5FINA

Darpins as a new tool for experimental phasing in protein crystallography
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
SDLGRKLLEAARAGQDDECRILMANGADVNAADNTGTTPLHLAAYSGHLEIVECLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Darpins as a New Tool for Experimental Phasing in Protein Crystallography
rcsb
source organism Synthetic construct
molecule tags Metal binding protein
molecule keywords NI3C DARPIN MUTANT5 HG-SITE N1
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5finA00
2RFMA 4QQIA 4O60A 3ZNGA 4O1OA 5AQBA 1NFIE 2AJAA 1BU9A 4BEPA 3TWSA 1IHBA 4HNAD 4HRNA 2Y0BG 4K5BA 4Z68A 2KXPC 3F6QA 4TUMA 4F1PA 5CBNA 2ETCA 2BKKB 2F8YA 4OAVB 3D9HA 3UTMA 5AQAA 2HE0A 3Q9NC 3UI2A 4HBDA 4DRXE 5AAOA 1MYOA 4U8YD 5KBAA 3ZKJA 1BLXB 1OT8A 5BXOA 4UUCA 4DX5D 5HS0A 3SO8A 5CBOA 2XEEA 4BETA 2NYJA 5ENPD 3C5RA 3JXJA 3HRAA 5ENOD 4N5QA 4YDYA 5EYPF 1SVXA 3B7BA 3W9GA 1YYHA 2RFAA 3B95A 3NOGD 1MX6A 1S70B 4BERA 1D9SA 5ENQD 5ENRD 5JA4D 2DZNA 3DEPA 2ZGGA 3V30A 5KNHD 5ENTD 3HG0D 2V5QC 4F6RD 4GPMA 2DWZA 4ZHBA 1A5EA 5AQ9A 3JXIA 4K5AB 3T9KA 1N0RA 4HRLA 3AAAC 3TWRA 3V79K 5CEDB 1QYMA 3TWTA 3TWUA 4OAUC 1OY3D 4A63B 3NBNB 4NIKA 1UOHA 4RLYA 5ENSD 1MX4A 2F8XK 1DC2A 1BI7B 2JABA 4C48B 5EYLA 2BKGA 5CERB 4HI9A 4DUIA 2VGEA 4DX1A 2F37A 1MJ0A 4ATZD 4U95D 3AJIA 5FIOA 4U8VD 1YMPA 2ZGDA 3TWVA 4B93B 2MYOA 5KWDA 2XZDG 1BI8B 1MX2A 1IXVA 2XENA 4J8YA 5KNGA 5AN8A 3UXGA 3TWQA 4DX7D 4K5CA 5CEAA 4YDWA 1K3ZD 2A5EA 1K1AA 5CECB 4HLLA 3T8KA 2QC9A 2XZTG 4G8KA 4JB8P 1AWCB 3EHQA 4CZ2D 3J5PA 3TWXA 2B0OE 2DVWA 4GMRA 2QYJA 4ZFHA 2DZOA 4HQDA 5AQ7A 4CYMD 1IKND 4LG6A 5HKPA 3ZU7B 5D66A 3EU9A 4HI8A 5AARA 3ZUVB 4HRMB 2P2CP 3IXEA 1DCQA 4LNUD 3W9FA 1AP7A 2ETAA 3J5QB 5EIDA 1N0QA 3LJNA 4G8LA 3V2OA 4DX2A 5EIBE 1TR4A 3DEOA 1K1BA 4HB5A 1N11A 4J7WA 4LSZE 2L6BA 2J8SD 2ETBA 2PNNA 3NOCD 5JMND 3V2XA 2XEHA 5EN5D 5EILA 5HRYA 4U96D 5BXUA 5FINA 4BESA 1WDYA 3V31A 1BD8A 2KBXA 2Y1LE 3Q9UC 3JUEA 4BSZB 3KEAA 3EHRA 4QFVA 5ITZF 4O1PA 4DX6D 1YCSB 1G3NB 1SW6A 2V4HC 2FO1E 3TWWA 1WG0A
chains in the Genus database with same CATH superfamily
2L0TB 4UWHA 1TNBA 2P9PG 5A7DB 4DLQA 1S0PA 3MA5A 3VTXA 2OVFA 1U3CA 3RRMB 4I9EA 1BLXB 3ULQA 2ZXWE 2CFUA 2LXLA 2KCLA 4J8EA 4NRHB 2RFAA 4AEZC 4DJAA 1NI1A 2RG8A 3PRZA 2WB2A 4J8DA 2LAHA 4LCTA 1GW6A 1A5EA 1Z6TA 3UMVA 3MKRA 4UI9K 1QYMA 5ENSD 3SHFA 2R2LA 2X3MA 2WXJA 1Y8MA 5CERB 5CRUA 4J8YA 4CGVA 1NP7A 2CHXA 2WXGA 3NQPA 3CVXA 4KYOB 2H6GA 5JJTA 3RAUA 3TWXA 1HU3A 1O1TA 2WQHA 4Y6CA 3EU5A 4TRQA 4JXTA 5D66A 3EU9A 3EIQC 1X81A 4G8LA 2OV8A 3CVYA 4J7WA 3FTUA 2V5FA 4M3OA 3QC1A 3LEWA 5HRYA 4M7CA 2GRMA 5LFAA 5FZQA 5BV0A 3ML9A 4I43A 4U0SA 4J0UA 2RFMA 2A4ZA 2WVIA 4I6GA 2Y0BG 3UKUG 4YVOA 3CQCB 4H7XA 4J6IA 3NZSA 1QZ2A 1UG3A 3DSUA 3QJZA 4U8YD 4XI0A 3DSSA 5DBKA 1DCEA 4GA2A 5ENPD 3JXJA 3BEEA 3I5PA 4LUNU 2XQ0A 1MQSA 2IOLA 1FVHA 4DI3A 3PE4A 3PZ3A 2WXOA 3SBSA 3GYZA 1LTXA 4JHKA 4RQIA 4A3VA 2KZTB 1OY3D 2F8XK 4FLBA 3Q79A 2WXRA 3QK0A 2VGXA 2VTBA 2P9LG 1V54E 3SF4A 4BT8A 5B3SE 3LY8A 1EPUA 2BUGA 1H0AA 3UXGA 1D8EA 1K3ZD 2XS8A 1NZNA 3T8KA 4HLEA 3R9AB 4G8KA 2Q7FA 1TN7A 3ZRHA 3ML8A 4F3VA 3IXEA 3W9FA 3QKYA 3J5QB 2P9NG 2FULA 4V3IA 3CIAA 3V2XA 4KZ0A 5FINA 5AIJA 2Y1LE 4D10C 2P9UG 4DX6D 2HYZA 3MKQA 4C0EA 3O48A 4BFRA 3TWSA 2HR2A 1SA5A 2RKKA 3FTYA 3TGOA 4XZ4A 5G55A 3CKBA 4NACA 3FUNA 3FHEA 3IBEA 4FP7A 1B89A 1OT8A 3U4TA 1ELKA 4NQ0A 4U8HA 3C5RA 4A1SA 5FQ4A 3VLEA 3PDNA 3FUEA 3AS5A 3HG0D 4F6RD 1JCSA 5BV1A 3UM2A 1MJ0A 4EBAA 3ESKA 3TG4A 3AJIA 3ASOE 1HXIA 3E32A 3MZLB 3CVUA 1YMPA 1Q2ZA 5KWDA 3R7QA 1SZAA 3S7BA 4EZLA 5T3RA 2VSNA 3EHNA 2IEJA 3J5PA 2WXKA 4AV7A 3ASNE 4ZFHA 3SFZA 2VQ2A 3LDZA 4BTBA 5HKPA 2MOWA 1DCQA 4K0RA 3CQGB 1E8ZA 3LVQE 3UT8A 3PEUB 4F1SA 3GZ1A 1WM5A 2ILRA 2ETBA 3NOCD 5HI7A 1E8YA 3V31A 3RRUA 1IYGA 3ABKE 3AG4E 3HXBA 4CDRA 4EPZA 1KLXA 