5FINA

Darpins as a new tool for experimental phasing in protein crystallography
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
SDLGRKLLEAARAGQDDECRILMANGADVNAADNTGTTPLHLAAYSGHLEIVECLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords NI3C DARPIN MUTANT5 HG-SITE N1
publication title Darpins as a New Tool for Experimental Phasing in Protein Crystallography
rcsb
source organism Synthetic construct
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5finA00
3UTMA 5AQBA 3TWVA 4U8VD 1MX6A 3V2XA 3J5PA 2FO1E 1MX2A 5EYPF 4ZHBA 5BXUA 5ENPD 3JXIA 4DX5D 2B0OE 4HB5A 4K5CA 2VGEA 2ZGDA 5ENTD 3T8KA 1YCSB 1BI8B 4OAUC 3DEOA 1YMPA 5AQ9A 3V79K 5D66A 3DEPA 5AARA 2BKGA 2ETBA 3JXJA 2F8YA 2HE0A 3JUEA 3KEAA 3TWRA 3W9FA 3F6QA 2ETCA 4G8KA 1N0QA 3TWUA 2RFMA 5AQ7A 4J7WA 2XEHA 3NOCD 4YDWA 5CEDB 4K5AB 1AWCB 1YYHA 4N5QA 1OY3D 1BLXB 2F37A 3SO8A 3W9GA 4BEPA 4DX7D 5EIDA 3NBNB 5FIOA 4G8LA 4ATZD 5CEAA 3T9KA 5KWDA 4B93B 3EU9A 1D9SA 1K3ZD 2Y0BG 3Q9UC 4HRLA 4HI8A 4Z68A 1SVXA 2RFAA 4QQIA 5EILA 4F6RD 1BU9A 3HRAA 4HLLA 4NIKA 4RLYA 3V31A 5AQAA 1IKND 1K1AA 3TWTA 1AP7A 2KXPC 2DZNA 3B7BA 4UUCA 1WG0A 2F8XK 3TWWA 2XEEA 3D9HA 2P2CP 2XZDG 4DRXE 1IHBA 1WDYA 2ZGGA 4BSZB 4CYMD 4OAVB 4A63B 2V5QC 4YDYA 2J8SD 5ENSD 2XZTG 5HS0A 5KNHD 3UI2A 5FINA 4ZFHA 2Y1LE 3HG0D 3V2OA 3ZKJA 3V30A 1N0RA 1OT8A 2A5EA 4LG6A 4HRMB 4U96D 4F1PA 4K5BA 3UXGA 2BKKB 4LNUD 4J8YA 2DWZA 5HRYA 4O1PA 2ETAA 1K1BA 2NYJA 5HKPA 3ZNGA 4DX6D 2QC9A 4HNAD 1G3NB 1S70B 3IXEA 4BERA 2V4HC 2QYJA 3AAAC 5CBNA 1BD8A 1MYOA 1QYMA 4HRNA 1A5EA 4CZ2D 2DVWA 5JMND 3EHQA 3ZU7B 5AN8A 3LJNA 5EIBE 1BI7B 4DX2A 2KBXA 3EHRA 4HBDA 5AAOA 5CBOA 5KBAA 5CERB 4BETA 4HQDA 3J5QB 2PNNA 1TR4A 3TWSA 5CECB 1MX4A 5JA4D 4O60A 3TWXA 4LSZE 2AJAA 2MYOA 3NOGD 1IXVA 4O1OA 5ENQD 4U8YD 5ENRD 5BXOA 2DZOA 3C5RA 2L6BA 3AJIA 4JB8P 3B95A 3ZUVB 1UOHA 5EYLA 1MJ0A 1SW6A 1DC2A 4GPMA 1NFIE 2XENA 4TUMA 4C48B 5KNGA 4GMRA 4BESA 4DX1A 1DCQA 1N11A 4DUIA 5ENOD 4QFVA 4HI9A 3Q9NC 5EN5D 3TWQA 2JABA 4U95D 5ITZF
chains in the Genus database with same CATH superfamily
4KYOB 1UN8A 3TXNA 4GTOA 2WMNA 1IYGA 3JUEA 3F6QA 2ETCA 2FO7A 3TWUA 4WUYA 2IO2C 2IONA 2IO3C 3Q9UC 4U63A 5EILA 2LNIA 1QBQA 2UWJG 3G2SA 4RLYA 2WB2A 3GYZA 3TWTA 4APOA 4K0RA 1TJFA 4RQIA 4ANXA 2OCCE 4BSZB 4PDXA 3G2UA 1H6OA 5DBKA 4UWGA 3UQ3A 3ASHA 4NURA 4XKBA 3N71A 1OUVA 2R05A 3PS6A 1N54A 3V30A 3FTUA 3NQPA 3T8MA 5HRYA 1E8ZA 5CMWA 1E8YA 4XEIG 4CDMA 1N4PA 4CZ2D 4JPSA 4N2QA 3LJNA 3D9NA 2OV8A 2RD0A 5CECB 2IFUA 1TN8A 4I6GA 3RRMB 4GTVA 4CCAA 1N4QA 3CVLA 3E32A 5KJNA 1KPSB 1Y6IA 2XHEA 1DNPA 4K03A 1N4SA 4G25A 4BX8A 4U8VD 4I1OB 1S63A 2Q7FA 3DRAA 3DSVA 4BX9A 2HE0A 3Q7AA 3QARA 4PH4B 5T3RA 4F1SA 5H7PA 3AU5A 3VTXA 2BF0X 4WWPA 2R2LA 5KCMA 4CGVA 5JJ7A 1RW2A 4HRLA 4C0MA 1OWLA 1HE8A 4UWFA 3NAWA 3CVPA 4LCTA 1N52A 3ZGQA 2PQNA 5LX8A 3GZSA 4JHJA 3ZHEA 3JCKC 2R5SA 2E2EA 3QWWA 3EIQC 2A5EA 3FFLA 4GMJA 3UUXA 3S7DA 3LS8A 2KZTB 4I43A 1JWFA 2OEWA 5C1DA 4U7EB 2GRNB 3CVNA 5BUZA 3QWVA 4UWLA 2QYJA 4I9EA 4EZLA 1D8DA 2YINA 2HO1A 4ANVA 1MX4A 3FUMA 2IQCA 5FQ7A 4PS8A 5ENRD 3FUIA 1UW4B 3VLDA 1NP7A 5JHAA 2LUHA 2VTBB 3B7SA 4HS2A 3FULA 3NF1A 4GTPA 5HS0A 2FBNA 3QOUA 2DIWA 1N95A 4GZDA 5ENTD 4U8HA 3PZ3A 5AQ9A 3ENEA 2BKGA 3FDHA 1FVFA 3O48A 4RG9A 5BPPA 2KZTA 3JQ1A 4RSYA 3UT8A 1LF8A 2PZIA 1BLXB 3W9GA 4EHMA 4BY6A 4ATZD 1H2VC 4G11A 3EU9A 4EQFA 4JHRA 3TXMA 2VGXB 2WXFA 3MV3B 1OCZE 5FWQA 2VSOE 1O1RA 1IKND 2RG8A 1O1SA 3OXGA 3ZRHA 3ABME 5EKQD 3WG7E 4BT8A 1DVPA 3G2WA 4E85A 1ELWA 4E6HA 1N0RA 1OT8A 3IHVA 2XRZA 4EBAA 3CVYA 3ZYQA 3D3MA 1BPOA 5ENNA 4HOUA 1G3NB 2V4HC 4MRUA 3FU3A 1BD8A 1FCHA 3ASFA 2VGXA 4P29A 2EIJE 2WQHA 1TNYA 1IXVA 4V3IA 3B13A 3EJNA 1MJ0A 1SW6A 1ELRA 4ME2A 1N11A 1TNZA 2A4ZA 1Z6TA 3D9KA 3RU0A 2PL2A 5A23A 3UT7A 4KVMA 1EF1C 3CVXA 1LTXA 3ZN3A 3ML9A 3CVVA 1HZ4A 2XEHA 