2XZDG

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
DLGKKLLEATRAGQDDEVRILMANGADVNAMDDAGVTPLHLAAKRGHLEIVEVLLKHGADVNASDIWGRTPLHLAATVGHLEIVEVLLEYGADVNAQDKFGKTAFDISIDNGNEDLAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 36
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2xzdG00
2DWZA 3UXGA 1BU9A 5EIBE 1A5EA 4UUCA 5CERB 2B0OE 3EHRA 3DEPA 4K5AB 1WG0A 5EILA 4F6RD 3EU9A 4GMRA 3V79K 4HRNA 4K5BA 1BD8A 2QC9A 4HNAD 4YDWA 4U96D 2KBXA 2BKKB 1AP7A 3JUEA 1WDYA 1NFIE 5AN8A 3TWXA 4B93B 4ZFHA 4G8LA 1BI8B 5HKPA 4DUIA 5AAOA 1MJ0A 4OAUC 2XEEA 1OT8A 3NOGD 5AQ7A 2V4HC 1K3ZD 4RLYA 3ZU7B 5AQAA 4BESA 4K5CA 2F8XK 4YDYA 1MYOA 2RFAA 4O1PA 3DEOA 4CYMD 3F6QA 5HRYA 4ATZD 5CEDB 1MX2A 5AQBA 3B95A 3Q9UC 4LNUD 5BXUA 4J8YA 3V2XA 4BETA 5HS0A 4GPMA 4U95D 3B7BA 3EHQA 4LG6A 4OAVB 3ZUVB 2ZGDA 1DC2A 5KBAA 3IXEA 2XZTG 4F1PA 4HI9A 4U8YD 5AARA 4N5QA 2JABA 2RFMA 3JXJA 3KEAA 3AJIA 3HG0D 3UTMA 2XZDG 4DX5D 1DCQA 2J8SD 1MX6A 3TWRA 5JA4D 3NOCD 2BKGA 5EN5D 1BLXB 2P2CP 1OY3D 5KNHD 2AJAA 3JXIA 2KXPC 2MYOA 1YMPA 5CECB 5ENPD 3J5PA 2A5EA 2DZNA 2QYJA 4G8KA 3NBNB 1SW6A 1S70B 2Y1LE 2NYJA 2F37A 5EYLA 4BEPA 3AAAC 1QYMA 5ENOD 3V30A 2DZOA 3TWVA 4QQIA 2V5QC 5CBNA 2VGEA 4JB8P 5KNGA 1N0QA 4O60A 3D9HA 4C48B 1UOHA 3TWSA 2L6BA 3TWUA 2DVWA 5ENRD 5FIOA 2ETCA 3ZNGA 4DRXE 1G3NB 3T9KA 5JMND 4U8VD 3W9FA 4HRMB 4HB5A 1IKND 1YCSB 3C5RA 1SVXA 2ZGGA 3V2OA 3HRAA 4HRLA 3SO8A 1BI7B 5ITZF 3UI2A 5KWDA 4DX2A 3J5QB 5D66A 5BXOA 1MX4A 4DX1A 1TR4A 2ETAA 4CZ2D 4DX7D 3T8KA 1D9SA 4LSZE 1K1AA 4HBDA 1K1BA 4NIKA 3W9GA 5ENQD 3TWWA 3TWQA 2ETBA 1YYHA 1IHBA 3V31A 4HI8A 5CEAA 4Z68A 2FO1E 4QFVA 2F8YA 4HLLA 4TUMA 5FINA 2XEHA 5ENTD 3ZKJA 2Y0BG 4A63B 5EYPF 4BERA 4BSZB 4DX6D 2XENA 3TWTA 3LJNA 2HE0A 5ENSD 5AQ9A 1AWCB 3Q9NC 1IXVA 5CBOA 1N11A 4HQDA 4O1OA 1N0RA 2PNNA 4ZHBA 4J7WA 5EIDA
chains in the Genus database with same CATH superfamily
1L5JA 3ASOE 4FC8A 4J8EA 2QFCA 1H0AA 2L9BA 4JHJA 3E37A 3B7SA 3ONLA 1JWGA 4K5BA 3CK7A 3RU0A 4B93B 5EX3A 1BI8B 4ANXA 3UM1A 2RD0A 2GGFA 2P9UG 4BTAA 3FH5A 3R9MA 3NZSA 1NI1A 2XEVA 4OAVB 4A55A 3U64A 1N4QA 1INZA 3SBTB 2H6HA 3TWRA 2P2CP 4LNGA 2AVPA 2IOSA 3MV2B 1YMPA 4GMLA 4G11A 3ULQA 5KJMA 3QARA 4G23A 5KNGA 4U0UA 4H7YA 4EBAG 2J07A 2IY0C 4Q96A 5LCWC 3FY4A 1NZNA 3MYVA 4CEMA 1SVXA 2ZISA 3NZUA 3QDNA 1UN8A 1E7UA 3KEZA 1PY1A 3NB2A 4O6FA 4AP2A 3IBEA 3B7RL 1D9SA 1K1BA 2ZXWE 2UY1B 2Q7FA 5A7DB 2KATA 3TWTA 2IU1A 4XX5A 4ABNA 4FADA 1IHGA 2QZAA 3EHNA 3PZ4A 5EDSA 4PS3A 5ANRA 2PQNA 3B7UX 3V79K 3ISMC 3JUEA 3L22A 2XQ0A 1HXIA 1RW2A 2F8XK 4ANWA 3DEOA 2GRPB 2LXMA 4GTTA 2V4LA 4HOUA 3ZEFA 5B1BE 5EKQD 4C9BB 2P9SG 4WWPA 2IOLA 1MZCA 4TV3A 4YVOA 5G05J 5E75A 4NACA 3L9TA 4TXPA 4WWNA 4G1TA 4ANUA 2P9PG 1S70B 4GTRA 2DZOA 4CT0A 4LUNU 3GZ2A 2GRRB 1HG2A 3FWVA 3UPVA 4R7LA 3ZYKA 2HM8A 2GRNB 4N3CA 3SHFA 3VLDA 4Z68A 4V3IA 4J0UA 2BEDA 2XENA 2XS8A 5CBOA 4GTQA 4GZDA 2P9NG 3ULYA 3S7FA 4UUCA 4N3BA 3CVXA 2CHWA 3R7RA 1QBQA 1N54A 4F6RD 3Q73A 4JA9A 3Q47B 1W3BA 3MGBA 5FZQA 3FP3A 4U63A 4YDWA 3AU4A 3D9OA 4TUUA 1MJ0A 3ZGQA 3AG4E 2RFAA 5J08A 3EU5A 4RVBA 4LNUD 4B89A 4BSXA 2XPYA 3LVQE 1WM5A 3MV3B 4FP7A 1LD8A 3DSXA 3NOCD 5EN5D 5HQ8A 4ILGA 3ZFWA 2UY1A 3N71A 3ABKE 5FQ6A 1SW6A 2Y1LE 3DSWA 2EIKE 1E8XA 1E96B 1HX8A 4J8SA 2KCLA 2KZTB 3MJWA 1N9AA 2IQCA 1H2TC 1BI7B 3UI2A 3EDTB 4DLOA 1OCOE 4N39A 1K1AA 3CVVA 2XRYA 3UX4A 1EYHA 3U4TA 4GZCA 3V31A 4M7CA 3DSSA 4N2QA 4IYPA 3WXXA 3CV0A 4GTVA 2Y69E 3Q9NC 1IXVA 2MRIA 3G2TA 3SFXA 3PS6A 2X3MA 4IRUA 4MLPA 1KT0A 3L54A 4KZCA 1NA0A 4U0ZA 3UUXA 3DEPA 1MQSA 3QNKA 3OXFA 1UW4B 4C0MA 4YNDA 1TNOA 3PRZA 3UKRG 5FJYA 3UM2A 4DUIA 2PZIA 1KZPA 1TN7A 1TJCA 4N2SA 3ZW3A 5G05C 5J90A 4U95D 3CHQA 2VGYA 3TJPA 3LCAA 3DSTA 1FVFA 1DC2A 1Z5SC 3ASNE 2AXUA 2JABA 3TXNA 1FVHA 1TJFA 3UT8A 4ANVA 1KZOA 4GA1A 4W9RA 2J4BA 2F37A 3PNLB 