2XZDG

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
DLGKKLLEATRAGQDDEVRILMANGADVNAMDDAGVTPLHLAAKRGHLEIVEVLLKHGADVNASDIWGRTPLHLAATVGHLEIVEVLLEYGADVNAQDKFGKTAFDISIDNGNEDLAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3
total genus 36
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2xzdG00
4G8KA 3KEAA 4K5AB 3EU9A 5EYPF 4DRXE 2ZGGA 2XZTG 5KBAA 1NFIE 4QFVA 3TWVA 4O1OA 2A5EA 1YCSB 2PNNA 5CBNA 1N0QA 5D66A 2Y0BG 2P2CP 4TUMA 5EILA 3W9GA 5EIBE 2J8SD 5AQ9A 4K5CA 2Y1LE 3UXGA 4GPMA 4BESA 3B95A 3J5PA 3Q9NC 4J7WA 3TWQA 1MYOA 5ENSD 5HRYA 3F6QA 1DCQA 1YMPA 2V5QC 2MYOA 5FIOA 1OT8A 3HG0D 2DZNA 4HI9A 5AQBA 5AQAA 5JMND 5EYLA 1BD8A 1MX2A 4HRLA 4YDWA 4HRNA 2NYJA 4DX1A 4B93B 4HI8A 4DX6D 3NOCD 4HNAD 4LNUD 1BI8B 2QYJA 4Z68A 3JXIA 3DEOA 3Q9UC 3NBNB 1DC2A 2XENA 4HRMB 3T9KA 5EN5D 5KNGA 3TWSA 1MX4A 3SO8A 1WDYA 4GMRA 5AN8A 1IXVA 3NOGD 3EHQA 4OAVB 5ENOD 5HS0A 4U96D 4BETA 1AWCB 1N11A 5CEDB 5FINA 5CECB 4HB5A 4NIKA 4BEPA 5JA4D 4UUCA 1QYMA 3TWRA 3V31A 4N5QA 5BXUA 1A5EA 3IXEA 4QQIA 1N0RA 4J8YA 3C5RA 1BI7B 5ENPD 1IHBA 3V2OA 2F37A 4ZFHA 3V2XA 2B0OE 2ZGDA 4BERA 3V30A 1YYHA 4DUIA 5CERB 1K3ZD 1BLXB 2DVWA 3UI2A 4ATZD 2FO1E 1TR4A 2BKKB 4CYMD 3V79K 3ZUVB 1MJ0A 4YDYA 1D9SA 3HRAA 2ETBA 4K5BA 1IKND 4G8LA 4HLLA 2V4HC 2XZDG 4JB8P 2ETAA 3JXJA 1S70B 3TWTA 3AAAC 3J5QB 3D9HA 2DZOA 5KNHD 4DX5D 1K1AA 4BSZB 4U8VD 5ENQD 2HE0A 1UOHA 2F8YA 2KXPC 4O60A 2VGEA 5ENRD 5KWDA 1AP7A 4HQDA 1G3NB 4DX2A 5EIDA 4OAUC 3TWWA 5BXOA 5AARA 2XEEA 3AJIA 4RLYA 1MX6A 3JUEA 4F1PA 1SVXA 1BU9A 3B7BA 3ZU7B 2AJAA 3W9FA 3ZKJA 4LG6A 2RFAA 4O1PA 5CBOA 1WG0A 4U95D 1SW6A 4F6RD 4U8YD 1OY3D 2JABA 5ITZF 4HBDA 3ZNGA 2DWZA 2F8XK 3UTMA 3LJNA 3TWUA 5HKPA 2QC9A 4C48B 1K1BA 2L6BA 2RFMA 5ENTD 4DX7D 3DEPA 3TWXA 5AQ7A 2ETCA 4A63B 3T8KA 3EHRA 2BKGA 4CZ2D 4ZHBA 5CEAA 2XEHA 2KBXA 4LSZE 5AAOA
chains in the Genus database with same CATH superfamily
3HVEB 4MKTA 3JUIA 5BW8C 1N0QA 5D66A 2Y0BG 2P2CP 2PZIA 3DSVA 4BY6A 3L6AA 4LEUA 5CMWA 4GYOA 3Q9NC 2OEWA 2WXJA 3FP3A 5KJMA 1HXIA 2WXFA 2VSXE 4TV3A 3Q9UC 5ENNA 3R7QA 4L1BA 3UQ3A 3AG3E 4GPKA 2VSNA 1MQSA 3NZSA 4R7LA 2IOLA 3CKBA 4WWNA 2VGXA 3IBEA 2F37A 2VQ2A 3GZ1A 3FTUA 3PNLB 4GZDA 2KATA 4ILIA 3BQOA 4L2LA 4N3CA 3B7TA 3DBSA 3BG1B 1INZA 1XNFA 1N95A 4G24A 5ENQD 3D9MA 1FT2A 3EJNA 2VGEA 2OOEA 4N3BA 3FU6A 4WNDA 2AJAA 4W9RA 2BTDA 1Z5SC 3ASNE 4JHKA 2LSVA 2XS1A 5KJKA 1BPOA 3SY2A 3IHVA 1N4PA 3ZFWA 3CEQA 4EZLA 1KLXA 2BKGA 4GTPA 1Z6TA 3OTNA 2WQHA 4BFRA 2IOSA 3SFYA 3PRZA 4B8CB 5KBAA 1EDUA 3CVQA 3D9PA 4TUMA 2J8SD 4L23A 4B0ZA 4N39A 4CDRA 4J7WA 1XGWA 3L17A 4XKBA 3X2QE 2EIJE 4FHJA 1H6KA 2NSZA 4HI8A 2WXQA 3B7SA 3FEYA 3TGOA 2BF0X 4C9BB 2A5UA 5JJ6A 3PUKA 3CKCA 4NACA 1N54A 4LNGA 1N52A 5ENOD 1OCCE 2GRRB 2GRQB 3QJZA 1FCHA 2LXMA 5FWQA 4PS7A 2E2EA 2IJGX 3SZ7A 3I5PA 1GW6A 3V2XA 4A1SA 3CK8A 4GZ5A 2WXHA 1TR4A 5BNWA 4U0UA 2YINA 1HU3A 2WQ7A 2DZOA 4F7AA 4I6EA 3ZN3A 2XHEA 1JPLA 3UKRG 1B89A 5HI7A 3EIJA 1OUVA 1TN6A 4WNEA 1KZPA 1SA4A 4TXPA 4DI3A 2F8XK 3PUJA 4U63A 4DX7D 3MZLB 3BUAA 4UWLA 4A63B 3EUVA 5E76A 1WM5A 3FUFA 4JC8A 2OEVA 2IO3C 2L0TB 4GTOA 3FUHA 4APOA 3BU8A 3BEEA 5EIBE 5B1AE 3KD7A 1HFAA 4RG9A 3BG0B 4UQYA 1MHQA 1X5BA 2P9IG 2XQ0A 2MYOA 2XGOA 1SA5A 4GU5A 1Z3YA 3PE4A 3TL5A 5A23A 4CGVA 3DSUA 3QB2A 2Q7FA 4HOSA 4ACLA 4RG6A 3HXBA 4J8YA 3Q79A 1HZ4A 1YYHA 4HORA 3L16A 4ATZD 3SHFA 4TXRA 5B3SE 3CHQA 3ULQA 1E90A 3LVRE 1AP7A 1JUQA 5EIDA 3TWWA 3N71A 1KZOA 4GAAA 3Q75A 3MX3A 2WXRA 4GYWA 3ASGA 3MCXA 2F0YA 2WM9A 4LUNU 3ZHEA 4UQZA 2FEZA 3HDXA 3VLEA 3EHRA 5A6CA 3I4GA 3JQ0A 4UWHA 3Q7FA 3GZSA 1WY6A 3CK9A 3FFLA 4GPMA 2OVBA 4Y6CA 4JD2G 3O4ZA 3PS6A 3HXFA 1NA3A 5JMND 3SFZA 3QNKA 4FLHA 4EECA 1N94A 3LXUX 3PVLA 4GTQA 2KM4A 3IHYA 5C2YA 1N4RA 2V4LA 5EX3A 5CCMA 3KEZA 1EPUA 3ENEA 1QZ2A 2EQXA 3FWVA 4GB9A 2UWJG 1RW2A 2WXOA 