3UIPC 4KT6B 4BTBA 1QNFA 2NC9A 2OEVA 3CKBA 1K8KG 3MKQB 2J08A 3MJWA 5ANLA 5LP0A 3HXCA 1Q2ZA 1H2UA 2GW1A 4AY5A 3I4RB 5FZRA 2V5QC 3MYVA 3AS4A 4M7CA 4M3OA 3CR3A 4YDOA 3CQGB 4PS7A 1E8WA 3QNKA 3LY7A 4XZ4A 3UX4A 3UINC 4DX6D 4F7AA 4AY6A 3L16A 4IULA 2X38A 3HXEA 4FLHA 3TGOA 4YVQC 3ASDA 3HIZA 3CSFA 1OWMA 2MYOA 3FU0A 4GCNA 2H6HA 3E30A 4F3VA 4LNBA 4HFGA 1KLXA 2EIKE 1OWNA 2GRLA 2R02A 1JCRA 4GMRA 3UIOC 2I9CA 3KD7A 4MBGA 3UM3A 3BG1B 5BXUA 1O5MA 4EZKA 1OWPA 3SFZA 3S7JA 2QYUA 4CDNA 5JJTA 1N9AA 4J7WA 1AWCB 3SI5A 1Y8MA 3Q75A 4IN3B 1K3ZD 2WXMA 4FJZA 3ASNE 2WMOA 3LKUA 3EDTB 2P9KG 3UM1A 3FTSA 4J8FA 1Z3XA 3FU6A 3TWWA 2XZDG 1IHBA 2VJ8A 4G2VA 4RG6A 4U0SA 3APDA 2XPYA 1SQMA 4L7TA 4A63B 2FULA 2MHKA 1TEZA 4ILIA 2CHXA 3DWLG 5M72A 4PUCA 3ONKA 2BKKB 4WAFA 2QC9A 3FEYA 4J6IA 4UWKA 4JL0A 1A5EA 4G23A 2QY7A 3L08A 3RIBA 1V54E 5JJ6A 4JHKA 3URZA 4F53A 2WXHA 3RSEG 4HOQA 3IBEA 2E0IA 5ENQD 2KATA 3GZ1A 3BQOA 2A5UA 3Q7FA 3ZUVB 3S2AA 2XQ0A 4L1BA 4HI9A 2I6HA 3ZYMA 5ITZF 3TWVA 4L9PA 2ZGDA 2HYZA 3DEOA 4ANWA 3FUHA 2MOWA 2ETBA 3JXJA 3TWRA 4U0UA 4YDWA 1WY6A 2HR2A 3NBNB 4JVSA 5J90A 4D10C 1GW6A 5EX3A 4NIKA 3UKRG 2GRPB 2LXMA 3C3QA 3PE4A 2J07A 2WXGA 3ZW3A 4UI9J 1TNBA 3CHMA 4UQZA 2CFZA 4GYWA 5ENSD 5FINA 4ACKA 3EUVA 2WM9A 2XPZA 4UQYA 5C2YA 2BEDA 1NI1A 3U9WA 4A3TA 2DWZA 1JCQA 2WXQA 4TXPA 4N2SA 2BTDA 3PRZA 2AW6A 3IXEA 3D9PA 5AJLA 2P9SG 5FZSA 2I2OA 5ANRA 5AN8A 4AV7A 1BI7B 3FUFA 4HBDA 3TL5A 2IY0C 1KT1A 5BT1A 3RRNB 2VSYA 3L82A 1A17A 5LOZA 3EHNA 2DZOA 3D9MA 3ISMC 3UKUG 5BW8C 4KBQA 4TUMA 4XIFA 2WXPA 4DJAA 3LDZA 4GTQA 4Y6WA 4WNEA 3DEPA 3L9TA 3I5PA 2VSXE 2VSNA 3APCA 3ULEG 3X2QE 4G8LA 4UWHA 4WNDA 4TUUA 2YNQA 2BUGA 4J8EA 3IHYA 5FJYA 1E8XA 2Y3AA 1LD7A 3D9HA 4G26A 5E76A 2ZGGA 3NZSA 2AVPA 4OAVB 3CVWA 2J8SD 3E37A 1E7UA 3V2OA 3LEWA 2XPIA 4LG6A 4ATGA 4HRMB 4I1AA 3FWVA 1OCOE 4AP2A 3AU4A 5AENA 3HXDA 3MKRA 4GTSA 2L0TB 3MZLB 5LCWJ 3CSTA 2KBXA 2GRQB 4NACA 2L6JA 3I3NA 1PC2A 4TV3A 5BXOA 2NSZA 4AM9A 3AJIA 3KAEA 3D9LA 3GW4A 2HM8A 4GA0A 3SFYA 1U3CA 4ZHBA 1KZPA 3FUEA 2FEZA 3ULYA 4OAUC 5CMYA 1QZ2A 1SZAA 3HDXA 1IQUA 3CK8A 5CEDB 4K5AB 1YYHA 2R03A 2LO6A 4DX7D 1H6KA 2Y0BG 2GRMA 3FUNA 4AEZC 2WXRA 2KXPC 1TN6A 5BV0A 2H6IA 3HYMB 1WDYA 4EZJA 4JEUA 1UJJA 3FH5A 1VDYA 2WXOA 5T4YA 1EPUA 2XS8A 1MQSA 3U4TA 3LVQE 3CK7A 4XI9A 4JZYA 1ZU2A 4ANUA 2QZAA 4F1PA 1FPPA 1OCCE 2J4DA 2JLBA 4HLEA 4XI0A 4BERA 4CT0A 2VTBA 4BFRA 2AXUA 2Y4TA 1JWGA 5CERB 1DCEA 3CHRA 4AOFA 4FULA 5B1AE 3K9IA 4W9RA 3C98A 2ZXWE 1X5BA 4B0ZA 4GZ6A 4QFVA 4AVXA 2V0PA 3SZ7A 5AQBA 2FO1E 1MX2A 4I6JA 3JXIA 3JUIA 4JA7A 2WXIA 1JPLA 3FTYA 4LERA 4DI4A 3MX3A 1ZB1A 3OAWA 1N0QA 2J49A 3DXKG 4GPKA 1WAO1 4AJWA 1H0AA 3SO8A 2KCLA 5FQ6A 2LAHA 5FIOA 3Q79A 4GCOA 2GRRB 3KSQA 1SVXA 3Q5MA 4J0UA 4F6RD 1MZCA 3TJPA 3Q49B 4I6EA 2UY1B 4FHKA 1K1AA 4CGWA 1UJKA 1OXJA 3ASOE 3LXUX 2H6GA 4DRXE 3ZYLA 4CDRA 5JHBA 5D2MC 4AXHA 4Q94A 4DI3A 5E75A 1TYQG 1YA0A 4U07A 3VLFA 1HX8A 2L0IA 4GAAA 3R9MA 5HKPA 4HNAD 5EX0A 3AG2E 3U64A 3IEGA 1KZOA 5CRUA 4DX2A 2DCPA 2P9IG 3MEKA 2AXZA 2AJAA 4BSXA 4EPZA 3QWPA 3U66A 1PY1A 1E7VA 3FTZA 5G05J 4J8DA 4H7XA 4N5QA 3V2XA 1P5QA 4NRHB 3ASGA 2KCVA 4YVOA 1BI8B 1UG3A 3MKQA 4A1SA 1XNFA 3BEEA 3EIJA 3D9OA 5G04J 3ONLA 3AS8A 4WNFA 4BEPA 4I2ZA 2I1KA 5CEAA 2VYIA 4HI8A 2ILRA 3QJZA 2C2LA 2OOEA 4RVBA 1BU9A 3QAQA 1N94A 3DBSA 2C0LA 1S0PA 4XE0A 2F8XK 4JD2G 2WQ7A 4WWNA 4CEMA 1JUQA 3SD5A 4XX5A 5KNHD 3LY9A 1JCSA 5G05C 2YQ8A 1D8EA 1EDUA 2WXKA 2Y4UA 5FQ4A 2P9LG 4LNUD 3ML8A 4GB9A 1K1BA 5KJLA 5G04C 4JW1A 4GTTA 5CBNA 2ONDA 3B7UX 3CQCB 3C3RA 3NB2A 3EHRA 3CVQA 3TG4A 4GYOA 3L6AA 4O60A 2XCBA 4B89A 3LCAA 1OCRE 3MA5A 3ESKA 1ZBPA 3B95A 1MHQA 3DSSA 5KJKA 2ZISA 3EHMA 4YDEA 2WXLA 1TN7A 2WQ6A 1DC2A 3ULQA 1NFIE 3O4ZA 5FTPA 4U04A 4BESA 4DX1A 2LAIA 3OXFA 4KXKB 3UTMA 1OWOA 2LXLA 3DXMG 2VGEA 3T8KA 2KM4A 2F8YA 3CHSA 2PQRA 3RO3A 3UT4A 