5FINA

Darpins as a new tool for experimental phasing in protein crystallography
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
SDLGRKLLEAARAGQDDECRILMANGADVNAADNTGTTPLHLAAYSGHLEIVECLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NI3C DARPIN MUTANT5 HG-SITE N1
publication title Darpins as a New Tool for Experimental Phasing in Protein Crystallography
rcsb
source organism Synthetic construct
molecule tags Metal binding protein
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5finA00
3J5PA 4O1OA 1K1AA 1SW6A 2NYJA 3V2XA 3TWQA 3LJNA 5HS0A 3KEAA 3V30A 1BLXB 4CZ2D 3ZUVB 5EILA 2BKKB 3EHRA 2KXPC 2RFAA 2Y0BG 4J8YA 4DRXE 1AWCB 5AN8A 2Y1LE 2DZOA 5CERB 1SVXA 1BD8A 4F6RD 2ETBA 4HNAD 5AARA 2KBXA 3UTMA 4OAUC 1DC2A 3NOGD 1YMPA 5AQ9A 2L6BA 3B7BA 3D9HA 1DCQA 4HRNA 3NOCD 5CBOA 2F8XK 5EN5D 1YCSB 5ENQD 3B95A 3DEPA 4J7WA 1TR4A 5FIOA 2A5EA 1OY3D 4HQDA 5KNGA 1YYHA 5CECB 4HBDA 4ZFHA 4JB8P 4RLYA 4LG6A 3AAAC 5HRYA 3TWXA 3V31A 2XEEA 1WDYA 1IXVA 1D9SA 4BERA 4HI9A 3V2OA 4YDWA 4CYMD 5HKPA 4UUCA 5KWDA 1A5EA 2XEHA 5CEDB 3V79K 2V4HC 2XENA 5AQBA 4Z68A 2DWZA 3W9GA 1MX4A 2BKGA 2QC9A 3JUEA 4K5CA 4N5QA 2V5QC 4HRMB 1G3NB 4U96D 5ITZF 3NBNB 2ZGDA 4U8VD 3HG0D 5AQ7A 2J8SD 3IXEA 3TWTA 4ATZD 5JMND 3HRAA 4QFVA 4G8LA 5JA4D 3TWRA 1K1BA 3EU9A 3Q9NC 1BI8B 5EIDA 5FINA 5BXUA 3DEOA 4O60A 2DVWA 4GMRA 5AQAA 2FO1E 1MJ0A 4HB5A 3F6QA 2ZGGA 3JXJA 4DX7D 4U8YD 5ENOD 4HI8A 4BEPA 2QYJA 1IKND 2RFMA 5KBAA 2P2CP 3TWSA 1NFIE 2PNNA 2XZTG 4QQIA 4DX6D 3J5QB 1S70B 5EYLA 2VGEA 4LSZE 4K5BA 5ENSD 5KNHD 4DX5D 3TWWA 3SO8A 4BETA 3T9KA 3JXIA 3ZKJA 4K5AB 5CBNA 2XZDG 1MX2A 4G8KA 4C48B 1MX6A 1IHBA 2JABA 4GPMA 3UI2A 4BESA 2F37A 3W9FA 1OT8A 5CEAA 4O1PA 4B93B 1MYOA 3UXGA 2ETCA 1BI7B 2MYOA 5ENPD 4OAVB 4ZHBA 3C5RA 3AJIA 3EHQA 3TWUA 4BSZB 3T8KA 4TUMA 4HLLA 3ZNGA 1WG0A 4F1PA 5AAOA 5EIBE 3ZU7B 4DX2A 3TWVA 4U95D 1N0QA 2ETAA 2AJAA 4HRLA 1K3ZD 5D66A 5ENTD 2DZNA 4A63B 3Q9UC 1QYMA 5ENRD 5EYPF 1BU9A 1AP7A 4LNUD 1UOHA 4DUIA 1N0RA 4NIKA 4DX1A 4YDYA 5BXOA 2F8YA 2HE0A 2B0OE 1N11A
chains in the Genus database with same CATH superfamily
1A17A 2DIWA 2E0IA 3E30A 2FBNA 3CVQA 2WXRA 4I43A 3SFXA 1AWCB 2VTBA 2V5FA 3LVQE 3JYSA 4HNAD 2KBXA 3MKRA 3PS6A 4C9BB 1EDUA 4J7WA 3Q78A 4HQDA 3EDTB 3UX4A 4EBAA 4GTMA 4ZFHA 5LOZA 2WXGA 2GRRB 3R9MA 2X3MA 4U8HA 3T5XA 2KZTB 1UJJA 1ZU2A 5LP0A 3E32A 3PDNA 2XGSA 2XPIA 5A7DB 4ILHB 3QC1A 3VLDA 4GTOA 3IV0A 1WM5A 2GRLA 3ZYMA 4CRWA 1DNPA 4HB5A 3LPZA 4R7LA 4N3CA 4N2QA 2PL2A 4UWHA 2WXLA 1JCSA 1OWMA 3FH5A 3VLFA 3Q49B 5BV0A 1S70B 5EYLA 2VGEA 1TN8A 5JJ6A 3ZPJA 1HXIA 2WMOA 3EHQA 3AJIA 4IRUA 4KYOB 4F1PA 2E2EA 1EPUA 4ABNA 3CHSA 3S7JA 3FUIA 1NI1A 2ZU6B 2VJ8A 1HX8A 1UOHA 4LUNU 4RG6A 4CGVA 2AW6A 5D2MC 4F1SA 3FFLA 3LJNA 4HORA 3CKCA 5HS0A 4TV3A 4KZCA 4IULA 5FZQA 1SVXA 3IHVA 4GPKA 2OOEA 4DPRA 4APFA 4A1SA 5FWQA 5CECB 1Y6IA 3IHYA 3CVNA 2QYUA 3AU4A 1KPSB 3FH8A 4C0MA 3LY7A 2YQ8A 1HZ4A 4I1OB 2PM7A 2CHWA 4FLHA 4U0SA 3TWTA 3IXEA 2EIKE 3I4GA 3UKRG 5BUZA 4JXTA 3ENEA 3Q9NC 1N9AA 1BI8B 3OTNA 3ASHA 4EHMA 1X81A 3ABME 3ONKA 4BEPA 3CVWA 4GYWA 4LSZE 2I1KA 2EINE 1NA0A 4TRQA 1TJFA 3AG2E 1TNOA 2YHCA 3I3NA 3SHFA 1H2UA 4G1TA 2XZDG 4LERA 3DSXA 3ZFWA 5M72A 1JUQA 3PE3A 3CHMA 2HO1A 3ZU7B 4UI9C 1WY6A 4ILGA 1ZB1A 2WXMA 4OVVA 5JHAA 2L0IA 2XPYA 1HG2A 3CK8A 3CSFA 4HOUA 2LXLA 1N95A 3DSVA 4XI9A 4JZYA 4RVBA 1IQUA 4DRXE 3I5PA 1Z3XA 2OCCE 3DSSA 5FQ4A 4HRNA 3FUJA 4I6GA 3QWWA 4BTBA 2V8SE 4ANUA 4GZDA 3CHOA 5EX0A 4L7TA 1JCQA 1BPOA 3ZVVA 1TJCA 2V4LA 3FWVA 1HO8A 3G2VA 2NC9A 5EKQD 3I4RB 4GMLA 3ZEFA 2P9LG 1LD8A 3UQ3A 3T5VA 4O60A 1ELKA 1H0AA 1L5JA 2AWIA 5ENOD 1HU3A 3FU5A 1JWGA 2QYJA 1NA3A 4W9RA 4GTSA 2UWJG 3OXLA 4WWNA 1Z5SC 2FO7A 3PUJA 1LD7A 2XS1A 3T9KA 2RKKA 2WXPA 4NURA 3C3RA 3AS5A 4YVQC 4DJAA 4MLPA 5CEAA 4JA9A 1OXJA 3PZ3A 2XQ0A 5ARGA 3AS8A 4K0RA 4EZKA 1H6KA 