1V54E 2AXZA 2C0LA 4I43A 3T5VA 2FO1E 3T5XA 5FQ8A 4J0UA 3D9NA 3JCKC 1D9SA 4OYSA 3UM3A 3JXJA 4J8SA 2HE0A 1K8KG 5BT1A 5KWDA 2PM6A 2DYRE 4JW1A 2HM8A 2XS8A 1BU9A 4G23A 4GZ6A 4IYPA 3ABME 4TRQA 5ARGA 3U9WA 4N2SA 3NB2A 5HKPA 3MKQA 4GA1A 3CLJA 3TG5A 3FUNA 2L6BA 1ZU2A 3RO3A 5T3RA 3OXGA 3D9JA 3Q47B 4ZHBA 4J8EA 3LCAA 4A3VA 1D8EA 1NFIE 3TWVA 3EHMA 5T8IA 3DXMG 4I6JA 4CEMA 3K9IA 3LJ3A 5T4YA 3CHOA 3LY7A 2A4ZA 2R02A 3P2BA 3FTXA 4HRNA 3FULA 3NOCD 4Z68A 3HIZA 5FT9A 3RJVA 4GYYA 1QYMA 3QARA 5BV0A 5CHEE 1NL4A 5FQ4A 4KMOA 4B89A 3AS8A 3MV2B 4DK5A 4AY6A 3HHMA 2J07A 3KS2A 4YDYA 3HRAA 2DBAA 3RSEG 4CDMA 3AAAC 4U8VD 1UW4B 5A7DB 4U7EB 3C3RA 4HQDA 4OAUC 1OCOE 1S64A 3RK6A 5J90A 3VTXA 4ILHB 3KSLA 5CBOA 1WG0A 3FTYA 3FUMA 3CV0A 3AU4A 2CFZA 3DRAA 4HBDA 3UX4A 3ZNGA 4C48B 3ONLA 4ME2A 4XX5A 4FADA 2J4BA 4PDXA 3T8KA 3CVVA 3CHSA 2XPYA 3MJWA 2HO1A 4DRXE 3I3NA 3D3MA 5LCWC 2J49A 4L9PA 1OCRE 3DSSA 2P9NG 1IQUA 4AOFA 4HI9A 4B94A 2X6FA 3LKUA 2QFCA 3PZDA 4B93B 2ZISA 2H6GA 3LS8A 1UG3A 3B7UX 4F1SA 4JL0A 1D8DA 3TWSA 3SO8A 3VLFA 1Q2ZA 2ONDA 4FLBA 4KZCA 4HLEA 5M72A 2IEJA 3OXLA 5JA4D 3ZYLA 5ENPD 4PS8A 3ZYQA 2ZGDA 1OWLA 4I1OB 4MBGA 3HXDA 1NA0A 5LOZA 1N4SA 1PY1A 3FU0A 3TWTA 3CQCB 5KNHD 5CCLA 4MLPA 4U0SA 1W3BA 1A17A 2F8YA 2XRZA 1TEZA 3E32A 5G05C 1Y6IA 3U4TA 4J8FA 2RFAA 3MGBA 4U8YD 3CQGB 5EKQD 2KC7A 3G2TA 4GTSA 2GRLA 5ENTD 5AQ7A 2KZTA 1UJKA 3ZRHA 4H7YA 2XCCA 4XKCA 1HF8A 3FUDA 3UT4A 3MV3B 2PNNA 5AQ9A 3UXGA 3ESLA 2WVIA 4BESA 1DNPA 4AJWA 3ML9A 3Q73A 5HRYA 4Q69A 4WWPA 2HYZA 3AG1E 4AP2A 3FUJA 3DSWA 1BD8A 4HRLA 3VLDA 2I9CA 2J4DA 4LNUD 3NBNB 2XENA 1S63A 4N2QA 1MX4A 3EIQC 3MEKA 5DIZA 2GGFA 4GMRA 1N4QA 1P5QA 5KCMA 1TYQG 1MZCA 4JA7A 2UY1B 4GZCA 2NXPA 2XPZA 4QQIA 4HXIA 2GRNB 2LUHA 3C98A 1HE8A 2OV8A 3L54A 1FVFA 3JYSA 3APDA 5BV1A 3PDNA 2EINE 2J9QA 3CVYA 4BEPA 3APFA 3D9IA 1S70B 4BSXA 3ONKA 4O60A 4JPSA 4WAFA 1G3NB 4DX2A 2DIWA 1OXJA 5BXOA 3KAEA 1U3DA 2Y69E 1FPPA 4I9EA 1KPSB 3RRUA 3S7JA 5ITZF 3OXFA 2QC9A 3FH8A 1H6OA 2YNQA 2R5SA 4LSZE 1O1RA 3PH0C 3DSTA 3KEAA 5EYPF 4HOUA 4UI9K 4O1OA 1YCSB 5CBNA 1V55E 4HOTA 2WMNA 4Q96A 1NP7A 4GTVA 5JJTA 2WB2A 5ANLA 3URZA 3B7RL 3J5PA 3F6QA 4V3IA 1YMPA 4YDWA 4H7XA 4DX1A 2H6HA 3JXIA 4YDEA 1DC2A 3T9KA 1TNUA 3QKYA 5FQ6A 3ASDA 3QK0A 1IHGA 4BETA 1N11A 4U0ZA 2R59A 1A5EA 3NQPA 5CRUA 1N0RA 4I2ZA 2VJ8A 1FT1A 2B0OE 3CVLA 4DUIA 4KT6B 3FY4A 1BLXB 3FTWA 4M7CA 3UM1A 2KCVA 1IKND 3CHPA 4BX9A 1SQMA 2HR2A 3FUKA 1OCZE 2KXPC 1TNZA 4ILGA 5LP0A 3Q4AB 3ASHA 4RLYA 3GYZA 4IRUA 3SD5A 3LEWA 1S0PA 4RSYA 2IFUA 4FJYA 2RFMA 2CFUA 2WXGA 3Q7AA 1H2TC 5AAOA 2R2LA 4C0MA 4ANWA 3JQ1A 1FVHA 3DWLG 1E8WA 2QZAA 1QNFA 3QWPA 1JWFA 4GZ3A 2PL2A 1ZBPA 5JJ7A 4JEUA 1E8YA 3UUXA 2X6KA 5FIOA 5FZQA 4YVOA 3CGHA 3HXCA 4K03A 2YQ8A 2IY0C 3PZ3A 5BUZA 4FJZA 1U2VG 3PEVB 3NF1A 4HS2A 3NOGD 4UI9J 5D0OD 1OWOA 5HQ8A 4A55A 3LYAA 2X6IA 3V2OA 1ELWA 3KSQA 1K3ZD 2BKKB 3V79K 1UN9A 1MJ0A 2ETAA 3J5QB 2AW6A 4RVBA 5G55A 4IULA 4CT4A 1HX8A 4URKA 4X8QA 3E33A 2MOWA 1QBQA 2OVFA 1E96B 5H7PA 4L7TA 4DLOA 3LJNA 4A1GA 2VTBA 3FEXA 5FJYA 3LY9A 2PQNA 3R7RA 4TXQA 1DVPA 3ASFA 3IKOB 5LFAA 3RRMB 3HXEA 2ZGGA 2L9BA 3SBTB 2WXLA 3ULEG 3TXNA 1YA0A 3HVEA 3U3WA 3PREA 3GZ2A 2GRPB 4AY5A 4E6HA 5EX0A 1TNBA 3G2SA 2QYUA 2DZNA 1KT1A 2RKKA 2NYJA 2IO2C 5G04J 2CHZA 1BI8B 2KCKA 3LY8A 3QWVA 2VTBB 4JXTA 3E4BA 2LXLA 3R9AB 5CECB 2KCLA 3LVQE 3UIOC 3APCA 4CGWA 3DSXA 4PS3A 3C5RA 1BI7B 1TN7A 4CDNA 4GTRA 4BERA 3RKVA 3UI2A 4CYMD 4G8LA 2XZDG 3D9KA 2Y4TA 1UOHA 4BT8A 2X6JA 2X6HA 4I1AA 2H6FA 4UWFA 2FBNA 2LAHA 4EZKA 3SI5A 2WXKA 3ZPJA 2WXMA 4NQ0A 3ZW3A 3CSTA 4F6RD 4FHKA 4RQIA 4D10C 5AJDA 1IYGA 2EILE 4G11A 1K1BA 3TWXA 2ETCA 4MRUA 2J08A 4N5CA 2ILRA 3AS5A 4CRWA 3SGHA 2LNIA 3EU9A 1E7UA 4QFVA 3S7FA 4GA0A 3W9GA 3ZXPA 3MYVA 1TNOA 3Q15A 5B1BE 3DXKG 3L22A 3VTYA 4UWGA 2DYSE 1DCQA 2V5QC 5AQAA 