2V5QC 2V5FA 1TNUA 4GYOA 5C1DA 3T8MA 4XE0A 3CLJA 2GRMA 3S7JA 1KPSB 1BPOA 2WB2A 1A17A 3D9NA 4JHRA 4G2VA 3FUHA 4UQXA 4C0EA 2CHXA 2WXHA 4DX7D 3QWVA 3CHSA 2Y3AA 1QNFA 1OWNA 5BW8C 4A63B 3UIPC 5EYPF 4BSZB 3ZYMA 5FWQA 1N0RA 3RO3A 3PE4A 3EIJA 2C0MA 3LY7A 4FA6A 1SZAA 4U8HA 3LY9A 4RSYA 3FU5A 1DNPA 4XI9A 3S7DA 4L2YA 4Q69A 4EZKA 3FTSA 4F53A 3Q15A 3CIAA 4BESA 4YDYA 4AXHA 4O1PA 5FZRA 4LERA 1H2UA 4NURA 4F7AA 1YA0A 1UJKA 3FH8A 3URZA 4EPZA 5KBAA 3IXEA 2PL2A 4HI9A 2M63A 2P58C 3JXJA 3UTMA 3D9KA 2YHEA 5CECB 3MZLB 4GTOA 5ENPD 4I17A 3ZYLA 1SA5A 4BEPA 3D9IA 3AAAC 1KLXA 5CBNA 1QQEA 3L17A 4WUYA 3ZNGA 4TXQA 2FI7A 3MA5A 2J9QA 4UWFA 1OWPA 1HH8A 3DWLG 4DLQA 3S2AA 1Z3XA 3AG2E 5FZSA 2V0PA 2X6KA 3PREA 2FO1E 2Y0BG 3C3QA 4HVBA 4RG6A 4FJYA 3ML8A 5G04J 3FHEA 3OXGA 4B8AA 5EX0A 3E4BA 2CFZA 3BG1B 1NP7A 4L2LA 4LRZA 4PS8A 4G8LA 4LEUA 4GZ3A 5AJLA 1LF8A 4WWOA 4U04A 3UQ3A 1E8WA 5HRYA 3RRUA 3TXMA 4BTBA 4P29A 3B95A 3QK0A 4XI0A 4BETA 3D9LA 2R59A 2NXPA 1N52A 1FCHA 2J8SD 2BTDA 5JA4D 2E2EA 3NQPA 3TAXA 2KXPC 3Q79A 3EJNA 3J5PA 3E34A 2R05A 3TWVA 3LVRE 3ZVVA 2X38A 3TWSA 3ENEA 2OOEA 5FIOA 1EPUA 3C3RA 1PC2A 1LTXA 1FT2A 3DPDA 1IKND 2QY7A 5KWDA 3PNTB 4JW1A 1MX4A 4DX1A 2WXJA 3T8KA 2R17C 4BFRA 4EHMA 3FFLA 2LXLA 3RIBA 4ILHB 1Z6TA 3ZKJA 4DX6D 5AQ9A 2WXIA 1S64A 2IONA 4J7WA 3BG0B 5BT1A 1BU9A 4MS6A 5EIBE 3SQVA 2P9IG 3G2VA 1XNFA 4K5AB 5KJLA 3QJZA 4XIFA 2X6FA 4FJZA 4Y6WA 2I6HA 3JYSA 3BEEA 5AN8A 4OYSA 1EF1C 4OAUC 3FTXA 4RLYA 3HVEA 2B6CA 3S7BA 3IHVA 3QOUA 5AQBA 1UG3A 4GPMA 1E8YA 3CHRA 4ME2A 4F1PA 1UN9A 1HG5A 4WAFA 3PZ1A 1Y8MA 4JXTA 3PZ2A 2DIWA 2NYJA 2IF4A 3SNXA 2VGEA 2ILRA 4WNEA 1G3NB 4BX9A 1OCZE 5JHBA 4U8VD 4UQZA 1HS6A 4UWKA 1O1SA 4UWLA 3MKQB 4JA7A 2WXNA 2YHCA 4JVSA 2P9KG 4LSZE 4NIKA 4HI8A 4QFVA 4AOFA 4F1SA 5ENTD 5G04C 4KYOB 3GYZA 1JCRA 2PNNA 3PUJA 4U7EB 4UQYA 3JQ0A 5JJ6A 2XCCA 3APFA 4B8CB 1N94A 3EHRA 3FUFA 1U2VG 3QB2A 4JPSA 3TL5A 2Y4TA 4FLBA 1BD8A 3GW4A 4HNAD 1AP7A 4FHKA 5BNWA 3AS4A 1N4PA 2V4HC 2ZIRA 3F6QA 4I1OB 4A3VA 3ULEG 5T3RA 3B7BA 3RAUA 2XCBA 3VLFA 4EQFA 3FEXA 5KJNA 5AARA 4GYWA 3AJIA 1DCQA 3CVUA 5D2MC 4GCOA 2R03A 4E85A 4BT9A 4I2ZA 3PZDA 3U3WA 3C3OA 3DXKG 3Q7AA 3LPZA 5ENOD 3SBSA 3V30A 2H6GA 3D9HA 3FTUA 3ML9A 1JPLA 3IHYA 4BY6A 4FULA 4NRHB 4HRMB 2VSNA 1YCSB 4HB5A 3CVPA 4PS7A 2YINA 5ITZF 4G26A 3O48A 5T4YA 3PUKA 4L1BA 5JJ7A 3CKCA 2ETBA 2LAIA 4GZ6A 3PEUB 2F8YA 1QZ2A 4KXKB 2EILE 4URKA 3LJ3A 4IULA 2I2OA 4G24A 5CERB 1WG0A 3RSEG 5EILA 3EU9A 2XHEA 3KD7A 4F3VA 4GCNA 2PQRA 2RG8A 3RK6A 5CRUA 4B94A 1VDYA 2KBXA 1HU3A 3HXBA 2CG3A 3MKRA 5AAOA 1H2VC 1OT8A 3L16A 1K3ZD 5AIJA 4UWGA 3D9PA 3BU8A 4I2WA 3IV0A 5BXUA 5T8IA 2AWIA 5HS0A 3MKQA 3UM0A 3FH7A 2UWJG 2XZTG 3LXUX 2L0TB 3BUAA 3LS8A 2CHZA 4HFGA 2P9LG 3UINC 2IFUA 2MYOA 4K0RA 2DZNA 2GRQB 2FF4A 4CRWA 4BT8A 1IQRA 2L6JA 2BF0X 2ETCA 2I9CA 2XGMA 5FQ4A 3ZN3A 3DSVA 3SGHA 3T5VA 1ZBPA 2EINE 4GYYA 1E8ZA 3CEQA 3Q5MA 5LX8A 2GROB 4BWRA 4H7XA 4KT6B 1TEZA 1WAO1 4GTMA 2MHKA 5ENSD 1AWCB 1OWOA 1OXJA 2HO1A 1H6OA 3UXGA 3FTWA 4CDNA 1D8DA 3FUNA 4GMJA 1LD7A 3T5XA 3QKYA 4HXIA 2VSOE 3LKUA 2CG2A 4Y6CA 4JEHA 3HXEA 3HYMB 4TRQA 1NFIE 3CVQA 3FEYA 3ZU7B 4CGVA 4K5CA 4CYMD 4I1AA 2HR2A 1ELRA 4LNBA 2GRLA 2IEJA 4OVVA 5FTPA 2WVIA 4Q94A 4KMOA 4DJAA 3ASFA 4DX5D 2R02A 3SI5A 1MX6A 2VGXB 3RRNB 4I43A 1OY3D 2AJAA 3JXIA 1N4SA 3UT4A 4DI4A 4WNDA 5AJDA 3NBNB 3JCKC 4AV7A 3FUIA 2XPIA 2KZTA 1NL4A 2WXQA 2L6BA 3G2UA 2DVWA 3OXLA 4HOQA 3FTZA 3FUMA 1H6PA 3IEGA 3OAWA 4YDEA 4KVMA 3Q75A 4EBAA 4HRLA 3U66A 1KT1A 1JCQA 4MBGA 5DBKA 3CR3A 4CZ2D 4M3OA 2RKKA 2FBNA 3W9GA 1IHBA 2LUHA 4GTSA 4AM9A 3UIOC 1XGWA 2WQHA 5G55A 4D10C 3CSTA 4HS2A 1S63A 4A1GA 2YNQA 3L13A 1S0PA 5CMWA 4DPRA 4AY5A 2IO3C 2B0OE 2XGSA 4HOSA 3R7QA 4CCAA 3O4ZA 1WDYA 2WXGA 5KCMA 1JUQA 2XEEA 5AQ7A 5BUZA 4I1MA 2CFUA 3AG1E 5JJTA 2VJ8A 1HF8A 1IQUA 2J09A 