4QQIA 3CV0A 5JJ6A 3UQ3A 2PM6A 4TUMA 3UINC 1LD7A 2BTDA 3D9KA 4ANWA 3JUIA 3Q4AB 3D9OA 4HBDA 2AWIA 4GU5A 5JHBA 1OWOA 4FULA 3I4GA 3PZDA 2J09A 3ASGA 2J07A 3DEPA 4AXHA 2KM4A 4EBAG 3ASFA 1TNZA 2XPYA 5AQ9A 3T9KA 1N0RA 1P5QA 2YINA 3TWUA 5KJNA 4MLPA 3RIBA 3HXDA 3C98A 3CHOA 5G05C 2F37A 4G2VA 3FTZA 1D8DA 4RG9A 4WWOA 3FUKA 1Y6IA 2MYOA 4PS8A 3B7UX 2UWJG 4K03A 4GCNA 1IHGA 3L17A 4XX5A 3RKVA 3OXLA 4FA6A 3CK9A 1N95A 4JEHA 3UM1A 3PUKA 3HXFA 4ANVA 4F53A 4NURA 3CVLA 2XGOA 4U63A 4BESA 4TXPA 4B89A 3L22A 4BSZB 3PUJA 1N4PA 3TL5A 3I3NA 2XCBA 2P9IG 3OXFA 5AJDA 1FPPA 3FTVA 4KZCA 2C0MA 5KBAA 5BXOA 3HRAA 3CLJA 1YYHA 3DPYA 2RD0A 1O1RA 5AJLA 4OVVA 3Q78A 5EX3A 3FUHA 5EYLA 2GRNB 1Z3YA 3Q15A 3SI5A 4JPSA 2V8SE 2JLBA 4I6EA 4JA7A 2XRYA 2H6FA 2P58C 2IJGX 4FHJA 5J08A 3EHQA 3CSFA 4GMRA 2YHEA 1X5BA 1L5JA 2DZOA 1IKND 3ZN3A 2ETAA 4I2ZA 5B1AE 2VGXB 3UT7A 2DYRE 4U96D 4GYWA 1BD8A 3D9PA 3EUVA 3SNXA 3IEGA 5T4YA 3E34A 3TXMA 3RSEG 2FO1E 3G2VA 1WG0A 5LCWC 1TN8A 2WMNA 3ENEA 5D0QD 1NFIE 2KATA 4URKA 3URZA 2R17C 4UWKA 1OWPA 1OWNA 3CR3A 2I9CA 3ZKJA 1IQUA 4DX5D 3LS8A 3FU5A 3U64A 4GZ5A 4HXIA 1OCOE 5HQ8A 4B0ZA 4GPMA 3HVEA 3LY7A 3DXKG 2DCPA 3ZHEB 2VSYA 2QYUA 4N3AA 3KAEA 5ANRA 3PZ4A 3OTNA 2R59A 3JQ0A 1FVFA 3CVPA 1O5MA 2ZGDA 3JCKC 4Q69A 2XCCA 5AN8A 4YDOA 4YDEA 3CHSA 4JB8P 3FEXA 2KCKA 3SFYA 2X6HA 2XRZA 3O4ZA 2KC7A 4JC8A 3S2AA 2Y4TA 3ZYLA 1QBQA 1KT1A 4XKBA 3CEQA 3FEYA 2J8SD 3AG2E 2WXNA 5FZSA 1DVPA 4GZ3A 3G2SA 2VYIA 2KBXA 4XKCA 3EHRA 3UPVA 4GMJA 4GA0A 5T8IA 4QFVA 1G3NB 5A23A 4O60A 4DI4A 3AU4A 2YQ8A 2ZIRA 3ULYA 3ZGQA 2LNIA 4GTTA 3UKRG 3U9WA 3PH0C 4FJZA 3UI2A 3EJNA 3T5VA 4JHJA 4IN3B 5ARGA 3OXGA 4FU3A 1EDUA 2V4LA 4L9PA 4L2LA 4XEIG 5FTPA 3UX4A 4BETA 4ANUA 4FADA 3HXEA 3NOGD 1MX6A 3E37A 4J8FA 4IRUA 5ENRD 5D0OD 5JA4D 2ZGGA 3ZYKA 3NAWA 5G05J 2R02A 3AAAC 1ELWA 1N4SA 3TWRA 3TWTA 1UOHA 5EKQD 4A1GA 4JZYA 3ISMC 4DUIA 3B7SA 4ATZD 4WNDA 2B6CA 2QZAA 2GRPB 1HX8A 3FH5A 3MX3A 3PZ1A 3T8MA 3TWQA 1A17A 4WAFA 2PQNA 4TUUA 4U04A 4J8SA 3FU3A 1AWCB 4CZ2D 2DVWA 5LOZA 4C9BB 4BWRA 3CKCA 5KJLA 2A5UA 3ZEFA 4LNUD 5ENNA 2PQRA 1UJJA 1QNFA 4UQZA 4XIFA 2L6BA 4CT4A 2VSOE 4GYYA 4GPKA 4GTRA 5FT9A 4AY5A 4IULA 4B8AA 4DLOA 4AIFA 3TWWA 2UY1A 3CGHA 1FT2A 3ZNGA 2Y4UA 4BEPA 1RW2A 1OWLA 3SFXA 4XI9A 3Q73A 5CBNA 3KSQA 4CRWA 4PDXA 1OXJA 2R5SA 4UUCA 5FWQA 3FFLA 1HE8A 5CBOA 4APFA 5IY5E 3LVRE 4U7EB 1D9SA 1EF1C 2PZIA 3JQ1A 4GZCA 3K9IA 4KVMA 2M63A 3V79K 3FU6A 3NBNB 4I1MA 2BKGA 1E8WA 2I6HA 4N3CA 3KSLA 3APDA 2DYSE 3LJ3A 1WAO1 3EDTB 2WXFA 1IXVA 4AP2A 3L9TA 4K5CA 3G2TA 1KZPA 2AXZA 2EIKE 4RSYA 3CVVA 2P9SG 1E7VA 2XHEA 4BSXA 4LG6A 4HI8A 1KZOA 5CHEE 2GRLA 2XGSA 3HVEB 2I1KA 2L0IA 5BNWA 1Z3XA 3I4RB 5EN5D 3L6AA 3ZXPA 1N4QA 1N4RA 4ACLA 3Q5MA 4U0ZA 3HYMB 1IQRA 3UM3A 3MEKA 4EHMA 1ZU2A 1N52A 3FUFA 1LF8A 3DSTA 5AQBA 4HOTA 1ZBPA 3LYAA 4MBGA 4HRNA 4K5BA 3QWPA 4EQFA 2BKKB 1HF8A 4LNBA 1JCRA 4HORA 3HHMA 3N71A 1OCZE 4BTAA 2NYJA 3MYVA 3MJWA 4DK5A 5EYPF 4LERA 3E30A 3B13A 4BERA 4G26A 3ASHA 1JPLA 2EQXA 2V0PA 1E7UA 2DWZA 1S64A 2IU1A 4B8CB 1YA0A 1LD8A 5D2MC 1K8KG 2BF0X 3G2UA 1H2TC 2VTBB 3QB2A 2E2EA 1MHQA 2X6FA 2WQ7A 1H6OA 3QWWA 4R7LA 3WG7E 2KZTA 3OAWA 1K1AA 2P9KG 1PY1A 3PEVB 4MRUA 3L13A 4L2YA 2J9QA 3C3OA 3APCA 4FC8A 3IKOB 4UQXA 3L54A 1PC2A 3ZUVB 2XPIA 4AM9A 3LJNA 4DX2A 4FLHA 1K1BA 5H7PA 4PS3A 3L08A 2GW1A 1ELRA 2C2LA 2XEHA 4HFGA 3X2QE 4LRZA 2MHKA 3QOUA 2Y69E 2V4HC 3ONLA 3D3MA 3SBTB 4Z68A 4GTQA 2AW6A 2EIME 2EILE 4CCAA 4DRXE 4JA9A 1HH8A 3D9IA 1S63A 5FQ8A 1SZ9A 4YDYA 4BX9A 2PL2A 5ENQD 3L16A 5KNHD 3DWLG 3SGHA 2V5QC 3PZ2A 2GRQB 4I6JA 3ZIMA 3Q49B 5LCWJ 5CEDB 4ILGA 1U2VG 3LPZA 3RO2A 3CHMA 1UN8A 5J90A 4HI9A 2IY0C 5B1BE 3MKQB 1RZ4A 2CG2A 3FU0A 4DPRA 2J4BA 5KNGA 3BG0B 4G25A 4GZDA 3E33A 2AVPA 4AOFA 2X6IA 5CECB 2XPZA 3EHMA 1Z5SC 4JEUA 1H6KA 5CMWA 3ONKA 4G11A 2WXLA 2WXQA 4XE0A 4CDNA 2PM7A 3CHPA 