2RG8A 4AEZC 5KJNA 3ZYKA 1L5JA 3EDTB 4GCNA 5JHAA 4JZYA 2JLBA 2IU1A 3SNXA 1PAQA 4GMJA 5AN8A 1NI1A 3U64A 1AWCB 4U8HA 2XRYA 1U3CA 1DCEA 3ML8A 3DPDA 3AG2E 1OWMA 3TWRA 5KJLA 3V31A 3E37A 3G2VA 5FTPA 3FU5A 2R05A 4G26A 2R17C 3CVPA 5D2MC 1HG2A 3S7BA 4BX8A 5LCWJ 3NZUA 2C0MA 4HLLA 2V5FA 3B13A 1K1AA 5JHBA 2PM7A 4GA2A 2RD0A 4AXHA 3Q49B 4J8DA 4F1PA 4G2VA 2EIKE 3D9OA 3ISMC 1O1SA 4PUCA 4HOQA 1OY3D 2I2OA 1EF1C 1LTXA 4EPZA 4LCTA 2P58C 4KZ0A 3D9LA 2WQ6A 2AWIA 4JEHA 5CEAA 2XEHA 2P9PG 2XCBA 2YHEA 3CHMA 5BPPA 4XIFA 2XZTG 5EILA 4JVSA 3UMVA 3QAQA 3RAUA 4C0EA 4G1TA 4XEIG 3RRNB 4K0RA 3EHNA 1Y8MA 3ZVVA 4GCOA 4HNAD 2X38A 3DEOA 4N3AA 5KNGA 1WDYA 4I1MA 1IXVA 4LERA 1SZAA 3ZIMA 5HS0A 3UT8A 4JA9A 3FHEA 3ZEFA 5ANRA 3AG4E 3UT7A 5D0QD 3OAWA 5FZSA 3DPYA 4EBAG 2GW1A 4DX5D 1QQEA 1H19A 4KVOA 1HG5A 1NZNA 3FH5A 5AIJA 4LG6A 3TJPA 1HS6A 4UI9C 4AIFA 3WXXA 2E0IA 5AJLA 3UKUG 3CIAA 2KBXA 4PH4B 4G8KA 1H2UA 3C3OA 5G2NA 4ANUA 1N9AA 2CHXA 3ZYMA 1E8XA 2CHWA 1OWPA 1OWNA 1HH8A 3ASOE 4LRZA 4GTTA 4ABNA 3FTZA 4HVBA 4FULA 2WXPA 4YVQC 3MKQB 3C3QA 2ZU6B 4I2WA 1O1TA 4O6FA 2I1KA 5EN5D 4MS6A 2I6HA 3EHQA 2VGYA 5FINA 1TNYA 4AV7A 2VSOE 4UUCA 2VGXB 1H6PA 5ARFA 4KBQA 1TJFA 1ELRA 2QY7A 2XPIA 5CERB 4JHRA 1Z3XA 3EU5A 3FU3A 3Q5MA 3LDZA 4FC8A 3ZUVB 1UJJA 2VSYA 4CCAA 3AU5A 2XGSA 3D9HA 3ESKA 1ELKA 4AVXA 1UN8A 2R03A 4BTAA 2I1JA 2L6JA 2AXUA 3B7BA 2V0PA 1JCQA 4Q94A 5G04C 4ATGA 3W9FA 1H2VC 5AYWD 4U95D 2JABA 1O5MA 3UTMA 3TWUA 2P9LG 3ABLE 5IY5E 3MKRA 3ZXSA 4AM9A 3U66A 4M3OA 2H6IA 4OVUA 4WWOA 3FUEA 4WNGA 3O48A 2GRMA 4OVVA 4KYOB 3R9MA 4ANVA 3RIBA 3CK7A 3MA5A 2WPVA 1X81A 3PNTB 2DCPA 3B95A 5DBKA 4G25A 2IQCA 4HFGA 1TN8A 3TAXA 1OT8A 2FO7A 3IEGA 2GROB 2L0IA 2FF4A 4GMLA 3QDNA 3G2WA 5FZRA 4ACKA 2BEDA 5CEDB 4FU3A 3E30A 3FDHA 1JWGA 3CVWA 3TXMA 4NRHB 3UIPC 5BXUA 4I6GA 1KT0A 3PE3A 5AENA 4ZFHA 4P29A 3PZ4A 3CHRA 4TUUA 2OCCE 2ETBA 1JCRA 3G2UA 5ENRD 4LNBA 4U07A 2XEEA 3JUEA 4I17A 2XGMA 4EBAA 1JCSA 2P9SG 3PEUB 3ZKJA 2WXNA 4O1PA 4YDOA 4J6IA 5FQ7A 1LF8A 5G05J 2P9KG 3E34A 1IQRA 3HYMB 4UWKA 4KXKB 3LPZA 4WUYA 1EYHA 3ULYA 3UM2A 3FUIA 4NURA 2V8SE 1PC2A 4IN3B 5C1DA 3UPVA 4XI9A 4K5CA 3FTSA 3S7DA 3SQVA 4DPRA 2AXVA 3TWQA 2LAIA 1MYOA 5ENSD 2LO6A 5AQBA 5EYLA 4BTBA 4DLQA 3FH7A 4F53A 4DX6D 4DI4A 3SBSA 4EZJA 1E8ZA 2ZIRA 3SFXA 4HRMB 3CVXA 3I4RB 3SF4A 4OAVB 4CT0A 2LSUA 4FA6A 3UM0A 4HB5A 4N5QA 2IONA 3P1UA 3IV0A 1IHBA 2Y4UA 4WNFA 2C2LA 3RO2A 3V30A 2Y3AA 2DVWA 1H0AA 3QOUA 4XZ4A 2MRIA 3GW4A 5EDSA 4K5BA 3L13A 3UINC 4JB8P 1HO8A 2VYIA 3CVUA 5AARA 5CRVA 4L2YA 4FP7A 4ANXA 3ZU7B 2MHKA 3QWWA 2UY1A 2WMOA 2WXIA 2DWZA 2ZXWE 2AVPA 3PZ1A 4XE0A 3CSFA 2EIME 4DJAA 2FULA 4EHMA 4U04A 5E75A 4F3VA 4Y6WA 3T8MA 4K5AB 2CG2A 2M63A 2FI7A 2A5EA 4I9CA 3L9TA 5LX8A 3ZHEB 4GTMA 2Y1LE 3C72A 3QC1A 4YNDA 3PZ2A 2IF4A 3HG0D 5CMYA 1MX2A 3FTVA 2QYJA 4KVMA 4UQXA 4E85A 3ABKE 2XEVA 1RZ4A 3L08A 3RU0A 4U96D 2CG3A 5J08A 4BT9A 4NIKA 4XI0A 2X3MA 3IXEA 3WG7E 2KZTB 2B6CA 2NC9A 3TG4A 1ZB1A 2YHCA 3CR3A 3AS4A 2P9UG 1TJCA 4JHJA 3S2AA 2V4HC 1VDYA 4BWRA 4B8AA 4BSZB 3ZGQA 4APFA 2J09A 3NAWA 3AJIA 1MX6A 1LD8A 1SVXA 2JEKA 3Q78A 2BUGA 2PQRA 1E7VA 1SW6A 1WAO1 3CVNA 1LD7A 4EQFA 1SZ9A 3DEPA 4CZ2D 3L82A 4A3TA
chains in the Genus database with same CATH topology
4G8KA 3KEAA 4K5AB 3EU9A 5EYPF 4DRXE 2ZGGA 2XZTG 5KBAA 1NFIE 4QFVA 3TWVA 4O1OA 2A5EA 1YCSB 2PNNA 5CBNA 1N0QA 5D66A 2Y0BG 2P2CP 4TUMA 5EILA 3W9GA 5EIBE 2J8SD 5AQ9A 4K5CA 2Y1LE 3UXGA 4GPMA 4BESA 3B95A 3J5PA 3Q9NC 4J7WA 3TWQA 1MYOA 5ENSD 5HRYA 3F6QA 1DCQA 1YMPA 2V5QC 2MYOA 5FIOA 1OT8A 3HG0D 2DZNA 4HI9A 5AQBA 5AQAA 5JMND 5EYLA 1BD8A 1MX2A 4HRLA 4YDWA 4HRNA 2NYJA 4DX1A 4B93B 4HI8A 4DX6D 3NOCD 4HNAD 4LNUD 1BI8B 2QYJA 4Z68A 3JXIA 3DEOA 3Q9UC 3NBNB 1DC2A 2XENA 4HRMB 3T9KA 5EN5D 5KNGA 3TWSA 1MX4A 3SO8A 1WDYA 4GMRA 5AN8A 1IXVA 3NOGD 3EHQA 4OAVB 5ENOD 