4J8YA 3D9JA 3CK9A 1TYQG 2AXZA 3U9WA 2RFMA 2WQ6A 3I3NA 5E76A 1BLXB 5AYWD 2KCKA 3ZPJA 2ZU6B 3HXFA 5D0QD 1HO8A 3CQGB 5BV1A 1O5MA 1K8KG 4JHKA 4FLHA 3DRAA 3RO2A 1N95A 3FUDA 4NQ0A 2WXOA 3V2OA 3I5PA 3DXMG 1X5BA 2EIME 4AJWA 2OV8A 3J5QB 5D66A 3ZXPA 2ETAA 1RZ4A 4E6HA 3PZ3A 4YDOA 5CEAA 2OEVA 3SZ7A 4L23A 3EIQC 4AEZC 4HQDA 3EHMA 4ACKA 2NSZA 3ZHEB 2J08A 5CCLA 2XRZA 2X6IA 1SZ9A 4JC8A 4TXRA 5KJKA 3FUEA 1E90A 2VGXA 1P5QA 2FO7A 5M72A 4CDRA 5A23A 2WM9A 2BKKB 3CK8A 4U0SA 2A4ZA 2F0YA 4FU3A 1FPPA 3I4GA 3KSQA 1V55E 2LSUA 3TG4A 4LG6A 2ZGDA 4JD2G 3HXDA 4GU5A 4XZ4A 2J4DA 1E7VA 3HG0D 2XZDG 5B3SE 2LO6A 3DPYA 5DIZA 2H6FA 2QYJA 4B0ZA 4XKBA 1V54E 3TG5A 4BX8A 4WNFA 5D0OD 5ARGA 3UMVA 3I4RB 4J8FA 4A3TA 2H6IA 1ELWA 3C5RA 4I9CA 3SO8A 2E0IA 4J6IA 5BXOA 4ATGA 3HDXA 3FUKA 1GW6A 4HBDA 1PAQA 3SFYA 1O1TA 1H6KA 3CHMA 3CSFA 2I1KA 3FTYA 3OTNA 3JQ1A 4GAAA 4TUMA 4HLLA 5FINA 4N3AA 3FU6A 3APCA 3RJVA 4ZHBA 4CGWA 4RG9A 3KAEA 2AXVA 2IO2C 3CVWA 3QWWA 2XPZA 3PEVB 5FQ7A 3B13A 3GZSA 3ZYQA 3AS8A 3RRMB 3ASHA 3SD5A 3VLEA 5LFAA 2QC9A 2BUGA 3DSUA 3TWXA 2WXRA 3CVLA 4PH4B 4I9EA 4PDXA 4ATZD 3CVNA 3V2XA 1FT1A 1D8EA 1IYGA 3GZ1A 2BKGA 3LEWA 5IY5E 5KNHD 4L7TA 3B7TA 4YVQC 3ABME 2R2LA 2WMOA 3CGHA 3D3MA 4I6EA 3ZRHA 4PUCA 4QQIA 3R9AB 1OCRE 1N0QA 4O60A 1UOHA 2EIJE 2YQ8A 2X6HA 4ILIA 3ZHEA 2VSYA 3T9KA 3MCXA 4FHJA 2AW6A 1X81A 2ONDA 4U07A 2WQ7A 1N4RA 4DX2A 5ENNA 4N5CA 5BV0A 1OCCE 5ENQD 4GA0A 2EQXA 3LY8A 1HE8A 2OCCE 5LP0A 2XEHA 1TNZA 3JUIA 4UI9J 5B1AE 4DI3A 4HORA 3PE3A 3HHMA 2DWZA 5HI7A 5CMYA 1ELKA 2FEZA 3CVYA 5C2YA 2VQ2A 3ESLA 3Q4AB 3HIZA 4GPKA 3E32A 4L9PA 3CHOA 2PM7A 3UT7A 4HOTA 2VSXE 3UM3A 3LDZA 4UWHA 3ASGA 2DYRE 5CEDB 1TN8A 2WXKA 4I6JA 3SY2A 2VYIA 2WXLA 4GB9A 3WG7E 1TNYA 4CDMA 3EHQA 2C2LA 1MHQA 4G25A 1U3DA 3KEAA 2WXPA 3MEKA 1DCEA 2MOWA 2HYZA 5ANLA 3C98A 3APDA 2L0IA 3D9MA 1JWFA 4OVUA 4KBQA 5EYLA 4EECA 1HFAA 2IJGX 1TN6A 3C72A 4KZ0A 3Q78A 5AENA 2KM4A 4C48B 3TWUA 4CT4A 1NA3A 5ENRD 3ESKA 2KCVA 3W9FA 3CHPA 3NF1A 2ZGGA 4AVXA 3BQOA 4APOA 3VTXA 3AS5A 3ASDA 3FU0A 2LSVA 4IN3B 3FU3A 2J49A 3TWWA 3TWQA 2JEKA 3EUVA 2QYUA 2WMNA 1Y6IA 2DCPA 4BERA 3QWPA 1OUVA 1O1RA 4GZ5A 1OWMA 4APFA 3ZXSA 5EIDA 1EDUA 3ZIMA 2PM6A 3HXCA 3SFZA 3TGOA 2VTBB 4GMRA 4LCTA 1SQMA 3G2WA 2OEWA 3P2BA 4U96D 1DVPA 2DBAA 1SA4A 5HKPA 2X6JA 2I1JA 3ABLE 3K9IA 5AQAA 2DYSE 1MYOA 4ACLA 4J8DA 3FULA 4I6GA 5A6CA 2OVFA 3Q9UC 5CRVA 3DBSA 2XS1A 3ZUVB 4MKTA 4N5QA 5H7PA 5CHEE 3FDHA 3VTYA 4AY6A 3Q49B 2R5SA 3UKUG 1WY6A 3FUJA 4WNGA 1UJJA 5LOZA 3CKBA 1QYMA 2WPVA 3E30A 4RQIA 3L6AA 3L82A 5JMND 3E33A 3MX3A 4DK5A 3LYAA 2Y4UA 1JCSA 3Q7FA 3PVLA 1Q2ZA 3CQCB 2OVBA 2WXFA 4MRUA 2FULA 5LCWJ 4UI9C 4UI9K 3QAQA 1YYHA 3IKOB 3NAWA 5BPPA 3P1UA 4JL0A 2HE0A 5FQ8A 3RKVA 4O1OA 1U3CA 2WXMA 1A5EA 2NC9A 1HZ4A 3PDNA 4A1SA 4HRNA 2V8SE 1B89A 1H19A 4ZFHA 3QC1A 3NOGD 1TNBA 1ZU2A 1MX2A 3X2QE 4AIFA 5JHAA 3KS2A 2GW1A 3HVEB 3KSLA 1Z3YA 4GTPA 4U8YD 3PH0C 4XEIG 4GA2A 5ARFA 1OWLA 4XKCA 2A5EA 5FT9A 4G8KA 2A5UA 4K03A 1ZB1A 4JZYA 5CCMA 4JB8P 2KC7A 2XGOA 4HLEA 4X8QA 5G2NA 4DRXE 2LAHA 3ONKA 4JEUA 3HRAA 2LNIA 4EZJA 4KVOA 2VTBA 4EZLA 3SF4A 1TR4A 3FTVA 2C0LA 3G2SA 3AG3E 3LJNA 1N11A 3AU5A 3L08A 2JLBA
chains in the Genus database with same CATH topology
2DWZA 3UXGA 1BU9A 5EIBE 1A5EA 4UUCA 5CERB 2B0OE 3EHRA 3DEPA 4K5AB 1WG0A 5EILA 4F6RD 3EU9A 4GMRA 3V79K 4HRNA 4K5BA 1BD8A 2QC9A 4HNAD 4YDWA 4U96D 2KBXA 2BKKB 1AP7A 3JUEA 1WDYA 1NFIE 5AN8A 3TWXA 4B93B 4ZFHA 4G8LA 1BI8B 5HKPA 4DUIA 5AAOA 1MJ0A 4OAUC 2XEEA 1OT8A 3NOGD 5AQ7A 2V4HC 1K3ZD 4RLYA 3ZU7B 5AQAA 4BESA 4K5CA 2F8XK 4YDYA 1MYOA 2RFAA 4O1PA 3DEOA 4CYMD 3F6QA 5HRYA 4ATZD 5CEDB 1MX2A 5AQBA 3B95A 3Q9UC 4LNUD 5BXUA 4J8YA 3V2XA 4BETA 5HS0A 4GPMA 4U95D 3B7BA 3EHQA 4LG6A 4OAVB 3ZUVB 2ZGDA 1DC2A 5KBAA 3IXEA 2XZTG 4F1PA 4HI9A 4U8YD 5AARA 4N5QA 2JABA 2RFMA 