4E85A 3SZ7A 4BT9A 2WM9A 2LAIA 3DSXA 3Q9UC 4EZKA 3DSVA 4TV3A 4I9CA 3U3WA 5FQ6A 4GMLA 3LY9A 4I2WA 2Y3AA 4N2SA 2J49A 3QWVA 2FBNA 3WXXA 4UWFA 2ETCA 2F8YA 3D9HA 3UTMA 1OWMA 3APFA 2VJ8A 4CGWA 3UM0A 4L7TA 3VLFA 2XEEA 5C2YA 3BG1B 1SVXA 3W9GA 4GB9A 3RK6A 3LCAA 4GTVA 3MCXA 2UY1B 1E96B 1NA3A 4W9RA 2KCVA 1MX4A 3PE3A 4AVXA 3UIOC 4A55A 1SQMA 3QDNA 4ABNA 1JCQA 5FIOA 5M72A 2F0YA 1SA4A 4G1TA 2WQ6A 2FF4A 3HDXA 2QYJA 4TXRA 3GW4A 3ABLE 1W3BA 5EX0A 3FTSA 4CYMD 3PNTB 3FTXA 3SQVA 3VTYA 4FHKA 4O6FA 1TR4A 5EILA 4PUCA 5AYWD 3FUJA 5BW8C 3FTWA 5ITZF 2IF4A 3CVNA 4O1PA 4EECA 5CCMA 3ZYMA 4RVBA 4FJYA 3UIPC 1IHBA 3FULA 2CFZA 3FH8A 3ZYQA 3CK8A 1JWGA 4KVOA 4UQYA 2LO6A 2YNQA 2HE0A 4UI9C 5AAOA 3Q47B 3HIZA 5HS0A 5CCLA 3SO8A 1TNYA 1O1SA 4KT6B 1BPOA 4JHRA 4Q96A 1KT0A 3BQOA 3B7BA 2BEDA 2ONDA 4HVBA 3G2WA 1UJKA 4A3TA 1V55E 3JXIA 1U3DA 3Q75A 4A63B 1XNFA 3RJVA 2CHWA 3RU0A 3Q7AA 2XENA 4HOUA 5FJYA 4GA1A 4H7YA 4YVQC 4G23A 4Y6WA 3MV2B 1ZB1A 2XZTG 2LSUA 5A6CA 1N94A 4HQDA 3CHQA 4GYOA 3ZPJA 1EYHA 3BUAA 5EIDA 4WNGA 2WXHA 3S7DA 4HB5A 2J4DA 3D9JA 2ZU6B 2GROB 1UW4B 4Q94A 3CVQA 5KJMA 3FUDA 4N39A 3KEZA 1NL4A 3NZUA 1H2UA 2AJAA 5DIZA 4HNAD 4U0UA 3SY2A 3AS4A 1MYOA 4B94A 2H6IA 4JL0A 4N5QA 1HO8A 1QQEA 1FCHA 4ILHB 3HXCA 3T5XA 2HO1A 3MGBA 4TXQA 4GAAA 1TYQG 4BY6A 1E8XA 5G04J 1INZA 4NIKA 3GZ2A 3DSWA 3GZSA 2JEKA 2JABA 4HOQA 2VGEA 5EDSA 3FWVA 2AXVA 3MV3B 3CSTA 5ANLA 3E4BA 4DX7D 2FI7A 2QC9A 3PREA 3FUMA 1HG2A 2R05A 1TN6A 1TEZA 5AENA 4OYSA 2IQCA 3DBSA 5KJKA 2EINE 4PH4B 3QNKA 5EIBE 5JJ7A 5LX8A 1FT1A 4N3BA 3UUXA 2AXUA 2ZISA 3P1UA 5BXUA 2IO2C 3JUEA 3KEAA 4I1AA 4JVSA 2I2OA 3JYSA 3KS2A 3C72A 3DXMG 4WWNA 3D9MA 3PS6A 4I1OB 4OAVB 4WWPA 4ME2A 3L82A 4RG6A 3AG1E 3AG3E 3R9MA 3TXNA 3DRAA 4JD2G 2FO7A 3V30A 1OUVA 2GGFA 4ZHBA 3CVWA 4OVUA 1HG5A 1MZCA 3FH7A 3TG5A 2DIWA 5BPPA 2QFCA 2X38A 4F7AA 4C48B 4APOA 3QAQA 3Q7FA 3D9NA 4MS6A 5JHAA 3TWVA 1MX2A 5BT1A 4KBQA 4U07A 2IO3C 3CHRA 5CEAA 4YDWA 4HLLA 5C1DA 1H6PA 4GTOA 2B0OE 5AQ7A 3TAXA 3ZU7B 4ATGA 4HRMB 3VLDA 1AP7A 3ZXSA 2LSVA 3DEOA 2PNNA 4AJWA 1VDYA 2YHCA 3IHVA 4UWLA 2E0IA 2QY7A 3ZVVA 3IHYA 3RO3A 3ZHEA 2WMOA 3C3QA 3R7RA 2LUHA 3F6QA 4E6HA 2MRIA 3EIJA 1OCRE 3Q9NC 4CT0A 1DNPA 2VGYA 4MKTA 4L1BA 3UT4A 4X8QA 3ASDA 2EIJE 3BU8A 3SD5A 3AU5A 2X6KA 3B95A 5CRVA 4GZ6A 3C3RA 2HM8A 3FDHA 3ULEG 4GTSA 4UWGA 4KXKB 4K5AB 4C0MA 4RLYA 1BI7B 3NF1A 4ANXA 5FZRA 4DX1A 3S7FA 5G2NA 1H2VC 4U95D 4ACKA 1HS6A 1OCCE 1JWFA 4U8VD 1NA0A 4EZJA 2XZDG 3ABME 2IONA 2A5EA 1WY6A 1E90A 1N9AA 5AARA 1PAQA 2P2CP 5ARFA 3B7TA 5E75A 1N0QA 1TNOA 5LP0A 1N11A 4LSZE 4GTPA 4I17A 3LKUA 2OOEA 3RRNB 3FP3A 2IFUA 3U66A 2DBAA 1TNUA 2X6JA 4G24A 4JW1A 4PS7A 1HZ4A 1SW6A 4WNFA 2C0LA 3AS8A 4O1OA 4AY6A 1BU9A 2GRRB 2J08A 3B7RL 4HOSA 2KXPC 4F1PA 2IOSA 2LXMA 4GCOA 1UN9A 4HS2A 5AQAA 1HFAA 1TJCA 3TJPA 4WNEA 2XEVA 4LEUA 2WPVA 5FQ7A 3PNLB 2XGMA 3S7JA 3IV0A 2FEZA 5ENOD 3LXUX 2H6HA 2CG3A 5G04C 1S70B 3CK7A 2WXPA 1TJFA 4N5CA 4KMOA 1N54A 2DZNA 5ENTD 4P29A 2WXMA 4HRLA 2WXIA 4OAUC 2VSXE 2XS1A 1DC2A 2NXPA 1H19A 3DPDA 3NB2A 3ZW3A 4UI9J 2OVBA 3FY4A 4B93B 4L23A 5BUZA 2CHZA 4CEMA 1BI8B 4CDMA 2R03A 4LNGA 4YNDA 5KCMA 2OEVA 2L6JA 3QARA 5CMYA 1JUQA 4IYPA 4GTMA 3PVLA 2L9BA 2NSZA 2OCCE 2I1JA 5E76A 3V2OA 4WUYA 3KD7A 4N2QA 3P2BA 1XGWA 5JMND 4ILIA 3D9LA 1WDYA 1KPSB 3ESLA 3FUIA 2NC9A 1YCSB 2OEWA 4BX8A 3ZFWA
chains in the Genus database with same CATH topology
