2XZDG

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
DLGKKLLEATRAGQDDEVRILMANGADVNAMDDAGVTPLHLAAKRGHLEIVEVLLKHGADVNASDIWGRTPLHLAATVGHLEIVEVLLEYGADVNAQDKFGKTAFDISIDNGNEDLAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3
total genus 36
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2xzdG00
3JXIA 3DEPA 4BETA 3TWRA 2JABA 2FO1E 2DWZA 1DC2A 3C5RA 2V4HC 5ENPD 3HRAA 3T9KA 2ETCA 4OAVB 3KEAA 3UTMA 5ENQD 4K5BA 4LSZE 2KXPC 2XENA 3AAAC 3V2XA 1TR4A 5EN5D 3W9GA 1N0QA 3EHQA 5AN8A 4DRXE 4UUCA 1K3ZD 4J8YA 4NIKA 3HG0D 4DX5D 2AJAA 4HBDA 5CBOA 1BLXB 4CZ2D 4Z68A 5CERB 3NBNB 1IHBA 5AQBA 1BU9A 1S70B 5D66A 3TWSA 4BEPA 4G8KA 5BXUA 4HB5A 5FINA 3TWVA 2Y1LE 2QC9A 3V79K 1WDYA 3NOCD 4J7WA 4YDYA 1OY3D 2B0OE 5EIDA 2A5EA 2XZDG 4HQDA 2Y0BG 1YYHA 4GPMA 1BI8B 2VGEA 2XZTG 4HLLA 4CYMD 5ENRD 5CEAA 2RFAA 4HRNA 3UI2A 1D9SA 3V31A 4U8YD 1MYOA 4QFVA 1BD8A 4ATZD 3EU9A 2F37A 2KBXA 4HRLA 1G3NB 4LG6A 1MX2A 1MX4A 2HE0A 3Q9UC 4HNAD 5HS0A 3ZU7B 4C48B 5ITZF 2J8SD 1N11A 5KWDA 4GMRA 3B95A 3ZNGA 5CECB 3ZKJA 4B93B 1IXVA 5KBAA 4O1PA 3D9HA 4DX7D 2L6BA 5ENOD 5KNGA 1WG0A 4O1OA 2BKGA 3T8KA 4DX6D 4K5AB 3Q9NC 1YCSB 2NYJA 3F6QA 2ETBA 3J5PA 5ENSD 5AQAA 3TWTA 4DX1A 1YMPA 3V2OA 5BXOA 4DX2A 4O60A 5HRYA 1SVXA 4DUIA 1A5EA 5AQ9A 3EHRA 4K5CA 4BSZB 4JB8P 5CEDB 3TWWA 5KNHD 3ZUVB 4OAUC 3NOGD 3JUEA 5HKPA 1MX6A 2MYOA 3UXGA 3SO8A 2V5QC 4YDWA 4QQIA 5FIOA 3J5QB 3AJIA 1K1BA 4TUMA 1AP7A 1OT8A 1DCQA 1K1AA 5AARA 3V30A 4ZFHA 1IKND 5AAOA 2QYJA 5EYPF 5EYLA 3TWXA 4A63B 2F8YA 1MJ0A 1UOHA 2DZOA 4N5QA 1N0RA 5JMND 3W9FA 3B7BA 5EILA 3LJNA 2RFMA 2BKKB 4HI8A 4U8VD 5CBNA 1SW6A 4HI9A 3IXEA 3TWUA 1AWCB 2P2CP 4F6RD 2DZNA 4U95D 2PNNA 3DEOA 4G8LA 1NFIE 3TWQA 4BERA 4LNUD 2DVWA 4RLYA 4U96D 5AQ7A 4HRMB 2ZGDA 4F1PA 4ZHBA 2XEHA 2ZGGA 5ENTD 4BESA 2XEEA 1BI7B 5EIBE 5JA4D 2F8XK 1QYMA 2ETAA 3JXJA
chains in the Genus database with same CATH superfamily
3G2SA 4ACLA 3MV2B 3PUKA 2ETCA 3DBSA 2XENA 1E8YA 4I43A 4NIKA 4EZKA 3JCKC 2AJAA 3ZGQA 1H19A 1E7UA 4G8KA 2LAIA 3TWVA 3V79K 1HXIA 2B0OE 5LFAA 3HXFA 1BI8B 4UI9C 1E7VA 4CYMD 4EQFA 3ISMC 4RG9A 4FJZA 1TN7A 3D3MA 2YINA 4I6JA 4B93B 1IXVA 1N4RA 3VTYA 3PEUB 5ENOD 3Q73A 2LAHA 2NYJA 2ZU6B 3VLEA 3LKUA 3ZPJA 3ZUVB 5CRUA 4I17A 2LSVA 2WXGA 4DI3A 2KCLA 3MCXA 4I9CA 1N4QA 3ZXPA 3I5PA 4U0ZA 1ELKA 1N0RA 1TNYA 4I6EA 4BX9A 3CVLA 3MV3B 5CHEE 3Q15A 2J08A 2DVWA 2GGFA 4I2WA 4XEIG 3QAQA 2F8XK 3SGHA 3IKOB 4BX8A 4M3OA 4W9RA 2V4HC 5CCMA 4F3VA 2I2OA 3LDZA 4I1OB 3C3RA 4F53A 4TXPA 5ANRA 2WMOA 2M63A 4WNGA 3B7SA 3FFLA 2OEWA 2IF4A 2XPYA 2IQCA 3FUKA 5CCLA 1OCZE 5G05J 4E6HA 3NQPA 3RO3A 3UIOC 2ILRA 2F37A 3FUNA 3APDA 1XNFA 2DCPA 4AVXA 4U0SA 5FQ7A 1OCRE 5KNGA 4O1OA 4WUYA 3RRUA 3T8KA 2WXPA 5AQAA 1SZ9A 2VSXE 2PM7A 3LVQE 3LY9A 3Q79A 2EINE 4I1MA 4OAUC 2IU1A 3UUXA 1ZB1A 5J08A 2V4LA 2VSYA 3V30A 4ZFHA 2X6HA 3QKYA 1JPLA 5D0OD 1KZOA 1HG5A 4AXHA 1AWCB 3FH7A 4LNUD 2ZGGA 2P9KG 3SZ7A 3UQ3A 1JCSA 3DEPA 3CHMA 3PEVB 1TN6A 3E4BA 3OTNA 3KEAA 4LSZE 2KXPC 5AN8A 5J90A 4J8YA 1H2TC 2GRNB 3BG1B 5FINA 5BV0A 3APFA 1UN9A 3CSFA 4IULA 1D8DA 4HRNA 1OCCE 2UY1B 4U8YD 1MYOA 1BD8A 1TJFA 1Z5SC 3RO2A 4JHJA 2HE0A 3LY7A 3ZKJA 2FI7A 5A23A 2L6BA 5LCWJ 3CVWA 1W3BA 4XI9A 2B6CA 1SVXA 5AYWD 3EHRA 4WWOA 1UJKA 4JB8P 3ZYMA 2R05A 3TWWA 3UXGA 3ASDA 1AP7A 1OT8A 1DCQA 3NF1A 3RK6A 3CQCB 2P9UG 2QYJA 3DSSA 5EYLA 3LJ3A 5BV1A 4MS6A 4A1GA 3CHSA 4K03A 3DRAA 3CVNA 4FLHA 4JEHA 3N71A 3KSQA 4HOSA 4Q94A 1EYHA 2NSZA 4LERA 3L17A 3GW4A 5T8IA 3QOUA 4N39A 3O48A 3JXIA 1TN8A 4UQYA 1NL4A 2XEVA 4DJAA 2EILE 1IQRA 2HR2A 3OXLA 5EN5D 1IHGA 2KZTA 2DBAA 1KT0A 