3JXJA 3KEAA 3AJIA 3HG0D 3UTMA 2XZDG 4DX5D 1DCQA 2J8SD 1MX6A 3TWRA 5JA4D 3NOCD 2BKGA 5EN5D 1BLXB 2P2CP 1OY3D 5KNHD 2AJAA 3JXIA 2KXPC 2MYOA 1YMPA 5CECB 5ENPD 3J5PA 2A5EA 2DZNA 2QYJA 4G8KA 3NBNB 1SW6A 1S70B 2Y1LE 2NYJA 2F37A 5EYLA 4BEPA 3AAAC 1QYMA 5ENOD 3V30A 2DZOA 3TWVA 4QQIA 2V5QC 5CBNA 2VGEA 4JB8P 5KNGA 1N0QA 4O60A 3D9HA 4C48B 1UOHA 3TWSA 2L6BA 3TWUA 2DVWA 5ENRD 5FIOA 2ETCA 3ZNGA 4DRXE 1G3NB 3T9KA 5JMND 4U8VD 3W9FA 4HRMB 4HB5A 1IKND 1YCSB 3C5RA 1SVXA 2ZGGA 3V2OA 3HRAA 4HRLA 3SO8A 1BI7B 5ITZF 3UI2A 5KWDA 4DX2A 3J5QB 5D66A 5BXOA 1MX4A 4DX1A 1TR4A 2ETAA 4CZ2D 4DX7D 3T8KA 1D9SA 4LSZE 1K1AA 4HBDA 1K1BA 4NIKA 3W9GA 5ENQD 3TWWA 3TWQA 2ETBA 1YYHA 1IHBA 3V31A 4HI8A 5CEAA 4Z68A 2FO1E 4QFVA 2F8YA 4HLLA 4TUMA 5FINA 2XEHA 5ENTD 3ZKJA 2Y0BG 4A63B 5EYPF 4BERA 4BSZB 4DX6D 2XENA 3TWTA 3LJNA 2HE0A 5ENSD 5AQ9A 1AWCB 3Q9NC 1IXVA 5CBOA 1N11A 4HQDA 4O1OA 1N0RA 2PNNA 4ZHBA 4J7WA 5EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWZ A;  3UXG A;  1BU9 A;  5EIB E;  1A5E A;  4UUC A;  5CER B;  2B0O E;  3EHR A;  3DEP A;  4K5A B;  1WG0 A;  5EIL A;  4F6R D;  3EU9 A;  4GMR A;  3V79 K;  4HRN A;  4K5B A;  1BD8 A;  2QC9 A;  4HNA D;  4YDW A;  4U96 D;  2KBX A;  2BKK B;  1AP7 A;  3JUE A;  1WDY A;  1NFI E;  5AN8 A;  3TWX A;  4B93 B;  4ZFH A;  4G8L A;  1BI8 B;  5HKP A;  4DUI A;  5AAO A;  1MJ0 A;  4OAU C;  2XEE A;  1OT8 A;  3NOG D;  5AQ7 A;  2V4H C;  1K3Z D;  4RLY A;  3ZU7 B;  5AQA A;  4BES A;  4K5C A;  2F8X K;  4YDY A;  1MYO A;  2RFA A;  4O1P A;  3DEO A;  4CYM D;  3F6Q A;  5HRY A;  4ATZ D;  5CED B;  1MX2 A;  5AQB A;  3B95 A;  3Q9U C;  4LNU D;  5BXU A;  4J8Y A;  3V2X A;  4BET A;  5HS0 A;  4GPM A;  4U95 D;  3B7B A;  3EHQ A;  4LG6 A;  4OAV B;  3ZUV B;  2ZGD A;  1DC2 A;  5KBA A;  3IXE A;  2XZT G;  4F1P A;  4HI9 A;  4U8Y D;  5AAR A;  4N5Q A;  2JAB A;  2RFM A;  3JXJ A;  3KEA A;  3AJI A;  3HG0 D;  3UTM A;  2XZD G;  4DX5 D;  1DCQ A;  2J8S D;  1MX6 A;  3TWR A;  5JA4 D;  3NOC D;  2BKG A;  5EN5 D;  1BLX B;  2P2C P;  1OY3 D;  5KNH D;  2AJA A;  3JXI A;  2KXP C;  2MYO A;  1YMP A;  5CEC B;  5ENP D;  3J5P A;  2A5E A;  2DZN A;  2QYJ A;  4G8K A;  3NBN B;  1SW6 A;  1S70 B;  2Y1L E;  2NYJ A;  2F37 A;  5EYL A;  4BEP A;  3AAA C;  1QYM A;  5ENO D;  3V30 A;  2DZO A;  3TWV A;  4QQI A;  2V5Q C;  5CBN A;  2VGE A;  4JB8 P;  5KNG A;  1N0Q A;  4O60 A;  3D9H A;  4C48 B;  1UOH A;  3TWS A;  2L6B A;  3TWU A;  2DVW A;  5ENR D;  5FIO A;  2ETC A;  3ZNG A;  4DRX E;  1G3N B;  3T9K A;  5JMN D;  4U8V D;  3W9F A;  4HRM B;  4HB5 A;  1IKN D;  1YCS B;  3C5R A;  1SVX A;  2ZGG A;  3V2O A;  3HRA A;  4HRL A;  3SO8 A;  1BI7 B;  5ITZ F;  3UI2 A;  5KWD A;  4DX2 A;  3J5Q B;  5D66 A;  5BXO A;  1MX4 A;  4DX1 A;  1TR4 A;  2ETA A;  4CZ2 D;  4DX7 D;  3T8K A;  1D9S A;  4LSZ E;  1K1A A;  4HBD A;  1K1B A;  4NIK A;  3W9G A;  5ENQ D;  3TWW A;  3TWQ A;  2ETB A;  1YYH A;  1IHB A;  3V31 A;  4HI8 A;  5CEA A;  4Z68 A;  2FO1 E;  4QFV A;  2F8Y A;  4HLL A;  4TUM A;  5FIN A;  2XEH A;  5ENT D;  3ZKJ A;  2Y0B G;  4A63 B;  5EYP F;  4BER A;  4BSZ B;  4DX6 D;  2XEN A;  3TWT A;  3LJN A;  2HE0 A;  5ENS D;  5AQ9 A;  1AWC B;  3Q9N C;  1IXV A;  5CBO A;  1N11 A;  4HQD A;  4O1O A;  1N0R A;  2PNN A;  4ZHB A;  4J7W A;  5EID A; 
#chains in the Genus database with same CATH topology