5HS0A 4U96D 4BETA 1AWCB 1N11A 5CEDB 5FINA 5CECB 4HB5A 4NIKA 4BEPA 5JA4D 4UUCA 1QYMA 3TWRA 3V31A 4N5QA 5BXUA 1A5EA 3IXEA 4QQIA 1N0RA 4J8YA 3C5RA 1BI7B 5ENPD 1IHBA 3V2OA 2F37A 4ZFHA 3V2XA 2B0OE 2ZGDA 4BERA 3V30A 1YYHA 4DUIA 5CERB 1K3ZD 1BLXB 2DVWA 3UI2A 4ATZD 2FO1E 1TR4A 2BKKB 4CYMD 3V79K 3ZUVB 1MJ0A 4YDYA 1D9SA 3HRAA 2ETBA 4K5BA 1IKND 4G8LA 4HLLA 2V4HC 2XZDG 4JB8P 2ETAA 3JXJA 1S70B 3TWTA 3AAAC 3J5QB 3D9HA 2DZOA 5KNHD 4DX5D 1K1AA 4BSZB 4U8VD 5ENQD 2HE0A 1UOHA 2F8YA 2KXPC 4O60A 2VGEA 5ENRD 5KWDA 1AP7A 4HQDA 1G3NB 4DX2A 5EIDA 4OAUC 3TWWA 5BXOA 5AARA 2XEEA 3AJIA 4RLYA 1MX6A 3JUEA 4F1PA 1SVXA 1BU9A 3B7BA 3ZU7B 2AJAA 3W9FA 3ZKJA 4LG6A 2RFAA 4O1PA 5CBOA 1WG0A 4U95D 1SW6A 4F6RD 4U8YD 1OY3D 2JABA 5ITZF 4HBDA 3ZNGA 2DWZA 2F8XK 3UTMA 3LJNA 3TWUA 5HKPA 2QC9A 4C48B 1K1BA 2L6BA 2RFMA 5ENTD 4DX7D 3DEPA 3TWXA 5AQ7A 2ETCA 4A63B 3T8KA 3EHRA 2BKGA 4CZ2D 4ZHBA 5CEAA 2XEHA 2KBXA 4LSZE 5AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G8K A;  3KEA A;  4K5A B;  3EU9 A;  5EYP F;  4DRX E;  2ZGG A;  2XZT G;  5KBA A;  1NFI E;  4QFV A;  3TWV A;  4O1O A;  2A5E A;  1YCS B;  2PNN A;  5CBN A;  1N0Q A;  5D66 A;  2Y0B G;  2P2C P;  4TUM A;  5EIL A;  3W9G A;  5EIB E;  2J8S D;  5AQ9 A;  4K5C A;  2Y1L E;  3UXG A;  4GPM A;  4BES A;  3B95 A;  3J5P A;  3Q9N C;  4J7W A;  3TWQ A;  1MYO A;  5ENS D;  5HRY A;  3F6Q A;  1DCQ A;  1YMP A;  2V5Q C;  2MYO A;  5FIO A;  1OT8 A;  3HG0 D;  2DZN A;  4HI9 A;  5AQB A;  5AQA A;  5JMN D;  5EYL A;  1BD8 A;  1MX2 A;  4HRL A;  4YDW A;  4HRN A;  2NYJ A;  4DX1 A;  4B93 B;  4HI8 A;  4DX6 D;  3NOC D;  4HNA D;  4LNU D;  1BI8 B;  2QYJ A;  4Z68 A;  3JXI A;  3DEO A;  3Q9U C;  3NBN B;  1DC2 A;  2XEN A;  4HRM B;  3T9K A;  5EN5 D;  5KNG A;  3TWS A;  1MX4 A;  3SO8 A;  1WDY A;  4GMR A;  5AN8 A;  1IXV A;  3NOG D;  3EHQ A;  4OAV B;  5ENO D;  5HS0 A;  4U96 D;  4BET A;  1AWC B;  1N11 A;  5CED B;  5FIN A;  5CEC B;  4HB5 A;  4NIK A;  4BEP A;  5JA4 D;  4UUC A;  1QYM A;  3TWR A;  3V31 A;  4N5Q A;  5BXU A;  1A5E A;  3IXE A;  4QQI A;  1N0R A;  4J8Y A;  3C5R A;  1BI7 B;  5ENP D;  1IHB A;  3V2O A;  2F37 A;  4ZFH A;  3V2X A;  2B0O E;  2ZGD A;  4BER A;  3V30 A;  1YYH A;  4DUI A;  5CER B;  1K3Z D;  1BLX B;  2DVW A;  3UI2 A;  4ATZ D;  2FO1 E;  1TR4 A;  2BKK B;  4CYM D;  3V79 K;  3ZUV B;  1MJ0 A;  4YDY A;  1D9S A;  3HRA A;  2ETB A;  4K5B A;  1IKN D;  4G8L A;  4HLL A;  2V4H C;  2XZD G;  4JB8 P;  2ETA A;  3JXJ A;  1S70 B;  3TWT A;  3AAA C;  3J5Q B;  3D9H A;  2DZO A;  5KNH D;  4DX5 D;  1K1A A;  4BSZ B;  4U8V D;  5ENQ D;  2HE0 A;  1UOH A;  2F8Y A;  2KXP C;  4O60 A;  2VGE A;  5ENR D;  5KWD A;  1AP7 A;  4HQD A;  1G3N B;  4DX2 A;  5EID A;  4OAU C;  3TWW A;  5BXO A;  5AAR A;  2XEE A;  3AJI A;  4RLY A;  1MX6 A;  3JUE A;  4F1P A;  1SVX A;  1BU9 A;  3B7B A;  3ZU7 B;  2AJA A;  3W9F A;  3ZKJ A;  4LG6 A;  2RFA A;  4O1P A;  5CBO A;  1WG0 A;  4U95 D;  1SW6 A;  4F6R D;  4U8Y D;  1OY3 D;  2JAB A;  5ITZ F;  4HBD A;  3ZNG A;  2DWZ A;  2F8X K;  3UTM A;  3LJN A;  3TWU A;  5HKP A;  2QC9 A;  4C48 B;  1K1B A;  2L6B A;  2RFM A;  5ENT D;  4DX7 D;  3DEP A;  3TWX A;  5AQ7 A;  2ETC A;  4A63 B;  3T8K A;  3EHR A;  2BKG A;  4CZ2 D;  4ZHB A;  5CEA A;  2XEH A;  2KBX A;  4LSZ E;  5AAO A; 
#chains in the Genus database with same CATH topology