4J8EA 2WB2A 2JEKA 1HE8A 4JVSA 4N3BA 4YDOA 3RU0A 1L5JA 4GTVA 5FZQA 3C3QA 4V3IA 2AW6A 3MJWA 1H6OA 5ENRD 1XGWA 3AG4E 2A5UA 1QQEA 4QFVA 3Q75A 2YHEA 2FBNA 2HO1A 3AG1E 4F7AA 2P9LG 2V5FA 5G55A 3LY8A 4DX7D 3ZYLA 2GROB 4UWGA 1Z3YA 4U8HA 2MOWA 4YVOA 3ZYKA 2XS1A 3JUEA 2CG2A 3B7TA 2XGMA 5AAOA 4A63B 4R7LA 4TUUA 3SBTB 4HI8A 5CBNA 1KPSB 3FDHA 4JA7A 3LCAA 4P29A 4EBAA 2RD0A 2WXJA 2WXFA 3ESKA 4RLYA 2XHEA 3BU8A 3AS4A 1LD7A 4C0MA 4EBAG 3CR3A 4JHRA 1KZPA 1RW2A 4ATGA 2CHZA 2LXMA 2XQ0A 3HYMB 2WXQA 2WXNA 3DWLG 2GRPB 2YNQA 4NURA 3AAAC 2VSNA 2WXMA 2GRLA 3EHQA 1TNBA 3JYSA 3PH0C 3S7FA 2HM8A 5AJLA 4GA2A 3G2WA 3EHMA 4UWLA 5D66A 2VTBA 4U63A 4KXKB 4J7WA 4HQDA 2X6IA 4GPMA 2Y69E 3QARA 3DXKG 3L6AA 4AP2A 5ARFA 5EX3A 4HNAD 4U0UA 5CECB 4ANWA 3TXMA 4L9PA 4GTQA 3WXXA 4HVBA 3B7RL 3QB2A 3ULEG 3PZ1A 1TYQG 4GPKA 5CEDB 3U64A 4FA6A 3SY2A 1N4PA 3LEWA 2WXRA 4GTTA 3GZ1A 5M72A 2J09A 2VJ8A 3Q49B 1JUQA 5ENNA 4URKA 4BT8A 5EILA 2BKKB 1N9AA 5EKQD 1FVHA 4BFRA 3S7BA 2UY1A 3JUIA 3PVLA 3PREA 2ZGDA 4ZHBA 3MGBA 2VTBB 1N54A 3QWVA 3PE4A 2OV8A 2L0IA 2XGSA 1S0PA 3HXDA 4TRQA 2JABA 3APCA 2FO1E 5JHAA 4CDRA 4FLBA 3FTXA 4OAVB 4GAAA 1IYGA 1N0QA 3ASFA 2F0YA 1U3DA 3KEZA 1A17A 3C3OA 3HG0D 3SHFA 1IHBA 3TWSA 2QC9A 1E8ZA 1GW6A 3ZHEB 1JWGA 1D8EA 2RFAA 3BQOA 4YVQC 1ELRA 1HF8A 4LRZA 2UWJG 3O4ZA 4ATZD 4LG6A 5JJ6A 3UT8A 2I1JA 4JD2G 1FCHA 3MA5A 2LXLA 5B1BE 4B8AA 3UPVA 3S7JA 5BXOA 4G11A 2ZISA 2LNIA 2PZIA 1ZU2A 5DBKA 4JA9A 4DLQA 2EIME 1NP7A 3CVQA 3RAUA 3T5VA 5AARA 3CVYA 3S2AA 4GU5A 1SQMA 5FJYA 4CRWA 2KCVA 3MKRA 3SFZA 2YQ8A 3FTVA 2WPVA 2XEHA 1BI7B 2KCKA 3EIJA 1V55E 3HIZA 4APOA 1DC2A 5E76A 3GZSA 4K5BA 2P9NG 4GZCA 3PZ2A 4G2VA 2J49A 4GZ3A 1EDUA 5CERB 2GW1A 2PQNA 2QFCA 1JCQA 4XI0A 1MQSA 3CV0A 4J6IA 1TEZA 3HXBA 4N2QA 4JPSA 4HLLA 4Q96A 4BWRA 3LPZA 3MEKA 3V31A 2XCBA 2HYZA 2BF0X 4JC8A 3D9PA 3HVEA 5KJLA 4H7XA 4EZJA 4AY5A 4GB9A 5ENSD 3FU6A 3KD7A 3IBEA 4DX2A 3CVPA 3D9OA 4XKBA 4FHKA 3E37A 5JJTA 1ZBPA 1HO8A 4XKCA 1K1BA 4XE0A 3CVUA 2WXOA 5BNWA 1QNFA 1OWPA 3K9IA 1SW6A 1OWOA 3QC1A 2KZTB 4AEZC 4O6FA 4D10C 4HRMB 3QDNA 5JA4D 4LNGA 1TJCA 4ANXA 3SFXA 2GRRB 2QY7A 1LD8A 4DI4A 3C5RA 3JQ1A 3GYZA 3HXEA 4MBGA 2J4DA 4FJYA 4GYYA 2EIKE 3Q5MA 4DRXE 3E34A 3FUIA 3FUHA 5CBOA 3BG0B 3Q7AA 5BW8C 4CDNA 1BU9A 3AS8A 4C0EA 3ZYQA 4HB5A 4KMOA 2XCCA 5JJ7A 4JHKA 1EF1C 2FO7A 5CEAA 3TGOA 1PAQA 3UI2A 3ZW3A 4KVOA 3PZDA 3FTZA 3SQVA 3ZU7B 4FADA 2J8SD 3PNTB 4O1PA 1X81A 4G23A 5BT1A 1INZA 3DPDA 2ETBA 4DX1A 3ULYA 3AG3E 4BT9A 5ARGA 2IFUA 3E30A 3FUEA 1H2UA 3C98A 4TXQA 1WM5A 3CVXA 1E96B 3ML8A 3ZIMA 3TG4A 4A3TA 3QWPA 4K0RA 3FP3A 1N4SA 5ANLA 4PS7A 4GTOA 3CGHA 1UW4B 4PH4B 1S64A 4PS8A 4WNDA 2IOSA 3IHVA 1U3CA 2P2CP 3NZSA 3DSWA 1HU3A 4KT6B 4L2YA 4F1PA 5FT9A 3TL5A 4NRHB 5ENTD 4BESA 2CFUA 1QYMA 4I9EA 3MKQA 3UINC 2R2LA 2PQRA 4ME2A 5FQ8A 5HQ8A 4APFA 4DLOA 4B8CB 3FUJA 4FP7A 3PRZA 4J8DA 5EDSA 3UMVA 4UUCA 3UKRG 4HOTA 2WMNA 4ILHB 4BY6A 1OWNA 1TNUA 5EX0A 2AXUA 4KYOB 2Y0BG 3FUFA 2XZTG 3UT7A 3PE3A 4UI9J 3OAWA 4JEUA 2EIJE 1V54E 3EDTB 1MX4A 2EQXA 5G2NA 3TXNA 2I1KA 3UM2A 3D9IA 1UG3A 5LCWC 1E90A 3V2OA 3I3NA 1HS6A 2GRMA 5A7DB 3D9NA 4CGWA 1A5EA 3LXUX 2R02A 3TG5A 3OXFA 3FU0A 4G24A 5HKPA 3FEYA 1H2VC 4AIFA 4EECA 2ZXWE 4HOQA 4WWPA 5EYPF 1HG2A 1MJ0A 2DZOA 2FF4A 4G25A 4JL0A 4U8VD 2RFMA 2VGXB 1OUVA 3FH8A 3G2VA 4I1AA 2AXZA 4OYSA 3L13A 3TWQA 2GRQB 4UWKA 4E85A 2Q7FA 4GTSA 4RQIA 3B13A 1NA3A 2V8SE 4B89A 1HX8A 1N94A 2X3MA 3AU4A 5ENPD 5LOZA 4RSYA 2VGXA 4CEMA 2Y4UA 3ML9A 4HOUA 3ZRHA 3ABLE 2DYSE 1SA4A 1K3ZD 4NQ0A 3T5XA 4HBDA 3G2UA 3ZVVA 1JWFA 1U2VG 2XRYA 3KAEA 3URZA 3FUMA 1S70B 