4J8DA 3U4TA 4ANXA 1N0RA 5KJKA 4DX1A 3KSQA 1H6PA 4GAAA 4U07A 3S7FA 4H7XA 3ZHEB 5DBKA 3NOGD 4AEZC 3GZ2A 3B7TA 4KBQA 1V54E 4HVBA 4JEHA 4JB8P 2XEEA 1FPPA 4BERA 2VGYA 3L17A 4YDWA 3FUMA 1TN6A 3ZGQA 4BWRA 4N3BA 2X6KA 5FZSA 4AJWA 5LFAA 1HS6A 4PDXA 4AM9A 4D10C 4EBAG 3FDHA 4GCOA 3CK9A 2PQRA 4GMRA 4DX7D 3R7RA 3FTWA 2IONA 3UT4A 4GTTA 4UQXA 2AXUA 4K5BA 4NACA 4ACLA 3FU6A 1IHBA 2J9QA 2GRPB 4WNGA 4I2ZA 4HOSA 4UWLA 2C0MA 4JHKA 3R7QA 1SQMA 2ETAA 3MZLB 4LRZA 3B7UX 1QNFA 3D9PA 2J4DA 1RZ4A 4B89A 4GMJA 3Q15A 2MOWA 3EU5A 3RIBA 3EIJA 2BKKB 4U63A 2R2LA 2XS8A 1RW2A 4G2VA 2WQHA 4P29A 1YCSB 3DXMG 4KVMA 3PVLA 1OWNA 3PEUB 4HI9A 4BSXA 2WVIA 4UUCA 3V79K 4M3OA 1FT1A 4K5CA 2R05A 2FF4A 3MX3A 2OEWA 3RJVA 2IOLA 2OVBA 4I6JA 2ZGDA 4ATZD 1D8EA 4G8LA 2F0YA 5G55A 4OYSA 3ISMC 3FEXA 3E34A 2R17C 4MKTA 2ONDA 3HVEB 4JL0A 3BUAA 3JCKC 3VLEA 4AY5A 1D8DA 2R02A 5C1DA 3S7BA 3G2SA 3ULEG 3UI2A 2KM4A 3RRUA 2LO6A 3FTYA 3UXGA 4UI9J 2KATA 3SFZA 4OVUA 3ZNGA 1WG0A 1N94A 1N0QA 3ZYLA 3URZA 3DWLG 3FTZA 4A63B 5J90A 4GZ5A 3ASNE 5BXOA 1N11A 3FH7A 4WNEA 5AIJA 2BEDA 2NSZA 3NAWA 3P1UA 4I2WA 5CRVA 4TXQA 4F6RD 4FHJA 3APFA 4L9PA 3MGBA 4XKCA 2B6CA 1TR4A 2GRMA 4V3IA 3EHNA 3UIOC 1X5BA 5B3SE 2BKGA 2V5QC 4GB9A 3MYVA 5AJDA 2C2LA 3AS4A 3EUVA 1OWLA 3CVUA 3EU9A 5CMWA 2WQ6A 1IQRA 5BXUA 1SA5A 5AQAA 2FO1E 2WXKA 4KZ0A 2DYSE 2XGOA 5B1AE 2RFMA 4FJYA 3ULYA 2XZTG 5FJYA 2WXHA 4ACKA 3ESKA 5ARFA 4DX5D 2XPZA 4G26A 1SZ9A 1TNYA 2ZIRA 5LX8A 3AG1E 3U66A 3OXGA 3KAEA 2UY1B 3UIPC 1TNZA 1BU9A 4LNUD 4JHJA 1HF8A 2P9UG 4BX9A 3ASOE 3MKQB 3ZUVB 1NZNA 3EHRA 5CRUA 5CERB 3C72A 3GYZA 4RSYA 1DCQA 4UWKA 5CCMA 1OY3D 4HBDA 2DCPA 4GU5A 3VTXA 3C3OA 3CHQA 4XI0A 1O1TA 4CYMD 4EECA 4BY6A 2XEHA 4U04A 4XE0A 3BU8A 3HXFA 2V4HC 3HYMB 3P2BA 4N5QA 2GGFA 3SZ7A 4I1MA 5ITZF 4A55A 4U8VD 5AQ7A 1MZCA 1E90A 3RRNB 4QFVA 5JA4D 3L54A 4IN3B 4J0UA 4B8AA 1E8YA 1K1BA 3L08A 1O5MA 3JXJA 4N5CA 1IKND 5KJLA 5AYWD 2PNNA 4H7YA 1U3DA 4JHRA 3SO8A 3UM1A 3JXIA 1MX6A 5BPPA 2JABA 2H6FA 4GA0A 3AG4E 2JLBA 3HXDA 3ZHEA 3HDXA 3QOUA 4BSZB 3LKUA 4UWGA 4RQIA 1K3ZD 3FY4A 4GTQA 2IU1A 4PS8A 1NP7A 3KEZA 1Z3YA 1VDYA 4U0UA 3J5PA 1O1SA 3TWQA 3FUHA 2RFAA 4CDRA 3QWVA 1BD8A 4G23A 5KCMA 4OAUC 2VTBB 3UTMA 3FUKA 4G25A 2CFUA 3D9MA 3GZSA 1WAO1 2WQ7A 5KNGA 4KT6B 3CHPA 2RG8A 1WDYA 3NF1A 5HQ8A 3DPYA 2KCKA 3FULA 5FQ6A 3SNXA 2XENA 5AQBA 3FTVA 2QC9A 2X6HA 3CVLA 3ABKE 4FJZA 4E6HA 3CVYA 2V0PA 3LEWA 5CMYA 5FINA 3APCA 3Q47B 4M7CA 1UG3A 2WXIA 3QAQA 4GYYA 2WXNA 3QWPA 3ZIMA 4CDMA 4A1GA 5T4YA 3DSWA 4EZJA 5FT9A 3D9KA 1FVFA 2CG3A 2A4ZA 3QB2A 3ZN3A 3ZKJA 5CBNA 1S63A 4PUCA 3EIQC 1OCOE 1UJKA 3SY2A 3CQCB 2AVPA 2LAIA 3C98A 5IY5E 2WM9A 2AXZA 3S2AA 3MV2B 1IYGA 3D3MA 4NIKA 3APDA 4XZ4A 5ANRA 5D0QD 1KT1A 1JPLA 1SW6A 3FHEA 2NXPA 5G2NA 2IEJA 1N4PA 2DZOA 3ZYKA 2I1JA 3KS2A 4GZCA 2X6IA 4JVSA 3U9WA 5ENQD 3ZW3A 2CG2A 3Q7FA 1PY1A 4AV7A 3R9AB 4LG6A 5AENA 1UW4B 5HKPA 4B8CB 2M63A 3Q73A 4KXKB 3L22A 4J8FA 3RSEG 4PS3A 4DI4A 3O4ZA 3UUXA 2FEZA 3HRAA 1KLXA 4KVOA 3UKUG 3CIAA 3B7SA 3TWRA 4HXIA 4GZ6A 5HI7A 4U8YD 4FLBA 1N54A 1B89A 3J5QB 5JJ7A 1OCCE 4GA1A 5ENSD 3X2QE 4JEUA 3FUFA 4ILIA 2WPVA 5B1BE 4AVXA 1MX2A 5EDSA 3DPDA 4TXRA 3PE4A 1N4QA 1UN9A 1BI7B 3PEVB 3TWUA 3BEEA 3HXEA 2Q7FA 3TWVA 1KZOA 3UM2A 2OV8A 1Y8MA 3U3WA 1OWOA 1HE8A 3UM0A 1FVHA 5CCLA 3CEQA 4RG9A 5EILA 3UM3A 1N4RA 2Y1LE 4Y6WA 1DC2A 1OCZE 1HG5A 3UT7A 1OWPA 3DEPA 2H6GA 3AAAC 5HRYA 5DIZA 4EZLA 2WB2A 2P9SG 3LCAA 5H7PA 4LNGA 2VQ2A 2KZTA 2LUHA 2WXQA 3SFYA 4LNBA 2XGMA 2H6HA 4HRMB 1G3NB 4JA7A 2J8SD 1HH8A 4UI9K 2J09A 1Z6TA 3DXKG 1O1RA 4CT0A 1QZ2A 4DLQA 1MQSA 1U3CA 3TJPA 2UY1A 4PS7A 4L2LA 3NQPA 3D9LA 3ZXPA 1SZAA 5KNHD 1QQEA 4F7AA 3RK6A 2GRNB 1NL4A 3BG0B 4J8EA 2EILE 4YDEA 3FU0A 1FCHA 1OT8A 1TNUA 1ELWA 1MYOA 2MYOA 2IOSA 2EQXA 5EIBE 2VYIA 4NRHB 4U95D 4ATGA 5E75A 4MS6A 1QYMA 1V55E 2HM8A 2OEVA 1INZA 3CQGB 1KT0A 