2RFMA 4QQIA 4O60A 3ZNGA 4O1OA 5AQBA 1NFIE 2AJAA 1BU9A 4BEPA 3TWSA 1IHBA 4HNAD 4HRNA 2Y0BG 4K5BA 4Z68A 2KXPC 3F6QA 4TUMA 4F1PA 5CBNA 2ETCA 2BKKB 2F8YA 4OAVB 3D9HA 3UTMA 5AQAA 2HE0A 3Q9NC 3UI2A 4HBDA 4DRXE 5AAOA 1MYOA 4U8YD 5KBAA 3ZKJA 1BLXB 1OT8A 5BXOA 4UUCA 4DX5D 5HS0A 3SO8A 5CBOA 2XEEA 4BETA 2NYJA 5ENPD 3C5RA 3JXJA 3HRAA 5ENOD 4N5QA 4YDYA 5EYPF 1SVXA 3B7BA 3W9GA 1YYHA 2RFAA 3B95A 3NOGD 1MX6A 1S70B 4BERA 1D9SA 5ENQD 5ENRD 5JA4D 2DZNA 3DEPA 2ZGGA 3V30A 5KNHD 5ENTD 3HG0D 2V5QC 4F6RD 4GPMA 2DWZA 4ZHBA 1A5EA 5AQ9A 3JXIA 4K5AB 3T9KA 1N0RA 4HRLA 3AAAC 3TWRA 3V79K 5CEDB 1QYMA 3TWTA 3TWUA 4OAUC 1OY3D 4A63B 3NBNB 4NIKA 1UOHA 4RLYA 5ENSD 1MX4A 2F8XK 1DC2A 1BI7B 2JABA 4C48B 5EYLA 2BKGA 5CERB 4HI9A 4DUIA 2VGEA 4DX1A 2F37A 1MJ0A 4ATZD 4U95D 3AJIA 5FIOA 4U8VD 1YMPA 2ZGDA 3TWVA 4B93B 2MYOA 5KWDA 2XZDG 1BI8B 1MX2A 1IXVA 2XENA 4J8YA 5KNGA 5AN8A 3UXGA 3TWQA 4DX7D 4K5CA 5CEAA 4YDWA 1K3ZD 2A5EA 1K1AA 5CECB 4HLLA 3T8KA 2QC9A 2XZTG 4G8KA 4JB8P 1AWCB 3EHQA 4CZ2D 3J5PA 3TWXA 2B0OE 2DVWA 4GMRA 2QYJA 4ZFHA 2DZOA 4HQDA 5AQ7A 4CYMD 1IKND 4LG6A 5HKPA 3ZU7B 5D66A 3EU9A 4HI8A 5AARA 3ZUVB 4HRMB 2P2CP 3IXEA 1DCQA 4LNUD 3W9FA 1AP7A 2ETAA 3J5QB 5EIDA 1N0QA 3LJNA 4G8LA 3V2OA 4DX2A 5EIBE 1TR4A 3DEOA 1K1BA 4HB5A 1N11A 4J7WA 4LSZE 2L6BA 2J8SD 2ETBA 2PNNA 3NOCD 5JMND 3V2XA 2XEHA 5EN5D 5EILA 5HRYA 4U96D 5BXUA 5FINA 4BESA 1WDYA 3V31A 1BD8A 2KBXA 2Y1LE 3Q9UC 3JUEA 4BSZB 3KEAA 3EHRA 4QFVA 5ITZF 4O1PA 4DX6D 1YCSB 1G3NB 1SW6A 2V4HC 2FO1E 3TWWA 1WG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFM A;  4QQI A;  4O60 A;  3ZNG A;  4O1O A;  5AQB A;  1NFI E;  2AJA A;  1BU9 A;  4BEP A;  3TWS A;  1IHB A;  4HNA D;  4HRN A;  2Y0B G;  4K5B A;  4Z68 A;  2KXP C;  3F6Q A;  4TUM A;  4F1P A;  5CBN A;  2ETC A;  2BKK B;  2F8Y A;  4OAV B;  3D9H A;  3UTM A;  5AQA A;  2HE0 A;  3Q9N C;  3UI2 A;  4HBD A;  4DRX E;  5AAO A;  1MYO A;  4U8Y D;  5KBA A;  3ZKJ A;  1BLX B;  1OT8 A;  5BXO A;  4UUC A;  4DX5 D;  5HS0 A;  3SO8 A;  5CBO A;  2XEE A;  4BET A;  2NYJ A;  5ENP D;  3C5R A;  3JXJ A;  3HRA A;  5ENO D;  4N5Q A;  4YDY A;  5EYP F;  1SVX A;  3B7B A;  3W9G A;  1YYH A;  2RFA A;  3B95 A;  3NOG D;  1MX6 A;  1S70 B;  4BER A;  1D9S A;  5ENQ D;  5ENR D;  5JA4 D;  2DZN A;  3DEP A;  2ZGG A;  3V30 A;  5KNH D;  5ENT D;  3HG0 D;  2V5Q C;  4F6R D;  4GPM A;  2DWZ A;  4ZHB A;  1A5E A;  5AQ9 A;  3JXI A;  4K5A B;  3T9K A;  1N0R A;  4HRL A;  3AAA C;  3TWR A;  3V79 K;  5CED B;  1QYM A;  3TWT A;  3TWU A;  4OAU C;  1OY3 D;  4A63 B;  3NBN B;  4NIK A;  1UOH A;  4RLY A;  5ENS D;  1MX4 A;  2F8X K;  1DC2 A;  1BI7 B;  2JAB A;  4C48 B;  5EYL A;  2BKG A;  5CER B;  4HI9 A;  4DUI A;  2VGE A;  4DX1 A;  2F37 A;  1MJ0 A;  4ATZ D;  4U95 D;  3AJI A;  5FIO A;  4U8V D;  1YMP A;  2ZGD A;  3TWV A;  4B93 B;  2MYO A;  5KWD A;  2XZD G;  1BI8 B;  1MX2 A;  1IXV A;  2XEN A;  4J8Y A;  5KNG A;  5AN8 A;  3UXG A;  3TWQ A;  4DX7 D;  4K5C A;  5CEA A;  4YDW A;  1K3Z D;  2A5E A;  1K1A A;  5CEC B;  4HLL A;  3T8K A;  2QC9 A;  2XZT G;  4G8K A;  4JB8 P;  1AWC B;  3EHQ A;  4CZ2 D;  3J5P A;  3TWX A;  2B0O E;  2DVW A;  4GMR A;  2QYJ A;  4ZFH A;  2DZO A;  4HQD A;  5AQ7 A;  4CYM D;  1IKN D;  4LG6 A;  5HKP A;  3ZU7 B;  5D66 A;  3EU9 A;  4HI8 A;  5AAR A;  3ZUV B;  4HRM B;  2P2C P;  3IXE A;  1DCQ A;  4LNU D;  3W9F A;  1AP7 A;  2ETA A;  3J5Q B;  5EID A;  1N0Q A;  3LJN A;  4G8L A;  3V2O A;  4DX2 A;  5EIB E;  1TR4 A;  3DEO A;  1K1B A;  4HB5 A;  1N11 A;  4J7W A;  4LSZ E;  2L6B A;  2J8S D;  2ETB A;  2PNN A;  3NOC D;  5JMN D;  3V2X A;  2XEH A;  5EN5 D;  5EIL A;  5HRY A;  4U96 D;  5BXU A;  5FIN A;  4BES A;  1WDY A;  3V31 A;  1BD8 A;  2KBX A;  2Y1L E;  3Q9U C;  3JUE A;  4BSZ B;  3KEA A;  3EHR A;  4QFV A;  5ITZ F;  4O1P A;  4DX6 D;  1YCS B;  1G3N B;  1SW6 A;  2V4H C;  2FO1 E;  3TWW A;  1WG0 A; 
#chains in the Genus database with same CATH topology