3LJ3A 4OYSA 1FVHA 2KCKA 1NZNA 2F37A 4NQ0A 3QKYA 4UI9K 4APFA 3ZIMA 3E34A 4GYYA 1FT1A 4DPRA 3BG0B 1FT2A 4Z68A 2RFAA 2JEKA 1HG5A 3V31A 4FLBA 4A55A 3CGHA 2P2CP 2X6IA 4XKCA 2L9BA 3SF4A 5J08A 3BUAA 3B7TA 5CCMA 2Y1LE 1NA3A 3TG5A 3ZKJA 3PUKA 1HG2A 2H6FA 2GROB 4N3BA 4EBAG 4N39A 2VGYA 4L2YA 5D0QD 3DPYA 2WXJA 3FTWA 4H7YA 4LRZA 2NYJA 3ZNGA 3FUDA 3ESLA 3T5VA 5DIZA 2LSUA 5B1BE 2DYRE 3AAAC 4I2WA 4DK5A 1SA4A 2DVWA 3AG1E 3FUKA 5CBOA 3TWSA 4MS6A 3VLEA 4GPMA 1E90A 2JABA 1TJCA 3HVEB 5HQ8A 3OXLA 4BTAA 2B0OE 4K5CA 2R59A 5G55A 1H19A 2IEJA 5AARA 2EILE 3I4GA 4FU3A 2NXPA 4MLPA 2OVBA 1HH8A 4WWOA 4N5CA 2I1JA 2IU1A 1HFAA 2PM6A 1SA5A 1D9SA 4B93B 4UI9C 3T5XA 1NL4A 4FP7A 4GA2A 5A7DB 3HXFA 4KZCA 4IRUA 4AIFA 3KSLA 3CK9A 3UI2A 2XEVA 4R7LA 3HVEA 5BNWA 1HXIA 3LVRE 3Q73A 3FTXA 2IJGX 4GZ3A 2VQ2A 5KJMA 2V5FA 3ZHEB 2P58C 5LFAA 2WVIA 3B7RL 4Q69A 3ZFWA 3L22A 3EHQA 2P9NG 5AAOA 2M63A 3Q78A 3PZDA 3J5QB 3TWXA 4LSZE 2XS1A 3C5RA 3C72A 1ELKA 3ZYKA 3P2BA 4DLOA 4TXRA 4C48B 5KNGA 1TNOA 4GTRA 2YHEA 1V55E 3TWQA 3RO2A 2DYSE 5ENPD 4DX5D 4HB5A 3DSXA 4BWRA 5D0OD 4CT4A 4Y6CA 3CVUA 5B3SE 2KC7A 1PAQA 2ZIRA 4Q96A 2V8SE 3PZ1A 4X8QA 5KWDA 3JQ0A 5FT9A 3NZUA 3PNTB 3SNXA 3AG4E 2XRYA 4PS3A 3DSWA 1INZA 2DZNA 1WG0A 5BV1A 2XEEA 4CYMD 4ACLA 3S7BA 4WNGA 5AJDA 1HS6A 1RZ4A 2XZTG 4IYPA 3HG0D 3CHPA 4G24A 3RK6A 4CRWA 5LCWC 4TRQA 4U96D 3CV0A 3UPVA 3DSTA 3PDNA 1WM5A 3IV0A 1SZ9A 1O1TA 4HRNA 1E96B 2EIME 3FHEA 3ZU7B 2B6CA 5G2NA 5EIBE 2XGMA 4BETA 1Z5SC 3QB2A 4O1OA 1W3BA 1LD8A 2X6FA 4GA1A 4C0EA 4GU5A 4GMLA 4O6FA 2EQXA 3RKVA 4HOSA 2PM7A 3L13A 5ENOD 3GZ2A 3PREA 3R7RA 4BT9A 5HI7A 2X6JA 2OVFA 3MGBA 1YCSB 2WPVA 1YMPA 3V79K 3ABLE 2LSVA 2RFMA 5AQ7A 4LEUA 4MKTA 3L17A 2IOSA 5ARFA 1OY3D 4JXTA 4FHJA 2AXVA 3OTNA 4DLQA 3KS2A 1HO8A 4URKA 1AP7A 4J8SA 3B7BA 1HF8A 2CFUA 4OVVA 3PUJA 4TXQA 1QQEA 3SGHA 4EECA 1Z3YA 3ZEFA 3MV2B 1TNUA 3CHQA 3LY8A 3ZPJA 3HXBA 3ABKE 1HU3A 2FI7A 3QC1A 1U2VG 4HVBA 4GZCA 4ILHB 3WXXA 3FY4A 3G2TA 3PEUB 3L54A 5EDSA 5KBAA 4HQDA 2XGSA 4L23A 4A3VA 1X81A 2X3MA 3Q47B 3DSUA 3U3WA 1N4RA 4C9BB 3D9IA 1UOHA 3EU5A 4B8CB 1DCQA 2CG2A 4DUIA 2F0YA 3Q9NC 3FH8A 4U95D 3Q4AB 4N3CA 3LYAA 1MX6A 3J5PA 3SBTB 2IOLA 2UY1A 4HOTA 5D66A 4L2LA 3KEAA 2X6HA 4FJYA 3W9FA 3FEXA 2WXNA 4UQXA 3NOCD 4I9CA 3ZXPA 4B94A 3SBSA 3PEVB 2RKKA 1H2TC 4FADA 1IQRA 4QQIA 3P1UA 3HRAA 3SQVA 5AQAA 3PZ2A 1KT0A 2YHCA 4UUCA 3CLJA 1U3DA 3MCXA 5FZQA 3S7FA 2XGOA 3UM0A 1EYHA 4ZFHA 4YNDA 4GZ5A 1XGWA 2P9PG 5T8IA 3ZVVA 3UXGA 3HHMA 4O1PA 3APFA 3SFXA 4U0ZA 4HORA 3FP3A 1MYOA 3G2VA 2DBAA 4FC8A 2FF4A 1H6PA 3PVLA 3CHOA 2PNNA 3SY2A 1TR4A 5JA4D 2J09A 4U8YD 4KZ0A 4JB8P 3RRUA 3FUJA 3SHFA 5EYLA 2XENA 2GGFA 1NA0A 5EN5D 3TAXA 5AIJA 5EYPF 3FU5A 3R9AB 3PNLB 2J4BA 1IHGA 4I1MA 4KMOA 1B89A 4LNGA 3FTVA 3PE3A 2V4LA 3E33A 4LUNU 4JC8A 4ILGA 2ZU6B 4G8KA 3RAUA 1S64A 3UMVA 3CEQA 4KVOA 3E4BA 4ABNA 3IKOB 5EIDA 1L5JA 5CRVA 3T9KA 5FQ8A 3KEZA 2EINE 4HLLA 3ZXSA 2P9UG 2IF4A 3PH0C 3BU8A 2J9QA 4B8AA 3CIAA 5AYWD 3DPDA 3QDNA 4YDYA 2MRIA 3AS5A 3D9JA 5CCLA 2CHWA 4HXIA 3RJVA 3PZ4A 2CHZA 3UM2A 3CKCA 4K5BA 4J8YA 4I17A 2R17C 4GTMA 2ETAA 5IY5E 1S70B 3QK0A 1QYMA 2QFCA 3JYSA 5ARGA 3AG3E 5JMND 3VTYA 4G1TA 3LPZA 5A6CA 2C0MA 2AWIA 3C3OA 4JA9A 4N3AA 2XCCA 2X6KA 3NOGD 5CHEE 4A1GA 2Y69E 4JEHA 2L6BA 3R7QA 2CG3A 3Q15A 3FH7A 1UN9A 4FA6A 4OVUA
chains in the Genus database with same CATH topology