4GTRA 3LJ3A 4EPZA 4O6FA 3ASGA 3V2OA 2HE0A 2B0OE 2YINA 3GW4A 4GZ3A 4CGWA 3KEAA 3LDZA 4CZ2D 3B7RL 4UWFA 2VSXE 2Y3AA 4NQ0A 4FULA 3L82A 1H2TC 4WWPA 5AQ9A 2L6BA 3ASDA 1TN7A 2Y4TA 3UMVA 3FTUA 2QY7A 4FP7A 2VSYA 1D9SA 2P9NG 2HYZA 5G04C 1FT2A 4TXPA 5KWDA 3S7DA 3L13A 1H19A 4U96D 5LCWC 2J07A 5JHBA 5BNWA 1S64A 3O48A 3Q7AA 4FU3A 3QK0A 3FU3A 4ME2A 3D9IA 3MA5A 4GYOA 2GW1A 3IKOB 4CEMA 2DBAA 4QQIA 2AXVA 3JQ1A 1EYHA 3CK7A 4YNDA 3UT8A 2R03A 2WMNA 3IEGA 4WUYA 2ETCA 2IQCA 2L0TB 4HLLA 4N39A 3DSUA 4G11A 3K9IA 2IF4A 2DZNA 1HFAA 1YA0A 3LVRE 4L2YA 4CDNA 4DUIA 4FA6A 4LCTA 2F8YA 2NYJA 3LS8A 1BLXB 2VGXB 3CLJA 3ULQA 3RO2A 2PM6A 2MHKA 4GTPA 3D9HA 3GZ1A 2ZXWE 4AY6A 3B95A 4F53A 2A5EA 1OCRE 1XNFA 5FTPA 2YNQA 2JEKA 1IHGA 1TEZA 3JUEA 3BQOA 3B13A 4A3VA 2XRZA 4KMOA 3NBNB 4DLOA 4J8SA 3ML9A 1SA4A 5E76A 2RD0A 3PZ1A 3G2WA 4F3VA 3HIZA 3SGHA 5EIDA 1H2VC 3QJZA 2DVWA 4WNDA 4APOA 3LY9A 4HFGA 2EIME 3Q75A 4AP2A 4HS2A 2CFZA 2P9KG 4JPSA 2WXOA 3HHMA 4G8KA 4I9EA 4B94A 4GTVA 3MCXA 3NB2A 1UN8A 4B93B 3TGOA 3L16A 4I9CA 3RU0A 1JWFA 4AXHA 4HOTA 4DX2A 1XGWA 4BFRA 2AJAA 4AOFA 2LXMA 2YHEA 1AP7A 3CV0A 2IO3C 4XX5A 1K1AA 2QFCA 3CHRA 3V30A 5FQ7A 3PUKA 1E7UA 3DBSA 3TAXA 3BG1B 1QBQA 2IY0C 2DYRE 3HXCA 3NOCD 2F8XK 3SI5A 5EN5D 2X38A 4G24A 4RLYA 3TWXA 2IFUA 2LSVA 2Y4UA 3RO3A 4BTAA 4EQFA 3RAUA 4C0EA 1A5EA 4Z68A 3W9GA 4J6IA 3D9OA 2LSUA 2X6FA 3PNTB 3ZRHA 2LAHA 4PH4B 4U0ZA 1W3BA 3G2TA 3QDNA 4B0ZA 4I1AA 5A23A 4FADA 2BUGA 2P2CP 3TWSA 2PQNA 3Q4AB 3E4BA 4ANVA 4BETA 2IO2C 1E7VA 1K8KG 5G05C 4ANWA 4GPMA 3W9FA 4TUUA 4WWOA 2VSOE 1U2VG 2CHZA 5T8IA 5J08A 2J4BA 3C5RA 2IJGX 3ML8A 3DSTA 1DCEA 2BTDA 2PZIA 3SD5A 3WG7E 4HRLA 4XIFA 2XRYA 2GRQB 3Q9UC 1E8WA 3JUIA 4YDYA 3UPVA 4O1OA 3V2XA 4BT8A 3TXNA 4XKBA 3FP3A 2Y0BG 3N71A 4Q94A 3LYAA 3CVPA 2I2OA 1YMPA 2I6HA 2GROB 4YDOA 5G04J 3TXMA 1EF1C 3WXXA 1IXVA 3PRZA 3QKYA 3PZDA 2H6IA 3FTXA 2DWZA 1MX4A 5LCWJ 3FTSA 3HG0D 3HXBA 2KCLA 2MRIA 1Q2ZA 2FULA 4N3AA 4I17A 4LEUA 1LF8A 3L9TA 3Q79A 3F6QA 4L23A 3FUNA 2XHEA 5KBAA 3HVEA 2KC7A 2A5UA 2XCCA 4HOQA 4DX6D 1GW6A 4JC8A 5EX3A 4BT9A 3TWWA 5AJLA 1JCRA 4K5AB 4BESA 2F37A 4WNFA 4FHKA 3NZUA 4O1PA 4UQYA 4UQZA 3CVXA 3FUEA 5BT1A 3OXFA 5ENTD 5D66A 3CKBA 4E85A 2CHXA 4L1BA 3NZSA 3IBEA 5JJTA 4YVOA 1KZPA 1OUVA 2J49A 3SQVA 1E8XA 2KXPC 4J8YA 4MRUA 3OAWA 3B7BA 4XEIG 2ILRA 3TG4A 1YYHA 2Y69E 2BF0X 4FC8A 4N2SA 1DVPA 3V31A 4HLEA 3RKVA 2L9BA 3ZYQA 3D9JA 4JD2G 5BW8C 5CEDB 2R59A 4WAFA 1MHQA 1N4SA 3SBSA 4IYPA 5JMND 4Q69A 5T3RA 3U64A 3CSTA 1PC2A 3DEOA 5ENNA 3LXUX 5C2YA 5FZRA 3KSLA 3PREA 4DI3A 4DK5A 1E96B 3C3QA 4C48B 3ESLA 3PZ2A 1H6OA 2X6JA 3E37A 2VGXA 5BV1A 3ABLE 4ZHBA 2KCVA 3T8KA 4TUMA 2P58C 5AAOA 3QARA 2FI7A 3DRAA 2P9IG 2XCBA 3MEKA 5EYPF 3TG5A 5ANLA 4URKA 3EHMA 2P9PG 1LTXA 5FQ8A 2C0LA 3MKQA 3PNLB 3UINC 5CHEE 4Y6CA 3MV3B 5AN8A 2ETBA 5AARA 3SBTB 4CCAA 5CBOA 1E8ZA 5KJMA 3AU5A 2ZISA 5FIOA 5D0OD 4K03A 2WXJA 4Q96A 3L6AA 4JW1A 3ONLA 4GCNA 3T8MA 3CR3A 4I6EA 2EIJE 2J08A 1TNBA 3D9NA 4X8QA 2WXFA 3SF4A 3RRMB 2LNIA 4GA2A 3TL5A 3PH0C 3CGHA 2HR2A 3ZXSA 5KJNA 2XEVA 3FEYA 2I9CA 1MJ0A 2OVFA 4AIFA 2ZGGA 4HI8A 4BX8A 3MJWA 1PAQA 1NFIE 3AG3E 3PZ4A 5G05J 3JQ0A 3KD7A 3CVVA 2R5SA 3ASFA 2QZAA 4MBGA 3G2UA 1P5QA 3QNKA 2L6JA 4CT4A 1TYQG 4OAVB 3VTYA 5ENPD 1ZBPA 3FUDA 1N52A 4A3TA 3LY8A 3E33A 4U7EB 1S0PA 3EJNA 5A6CA 1ELRA 5ENRD 3Q5MA 2VSNA
chains in the Genus database with same CATH topology