3EUVA 2IEJA 2Y1LE 5BUZA 3PZ3A 4EPZA 1Q2ZA 2Y4TA 3FWVA 2CHWA 2P9SG 2P9PG 4B0ZA 1FPPA 1MX2A 5HS0A 3RRMB 4GMRA 3B95A 3CQGB 2XGOA 4KVMA 1WG0A 1E8XA 2XPIA 3MZLB 3PZ4A 4K5CA 4HFGA 3HDXA 2CHXA 4LUNU 1N52A 4TUMA 4ACKA 1ELWA 4EZLA 5FZSA 4WAFA 3X2QE 4F6RD 3FULA 4L23A 3L22A 1O1TA 2WM9A 3SF4A 2OEVA 3FU3A 5JHBA 1OWMA 4N2SA 2E2EA 1FT1A 2J9QA 2IONA 2X6FA 3C72A 5CMWA 3E33A 3CIAA 1NI1A 2OOEA 3ZFWA 2XRZA 1B89A 2IJGX 4N5CA 3CSTA 2H6IA 2R03A 2WQHA 3NBNB 5BXUA 1WDYA 1UN8A 3IV0A 4U07A 1OY3D 4BTAA 1YYHA 1DCEA 5D2MC 2C0LA 3DSXA 1D9SA 1MHQA 3ABME 3ONKA 3LVRE 2J4BA 2WXIA 4C48B 1DVPA 3ZNGA 3ENEA 4BSXA 2FULA 2QZAA 2WXLA 2P9IG 2MHKA 4GCNA 2BEDA 4RVBA 4U04A 4JXTA 1BPOA 3VLDA 1MX6A 2MYOA 5FIOA 4CDMA 2KM4A 3CK9A 4UI9K 5CMYA 1E8WA 2H6GA 3ZXSA 2DYRE 3PDNA 4ABNA 1X5BA 4J8FA 2OCCE 3UM3A 4PDXA 4GA0A 4A1SA 1IKND 2V0PA 3PUJA 1NZNA 4GZ6A 2R17C 4FHJA 1Y8MA 1QBQA 1Z6TA 4J8SA 3T9KA 3FY4A 3UTMA 3DSTA 4G1TA 4DPRA 4RG6A 3FHEA 4WWNA 2E0IA 1H6PA 1YA0A 1TNZA 4GTRA 3CVVA 4CZ2D 4BTBA 4FULA 2R59A 4ANUA 3AU5A 5AENA 5G04C 4NACA 1HZ4A 2XZDG 1K8KG 3BUAA 3Q47B 3FU5A 4UWFA 4WNFA 2RG8A 3FUDA 3CHRA 1DNPA 1TNOA 5ITZF 1LF8A 3D9HA 3SI5A 4K5AB 1YCSB 4B94A 2YHCA 3J5PA 4OVVA 4O60A 5LP0A 4C9BB 4AJWA 2X6JA 3RJVA 2IO3C 3CKBA 4GA1A 3I4GA 4G26A 4ILGA 3D9LA 3IHYA 3QK0A 4AY6A 2VGYA 4JZYA 3ABKE 2F8YA 1N95A 4N5QA 2A4ZA 3IEGA 5JMND 3W9FA 2OVBA 3L54A 3E32A 3Q78A 3UX4A 3ESLA 5KCMA 2DIWA 4IN3B 5EIBE 1MZCA 3NAWA 5D0QD 2ETAA 5FZRA 4BETA 2DWZA 2IO2C 3B7UX 3HRAA 4LNBA 4IRUA 3D9JA 2WXKA 2WQ7A 2AWIA 3FTYA 3V2XA 1TR4A 1RZ4A 1PY1A 2J07A 3LS8A 3D9MA 2H6HA 3L08A 1O5MA 4ANVA 5H7PA 4GTMA 4WNEA 5KJMA 3EU5A 3NOCD 1KLXA 5G05C 3OXGA 1FT2A 2WXHA 3R9AB 3SFYA 3PS6A 1FVFA 3EU9A 3T8MA 1VDYA 4MKTA 4FC8A 3KS2A 5KWDA 4CGVA 4Q69A 2H6FA 3F6QA 3TWTA 4TV3A 1YMPA 3MX3A 2IY0C 5AQ9A 3RRNB 3U66A 4J0UA 2IOLA 5KNHD 3KSLA 3SO8A 3AS5A 2XPZA 4YDWA 4QQIA 3J5QB 3Q4AB 1PC2A 1UJJA 4XIFA 1HFAA 4KZCA 4AV7A 3ASOE 2MRIA 2WQ6A 2WVIA 1IQUA 4OVUA 3I4RB 3LJNA 4HI9A 4L2LA 2CFZA 3R9MA 3RKVA 5AQ7A 3P2BA 3HVEB 4HORA 3JXJA 3FTWA 4HS2A 4CT0A 2NXPA 4YNDA 3FH5A 3DXMG 1WY6A 5ENQD 4GTPA 4UQZA 3DSUA 3UM0A 1H0AA 3CHOA 3LYAA 2JLBA 3UKUG 3NZUA 5HI7A 4ILIA 3FTSA 4DX5D 4GMJA 3GZ2A 4H7YA 4GCOA 4Y6CA 3S7DA 2AVPA 4UWHA 4BEPA 3RIBA 5EIDA 4AM9A 3HXCA 4MLPA 4N3AA 2KBXA 3Q9UC 1N11A 3HHMA 5FQ6A 3CEQA 3Q9NC 2P58C 3QJZA 5T3RA 2FEZA 1OXJA 2X38A 4DUIA 4CT4A 4AOFA 3NB2A 2I6HA 5B3SE 2CG3A 1QZ2A 1O1RA 3SBSA 4KZ0A 1LTXA 3EHNA 3ZEFA 4GMLA 4GZDA 4X8QA 3TWUA 1P5QA 5AJDA 3DEOA 2ZIRA 4G8LA 1OWLA 4XZ4A 3P1UA 4BERA 3CHQA 3U9WA 1Z3XA 3ONLA 5A6CA 4HLEA 3TWRA 1JCRA 2C0MA 3EJNA 2AXVA 2PL2A 5LX8A 3D9KA 5E75A 2R5SA 4PS3A 5B1AE 2LSUA 4EHMA 4Z68A 1EPUA 3ASHA 5AQBA 4YDEA 4L1BA 4F1SA 5KJNA 3UIPC 3EIQC 3UT4A 3R7QA 3WG7E 4IYPA 2A5EA 1H6KA 3L82A 3VTXA 2VGEA 1WAO1 1Y6IA 3SNXA 3ULQA 4DK5A 1HH8A 1NA0A 4HRLA 3U3WA 5BPPA 2L9BA 5KBAA 5FQ4A 3L16A 3ASGA 3MKQB 3L9TA 5DIZA 5HRYA 2VYIA 4HXIA 3FTUA 2KC7A 4LEUA 3AJIA 4KBQA 4UQXA 2L0TB 5C2YA 3SD5A 2QYUA 3QNKA 1KT1A 3ZHEA 3DPYA 4N3CA 4GZ5A 3QWWA 2DZNA 2BTDA 3ZN3A 4U95D 1NFIE 1OCOE 4U96D 4FU3A 4Y6WA 2L6JA 4I6GA 2NC9A 3PNLB 4A3VA 5G04J 2PM6A 5CRVA 2Y3AA 3MYVA 3Q7FA 4PUCA 1SA5A 4JW1A 3W9GA 5FTPA 4L7TA 3TJPA 4M7CA 3TAXA 3CK8A 4GYWA 2LUHA 2C2LA 3FEXA 4GYOA 4MRUA 4I2ZA 1BLXB 3R7RA 3CHPA 4YDYA 5C1DA 4XX5A 2OVFA 4U7EB 5KJKA 3UM1A 3JQ0A 2ONDA 5T4YA 1G3NB 4TXRA 5AIJA 3ASNE 3BEEA 3AG2E 2BKGA 4DX6D 2I9CA 3VLFA 2XS8A 2VSOE 3CK7A 5FWQA 2X6KA 1SZAA 4BSZB 1S63A 2RKKA 1O1SA 3DSVA 3NOGD 2V5QC 2BUGA 1K1AA 3RSEG 2VQ2A 3TWXA 1UOHA 3B7BA 4LCTA 2KATA 3IXEA 2PNNA 3CLJA 5IY5E 4A55A 3U4TA 2LO6A 3CKCA 2XEEA 4CCAA 3G2TA