 2L0T B;  4UWH A;  1TNB A;  2P9P G;  5A7D B;  4DLQ A;  1S0P A;  3MA5 A;  3VTX A;  2OVF A;  1U3C A;  3RRM B;  4I9E A;  1BLX B;  3ULQ A;  2ZXW E;  2CFU A;  2LXL A;  2KCL A;  4J8E A;  4NRH B;  2RFA A;  4AEZ C;  4DJA A;  1NI1 A;  2RG8 A;  3PRZ A;  2WB2 A;  4J8D A;  2LAH A;  4LCT A;  1GW6 A;  1A5E A;  1Z6T A;  3UMV A;  3MKR A;  4UI9 K;  1QYM A;  5ENS D;  3SHF A;  2R2L A;  2X3M A;  2WXJ A;  1Y8M A;  5CER B;  5CRU A;  4J8Y A;  4CGV A;  1NP7 A;  2CHX A;  2WXG A;  3NQP A;  3CVX A;  4KYO B;  2H6G A;  5JJT A;  3RAU A;  3TWX A;  1HU3 A;  1O1T A;  2WQH A;  4Y6C A;  3EU5 A;  4TRQ A;  4JXT A;  5D66 A;  3EU9 A;  3EIQ C;  1X81 A;  4G8L A;  2OV8 A;  3CVY A;  4J7W A;  3FTU A;  2V5F A;  4M3O A;  3QC1 A;  3LEW A;  5HRY A;  4M7C A;  2GRM A;  5LFA A;  5FZQ A;  5BV0 A;  3ML9 A;  4I43 A;  4U0S A;  4J0U A;  2RFM A;  2A4Z A;  2WVI A;  4I6G A;  2Y0B G;  3UKU G;  4YVO A;  3CQC B;  4H7X A;  4J6I A;  3NZS A;  1QZ2 A;  1UG3 A;  3DSU A;  3QJZ A;  4U8Y D;  4XI0 A;  3DSS A;  5DBK A;  1DCE A;  4GA2 A;  5ENP D;  3JXJ A;  3BEE A;  3I5P A;  4LUN U;  2XQ0 A;  1MQS A;  2IOL A;  1FVH A;  4DI3 A;  3PE4 A;  3PZ3 A;  2WXO A;  3SBS A;  3GYZ A;  1LTX A;  4JHK A;  4RQI A;  4A3V A;  2KZT B;  1OY3 D;  2F8X K;  4FLB A;  3Q79 A;  2WXR A;  3QK0 A;  2VGX A;  2VTB A;  2P9L G;  1V54 E;  3SF4 A;  4BT8 A;  5B3S E;  3LY8 A;  1EPU A;  2BUG A;  1H0A A;  3UXG A;  1D8E A;  1K3Z D;  2XS8 A;  1NZN A;  3T8K A;  4HLE A;  3R9A B;  4G8K A;  2Q7F A;  1TN7 A;  3ZRH A;  3ML8 A;  4F3V A;  3IXE A;  3W9F A;  3QKY A;  3J5Q B;  2P9N G;  2FUL A;  4V3I A;  3CIA A;  3V2X A;  4KZ0 A;  5FIN A;  5AIJ A;  2Y1L E;  4D10 C;  2P9U G;  4DX6 D;  2HYZ A;  3MKQ A;  4C0E A;  3O48 A;  4BFR A;  3TWS A;  2HR2 A;  1SA5 A;  2RKK A;  3FTY A;  3TGO A;  4XZ4 A;  5G55 A;  3CKB A;  4NAC A;  3FUN A;  3FHE A;  3IBE A;  4FP7 A;  1B89 A;  1OT8 A;  3U4T A;  1ELK A;  4NQ0 A;  4U8H A;  3C5R A;  4A1S A;  5FQ4 A;  3VLE A;  3PDN A;  3FUE A;  3AS5 A;  3HG0 D;  4F6R D;  1JCS A;  5BV1 A;  3UM2 A;  1MJ0 A;  4EBA A;  3ESK A;  3TG4 A;  3AJI A;  3ASO E;  1HXI A;  3E32 A;  3MZL B;  3CVU A;  1YMP A;  1Q2Z A;  5KWD A;  3R7Q A;  1SZA A;  3S7B A;  4EZL A;  5T3R A;  2VSN A;  3EHN A;  2IEJ A;  3J5P A;  2WXK A;  4AV7 A;  3ASN E;  4ZFH A;  3SFZ A;  2VQ2 A;  3LDZ A;  4BTB A;  5HKP A;  2MOW A;  1DCQ A;  4K0R A;  3CQG B;  1E8Z A;  3LVQ E;  3UT8 A;  3PEU B;  4F1S A;  3GZ1 A;  1WM5 A;  2ILR A;  2ETB A;  3NOC D;  5HI7 A;  1E8Y A;  3V31 A;  3RRU A;  1IYG A;  3ABK E;  3AG4 E;  3HXB A;  4CDR A;  4EPZ A;  1KLX A;  4QQI A;  3CV0 A;  5JJ6 A;  3UQ3 A;  2PM6 A;  4TUM A;  3UIN C;  1LD7 A;  2BTD A;  3D9K A;  4ANW A;  3JUI A;  3Q4A B;  3D9O A;  4HBD A;  2AWI A;  4GU5 A;  5JHB A;  1OWO A;  4FUL A;  3I4G A;  3PZD A;  2J09 A;  3ASG A;  2J07 A;  3DEP A;  4AXH A;  2KM4 A;  4EBA G;  3ASF A;  1TNZ A;  2XPY A;  5AQ9 A;  3T9K A;  1N0R A;  1P5Q A;  2YIN A;  3TWU A;  5KJN A;  4MLP A;  3RIB A;  3HXD A;  3C98 A;  3CHO A;  5G05 C;  2F37 A;  4G2V A;  3FTZ A;  1D8D A;  4RG9 A;  4WWO A;  3FUK A;  1Y6I A;  2MYO A;  4PS8 A;  3B7U X;  2UWJ G;  4K03 A;  4GCN A;  1IHG A;  3L17 A;  4XX5 A;  3RKV A;  3OXL A;  4FA6 A;  3CK9 A;  1N95 A;  4JEH A;  3UM1 A;  3PUK A;  3HXF A;  4ANV A;  4F53 A;  4NUR A;  3CVL A;  2XGO A;  4U63 A;  4BES A;  4TXP A;  4B89 A;  3L22 A;  4BSZ B;  3PUJ A;  1N4P A;  3TL5 A;  3I3N A;  2XCB A;  2P9I G;  3OXF A;  5AJD A;  1FPP A;  3FTV A;  4KZC A;  2C0M A;  5KBA A;  5BXO A;  3HRA A;  3CLJ A;  1YYH A;  3DPY A;  2RD0 A;  1O1R A;  5AJL A;  4OVV A;  3Q78 A;  5EX3 A;  3FUH A;  5EYL A;  2GRN B;  1Z3Y A;  3Q15 A;  3SI5 A;  4JPS A;  2V8S E;  2JLB A;  4I6E A;  4JA7 A;  2XRY A;  2H6F A;  2P58 C;  2IJG X;  4FHJ A;  5J08 A;  3EHQ A;  3CSF A;  4GMR A;  2YHE A;  1X5B A;  1L5J A;  2DZO A;  1IKN D;  3ZN3 A;  2ETA A;  4I2Z A;  5B1A E;  2VGX B;  3UT7 A;  2DYR E;  4U96 D;  4GYW A;  1BD8 A;  3D9P A;  3EUV A;  3SNX A;  3IEG A;  5T4Y A;  3E34 A;  3TXM A;  3RSE G;  2FO1 E;  3G2V A;  1WG0 A;  5LCW C;  1TN8 A;  2WMN A;  3ENE A;  5D0Q D;  1NFI E;  2KAT A;  4URK A;  3URZ A;  2R17 C;  4UWK A;  1OWP A;  1OWN A;  3CR3 A;  2I9C A;  3ZKJ A;  1IQU A;  4DX5 D;  