 3HVE B;  4MKT A;  3JUI A;  5BW8 C;  1N0Q A;  5D66 A;  2Y0B G;  2P2C P;  2PZI A;  3DSV A;  4BY6 A;  3L6A A;  4LEU A;  5CMW A;  4GYO A;  3Q9N C;  2OEW A;  2WXJ A;  3FP3 A;  5KJM A;  1HXI A;  2WXF A;  2VSX E;  4TV3 A;  3Q9U C;  5ENN A;  3R7Q A;  4L1B A;  3UQ3 A;  3AG3 E;  4GPK A;  2VSN A;  1MQS A;  3NZS A;  4R7L A;  2IOL A;  3CKB A;  4WWN A;  2VGX A;  3IBE A;  2F37 A;  2VQ2 A;  3GZ1 A;  3FTU A;  3PNL B;  4GZD A;  2KAT A;  4ILI A;  3BQO A;  4L2L A;  4N3C A;  3B7T A;  3DBS A;  3BG1 B;  1INZ A;  1XNF A;  1N95 A;  4G24 A;  5ENQ D;  3D9M A;  1FT2 A;  3EJN A;  2VGE A;  2OOE A;  4N3B A;  3FU6 A;  4WND A;  2AJA A;  4W9R A;  2BTD A;  1Z5S C;  3ASN E;  4JHK A;  2LSV A;  2XS1 A;  5KJK A;  1BPO A;  3SY2 A;  3IHV A;  1N4P A;  3ZFW A;  3CEQ A;  4EZL A;  1KLX A;  2BKG A;  4GTP A;  1Z6T A;  3OTN A;  2WQH A;  4BFR A;  2IOS A;  3SFY A;  3PRZ A;  4B8C B;  5KBA A;  1EDU A;  3CVQ A;  3D9P A;  4TUM A;  2J8S D;  4L23 A;  4B0Z A;  4N39 A;  4CDR A;  4J7W A;  1XGW A;  3L17 A;  4XKB A;  3X2Q E;  2EIJ E;  4FHJ A;  1H6K A;  2NSZ A;  4HI8 A;  2WXQ A;  3B7S A;  3FEY A;  3TGO A;  2BF0 X;  4C9B B;  2A5U A;  5JJ6 A;  3PUK A;  3CKC A;  4NAC A;  1N54 A;  4LNG A;  1N52 A;  5ENO D;  1OCC E;  2GRR B;  2GRQ B;  3QJZ A;  1FCH A;  2LXM A;  5FWQ A;  4PS7 A;  2E2E A;  2IJG X;  3SZ7 A;  3I5P A;  1GW6 A;  3V2X A;  4A1S A;  3CK8 A;  4GZ5 A;  2WXH A;  1TR4 A;  5BNW A;  4U0U A;  2YIN A;  1HU3 A;  2WQ7 A;  2DZO A;  4F7A A;  4I6E A;  3ZN3 A;  2XHE A;  1JPL A;  3UKR G;  1B89 A;  5HI7 A;  3EIJ A;  1OUV A;  1TN6 A;  4WNE A;  1KZP A;  1SA4 A;  4TXP A;  4DI3 A;  2F8X K;  3PUJ A;  4U63 A;  4DX7 D;  3MZL B;  3BUA A;  4UWL A;  4A63 B;  3EUV A;  5E76 A;  1WM5 A;  3FUF A;  4JC8 A;  2OEV A;  2IO3 C;  2L0T B;  4GTO A;  3FUH A;  4APO A;  3BU8 A;  3BEE A;  5EIB E;  5B1A E;  3KD7 A;  1HFA A;  4RG9 A;  3BG0 B;  4UQY A;  1MHQ A;  1X5B A;  2P9I G;  2XQ0 A;  2MYO A;  2XGO A;  1SA5 A;  4GU5 A;  1Z3Y A;  3PE4 A;  3TL5 A;  5A23 A;  4CGV A;  3DSU A;  3QB2 A;  2Q7F A;  4HOS A;  4ACL A;  4RG6 A;  3HXB A;  4J8Y A;  3Q79 A;  1HZ4 A;  1YYH A;  4HOR A;  3L16 A;  4ATZ D;  3SHF A;  4TXR A;  5B3S E;  3CHQ A;  3ULQ A;  1E90 A;  3LVR E;  1AP7 A;  1JUQ A;  5EID A;  3TWW A;  3N71 A;  1KZO A;  4GAA A;  3Q75 A;  3MX3 A;  2WXR A;  4GYW A;  3ASG A;  3MCX A;  2F0Y A;  2WM9 A;  4LUN U;  3ZHE A;  4UQZ A;  2FEZ A;  3HDX A;  3VLE A;  3EHR A;  5A6C A;  3I4G A;  3JQ0 A;  4UWH A;  3Q7F A;  3GZS A;  1WY6 A;  3CK9 A;  3FFL A;  4GPM A;  2OVB A;  4Y6C A;  4JD2 G;  3O4Z A;  3PS6 A;  3HXF A;  1NA3 A;  5JMN D;  3SFZ A;  3QNK A;  4FLH A;  4EEC A;  1N94 A;  3LXU X;  3PVL A;  4GTQ A;  2KM4 A;  3IHY A;  5C2Y A;  1N4R A;  2V4L A;  5EX3 A;  5CCM A;  3KEZ A;  1EPU A;  3ENE A;  1QZ2 A;  2EQX A;  3FWV A;  4GB9 A;  2UWJ G;  1RW2 A;  2WXO A;  1V54 E;  2AXZ A;  2C0L A;  4I43 A;  3T5V A;  2FO1 E;  3T5X A;  5FQ8 A;  4J0U A;  3D9N A;  3JCK C;  1D9S A;  4OYS A;  3UM3 A;  3JXJ A;  4J8S A;  2HE0 A;  1K8K G;  5BT1 A;  5KWD A;  2PM6 A;  2DYR E;  4JW1 A;  2HM8 A;  2XS8 A;  1BU9 A;  4G23 A;  4GZ6 A;  4IYP A;  3ABM E;  4TRQ A;  5ARG A;  3U9W A;  4N2S A;  3NB2 A;  5HKP A;  3MKQ A;  4GA1 A;  3CLJ A;  3TG5 A;  3FUN A;  2L6B A;  1ZU2 A;  3RO3 A;  5T3R A;  3OXG A;  3D9J A;  3Q47 B;  4ZHB A;  4J8E A;  3LCA A;  4A3V A;  1D8E A;  1NFI E;  3TWV A;  3EHM A;  5T8I A;  3DXM G;  4I6J A;  4CEM A;  3K9I A;  3LJ3 A;  5T4Y A;  3CHO A;  3LY7 A;  2A4Z A;  2R02 A;  3P2B A;  3FTX A;  4HRN A;  3FUL A;  3NOC D;  4Z68 A;  3HIZ A;  5FT9 A;  3RJV A;  4GYY A;  1QYM A;  3QAR A;  5BV0 A;  5CHE E;  1NL4 A;  5FQ4 A;  4KMO A;  4B89 A;  3AS8 A;  3MV2 B;  4DK5 A;  4AY6 A;  3HHM A;  2J07 A;  3KS2 A;  4YDY A;  3HRA A;  2DBA A;  3RSE G;  4CDM A;  3AAA C;  4U8V D;  1UW4 B;  5A7D B;  4U7E B;  3C3R A;  4HQD A;  4OAU C;  1OCO E;  1S64 A;  3RK6 A;  5J90 A;  3VTX A;  4ILH B;  3KSL A;  5CBO A;  1WG0 A;  3FTY A;  3FUM A;  3CV0 A;  3AU4 A;  2CFZ A;  3DRA A;  4HBD A;  3UX4 A;  3ZNG A;  4C48 B;  3ONL A;  4ME2 A;  4XX5 A;  4FAD A;  2J4B A;  4PDX A;  3T8K A;  3CVV A;  3CHS A;  2XPY A;  3MJW A;  2HO1 A;  4DRX E;  3I3N A;  3D3M A;  5LCW C;  2J49 A;  4L9P A;  1OCR E;  3DSS A;  2P9N G;  1IQU A;  4AOF A;  4HI9 A;  4B94 A;  2X6F A;  