3J5PA 4O1OA 1K1AA 1SW6A 2NYJA 3V2XA 3TWQA 3LJNA 5HS0A 3KEAA 3V30A 1BLXB 4CZ2D 3ZUVB 5EILA 2BKKB 3EHRA 2KXPC 2RFAA 2Y0BG 4J8YA 4DRXE 1AWCB 5AN8A 2Y1LE 2DZOA 5CERB 1SVXA 1BD8A 4F6RD 2ETBA 4HNAD 5AARA 2KBXA 3UTMA 4OAUC 1DC2A 3NOGD 1YMPA 5AQ9A 2L6BA 3B7BA 3D9HA 1DCQA 4HRNA 3NOCD 5CBOA 2F8XK 5EN5D 1YCSB 5ENQD 3B95A 3DEPA 4J7WA 1TR4A 5FIOA 2A5EA 1OY3D 4HQDA 5KNGA 1YYHA 5CECB 4HBDA 4ZFHA 4JB8P 4RLYA 4LG6A 3AAAC 5HRYA 3TWXA 3V31A 2XEEA 1WDYA 1IXVA 1D9SA 4BERA 4HI9A 3V2OA 4YDWA 4CYMD 5HKPA 4UUCA 5KWDA 1A5EA 2XEHA 5CEDB 3V79K 2V4HC 2XENA 5AQBA 4Z68A 2DWZA 3W9GA 1MX4A 2BKGA 2QC9A 3JUEA 4K5CA 4N5QA 2V5QC 4HRMB 1G3NB 4U96D 5ITZF 3NBNB 2ZGDA 4U8VD 3HG0D 5AQ7A 2J8SD 3IXEA 3TWTA 4ATZD 5JMND 3HRAA 4QFVA 4G8LA 5JA4D 3TWRA 1K1BA 3EU9A 3Q9NC 1BI8B 5EIDA 5FINA 5BXUA 3DEOA 4O60A 2DVWA 4GMRA 5AQAA 2FO1E 1MJ0A 4HB5A 3F6QA 2ZGGA 3JXJA 4DX7D 4U8YD 5ENOD 4HI8A 4BEPA 2QYJA 1IKND 2RFMA 5KBAA 2P2CP 3TWSA 1NFIE 2PNNA 2XZTG 4QQIA 4DX6D 3J5QB 1S70B 5EYLA 2VGEA 4LSZE 4K5BA 5ENSD 5KNHD 4DX5D 3TWWA 3SO8A 4BETA 3T9KA 3JXIA 3ZKJA 4K5AB 5CBNA 2XZDG 1MX2A 4G8KA 4C48B 1MX6A 1IHBA 2JABA 4GPMA 3UI2A 4BESA 2F37A 3W9FA 1OT8A 5CEAA 4O1PA 4B93B 1MYOA 3UXGA 2ETCA 1BI7B 2MYOA 5ENPD 4OAVB 4ZHBA 3C5RA 3AJIA 3EHQA 3TWUA 4BSZB 3T8KA 4TUMA 4HLLA 3ZNGA 1WG0A 4F1PA 5AAOA 5EIBE 3ZU7B 4DX2A 3TWVA 4U95D 1N0QA 2ETAA 2AJAA 4HRLA 1K3ZD 5D66A 5ENTD 2DZNA 4A63B 3Q9UC 1QYMA 5ENRD 5EYPF 1BU9A 1AP7A 4LNUD 1UOHA 4DUIA 1N0RA 4NIKA 4DX1A 4YDYA 5BXOA 2F8YA 2HE0A 2B0OE 1N11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J5P A;  4O1O A;  1K1A A;  1SW6 A;  2NYJ A;  3V2X A;  3TWQ A;  3LJN A;  5HS0 A;  3KEA A;  3V30 A;  1BLX B;  4CZ2 D;  3ZUV B;  5EIL A;  2BKK B;  3EHR A;  2KXP C;  2RFA A;  2Y0B G;  4J8Y A;  4DRX E;  1AWC B;  5AN8 A;  2Y1L E;  2DZO A;  5CER B;  1SVX A;  1BD8 A;  4F6R D;  2ETB A;  4HNA D;  5AAR A;  2KBX A;  3UTM A;  4OAU C;  1DC2 A;  3NOG D;  1YMP A;  5AQ9 A;  2L6B A;  3B7B A;  3D9H A;  1DCQ A;  4HRN A;  3NOC D;  5CBO A;  2F8X K;  5EN5 D;  1YCS B;  5ENQ D;  3B95 A;  3DEP A;  4J7W A;  1TR4 A;  5FIO A;  2A5E A;  1OY3 D;  4HQD A;  5KNG A;  1YYH A;  5CEC B;  4HBD A;  4ZFH A;  4JB8 P;  4RLY A;  4LG6 A;  3AAA C;  5HRY A;  3TWX A;  3V31 A;  2XEE A;  1WDY A;  1IXV A;  1D9S A;  4BER A;  4HI9 A;  3V2O A;  4YDW A;  4CYM D;  5HKP A;  4UUC A;  5KWD A;  1A5E A;  2XEH A;  5CED B;  3V79 K;  2V4H C;  2XEN A;  5AQB A;  4Z68 A;  2DWZ A;  3W9G A;  1MX4 A;  2BKG A;  2QC9 A;  3JUE A;  4K5C A;  4N5Q A;  2V5Q C;  4HRM B;  1G3N B;  4U96 D;  5ITZ F;  3NBN B;  2ZGD A;  4U8V D;  3HG0 D;  5AQ7 A;  2J8S D;  3IXE A;  3TWT A;  4ATZ D;  5JMN D;  3HRA A;  4QFV A;  4G8L A;  5JA4 D;  3TWR A;  1K1B A;  3EU9 A;  3Q9N C;  1BI8 B;  5EID A;  5FIN A;  5BXU A;  3DEO A;  4O60 A;  2DVW A;  4GMR A;  5AQA A;  2FO1 E;  1MJ0 A;  4HB5 A;  3F6Q A;  2ZGG A;  3JXJ A;  4DX7 D;  4U8Y D;  5ENO D;  4HI8 A;  4BEP A;  2QYJ A;  1IKN D;  2RFM A;  5KBA A;  2P2C P;  3TWS A;  1NFI E;  2PNN A;  2XZT G;  4QQI A;  4DX6 D;  3J5Q B;  1S70 B;  5EYL A;  2VGE A;  4LSZ E;  4K5B A;  5ENS D;  5KNH D;  4DX5 D;  3TWW A;  3SO8 A;  4BET A;  3T9K A;  3JXI A;  3ZKJ A;  4K5A B;  5CBN A;  2XZD G;  1MX2 A;  4G8K A;  4C48 B;  1MX6 A;  1IHB A;  2JAB A;  4GPM A;  3UI2 A;  4BES A;  2F37 A;  3W9F A;  1OT8 A;  5CEA A;  4O1P A;  4B93 B;  1MYO A;  3UXG A;  2ETC A;  1BI7 B;  2MYO A;  5ENP D;  4OAV B;  4ZHB A;  3C5R A;  3AJI A;  3EHQ A;  3TWU A;  4BSZ B;  3T8K A;  4TUM A;  4HLL A;  3ZNG A;  1WG0 A;  4F1P A;  5AAO A;  5EIB E;  3ZU7 B;  4DX2 A;  3TWV A;  4U95 D;  1N0Q A;  2ETA A;  2AJA A;  4HRL A;  1K3Z D;  5D66 A;  5ENT D;  2DZN A;  4A63 B;  3Q9U C;  1QYM A;  5ENR D;  5EYP F;  1BU9 A;  1AP7 A;  4LNU D;  1UOH A;  4DUI A;  1N0R A;  4NIK A;  4DX1 A;  4YDY A;  5BXO A;  2F8Y A;  2HE0 A;  2B0O E;  1N11 A; 
#chains in the Genus database with same CATH topology
