A;  2V5Q C;  3HG0 D;  1U3D A;  4J8F A;  5FTP A;  4WND A;  4GPM A;  3ESK A;  4GZ6 A;  1BLX B;  4F1P A;  2Y4U A;  2YIN A;  4BWR A;  3FTZ A;  3L13 A;  4EBA G;  2QYJ A;  3ML8 A;  3FUH A;  3CEQ A;  4HRL A;  1NZN A;  3SGH A;  2IO3 C;  3ISM C;  5KNG A;  3K9I A;  3TWQ A;  1Y6I A;  4LCT A;  3JQ0 A;  3PEU B;  4XI9 A;  4KVO A;  1JCR A;  2QYU A;  3FHE A;  2HO1 A;  4AXH A;  1OWP A;  3VTY A;  3GZ1 A;  4NQ0 A;  5AIJ A;  3Q49 B;  4CRW A;  3ZVV A;  2OV8 A;  2H6H A;  3D9I A;  4OVV A;  5FJY A;  3Q5M A;  4IRU A;  5FZQ A;  3TGO A;  2IF4 A;  2WXK A;  2XRZ A;  3ZGQ A;  1ELW A;  1KLX A;  4N3C A;  3S7F A;  2KZT B;  2BF0 X;  2R03 A;  1BI7 B;  2P58 C;  4Q69 A;  5EYL A;  3QAR A;  4FLB A;  3AS5 A;  4G25 A;  2XQ0 A;  1DCE A;  5CRU A;  1TNZ A;  3T5X A;  2ZGD A;  2GRL A;  2Y1L E;  3LDZ A;  4G1T A;  1D8D A;  3HRA A;  4UQX A;  3LY9 A;  1N4R A;  4ANU A;  3EHR A;  1N52 A;  4AJW A;  5D66 A;  3R9A B;  4F6R D;  3E4B A;  4A3V A;  4YDO A;  2P2C P;  3DSW A;  2V0P A;  1ZBP A;  3QWP A;  4BSZ B;  3C98 A;  4PS7 A;  1KT0 A;  5JA4 D;  2J8S D;  4F1S A;  3PS6 A;  3DXM G;  1JCQ A;  3CKB A;  1YMP A;  2EIK E;  4DX7 D;  4HXI A;  2FO1 E;  3UKU G;  2CHZ A;  1PY1 A;  3FUM A;  2XZD G;  4I2Z A;  3OAW A;  5HQ8 A;  4DPR A;  2RG8 A;  5BPP A;  2I9C A;  3SNX A;  1Z5S C;  3UT7 A;  4I2W A;  1NFI E;  3E34 A;  5KJK A;  3V2X A;  1OWN A;  4HOT A;  2EQX A;  2IFU A;  4UQZ A;  3ZPJ A;  3D9K A;  3ULQ A;  3QB2 A;  3CQC B;  2V8S E;  5CER B;  4ME2 A;  4C0E A;  3UPV A;  2ETA A;  3QWV A;  2J07 A;  3KEA A;  3FTV A;  1TJC A;  3DST A;  1YYH A;  3BEE A;  5EKQ D;  4U07 A;  3ONK A;  4CDM A;  5KJN A;  4ACL A;  4EZJ A;  2F0Y A;  3SZ7 A;  3T8M A;  5EDS A;  5KCM A;  3GYZ A;  3UM3 A;  3FDH A;  2F37 A;  2IOS A;  2KM4 A;  1HFA A;  3L08 A;  3L82 A;  2RD0 A;  2OEV A;  4DX6 D;  4JL0 A;  5BUZ A;  5FIO A;  3SFY A;  5T4Y A;  5CMY A;  1VDY A;  2A4Z A;  3D9L A;  1JCS A;  4A1S A;  2CHW A;  4U04 A;  2QY7 A;  5AQA A;  1KZO A;  4DRX E;  4ATG A;  4EBA A;  3JYS A;  3FUF A;  2X6K A;  5B1B E;  1OXJ A;  1FT1 A;  4A55 A;  2NSZ A;  4LUN U;  4NRH B;  3T9K A;  3KAE A;  3L9T A;  2XPZ A;  2GRQ B;  2L6B A;  3AU5 A;  1Q2Z A;  3Q9N C;  2VGX B;  1K8K G;  4XEI G;  3SBS A;  3C3Q A;  4DUI A;  1FVF A;  4CEM A;  5JJ6 A;  4U0Z A;  3JXI A;  3FEX A;  4OAU C;  1N0Q A;  3EHN A;  1TNB A;  3B7R L;  2R2L A;  4NIK A;  3PZ4 A;  3R9M A;  1TN6 A;  3CHM A;  3TAX A;  2GGF A;  2KCL A;  2Y4T A;  3APF A;  2WPV A;  4BTA A;  3ZN3 A;  2QC9 A;  1LD8 A;  2GRR B;  3CVN A;  3S7J A;  2KAT A;  5E76 A;  4QQI A;  3JQ1 A;  1WY6 A;  2XEN A;  2PM7 A;  5JHA A;  4K5C A;  4MS6 A;  1IYG A;  4P29 A;  4A1G A;  3UX4 A;  4ILH B;  5BV0 A;  