chains in the Genus database with same CATH topology
3JXIA 3DEPA 4BETA 3TWRA 2JABA 2FO1E 2DWZA 1DC2A 3C5RA 2V4HC 5ENPD 3HRAA 3T9KA 2ETCA 4OAVB 3KEAA 3UTMA 5ENQD 4K5BA 4LSZE 2KXPC 2XENA 3AAAC 3V2XA 1TR4A 5EN5D 3W9GA 1N0QA 3EHQA 5AN8A 4DRXE 4UUCA 1K3ZD 4J8YA 4NIKA 3HG0D 4DX5D 2AJAA 4HBDA 5CBOA 1BLXB 4CZ2D 4Z68A 5CERB 3NBNB 1IHBA 5AQBA 1BU9A 1S70B 5D66A 3TWSA 4BEPA 4G8KA 5BXUA 4HB5A 5FINA 3TWVA 2Y1LE 2QC9A 3V79K 1WDYA 3NOCD 4J7WA 4YDYA 1OY3D 2B0OE 5EIDA 2A5EA 2XZDG 4HQDA 2Y0BG 1YYHA 4GPMA 1BI8B 2VGEA 2XZTG 4HLLA 4CYMD 5ENRD 5CEAA 2RFAA 4HRNA 3UI2A 1D9SA 3V31A 4U8YD 1MYOA 4QFVA 1BD8A 4ATZD 3EU9A 2F37A 2KBXA 4HRLA 1G3NB 4LG6A 1MX2A 1MX4A 2HE0A 3Q9UC 4HNAD 5HS0A 3ZU7B 4C48B 5ITZF 2J8SD 1N11A 5KWDA 4GMRA 3B95A 3ZNGA 5CECB 3ZKJA 4B93B 1IXVA 5KBAA 4O1PA 3D9HA 4DX7D 2L6BA 5ENOD 5KNGA 1WG0A 4O1OA 2BKGA 3T8KA 4DX6D 4K5AB 3Q9NC 1YCSB 2NYJA 3F6QA 2ETBA 3J5PA 5ENSD 5AQAA 3TWTA 4DX1A 1YMPA 3V2OA 5BXOA 4DX2A 4O60A 5HRYA 1SVXA 4DUIA 1A5EA 5AQ9A 3EHRA 4K5CA 4BSZB 4JB8P 5CEDB 3TWWA 5KNHD 3ZUVB 4OAUC 3NOGD 3JUEA 5HKPA 1MX6A 2MYOA 3UXGA 3SO8A 2V5QC 4YDWA 4QQIA 5FIOA 3J5QB 3AJIA 1K1BA 4TUMA 1AP7A 1OT8A 1DCQA 1K1AA 5AARA 3V30A 4ZFHA 1IKND 5AAOA 2QYJA 5EYPF 5EYLA 3TWXA 4A63B 2F8YA 1MJ0A 1UOHA 2DZOA 4N5QA 1N0RA 5JMND 3W9FA 3B7BA 5EILA 3LJNA 2RFMA 2BKKB 4HI8A 4U8VD 5CBNA 1SW6A 4HI9A 3IXEA 3TWUA 1AWCB 2P2CP 4F6RD 2DZNA 4U95D 2PNNA 3DEOA 4G8LA 1NFIE 3TWQA 4BERA 4LNUD 2DVWA 4RLYA 4U96D 5AQ7A 4HRMB 2ZGDA 4F1PA 4ZHBA 2XEHA 2ZGGA 5ENTD 4BESA 2XEEA 1BI7B 5EIBE 5JA4D 2F8XK 1QYMA 2ETAA 3JXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXI A;  3DEP A;  4BET A;  3TWR A;  2JAB A;  2FO1 E;  2DWZ A;  1DC2 A;  3C5R A;  2V4H C;  5ENP D;  3HRA A;  3T9K A;  2ETC A;  4OAV B;  3KEA A;  3UTM A;  5ENQ D;  4K5B A;  4LSZ E;  2KXP C;  2XEN A;  3AAA C;  3V2X A;  1TR4 A;  5EN5 D;  3W9G A;  1N0Q A;  3EHQ A;  5AN8 A;  4DRX E;  4UUC A;  1K3Z D;  4J8Y A;  4NIK A;  3HG0 D;  4DX5 D;  2AJA A;  4HBD A;  5CBO A;  1BLX B;  4CZ2 D;  4Z68 A;  5CER B;  3NBN B;  1IHB A;  5AQB A;  1BU9 A;  1S70 B;  5D66 A;  3TWS A;  4BEP A;  4G8K A;  5BXU A;  4HB5 A;  5FIN A;  3TWV A;  2Y1L E;  2QC9 A;  3V79 K;  1WDY A;  3NOC D;  4J7W A;  4YDY A;  1OY3 D;  2B0O E;  5EID A;  2A5E A;  2XZD G;  4HQD A;  2Y0B G;  1YYH A;  4GPM A;  1BI8 B;  2VGE A;  2XZT G;  4HLL A;  4CYM D;  5ENR D;  5CEA A;  2RFA A;  4HRN A;  3UI2 A;  1D9S A;  3V31 A;  4U8Y D;  1MYO A;  4QFV A;  1BD8 A;  4ATZ D;  3EU9 A;  2F37 A;  2KBX A;  4HRL A;  1G3N B;  4LG6 A;  1MX2 A;  1MX4 A;  2HE0 A;  3Q9U C;  4HNA D;  5HS0 A;  3ZU7 B;  4C48 B;  5ITZ F;  2J8S D;  1N11 A;  5KWD A;  4GMR A;  3B95 A;  3ZNG A;  5CEC B;  3ZKJ A;  4B93 B;  1IXV A;  5KBA A;  4O1P A;  3D9H A;  4DX7 D;  2L6B A;  5ENO D;  5KNG A;  1WG0 A;  4O1O A;  2BKG A;  3T8K A;  4DX6 D;  4K5A B;  3Q9N C;  1YCS B;  2NYJ A;  3F6Q A;  2ETB A;  3J5P A;  5ENS D;  5AQA A;  3TWT A;  4DX1 A;  1YMP A;  3V2O A;  5BXO A;  4DX2 A;  4O60 A;  5HRY A;  1SVX A;  4DUI A;  1A5E A;  5AQ9 A;  3EHR A;  4K5C A;  4BSZ B;  4JB8 P;  5CED B;  3TWW A;  5KNH D;  3ZUV B;  4OAU C;  3NOG D;  3JUE A;  5HKP A;  1MX6 A;  2MYO A;  3UXG A;  3SO8 A;  2V5Q C;  4YDW A;  4QQI A;  5FIO A;  3J5Q B;  3AJI A;  1K1B A;  4TUM A;  1AP7 A;  1OT8 A;  1DCQ A;  1K1A A;  5AAR A;  3V30 A;  4ZFH A;  1IKN D;  5AAO A;  2QYJ A;  5EYP F;  5EYL A;  3TWX A;  4A63 B;  2F8Y A;  1MJ0 A;  1UOH A;  2DZO A;  4N5Q A;  1N0R A;  5JMN D;  3W9F A;  3B7B A;  5EIL A;  3LJN A;  2RFM A;  2BKK B;  4HI8 A;  4U8V D;  5CBN A;  1SW6 A;  4HI9 A;  3IXE A;  3TWU A;  1AWC B;  2P2C P;  4F6R D;  2DZN A;  4U95 D;  2PNN A;  3DEO A;  4G8L A;  1NFI E;  3TWQ A;  4BER A;  4LNU D;  2DVW A;  4RLY A;  4U96 D;  5AQ7 A;  4HRM B;  2ZGD A;  4F1P A;  4ZHB A;  2XEH A;  2ZGG A;  5ENT D;  4BES A;  2XEE A;  1BI7 B;  5EIB E;  5JA4 D;  2F8X K;  1QYM A;  2ETA A;  3JXJ A; 
