5FINA

Darpins as a new tool for experimental phasing in protein crystallography
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
b'SDLGRKLLEAARAGQDDECRILMANGADVNAADNTGTTPLHLAAYSGHLEIVECLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NI3C DARPIN MUTANT5 HG-SITE N1
publication title Darpins as a New Tool for Experimental Phasing in Protein Crystallography
rcsb
source organism Synthetic construct
molecule tags Metal binding protein
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5finA00
3EHRA 1N11A 3F6QA 4BERA 1N0QA 1K3ZD 2Y0BG 4HI9A 3TWVA 5EILA 1A5EA 5ENSD 4U8YD 3UXGA 2BKGA 5D66A 4ZHBA 3DEPA 1BI8B 2F37A 1WG0A 2QC9A 5CERB 1BLXB 2ZGDA 3B95A 2V4HC 3SO8A 2KBXA 4QQIA 3JXJA 3EHQA 5ENOD 5KNGA 3UI2A 4ZFHA 4DX1A 3T8KA 3ZKJA 4LNUD 4RLYA 3TWUA 4YDWA 4A63B 1TR4A 3IXEA 4O60A 2XZDG 3J5QB 3JUEA 3LJNA 4K5AB 5KWDA 4HBDA 3ZU7B 4BEPA 1YCSB 4DX2A 5AQ9A 4HRMB 5BXUA 3B7BA 2ETCA 1G3NB 5EYLA 4J7WA 2BKKB 1N0RA 3AJIA 3KEAA 2Y1LE 2XEHA 4GPMA 2ETBA 3JXIA 5AQAA 4O1OA 5AQ7A 5CBNA 5CEAA 3V31A 5AARA 3V2XA 4HQDA 4N5QA 5HKPA 1YYHA 3AAAC 4HNAD 2DZNA 4NIKA 3J5PA 4U8VD 5EIDA 1WDYA 2XEEA 5ENQD 3TWWA 5HRYA 4DX5D 3V79K 2FO1E 2DVWA 5KBAA 1MX2A 1SVXA 4QFVA 4HLLA 5AAOA 1BU9A 1K1BA 2L6BA 2XENA 1OY3D 1IKND 5ENRD 4UUCA 4CZ2D 5ENPD 4G8KA 2A5EA 3ZUVB 4B93B 2B0OE 5KNHD 1IHBA 3C5RA 2J8SD 3TWTA 3W9GA 1DC2A 4GMRA 4BETA 3W9FA 4O1PA 2QYJA 2HE0A 3NOGD 2KXPC 1YMPA 4HRNA 3NOCD 4K5CA 1DCQA 4U96D 1IXVA 5EN5D 4BESA 4CYMD 1OT8A 5CBOA 4LG6A 4HB5A 5EIBE 3HRAA 5FINA 4U95D 3HG0D 2F8YA 3TWXA 5ITZF 4Z68A 2MYOA 1MX4A 5EYPF 3TWQA 3TWSA 2ETAA 3T9KA 3Q9NC 3DEOA 2P2CP 2NYJA 4HRLA 2AJAA 1AP7A 1MX6A 3D9HA 5JMND 3TWRA 1D9SA 4C48B 1S70B 2V5QC 5JA4D 1BD8A 1NFIE 4DUIA 4K5BA 3V30A 4DRXE 5CEDB 2VGEA 4HI8A 2XZTG 2PNNA 4F1PA 3ZNGA 4OAVB 3Q9UC 3NBNB 4F6RD 4LSZE 5HS0A 1UOHA 1QYMA 4BSZB 2DZOA 1K1AA 1SW6A 4TUMA 2DWZA 4G8LA 3V2OA 4YDYA 5CECB 5AN8A 5ENTD 2ZGGA 4J8YA 1MYOA 3EU9A 2F8XK 1AWCB 2RFMA 4DX6D 4JB8P 3UTMA 5BXOA 5AQBA 4ATZD 4DX7D 2JABA 2RFAA 4OAUC 5FIOA 1BI7B 1MJ0A
chains in the Genus database with same CATH superfamily
1PC2A 2FF4A 3WG7E 3F6QA 4BERA 1O1RA 2X6IA 3E32A 2MRIA 2VGXB 4UQXA 1JPLA 4GPKA 4U7EB 4OYSA 3ONLA 4GU5A 2BTDA 3DSTA 4YDEA 3Q47B 4K03A 3QC1A 1HZ4A 3FTWA 4KXKB 3FH8A 3V2XA 3GZ1A 2GRRB 1JCQA 5LP0A 1WDYA 5IY5E 4HORA 1BU9A 2WQ7A 3DSXA 1A17A 1KPSB 4O6FA 3S7DA 3I4RB 3TAXA 4AV7A 3ZFWA 4C0EA 2F0YA 3PVLA 1LTXA 4DLQA 3D9JA 1S64A 4U96D 3UM2A 1JCRA 1O1SA 3DSSA 2F8YA 2MYOA 5BNWA 4AY5A 3MEKA 5LX8A 4K5BA 2ILRA 4I1MA 3DSWA 4FJYA 4F6RD 2PL2A 2DWZA 4CDRA 1O1TA 2Y3AA 2CHXA 5LOZA 3VTYA 4TXRA 4YVOA 3KAEA 3JCKC 1EPUA 4AOFA 3NB2A 3RKVA 2ONDA 3D9KA 5EILA 1HS6A 3SQVA 2AXZA 5HI7A 3UI2A 3LY8A 4KMOA 4UQYA 4EBAA 3T8KA 3PUKA 3SGHA 4CGVA 5FZSA 2CG2A 4RLYA 4YVQC 4DX2A 3FUNA 2WXOA 2X6KA 3FTUA 1TNZA 4L2YA 2P9UG 4GMLA 4UWGA 3V31A 2LAIA 5G04J 3ASFA 3QJZA 3E34A 4U8VD 1D8DA 4APOA 3PZ4A 4BX8A 2LXMA 2L0TB 2L9BA 4NRHB 4UUCA 5T4YA 3QWVA 3ULEG 1IHBA 1OWMA 4FULA 4O1PA 3IV0A 3RAUA 3R7QA 1EYHA 3NQPA 2GW1A 2WXJA 3LYAA 3KSLA 3R9MA 2ETAA 4HOQA 3PH0C 1QZ2A 2HR2A 2ZU6B 1S70B 4GZCA 3HHMA 5CEDB 3URZA 4GCOA 1E90A 3CV0A 5BW8C 1NA0A 3AS5A 3AS8A 4GYWA 1QQEA 4JHKA 2RFMA 5BT1A 2IOLA 1FT1A 4OAUC 4WAFA 4I6EA 2YNQA 4GB9A 2XGOA 2AW6A 4R7LA 1NA3A 2XPYA 2AVPA 3AG1E 5D66A 5AENA 5JJ7A 3UPVA 5CERB 3B95A 3LVQE 3NZUA 4LNBA 3IXEA 4GTOA 1H2TC 3FP3A 2PM7A 5BXUA 3B13A 4FJZA 3MV2B 4KZ0A 1LF8A 4GMJA 3ABKE 1WAO1 4JHJA 4HVBA 3TL5A 4U0SA 2VYIA 4I6GA 2VSYA 3UQ3A 4GMRA 1KZOA 4BETA 2QYJA 1N4QA 3CHPA 1YMPA 3GZ2A 4LG6A 4A3VA 5C2YA 1ELKA 2XPZA 4WNFA 5JA4D 1NZNA 4HI8A 3RJVA 3UUXA 3C72A 5HS0A 4B8CB 4MRUA 3ML9A 1U3CA 2P9PG 1ZU2A 1K8KG 1OCOE 1EDUA 2RKKA 3CVXA 4FP7A 4GA2A 3CR3A 4ILHB 2KM4A 2BEDA 2WXKA 3FH5A 2YHCA 1QBQA 2KC7A 2X38A 3CHMA 5ARFA 4ZHBA 1IQRA 4DLOA 2UY1A 3HXBA 1O5MA 