3V30 A;  4FHJ A;  2XS8 A;  2ION A;  2GRN B;  2EIJ E;  1L5J A;  2MOW A;  4N39 A;  3FUI A;  4URK A;  1N94 A;  3QJZ A;  3L16 A;  4B94 A;  2RKK A;  3EUV A;  5FZS A;  5AQ9 A;  1JUQ A;  2ZU6 B;  1QNF A;  4DI4 A;  3ZUV B;  2KC7 A;  3NZU A;  5AJD A;  1HX8 A;  4W9R A;  4OAV B;  1HG5 A;  1OY3 D;  3NOC D;  3EIQ C;  3E30 A;  2WQ7 A;  3PUK A;  5ITZ F;  1QQE A;  1N4P A;  4GB9 A;  4G2V A;  2QFC A;  5EYP F;  2WXI A;  1JPL A;  1TNY A;  3PZD A;  3LCA A;  4HOU A;  1EPU A;  1EYH A;  5CEA A;  2VGE A;  5AJL A;  3FU5 A;  4LER A;  4XX5 A;  1HS6 A;  3CHP A;  1Z3X A;  2A5E A;  3F6Q A;  1S0P A;  3FTW A;  3JCK C;  4Q96 A;  3HXB A;  1H6K A;  1OWO A;  2H6F A;  3UT4 A;  2XCC A;  3TG5 A;  3I4G A;  3KD7 A;  2Y69 E;  2P9I G;  4GZ5 A;  4C9B B;  2JEK A;  1S64 A;  3ZXS A;  1UJK A;  3L6A A;  3FTS A;  2R05 A;  4H7Y A;  5D0O D;  3JUE A;  4TRQ A;  3MV3 B;  3PRE A;  4R7L A;  3ZEF A;  4B0Z A;  2AWI A;  4BT8 A;  3KSQ A;  3ABL E;  3B7B A;  3EU9 A;  3P2B A;  4N2S A;  3J5Q B;  4JHR A;  4UI9 J;  1H0A A;  3FH5 A;  3AU4 A;  2XPI A;  1BI8 B;  3SHF A;  3NB2 A;  3ASO E;  2CG3 A;  2JAB A;  3B7S A;  2OEW A;  4U7E B;  3ZNG A;  3D9P A;  3T5V A;  1TEZ A;  2ETB A;  3IV0 A;  4UWK A;  2R5S A;  2EIL E;  3IKO B;  4HI9 A;  3ZW3 A;  4K03 A;  4GTT A;  2RFA A;  2UY1 A;  5H7P A;  1KZP A;  4TV3 A;  4YVO A;  2VQ2 A;  2GRM A;  3CVW A;  3ABK E;  1NP7 A;  4JVS A;  1MJ0 A;  1SA5 A;  4YND A;  3CHR A;  3AG2 E;  1E96 B;  3CR3 A;  3LKU A;  3L54 A;  2UWJ G;  1H2T C;  3D9J A;  1OCR E;  2LXM A;  1PC2 A;  2H6G A;  3KEZ A;  4GA1 A;  4GA2 A;  2R02 A;  3HHM A;  1QYM A;  3UM2 A;  3MYV A;  4BET A;  2XS1 A;  4LEU A;  1FPP A;  2PZI A;  4Q94 A;  4GU5 A;  2EIM E;  3ZHE A;  3ZYL A;  2WXL A;  2ZIS A;  3KSL A;  2KZT A;  4J8E A;  1UN8 A;  4FLH A;  3VLE A;  1OWM A;  1UG3 A;  2YHE A;  2WXR A;  4B8A A;  4CCA A;  3C3R A;  2C0L A;  2JLB A;  4MRU A;  3CVL A;  5LP0 A;  4PH4 B;  3FEY A;  3MZL B;  3UQ3 A;  4LNB A;  2WXF A;  4F53 A;  3LVQ E;  5KWD A;  3EJN A;  3CVQ A;  5FQ8 A;  3R7Q A;  4AP2 A;  3TWR A;  1HH8 A;  5CBN A;  3DEP A;  3CQG B;  2B6C A;  4HLL A;  2Q7F A;  2QZA A;  5DIZ A;  3FUK A;  1E7U A;  4E85 A;  4L1B A;  2XGS A;  4K5A B;  3DBS A;  3ASD A;  3CK8 A;  2UY1 B;  5KNH D;  4F7A A;  4C0M A;  1TNO A;  5AN8 A;  4J8S A;  3U66 A;  3IHY A;  1K1A A;  1Z3Y A;  3SFZ A;  3AG3 E;  1N11 A;  4PS3 A;  5G05 J;  2GRO B;  1N4S A;  4O60 A;  5E75 A;  1MX2 A;  2R17 C;  4ILG A;  4DLQ A;  3RKV A;  3CIA A;  4JB8 P;  3C3O A;  5CBO A;  1HZ4 A;  4XE0 A;  3DSV A;  3LJ3 A;  4I1O B;  3TXM A;  2DZO A;  4AV7 A;  1TR4 A;  3DWL G;  3SFX A;  3WXX A;  4F3V A;  2IO2 C;  4ANW A;  4KZ0 A;  1YA0 A;  2P9P G;  4APO A;  3PDN A;  1XGW A;  3JXJ A;  2WXP A;  4NAC A;  2XZT G;  3PRZ A;  4KMO A;  4A63 B;  3FH7 A;  3GZ2 A;  4HOR A;  3WG7 E;  4ZFH A;  3OXG A;  1RW2 A;  3NOG D;  3LY8 A;  4CT0 A;  2NYJ A;  1DVP A;  4HVB A;  2L0T B;  4KBQ A;  3FUJ A;  2AVP A;  1N54 A;  4JC8 A;  1N0R A;  4HFG A;  1LF8 A; 