#chains in the Genus database with same CATH topology
 3G2S A;  4ACL A;  3MV2 B;  3PUK A;  2ETC A;  3DBS A;  2XEN A;  1E8Y A;  4I43 A;  4NIK A;  4EZK A;  3JCK C;  2AJA A;  3ZGQ A;  1H19 A;  1E7U A;  4G8K A;  2LAI A;  3TWV A;  3V79 K;  1HXI A;  2B0O E;  5LFA A;  3HXF A;  1BI8 B;  4UI9 C;  1E7V A;  4CYM D;  4EQF A;  3ISM C;  4RG9 A;  4FJZ A;  1TN7 A;  3D3M A;  2YIN A;  4I6J A;  4B93 B;  1IXV A;  1N4R A;  3VTY A;  3PEU B;  5ENO D;  3Q73 A;  2LAH A;  2NYJ A;  2ZU6 B;  3VLE A;  3LKU A;  3ZPJ A;  3ZUV B;  5CRU A;  4I17 A;  2LSV A;  2WXG A;  4DI3 A;  2KCL A;  3MCX A;  4I9C A;  1N4Q A;  3ZXP A;  3I5P A;  4U0Z A;  1ELK A;  1N0R A;  1TNY A;  4I6E A;  4BX9 A;  3CVL A;  3MV3 B;  5CHE E;  3Q15 A;  2J08 A;  2DVW A;  2GGF A;  4I2W A;  4XEI G;  3QAQ A;  2F8X K;  3SGH A;  3IKO B;  4BX8 A;  4M3O A;  4W9R A;  2V4H C;  5CCM A;  4F3V A;  2I2O A;  3LDZ A;  4I1O B;  3C3R A;  4F53 A;  4TXP A;  5ANR A;  2WMO A;  2M63 A;  4WNG A;  3B7S A;  3FFL A;  2OEW A;  2IF4 A;  2XPY A;  2IQC A;  3FUK A;  5CCL A;  1OCZ E;  5G05 J;  4E6H A;  3NQP A;  3RO3 A;  3UIO C;  2ILR A;  2F37 A;  3FUN A;  3APD A;  1XNF A;  2DCP A;  4AVX A;  4U0S A;  5FQ7 A;  1OCR E;  5KNG A;  4O1O A;  4WUY A;  3RRU A;  3T8K A;  2WXP A;  5AQA A;  1SZ9 A;  2VSX E;  2PM7 A;  3LVQ E;  3LY9 A;  3Q79 A;  2EIN E;  4I1M A;  4OAU C;  2IU1 A;  3UUX A;  1ZB1 A;  5J08 A;  2V4L A;  2VSY A;  3V30 A;  4ZFH A;  2X6H A;  3QKY A;  1JPL A;  5D0O D;  1KZO A;  1HG5 A;  4AXH A;  1AWC B;  3FH7 A;  4LNU D;  2ZGG A;  2P9K G;  3SZ7 A;  3UQ3 A;  1JCS A;  3DEP A;  3CHM A;  3PEV B;  1TN6 A;  3E4B A;  3OTN A;  3KEA A;  4LSZ E;  2KXP C;  5AN8 A;  5J90 A;  4J8Y A;  1H2T C;  2GRN B;  3BG1 B;  5FIN A;  5BV0 A;  3APF A;  1UN9 A;  3CSF A;  4IUL A;  1D8D A;  4HRN A;  1OCC E;  2UY1 B;  4U8Y D;  1MYO A;  1BD8 A;  1TJF A;  1Z5S C;  3RO2 A;  4JHJ A;  2HE0 A;  3LY7 A;  3ZKJ A;  2FI7 A;  5A23 A;  2L6B A;  5LCW J;  3CVW A;  1W3B A;  4XI9 A;  2B6C A;  1SVX A;  5AYW D;  3EHR A;  4WWO A;  1UJK A;  4JB8 P;  3ZYM A;  2R05 A;  3TWW A;  3UXG A;  3ASD A;  1AP7 A;  1OT8 A;  1DCQ A;  3NF1 A;  3RK6 A;  3CQC B;  2P9U G;  2QYJ A;  3DSS A;  5EYL A;  3LJ3 A;  5BV1 A;  4MS6 A;  4A1G A;  3CHS A;  4K03 A;  3DRA A;  3CVN A;  4FLH A;  4JEH A;  3N71 A;  3KSQ A;  4HOS A;  4Q94 A;  1EYH A;  2NSZ A;  4LER A;  3L17 A;  3GW4 A;  5T8I A;  3QOU A;  4N39 A;  3O48 A;  3JXI A;  1TN8 A;  4UQY A;  1NL4 A;  2XEV A;  4DJA A;  2EIL E;  1IQR A;  2HR2 A;  3OXL A;  5EN5 D;  1IHG A;  2KZT A;  2DBA A;  1KT0 A;  4J8E A;  2WB2 A;  2JEK A;  1HE8 A;  4JVS A;  4N3B A;  4YDO A;  3RU0 A;  1L5J A;  4GTV A;  5FZQ A;  3C3Q A;  4V3I A;  2AW6 A;  3MJW A;  1H6O A;  5ENR D;  1XGW A;  3AG4 E;  2A5U A;  1QQE A;  4QFV A;  3Q75 A;  2YHE A;  2FBN A;  2HO1 A;  3AG1 E;  4F7A A;  2P9L G;  2V5F A;  5G55 A;  3LY8 A;  4DX7 D;  3ZYL A;  2GRO B;  4UWG A;  1Z3Y A;  4U8H A;  2MOW A;  4YVO A;  3ZYK A;  2XS1 A;  3JUE A;  2CG2 A;  3B7T A;  2XGM A;  5AAO A;  4A63 B;  4R7L A;  4TUU A;  3SBT B;  4HI8 A;  5CBN A;  1KPS B;  3FDH A;  4JA7 A;  3LCA A;  4P29 A;  4EBA A;  2RD0 A;  2WXJ A;  2WXF A;  3ESK A;  4RLY A;  2XHE A;  3BU8 A;  