3LS8 A;  3FU5 A;  3U64 A;  4GZ5 A;  4HXI A;  1OCO E;  5HQ8 A;  4B0Z A;  4GPM A;  3HVE A;  3LY7 A;  3DXK G;  2DCP A;  3ZHE B;  2VSY A;  2QYU A;  4N3A A;  3KAE A;  5ANR A;  3PZ4 A;  3OTN A;  2R59 A;  3JQ0 A;  1FVF A;  3CVP A;  1O5M A;  2ZGD A;  3JCK C;  4Q69 A;  2XCC A;  5AN8 A;  4YDO A;  4YDE A;  3CHS A;  4JB8 P;  3FEX A;  2KCK A;  3SFY A;  2X6H A;  2XRZ A;  3O4Z A;  2KC7 A;  4JC8 A;  3S2A A;  2Y4T A;  3ZYL A;  1QBQ A;  1KT1 A;  4XKB A;  3CEQ A;  3FEY A;  2J8S D;  3AG2 E;  2WXN A;  5FZS A;  1DVP A;  4GZ3 A;  3G2S A;  2VYI A;  2KBX A;  4XKC A;  3EHR A;  3UPV A;  4GMJ A;  4GA0 A;  5T8I A;  4QFV A;  1G3N B;  5A23 A;  4O60 A;  4DI4 A;  3AU4 A;  2YQ8 A;  2ZIR A;  3ULY A;  3ZGQ A;  2LNI A;  4GTT A;  3UKR G;  3U9W A;  3PH0 C;  4FJZ A;  3UI2 A;  3EJN A;  3T5V A;  4JHJ A;  4IN3 B;  5ARG A;  3OXG A;  4FU3 A;  1EDU A;  2V4L A;  4L9P A;  4L2L A;  4XEI G;  5FTP A;  3UX4 A;  4BET A;  4ANU A;  4FAD A;  3HXE A;  3NOG D;  1MX6 A;  3E37 A;  4J8F A;  4IRU A;  5ENR D;  5D0O D;  5JA4 D;  2ZGG A;  3ZYK A;  3NAW A;  5G05 J;  2R02 A;  3AAA C;  1ELW A;  1N4S A;  3TWR A;  3TWT A;  1UOH A;  5EKQ D;  4A1G A;  4JZY A;  3ISM C;  4DUI A;  3B7S A;  4ATZ D;  4WND A;  2B6C A;  2QZA A;  2GRP B;  1HX8 A;  3FH5 A;  3MX3 A;  3PZ1 A;  3T8M A;  3TWQ A;  1A17 A;  4WAF A;  2PQN A;  4TUU A;  4U04 A;  4J8S A;  3FU3 A;  1AWC B;  4CZ2 D;  2DVW A;  5LOZ A;  4C9B B;  4BWR A;  3CKC A;  5KJL A;  2A5U A;  3ZEF A;  4LNU D;  5ENN A;  2PQR A;  1UJJ A;  1QNF A;  4UQZ A;  4XIF A;  2L6B A;  4CT4 A;  2VSO E;  4GYY A;  4GPK A;  4GTR A;  5FT9 A;  4AY5 A;  4IUL A;  4B8A A;  4DLO A;  4AIF A;  3TWW A;  2UY1 A;  3CGH A;  1FT2 A;  3ZNG A;  2Y4U A;  4BEP A;  1RW2 A;  1OWL A;  3SFX A;  4XI9 A;  3Q73 A;  5CBN A;  3KSQ A;  4CRW A;  4PDX A;  1OXJ A;  2R5S A;  4UUC A;  5FWQ A;  3FFL A;  1HE8 A;  5CBO A;  4APF A;  5IY5 E;  3LVR E;  4U7E B;  1D9S A;  1EF1 C;  2PZI A;  3JQ1 A;  4GZC A;  3K9I A;  4KVM A;  2M63 A;  3V79 K;  3FU6 A;  3NBN B;  4I1M A;  2BKG A;  1E8W A;  2I6H A;  4N3C A;  3KSL A;  3APD A;  2DYS E;  3LJ3 A;  1WAO 1;  3EDT B;  2WXF A;  1IXV A;  4AP2 A;  3L9T A;  4K5C A;  3G2T A;  1KZP A;  2AXZ A;  2EIK E;  4RSY A;  3CVV A;  2P9S G;  1E7V A;  2XHE A;  4BSX A;  4LG6 A;  4HI8 A;  1KZO A;  5CHE E;  2GRL A;  2XGS A;  3HVE B;  2I1K A;  2L0I A;  5BNW A;  1Z3X A;  3I4R B;  5EN5 D;  3L6A A;  3ZXP A;  1N4Q A;  1N4R A;  4ACL A;  3Q5M A;  4U0Z A;  3HYM B;  1IQR A;  3UM3 A;  3MEK A;  4EHM A;  1ZU2 A;  1N52 A;  3FUF A;  1LF8 A;  3DST A;  5AQB A;  4HOT A;  1ZBP A;  3LYA A;  4MBG A;  4HRN A;  4K5B A;  3QWP A;  4EQF A;  2BKK B;  1HF8 A;  4LNB A;  1JCR A;  4HOR A;  3HHM A;  3N71 A;  1OCZ E;  4BTA A;  2NYJ A;  3MYV A;  3MJW A;  4DK5 A;  5EYP F;  4LER A;  3E30 A;  3B13 A;  4BER A;  4G26 A;  3ASH A;  1JPL A;  2EQX A;  2V0P A;  1E7U A;  2DWZ A;  1S64 A;  2IU1 A;  4B8C B;  1YA0 A;  1LD8 A;  5D2M C;  1K8K G;  2BF0 X;  3G2U A;  1H2T C;  2VTB B;  3QB2 A;  2E2E A;  1MHQ A;  2X6F A;  2WQ7 A;  1H6O A;  3QWW A;  4R7L A;  3WG7 E;  2KZT A;  3OAW A;  1K1A A;  2P9K G;  1PY1 A;  3PEV B;  4MRU A;  3L13 A;  4L2Y A;  2J9Q A;  3C3O A;  3APC A;  4FC8 A;  3IKO B;  4UQX A;  3L54 A;  1PC2 A;  3ZUV B;  2XPI A;  4AM9 A;  3LJN A;  4DX2 A;  4FLH A;  1K1B A;  5H7P A;  4PS3 A;  3L08 A;  2GW1 A;  1ELR A;  2C2L A;  2XEH A;  4HFG A;  3X2Q E;  4LRZ A;  2MHK A;  3QOU A;  2Y69 E;  2V4H C;  3ONL A;  3D3M A;  3SBT B;  4Z68 A;  4GTQ A;  2AW6 A;  2EIM E;  2EIL E;  4CCA A;  4DRX E;  4JA9 A;  1HH8 A;  3D9I A;  1S63 A;  5FQ8 A;  1SZ9 A;  4YDY A;  4BX9 A;  2PL2 A;  5ENQ D;  3L16 A;  5KNH D;  3DWL G;  3SGH A;  2V5Q C;  3PZ2 A;  2GRQ B;  4I6J A;  3ZIM A;  3Q49 B;  5LCW J;  5CED B;  4ILG A;  1U2V G;  3LPZ A;  3RO2 A;  3CHM A;  1UN8 A;  5J90 A;  4HI9 A;  2IY0 C;  5B1B