3UTMA 5AQBA 3TWVA 4U8VD 1MX6A 3V2XA 3J5PA 2FO1E 1MX2A 5EYPF 4ZHBA 5BXUA 5ENPD 3JXIA 4DX5D 2B0OE 4HB5A 4K5CA 2VGEA 2ZGDA 5ENTD 3T8KA 1YCSB 1BI8B 4OAUC 3DEOA 1YMPA 5AQ9A 3V79K 5D66A 3DEPA 5AARA 2BKGA 2ETBA 3JXJA 2F8YA 2HE0A 3JUEA 3KEAA 3TWRA 3W9FA 3F6QA 2ETCA 4G8KA 1N0QA 3TWUA 2RFMA 5AQ7A 4J7WA 2XEHA 3NOCD 4YDWA 5CEDB 4K5AB 1AWCB 1YYHA 4N5QA 1OY3D 1BLXB 2F37A 3SO8A 3W9GA 4BEPA 4DX7D 5EIDA 3NBNB 5FIOA 4G8LA 4ATZD 5CEAA 3T9KA 5KWDA 4B93B 3EU9A 1D9SA 1K3ZD 2Y0BG 3Q9UC 4HRLA 4HI8A 4Z68A 1SVXA 2RFAA 4QQIA 5EILA 4F6RD 1BU9A 3HRAA 4HLLA 4NIKA 4RLYA 3V31A 5AQAA 1IKND 1K1AA 3TWTA 1AP7A 2KXPC 2DZNA 3B7BA 4UUCA 1WG0A 2F8XK 3TWWA 2XEEA 3D9HA 2P2CP 2XZDG 4DRXE 1IHBA 1WDYA 2ZGGA 4BSZB 4CYMD 4OAVB 4A63B 2V5QC 4YDYA 2J8SD 5ENSD 2XZTG 5HS0A 5KNHD 3UI2A 5FINA 4ZFHA 2Y1LE 3HG0D 3V2OA 3ZKJA 3V30A 1N0RA 1OT8A 2A5EA 4LG6A 4HRMB 4U96D 4F1PA 4K5BA 3UXGA 2BKKB 4LNUD 4J8YA 2DWZA 5HRYA 4O1PA 2ETAA 1K1BA 2NYJA 5HKPA 3ZNGA 4DX6D 2QC9A 4HNAD 1G3NB 1S70B 3IXEA 4BERA 2V4HC 2QYJA 3AAAC 5CBNA 1BD8A 1MYOA 1QYMA 4HRNA 1A5EA 4CZ2D 2DVWA 5JMND 3EHQA 3ZU7B 5AN8A 3LJNA 5EIBE 1BI7B 4DX2A 2KBXA 3EHRA 4HBDA 5AAOA 5CBOA 5KBAA 5CERB 4BETA 4HQDA 3J5QB 2PNNA 1TR4A 3TWSA 5CECB 1MX4A 5JA4D 4O60A 3TWXA 4LSZE 2AJAA 2MYOA 3NOGD 1IXVA 4O1OA 5ENQD 4U8YD 5ENRD 5BXOA 2DZOA 3C5RA 2L6BA 3AJIA 4JB8P 3B95A 3ZUVB 1UOHA 5EYLA 1MJ0A 1SW6A 1DC2A 4GPMA 1NFIE 2XENA 4TUMA 4C48B 5KNGA 4GMRA 4BESA 4DX1A 1DCQA 1N11A 4DUIA 5ENOD 4QFVA 4HI9A 3Q9NC 5EN5D 3TWQA 2JABA 4U95D 5ITZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTM A;  5AQB A;  3TWV A;  4U8V D;  1MX6 A;  3V2X A;  3J5P A;  2FO1 E;  1MX2 A;  5EYP F;  4ZHB A;  5BXU A;  5ENP D;  3JXI A;  4DX5 D;  2B0O E;  4HB5 A;  4K5C A;  2VGE A;  2ZGD A;  5ENT D;  3T8K A;  1YCS B;  1BI8 B;  4OAU C;  3DEO A;  1YMP A;  5AQ9 A;  3V79 K;  5D66 A;  3DEP A;  5AAR A;  2BKG A;  2ETB A;  3JXJ A;  2F8Y A;  2HE0 A;  3JUE A;  3KEA A;  3TWR A;  3W9F A;  3F6Q A;  2ETC A;  4G8K A;  1N0Q A;  3TWU A;  2RFM A;  5AQ7 A;  4J7W A;  2XEH A;  3NOC D;  4YDW A;  5CED B;  4K5A B;  1AWC B;  1YYH A;  4N5Q A;  1OY3 D;  1BLX B;  2F37 A;  3SO8 A;  3W9G A;  4BEP A;  4DX7 D;  5EID A;  3NBN B;  5FIO A;  4G8L A;  4ATZ D;  5CEA A;  3T9K A;  5KWD A;  4B93 B;  3EU9 A;  1D9S A;  1K3Z D;  2Y0B G;  3Q9U C;  4HRL A;  4HI8 A;  4Z68 A;  1SVX A;  2RFA A;  4QQI A;  5EIL A;  4F6R D;  1BU9 A;  3HRA A;  4HLL A;  4NIK A;  4RLY A;  3V31 A;  5AQA A;  1IKN D;  1K1A A;  3TWT A;  1AP7 A;  2KXP C;  2DZN A;  3B7B A;  4UUC A;  1WG0 A;  2F8X K;  3TWW A;  2XEE A;  3D9H A;  2P2C P;  2XZD G;  4DRX E;  1IHB A;  1WDY A;  2ZGG A;  4BSZ B;  4CYM D;  4OAV B;  4A63 B;  2V5Q C;  4YDY A;  2J8S D;  5ENS D;  2XZT G;  5HS0 A;  5KNH D;  3UI2 A;  5FIN A;  4ZFH A;  2Y1L E;  3HG0 D;  3V2O A;  3ZKJ A;  3V30 A;  1N0R A;  1OT8 A;  2A5E A;  4LG6 A;  4HRM B;  4U96 D;  4F1P A;  4K5B A;  3UXG A;  2BKK B;  4LNU D;  4J8Y A;  2DWZ A;  5HRY A;  4O1P A;  2ETA A;  1K1B A;  2NYJ A;  5HKP A;  3ZNG A;  4DX6 D;  2QC9 A;  4HNA D;  1G3N B;  1S70 B;  3IXE A;  4BER A;  2V4H C;  2QYJ A;  3AAA C;  5CBN A;  1BD8 A;  1MYO A;  1QYM A;  4HRN A;  1A5E A;  4CZ2 D;  2DVW A;  5JMN D;  3EHQ A;  3ZU7 B;  5AN8 A;  3LJN A;  5EIB E;  1BI7 B;  4DX2 A;  2KBX A;  3EHR A;  4HBD A;  5AAO A;  5CBO A;  5KBA A;  5CER B;  4BET A;  4HQD A;  3J5Q B;  2PNN A;  1TR4 A;  3TWS A;  5CEC B;  1MX4 A;  5JA4 D;  4O60 A;  3TWX A;  4LSZ E;  2AJA A;  2MYO A;  3NOG D;  1IXV A;  4O1O A;  5ENQ D;  4U8Y D;  5ENR D;  5BXO A;  2DZO A;  3C5R A;  2L6B A;  3AJI A;  4JB8 P;  3B95 A;  3ZUV B;  1UOH A;  5EYL A;  1MJ0 A;  1SW6 A;  1DC2 A;  4GPM A;  1NFI E;  2XEN A;  4TUM A;  4C48 B;  5KNG A;  4GMR A;  4BES A;  4DX1 A;  1DCQ A;  1N11 A;  4DUI A;  5ENO D;  4QFV A;  4HI9 A;  3Q9N C;  5EN5 D;  3TWQ A;  2JAB A;  4U95 D;  5ITZ F; 
#chains in the Genus database with same CATH topology