 1A17 A;  2DIW A;  2E0I A;  3E30 A;  2FBN A;  3CVQ A;  2WXR A;  4I43 A;  3SFX A;  1AWC B;  2VTB A;  2V5F A;  3LVQ E;  3JYS A;  4HNA D;  2KBX A;  3MKR A;  3PS6 A;  4C9B B;  1EDU A;  4J7W A;  3Q78 A;  4HQD A;  3EDT B;  3UX4 A;  4EBA A;  4GTM A;  4ZFH A;  5LOZ A;  2WXG A;  2GRR B;  3R9M A;  2X3M A;  4U8H A;  3T5X A;  2KZT B;  1UJJ A;  1ZU2 A;  5LP0 A;  3E32 A;  3PDN A;  2XGS A;  2XPI A;  5A7D B;  4ILH B;  3QC1 A;  3VLD A;  4GTO A;  3IV0 A;  1WM5 A;  2GRL A;  3ZYM A;  4CRW A;  1DNP A;  4HB5 A;  3LPZ A;  4R7L A;  4N3C A;  4N2Q A;  2PL2 A;  4UWH A;  2WXL A;  1JCS A;  1OWM A;  3FH5 A;  3VLF A;  3Q49 B;  5BV0 A;  1S70 B;  5EYL A;  2VGE A;  1TN8 A;  5JJ6 A;  3ZPJ A;  1HXI A;  2WMO A;  3EHQ A;  3AJI A;  4IRU A;  4KYO B;  4F1P A;  2E2E A;  1EPU A;  4ABN A;  3CHS A;  3S7J A;  3FUI A;  1NI1 A;  2ZU6 B;  2VJ8 A;  1HX8 A;  1UOH A;  4LUN U;  4RG6 A;  4CGV A;  2AW6 A;  5D2M C;  4F1S A;  3FFL A;  3LJN A;  4HOR A;  3CKC A;  5HS0 A;  4TV3 A;  4KZC A;  4IUL A;  5FZQ A;  1SVX A;  3IHV A;  4GPK A;  2OOE A;  4DPR A;  4APF A;  4A1S A;  5FWQ A;  5CEC B;  1Y6I A;  3IHY A;  3CVN A;  2QYU A;  3AU4 A;  1KPS B;  3FH8 A;  4C0M A;  3LY7 A;  2YQ8 A;  1HZ4 A;  4I1O B;  2PM7 A;  2CHW A;  4FLH A;  4U0S A;  3TWT A;  3IXE A;  2EIK E;  3I4G A;  3UKR G;  5BUZ A;  4JXT A;  3ENE A;  3Q9N C;  1N9A A;  1BI8 B;  3OTN A;  3ASH A;  4EHM A;  1X81 A;  3ABM E;  3ONK A;  4BEP A;  3CVW A;  4GYW A;  4LSZ E;  2I1K A;  2EIN E;  1NA0 A;  4TRQ A;  1TJF A;  3AG2 E;  1TNO A;  2YHC A;  3I3N A;  3SHF A;  1H2U A;  4G1T A;  2XZD G;  4LER A;  3DSX A;  3ZFW A;  5M72 A;  1JUQ A;  3PE3 A;  3CHM A;  2HO1 A;  3ZU7 B;  4UI9 C;  1WY6 A;  4ILG A;  1ZB1 A;  2WXM A;  4OVV A;  5JHA A;  2L0I A;  2XPY A;  1HG2 A;  3CK8 A;  3CSF A;  4HOU A;  2LXL A;  1N95 A;  3DSV A;  4XI9 A;  4JZY A;  4RVB A;  1IQU A;  4DRX E;  3I5P A;  1Z3X A;  2OCC E;  3DSS A;  5FQ4 A;  4HRN A;  3FUJ A;  4I6G A;  3QWW A;  4BTB A;  2V8S E;  4ANU A;  4GZD A;  3CHO A;  5EX0 A;  4L7T A;  1JCQ A;  1BPO A;  3ZVV A;  1TJC A;  2V4L A;  3FWV A;  1HO8 A;  3G2V A;  2NC9 A;  5EKQ D;  3I4R B;  4GML A;  3ZEF A;  2P9L G;  1LD8 A;  3UQ3 A;  3T5V A;  4O60 A;  1ELK A;  1H0A A;  1L5J A;  2AWI A;  5ENO D;  1HU3 A;  3FU5 A;  1JWG A;  2QYJ A;  1NA3 A;  4W9R A;  4GTS A;  2UWJ G;  3OXL A;  4WWN A;  1Z5S C;  2FO7 A;  3PUJ A;  1LD7 A;  2XS1 A;  3T9K A;  2RKK A;  2WXP A;  4NUR A;  3C3R A;  3AS5 A;  4YVQ C;  4DJA A;  4MLP A;  5CEA A;  4JA9 A;  1OXJ A;  3PZ3 A;  2XQ0 A;  5ARG A;  3AS8 A;  4K0R A;  4EZK A;  1H6K A;  4J8D A;  3U4T A;  4ANX A;  1N0R A;  5KJK A;  4DX1 A;  3KSQ A;  1H6P A;  4GAA A;  4U07 A;  3S7F A;  4H7X A;  3ZHE B;  5DBK A;  3NOG D;  4AEZ C;  3GZ2 A;  3B7T A;  4KBQ A;  1V54 E;  4HVB A;  4JEH A;  4JB8 P;  2XEE A;  1FPP A;  4BER A;  2VGY A;  3L17 A;  4YDW A;  3FUM A;  1TN6 A;  3ZGQ A;  4BWR A;  4N3B A;  2X6K A;  5FZS A;  4AJW A;  5LFA A;  1HS6 A;  4PDX A;  4AM9 A;  4D10 C;  4EBA G;  3FDH A;  4GCO A;  3CK9 A;  2PQR A;  4GMR A;  4DX7 D;  3R7R A;  3FTW A;  2ION A;  3UT4 A;  4GTT A;  4UQX A;  2AXU A;  4K5B A;  4NAC A;  4ACL A;  3FU6 A;  1IHB A;  2J9Q A;  2GRP B;  4WNG A;  4I2Z A;  4HOS A;  4UWL A;  2C0M A;  4JHK A;  3R7Q A;  1SQM A;  2ETA A;  3MZL B;  4LRZ A;  3B7U X;  1QNF A;  3D9P A;  2J4D A;  1RZ4 A;  4B89 A;  4GMJ A;  3Q15 A;  2MOW A;  3EU5 A;  3RIB A;  3EIJ A;  2BKK B;  4U63 A;  2R2L A;  2XS8 A;  1RW2 A;  4G2V A;  2WQH A;  4P29 A;  1YCS B;  3DXM G;  4KVM A;  3PVL A;  1OWN A;  3PEU B;  4HI9 A;  4BSX A;  2WVI A;  4UUC A;  3V79 K;  4M3O A;  1FT1 A;  4K5C A;  2R05 A;  2FF4 A;  3MX3 A;  2OEW A;  3RJV A;  2IOL A;  2OVB A;  4I6J A;  2ZGD A;  4ATZ D;  1D8E A;  4G8L A;  2F0Y A;  5G55 A;  4OYS A;  3ISM C;  3FEX A;  3E34 A;  2R17 C;  4MKT A;  2OND A;  3HVE B;  4JL0 A;  3BUA A;  3JCK C;  3VLE A;  4AY5 A;  1D8D A;  2R02 A;  5C1D A;  3S7B A;  3G2S A;  3ULE G;  3UI2 A;  2KM4 A;  3RRU A;  2LO6 A;  3FTY A;  3UXG A;  4UI9 J;  2KAT A;  3SFZ A;  4OVU A;  3ZNG A;  1WG0 A;  1N94 A;  1N0Q A;  3ZYL A;  3URZ A;  3DWL G;  3FTZ A;  4A63 B;  5J90 A;  4GZ5 A;  3ASN E;  5BXO A;  1N11 A;  3FH7 A;  4WNE A;  5AIJ A;  2BED A;  2NSZ A;  