E;  3MKQ B;  1RZ4 A;  2CG2 A;  3FU0 A;  4DPR A;  2J4B A;  5KNG A;  3BG0 B;  4G25 A;  4GZD A;  3E33 A;  2AVP A;  4AOF A;  2X6I A;  5CEC B;  2XPZ A;  3EHM A;  1Z5S C;  4JEU A;  1H6K A;  5CMW A;  3ONK A;  4G11 A;  2WXL A;  2WXQ A;  4XE0 A;  4CDN A;  2PM7 A;  3CHP A;  4E85 A;  3SZ7 A;  4BT9 A;  2WM9 A;  2LAI A;  3DSX A;  3Q9U C;  4EZK A;  3DSV A;  4TV3 A;  4I9C A;  3U3W A;  5FQ6 A;  4GML A;  3LY9 A;  4I2W A;  2Y3A A;  4N2S A;  2J49 A;  3QWV A;  2FBN A;  3WXX A;  4UWF A;  2ETC A;  2F8Y A;  3D9H A;  3UTM A;  1OWM A;  3APF A;  2VJ8 A;  4CGW A;  3UM0 A;  4L7T A;  3VLF A;  2XEE A;  5C2Y A;  3BG1 B;  1SVX A;  3W9G A;  4GB9 A;  3RK6 A;  3LCA A;  4GTV A;  3MCX A;  2UY1 B;  1E96 B;  1NA3 A;  4W9R A;  2KCV A;  1MX4 A;  3PE3 A;  4AVX A;  3UIO C;  4A55 A;  1SQM A;  3QDN A;  4ABN A;  1JCQ A;  5FIO A;  5M72 A;  2F0Y A;  1SA4 A;  4G1T A;  2WQ6 A;  2FF4 A;  3HDX A;  2QYJ A;  4TXR A;  3GW4 A;  3ABL E;  1W3B A;  5EX0 A;  3FTS A;  4CYM D;  3PNT B;  3FTX A;  3SQV A;  3VTY A;  4FHK A;  4O6F A;  1TR4 A;  5EIL A;  4PUC A;  5AYW D;  3FUJ A;  5BW8 C;  3FTW A;  5ITZ F;  2IF4 A;  3CVN A;  4O1P A;  4EEC A;  5CCM A;  3ZYM A;  4RVB A;  4FJY A;  3UIP C;  1IHB A;  3FUL A;  2CFZ A;  3FH8 A;  3ZYQ A;  3CK8 A;  1JWG A;  4KVO A;  4UQY A;  2LO6 A;  2YNQ A;  2HE0 A;  4UI9 C;  5AAO A;  3Q47 B;  3HIZ A;  5HS0 A;  5CCL A;  3SO8 A;  1TNY A;  1O1S A;  4KT6 B;  1BPO A;  4JHR A;  4Q96 A;  1KT0 A;  3BQO A;  3B7B A;  2BED A;  2OND A;  4HVB A;  3G2W A;  1UJK A;  4A3T A;  1V55 E;  3JXI A;  1U3D A;  3Q75 A;  4A63 B;  1XNF A;  3RJV A;  2CHW A;  3RU0 A;  3Q7A A;  2XEN A;  4HOU A;  5FJY A;  4GA1 A;  4H7Y A;  4YVQ C;  4G23 A;  4Y6W A;  3MV2 B;  1ZB1 A;  2XZT G;  2LSU A;  5A6C A;  1N94 A;  4HQD A;  3CHQ A;  4GYO A;  3ZPJ A;  1EYH A;  3BUA A;  5EID A;  4WNG A;  2WXH A;  3S7D A;  4HB5 A;  2J4D A;  3D9J A;  2ZU6 B;  2GRO B;  1UW4 B;  4Q94 A;  3CVQ A;  5KJM A;  3FUD A;  4N39 A;  3KEZ A;  1NL4 A;  3NZU A;  1H2U A;  2AJA A;  5DIZ A;  4HNA D;  4U0U A;  3SY2 A;  3AS4 A;  1MYO A;  4B94 A;  2H6I A;  4JL0 A;  4N5Q A;  1HO8 A;  1QQE A;  1FCH A;  4ILH B;  3HXC A;  3T5X A;  2HO1 A;  3MGB A;  4TXQ A;  4GAA A;  1TYQ G;  4BY6 A;  1E8X A;  5G04 J;  1INZ A;  4NIK A;  3GZ2 A;  3DSW A;  3GZS A;  2JEK A;  2JAB A;  4HOQ A;  2VGE A;  5EDS A;  3FWV A;  2AXV A;  3MV3 B;  3CST A;  5ANL A;  3E4B A;  4DX7 D;  2FI7 A;  2QC9 A;  3PRE A;  3FUM A;  1HG2 A;  2R05 A;  1TN6 A;  1TEZ A;  5AEN A;  4OYS A;  2IQC A;  3DBS A;  5KJK A;  2EIN E;  4PH4 B;  3QNK A;  5EIB E;  5JJ7 A;  5LX8 A;  1FT1 A;  4N3B A;  3UUX A;  2AXU A;  2ZIS A;  3P1U A;  5BXU A;  2IO2 C;  3JUE A;  3KEA A;  4I1A A;  4JVS A;  2I2O A;  3JYS A;  3KS2 A;  3C72 A;  3DXM G;  4WWN A;  3D9M A;  3PS6 A;  4I1O B;  4OAV B;  4WWP A;  4ME2 A;  3L82 A;  4RG6 A;  3AG1 E;  3AG3 E;  3R9M A;  3TXN A;  3DRA A;  4JD2 G;  2FO7 A;  3V30 A;  1OUV A;  2GGF A;  4ZHB A;  3CVW A;  4OVU A;  1HG5 A;  1MZC A;  3FH7 A;  3TG5 A;  2DIW A;  5BPP A;  2QFC A;  2X38 A;  4F7A A;  4C48 B;  4APO A;  3QAQ A;  3Q7F A;  3D9N A;  4MS6 A;  5JHA A;  3TWV A;  1MX2 A;  5BT1 A;  4KBQ A;  4U07 A;  2IO3 C;  3CHR A;  5CEA A;  4YDW A;  4HLL A;  5C1D A;  1H6P A;  4GTO A;  2B0O E;  5AQ7 A;  3TAX A;  3ZU7 B;  4ATG A;  4HRM B;  3VLD A;  1AP7 A;  3ZXS A;  2LSV A;  3DEO A;  2PNN A;  4AJW A;  1VDY A;  2YHC A;  3IHV A;  4UWL A;  2E0I A;  2QY7 A;  3ZVV A;  3IHY A;  3RO3 A;  3ZHE A;  2WMO A;  3C3Q A;  3R7R A;  2LUH A;  3F6Q A;  4E6H A;  2MRI A;  3EIJ A;  1OCR E;  3Q9N C;  4CT0 A;  1DNP A;  2VGY A;  4MKT A;  4L1B A;  3UT4 A;  4X8Q A;  3ASD A;  2EIJ E;  3BU8 A;  3SD5 A;  3AU5 A;  2X6K A;  3B95 A;  5CRV A;  4GZ6 A;  3C3R A;  2HM8 A;  3FDH A;  3ULE G;  4GTS A;  4UWG A;  4KXK B;  4K5A B;  4C0M A;  4RLY A;  1BI7 B;  3NF1 A;  4ANX