3PRZA 4YDWA 3UM3A 3E30A 2XZDG 4WNEA 2HO1A 3B7BA 4W9RA 3AJIA 2EIKE 2OVFA 3BQOA 2FO7A 4XI0A 5HKPA 1YYHA 2WXFA 2FO1E 4A55A 4GTPA 4GAAA 3ULQA 1W3BA 3CK7A 3OAWA 2J8SD 2OV8A 4RG9A 4N3CA 3FU6A 2ZIRA 4XEIG 5H7PA 5AJDA 4TXPA 3TWQA 1Q2ZA 2P2CP 3IKOB 4HRLA 2XRYA 2OEVA 3OXLA 3CSFA 1Z3YA 2V4LA 4OAVB 3NBNB 3SFYA 3LXUX 1HO8A 4BWRA 2C0MA 2GRQB 1HX8A 3MZLB 3JQ0A 2WMNA 1E8XA 3UXGA 3HIZA 3UKRG 1JWGA 5HQ8A 3ASDA 4JZYA 4L7TA 3CVYA 1OXJA 3CVPA 2XHEA 2GROB 2WPVA 3B7UX 1N4RA 2XPIA 1SA4A 3VLDA 1E96B 3ISMC 2I9CA 2BF0X 4BEPA 4LRZA 4GPMA 5FTPA 4EPZA 4FHJA 4O1OA 1TNUA 4MS6A 4AP2A 3S7BA 5J90A 1ELWA 3KEZA 5ENQD 2JLBA 1MX2A 3QWPA 2WVIA 2XRZA 4XE0A 4CZ2D 1HXIA 2X6HA 2OEWA 4F53A 2XS8A 4BTAA 3FULA 2DYRE 2X3MA 4WWNA 1DC2A 4HS2A 4HRNA 3PZ2A 2LNIA 3KD7A 1E7UA 3HVEA 2P9NG 1BPOA 3IBEA 1TNOA 3TWXA 4ILGA 4Z68A 4MLPA 2VGXA 2ZISA 3FEXA 3RO3A 2FI7A 1HG2A 4F1PA 2V5FA 4XX5A 2P9KG 2R2LA 5D2MC 5B1BE 2IONA 3UINC 4BSZB 3G2VA 3C3RA 2IEJA 3CHOA 3CHSA 5JJ6A 3EJNA 4I2WA 3PE3A 3ASOE 3FH7A 5FIOA 1HG5A 3SO8A 3LY9A 3ASHA 2E0IA 4HI9A 3ZVVA 4Y6CA 4IYPA 2KBXA 2R5SA 2VSNA 2QYUA 2GGFA 3ONKA 5EKQD 4H7YA 2GRMA 1UG3A 4FU3A 5AJLA 4GZDA 1E7VA 3I5PA 1WY6A 4KT6B 3B7TA 4WUYA 3B7RL 3AAAC 3MCXA 2C2LA 5HRYA 3Q7FA 5CMWA 2GRNB 1E8ZA 2GRLA 4EHMA 4UI9C 5BUZA 2A5EA 2CHWA 2B0OE 4N5CA 2WXGA 4D10C 1H19A 2IQCA 5KJKA 3NOGD 3L9TA 2YINA 2E2EA 4BESA 2J09A 5CBOA 5EIBE 3LDZA 5ITZF 4G2VA 3T9KA 1N95A 2MHKA 5G55A 5FQ4A 4U0UA 3D9HA 1D9SA 4EZKA 3JYSA 3IHYA 1X5BA 3HXDA 3P1UA 3Q9UC 1E8YA 2H6FA 2I1JA 2IY0C 1K1AA 3FTYA 2DCPA 4J8YA 4AEZC 4JB8P 4ATZD 4U8HA 1PY1A 4XKCA 3L13A 2Y4TA 3EHRA 3PZ3A 3SFZA 2R05A 3ZN3A 3FTVA 5FQ6A 3OTNA 2ZGDA 3E33A 2V4HC 4PS7A 3EHQA 3KS2A 1IHGA 1Y6IA 3G2TA 3VTXA 4BT9A 4HRMB 2UWJG 4HOSA 1B89A 3PDNA 5FWQA 1S63A 4HQDA 4TRQA 3S7JA 4G1TA 1UJKA 4HLLA 4WNDA 5FJYA 4H7XA 2I2OA 3E37A 2WQ6A 2L6BA 4UI9K 1UJJA 1ZB1A 3L16A 4EZLA 3TG4A 1UN8A 3ZIMA 4MKTA 3CVWA 1KLXA 3MJWA 4CYMD 4ANVA 1S0PA 3DWLG 3U9WA 1N9AA 3S2AA 3FU3A 2I1KA 4G23A 3TWSA 3Q9NC 4GTSA 4B94A 1AP7A 2AJAA 1MX6A 4UQZA 1UN9A 1UW4B 3ZEFA 2RD0A 3MKRA 3EHNA 3DPDA 4LSZE 3EDTB 3CIAA 2WXIA 4C0MA 5B1AE 3P2BA 3C3OA 2EIJE 4CT4A 4PDXA 5ARGA 4IRUA 3PEUB 3FUJA 2JABA 4CDMA 2L6JA 3AG2E 2WXRA 1A5EA 5BV1A 3BUAA 4G26A 2M63A 3FUDA 4EQFA 4JL0A 2CFZA 3AG3E 3LCAA 2YQ8A 2J08A 4WWPA 4HOTA 4HXIA 4LNUD 3ZHEB 4N3AA 5KWDA 4M3OA 3APFA 3R9AB 5AQ9A 1N0RA 2Y1LE 2XEHA 4BX9A 5JHBA 5CEAA 3U3WA 2WXNA 2WXPA 1DVPA 3J5PA 2JEKA 4X8QA 4DX5D 3K9IA 4ILIA 1HU3A 3NAWA 5C1DA 1H2VC 3CK8A 2R02A 4RQIA 4ME2A 3C98A 3PZDA 2KZTB 4I9CA 1ELRA 3QARA 4XI9A 3B7SA 1LD7A 2WXQA 3C3QA 1LD8A 2J9QA 4AM9A 3HRAA 1FT2A 3FFLA 4I43A 3DEOA 2NYJA 4M7CA 5D0OD 4F3VA 1NFIE 1HH8A 4EBAG 4P29A 4RG6A 3WXXA 2PNNA 4GZ5A 3SZ7A 3QNKA 1H0AA 4UWHA 1QYMA 5EX0A 2EILE 2X6JA 4TUMA 3QOUA 3UMVA 3V2OA 3I3NA 4YDYA 4FLBA 3EU9A 4CDNA 2DYSE 3L22A 3ASGA 2EINE 2VGYA 3ZGQA 3BG1B 3FY4A 3T5VA 4NURA 5ENSD 1XGWA 1BI8B 2F37A 1BLXB 3L17A 5ENOD 5EDSA 4ABNA 4UI9J 3TXNA 4XKBA 2KCVA 3FUIA 3FU5A 1Z6TA 3GZSA 3E4BA 1INZA 3AU5A 4GA0A 2P9SG 2A4ZA 4N5QA 3ABLE 4NACA 2FEZA 3V79K 4RVBA 3HDXA 2B6CA 4A1GA 3TWTA 1FVFA 3CVLA 3MX3A 4FLHA 2A5UA 3D9IA 3GYZA 3NOCD 5LFAA 3APDA 4JD2G 4ANXA 2IF4A 3QWWA 5ENNA 3U4TA 2XEVA 4CGWA 4FHKA 3CSTA 4J8SA 2VSOE 2J07A 4APFA 4HLEA 4PS8A 3TGOA 3CVNA 2AXUA 4URKA 5CCMA 4CCAA 3T8MA 3PS6A 3AS4A 3FU0A 3UTMA 5AQBA 1TNYA 4JPSA 5JHAA 3SF4A 1FPPA 2AXVA 4GYOA 2WQHA 2Y0BG 5CRUA 3ASNE 1Y8MA 4QQIA 3L54A 3SHFA 4L9PA 5E75A 1TR4A 2PQNA 2IU1A 4HBDA 3ZU7B 4E85A 4GZ3A 3UT7A 2L0IA 4N3BA 4ATGA 2HYZA 5CBNA 3FUMA 1N52A 5FT9A 2LAHA 3BEEA 2LSUA 3TWWA 3PEVB 5G2NA 1U2VG 2KCLA 3MKQB 3ML8A 3W9GA 2VTBA 2HE0A 1PAQA 4BY6A 2WXMA 5EN5D 3FUFA 3NZSA 2LSVA 5EYPF 4ANUA 3DXKG 3UT8A 3BU8A 2V5QC 3D9OA 1BD8A 2H6HA 4XZ4A 3ZPJA 4DUIA 3D9PA 4AY6A 1JUQA 3FWVA 1FCHA 3S7FA 4EECA 4UWFA 3ZYLA 4WNGA 3PUJA 