 1L5J A;  3ASO E;  4FC8 A;  4J8E A;  2QFC A;  1H0A A;  2L9B A;  4JHJ A;  3E37 A;  3B7S A;  3ONL A;  1JWG A;  4K5B A;  3CK7 A;  3RU0 A;  4B93 B;  5EX3 A;  1BI8 B;  4ANX A;  3UM1 A;  2RD0 A;  2GGF A;  2P9U G;  4BTA A;  3FH5 A;  3R9M A;  3NZS A;  1NI1 A;  2XEV A;  4OAV B;  4A55 A;  3U64 A;  1N4Q A;  1INZ A;  3SBT B;  2H6H A;  3TWR A;  2P2C P;  4LNG A;  2AVP A;  2IOS A;  3MV2 B;  1YMP A;  4GML A;  4G11 A;  3ULQ A;  5KJM A;  3QAR A;  4G23 A;  5KNG A;  4U0U A;  4H7Y A;  4EBA G;  2J07 A;  2IY0 C;  4Q96 A;  5LCW C;  3FY4 A;  1NZN A;  3MYV A;  4CEM A;  1SVX A;  2ZIS A;  3NZU A;  3QDN A;  1UN8 A;  1E7U A;  3KEZ A;  1PY1 A;  3NB2 A;  4O6F A;  4AP2 A;  3IBE A;  3B7R L;  1D9S A;  1K1B A;  2ZXW E;  2UY1 B;  2Q7F A;  5A7D B;  2KAT A;  3TWT A;  2IU1 A;  4XX5 A;  4ABN A;  4FAD A;  1IHG A;  2QZA A;  3EHN A;  3PZ4 A;  5EDS A;  4PS3 A;  5ANR A;  2PQN A;  3B7U X;  3V79 K;  3ISM C;  3JUE A;  3L22 A;  2XQ0 A;  1HXI A;  1RW2 A;  2F8X K;  4ANW A;  3DEO A;  2GRP B;  2LXM A;  4GTT A;  2V4L A;  4HOU A;  3ZEF A;  5B1B E;  5EKQ D;  4C9B B;  2P9S G;  4WWP A;  2IOL A;  1MZC A;  4TV3 A;  4YVO A;  5G05 J;  5E75 A;  4NAC A;  3L9T A;  4TXP A;  4WWN A;  4G1T A;  4ANU A;  2P9P G;  1S70 B;  4GTR A;  2DZO A;  4CT0 A;  4LUN U;  3GZ2 A;  2GRR B;  1HG2 A;  3FWV A;  3UPV A;  4R7L A;  3ZYK A;  2HM8 A;  2GRN B;  4N3C A;  3SHF A;  3VLD A;  4Z68 A;  4V3I A;  4J0U A;  2BED A;  2XEN A;  2XS8 A;  5CBO A;  4GTQ A;  4GZD A;  2P9N G;  3ULY A;  3S7F A;  4UUC A;  4N3B A;  3CVX A;  2CHW A;  3R7R A;  1QBQ A;  1N54 A;  4F6R D;  3Q73 A;  4JA9 A;  3Q47 B;  1W3B A;  3MGB A;  5FZQ A;  3FP3 A;  4U63 A;  4YDW A;  3AU4 A;  3D9O A;  4TUU A;  1MJ0 A;  3ZGQ A;  3AG4 E;  2RFA A;  5J08 A;  3EU5 A;  4RVB A;  4LNU D;  4B89 A;  4BSX A;  2XPY A;  3LVQ E;  1WM5 A;  3MV3 B;  4FP7 A;  1LD8 A;  3DSX A;  3NOC D;  5EN5 D;  5HQ8 A;  4ILG A;  3ZFW A;  2UY1 A;  3N71 A;  3ABK E;  5FQ6 A;  1SW6 A;  2Y1L E;  3DSW A;  2EIK E;  1E8X A;  1E96 B;  1HX8 A;  4J8S A;  2KCL A;  2KZT B;  3MJW A;  1N9A A;  2IQC A;  1H2T C;  1BI7 B;  3UI2 A;  3EDT B;  4DLO A;  1OCO E;  4N39 A;  1K1A A;  3CVV A;  2XRY A;  3UX4 A;  1EYH A;  3U4T A;  4GZC A;  3V31 A;  4M7C A;  3DSS A;  4N2Q A;  4IYP A;  3WXX A;  3CV0 A;  4GTV A;  2Y69 E;  3Q9N C;  1IXV A;  2MRI A;  3G2T A;  3SFX A;  3PS6 A;  2X3M A;  4IRU A;  4MLP A;  1KT0 A;  3L54 A;  4KZC A;  1NA0 A;  4U0Z A;  3UUX A;  3DEP A;  1MQS A;  3QNK A;  3OXF A;  1UW4 B;  4C0M A;  4YND A;  1TNO A;  3PRZ A;  3UKR G;  5FJY A;  3UM2 A;  4DUI A;  2PZI A;  1KZP A;  1TN7 A;  1TJC A;  4N2S A;  3ZW3 A;  5G05 C;  5J90 A;  4U95 D;  3CHQ A;  2VGY A;  3TJP A;  3LCA A;  3DST A;  1FVF A;  1DC2 A;  1Z5S C;  3ASN E;  2AXU A;  2JAB A;  3TXN A;  1FVH A;  1TJF A;  3UT8 A;  4ANV A;  1KZO A;  4GA1 A;  4W9R A;  2J4B A;  2F37 A;  3PNL B;  2V5Q C;  2V5F A;  1TNU A;  4GYO A;  5C1D A;  3T8M A;  4XE0 A;  3CLJ A;  2GRM A;  3S7J A;  1KPS B;  1BPO A;  2WB2 A;  1A17 A;  3D9N A;  4JHR A;  4G2V A;  3FUH A;  4UQX A;  4C0E A;  2CHX A;  2WXH A;  4DX7 D;  3QWV A;  3CHS A;  2Y3A A;  1QNF A;  1OWN A;  5BW8 C;  4A63 B;  3UIP C;  5EYP F;  4BSZ B;  3ZYM A;  5FWQ A;  1N0R A;  3RO3 A;  3PE4 A;  3EIJ A;  2C0M A;  3LY7 A;  4FA6 A;  1SZA A;  4U8H A;  3LY9 A;  4RSY A;  3FU5 A;  1DNP A;  4XI9 A;  3S7D A;  4L2Y A;  4Q69 A;  4EZK A;  3FTS A;  4F53 A;  3Q15 A;  3CIA A;  4BES A;  4YDY A;  4AXH A;  4O1P A;  5FZR A;  4LER A;  1H2U A;  4NUR A;  4F7A A;  1YA0 A;  1UJK A;  3FH8 A;  3URZ A;  4EPZ A;  5KBA A;  3IXE A;  2PL2 A;  4HI9 A;  2M63 A;  2P58 C;  3JXJ A;  3UTM A;  3D9K A;  2YHE A;  5CEC B;  3MZL B;  4GTO A;  5ENP D;  4I17 A;  3ZYL A;  1SA5 A;  4BEP A;  3D9I A;  3AAA C;  1KLX A;  5CBN A;  1QQE A;  3L17 A;  4WUY A;  3ZNG A;  4TXQ A;  2FI7 A;  3MA5 A;  2J9Q A;  4UWF A;  1OWP A;  1HH8 A;  3DWL G;  4DLQ A;  3S2A A;  1Z3X A;  3AG2 E;  5FZS A;  2V0P A;  2X6K A;  3PRE A;  2FO1 E;  2Y0B G;  3C3Q A;  4HVB A;  4RG6 A;  4FJY A;  3ML8 A;  5G04 J;  3FHE A;  3OXG A;  4B8A A;  5EX0 A;  3E4B A;  2CFZ A;  3BG1 B;  1NP7 A;  4L2L A;  4LRZ A;  4PS8 A;  4G8L A;  4LEU A;  4GZ3 A;  5AJL A;  1LF8 A;  4WWO A;  4U04 A;  3UQ3 A;  1E8W A;  5HRY A;  3RRU A;  3TXM A;  4BTB A;  4P29 A;  3B95 A;  3QK0 A;  4XI0 A;  