A;  5FZR A;  4DX1 A;  3S7F A;  5G2N A;  1H2V C;  4U95 D;  4ACK A;  1HS6 A;  1OCC E;  1JWF A;  4U8V D;  1NA0 A;  4EZJ A;  2XZD G;  3ABM E;  2ION A;  2A5E A;  1WY6 A;  1E90 A;  1N9A A;  5AAR A;  1PAQ A;  2P2C P;  5ARF A;  3B7T A;  5E75 A;  1N0Q A;  1TNO A;  5LP0 A;  1N11 A;  4LSZ E;  4GTP A;  4I17 A;  3LKU A;  2OOE A;  3RRN B;  3FP3 A;  2IFU A;  3U66 A;  2DBA A;  1TNU A;  2X6J A;  4G24 A;  4JW1 A;  4PS7 A;  1HZ4 A;  1SW6 A;  4WNF A;  2C0L A;  3AS8 A;  4O1O A;  4AY6 A;  1BU9 A;  2GRR B;  2J08 A;  3B7R L;  4HOS A;  2KXP C;  4F1P A;  2IOS A;  2LXM A;  4GCO A;  1UN9 A;  4HS2 A;  5AQA A;  1HFA A;  1TJC A;  3TJP A;  4WNE A;  2XEV A;  4LEU A;  2WPV A;  5FQ7 A;  3PNL B;  2XGM A;  3S7J A;  3IV0 A;  2FEZ A;  5ENO D;  3LXU X;  2H6H A;  2CG3 A;  5G04 C;  1S70 B;  3CK7 A;  2WXP A;  1TJF A;  4N5C A;  4KMO A;  1N54 A;  2DZN A;  5ENT D;  4P29 A;  2WXM A;  4HRL A;  2WXI A;  4OAU C;  2VSX E;  2XS1 A;  1DC2 A;  2NXP A;  1H19 A;  3DPD A;  3NB2 A;  3ZW3 A;  4UI9 J;  2OVB A;  3FY4 A;  4B93 B;  4L23 A;  5BUZ A;  2CHZ A;  4CEM A;  1BI8 B;  4CDM A;  2R03 A;  4LNG A;  4YND A;  5KCM A;  2OEV A;  2L6J A;  3QAR A;  5CMY A;  1JUQ A;  4IYP A;  4GTM A;  3PVL A;  2L9B A;  2NSZ A;  2OCC E;  2I1J A;  5E76 A;  3V2O A;  4WUY A;  3KD7 A;  4N2Q A;  3P2B A;  1XGW A;  5JMN D;  4ILI A;  3D9L A;  1WDY A;  1KPS B;  3ESL A;  3FUI A;  2NC9 A;  1YCS B;  2OEW A;  4BX8 A;  3ZFW A; 
#chains in the Genus database with same CATH homology
 2RFM A;  4QQI A;  4O60 A;  3ZNG A;  4O1O A;  5AQB A;  1NFI E;  2AJA A;  1BU9 A;  4BEP A;  3TWS A;  1IHB A;  4HNA D;  4HRN A;  2Y0B G;  4K5B A;  4Z68 A;  2KXP C;  3F6Q A;  4TUM A;  4F1P A;  5CBN A;  2ETC A;  2BKK B;  2F8Y A;  4OAV B;  3D9H A;  3UTM A;  5AQA A;  2HE0 A;  3Q9N C;  3UI2 A;  4HBD A;  4DRX E;  5AAO A;  1MYO A;  4U8Y D;  5KBA A;  3ZKJ A;  1BLX B;  1OT8 A;  5BXO A;  4UUC A;  4DX5 D;  5HS0 A;  3SO8 A;  5CBO A;  2XEE A;  4BET A;  2NYJ A;  5ENP D;  3C5R A;  3JXJ A;  3HRA A;  5ENO D;  4N5Q A;  4YDY A;  5EYP F;  1SVX A;  3B7B A;  3W9G A;  1YYH A;  2RFA A;  3B95 A;  3NOG D;  1MX6 A;  1S70 B;  4BER A;  1D9S A;  5ENQ D;  5ENR D;  5JA4 D;  2DZN A;  3DEP A;  2ZGG A;  3V30 A;  5KNH D;  5ENT D;  3HG0 D;  2V5Q C;  4F6R D;  4GPM A;  2DWZ A;  4ZHB A;  1A5E A;  5AQ9 A;  3JXI A;  4K5A B;  3T9K A;  1N0R A;  4HRL A;  3AAA C;  3TWR A;  3V79 K;  5CED B;  1QYM A;  3TWT A;  3TWU A;  4OAU C;  1OY3 D;  4A63 B;  3NBN B;  4NIK A;  1UOH A;  4RLY A;  5ENS D;  1MX4 A;  2F8X K;  1DC2 A;  1BI7 B;  2JAB A;  4C48 B;  5EYL A;  2BKG A;  5CER B;  4HI9 A;  4DUI A;  2VGE A;  4DX1 A;  2F37 A;  1MJ0 A;  4ATZ D;  4U95 D;  3AJI A;  5FIO A;  4U8V D;  1YMP A;  2ZGD A;  3TWV A;  4B93 B;  2MYO A;  5KWD A;  2XZD G;  1BI8 B;  1MX2 A;  1IXV A;  2XEN A;  4J8Y A;  5KNG A;  5AN8 A;  3UXG A;  3TWQ A;  4DX7 D;  4K5C A;  5CEA A;  4YDW A;  1K3Z D;  2A5E A;  1K1A A;  5CEC B;  4HLL A;  3T8K A;  2QC9 A;  2XZT G;  4G8K A;  4JB8 P;  1AWC B;  3EHQ A;  4CZ2 D;  3J5P A;  3TWX A;  2B0O E;  2DVW A;  4GMR A;  2QYJ A;  4ZFH A;  2DZO A;  4HQD A;  5AQ7 A;  4CYM D;  1IKN D;  4LG6 A;  5HKP A;  3ZU7 B;  5D66 A;  3EU9 A;  4HI8 A;  5AAR A;  3ZUV B;  4HRM B;  2P2C P;  3IXE A;  1DCQ A;  4LNU D;  3W9F A;  1AP7 A;  2ETA A;  3J5Q B;  5EID A;  1N0Q A;  3LJN A;  4G8L A;  3V2O A;  4DX2 A;  5EIB E;  1TR4 A;  3DEO A;  1K1B A;  4HB5 A;  1N11 A;  4J7W A;  4LSZ E;  2L6B A;  2J8S D;  2ETB A;  2PNN A;  3NOC D;  5JMN D;  3V2X A;  2XEH A;  5EN5 D;  5EIL A;  5HRY A;  4U96 D;  5BXU A;  5FIN A;  4BES A;  1WDY A;  3V31 A;  1BD8 A;  2KBX A;  2Y1L E;  3Q9U C;  3JUE A;  4BSZ B;  3KEA A;  3EHR A;  4QFV A;  5ITZ F;  4O1P A;  4DX6 D;  1YCS B;  1G3N B;  1SW6 A;  2V4H C;  2FO1 E;  3TWW A;  1WG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...