3NAW A;  3P1U A;  4I2W A;  5CRV A;  4TXQ A;  4F6R D;  4FHJ A;  3APF A;  4L9P A;  3MGB A;  4XKC A;  2B6C A;  1TR4 A;  2GRM A;  4V3I A;  3EHN A;  3UIO C;  1X5B A;  5B3S E;  2BKG A;  2V5Q C;  4GB9 A;  3MYV A;  5AJD A;  2C2L A;  3AS4 A;  3EUV A;  1OWL A;  3CVU A;  3EU9 A;  5CMW A;  2WQ6 A;  1IQR A;  5BXU A;  1SA5 A;  5AQA A;  2FO1 E;  2WXK A;  4KZ0 A;  2DYS E;  2XGO A;  5B1A E;  2RFM A;  4FJY A;  3ULY A;  2XZT G;  5FJY A;  2WXH A;  4ACK A;  3ESK A;  5ARF A;  4DX5 D;  2XPZ A;  4G26 A;  1SZ9 A;  1TNY A;  2ZIR A;  5LX8 A;  3AG1 E;  3U66 A;  3OXG A;  3KAE A;  2UY1 B;  3UIP C;  1TNZ A;  1BU9 A;  4LNU D;  4JHJ A;  1HF8 A;  2P9U G;  4BX9 A;  3ASO E;  3MKQ B;  3ZUV B;  1NZN A;  3EHR A;  5CRU A;  5CER B;  3C72 A;  3GYZ A;  4RSY A;  1DCQ A;  4UWK A;  5CCM A;  1OY3 D;  4HBD A;  2DCP A;  4GU5 A;  3VTX A;  3C3O A;  3CHQ A;  4XI0 A;  1O1T A;  4CYM D;  4EEC A;  4BY6 A;  2XEH A;  4U04 A;  4XE0 A;  3BU8 A;  3HXF A;  2V4H C;  3HYM B;  3P2B A;  4N5Q A;  2GGF A;  3SZ7 A;  4I1M A;  5ITZ F;  4A55 A;  4U8V D;  5AQ7 A;  1MZC A;  1E90 A;  3RRN B;  4QFV A;  5JA4 D;  3L54 A;  4IN3 B;  4J0U A;  4B8A A;  1E8Y A;  1K1B A;  3L08 A;  1O5M A;  3JXJ A;  4N5C A;  1IKN D;  5KJL A;  5AYW D;  2PNN A;  4H7Y A;  1U3D A;  4JHR A;  3SO8 A;  3UM1 A;  3JXI A;  1MX6 A;  5BPP A;  2JAB A;  2H6F A;  4GA0 A;  3AG4 E;  2JLB A;  3HXD A;  3ZHE A;  3HDX A;  3QOU A;  4BSZ B;  3LKU A;  4UWG A;  4RQI A;  1K3Z D;  3FY4 A;  4GTQ A;  2IU1 A;  4PS8 A;  1NP7 A;  3KEZ A;  1Z3Y A;  1VDY A;  4U0U A;  3J5P A;  1O1S A;  3TWQ A;  3FUH A;  2RFA A;  4CDR A;  3QWV A;  1BD8 A;  4G23 A;  5KCM A;  4OAU C;  2VTB B;  3UTM A;  3FUK A;  4G25 A;  2CFU A;  3D9M A;  3GZS A;  1WAO 1;  2WQ7 A;  5KNG A;  4KT6 B;  3CHP A;  2RG8 A;  1WDY A;  3NF1 A;  5HQ8 A;  3DPY A;  2KCK A;  3FUL A;  5FQ6 A;  3SNX A;  2XEN A;  5AQB A;  3FTV A;  2QC9 A;  2X6H A;  3CVL A;  3ABK E;  4FJZ A;  4E6H A;  3CVY A;  2V0P A;  3LEW A;  5CMY A;  5FIN A;  3APC A;  3Q47 B;  4M7C A;  1UG3 A;  2WXI A;  3QAQ A;  4GYY A;  2WXN A;  3QWP A;  3ZIM A;  4CDM A;  4A1G A;  5T4Y A;  3DSW A;  4EZJ A;  5FT9 A;  3D9K A;  1FVF A;  2CG3 A;  2A4Z A;  3QB2 A;  3ZN3 A;  3ZKJ A;  5CBN A;  1S63 A;  4PUC A;  3EIQ C;  1OCO E;  1UJK A;  3SY2 A;  3CQC B;  2AVP A;  2LAI A;  3C98 A;  5IY5 E;  2WM9 A;  2AXZ A;  3S2A A;  3MV2 B;  1IYG A;  3D3M A;  4NIK A;  3APD A;  4XZ4 A;  5ANR A;  5D0Q D;  1KT1 A;  1JPL A;  1SW6 A;  3FHE A;  2NXP A;  5G2N A;  2IEJ A;  1N4P A;  2DZO A;  3ZYK A;  2I1J A;  3KS2 A;  4GZC A;  2X6I A;  4JVS A;  3U9W A;  5ENQ D;  3ZW3 A;  2CG2 A;  3Q7F A;  1PY1 A;  4AV7 A;  3R9A B;  4LG6 A;  5AEN A;  1UW4 B;  5HKP A;  4B8C B;  2M63 A;  3Q73 A;  4KXK B;  3L22 A;  4J8F A;  3RSE G;  4PS3 A;  4DI4 A;  3O4Z A;  3UUX A;  2FEZ A;  3HRA A;  1KLX A;  4KVO A;  3UKU G;  3CIA A;  3B7S A;  3TWR A;  4HXI A;  4GZ6 A;  5HI7 A;  4U8Y D;  4FLB A;  1N54 A;  1B89 A;  3J5Q B;  5JJ7 A;  1OCC E;  4GA1 A;  5ENS D;  3X2Q E;  4JEU A;  3FUF A;  4ILI A;  2WPV A;  5B1B E;  4AVX A;  1MX2 A;  5EDS A;  3DPD A;  4TXR A;  3PE4 A;  1N4Q A;  1UN9 A;  1BI7 B;  3PEV B;  3TWU A;  3BEE A;  3HXE A;  2Q7F A;  3TWV A;  1KZO A;  3UM2 A;  2OV8 A;  1Y8M A;  3U3W A;  1OWO A;  1HE8 A;  3UM0 A;  1FVH A;  5CCL A;  3CEQ A;  4RG9 A;  5EIL A;  3UM3 A;  1N4R A;  2Y1L E;  4Y6W A;  1DC2 A;  1OCZ E;  1HG5 A;  3UT7 A;  1OWP A;  3DEP A;  2H6G A;  3AAA C;  5HRY A;  5DIZ A;  4EZL A;  2WB2 A;  2P9S G;  3LCA A;  5H7P A;  4LNG A;  2VQ2 A;  2KZT A;  2LUH A;  2WXQ A;  3SFY A;  4LNB A;  2XGM A;  2H6H A;  4HRM B;  1G3N B;  4JA7 A;  2J8S D;  1HH8 A;  4UI9 K;  2J09 A;  1Z6T A;  3DXK G;  1O1R A;  4CT0 A;  1QZ2 A;  4DLQ A;  1MQS A;  1U3C A;  3TJP A;  2UY1 A;  4PS7 A;  4L2L A;  3NQP A;  3D9L A;  3ZXP A;  1SZA A;  5KNH D;  1QQE A;  4F7A A;  3RK6 