4JHRA 3D9NA 3Q75A 2MOWA 3SBSA 2LO6A 3MA5A 2CHZA 3SI5A 4L2LA 3KEAA 1OCRE 5KJNA 3HXEA 1GW6A 3UIPC 2CG3A 2WXLA 2R03A 4KBQA 3JXJA 3D9LA 5D0QD 1OWLA 3O48A 3FHEA 3TWUA 3L82A 2J49A 3O4ZA 1X81A 1DNPA 4BT8A 4I1OB 2ETBA 5AQAA 5ANRA 2Y69E 4NIKA 4AXHA 1SQMA 3SD5A 2DVWA 1SVXA 2XENA 4EZJA 4FC8A 1TN7A 3ZUVB 4J0UA 5KNHD 1TN8A 3LJ3A 2P9IG 3BG0B 3R7RA 4UWKA 3UX4A 3ZRHA 2RG8A 2KXPC 4I1AA 3Q4AB 4NQ0A 5FINA 3HG0D 2XS1A 3HYMB 4GTRA 1NI1A 3Q7AA 5FQ8A 4BTBA 3TWRA 3L6AA 4CRWA 4PS3A 4ACKA 3HVEB 4DRXE 5KJLA 2WM9A 2PZIA 2GRPB 5A7DB 2WMOA 1TYQG 5ENTD 5M72A 4LERA 1D8EA 4G24A 4JXTA 5FQ7A 5T3RA 1N0QA 4AIFA 1HE8A 3LS8A 2KCKA 1OWNA 5DIZA 4V3IA 1OUVA 4ZFHA 1H6PA 4Y6WA 3G2UA 4IULA 4I17A 2V8SE 3J5QB 3JUEA 3PNLB 4K5AB 3PREA 3KSQA 4GTTA 4DJAA 4J7WA 2BKKB 2KATA 3CEQA 2ZXWE 4HNAD 5EIDA 4L23A 1N94A 3ZW3A 5AAOA 2EQXA 2FULA 4U0ZA 1OWOA 4E6HA 1IKND 2NC9A 5ENRD 5G05C 5FZQA 2XGMA 5J08A 3UM1A 1N4SA 3ZYQA 3FTSA 3QK0A 4RSYA 4I6JA 2BUGA 3QAQA 3G2WA 5EX3A 3MYVA 4L1BA 3FDHA 4WWOA 3RIBA 3ZHEA 3ZNGA 3CLJA 4BSXA 3LVRE 1Z3XA 2P9LG 2HM8A 4N2QA 4Q94A 4DX6D 4JW1A 2RFAA 3ZXSA 3IEGA 2XQ0A 3TWVA 2R17C 4U8YD 1V55E 2BKGA 2KZTA 3HXFA 4OVVA 3RRNB 5T8IA 3CGHA 4PH4B 4A1SA 3NF1A 3CVUA 3LY7A 3T5XA 3FUHA 4CT0A 3QDNA 4GTVA 1SA5A 1H6KA 5AARA 2PM6A 5E76A 5CRVA 2DZNA 1OCZE 3U66A 2H6IA 2R59A 4LEUA 2Q7FA 4B0ZA 5JJTA 4B93B 3C5RA 4Q96A 4C9BB 4AVXA 4UWLA 4GYYA 1DCQA 4YNDA 1IXVA 4ANWA 4BFRA 3PE4A 4AJWA 4U07A 3FTZA 1SZ9A 3RU0A 3N71A 2V0PA 5LCWC 2VGEA 1HFAA 2P58C 4B89A 2QZAA 3ESLA 3RRUA 1SW6A 4G8LA 4HOUA 5AN8A 2F8XK 2LUHA 3Q5MA 1H2UA 1OCCE 3G2SA 3RK6A 1K3ZD 2NSZA 3CHRA 2OVBA 1EF1C 3VLFA 2XCBA 2EIME 3UM0A 2OCCE 1P5QA 4OVUA 3QB2A 3DEPA 3D3MA 3ULYA 1WG0A 3VLEA 4G25A 4LCTA 4TXQA 1NP7A 4DX1A 3HXCA 2VJ8A 4A63B 4YDOA 3ENEA 3LJNA 1QNFA 3UT4A 4KYOB 4CEMA 5AIJA 1TNBA 4DI3A 3PZ1A 5AQ7A 3ZYKA 3Q73A 3UKUG 1U3DA 4KVOA 3CQGB 3CHQA 4Q69A 3LKUA 2IO3C 4LUNU 2C0LA 4HFGA 1K1BA 1DCEA 5ENPD 3CK9A 1XNFA 4J6IA 3SNXA 3TJPA 2AWIA 2QFCA 4JA7A 4ACLA 3JQ1A 4J8FA 4HB5A 1FVHA 3UIOC 2IO2C 4JEUA 5JMND 1JCSA 3L08A 3AG4E 1VDYA 5B3SE 1KT1A 2IJGX 1WM5A 3DSVA 2YHEA 2WB2A 4JA9A 5CMYA 2ZGGA 1MYOA 1MHQA 5CCLA 4GZ6A 3CVQA 4J8EA 3CQCB 4DX7D 2Y4UA 1BI7B 1MJ0A 3DSUA 1N11A 4U63A 1E8WA 1JWFA 4N39A 1N4PA 1RZ4A 2J4BA 3MKQA 3EUVA 2WXHA 2QC9A 4F1SA 3CVVA 5KNGA 1TJCA 2DBAA 4GCNA 5ANLA 3ZKJA 5G05J 1NL4A 4MBGA 4IN3B 4GTQA 4DK5A 1YCSB 3AU4A 3LPZA 4GA1A 2ETCA 5EYLA 3EU5A 3APCA 3JXIA 1N54A 4DI4A 3X2QE 3SBTB 5CHEE 1IYGA 3RO2A 3MV3B 4FADA 3MGBA 3OXGA 4TV3A 1KZPA 4I9EA 3IHVA 3FTXA 2UY1B 4KVMA 5KCMA 4FA6A 5G04C 4KZCA 4PUCA 3SFXA 4U95D 3EHMA 4G11A 3RSEG 2I6HA 3GW4A 3Q49B 2VQ2A 4C48B 4I2ZA 3Q15A 4N2SA 1Z5SC 4K0RA 1YA0A 1OWPA 5CECB 2NXPA 2QY7A 1AWCB 5BXOA 3SY2A 3D9MA 4B8AA 4JEHA 3ABME 2OOEA 4DPRA 2XGSA 3FUKA 4LNGA 5KJMA 1HF8A 1MQSA 1TJFA 2J4DA 3FEYA 5A23A 3EIQC 4O60A 3Q79A 2IFUA 3EIJA 4GTMA 1G3NB 1ZBPA 3ZXPA 3DXMG 1MZCA 3CKCA 2XEEA 4J8DA 5KBAA 5AYWD 4QFVA 4A3TA 4JVSA 2LXLA 4TUUA 5LCWJ 5FZRA 1OY3D 3CKBA 5A6CA 3DPYA 3LEWA 1TEZA 4G8KA 3JUIA 2XCCA 3ESKA 3PNTB 4XIFA 4U04A 3W9FA 1TN6A 3QKYA 2DIWA 3ZYMA 1IQUA 4K5CA 1OT8A 4F7AA 3RRMB 5BV0A 3TXMA 1MX4A 3DRAA 3DBSA 2VTBB 2PQRA 4JC8A 5DBKA 5BPPA 3V30A 1H6OA 2XZTG 2CFUA 2X6FA 1UOHA 3I4GA 1RW2A 3Q78A 2VSXE 2DZOA 2IOSA 2FBNA 3FUEA 2H6GA 3OXFA 3TG5A 1L5JA 1V54E 1KT0A 3U64A 1SZAA
chains in the Genus database with same CATH topology