4BET A;  3D9L A;  2R59 A;  2NXP A;  1N52 A;  1FCH A;  2J8S D;  2BTD A;  5JA4 D;  2E2E A;  3NQP A;  3TAX A;  2KXP C;  3Q79 A;  3EJN A;  3J5P A;  3E34 A;  2R05 A;  3TWV A;  3LVR E;  3ZVV A;  2X38 A;  3TWS A;  3ENE A;  2OOE A;  5FIO A;  1EPU A;  3C3R A;  1PC2 A;  1LTX A;  1FT2 A;  3DPD A;  1IKN D;  2QY7 A;  5KWD A;  3PNT B;  4JW1 A;  1MX4 A;  4DX1 A;  2WXJ A;  3T8K A;  2R17 C;  4BFR A;  4EHM A;  3FFL A;  2LXL A;  3RIB A;  4ILH B;  1Z6T A;  3ZKJ A;  4DX6 D;  5AQ9 A;  2WXI A;  1S64 A;  2ION A;  4J7W A;  3BG0 B;  5BT1 A;  1BU9 A;  4MS6 A;  5EIB E;  3SQV A;  2P9I G;  3G2V A;  1XNF A;  4K5A B;  5KJL A;  3QJZ A;  4XIF A;  2X6F A;  4FJZ A;  4Y6W A;  2I6H A;  3JYS A;  3BEE A;  5AN8 A;  4OYS A;  1EF1 C;  4OAU C;  3FTX A;  4RLY A;  3HVE A;  2B6C A;  3S7B A;  3IHV A;  3QOU A;  5AQB A;  1UG3 A;  4GPM A;  1E8Y A;  3CHR A;  4ME2 A;  4F1P A;  1UN9 A;  1HG5 A;  4WAF A;  3PZ1 A;  1Y8M A;  4JXT A;  3PZ2 A;  2DIW A;  2NYJ A;  2IF4 A;  3SNX A;  2VGE A;  2ILR A;  4WNE A;  1G3N B;  4BX9 A;  1OCZ E;  5JHB A;  4U8V D;  4UQZ A;  1HS6 A;  4UWK A;  1O1S A;  4UWL A;  3MKQ B;  4JA7 A;  2WXN A;  2YHC A;  4JVS A;  2P9K G;  4LSZ E;  4NIK A;  4HI8 A;  4QFV A;  4AOF A;  4F1S A;  5ENT D;  5G04 C;  4KYO B;  3GYZ A;  1JCR A;  2PNN A;  3PUJ A;  4U7E B;  4UQY A;  3JQ0 A;  5JJ6 A;  2XCC A;  3APF A;  4B8C B;  1N94 A;  3EHR A;  3FUF A;  1U2V G;  3QB2 A;  4JPS A;  3TL5 A;  2Y4T A;  4FLB A;  1BD8 A;  3GW4 A;  4HNA D;  1AP7 A;  4FHK A;  5BNW A;  3AS4 A;  1N4P A;  2V4H C;  2ZIR A;  3F6Q A;  4I1O B;  4A3V A;  3ULE G;  5T3R A;  3B7B A;  3RAU A;  2XCB A;  3VLF A;  4EQF A;  3FEX A;  5KJN A;  5AAR A;  4GYW A;  3AJI A;  1DCQ A;  3CVU A;  5D2M C;  4GCO A;  2R03 A;  4E85 A;  4BT9 A;  4I2Z A;  3PZD A;  3U3W A;  3C3O A;  3DXK G;  3Q7A A;  3LPZ A;  5ENO D;  3SBS A;  3V30 A;  2H6G A;  3D9H A;  3FTU A;  3ML9 A;  1JPL A;  3IHY A;  4BY6 A;  4FUL A;  4NRH B;  4HRM B;  2VSN A;  1YCS B;  4HB5 A;  3CVP A;  4PS7 A;  2YIN A;  5ITZ F;  4G26 A;  3O48 A;  5T4Y A;  3PUK A;  4L1B A;  5JJ7 A;  3CKC A;  2ETB A;  2LAI A;  4GZ6 A;  3PEU B;  2F8Y A;  1QZ2 A;  4KXK B;  2EIL E;  4URK A;  3LJ3 A;  4IUL A;  2I2O A;  4G24 A;  5CER B;  1WG0 A;  3RSE G;  5EIL A;  3EU9 A;  2XHE A;  3KD7 A;  4F3V A;  4GCN A;  2PQR A;  2RG8 A;  3RK6 A;  5CRU A;  4B94 A;  1VDY A;  2KBX A;  1HU3 A;  3HXB A;  2CG3 A;  3MKR A;  5AAO A;  1H2V C;  1OT8 A;  3L16 A;  1K3Z D;  5AIJ A;  4UWG A;  3D9P A;  3BU8 A;  4I2W A;  3IV0 A;  5BXU A;  5T8I A;  2AWI A;  5HS0 A;  3MKQ A;  3UM0 A;  3FH7 A;  2UWJ G;  2XZT G;  3LXU X;  2L0T B;  3BUA A;  3LS8 A;  2CHZ A;  4HFG A;  2P9L G;  3UIN C;  2IFU A;  2MYO A;  4K0R A;  2DZN A;  2GRQ B;  2FF4 A;  4CRW A;  4BT8 A;  1IQR A;  2L6J A;  2BF0 X;  2ETC A;  2I9C A;  2XGM A;  5FQ4 A;  3ZN3 A;  3DSV A;  3SGH A;  3T5V A;  1ZBP A;  2EIN E;  4GYY A;  1E8Z A;  3CEQ A;  3Q5M A;  5LX8 A;  2GRO B;  4BWR A;  4H7X A;  4KT6 B;  1TEZ A;  1WAO 1;  4GTM A;  2MHK A;  5ENS D;  1AWC B;  1OWO A;  1OXJ A;  2HO1 A;  1H6O A;  3UXG A;  3FTW A;  4CDN A;  1D8D A;  3FUN A;  4GMJ A;  1LD7 A;  3T5X A;  3QKY A;  4HXI A;  2VSO E;  3LKU A;  2CG2 A;  4Y6C A;  4JEH A;  3HXE A;  3HYM B;  4TRQ A;  1NFI E;  3CVQ A;  3FEY A;  3ZU7 B;  4CGV A;  4K5C A;  4CYM D;  4I1A A;  2HR2 A;  1ELR A;  4LNB A;  2GRL A;  2IEJ A;  4OVV A;  5FTP A;  2WVI A;  4Q94 A;  4KMO A;  4DJA A;  3ASF A;  4DX5 D;  2R02 A;  3SI5 A;  1MX6 A;  2VGX B;  3RRN B;  4I43 A;  1OY3 D;  2AJA A;  3JXI A;  1N4S A;  3UT4 A;  4DI4 A;  4WND A;  5AJD A;  3NBN B;  3JCK C;  4AV7 A;  3FUI A;  2XPI A;  2KZT A;  1NL4 A;  2WXQ A;  2L6B A;  3G2U A;  2DVW A;  3OXL A;  4HOQ A;  3FTZ A;  3FUM A;  1H6P A;  3IEG A;  3OAW A;  4YDE A;  4KVM A;  3Q75 A;  4EBA A;  4HRL A;  3U66 A;  1KT1 A;  