 4KYO B;  1UN8 A;  3TXN A;  4GTO A;  2WMN A;  1IYG A;  3JUE A;  3F6Q A;  2ETC A;  2FO7 A;  3TWU A;  4WUY A;  2IO2 C;  2ION A;  2IO3 C;  3Q9U C;  4U63 A;  5EIL A;  2LNI A;  1QBQ A;  2UWJ G;  3G2S A;  4RLY A;  2WB2 A;  3GYZ A;  3TWT A;  4APO A;  4K0R A;  1TJF A;  4RQI A;  4ANX A;  2OCC E;  4BSZ B;  4PDX A;  3G2U A;  1H6O A;  5DBK A;  4UWG A;  3UQ3 A;  3ASH A;  4NUR A;  4XKB A;  3N71 A;  1OUV A;  2R05 A;  3PS6 A;  1N54 A;  3V30 A;  3FTU A;  3NQP A;  3T8M A;  5HRY A;  1E8Z A;  5CMW A;  1E8Y A;  4XEI G;  4CDM A;  1N4P A;  4CZ2 D;  4JPS A;  4N2Q A;  3LJN A;  3D9N A;  2OV8 A;  2RD0 A;  5CEC B;  2IFU A;  1TN8 A;  4I6G A;  3RRM B;  4GTV A;  4CCA A;  1N4Q A;  3CVL A;  3E32 A;  5KJN A;  1KPS B;  1Y6I A;  2XHE A;  1DNP A;  4K03 A;  1N4S A;  4G25 A;  4BX8 A;  4U8V D;  4I1O B;  1S63 A;  2Q7F A;  3DRA A;  3DSV A;  4BX9 A;  2HE0 A;  3Q7A A;  3QAR A;  4PH4 B;  5T3R A;  4F1S A;  5H7P A;  3AU5 A;  3VTX A;  2BF0 X;  4WWP A;  2R2L A;  5KCM A;  4CGV A;  5JJ7 A;  1RW2 A;  4HRL A;  4C0M A;  1OWL A;  1HE8 A;  4UWF A;  3NAW A;  3CVP A;  4LCT A;  1N52 A;  3ZGQ A;  2PQN A;  5LX8 A;  3GZS A;  4JHJ A;  3ZHE A;  3JCK C;  2R5S A;  2E2E A;  3QWW A;  3EIQ C;  2A5E A;  3FFL A;  4GMJ A;  3UUX A;  3S7D A;  3LS8 A;  2KZT B;  4I43 A;  1JWF A;  2OEW A;  5C1D A;  4U7E B;  2GRN B;  3CVN A;  5BUZ A;  3QWV A;  4UWL A;  2QYJ A;  4I9E A;  4EZL A;  1D8D A;  2YIN A;  2HO1 A;  4ANV A;  1MX4 A;  3FUM A;  2IQC A;  5FQ7 A;  4PS8 A;  5ENR D;  3FUI A;  1UW4 B;  3VLD A;  1NP7 A;  5JHA A;  2LUH A;  2VTB B;  3B7S A;  4HS2 A;  3FUL A;  3NF1 A;  4GTP A;  5HS0 A;  2FBN A;  3QOU A;  2DIW A;  1N95 A;  4GZD A;  5ENT D;  4U8H A;  3PZ3 A;  5AQ9 A;  3ENE A;  2BKG A;  3FDH A;  1FVF A;  3O48 A;  4RG9 A;  5BPP A;  2KZT A;  3JQ1 A;  4RSY A;  3UT8 A;  1LF8 A;  2PZI A;  1BLX B;  3W9G A;  4EHM A;  4BY6 A;  4ATZ D;  1H2V C;  4G11 A;  3EU9 A;  4EQF A;  4JHR A;  3TXM A;  2VGX B;  2WXF A;  3MV3 B;  1OCZ E;  5FWQ A;  2VSO E;  1O1R A;  1IKN D;  2RG8 A;  1O1S A;  3OXG A;  3ZRH A;  3ABM E;  5EKQ D;  3WG7 E;  4BT8 A;  1DVP A;  3G2W A;  4E85 A;  1ELW A;  4E6H A;  1N0R A;  1OT8 A;  3IHV A;  2XRZ A;  4EBA A;  3CVY A;  3ZYQ A;  3D3M A;  1BPO A;  5ENN A;  4HOU A;  1G3N B;  2V4H C;  4MRU A;  3FU3 A;  1BD8 A;  1FCH A;  3ASF A;  2VGX A;  4P29 A;  2EIJ E;  2WQH A;  1TNY A;  1IXV A;  4V3I A;  3B13 A;  3EJN A;  1MJ0 A;  1SW6 A;  1ELR A;  4ME2 A;  1N11 A;  1TNZ A;  2A4Z A;  1Z6T A;  3D9K A;  3RU0 A;  2PL2 A;  5A23 A;  3UT7 A;  4KVM A;  1EF1 C;  3CVX A;  1LTX A;  3ZN3 A;  3ML9 A;  3CVV A;  1HZ4 A;  2XEH A;  3UIP C;  4KT6 B;  4BTB A;  1QNF A;  2NC9 A;  2OEV A;  3CKB A;  1K8K G;  3MKQ B;  2J08 A;  3MJW A;  5ANL A;  5LP0 A;  3HXC A;  1Q2Z A;  1H2U A;  2GW1 A;  4AY5 A;  3I4R B;  5FZR A;  2V5Q C;  3MYV A;  3AS4 A;  4M7C A;  4M3O A;  3CR3 A;  4YDO A;  3CQG B;  4PS7 A;  1E8W A;  3QNK A;  3LY7 A;  4XZ4 A;  3UX4 A;  3UIN C;  4DX6 D;  4F7A A;  4AY6 A;  3L16 A;  4IUL A;  2X38 A;  3HXE A;  4FLH A;  3TGO A;  4YVQ C;  3ASD A;  3HIZ A;  3CSF A;  1OWM A;  2MYO A;  3FU0 A;  4GCN A;  2H6H A;  3E30 A;  4F3V A;  4LNB A;  4HFG A;  1KLX A;  2EIK E;  1OWN A;  2GRL A;  2R02 A;  1JCR A;  4GMR A;  3UIO C;  2I9C A;  3KD7 A;  4MBG A;  3UM3 A;  3BG1 B;  5BXU A;  1O5M A;  4EZK A;  1OWP A;  3SFZ A;  3S7J A;  2QYU A;  4CDN A;  5JJT A;  1N9A A;  4J7W A;  1AWC B;  3SI5 A;  1Y8M A;  3Q75 A;  4IN3 B;  1K3Z D;  2WXM A;  4FJZ A;  3ASN E;  2WMO A;  3LKU A;  3EDT B;  2P9K G;  3UM1 A;  3FTS A;  4J8F A;  1Z3X A;  3FU6 A;  3TWW A;  2XZD G;  1IHB A;  2VJ8 A;  4G2V A;  4RG6 A;  4U0S A;  3APD A;  2XPY A;  1SQM A;  4L7T A;  4A63 B;  2FUL A;  2MHK A;  1TEZ A;  4ILI A;  2CHX A;  3DWL G;  5M72 A;  4PUC A;  3ONK A;  2BKK B;  4WAF A;  2QC9 A;  3FEY A;  4J6I A;  4UWK A;  4JL0 A;  1A5E A;  4G23 A;  2QY7 A;  3L08 A;  3RIB A;  1V54 E;  5JJ6 A;  4JHK A;  3URZ A;  4F53 A;  2WXH A;  3RSE G;  4HOQ A;  3IBE A;  2E0I A;  5ENQ D;  2KAT A;  3GZ1 A;  3BQO A;  2A5U A;  3Q7F A;  3ZUV B;  3S2A A;  2XQ0 A;  4L1B A;  4HI9 A;  2I6H A;  3ZYM A;  5ITZ F;  3TWV A;  4L9P A;  2ZGD A;  2HYZ A;  3DEO A;  4ANW A;  3FUH A;  2MOW A;  2ETB A;  3JXJ A;  3TWR A;  4U0U