A;  2GRN B;  1NL4 A;  3BG0 B;  4J8E A;  2EIL E;  4YDE A;  3FU0 A;  1FCH A;  1OT8 A;  1TNU A;  1ELW A;  1MYO A;  2MYO A;  2IOS A;  2EQX A;  5EIB E;  2VYI A;  4NRH B;  4U95 D;  4ATG A;  5E75 A;  4MS6 A;  1QYM A;  1V55 E;  2HM8 A;  2OEV A;  1INZ A;  3CQG B;  1KT0 A;  4GTR A;  3LJ3 A;  4EPZ A;  4O6F A;  3ASG A;  3V2O A;  2HE0 A;  2B0O E;  2YIN A;  3GW4 A;  4GZ3 A;  4CGW A;  3KEA A;  3LDZ A;  4CZ2 D;  3B7R L;  4UWF A;  2VSX E;  2Y3A A;  4NQ0 A;  4FUL A;  3L82 A;  1H2T C;  4WWP A;  5AQ9 A;  2L6B A;  3ASD A;  1TN7 A;  2Y4T A;  3UMV A;  3FTU A;  2QY7 A;  4FP7 A;  2VSY A;  1D9S A;  2P9N G;  2HYZ A;  5G04 C;  1FT2 A;  4TXP A;  5KWD A;  3S7D A;  3L13 A;  1H19 A;  4U96 D;  5LCW C;  2J07 A;  5JHB A;  5BNW A;  1S64 A;  3O48 A;  3Q7A A;  4FU3 A;  3QK0 A;  3FU3 A;  4ME2 A;  3D9I A;  3MA5 A;  4GYO A;  2GW1 A;  3IKO B;  4CEM A;  2DBA A;  4QQI A;  2AXV A;  3JQ1 A;  1EYH A;  3CK7 A;  4YND A;  3UT8 A;  2R03 A;  2WMN A;  3IEG A;  4WUY A;  2ETC A;  2IQC A;  2L0T B;  4HLL A;  4N39 A;  3DSU A;  4G11 A;  3K9I A;  2IF4 A;  2DZN A;  1HFA A;  1YA0 A;  3LVR E;  4L2Y A;  4CDN A;  4DUI A;  4FA6 A;  4LCT A;  2F8Y A;  2NYJ A;  3LS8 A;  1BLX B;  2VGX B;  3CLJ A;  3ULQ A;  3RO2 A;  2PM6 A;  2MHK A;  4GTP A;  3D9H A;  3GZ1 A;  2ZXW E;  4AY6 A;  3B95 A;  4F53 A;  2A5E A;  1OCR E;  1XNF A;  5FTP A;  2YNQ A;  2JEK A;  1IHG A;  1TEZ A;  3JUE A;  3BQO A;  3B13 A;  4A3V A;  2XRZ A;  4KMO A;  3NBN B;  4DLO A;  4J8S A;  3ML9 A;  1SA4 A;  5E76 A;  2RD0 A;  3PZ1 A;  3G2W A;  4F3V A;  3HIZ A;  3SGH A;  5EID A;  1H2V C;  3QJZ A;  2DVW A;  4WND A;  4APO A;  3LY9 A;  4HFG A;  2EIM E;  3Q75 A;  4AP2 A;  4HS2 A;  2CFZ A;  2P9K G;  4JPS A;  2WXO A;  3HHM A;  4G8K A;  4I9E A;  4B94 A;  4GTV A;  3MCX A;  3NB2 A;  1UN8 A;  4B93 B;  3TGO A;  3L16 A;  4I9C A;  3RU0 A;  1JWF A;  4AXH A;  4HOT A;  4DX2 A;  1XGW A;  4BFR A;  2AJA A;  4AOF A;  2LXM A;  2YHE A;  1AP7 A;  3CV0 A;  2IO3 C;  4XX5 A;  1K1A A;  2QFC A;  3CHR A;  3V30 A;  5FQ7 A;  3PUK A;  1E7U A;  3DBS A;  3TAX A;  3BG1 B;  1QBQ A;  2IY0 C;  2DYR E;  3HXC A;  3NOC D;  2F8X K;  3SI5 A;  5EN5 D;  2X38 A;  4G24 A;  4RLY A;  3TWX A;  2IFU A;  2LSV A;  2Y4U A;  3RO3 A;  4BTA A;  4EQF A;  3RAU A;  4C0E A;  1A5E A;  4Z68 A;  3W9G A;  4J6I A;  3D9O A;  2LSU A;  2X6F A;  3PNT B;  3ZRH A;  2LAH A;  4PH4 B;  4U0Z A;  1W3B A;  3G2T A;  3QDN A;  4B0Z A;  4I1A A;  5A23 A;  4FAD A;  2BUG A;  2P2C P;  3TWS A;  2PQN A;  3Q4A B;  3E4B A;  4ANV A;  4BET A;  2IO2 C;  1E7V A;  1K8K G;  5G05 C;  4ANW A;  4GPM A;  3W9F A;  4TUU A;  4WWO A;  2VSO E;  1U2V G;  2CHZ A;  5T8I A;  5J08 A;  2J4B A;  3C5R A;  2IJG X;  3ML8 A;  3DST A;  1DCE A;  2BTD A;  2PZI A;  3SD5 A;  3WG7 E;  4HRL A;  4XIF A;  2XRY A;  2GRQ B;  3Q9U C;  1E8W A;  3JUI A;  4YDY A;  3UPV A;  4O1O A;  3V2X A;  4BT8 A;  3TXN A;  4XKB A;  3FP3 A;  2Y0B G;  3N71 A;  4Q94 A;  3LYA A;  3CVP A;  2I2O A;  1YMP A;  2I6H A;  2GRO B;  4YDO A;  5G04 J;  3TXM A;  1EF1 C;  3WXX A;  1IXV A;  3PRZ A;  3QKY A;  3PZD A;  2H6I A;  3FTX A;  2DWZ A;  1MX4 A;  5LCW J;  3FTS A;  3HG0 D;  3HXB A;  2KCL A;  2MRI A;  1Q2Z A;  2FUL A;  4N3A A;  4I17 A;  4LEU A;  1LF8 A;  3L9T A;  3Q79 A;  3F6Q A;  4L23 A;  3FUN A;  2XHE A;  5KBA A;  3HVE A;  2KC7 A;  2A5U A;  2XCC A;  4HOQ A;  4DX6 D;  1GW6 A;  4JC8 A;  5EX3 A;  4BT9 A;  3TWW A;  5AJL A;  1JCR A;  4K5A B;  4BES A;  2F37 A;  4WNF A;  4FHK A;  3NZU A;  4O1P A;  4UQY A;  4UQZ A;  3CVX A;  3FUE A;  5BT1 A;  3OXF A;  5ENT D;  5D66 A;  3CKB A;  4E85 A;  2CHX A;  4L1B A;  3NZS A;  3IBE A;  5JJT A;  4YVO A;  1KZP A;  1OUV A;  2J49 A;  3SQV A;  1E8X A;  2KXP C;  4J8Y A;  4MRU A;  3OAW A;  3B7B A;  4XEI G;  2ILR A;  3TG4 A;  1YYH A;  2Y69 E;  2BF0 X;  4FC8 A;  4N2S A;  1DVP A;  3V31 