1JCQ A;  4MBG A;  5DBK A;  3CR3 A;  4CZ2 D;  4M3O A;  2RKK A;  2FBN A;  3W9G A;  1IHB A;  2LUH A;  4GTS A;  4AM9 A;  3UIO C;  1XGW A;  2WQH A;  5G55 A;  4D10 C;  3CST A;  4HS2 A;  1S63 A;  4A1G A;  2YNQ A;  3L13 A;  1S0P A;  5CMW A;  4DPR A;  4AY5 A;  2IO3 C;  2B0O E;  2XGS A;  4HOS A;  3R7Q A;  4CCA A;  3O4Z A;  1WDY A;  2WXG A;  5KCM A;  1JUQ A;  2XEE A;  5AQ7 A;  5BUZ A;  4I1M A;  2CFU A;  3AG1 E;  5JJT A;  2VJ8 A;  1HF8 A;  1IQU A;  2J09 A;  4J8Y A;  3D9J A;  3CK9 A;  1TYQ G;  2AXZ A;  3U9W A;  2RFM A;  2WQ6 A;  3I3N A;  5E76 A;  1BLX B;  5AYW D;  2KCK A;  3ZPJ A;  2ZU6 B;  3HXF A;  5D0Q D;  1HO8 A;  3CQG B;  5BV1 A;  1O5M A;  1K8K G;  4JHK A;  4FLH A;  3DRA A;  3RO2 A;  1N95 A;  3FUD A;  4NQ0 A;  2WXO A;  3V2O A;  3I5P A;  3DXM G;  1X5B A;  2EIM E;  4AJW A;  2OV8 A;  3J5Q B;  5D66 A;  3ZXP A;  2ETA A;  1RZ4 A;  4E6H A;  3PZ3 A;  4YDO A;  5CEA A;  2OEV A;  3SZ7 A;  4L23 A;  3EIQ C;  4AEZ C;  4HQD A;  3EHM A;  4ACK A;  2NSZ A;  3ZHE B;  2J08 A;  5CCL A;  2XRZ A;  2X6I A;  1SZ9 A;  4JC8 A;  4TXR A;  5KJK A;  3FUE A;  1E90 A;  2VGX A;  1P5Q A;  2FO7 A;  5M72 A;  4CDR A;  5A23 A;  2WM9 A;  2BKK B;  3CK8 A;  4U0S A;  2A4Z A;  2F0Y A;  4FU3 A;  1FPP A;  3I4G A;  3KSQ A;  1V55 E;  2LSU A;  3TG4 A;  4LG6 A;  2ZGD A;  4JD2 G;  3HXD A;  4GU5 A;  4XZ4 A;  2J4D A;  1E7V A;  3HG0 D;  2XZD G;  5B3S E;  2LO6 A;  3DPY A;  5DIZ A;  2H6F A;  2QYJ A;  4B0Z A;  4XKB A;  1V54 E;  3TG5 A;  4BX8 A;  4WNF A;  5D0O D;  5ARG A;  3UMV A;  3I4R B;  4J8F A;  4A3T A;  2H6I A;  1ELW A;  3C5R A;  4I9C A;  3SO8 A;  2E0I A;  4J6I A;  5BXO A;  4ATG A;  3HDX A;  3FUK A;  1GW6 A;  4HBD A;  1PAQ A;  3SFY A;  1O1T A;  1H6K A;  3CHM A;  3CSF A;  2I1K A;  3FTY A;  3OTN A;  3JQ1 A;  4GAA A;  4TUM A;  4HLL A;  5FIN A;  4N3A A;  3FU6 A;  3APC A;  3RJV A;  4ZHB A;  4CGW A;  4RG9 A;  3KAE A;  2AXV A;  2IO2 C;  3CVW A;  3QWW A;  2XPZ A;  3PEV B;  5FQ7 A;  3B13 A;  3GZS A;  3ZYQ A;  3AS8 A;  3RRM B;  3ASH A;  3SD5 A;  3VLE A;  5LFA A;  2QC9 A;  2BUG A;  3DSU A;  3TWX A;  2WXR A;  3CVL A;  4PH4 B;  4I9E A;  4PDX A;  4ATZ D;  3CVN A;  3V2X A;  1FT1 A;  1D8E A;  1IYG A;  3GZ1 A;  2BKG A;  3LEW A;  5IY5 E;  5KNH D;  4L7T A;  3B7T A;  4YVQ C;  3ABM E;  2R2L A;  2WMO A;  3CGH A;  3D3M A;  4I6E A;  3ZRH A;  4PUC A;  4QQI A;  3R9A B;  1OCR E;  1N0Q A;  4O60 A;  1UOH A;  2EIJ E;  2YQ8 A;  2X6H A;  4ILI A;  3ZHE A;  2VSY A;  3T9K A;  3MCX A;  4FHJ A;  2AW6 A;  1X81 A;  2OND A;  4U07 A;  2WQ7 A;  1N4R A;  4DX2 A;  5ENN A;  4N5C A;  5BV0 A;  1OCC E;  5ENQ D;  4GA0 A;  2EQX A;  3LY8 A;  1HE8 A;  2OCC E;  5LP0 A;  2XEH A;  1TNZ A;  3JUI A;  4UI9 J;  5B1A E;  4DI3 A;  4HOR A;  3PE3 A;  3HHM A;  2DWZ A;  5HI7 A;  5CMY A;  1ELK A;  2FEZ A;  3CVY A;  5C2Y A;  2VQ2 A;  3ESL A;  3Q4A B;  3HIZ A;  4GPK A;  3E32 A;  4L9P A;  3CHO A;  2PM7 A;  3UT7 A;  4HOT A;  2VSX E;  3UM3 A;  3LDZ A;  4UWH A;  3ASG A;  2DYR E;  5CED B;  1TN8 A;  2WXK A;  4I6J A;  3SY2 A;  2VYI A;  2WXL A;  4GB9 A;  3WG7 E;  1TNY A;  4CDM A;  3EHQ A;  2C2L A;  1MHQ A;  4G25 A;  1U3D A;  3KEA A;  2WXP A;  3MEK A;  1DCE A;  2MOW A;  2HYZ A;  5ANL A;  3C98 A;  3APD A;  2L0I A;  3D9M A;  1JWF A;  4OVU A;  4KBQ A;  5EYL A;  4EEC A;  1HFA A;  2IJG X;  1TN6 A;  3C72 A;  4KZ0 A;  3Q78 A;  5AEN A;  2KM4 A;  4C48 B;  3TWU A;  4CT4 A;  1NA3 A;  5ENR D;  3ESK A;  2KCV A;  3W9F A;  3CHP A;  3NF1 A;  2ZGG A;  4AVX A;  3BQO A;  4APO A;  3VTX A;  3AS5 A;  3ASD A;  3FU0 A;  2LSV A;  4IN3 B;  3FU3 A;  2J49 A;  3TWW A;  3TWQ A;  2JEK A;  3EUV A;  2QYU A;  2WMN A;  1Y6I A;  2DCP A;  4BER A;  3QWP A;  1OUV A;  1O1R A;  4GZ5 A;  1OWM A;  4APF A;  3ZXS A;  5EID A;  1EDU A;  3ZIM A;  2PM6 A;  3HXC A;  3SFZ A;  3TGO A;  2VTB B;  4GMR