3AS4 A;  1LD7 A;  4C0M A;  4EBA G;  3CR3 A;  4JHR A;  1KZP A;  1RW2 A;  4ATG A;  2CHZ A;  2LXM A;  2XQ0 A;  3HYM B;  2WXQ A;  2WXN A;  3DWL G;  2GRP B;  2YNQ A;  4NUR A;  3AAA C;  2VSN A;  2WXM A;  2GRL A;  3EHQ A;  1TNB A;  3JYS A;  3PH0 C;  3S7F A;  2HM8 A;  5AJL A;  4GA2 A;  3G2W A;  3EHM A;  4UWL A;  5D66 A;  2VTB A;  4U63 A;  4KXK B;  4J7W A;  4HQD A;  2X6I A;  4GPM A;  2Y69 E;  3QAR A;  3DXK G;  3L6A A;  4AP2 A;  5ARF A;  5EX3 A;  4HNA D;  4U0U A;  5CEC B;  4ANW A;  3TXM A;  4L9P A;  4GTQ A;  3WXX A;  4HVB A;  3B7R L;  3QB2 A;  3ULE G;  3PZ1 A;  1TYQ G;  4GPK A;  5CED B;  3U64 A;  4FA6 A;  3SY2 A;  1N4P A;  3LEW A;  2WXR A;  4GTT A;  3GZ1 A;  5M72 A;  2J09 A;  2VJ8 A;  3Q49 B;  1JUQ A;  5ENN A;  4URK A;  4BT8 A;  5EIL A;  2BKK B;  1N9A A;  5EKQ D;  1FVH A;  4BFR A;  3S7B A;  2UY1 A;  3JUI A;  3PVL A;  3PRE A;  2ZGD A;  4ZHB A;  3MGB A;  2VTB B;  1N54 A;  3QWV A;  3PE4 A;  2OV8 A;  2L0I A;  2XGS A;  1S0P A;  3HXD A;  4TRQ A;  2JAB A;  3APC A;  2FO1 E;  5JHA A;  4CDR A;  4FLB A;  3FTX A;  4OAV B;  4GAA A;  1IYG A;  1N0Q A;  3ASF A;  2F0Y A;  1U3D A;  3KEZ A;  1A17 A;  3C3O A;  3HG0 D;  3SHF A;  1IHB A;  3TWS A;  2QC9 A;  1E8Z A;  1GW6 A;  3ZHE B;  1JWG A;  1D8E A;  2RFA A;  3BQO A;  4YVQ C;  1ELR A;  1HF8 A;  4LRZ A;  2UWJ G;  3O4Z A;  4ATZ D;  4LG6 A;  5JJ6 A;  3UT8 A;  2I1J A;  4JD2 G;  1FCH A;  3MA5 A;  2LXL A;  5B1B E;  4B8A A;  3UPV A;  3S7J A;  5BXO A;  4G11 A;  2ZIS A;  2LNI A;  2PZI A;  1ZU2 A;  5DBK A;  4JA9 A;  4DLQ A;  2EIM E;  1NP7 A;  3CVQ A;  3RAU A;  3T5V A;  5AAR A;  3CVY A;  3S2A A;  4GU5 A;  1SQM A;  5FJY A;  4CRW A;  2KCV A;  3MKR A;  3SFZ A;  2YQ8 A;  3FTV A;  2WPV A;  2XEH A;  1BI7 B;  2KCK A;  3EIJ A;  1V55 E;  3HIZ A;  4APO A;  1DC2 A;  5E76 A;  3GZS A;  4K5B A;  2P9N G;  4GZC A;  3PZ2 A;  4G2V A;  2J49 A;  4GZ3 A;  1EDU A;  5CER B;  2GW1 A;  2PQN A;  2QFC A;  1JCQ A;  4XI0 A;  1MQS A;  3CV0 A;  4J6I A;  1TEZ A;  3HXB A;  4N2Q A;  4JPS A;  4HLL A;  4Q96 A;  4BWR A;  3LPZ A;  3MEK A;  3V31 A;  2XCB A;  2HYZ A;  2BF0 X;  4JC8 A;  3D9P A;  3HVE A;  5KJL A;  4H7X A;  4EZJ A;  4AY5 A;  4GB9 A;  5ENS D;  3FU6 A;  3KD7 A;  3IBE A;  4DX2 A;  3CVP A;  3D9O A;  4XKB A;  4FHK A;  3E37 A;  5JJT A;  1ZBP A;  1HO8 A;  4XKC A;  1K1B A;  4XE0 A;  3CVU A;  2WXO A;  5BNW A;  1QNF A;  1OWP A;  3K9I A;  1SW6 A;  1OWO A;  3QC1 A;  2KZT B;  4AEZ C;  4O6F A;  4D10 C;  4HRM B;  3QDN A;  5JA4 D;  4LNG A;  1TJC A;  4ANX A;  3SFX A;  2GRR B;  2QY7 A;  1LD8 A;  4DI4 A;  3C5R A;  3JQ1 A;  3GYZ A;  3HXE A;  4MBG A;  2J4D A;  4FJY A;  4GYY A;  2EIK E;  3Q5M A;  4DRX E;  3E34 A;  3FUI A;  3FUH A;  5CBO A;  3BG0 B;  3Q7A A;  5BW8 C;  4CDN A;  1BU9 A;  3AS8 A;  4C0E A;  3ZYQ A;  4HB5 A;  4KMO A;  2XCC A;  5JJ7 A;  4JHK A;  1EF1 C;  2FO7 A;  5CEA A;  3TGO A;  1PAQ A;  3UI2 A;  3ZW3 A;  4KVO A;  3PZD A;  3FTZ A;  3SQV A;  3ZU7 B;  4FAD A;  2J8S D;  3PNT B;  4O1P A;  1X81 A;  4G23 A;  5BT1 A;  1INZ A;  3DPD A;  2ETB A;  4DX1 A;  3ULY A;  3AG3 E;  4BT9 A;  5ARG A;  2IFU A;  3E30 A;  3FUE A;  1H2U A;  3C98 A;  4TXQ A;  1WM5 A;  3CVX A;  1E96 B;  3ML8 A;  3ZIM A;  3TG4 A;  4A3T A;  3QWP A;  4K0R A;  3FP3 A;  1N4S A;  5ANL A;  4PS7 A;  4GTO A;  3CGH A;  1UW4 B;  4PH4 B;  1S64 A;  4PS8 A;  4WND A;  2IOS A;  3IHV A;  1U3C A;  2P2C P;  3NZS A;  3DSW A;  1HU3 A;  4KT6 B;  4L2Y A;  4F1P A;  5FT9 A;  3TL5 A;  4NRH B;  5ENT D;  4BES A;  2CFU A;  1QYM A;  4I9E A;  3MKQ A;  3UIN C;  2R2L A;  2PQR A;  4ME2 A;  5FQ8 A;  5HQ8 