3LKU A;  2QFC A;  3PZD A;  4B93 B;  2ZIS A;  2H6G A;  3LS8 A;  1UG3 A;  3B7U X;  4F1S A;  4JL0 A;  1D8D A;  3TWS A;  3SO8 A;  3VLF A;  1Q2Z A;  2OND A;  4FLB A;  4KZC A;  4HLE A;  5M72 A;  2IEJ A;  3OXL A;  5JA4 D;  3ZYL A;  5ENP D;  4PS8 A;  3ZYQ A;  2ZGD A;  1OWL A;  4I1O B;  4MBG A;  3HXD A;  1NA0 A;  5LOZ A;  1N4S A;  1PY1 A;  3FU0 A;  3TWT A;  3CQC B;  5KNH D;  5CCL A;  4MLP A;  4U0S A;  1W3B A;  1A17 A;  2F8Y A;  2XRZ A;  1TEZ A;  3E32 A;  5G05 C;  1Y6I A;  3U4T A;  4J8F A;  2RFA A;  3MGB A;  4U8Y D;  3CQG B;  5EKQ D;  2KC7 A;  3G2T A;  4GTS A;  2GRL A;  5ENT D;  5AQ7 A;  2KZT A;  1UJK A;  3ZRH A;  4H7Y A;  2XCC A;  4XKC A;  1HF8 A;  3FUD A;  3UT4 A;  3MV3 B;  2PNN A;  5AQ9 A;  3UXG A;  3ESL A;  2WVI A;  4BES A;  1DNP A;  4AJW A;  3ML9 A;  3Q73 A;  5HRY A;  4Q69 A;  4WWP A;  2HYZ A;  3AG1 E;  4AP2 A;  3FUJ A;  3DSW A;  1BD8 A;  4HRL A;  3VLD A;  2I9C A;  2J4D A;  4LNU D;  3NBN B;  2XEN A;  1S63 A;  4N2Q A;  1MX4 A;  3EIQ C;  3MEK A;  5DIZ A;  2GGF A;  4GMR A;  1N4Q A;  1P5Q A;  5KCM A;  1TYQ G;  1MZC A;  4JA7 A;  2UY1 B;  4GZC A;  2NXP A;  2XPZ A;  4QQI A;  4HXI A;  2GRN B;  2LUH A;  3C98 A;  1HE8 A;  2OV8 A;  3L54 A;  1FVF A;  3JYS A;  3APD A;  5BV1 A;  3PDN A;  2EIN E;  2J9Q A;  3CVY A;  4BEP A;  3APF A;  3D9I A;  1S70 B;  4BSX A;  3ONK A;  4O60 A;  4JPS A;  4WAF A;  1G3N B;  4DX2 A;  2DIW A;  1OXJ A;  5BXO A;  3KAE A;  1U3D A;  2Y69 E;  1FPP A;  4I9E A;  1KPS B;  3RRU A;  3S7J A;  5ITZ F;  3OXF A;  2QC9 A;  3FH8 A;  1H6O A;  2YNQ A;  2R5S A;  4LSZ E;  1O1R A;  3PH0 C;  3DST A;  3KEA A;  5EYP F;  4HOU A;  4UI9 K;  4O1O A;  1YCS B;  5CBN A;  1V55 E;  4HOT A;  2WMN A;  4Q96 A;  1NP7 A;  4GTV A;  5JJT A;  2WB2 A;  5ANL A;  3URZ A;  3B7R L;  3J5P A;  3F6Q A;  4V3I A;  1YMP A;  4YDW A;  4H7X A;  4DX1 A;  2H6H A;  3JXI A;  4YDE A;  1DC2 A;  3T9K A;  1TNU A;  3QKY A;  5FQ6 A;  3ASD A;  3QK0 A;  1IHG A;  4BET A;  1N11 A;  4U0Z A;  2R59 A;  1A5E A;  3NQP A;  5CRU A;  1N0R A;  4I2Z A;  2VJ8 A;  1FT1 A;  2B0O E;  3CVL A;  4DUI A;  4KT6 B;  3FY4 A;  1BLX B;  3FTW A;  4M7C A;  3UM1 A;  2KCV A;  1IKN D;  3CHP A;  4BX9 A;  1SQM A;  2HR2 A;  3FUK A;  1OCZ E;  2KXP C;  1TNZ A;  4ILG A;  5LP0 A;  3Q4A B;  3ASH A;  4RLY A;  3GYZ A;  4IRU A;  3SD5 A;  3LEW A;  1S0P A;  4RSY A;  2IFU A;  4FJY A;  2RFM A;  2CFU A;  2WXG A;  3Q7A A;  1H2T C;  5AAO A;  2R2L A;  4C0M A;  4ANW A;  3JQ1 A;  1FVH A;  3DWL G;  1E8W A;  2QZA A;  1QNF A;  3QWP A;  1JWF A;  4GZ3 A;  2PL2 A;  1ZBP A;  5JJ7 A;  4JEU A;  1E8Y A;  3UUX A;  2X6K A;  5FIO A;  5FZQ A;  4YVO A;  3CGH A;  3HXC A;  4K03 A;  2YQ8 A;  2IY0 C;  3PZ3 A;  5BUZ A;  4FJZ A;  1U2V G;  3PEV B;  3NF1 A;  4HS2 A;  3NOG D;  4UI9 J;  5D0O D;  1OWO A;  5HQ8 A;  4A55 A;  3LYA A;  2X6I A;  3V2O A;  1ELW A;  3KSQ A;  1K3Z D;  2BKK B;  3V79 K;  1UN9 A;  1MJ0 A;  2ETA A;  3J5Q B;  2AW6 A;  4RVB A;  5G55 A;  4IUL A;  4CT4 A;  1HX8 A;  4URK A;  4X8Q A;  3E33 A;  2MOW A;  1QBQ A;  2OVF A;  1E96 B;  5H7P A;  4L7T A;  4DLO A;  3LJN A;  4A1G A;  2VTB A;  3FEX A;  5FJY A;  3LY9 A;  2PQN A;  3R7R A;  4TXQ A;  1DVP A;  3ASF A;  3IKO B;  5LFA A;  3RRM B;  3HXE A;  2ZGG A;  2L9B A;  3SBT B;  2WXL A;  3ULE G;  3TXN A;  1YA0 A;  3HVE A;  3U3W A;  3PRE A;  3GZ2 A;  2GRP B;  4AY5 A;  4E6H A;  5EX0 A;  1TNB A;  3G2S A;  2QYU A;  2DZN A;  1KT1 A;  2RKK A;  2NYJ A;  2IO2 C;  5G04 J;  2CHZ A;  1BI8 B;  2KCK A;  3LY8 A;  3QWV A;  2VTB B;  4JXT A;  3E4B A;  2LXL A;  3R9A B;  5CEC B;  2KCL A;  3LVQ E;  3UIO C;  3APC A;  4CGW A;  3DSX A;  4PS3 A;  3C5R A;  1BI7 B;  1TN7 A;  4CDN A;  4GTR A;  4BER A;  3RKV A;  3UI2 A;  4CYM D;  4G8L A;  2XZD G;  3D9K A;  2Y4T A;  1UOH A;  4BT8 A;  2X6J A;  2X6H A;  4I1A A;  2H6F A;  4UWF