3EHRA 1N11A 3F6QA 4BERA 1N0QA 1K3ZD 2Y0BG 4HI9A 3TWVA 5EILA 1A5EA 5ENSD 4U8YD 3UXGA 2BKGA 5D66A 4ZHBA 3DEPA 1BI8B 2F37A 1WG0A 2QC9A 5CERB 1BLXB 2ZGDA 3B95A 2V4HC 3SO8A 2KBXA 4QQIA 3JXJA 3EHQA 5ENOD 5KNGA 3UI2A 4ZFHA 4DX1A 3T8KA 3ZKJA 4LNUD 4RLYA 3TWUA 4YDWA 4A63B 1TR4A 3IXEA 4O60A 2XZDG 3J5QB 3JUEA 3LJNA 4K5AB 5KWDA 4HBDA 3ZU7B 4BEPA 1YCSB 4DX2A 5AQ9A 4HRMB 5BXUA 3B7BA 2ETCA 1G3NB 5EYLA 4J7WA 2BKKB 1N0RA 3AJIA 3KEAA 2Y1LE 2XEHA 4GPMA 2ETBA 3JXIA 5AQAA 4O1OA 5AQ7A 5CBNA 5CEAA 3V31A 5AARA 3V2XA 4HQDA 4N5QA 5HKPA 1YYHA 3AAAC 4HNAD 2DZNA 4NIKA 3J5PA 4U8VD 5EIDA 1WDYA 2XEEA 5ENQD 3TWWA 5HRYA 4DX5D 3V79K 2FO1E 2DVWA 5KBAA 1MX2A 1SVXA 4QFVA 4HLLA 5AAOA 1BU9A 1K1BA 2L6BA 2XENA 1OY3D 1IKND 5ENRD 4UUCA 4CZ2D 5ENPD 4G8KA 2A5EA 3ZUVB 4B93B 2B0OE 5KNHD 1IHBA 3C5RA 2J8SD 3TWTA 3W9GA 1DC2A 4GMRA 4BETA 3W9FA 4O1PA 2QYJA 2HE0A 3NOGD 2KXPC 1YMPA 4HRNA 3NOCD 4K5CA 1DCQA 4U96D 1IXVA 5EN5D 4BESA 4CYMD 1OT8A 5CBOA 4LG6A 4HB5A 5EIBE 3HRAA 5FINA 4U95D 3HG0D 2F8YA 3TWXA 5ITZF 4Z68A 2MYOA 1MX4A 5EYPF 3TWQA 3TWSA 2ETAA 3T9KA 3Q9NC 3DEOA 2P2CP 2NYJA 4HRLA 2AJAA 1AP7A 1MX6A 3D9HA 5JMND 3TWRA 1D9SA 4C48B 1S70B 2V5QC 5JA4D 1BD8A 1NFIE 4DUIA 4K5BA 3V30A 4DRXE 5CEDB 2VGEA 4HI8A 2XZTG 2PNNA 4F1PA 3ZNGA 4OAVB 3Q9UC 3NBNB 4F6RD 4LSZE 5HS0A 1UOHA 1QYMA 4BSZB 2DZOA 1K1AA 1SW6A 4TUMA 2DWZA 4G8LA 3V2OA 4YDYA 5CECB 5AN8A 5ENTD 2ZGGA 4J8YA 1MYOA 3EU9A 2F8XK 1AWCB 2RFMA 4DX6D 4JB8P 3UTMA 5BXOA 5AQBA 4ATZD 4DX7D 2JABA 2RFAA 4OAUC 5FIOA 1BI7B 1MJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHR A;  1N11 A;  3F6Q A;  4BER A;  1N0Q A;  1K3Z D;  2Y0B G;  4HI9 A;  3TWV A;  5EIL A;  1A5E A;  5ENS D;  4U8Y D;  3UXG A;  2BKG A;  5D66 A;  4ZHB A;  3DEP A;  1BI8 B;  2F37 A;  1WG0 A;  2QC9 A;  5CER B;  1BLX B;  2ZGD A;  3B95 A;  2V4H C;  3SO8 A;  2KBX A;  4QQI A;  3JXJ A;  3EHQ A;  5ENO D;  5KNG A;  3UI2 A;  4ZFH A;  4DX1 A;  3T8K A;  3ZKJ A;  4LNU D;  4RLY A;  3TWU A;  4YDW A;  4A63 B;  1TR4 A;  3IXE A;  4O60 A;  2XZD G;  3J5Q B;  3JUE A;  3LJN A;  4K5A B;  5KWD A;  4HBD A;  3ZU7 B;  4BEP A;  1YCS B;  4DX2 A;  5AQ9 A;  4HRM B;  5BXU A;  3B7B A;  2ETC A;  1G3N B;  5EYL A;  4J7W A;  2BKK B;  1N0R A;  3AJI A;  3KEA A;  2Y1L E;  2XEH A;  4GPM A;  2ETB A;  3JXI A;  5AQA A;  4O1O A;  5AQ7 A;  5CBN A;  5CEA A;  3V31 A;  5AAR A;  3V2X A;  4HQD A;  4N5Q A;  5HKP A;  1YYH A;  3AAA C;  4HNA D;  2DZN A;  4NIK A;  3J5P A;  4U8V D;  5EID A;  1WDY A;  2XEE A;  5ENQ D;  3TWW A;  5HRY A;  4DX5 D;  3V79 K;  2FO1 E;  2DVW A;  5KBA A;  1MX2 A;  1SVX A;  4QFV A;  4HLL A;  5AAO A;  1BU9 A;  1K1B A;  2L6B A;  2XEN A;  1OY3 D;  1IKN D;  5ENR D;  4UUC A;  4CZ2 D;  5ENP D;  4G8K A;  2A5E A;  3ZUV B;  4B93 B;  2B0O E;  5KNH D;  1IHB A;  3C5R A;  2J8S D;  3TWT A;  3W9G A;  1DC2 A;  4GMR A;  4BET A;  3W9F A;  4O1P A;  2QYJ A;  2HE0 A;  3NOG D;  2KXP C;  1YMP A;  4HRN A;  3NOC D;  4K5C A;  1DCQ A;  4U96 D;  1IXV A;  5EN5 D;  4BES A;  4CYM D;  1OT8 A;  5CBO A;  4LG6 A;  4HB5 A;  5EIB E;  3HRA A;  5FIN A;  4U95 D;  3HG0 D;  2F8Y A;  3TWX A;  5ITZ F;  4Z68 A;  2MYO A;  1MX4 A;  5EYP F;  3TWQ A;  3TWS A;  2ETA A;  3T9K A;  3Q9N C;  3DEO A;  2P2C P;  2NYJ A;  4HRL A;  2AJA A;  1AP7 A;  1MX6 A;  3D9H A;  5JMN D;  3TWR A;  1D9S A;  4C48 B;  1S70 B;  2V5Q C;  5JA4 D;  1BD8 A;  1NFI E;  4DUI A;  4K5B A;  3V30 A;  4DRX E;  5CED B;  2VGE A;  4HI8 A;  2XZT G;  2PNN A;  4F1P A;  3ZNG A;  4OAV B;  3Q9U C;  3NBN B;  4F6R D;  4LSZ E;  5HS0 A;  1UOH A;  1QYM A;  4BSZ B;  2DZO A;  1K1A A;  1SW6 A;  4TUM A;  2DWZ A;  4G8L A;  3V2O A;  4YDY A;  5CEC B;  5AN8 A;  5ENT D;  2ZGG A;  4J8Y A;  1MYO A;  3EU9 A;  2F8X K;  1AWC B;  2RFM A;  4DX6 D;  4JB8 P;  3UTM A;  5BXO A;  5AQB A;  4ATZ D;  4DX7 D;  2JAB A;  2RFA A;  4OAU C;  5FIO A;  1BI7 B;  1MJ0 A; 
#chains in the Genus database with same CATH topology