A;  4APF A;  4DLO A;  4B8C B;  3FUJ A;  4FP7 A;  3PRZ A;  4J8D A;  5EDS A;  3UMV A;  4UUC A;  3UKR G;  4HOT A;  2WMN A;  4ILH B;  4BY6 A;  1OWN A;  1TNU A;  5EX0 A;  2AXU A;  4KYO B;  2Y0B G;  3FUF A;  2XZT G;  3UT7 A;  3PE3 A;  4UI9 J;  3OAW A;  4JEU A;  2EIJ E;  1V54 E;  3EDT B;  1MX4 A;  2EQX A;  5G2N A;  3TXN A;  2I1K A;  3UM2 A;  3D9I A;  1UG3 A;  5LCW C;  1E90 A;  3V2O A;  3I3N A;  1HS6 A;  2GRM A;  5A7D B;  3D9N A;  4CGW A;  1A5E A;  3LXU X;  2R02 A;  3TG5 A;  3OXF A;  3FU0 A;  4G24 A;  5HKP A;  3FEY A;  1H2V C;  4AIF A;  4EEC A;  2ZXW E;  4HOQ A;  4WWP A;  5EYP F;  1HG2 A;  1MJ0 A;  2DZO A;  2FF4 A;  4G25 A;  4JL0 A;  4U8V D;  2RFM A;  2VGX B;  1OUV A;  3FH8 A;  3G2V A;  4I1A A;  2AXZ A;  4OYS A;  3L13 A;  3TWQ A;  2GRQ B;  4UWK A;  4E85 A;  2Q7F A;  4GTS A;  4RQI A;  3B13 A;  1NA3 A;  2V8S E;  4B89 A;  1HX8 A;  1N94 A;  2X3M A;  3AU4 A;  5ENP D;  5LOZ A;  4RSY A;  2VGX A;  4CEM A;  2Y4U A;  3ML9 A;  4HOU A;  3ZRH A;  3ABL E;  2DYS E;  1SA4 A;  1K3Z D;  4NQ0 A;  3T5X A;  4HBD A;  3G2U A;  3ZVV A;  1JWF A;  1U2V G;  2XRY A;  3KAE A;  3URZ A;  3FUM A;  1S70 B;  3EUV A;  2IEJ A;  2Y1L E;  5BUZ A;  3PZ3 A;  4EPZ A;  1Q2Z A;  2Y4T A;  3FWV A;  2CHW A;  2P9S G;  2P9P G;  4B0Z A;  1FPP A;  1MX2 A;  5HS0 A;  3RRM B;  4GMR A;  3B95 A;  3CQG B;  2XGO A;  4KVM A;  1WG0 A;  1E8X A;  2XPI A;  3MZL B;  3PZ4 A;  4K5C A;  4HFG A;  3HDX A;  2CHX A;  4LUN U;  1N52 A;  4TUM A;  4ACK A;  1ELW A;  4EZL A;  5FZS A;  4WAF A;  3X2Q E;  4F6R D;  3FUL A;  4L23 A;  3L22 A;  1O1T A;  2WM9 A;  3SF4 A;  2OEV A;  3FU3 A;  5JHB A;  1OWM A;  4N2S A;  2E2E A;  1FT1 A;  2J9Q A;  2ION A;  2X6F A;  3C72 A;  5CMW A;  3E33 A;  3CIA A;  1NI1 A;  2OOE A;  3ZFW A;  2XRZ A;  1B89 A;  2IJG X;  4N5C A;  3CST A;  2H6I A;  2R03 A;  2WQH A;  3NBN B;  5BXU A;  1WDY A;  1UN8 A;  3IV0 A;  4U07 A;  1OY3 D;  4BTA A;  1YYH A;  1DCE A;  5D2M C;  2C0L A;  3DSX A;  1D9S A;  1MHQ A;  3ABM E;  3ONK A;  3LVR E;  2J4B A;  2WXI A;  4C48 B;  1DVP A;  3ZNG A;  3ENE A;  4BSX A;  2FUL A;  2QZA A;  2WXL A;  2P9I G;  2MHK A;  4GCN A;  2BED A;  4RVB A;  4U04 A;  4JXT A;  1BPO A;  3VLD A;  1MX6 A;  2MYO A;  5FIO A;  4CDM A;  2KM4 A;  3CK9 A;  4UI9 K;  5CMY A;  1E8W A;  2H6G A;  3ZXS A;  2DYR E;  3PDN A;  4ABN A;  1X5B A;  4J8F A;  2OCC E;  3UM3 A;  4PDX A;  4GA0 A;  4A1S A;  1IKN D;  2V0P A;  3PUJ A;  1NZN A;  4GZ6 A;  2R17 C;  4FHJ A;  1Y8M A;  1QBQ A;  1Z6T A;  4J8S A;  3T9K A;  3FY4 A;  3UTM A;  3DST A;  4G1T A;  4DPR A;  4RG6 A;  3FHE A;  4WWN A;  2E0I A;  1H6P A;  1YA0 A;  1TNZ A;  4GTR A;  3CVV A;  4CZ2 D;  4BTB A;  4FUL A;  2R59 A;  4ANU A;  3AU5 A;  5AEN A;  5G04 C;  4NAC A;  1HZ4 A;  2XZD G;  1K8K G;  3BUA A;  3Q47 B;  3FU5 A;  4UWF A;  4WNF A;  2RG8 A;  3FUD A;  3CHR A;  1DNP A;  1TNO A;  5ITZ F;  1LF8 A;  3D9H A;  3SI5 A;  4K5A B;  1YCS B;  4B94 A;  2YHC A;  3J5P A;  4OVV A;  4O60 A;  5LP0 A;  4C9B B;  4AJW A;  2X6J A;  3RJV A;  2IO3 C;  3CKB A;  4GA1 A;  3I4G A;  4G26 A;  4ILG A;  3D9L A;  3IHY A;  3QK0 A;  4AY6 A;  2VGY A;  4JZY A;  3ABK E;  2F8Y A;  1N95 A;  4N5Q A;  2A4Z A;  3IEG A;  5JMN D;  3W9F A;  2OVB A;  3L54 A;  3E32 A;  3Q78 A;  3UX4 A;  3ESL A;  5KCM A;  2DIW A;  4IN3 B;  5EIB E;  1MZC A;  3NAW A;  5D0Q D;  2ETA A;  5FZR A;  4BET A;  2DWZ A;  2IO2 C;  3B7U X;  3HRA A;  4LNB A;  4IRU A;  3D9J A;  2WXK A;  2WQ7 A;  2AWI A;  3FTY A;  3V2X A;  1TR4 A;  1RZ4 A;  1PY1 A;  2J07 A;  3LS8 A;  3D9M A;  2H6H A;  3L08 A;  1O5M A;  4ANV A;  5H7P