A;  2FBN A;  2LAH A;  4EZK A;  3SI5 A;  2WXK A;  3ZPJ A;  2WXM A;  4NQ0 A;  3ZW3 A;  3CST A;  4F6R D;  4FHK A;  4RQI A;  4D10 C;  5AJD A;  1IYG A;  2EIL E;  4G11 A;  1K1B A;  3TWX A;  2ETC A;  4MRU A;  2J08 A;  4N5C A;  2ILR A;  3AS5 A;  4CRW A;  3SGH A;  2LNI A;  3EU9 A;  1E7U A;  4QFV A;  3S7F A;  4GA0 A;  3W9G A;  3ZXP A;  3MYV A;  1TNO A;  3Q15 A;  5B1B E;  3DXK G;  3L22 A;  3VTY A;  4UWG A;  2DYS E;  1DCQ A;  2V5Q C;  5AQA A;  2RG8 A;  4AEZ C;  5KJN A;  3ZYK A;  1L5J A;  3EDT B;  4GCN A;  5JHA A;  4JZY A;  2JLB A;  2IU1 A;  3SNX A;  1PAQ A;  4GMJ A;  5AN8 A;  1NI1 A;  3U64 A;  1AWC B;  4U8H A;  2XRY A;  1U3C A;  1DCE A;  3ML8 A;  3DPD A;  3AG2 E;  1OWM A;  3TWR A;  5KJL A;  3V31 A;  3E37 A;  3G2V A;  5FTP A;  3FU5 A;  2R05 A;  4G26 A;  2R17 C;  3CVP A;  5D2M C;  1HG2 A;  3S7B A;  4BX8 A;  5LCW J;  3NZU A;  2C0M A;  4HLL A;  2V5F A;  3B13 A;  1K1A A;  5JHB A;  2PM7 A;  4GA2 A;  2RD0 A;  4AXH A;  3Q49 B;  4J8D A;  4F1P A;  4G2V A;  2EIK E;  3D9O A;  3ISM C;  1O1S A;  4PUC A;  4HOQ A;  1OY3 D;  2I2O A;  1EF1 C;  1LTX A;  4EPZ A;  4LCT A;  2P58 C;  4KZ0 A;  3D9L A;  2WQ6 A;  2AWI A;  4JEH A;  5CEA A;  2XEH A;  2P9P G;  2XCB A;  2YHE A;  3CHM A;  5BPP A;  4XIF A;  2XZT G;  5EIL A;  4JVS A;  3UMV A;  3QAQ A;  3RAU A;  4C0E A;  4G1T A;  4XEI G;  3RRN B;  4K0R A;  3EHN A;  1Y8M A;  3ZVV A;  4GCO A;  4HNA D;  2X38 A;  3DEO A;  4N3A A;  5KNG A;  1WDY A;  4I1M A;  1IXV A;  4LER A;  1SZA A;  3ZIM A;  5HS0 A;  3UT8 A;  4JA9 A;  3FHE A;  3ZEF A;  5ANR A;  3AG4 E;  3UT7 A;  5D0Q D;  3OAW A;  5FZS A;  3DPY A;  4EBA G;  2GW1 A;  4DX5 D;  1QQE A;  1H19 A;  4KVO A;  1HG5 A;  1NZN A;  3FH5 A;  5AIJ A;  4LG6 A;  3TJP A;  1HS6 A;  4UI9 C;  4AIF A;  3WXX A;  2E0I A;  5AJL A;  3UKU G;  3CIA A;  2KBX A;  4PH4 B;  4G8K A;  1H2U A;  3C3O A;  5G2N A;  4ANU A;  1N9A A;  2CHX A;  3ZYM A;  1E8X A;  2CHW A;  1OWP A;  1OWN A;  1HH8 A;  3ASO E;  4LRZ A;  4GTT A;  4ABN A;  3FTZ A;  4HVB A;  4FUL A;  2WXP A;  4YVQ C;  3MKQ B;  3C3Q A;  2ZU6 B;  4I2W A;  1O1T A;  4O6F A;  2I1K A;  5EN5 D;  4MS6 A;  2I6H A;  3EHQ A;  2VGY A;  5FIN A;  1TNY A;  4AV7 A;  2VSO E;  4UUC A;  2VGX B;  1H6P A;  5ARF A;  4KBQ A;  1TJF A;  1ELR A;  2QY7 A;  2XPI A;  5CER B;  4JHR A;  1Z3X A;  3EU5 A;  3FU3 A;  3Q5M A;  3LDZ A;  4FC8 A;  3ZUV B;  1UJJ A;  2VSY A;  4CCA A;  3AU5 A;  2XGS A;  3D9H A;  3ESK A;  1ELK A;  4AVX A;  1UN8 A;  2R03 A;  4BTA A;  2I1J A;  2L6J A;  2AXU A;  3B7B A;  2V0P A;  1JCQ A;  4Q94 A;  5G04 C;  4ATG A;  3W9F A;  1H2V C;  5AYW D;  4U95 D;  2JAB A;  1O5M A;  3UTM A;  3TWU A;  2P9L G;  3ABL E;  5IY5 E;  3MKR A;  3ZXS A;  4AM9 A;  3U66 A;  4M3O A;  2H6I A;  4OVU A;  4WWO A;  3FUE A;  4WNG A;  3O48 A;  2GRM A;  4OVV A;  4KYO B;  3R9M A;  4ANV A;  3RIB A;  3CK7 A;  3MA5 A;  2WPV A;  1X81 A;  3PNT B;  2DCP A;  3B95 A;  5DBK A;  4G25 A;  2IQC A;  4HFG A;  1TN8 A;  3TAX A;  1OT8 A;  2FO7 A;  3IEG A;  2GRO B;  2L0I A;  2FF4 A;  4GML A;  3QDN A;  3G2W A;  5FZR A;  4ACK A;  2BED A;  5CED B;  4FU3 A;  3E30 A;  3FDH A;  1JWG A;  3CVW A;  3TXM A;  4NRH B;  3UIP C;  5BXU A;  4I6G A;  1KT0 A;  3PE3 A;  5AEN A;  4ZFH A;  4P29 A;  3PZ4 A;  3CHR A;  4TUU A;  2OCC E;  2ETB A;  1JCR A;  3G2U A;  5ENR D;  4LNB A;  4U07 A;  2XEE A;  3JUE A;  4I17 A;  2XGM A;  4EBA A;  1JCS A;  2P9S G;  3PEU B;  3ZKJ A;  2WXN A;  4O1P A;  4YDO A;  4J6I A;  5FQ7 A;  1LF8 A;  5G05 J;  2P9K G;  3E34 A;  1IQR A;  3HYM B;  4UWK A;  4KXK B;  3LPZ A;  4WUY A;  1EYH A;  3ULY A;  3UM2 A;  3FUI A;  4NUR A;  2V8S E;  1PC2 A;  4IN3 B;  5C1D A;  3UPV A;  4XI9 A;  4K5C A;  3FTS A;  3S7D A;  3SQV A;  4DPR A;  2AXV A;  3TWQ A;  2LAI A;  1MYO A;  5ENS D;  2LO6 A;  5AQB A;  5EYL A;  4BTB A;  4DLQ A;  3FH7 A;  4F53 A;  4DX6 D;  4DI4 A;  3SBS A;  4EZJ A;  1E8Z A;  2ZIR A;  3SFX A;  4HRM B;  3CVX A;  3I4R B;  3SF4 A;  4OAV B;  4CT0 A;  2LSU A;  4FA6 A;  3UM0 A;  4HB5 A;  4N5Q A;  2ION A;  3P1U A;  3IV0 A;  1IHB A;  2Y4U A;  4WNF A;  2C2L A;  3RO2 A;  3V30 A;  2Y3A A;  2DVW A;  1H0A A;  3QOU A;  4XZ4 A;  2MRI A;  3GW4 A;  5EDS A;  4K5B A;  3L13 A;  3UIN C;  4JB8 P;  1HO8 A;  2VYI A;  3CVU A;  5AAR A;  5CRV A;  4L2Y A;  4FP7 A;  4ANX A;  3ZU7 B;  2MHK A;  3QWW A;  2UY1 A;  2WMO A;  2WXI A;  2DWZ A;  2ZXW E;  2AVP A;  3PZ1 A;  4XE0 A;  3CSF A;  2EIM E;  4DJA A;  2FUL A;  4EHM A;  4U04 A;  5E75 A;  4F3V A;  4Y6W A;  3T8M A;  4K5A B;  2CG2 A;  2M63 A;  2FI7 A;  2A5E A;  4I9C A;  3L9T A;  5LX8 A;  3ZHE B;  4GTM A;  2Y1L E;  3C72 A;  3QC1 A;  4YND A;  3PZ2 A;  2IF4 A;  3HG0 D;  5CMY A;  1MX2 A;  3FTV A;  2QYJ A;  4KVM A;  4UQX A;  4E85 A;  3ABK E;  2XEV A;  1RZ4 A;  3L08 A;  3RU0 A;  4U96 D;  2CG3 A;  5J08 A;  4BT9 A;  4NIK A;  4XI0 A;  2X3M A;  3IXE A;  3WG7 E;  2KZT B;  2B6C A;  2NC9 A;  3TG4 A;  1ZB1 A;  2YHC A;  3CR3 A;  3AS4 A;  2P9U G;  1TJC A;  4JHJ A;  3S2A A;  2V4H C;  1VDY A;  4BWR A;  4B8A A;  4BSZ B;  3ZGQ A;  4APF A;  2J09 A;  3NAW A;  3AJI A;  1MX6 A;  1LD8 A;  1SVX A;  2JEK A;  3Q78 A;  2BUG A;  2PQR A;  1E7V A;  1SW6 A;  1WAO 1;  3CVN A;  1LD7 A;  4EQF A;  1SZ9 A;  3DEP A;  4CZ2 D;  3L82 A;  4A3T A; 
#chains in the Genus database with same CATH homology
 4G8K A;  3KEA A;  4K5A B;  3EU9 A;  5EYP F;  4DRX E;  2ZGG A;  2XZT G;  5KBA A;  1NFI E;  4QFV A;  3TWV A;  4O1O A;  2A5E A;  1YCS B;  2PNN A;  5CBN A;  1N0Q A;  5D66 A;  2Y0B G;  2P2C P;  4TUM A;  5EIL A;  3W9G A;  5EIB E;  2J8S D;  5AQ9 A;  4K5C A;  2Y1L E;  3UXG A;  4GPM A;  4BES A;  3B95 A;  3J5P A;  3Q9N C;  4J7W A;  3TWQ A;  1MYO A;  5ENS D;  5HRY A;  3F6Q A;  1DCQ A;  1YMP A;  2V5Q C;  2MYO A;  5FIO A;  1OT8 A;  3HG0 D;  2DZN A;  4HI9 A;  5AQB A;  5AQA A;  5JMN D;  5EYL A;  1BD8 A;  1MX2 A;  4HRL A;  4YDW A;  4HRN A;  2NYJ A;  4DX1 A;  4B93 B;  4HI8 A;  4DX6 D;  3NOC D;  4HNA D;  4LNU D;  1BI8 B;  2QYJ A;  4Z68 A;  3JXI A;  3DEO A;  3Q9U C;  3NBN B;  1DC2 A;  2XEN A;  4HRM B;  3T9K A;  5EN5 D;  5KNG A;  3TWS A;  1MX4 A;  3SO8 A;  1WDY A;  4GMR A;  5AN8 A;  1IXV A;  3NOG D;  3EHQ A;  4OAV B;  5ENO D;  5HS0 A;  4U96 D;  4BET A;  1AWC B;  1N11 A;  5CED B;  5FIN A;  5CEC B;  4HB5 A;  4NIK A;  4BEP A;  5JA4 D;  4UUC A;  1QYM A;  3TWR A;  3V31 A;  4N5Q A;  5BXU A;  1A5E A;  3IXE A;  4QQI A;  1N0R A;  4J8Y A;  3C5R A;  1BI7 B;  5ENP D;  1IHB A;  3V2O A;  2F37 A;  4ZFH A;  3V2X A;  2B0O E;  2ZGD A;  4BER A;  3V30 A;  1YYH A;  4DUI A;  5CER B;  1K3Z D;  1BLX B;  2DVW A;  3UI2 A;  4ATZ D;  2FO1 E;  1TR4 A;  2BKK B;  4CYM D;  3V79 K;  3ZUV B;  1MJ0 A;  4YDY A;  1D9S A;  3HRA A;  2ETB A;  4K5B A;  1IKN D;  4G8L A;  4HLL A;  2V4H C;  2XZD G;  4JB8 P;  2ETA A;  3JXJ A;  1S70 B;  3TWT A;  3AAA C;  3J5Q B;  3D9H A;  2DZO A;  5KNH D;  4DX5 D;  1K1A A;  4BSZ B;  4U8V D;  5ENQ D;  2HE0 A;  1UOH A;  2F8Y A;  2KXP C;  4O60 A;  2VGE A;  5ENR D;  5KWD A;  1AP7 A;  4HQD A;  1G3N B;  4DX2 A;  5EID A;  4OAU C;  3TWW A;  5BXO A;  5AAR A;  2XEE A;  3AJI A;  4RLY A;  1MX6 A;  3JUE A;  4F1P A;  1SVX A;  1BU9 A;  3B7B A;  3ZU7 B;  2AJA A;  3W9F A;  3ZKJ A;  4LG6 A;  2RFA A;  4O1P A;  5CBO A;  1WG0 A;  4U95 D;  1SW6 A;  4F6R D;  4U8Y D;  1OY3 D;  2JAB A;  5ITZ F;  4HBD A;  3ZNG A;  2DWZ A;  2F8X K;  3UTM A;  3LJN A;  3TWU A;  5HKP A;  2QC9 A;  4C48 B;  1K1B A;  2L6B A;  2RFM A;  5ENT D;  4DX7 D;  3DEP A;  3TWX A;  5AQ7 A;  2ETC A;  4A63 B;  3T8K A;  3EHR A;  2BKG A;  4CZ2 D;  4ZHB A;  5CEA A;  2XEH A;  2KBX A;  4LSZ E;  5AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...