A;  4LCT A;  1SQM A;  3G2W A;  2OEW A;  3P2B A;  4U96 D;  1DVP A;  2DBA A;  1SA4 A;  5HKP A;  2X6J A;  2I1J A;  3ABL E;  3K9I A;  5AQA A;  2DYS E;  1MYO A;  4ACL A;  4J8D A;  3FUL A;  4I6G A;  5A6C A;  2OVF A;  3Q9U C;  5CRV A;  3DBS A;  2XS1 A;  3ZUV B;  4MKT A;  4N5Q A;  5H7P A;  5CHE E;  3FDH A;  3VTY A;  4AY6 A;  3Q49 B;  2R5S A;  3UKU G;  1WY6 A;  3FUJ A;  4WNG A;  1UJJ A;  5LOZ A;  3CKB A;  1QYM A;  2WPV A;  3E30 A;  4RQI A;  3L6A A;  3L82 A;  5JMN D;  3E33 A;  3MX3 A;  4DK5 A;  3LYA A;  2Y4U A;  1JCS A;  3Q7F A;  3PVL A;  1Q2Z A;  3CQC B;  2OVB A;  2WXF A;  4MRU A;  2FUL A;  5LCW J;  4UI9 C;  4UI9 K;  3QAQ A;  1YYH A;  3IKO B;  3NAW A;  5BPP A;  3P1U A;  4JL0 A;  2HE0 A;  5FQ8 A;  3RKV A;  4O1O A;  1U3C A;  2WXM A;  1A5E A;  2NC9 A;  1HZ4 A;  3PDN A;  4A1S A;  4HRN A;  2V8S E;  1B89 A;  1H19 A;  4ZFH A;  3QC1 A;  3NOG D;  1TNB A;  1ZU2 A;  1MX2 A;  3X2Q E;  4AIF A;  5JHA A;  3KS2 A;  2GW1 A;  3HVE B;  3KSL A;  1Z3Y A;  4GTP A;  4U8Y D;  3PH0 C;  4XEI G;  4GA2 A;  5ARF A;  1OWL A;  4XKC A;  2A5E A;  5FT9 A;  4G8K A;  2A5U A;  4K03 A;  1ZB1 A;  4JZY A;  5CCM A;  4JB8 P;  2KC7 A;  2XGO A;  4HLE A;  4X8Q A;  5G2N A;  4DRX E;  2LAH A;  3ONK A;  4JEU A;  3HRA A;  2LNI A;  4EZJ A;  4KVO A;  2VTB A;  4EZL A;  3SF4 A;  1TR4 A;  3FTV A;  2C0L A;  3G2S A;  3AG3 E;  3LJN A;  1N11 A;  3AU5 A;  3L08 A;  2JLB A; 
#chains in the Genus database with same CATH homology
 2DWZ A;  3UXG A;  1BU9 A;  5EIB E;  1A5E A;  4UUC A;  5CER B;  2B0O E;  3EHR A;  3DEP A;  4K5A B;  1WG0 A;  5EIL A;  4F6R D;  3EU9 A;  4GMR A;  3V79 K;  4HRN A;  4K5B A;  1BD8 A;  2QC9 A;  4HNA D;  4YDW A;  4U96 D;  2KBX A;  2BKK B;  1AP7 A;  3JUE A;  1WDY A;  1NFI E;  5AN8 A;  3TWX A;  4B93 B;  4ZFH A;  4G8L A;  1BI8 B;  5HKP A;  4DUI A;  5AAO A;  1MJ0 A;  4OAU C;  2XEE A;  1OT8 A;  3NOG D;  5AQ7 A;  2V4H C;  1K3Z D;  4RLY A;  3ZU7 B;  5AQA A;  4BES A;  4K5C A;  2F8X K;  4YDY A;  1MYO A;  2RFA A;  4O1P A;  3DEO A;  4CYM D;  3F6Q A;  5HRY A;  4ATZ D;  5CED B;  1MX2 A;  5AQB A;  3B95 A;  3Q9U C;  4LNU D;  5BXU A;  4J8Y A;  3V2X A;  4BET A;  5HS0 A;  4GPM A;  4U95 D;  3B7B A;  3EHQ A;  4LG6 A;  4OAV B;  3ZUV B;  2ZGD A;  1DC2 A;  5KBA A;  3IXE A;  2XZT G;  4F1P A;  4HI9 A;  4U8Y D;  5AAR A;  4N5Q A;  2JAB A;  2RFM A;  3JXJ A;  3KEA A;  3AJI A;  3HG0 D;  3UTM A;  2XZD G;  4DX5 D;  1DCQ A;  2J8S D;  1MX6 A;  3TWR A;  5JA4 D;  3NOC D;  2BKG A;  5EN5 D;  1BLX B;  2P2C P;  1OY3 D;  5KNH D;  2AJA A;  3JXI A;  2KXP C;  2MYO A;  1YMP A;  5CEC B;  5ENP D;  3J5P A;  2A5E A;  2DZN A;  2QYJ A;  4G8K A;  3NBN B;  1SW6 A;  1S70 B;  2Y1L E;  2NYJ A;  2F37 A;  5EYL A;  4BEP A;  3AAA C;  1QYM A;  5ENO D;  3V30 A;  2DZO A;  3TWV A;  4QQI A;  2V5Q C;  5CBN A;  2VGE A;  4JB8 P;  5KNG A;  1N0Q A;  4O60 A;  3D9H A;  4C48 B;  1UOH A;  3TWS A;  2L6B A;  3TWU A;  2DVW A;  5ENR D;  5FIO A;  2ETC A;  3ZNG A;  4DRX E;  1G3N B;  3T9K A;  5JMN D;  4U8V D;  3W9F A;  4HRM B;  4HB5 A;  1IKN D;  1YCS B;  3C5R A;  1SVX A;  2ZGG A;  3V2O A;  3HRA A;  4HRL A;  3SO8 A;  1BI7 B;  5ITZ F;  3UI2 A;  5KWD A;  4DX2 A;  3J5Q B;  5D66 A;  5BXO A;  1MX4 A;  4DX1 A;  1TR4 A;  2ETA A;  4CZ2 D;  4DX7 D;  3T8K A;  1D9S A;  4LSZ E;  1K1A A;  4HBD A;  1K1B A;  4NIK A;  3W9G A;  5ENQ D;  3TWW A;  3TWQ A;  2ETB A;  1YYH A;  1IHB A;  3V31 A;  4HI8 A;  5CEA A;  4Z68 A;  2FO1 E;  4QFV A;  2F8Y A;  4HLL A;  4TUM A;  5FIN A;  2XEH A;  5ENT D;  3ZKJ A;  2Y0B G;  4A63 B;  5EYP F;  4BER A;  4BSZ B;  4DX6 D;  2XEN A;  3TWT A;  3LJN A;  2HE0 A;  5ENS D;  5AQ9 A;  1AWC B;  3Q9N C;  1IXV A;  5CBO A;  1N11 A;  4HQD A;  4O1O A;  1N0R A;  2PNN A;  4ZHB A;  4J7W A;  5EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...