A;  4YDW A;  1WY6 A;  2HR2 A;  3NBN B;  4JVS A;  5J90 A;  4D10 C;  1GW6 A;  5EX3 A;  4NIK A;  3UKR G;  2GRP B;  2LXM A;  3C3Q A;  3PE4 A;  2J07 A;  2WXG A;  3ZW3 A;  4UI9 J;  1TNB A;  3CHM A;  4UQZ A;  2CFZ A;  4GYW A;  5ENS D;  5FIN A;  4ACK A;  3EUV A;  2WM9 A;  2XPZ A;  4UQY A;  5C2Y A;  2BED A;  1NI1 A;  3U9W A;  4A3T A;  2DWZ A;  1JCQ A;  2WXQ A;  4TXP A;  4N2S A;  2BTD A;  3PRZ A;  2AW6 A;  3IXE A;  3D9P A;  5AJL A;  2P9S G;  5FZS A;  2I2O A;  5ANR A;  5AN8 A;  4AV7 A;  1BI7 B;  3FUF A;  4HBD A;  3TL5 A;  2IY0 C;  1KT1 A;  5BT1 A;  3RRN B;  2VSY A;  3L82 A;  1A17 A;  5LOZ A;  3EHN A;  2DZO A;  3D9M A;  3ISM C;  3UKU G;  5BW8 C;  4KBQ A;  4TUM A;  4XIF A;  2WXP A;  4DJA A;  3LDZ A;  4GTQ A;  4Y6W A;  4WNE A;  3DEP A;  3L9T A;  3I5P A;  2VSX E;  2VSN A;  3APC A;  3ULE G;  3X2Q E;  4G8L A;  4UWH A;  4WND A;  4TUU A;  2YNQ A;  2BUG A;  4J8E A;  3IHY A;  5FJY A;  1E8X A;  2Y3A A;  1LD7 A;  3D9H A;  4G26 A;  5E76 A;  2ZGG A;  3NZS A;  2AVP A;  4OAV B;  3CVW A;  2J8S D;  3E37 A;  1E7U A;  3V2O A;  3LEW A;  2XPI A;  4LG6 A;  4ATG A;  4HRM B;  4I1A A;  3FWV A;  1OCO E;  4AP2 A;  3AU4 A;  5AEN A;  3HXD A;  3MKR A;  4GTS A;  2L0T B;  3MZL B;  5LCW J;  3CST A;  2KBX A;  2GRQ B;  4NAC A;  2L6J A;  3I3N A;  1PC2 A;  4TV3 A;  5BXO A;  2NSZ A;  4AM9 A;  3AJI A;  3KAE A;  3D9L A;  3GW4 A;  2HM8 A;  4GA0 A;  3SFY A;  1U3C A;  4ZHB A;  1KZP A;  3FUE A;  2FEZ A;  3ULY A;  4OAU C;  5CMY A;  1QZ2 A;  1SZA A;  3HDX A;  1IQU A;  3CK8 A;  5CED B;  4K5A B;  1YYH A;  2R03 A;  2LO6 A;  4DX7 D;  1H6K A;  2Y0B G;  2GRM A;  3FUN A;  4AEZ C;  2WXR A;  2KXP C;  1TN6 A;  5BV0 A;  2H6I A;  3HYM B;  1WDY A;  4EZJ A;  4JEU A;  1UJJ A;  3FH5 A;  1VDY A;  2WXO A;  5T4Y A;  1EPU A;  2XS8 A;  1MQS A;  3U4T A;  3LVQ E;  3CK7 A;  4XI9 A;  4JZY A;  1ZU2 A;  4ANU A;  2QZA A;  4F1P A;  1FPP A;  1OCC E;  2J4D A;  2JLB A;  4HLE A;  4XI0 A;  4BER A;  4CT0 A;  2VTB A;  4BFR A;  2AXU A;  2Y4T A;  1JWG A;  5CER B;  1DCE A;  3CHR A;  4AOF A;  4FUL A;  5B1A E;  3K9I A;  4W9R A;  3C98 A;  2ZXW E;  1X5B A;  4B0Z A;  4GZ6 A;  4QFV A;  4AVX A;  2V0P A;  3SZ7 A;  5AQB A;  2FO1 E;  1MX2 A;  4I6J A;  3JXI A;  3JUI A;  4JA7 A;  2WXI A;  1JPL A;  3FTY A;  4LER A;  4DI4 A;  3MX3 A;  1ZB1 A;  3OAW A;  1N0Q A;  2J49 A;  3DXK G;  4GPK A;  1WAO 1;  4AJW A;  1H0A A;  3SO8 A;  2KCL A;  5FQ6 A;  2LAH A;  5FIO A;  3Q79 A;  4GCO A;  2GRR B;  3KSQ A;  1SVX A;  3Q5M A;  4J0U A;  4F6R D;  1MZC A;  3TJP A;  3Q49 B;  4I6E A;  2UY1 B;  4FHK A;  1K1A A;  4CGW A;  1UJK A;  1OXJ A;  3ASO E;  3LXU X;  2H6G A;  4DRX E;  3ZYL A;  4CDR A;  5JHB A;  5D2M C;  4AXH A;  4Q94 A;  4DI3 A;  5E75 A;  1TYQ G;  1YA0 A;  4U07 A;  3VLF A;  1HX8 A;  2L0I A;  4GAA A;  3R9M A;  5HKP A;  4HNA D;  5EX0 A;  3AG2 E;  3U64 A;  3IEG A;  1KZO A;  5CRU A;  4DX2 A;  2DCP A;  2P9I G;  3MEK A;  2AXZ A;  2AJA A;  4BSX A;  4EPZ A;  3QWP A;  3U66 A;  1PY1 A;  1E7V A;  3FTZ A;  5G05 J;  4J8D A;  4H7X A;  4N5Q A;  3V2X A;  1P5Q A;  4NRH B;  3ASG A;  2KCV A;  4YVO A;  1BI8 B;  1UG3 A;  3MKQ A;  4A1S A;  1XNF A;  3BEE A;  3EIJ A;  3D9O A;  5G04 J;  3ONL A;  3AS8 A;  4WNF A;  4BEP A;  4I2Z A;  2I1K A;  5CEA A;  2VYI A;  4HI8 A;  2ILR A;  3QJZ A;  2C2L A;  2OOE A;  4RVB A;  1BU9 A;  3QAQ A;  1N94 A;  3DBS A;  2C0L A;  1S0P A;  4XE0 A;  2F8X K;  4JD2 G;  2WQ7 A;  4WWN A;  4CEM A;  1JUQ A;  3SD5 A;  4XX5 A;  5KNH D;  3LY9 A;  1JCS A;  5G05 C;  2YQ8 A;  1D8E A;  1EDU A;  2WXK A;  2Y4U A;  5FQ4 A;  2P9L G;  4LNU D;  3ML8 A;  4GB9 A;  1K1B A;  5KJL A;  5G04 C;  4JW1 A;  4GTT A;  5CBN A;  2OND A;  3B7U X;  3CQC B;  3C3R A;  3NB2 A;  3EHR A;  3CVQ A;  3TG4 A;  4GYO A;  3L6A A;  4O60 A;  2XCB A;  4B89 A;  3LCA A;  1OCR E;  3MA5 A;  3ESK A;  1ZBP A;  