#chains in the Genus database with same CATH homology
 4DUI A;  5EN5 D;  1BU9 A;  1UOH A;  3D9H A;  5FIN A;  3TWX A;  4BER A;  5CER B;  1K1A A;  1OT8 A;  2F8Y A;  5ENT D;  5AQ7 A;  2XEE A;  4U8Y D;  1MX6 A;  4G8L A;  4HRM B;  5ENQ D;  2ETA A;  5ENR D;  3JXI A;  4ZHB A;  5JMN D;  2A5E A;  3F6Q A;  3KEA A;  5CED B;  5AAR A;  5AQB A;  3W9G A;  5CEC B;  4OAU C;  2F8X K;  1N0Q A;  2Y0B G;  3Q9U C;  1K1B A;  4NIK A;  1BI7 B;  3IXE A;  1N11 A;  1YYH A;  3DEO A;  3ZU7 B;  2HE0 A;  4HQD A;  3V2O A;  1DCQ A;  4TUM A;  5EYL A;  1YCS B;  2ETC A;  4ATZ D;  2B0O E;  4BEP A;  1QYM A;  5BXU A;  4O60 A;  4BET A;  4G8K A;  1A5E A;  4QFV A;  2QC9 A;  1MX2 A;  4O1O A;  2ZGG A;  2ZGD A;  2Y1L E;  4YDW A;  4Z68 A;  1WG0 A;  4C48 B;  2F37 A;  3JUE A;  4GMR A;  3HRA A;  4QQI A;  4JB8 P;  2V5Q C;  3HG0 D;  3TWT A;  5AAO A;  1K3Z D;  5HKP A;  5CBO A;  2XEN A;  3TWV A;  1MX4 A;  5ENP D;  1AP7 A;  4GPM A;  3EHR A;  1WDY A;  4K5C A;  4DX6 D;  3SO8 A;  1BLX B;  4F1P A;  4U95 D;  5D66 A;  3V31 A;  4F6R D;  5BXO A;  3B7B A;  4LNU D;  4B93 B;  4U96 D;  2DZO A;  5FIO A;  3J5P A;  4K5B A;  5HRY A;  3V30 A;  3EU9 A;  4HB5 A;  4DX1 A;  2P2C P;  2PNN A;  1TR4 A;  3J5Q B;  2BKG A;  4UUC A;  4RLY A;  2QYJ A;  4O1P A;  3B95 A;  2DVW A;  1BI8 B;  1BD8 A;  3T8K A;  4BSZ B;  3TWW A;  4CZ2 D;  4HRL A;  4DX5 D;  5ENS D;  1DC2 A;  4J7W A;  3V79 K;  1S70 B;  3UTM A;  1D9S A;  2DZN A;  1SW6 A;  4LG6 A;  5JA4 D;  2JAB A;  4N5Q A;  5ENO D;  5AQA A;  2J8S D;  4DX2 A;  5KNG A;  2KXP C;  3JXJ A;  1SVX A;  5EIL A;  3TWQ A;  2XEH A;  4DRX E;  4CYM D;  2XZT G;  5EIB E;  2DWZ A;  3LJN A;  5KWD A;  3ZNG A;  5AQ9 A;  3UI2 A;  4A63 B;  1IXV A;  2ETB A;  3TWR A;  4HBD A;  5CBN A;  3TWU A;  1YMP A;  4HRN A;  3ZUV B;  1IKN D;  4DX7 D;  4J8Y A;  2KBX A;  3DEP A;  2FO1 E;  3NBN B;  4U8V D;  4HLL A;  1G3N B;  2RFM A;  5EID A;  4ZFH A;  2XZD G;  4HI9 A;  2MYO A;  4OAV B;  3NOG D;  1OY3 D;  2RFA A;  3NOC D;  1IHB A;  2AJA A;  4LSZ E;  4YDY A;  5ITZ F;  3W9F A;  3AJI A;  2NYJ A;  3T9K A;  3ZKJ A;  5EYP F;  3C5R A;  1NFI E;  5KBA A;  2V4H C;  4K5A B;  3V2X A;  4HNA D;  2BKK B;  2L6B A;  4BES A;  4HI8 A;  2VGE A;  5CEA A;  3EHQ A;  3Q9N C;  3UXG A;  3TWS A;  1AWC B;  1N0R A;  1MJ0 A;  5KNH D;  5AN8 A;  5HS0 A;  1MYO A;  3AAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...