A;  4HLE A;  3RKV A;  2L9B A;  3ZYQ A;  3D9J A;  4JD2 G;  5BW8 C;  5CED B;  2R59 A;  4WAF A;  1MHQ A;  1N4S A;  3SBS A;  4IYP A;  5JMN D;  4Q69 A;  5T3R A;  3U64 A;  3CST A;  1PC2 A;  3DEO A;  5ENN A;  3LXU X;  5C2Y A;  5FZR A;  3KSL A;  3PRE A;  4DI3 A;  4DK5 A;  1E96 B;  3C3Q A;  4C48 B;  3ESL A;  3PZ2 A;  1H6O A;  2X6J A;  3E37 A;  2VGX A;  5BV1 A;  3ABL E;  4ZHB A;  2KCV A;  3T8K A;  4TUM A;  2P58 C;  5AAO A;  3QAR A;  2FI7 A;  3DRA A;  2P9I G;  2XCB A;  3MEK A;  5EYP F;  3TG5 A;  5ANL A;  4URK A;  3EHM A;  2P9P G;  1LTX A;  5FQ8 A;  2C0L A;  3MKQ A;  3PNL B;  3UIN C;  5CHE E;  4Y6C A;  3MV3 B;  5AN8 A;  2ETB A;  5AAR A;  3SBT B;  4CCA A;  5CBO A;  1E8Z A;  5KJM A;  3AU5 A;  2ZIS A;  5FIO A;  5D0O D;  4K03 A;  2WXJ A;  4Q96 A;  3L6A A;  4JW1 A;  3ONL A;  4GCN A;  3T8M A;  3CR3 A;  4I6E A;  2EIJ E;  2J08 A;  1TNB A;  3D9N A;  4X8Q A;  2WXF A;  3SF4 A;  3RRM B;  2LNI A;  4GA2 A;  3TL5 A;  3PH0 C;  3CGH A;  2HR2 A;  3ZXS A;  5KJN A;  2XEV A;  3FEY A;  2I9C A;  1MJ0 A;  2OVF A;  4AIF A;  2ZGG A;  4HI8 A;  4BX8 A;  3MJW A;  1PAQ A;  1NFI E;  3AG3 E;  3PZ4 A;  5G05 J;  3JQ0 A;  3KD7 A;  3CVV A;  2R5S A;  3ASF A;  2QZA A;  4MBG A;  3G2U A;  1P5Q A;  3QNK A;  2L6J A;  4CT4 A;  1TYQ G;  4OAV B;  3VTY A;  5ENP D;  1ZBP A;  3FUD A;  1N52 A;  4A3T A;  3LY8 A;  3E33 A;  4U7E B;  1S0P A;  3EJN A;  5A6C A;  1ELR A;  5ENR D;  3Q5M A;  2VSN A; 
#chains in the Genus database with same CATH homology
 3J5P A;  4O1O A;  1K1A A;  1SW6 A;  2NYJ A;  3V2X A;  3TWQ A;  3LJN A;  5HS0 A;  3KEA A;  3V30 A;  1BLX B;  4CZ2 D;  3ZUV B;  5EIL A;  2BKK B;  3EHR A;  2KXP C;  2RFA A;  2Y0B G;  4J8Y A;  4DRX E;  1AWC B;  5AN8 A;  2Y1L E;  2DZO A;  5CER B;  1SVX A;  1BD8 A;  4F6R D;  2ETB A;  4HNA D;  5AAR A;  2KBX A;  3UTM A;  4OAU C;  1DC2 A;  3NOG D;  1YMP A;  5AQ9 A;  2L6B A;  3B7B A;  3D9H A;  1DCQ A;  4HRN A;  3NOC D;  5CBO A;  2F8X K;  5EN5 D;  1YCS B;  5ENQ D;  3B95 A;  3DEP A;  4J7W A;  1TR4 A;  5FIO A;  2A5E A;  1OY3 D;  4HQD A;  5KNG A;  1YYH A;  5CEC B;  4HBD A;  4ZFH A;  4JB8 P;  4RLY A;  4LG6 A;  3AAA C;  5HRY A;  3TWX A;  3V31 A;  2XEE A;  1WDY A;  1IXV A;  1D9S A;  4BER A;  4HI9 A;  3V2O A;  4YDW A;  4CYM D;  5HKP A;  4UUC A;  5KWD A;  1A5E A;  2XEH A;  5CED B;  3V79 K;  2V4H C;  2XEN A;  5AQB A;  4Z68 A;  2DWZ A;  3W9G A;  1MX4 A;  2BKG A;  2QC9 A;  3JUE A;  4K5C A;  4N5Q A;  2V5Q C;  4HRM B;  1G3N B;  4U96 D;  5ITZ F;  3NBN B;  2ZGD A;  4U8V D;  3HG0 D;  5AQ7 A;  2J8S D;  3IXE A;  3TWT A;  4ATZ D;  5JMN D;  3HRA A;  4QFV A;  4G8L A;  5JA4 D;  3TWR A;  1K1B A;  3EU9 A;  3Q9N C;  1BI8 B;  5EID A;  5FIN A;  5BXU A;  3DEO A;  4O60 A;  2DVW A;  4GMR A;  5AQA A;  2FO1 E;  1MJ0 A;  4HB5 A;  3F6Q A;  2ZGG A;  3JXJ A;  4DX7 D;  4U8Y D;  5ENO D;  4HI8 A;  4BEP A;  2QYJ A;  1IKN D;  2RFM A;  5KBA A;  2P2C P;  3TWS A;  1NFI E;  2PNN A;  2XZT G;  4QQI A;  4DX6 D;  3J5Q B;  1S70 B;  5EYL A;  2VGE A;  4LSZ E;  4K5B A;  5ENS D;  5KNH D;  4DX5 D;  3TWW A;  3SO8 A;  4BET A;  3T9K A;  3JXI A;  3ZKJ A;  4K5A B;  5CBN A;  2XZD G;  1MX2 A;  4G8K A;  4C48 B;  1MX6 A;  1IHB A;  2JAB A;  4GPM A;  3UI2 A;  4BES A;  2F37 A;  3W9F A;  1OT8 A;  5CEA A;  4O1P A;  4B93 B;  1MYO A;  3UXG A;  2ETC A;  1BI7 B;  2MYO A;  5ENP D;  4OAV B;  4ZHB A;  3C5R A;  3AJI A;  3EHQ A;  3TWU A;  4BSZ B;  3T8K A;  4TUM A;  4HLL A;  3ZNG A;  1WG0 A;  4F1P A;  5AAO A;  5EIB E;  3ZU7 B;  4DX2 A;  3TWV A;  4U95 D;  1N0Q A;  2ETA A;  2AJA A;  4HRL A;  1K3Z D;  5D66 A;  5ENT D;  2DZN A;  4A63 B;  3Q9U C;  1QYM A;  5ENR D;  5EYP F;  1BU9 A;  1AP7 A;  4LNU D;  1UOH A;  4DUI A;  1N0R A;  4NIK A;  4DX1 A;  4YDY A;  5BXO A;  2F8Y A;  2HE0 A;  2B0O E;  1N11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...