3B95 A;  1MHQ A;  3DSS A;  5KJK A;  2ZIS A;  3EHM A;  4YDE A;  2WXL A;  1TN7 A;  2WQ6 A;  1DC2 A;  3ULQ A;  1NFI E;  3O4Z A;  5FTP A;  4U04 A;  4BES A;  4DX1 A;  2LAI A;  3OXF A;  4KXK B;  3UTM A;  1OWO A;  2LXL A;  3DXM G;  2VGE A;  3T8K A;  2KM4 A;  2F8Y A;  3CHS A;  2PQR A;  3RO3 A;  3UT4 A;  3LJ3 A;  4OYS A;  1FVH A;  2KCK A;  1NZN A;  2F37 A;  4NQ0 A;  3QKY A;  4UI9 K;  4APF A;  3ZIM A;  3E34 A;  4GYY A;  1FT1 A;  4DPR A;  3BG0 B;  1FT2 A;  4Z68 A;  2RFA A;  2JEK A;  1HG5 A;  3V31 A;  4FLB A;  4A55 A;  3CGH A;  2P2C P;  2X6I A;  4XKC A;  2L9B A;  3SF4 A;  5J08 A;  3BUA A;  3B7T A;  5CCM A;  2Y1L E;  1NA3 A;  3TG5 A;  3ZKJ A;  3PUK A;  1HG2 A;  2H6F A;  2GRO B;  4N3B A;  4EBA G;  4N39 A;  2VGY A;  4L2Y A;  5D0Q D;  3DPY A;  2WXJ A;  3FTW A;  4H7Y A;  4LRZ A;  2NYJ A;  3ZNG A;  3FUD A;  3ESL A;  3T5V A;  5DIZ A;  2LSU A;  5B1B E;  2DYR E;  3AAA C;  4I2W A;  4DK5 A;  1SA4 A;  2DVW A;  3AG1 E;  3FUK A;  5CBO A;  3TWS A;  4MS6 A;  3VLE A;  4GPM A;  1E90 A;  2JAB A;  1TJC A;  3HVE B;  5HQ8 A;  3OXL A;  4BTA A;  2B0O E;  4K5C A;  2R59 A;  5G55 A;  1H19 A;  2IEJ A;  5AAR A;  2EIL E;  3I4G A;  4FU3 A;  2NXP A;  4MLP A;  2OVB A;  1HH8 A;  4WWO A;  4N5C A;  2I1J A;  2IU1 A;  1HFA A;  2PM6 A;  1SA5 A;  1D9S A;  4B93 B;  4UI9 C;  3T5X A;  1NL4 A;  4FP7 A;  4GA2 A;  5A7D B;  3HXF A;  4KZC A;  4IRU A;  4AIF A;  3KSL A;  3CK9 A;  3UI2 A;  2XEV A;  4R7L A;  3HVE A;  5BNW A;  1HXI A;  3LVR E;  3Q73 A;  3FTX A;  2IJG X;  4GZ3 A;  2VQ2 A;  5KJM A;  2V5F A;  3ZHE B;  2P58 C;  5LFA A;  2WVI A;  3B7R L;  4Q69 A;  3ZFW A;  3L22 A;  3EHQ A;  2P9N G;  5AAO A;  2M63 A;  3Q78 A;  3PZD A;  3J5Q B;  3TWX A;  4LSZ E;  2XS1 A;  3C5R A;  3C72 A;  1ELK A;  3ZYK A;  3P2B A;  4DLO A;  4TXR A;  4C48 B;  5KNG A;  1TNO A;  4GTR A;  2YHE A;  1V55 E;  3TWQ A;  3RO2 A;  2DYS E;  5ENP D;  4DX5 D;  4HB5 A;  3DSX A;  4BWR A;  5D0O D;  4CT4 A;  4Y6C A;  3CVU A;  5B3S E;  2KC7 A;  1PAQ A;  2ZIR A;  4Q96 A;  2V8S E;  3PZ1 A;  4X8Q A;  5KWD A;  3JQ0 A;  5FT9 A;  3NZU A;  3PNT B;  3SNX A;  3AG4 E;  2XRY A;  4PS3 A;  3DSW A;  1INZ A;  2DZN A;  1WG0 A;  5BV1 A;  2XEE A;  4CYM D;  4ACL A;  3S7B A;  4WNG A;  5AJD A;  1HS6 A;  1RZ4 A;  2XZT G;  4IYP A;  3HG0 D;  3CHP A;  4G24 A;  3RK6 A;  4CRW A;  5LCW C;  4TRQ A;  4U96 D;  3CV0 A;  3UPV A;  3DST A;  3PDN A;  1WM5 A;  3IV0 A;  1SZ9 A;  1O1T A;  4HRN A;  1E96 B;  2EIM E;  3FHE A;  3ZU7 B;  2B6C A;  5G2N A;  5EIB E;  2XGM A;  4BET A;  1Z5S C;  3QB2 A;  4O1O A;  1W3B A;  1LD8 A;  2X6F A;  4GA1 A;  4C0E A;  4GU5 A;  4GML A;  4O6F A;  2EQX A;  3RKV A;  4HOS A;  2PM7 A;  3L13 A;  5ENO D;  3GZ2 A;  3PRE A;  3R7R A;  4BT9 A;  5HI7 A;  2X6J A;  2OVF A;  3MGB A;  1YCS B;  2WPV A;  1YMP A;  3V79 K;  3ABL E;  2LSV A;  2RFM A;  5AQ7 A;  4LEU A;  4MKT A;  3L17 A;  2IOS A;  5ARF A;  1OY3 D;  4JXT A;  4FHJ A;  2AXV A;  3OTN A;  4DLQ A;  3KS2 A;  1HO8 A;  4URK A;  1AP7 A;  4J8S A;  3B7B A;  1HF8 A;  2CFU A;  4OVV A;  3PUJ A;  4TXQ A;  1QQE A;  3SGH A;  4EEC A;  1Z3Y A;  3ZEF A;  3MV2 B;  1TNU A;  3CHQ A;  3LY8 A;  3ZPJ A;  3HXB A;  3ABK E;  1HU3 A;  2FI7 A;  3QC1 A;  1U2V G;  4HVB A;  4GZC A;  4ILH B;  3WXX A;  3FY4 A;  3G2T A;  3PEU B;  3L54 A;  5EDS A;  5KBA A;  4HQD A;  2XGS A;  4L23 A;  4A3V A;  1X81 A;  2X3M A;  3Q47 B;  3DSU A;  3U3W A;  1N4R A;  4C9B B;  3D9I A;  1UOH A;  3EU5 A;  4B8C B;  1DCQ A;  2CG2 A;  4DUI A;  2F0Y A;  3Q9N C;  3FH8 A;  4U95 D;  3Q4A B;  4N3C A;  3LYA A;  1MX6 A;  3J5P A;  3SBT B;  2IOL A;  2UY1 A;  4HOT A;  5D66 A;  4L2L A;  3KEA A;  2X6H A;  4FJY A;  3W9F A;  3FEX A;  2WXN A;  4UQX A;  3NOC D;  4I9C A;  3ZXP A;  4B94 A;  3SBS A;  3PEV B;  2RKK A;  1H2T C;  4FAD A;  1IQR A;  4QQI A;  3P1U A;  3HRA A;  3SQV A;  5AQA A;  3PZ2 A;  1KT0 A;  2YHC A;  4UUC A;  3CLJ A;  1U3D A;  3MCX A;  5FZQ A;  3S7F A;  2XGO A;  3UM0 A;  1EYH A;  4ZFH A;  4YND A;  4GZ5 A;  1XGW A;  2P9P G;  5T8I A;  3ZVV A;  3UXG A;  3HHM A;  4O1P A;  3APF A;  3SFX A;  4U0Z A;  4HOR A;  3FP3 A;  1MYO A;  3G2V A;  2DBA A;  4FC8 A;  2FF4 A;  1H6P A;  3PVL A;  3CHO A;  2PNN A;  3SY2 A;  1TR4 A;  5JA4 D;  2J09 A;  4U8Y D;  4KZ0 A;  4JB8 P;  3RRU A;  3FUJ A;  3SHF A;  5EYL A;  2XEN A;  2GGF A;  1NA0 A;  5EN5 D;  3TAX A;  5AIJ A;  5EYP F;  3FU5 A;  3R9A B;  3PNL B;  2J4B A;  1IHG A;  4I1M A;  4KMO A;  1B89 A;  4LNG A;  3FTV A;  3PE3 A;  2V4L A;  3E33 A;  4LUN U;  4JC8 A;  4ILG A;  2ZU6 B;  4G8K A;  3RAU A;  1S64 A;  3UMV A;  3CEQ A;  4KVO A;  3E4B A;  4ABN A;  3IKO B;  5EID A;  1L5J A;  5CRV A;  3T9K A;  5FQ8 A;  3KEZ A;  2EIN E;  4HLL A;  3ZXS A;  2P9U G;  2IF4 A;  3PH0 C;  3BU8 A;  2J9Q A;  4B8A A;  3CIA A;  5AYW D;  3DPD A;  3QDN A;  4YDY A;  2MRI A;  3AS5 A;  3D9J A;  5CCL A;  2CHW A;  4HXI A;  3RJV A;  3PZ4 A;  2CHZ A;  3UM2 A;  3CKC A;  4K5B A;  4J8Y A;  4I17 A;  2R17 C;  4GTM A;  2ETA A;  5IY5 E;  1S70 B;  3QK0 A;  1QYM A;  2QFC A;  3JYS A;  5ARG A;  3AG3 E;  5JMN D;  3VTY A;  4G1T A;  3LPZ A;  5A6C A;  2C0M A;  2AWI A;  3C3O A;  4JA9 A;  4N3A A;  2XCC A;  2X6K A;  3NOG D;  5CHE E;  4A1G A;  2Y69 E;  4JEH A;  2L6B A;  3R7Q A;  2CG3 A;  3Q15 A;  3FH7 A;  1UN9 A;  4FA6 A;  4OVU A; 
#chains in the Genus database with same CATH homology
 3UTM A;  5AQB A;  3TWV A;  4U8V D;  1MX6 A;  3V2X A;  3J5P A;  2FO1 E;  1MX2 A;  5EYP F;  4ZHB A;  5BXU A;  5ENP D;  3JXI A;  4DX5 D;  2B0O E;  4HB5 A;  4K5C A;  2VGE A;  2ZGD A;  5ENT D;  3T8K A;  1YCS B;  1BI8 B;  4OAU C;  3DEO A;  1YMP A;  5AQ9 A;  3V79 K;  5D66 A;  3DEP A;  5AAR A;  2BKG A;  2ETB A;  3JXJ A;  2F8Y A;  2HE0 A;  3JUE A;  3KEA A;  3TWR A;  3W9F A;  3F6Q A;  2ETC A;  4G8K A;  1N0Q A;  3TWU A;  2RFM A;  5AQ7 A;  4J7W A;  2XEH A;  3NOC D;  4YDW A;  5CED B;  4K5A B;  1AWC B;  1YYH A;  4N5Q A;  1OY3 D;  1BLX B;  2F37 A;  3SO8 A;  3W9G A;  4BEP A;  4DX7 D;  5EID A;  3NBN B;  5FIO A;  4G8L A;  4ATZ D;  5CEA A;  3T9K A;  5KWD A;  4B93 B;  3EU9 A;  1D9S A;  1K3Z D;  2Y0B G;  3Q9U C;  4HRL A;  4HI8 A;  4Z68 A;  1SVX A;  2RFA A;  4QQI A;  5EIL A;  4F6R D;  1BU9 A;  3HRA A;  4HLL A;  4NIK A;  4RLY A;  3V31 A;  5AQA A;  1IKN D;  1K1A A;  3TWT A;  1AP7 A;  2KXP C;  2DZN A;  3B7B A;  4UUC A;  1WG0 A;  2F8X K;  3TWW A;  2XEE A;  3D9H A;  2P2C P;  2XZD G;  4DRX E;  1IHB A;  1WDY A;  2ZGG A;  4BSZ B;  4CYM D;  4OAV B;  4A63 B;  2V5Q C;  4YDY A;  2J8S D;  5ENS D;  2XZT G;  5HS0 A;  5KNH D;  3UI2 A;  5FIN A;  4ZFH A;  2Y1L E;  3HG0 D;  3V2O A;  3ZKJ A;  3V30 A;  1N0R A;  1OT8 A;  2A5E A;  4LG6 A;  4HRM B;  4U96 D;  4F1P A;  4K5B A;  3UXG A;  2BKK B;  4LNU D;  4J8Y A;  2DWZ A;  5HRY A;  4O1P A;  2ETA A;  1K1B A;  2NYJ A;  5HKP A;  3ZNG A;  4DX6 D;  2QC9 A;  4HNA D;  1G3N B;  1S70 B;  3IXE A;  4BER A;  2V4H C;  2QYJ A;  3AAA C;  5CBN A;  1BD8 A;  1MYO A;  1QYM A;  4HRN A;  1A5E A;  4CZ2 D;  2DVW A;  5JMN D;  3EHQ A;  3ZU7 B;  5AN8 A;  3LJN A;  5EIB E;  1BI7 B;  4DX2 A;  2KBX A;  3EHR A;  4HBD A;  5AAO A;  5CBO A;  5KBA A;  5CER B;  4BET A;  4HQD A;  3J5Q B;  2PNN A;  1TR4 A;  3TWS A;  5CEC B;  1MX4 A;  5JA4 D;  4O60 A;  3TWX A;  4LSZ E;  2AJA A;  2MYO A;  3NOG D;  1IXV A;  4O1O A;  5ENQ D;  4U8Y D;  5ENR D;  5BXO A;  2DZO A;  3C5R A;  2L6B A;  3AJI A;  4JB8 P;  3B95 A;  3ZUV B;  1UOH A;  5EYL A;  1MJ0 A;  1SW6 A;  1DC2 A;  4GPM A;  1NFI E;  2XEN A;  4TUM A;  4C48 B;  5KNG A;  4GMR A;  4BES A;  4DX1 A;  1DCQ A;  1N11 A;  4DUI A;  5ENO D;  4QFV A;  4HI9 A;  3Q9N C;  5EN5 D;  3TWQ A;  2JAB A;  4U95 D;  5ITZ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...