 1PC2 A;  2FF4 A;  3WG7 E;  3F6Q A;  4BER A;  1O1R A;  2X6I A;  3E32 A;  2MRI A;  2VGX B;  4UQX A;  1JPL A;  4GPK A;  4U7E B;  4OYS A;  3ONL A;  4GU5 A;  2BTD A;  3DST A;  4YDE A;  3Q47 B;  4K03 A;  3QC1 A;  1HZ4 A;  3FTW A;  4KXK B;  3FH8 A;  3V2X A;  3GZ1 A;  2GRR B;  1JCQ A;  5LP0 A;  1WDY A;  5IY5 E;  4HOR A;  1BU9 A;  2WQ7 A;  3DSX A;  1A17 A;  1KPS B;  4O6F A;  3S7D A;  3I4R B;  3TAX A;  4AV7 A;  3ZFW A;  4C0E A;  2F0Y A;  3PVL A;  1LTX A;  4DLQ A;  3D9J A;  1S64 A;  4U96 D;  3UM2 A;  1JCR A;  1O1S A;  3DSS A;  2F8Y A;  2MYO A;  5BNW A;  4AY5 A;  3MEK A;  5LX8 A;  4K5B A;  2ILR A;  4I1M A;  3DSW A;  4FJY A;  4F6R D;  2PL2 A;  2DWZ A;  4CDR A;  1O1T A;  2Y3A A;  2CHX A;  5LOZ A;  3VTY A;  4TXR A;  4YVO A;  3KAE A;  3JCK C;  1EPU A;  4AOF A;  3NB2 A;  3RKV A;  2OND A;  3D9K A;  5EIL A;  1HS6 A;  3SQV A;  2AXZ A;  5HI7 A;  3UI2 A;  3LY8 A;  4KMO A;  4UQY A;  4EBA A;  3T8K A;  3PUK A;  3SGH A;  4CGV A;  5FZS A;  2CG2 A;  4RLY A;  4YVQ C;  4DX2 A;  3FUN A;  2WXO A;  2X6K A;  3FTU A;  1TNZ A;  4L2Y A;  2P9U G;  4GML A;  4UWG A;  3V31 A;  2LAI A;  5G04 J;  3ASF A;  3QJZ A;  3E34 A;  4U8V D;  1D8D A;  4APO A;  3PZ4 A;  4BX8 A;  2LXM A;  2L0T B;  2L9B A;  4NRH B;  4UUC A;  5T4Y A;  3QWV A;  3ULE G;  1IHB A;  1OWM A;  4FUL A;  4O1P A;  3IV0 A;  3RAU A;  3R7Q A;  1EYH A;  3NQP A;  2GW1 A;  2WXJ A;  3LYA A;  3KSL A;  3R9M A;  2ETA A;  4HOQ A;  3PH0 C;  1QZ2 A;  2HR2 A;  2ZU6 B;  1S70 B;  4GZC A;  3HHM A;  5CED B;  3URZ A;  4GCO A;  1E90 A;  3CV0 A;  5BW8 C;  1NA0 A;  3AS5 A;  3AS8 A;  4GYW A;  1QQE A;  4JHK A;  2RFM A;  5BT1 A;  2IOL A;  1FT1 A;  4OAU C;  4WAF A;  4I6E A;  2YNQ A;  4GB9 A;  2XGO A;  2AW6 A;  4R7L A;  1NA3 A;  2XPY A;  2AVP A;  3AG1 E;  5D66 A;  5AEN A;  5JJ7 A;  3UPV A;  5CER B;  3B95 A;  3LVQ E;  3NZU A;  4LNB A;  3IXE A;  4GTO A;  1H2T C;  3FP3 A;  2PM7 A;  5BXU A;  3B13 A;  4FJZ A;  3MV2 B;  4KZ0 A;  1LF8 A;  4GMJ A;  3ABK E;  1WAO 1;  4JHJ A;  4HVB A;  3TL5 A;  4U0S A;  2VYI A;  4I6G A;  2VSY A;  3UQ3 A;  4GMR A;  1KZO A;  4BET A;  2QYJ A;  1N4Q A;  3CHP A;  1YMP A;  3GZ2 A;  4LG6 A;  4A3V A;  5C2Y A;  1ELK A;  2XPZ A;  4WNF A;  5JA4 D;  1NZN A;  4HI8 A;  3RJV A;  3UUX A;  3C72 A;  5HS0 A;  4B8C B;  4MRU A;  3ML9 A;  1U3C A;  2P9P G;  1ZU2 A;  1K8K G;  1OCO E;  1EDU A;  2RKK A;  3CVX A;  4FP7 A;  4GA2 A;  3CR3 A;  4ILH B;  2KM4 A;  2BED A;  2WXK A;  3FH5 A;  2YHC A;  1QBQ A;  2KC7 A;  2X38 A;  3CHM A;  5ARF A;  4ZHB A;  1IQR A;  4DLO A;  2UY1 A;  3HXB A;  1O5M A;  3PRZ A;  4YDW A;  3UM3 A;  3E30 A;  2XZD G;  4WNE A;  2HO1 A;  3B7B A;  4W9R A;  3AJI A;  2EIK E;  2OVF A;  3BQO A;  2FO7 A;  4XI0 A;  5HKP A;  1YYH A;  2WXF A;  2FO1 E;  4A55 A;  4GTP A;  4GAA A;  3ULQ A;  1W3B A;  3CK7 A;  3OAW A;  2J8S D;  2OV8 A;  4RG9 A;  4N3C A;  3FU6 A;  2ZIR A;  4XEI G;  5H7P A;  5AJD A;  4TXP A;  3TWQ A;  1Q2Z A;  2P2C P;  3IKO B;  4HRL A;  2XRY A;  2OEV A;  3OXL A;  3CSF A;  1Z3Y A;  2V4L A;  4OAV B;  3NBN B;  3SFY A;  3LXU X;  1HO8 A;  4BWR A;  2C0M A;  2GRQ B;  1HX8 A;  3MZL B;  3JQ0 A;  2WMN A;  1E8X A;  3UXG A;  3HIZ A;  3UKR G;  1JWG A;  5HQ8 A;  3ASD A;  4JZY A;  4L7T A;  3CVY A;  1OXJ A;  3CVP A;  2XHE A;  2GRO B;  2WPV A;  3B7U X;  1N4R A;  2XPI A;  1SA4 A;  3VLD A;  1E96 B;  3ISM C;  2I9C A;  2BF0 X;  4BEP A;  4LRZ A;  4GPM A;  5FTP A;  4EPZ A;  4FHJ A;  4O1O A;  1TNU A;  4MS6 A;  4AP2 A;  3S7B A;  5J90 A;  1ELW A;  3KEZ A;  5ENQ D;  2JLB A;  1MX2 A;  3QWP A;  2WVI A;  2XRZ A;  4XE0 A;  4CZ2 D;  1HXI A;  2X6H A;  2OEW A;  4F53 A;  2XS8 A;  4BTA A;  3FUL A;  2DYR E;  2X3M A;  4WWN A;  1DC2 A;  4HS2 A;  4HRN A;  3PZ2 A;  2LNI A;  3KD7 A;  1E7U A;  3HVE A;  2P9N G;  1BPO A;  3IBE A;  1TNO A;  3TWX A;  4ILG A;  4Z68 A;  4MLP A;  2VGX A;  2ZIS A;  3FEX A;  3RO3 A;  2FI7 A;  1HG2 A;  4F1P A;  2V5F A;  4XX5 A;  2P9K G;  2R2L A;  5D2M C;  5B1B E;  2ION A;  3UIN C;  4BSZ B;  3G2V A;  3C3R A;  2IEJ A;  3CHO A;  3CHS A;  5JJ6 A;  3EJN A;  4I2W A;  3PE3 A;  3ASO E;  3FH7 A;  5FIO A;  1HG5 A;  3SO8 A;  3LY9 A;  3ASH A;  2E0I A;  4HI9 A;  3ZVV A;  4Y6C A;  4IYP A;  2KBX A;  2R5S A;  2VSN A;  2QYU A;  2GGF A;  3ONK A;  5EKQ D;  4H7Y A;  2GRM A;  1UG3 A;  4FU3 A;  5AJL A;  4GZD A;  1E7V A;  3I5P A;  1WY6 A;  4KT6 B;  3B7T A;  4WUY A;  3B7R L;  3AAA C;  3MCX A;  2C2L A;  5HRY A;  3Q7F A;  5CMW A;  2GRN B;  1E8Z A;  2GRL A;  4EHM A;  4UI9 C;  5BUZ A;  2A5E A;  2CHW A;  2B0O E;  4N5C A;  2WXG A;  4D10 C;  1H19 A;  2IQC A;  5KJK A;  3NOG D;  3L9T A;  2YIN A;  2E2E A;  4BES A;  2J09 A;  5CBO A;  5EIB E;  3LDZ A;  5ITZ F;  4G2V A;  3T9K A;  1N95 A;  2MHK A;  5G55 A;  5FQ4 A;  4U0U A;  3D9H A;  1D9S A;  4EZK A;  3JYS A;  3IHY A;  1X5B A;  3HXD A;  3P1U A;  3Q9U C;  1E8Y A;  2H6F A;  2I1J A;  2IY0 C;  1K1A A;  3FTY A;  2DCP A;  4J8Y A;  4AEZ C;  4JB8 P;  4ATZ D;  4U8H A;  1PY1 A;  4XKC A;  3L13 A;  2Y4T A;  3EHR A;  3PZ3 A;  3SFZ A;  2R05 A;  3ZN3 A;  3FTV A;  5FQ6 A;  3OTN A;  2ZGD A;  3E33 A;  2V4H C;  4PS7 A;  3EHQ A;  3KS2 A;  1IHG A;  1Y6I A;  3G2T A;  3VTX A;  4BT9 A;  4HRM B;  2UWJ G;  4HOS A;  1B89 A;  3PDN A;  5FWQ A;  1S63 A;  4HQD A;  4TRQ A;  3S7J A;  4G1T A;  1UJK A;  4HLL A;  4WND A;  5FJY A;  4H7X A;  2I2O A;  3E37 A;  2WQ6 A;  2L6B A;  4UI9 K;  1UJJ A;  1ZB1 A;  3L16 A;  4EZL A;  3TG4 A;  1UN8 A;  3ZIM A;  4MKT A;  3CVW A;  1KLX A;  3MJW A;  4CYM D;  4ANV A;  1S0P A;  3DWL G;  3U9W A;  1N9A A;  3S2A A;  3FU3 A;  2I1K A;  4G23 A;  3TWS A;  3Q9N C;  4GTS A;  4B94 A;  1AP7 A;  2AJA A;  1MX6 A;  4UQZ A;  1UN9 A;  1UW4 B;  3ZEF A;  2RD0 A;  3MKR A;  3EHN A;  3DPD A;  4LSZ E;  3EDT B;  3CIA A;  2WXI A;  4C0M A;  5B1A E;  3P2B A;  3C3O A;  2EIJ E;  4CT4 A;  4PDX A;  5ARG A;  4IRU A;  3PEU B;  3FUJ A;  2JAB A;  4CDM A;  2L6J A;  3AG2 E;  2WXR A;  1A5E A;  5BV1 A;  3BUA A;  4G26 A;  2M63 A;  3FUD A;  4EQF A;  4JL0 A;  2CFZ A;  3AG3 E;  3LCA A;  2YQ8 A;  2J08 A;  4WWP A;  4HOT A;  4HXI A;  4LNU D;  3ZHE B;  4N3A A;  5KWD A;  4M3O A;  3APF A;  3R9A B;  5AQ9 A;  1N0R A;  2Y1L E;  2XEH A;  4BX9 A;  5JHB A;  5CEA A;  3U3W A;  2WXN A;  2WXP A;  1DVP A;  3J5P A;  2JEK A;  4X8Q A;  4DX5 D;  3K9I A;  4ILI A;  1HU3 A;  3NAW A;  5C1D A;  1H2V C;  3CK8 A;  2R02 A;  4RQI A;  4ME2 A;  3C98 A;  3PZD A;  2KZT B;  4I9C A;  1ELR A;  3QAR A;  4XI9 A;  3B7S A;  1LD7 A;  2WXQ A;  3C3Q A;  1LD8 A;  2J9Q A;  4AM9 A;  3HRA A;  1FT2 A;  3FFL A;  4I43 A;  3DEO A;  2NYJ A;  4M7C A;  5D0O D;  4F3V A;  1NFI E;  1HH8 A;  4EBA G;  4P29 A;  4RG6 A;  3WXX A;  2PNN A;  4GZ5 A;  3SZ7 A;  3QNK A;  1H0A A;  4UWH A;  1QYM A;  5EX0 A;  2EIL E;  2X6J A;  4TUM A;  3QOU A;  3UMV A;  3V2O A;  3I3N A;  4YDY A;  4FLB A;  3EU9 A;  4CDN A;  2DYS E;  3L22 A;  3ASG A;  2EIN E;  2VGY A;  3ZGQ A;  3BG1 B;  3FY4 A;  3T5V A;  4NUR A;  5ENS D;  1XGW A;  1BI8 B;  2F37 A;  1BLX B;  3L17 A;  5ENO D;  5EDS A;  4ABN A;  4UI9 J;  3TXN A;  4XKB A;  2KCV A;  3FUI A;  3FU5 A;  1Z6T A;  3GZS A;  3E4B A;  1INZ A;  3AU5 A;  4GA0 A;  2P9S G;  2A4Z A;  4N5Q A;  3ABL E;  4NAC A;  2FEZ A;  3V79 K;  4RVB A;  3HDX A;  2B6C A;  4A1G A;  3TWT A;  1FVF A;  3CVL A;  3MX3 A;  4FLH A;  2A5U A;  3D9I A;  3GYZ A;  3NOC D;  5LFA A;  3APD A;  4JD2 G;  4ANX A;  2IF4 A;  3QWW A;  5ENN A;  3U4T A;  2XEV A;  4CGW A;  4FHK A;  3CST A;  4J8S A;  2VSO E;  2J07 A;  4APF A;  4HLE A;  4PS8 A;  3TGO A;  3CVN A;  2AXU A;  4URK A;  5CCM A;  4CCA A;  3T8M A;  3PS6 A;  3AS4 A;  3FU0 A;  3UTM A;  5AQB A;  1TNY A;  4JPS A;  5JHA A;  3SF4 A;  1FPP A;  2AXV A;  4GYO A;  2WQH A;  2Y0B G;  5CRU A;  3ASN E;  1Y8M A;  4QQI A;  3L54 A;  3SHF A;  4L9P A;  5E75 A;  1TR4 A;  2PQN A;  2IU1 A;  4HBD A;  3ZU7 B;  4E85 A;  4GZ3 A;  3UT7 A;  2L0I A;  4N3B A;  4ATG A;  2HYZ A;  5CBN A;  3FUM A;  1N52 A;  5FT9 A;  2LAH A;  3BEE A;  2LSU A;  3TWW A;  3PEV B;  5G2N A;  1U2V G;  2KCL A;  3MKQ B;  3ML8 A;  3W9G A;  2VTB A;  2HE0 A;  1PAQ A;  4BY6 A;  2WXM A;  5EN5 D;  3FUF A;  3NZS A;  2LSV A;  5EYP F;  4ANU A;  3DXK G;  3UT8 A;  3BU8 A;  2V5Q C;  3D9O A;  1BD8 A;  2H6H A;  4XZ4 A;  3ZPJ A;  4DUI A;  3D9P A;  4AY6 A;  1JUQ A;  3FWV A;  1FCH A;  3S7F A;  4EEC A;  4UWF A;  3ZYL A;  4WNG A;  3PUJ A;  4JHR A;  3D9N A;  3Q75 A;  2MOW A;  3SBS A;  2LO6 A;  3MA5 A;  2CHZ A;  3SI5 A;  4L2L A;  3KEA A;  1OCR E;  5KJN A;  3HXE A;  1GW6 A;  3UIP C;  2CG3 A;  2WXL A;  2R03 A;  4KBQ A;  3JXJ A;  3D9L A;  5D0Q D;  1OWL A;  3O48 A;  3FHE A;  3TWU A;  3L82 A;  2J49 A;  3O4Z A;  1X81 A;  1DNP A;  4BT8 A;  4I1O B;  2ETB A;  5AQA A;  5ANR A;  2Y69 E;  4NIK A;  4AXH A;  1SQM A;  3SD5 A;  2DVW A;  1SVX A;  2XEN A;  4EZJ A;  4FC8 A;  1TN7 A;  3ZUV B;  4J0U A;  5KNH D;  1TN8 A;  3LJ3 A;  2P9I G;  3BG0 B;  3R7R A;  4UWK A;  3UX4 A;  3ZRH A;  2RG8 A;  2KXP C;  4I1A A;  3Q4A B;  4NQ0 A;  5FIN A;  3HG0 D;  2XS1 A;  3HYM B;  4GTR A;  1NI1 A;  3Q7A A;  5FQ8 A;  4BTB A;  3TWR A;  3L6A A;  4CRW A;  4PS3 A;  4ACK A;  3HVE B;  4DRX E;  5KJL A;  2WM9 A;  2PZI A;  2GRP B;  5A7D B;  2WMO A;  1TYQ G;  5ENT D;  5M72 A;  4LER A;  1D8E A;  4G24 A;  4JXT A;  5FQ7 A;  5T3R A;  1N0Q A;  4AIF A;  1HE8 A;  3LS8 A;  2KCK A;  1OWN A;  5DIZ A;  4V3I A;  1OUV A;  4ZFH A;  1H6P A;  4Y6W A;  3G2U A;  4IUL A;  4I17 A;  2V8S E;  3J5Q B;  3JUE A;  3PNL B;  4K5A B;  3PRE A;  3KSQ A;  4GTT A;  4DJA A;  4J7W A;  2BKK B;  2KAT A;  3CEQ A;  2ZXW E;  4HNA D;  5EID A;  4L23 A;  1N94 A;  3ZW3 A;  5AAO A;  2EQX A;  2FUL A;  4U0Z A;  1OWO A;  4E6H A;  1IKN D;  2NC9 A;  5ENR D;  5G05 C;  5FZQ A;  2XGM A;  5J08 A;  3UM1 A;  1N4S A;  3ZYQ A;  3FTS A;  3QK0 A;  4RSY A;  4I6J A;  2BUG A;  3QAQ A;  3G2W A;  5EX3 A;  3MYV A;  4L1B A;  3FDH A;  4WWO A;  3RIB A;  3ZHE A;  3ZNG A;  3CLJ A;  4BSX A;  3LVR E;  1Z3X A;  2P9L G;  2HM8 A;  4N2Q A;  4Q94 A;  4DX6 D;  4JW1 A;  2RFA A;  3ZXS A;  3IEG A;  2XQ0 A;  3TWV A;  2R17 C;  4U8Y D;  1V55 E;  2BKG A;  2KZT A;  3HXF A;  4OVV A;  3RRN B;  5T8I A;  3CGH A;  4PH4 B;  4A1S A;  3NF1 A;  3CVU A;  3LY7 A;  3T5X A;  3FUH A;  4CT0 A;  3QDN A;  4GTV A;  1SA5 A;  1H6K A;  5AAR A;  2PM6 A;  5E76 A;  5CRV A;  2DZN A;  1OCZ E;  3U66 A;  2H6I A;  2R59 A;  4LEU A;  2Q7F A;  4B0Z A;  5JJT A;  4B93 B;  3C5R A;  4Q96 A;  4C9B B;  4AVX A;  4UWL A;  4GYY A;  1DCQ A;  4YND A;  1IXV A;  4ANW A;  4BFR A;  3PE4 A;  4AJW A;  4U07 A;  3FTZ A;  1SZ9 A;  3RU0 A;  3N71 A;  2V0P A;  5LCW C;  2VGE A;  1HFA A;  2P58 C;  4B89 A;  2QZA A;  3ESL A;  3RRU A;  1SW6 A;  4G8L A;  4HOU A;  5AN8 A;  2F8X K;  2LUH A;  3Q5M A;  1H2U A;  1OCC E;  3G2S A;  3RK6 A;  1K3Z D;  2NSZ A;  3CHR A;  2OVB A;  1EF1 C;  3VLF A;  2XCB A;  2EIM E;  3UM0 A;  2OCC E;  1P5Q A;  4OVU A;  3QB2 A;  3DEP A;  3D3M A;  3ULY A;  1WG0 A;  3VLE A;  4G25 A;  4LCT A;  4TXQ A;  1NP7 A;  4DX1 A;  3HXC A;  2VJ8 A;  4A63 B;  4YDO A;  3ENE A;  3LJN A;  1QNF A;  3UT4 A;  4KYO B;  4CEM A;  5AIJ A;  1TNB A;  4DI3 A;  3PZ1 A;  5AQ7 A;  3ZYK A;  3Q73 A;  3UKU G;  1U3D A;  4KVO A;  3CQG B;  3CHQ A;  4Q69 A;  3LKU A;  2IO3 C;  4LUN U;  2C0L A;  4HFG A;  1K1B A;  1DCE A;  5ENP D;  3CK9 A;  1XNF A;  4J6I A;  3SNX A;  3TJP A;  2AWI A;  2QFC A;  4JA7 A;  4ACL A;  3JQ1 A;  4J8F A;  4HB5 A;  1FVH A;  3UIO C;  2IO2 C;  4JEU A;  5JMN D;  1JCS A;  3L08 A;  3AG4 E;  1VDY A;  5B3S E;  1KT1 A;  2IJG X;  1WM5 A;  3DSV A;  2YHE A;  2WB2 A;  4JA9 A;  5CMY A;  2ZGG A;  1MYO A;  1MHQ A;  5CCL A;  4GZ6 A;  3CVQ A;  4J8E A;  3CQC B;  4DX7 D;  2Y4U A;  1BI7 B;  1MJ0 A;  3DSU A;  1N11 A;  4U63 A;  1E8W A;  1JWF A;  4N39 A;  1N4P A;  1RZ4 A;  2J4B A;  3MKQ A;  3EUV A;  2WXH A;  2QC9 A;  4F1S A;  3CVV A;  5KNG A;  1TJC A;  2DBA A;  4GCN A;  5ANL A;  3ZKJ A;  5G05 J;  1NL4 A;  4MBG A;  4IN3 B;  4GTQ A;  4DK5 A;  1YCS B;  3AU4 A;  3LPZ A;  4GA1 A;  2ETC A;  5EYL A;  3EU5 A;  3APC A;  3JXI A;  1N54 A;  4DI4 A;  3X2Q E;  3SBT B;  5CHE E;  1IYG A;  3RO2 A;  3MV3 B;  4FAD A;  3MGB A;  3OXG A;  4TV3 A;  1KZP A;  4I9E A;  3IHV A;  3FTX A;  2UY1 B;  4KVM A;  5KCM A;  4FA6 A;  5G04 C;  4KZC A;  4PUC A;  3SFX A;  4U95 D;  3EHM A;  4G11 A;  3RSE G;  2I6H A;  3GW4 A;  3Q49 B;  2VQ2 A;  4C48 B;  4I2Z A;  3Q15 A;  4N2S A;  1Z5S C;  4K0R A;  1YA0 A;  1OWP A;  5CEC B;  2NXP A;  2QY7 A;  1AWC B;  5BXO A;  3SY2 A;  3D9M A;  4B8A A;  4JEH A;  3ABM E;  2OOE A;  4DPR A;  2XGS A;  3FUK A;  4LNG A;  5KJM A;  1HF8 A;  1MQS A;  1TJF A;  2J4D A;  3FEY A;  5A23 A;  3EIQ C;  4O60 A;  3Q79 A;  2IFU A;  3EIJ A;  4GTM A;  1G3N B;  1ZBP A;  3ZXP A;  3DXM G;  1MZC A;  3CKC A;  2XEE A;  4J8D A;  5KBA A;  5AYW D;  4QFV A;  4A3T A;  4JVS A;  2LXL A;  4TUU A;  5LCW J;  5FZR A;  1OY3 D;  3CKB A;  5A6C A;  3DPY A;  3LEW A;  1TEZ A;  4G8K A;  3JUI A;  2XCC A;  3ESK A;  3PNT B;  4XIF A;  4U04 A;  3W9F A;  1TN6 A;  3QKY A;  2DIW A;  3ZYM A;  1IQU A;  4K5C A;  1OT8 A;  4F7A A;  3RRM B;  5BV0 A;  3TXM A;  1MX4 A;  3DRA A;  3DBS A;  2VTB B;  2PQR A;  4JC8 A;  5DBK A;  5BPP A;  3V30 A;  1H6O A;  2XZT G;  2CFU A;  2X6F A;  1UOH A;  3I4G A;  1RW2 A;  3Q78 A;  2VSX E;  2DZO A;  2IOS A;  2FBN A;  3FUE A;  2H6G A;  3OXF A;  3TG5 A;  1L5J A;  1V54 E;  1KT0 A;  3U64 A;  1SZA A; 
#chains in the Genus database with same CATH homology
 3EHR A;  1N11 A;  3F6Q A;  4BER A;  1N0Q A;  1K3Z D;  2Y0B G;  4HI9 A;  3TWV A;  5EIL A;  1A5E A;  5ENS D;  4U8Y D;  3UXG A;  2BKG A;  5D66 A;  4ZHB A;  3DEP A;  1BI8 B;  2F37 A;  1WG0 A;  2QC9 A;  5CER B;  1BLX B;  2ZGD A;  3B95 A;  2V4H C;  3SO8 A;  2KBX A;  4QQI A;  3JXJ A;  3EHQ A;  5ENO D;  5KNG A;  3UI2 A;  4ZFH A;  4DX1 A;  3T8K A;  3ZKJ A;  4LNU D;  4RLY A;  3TWU A;  4YDW A;  4A63 B;  1TR4 A;  3IXE A;  4O60 A;  2XZD G;  3J5Q B;  3JUE A;  3LJN A;  4K5A B;  5KWD A;  4HBD A;  3ZU7 B;  4BEP A;  1YCS B;  4DX2 A;  5AQ9 A;  4HRM B;  5BXU A;  3B7B A;  2ETC A;  1G3N B;  5EYL A;  4J7W A;  2BKK B;  1N0R A;  3AJI A;  3KEA A;  2Y1L E;  2XEH A;  4GPM A;  2ETB A;  3JXI A;  5AQA A;  4O1O A;  5AQ7 A;  5CBN A;  5CEA A;  3V31 A;  5AAR A;  3V2X A;  4HQD A;  4N5Q A;  5HKP A;  1YYH A;  3AAA C;  4HNA D;  2DZN A;  4NIK A;  3J5P A;  4U8V D;  5EID A;  1WDY A;  2XEE A;  5ENQ D;  3TWW A;  5HRY A;  4DX5 D;  3V79 K;  2FO1 E;  2DVW A;  5KBA A;  1MX2 A;  1SVX A;  4QFV A;  4HLL A;  5AAO A;  1BU9 A;  1K1B A;  2L6B A;  2XEN A;  1OY3 D;  1IKN D;  5ENR D;  4UUC A;  4CZ2 D;  5ENP D;  4G8K A;  2A5E A;  3ZUV B;  4B93 B;  2B0O E;  5KNH D;  1IHB A;  3C5R A;  2J8S D;  3TWT A;  3W9G A;  1DC2 A;  4GMR A;  4BET A;  3W9F A;  4O1P A;  2QYJ A;  2HE0 A;  3NOG D;  2KXP C;  1YMP A;  4HRN A;  3NOC D;  4K5C A;  1DCQ A;  4U96 D;  1IXV A;  5EN5 D;  4BES A;  4CYM D;  1OT8 A;  5CBO A;  4LG6 A;  4HB5 A;  5EIB E;  3HRA A;  5FIN A;  4U95 D;  3HG0 D;  2F8Y A;  3TWX A;  5ITZ F;  4Z68 A;  2MYO A;  1MX4 A;  5EYP F;  3TWQ A;  3TWS A;  2ETA A;  3T9K A;  3Q9N C;  3DEO A;  2P2C P;  2NYJ A;  4HRL A;  2AJA A;  1AP7 A;  1MX6 A;  3D9H A;  5JMN D;  3TWR A;  1D9S A;  4C48 B;  1S70 B;  2V5Q C;  5JA4 D;  1BD8 A;  1NFI E;  4DUI A;  4K5B A;  3V30 A;  4DRX E;  5CED B;  2VGE A;  4HI8 A;  2XZT G;  2PNN A;  4F1P A;  3ZNG A;  4OAV B;  3Q9U C;  3NBN B;  4F6R D;  4LSZ E;  5HS0 A;  1UOH A;  1QYM A;  4BSZ B;  2DZO A;  1K1A A;  1SW6 A;  4TUM A;  2DWZ A;  4G8L A;  3V2O A;  4YDY A;  5CEC B;  5AN8 A;  5ENT D;  2ZGG A;  4J8Y A;  1MYO A;  3EU9 A;  2F8X K;  1AWC B;  2RFM A;  4DX6 D;  4JB8 P;  3UTM A;  5BXO A;  5AQB A;  4ATZ D;  4DX7 D;  2JAB A;  2RFA A;  4OAU C;  5FIO A;  1BI7 B;  1MJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...