A;  4GTM A;  4WNE A;  5KJM A;  3EU5 A;  3NOC D;  1KLX A;  5G05 C;  3OXG A;  1FT2 A;  2WXH A;  3R9A B;  3SFY A;  3PS6 A;  1FVF A;  3EU9 A;  3T8M A;  1VDY A;  4MKT A;  4FC8 A;  3KS2 A;  5KWD A;  4CGV A;  4Q69 A;  2H6F A;  3F6Q A;  3TWT A;  4TV3 A;  1YMP A;  3MX3 A;  2IY0 C;  5AQ9 A;  3RRN B;  3U66 A;  4J0U A;  2IOL A;  5KNH D;  3KSL A;  3SO8 A;  3AS5 A;  2XPZ A;  4YDW A;  4QQI A;  3J5Q B;  3Q4A B;  1PC2 A;  1UJJ A;  4XIF A;  1HFA A;  4KZC A;  4AV7 A;  3ASO E;  2MRI A;  2WQ6 A;  2WVI A;  1IQU A;  4OVU A;  3I4R B;  3LJN A;  4HI9 A;  4L2L A;  2CFZ A;  3R9M A;  3RKV A;  5AQ7 A;  3P2B A;  3HVE B;  4HOR A;  3JXJ A;  3FTW A;  4HS2 A;  4CT0 A;  2NXP A;  4YND A;  3FH5 A;  3DXM G;  1WY6 A;  5ENQ D;  4GTP A;  4UQZ A;  3DSU A;  3UM0 A;  1H0A A;  3CHO A;  3LYA A;  2JLB A;  3UKU G;  3NZU A;  5HI7 A;  4ILI A;  3FTS A;  4DX5 D;  4GMJ A;  3GZ2 A;  4H7Y A;  4GCO A;  4Y6C A;  3S7D A;  2AVP A;  4UWH A;  4BEP A;  3RIB A;  5EID A;  4AM9 A;  3HXC A;  4MLP A;  4N3A A;  2KBX A;  3Q9U C;  1N11 A;  3HHM A;  5FQ6 A;  3CEQ A;  3Q9N C;  2P58 C;  3QJZ A;  5T3R A;  2FEZ A;  1OXJ A;  2X38 A;  4DUI A;  4CT4 A;  4AOF A;  3NB2 A;  2I6H A;  5B3S E;  2CG3 A;  1QZ2 A;  1O1R A;  3SBS A;  4KZ0 A;  1LTX A;  3EHN A;  3ZEF A;  4GML A;  4GZD A;  4X8Q A;  3TWU A;  1P5Q A;  5AJD A;  3DEO A;  2ZIR A;  4G8L A;  1OWL A;  4XZ4 A;  3P1U A;  4BER A;  3CHQ A;  3U9W A;  1Z3X A;  3ONL A;  5A6C A;  4HLE A;  3TWR A;  1JCR A;  2C0M A;  3EJN A;  2AXV A;  2PL2 A;  5LX8 A;  3D9K A;  5E75 A;  2R5S A;  4PS3 A;  5B1A E;  2LSU A;  4EHM A;  4Z68 A;  1EPU A;  3ASH A;  5AQB A;  4YDE A;  4L1B A;  4F1S A;  5KJN A;  3UIP C;  3EIQ C;  3UT4 A;  3R7Q A;  3WG7 E;  4IYP A;  2A5E A;  1H6K A;  3L82 A;  3VTX A;  2VGE A;  1WAO 1;  1Y6I A;  3SNX A;  3ULQ A;  4DK5 A;  1HH8 A;  1NA0 A;  4HRL A;  3U3W A;  5BPP A;  2L9B A;  5KBA A;  5FQ4 A;  3L16 A;  3ASG A;  3MKQ B;  3L9T A;  5DIZ A;  5HRY A;  2VYI A;  4HXI A;  3FTU A;  2KC7 A;  4LEU A;  3AJI A;  4KBQ A;  4UQX A;  2L0T B;  5C2Y A;  3SD5 A;  2QYU A;  3QNK A;  1KT1 A;  3ZHE A;  3DPY A;  4N3C A;  4GZ5 A;  3QWW A;  2DZN A;  2BTD A;  3ZN3 A;  4U95 D;  1NFI E;  1OCO E;  4U96 D;  4FU3 A;  4Y6W A;  2L6J A;  4I6G A;  2NC9 A;  3PNL B;  4A3V A;  5G04 J;  2PM6 A;  5CRV A;  2Y3A A;  3MYV A;  3Q7F A;  4PUC A;  1SA5 A;  4JW1 A;  3W9G A;  5FTP A;  4L7T A;  3TJP A;  4M7C A;  3TAX A;  3CK8 A;  4GYW A;  2LUH A;  2C2L A;  3FEX A;  4GYO A;  4MRU A;  4I2Z A;  1BLX B;  3R7R A;  3CHP A;  4YDY A;  5C1D A;  4XX5 A;  2OVF A;  4U7E B;  5KJK A;  3UM1 A;  3JQ0 A;  2OND A;  5T4Y A;  1G3N B;  4TXR A;  5AIJ A;  3ASN E;  3BEE A;  3AG2 E;  2BKG A;  4DX6 D;  2I9C A;  3VLF A;  2XS8 A;  2VSO E;  3CK7 A;  5FWQ A;  2X6K A;  1SZA A;  4BSZ B;  1S63 A;  2RKK A;  1O1S A;  3DSV A;  3NOG D;  2V5Q C;  2BUG A;  1K1A A;  3RSE G;  2VQ2 A;  3TWX A;  1UOH A;  3B7B A;  4LCT A;  2KAT A;  3IXE A;  2PNN A;  3CLJ A;  5IY5 E;  4A55 A;  3U4T A;  2LO6 A;  3CKC A;  2XEE A;  4CCA A;  3G2T A; 
#chains in the Genus database with same CATH homology
 3JXI A;  3DEP A;  4BET A;  3TWR A;  2JAB A;  2FO1 E;  2DWZ A;  1DC2 A;  3C5R A;  2V4H C;  5ENP D;  3HRA A;  3T9K A;  2ETC A;  4OAV B;  3KEA A;  3UTM A;  5ENQ D;  4K5B A;  4LSZ E;  2KXP C;  2XEN A;  3AAA C;  3V2X A;  1TR4 A;  5EN5 D;  3W9G A;  1N0Q A;  3EHQ A;  5AN8 A;  4DRX E;  4UUC A;  1K3Z D;  4J8Y A;  4NIK A;  3HG0 D;  4DX5 D;  2AJA A;  4HBD A;  5CBO A;  1BLX B;  4CZ2 D;  4Z68 A;  5CER B;  3NBN B;  1IHB A;  5AQB A;  1BU9 A;  1S70 B;  5D66 A;  3TWS A;  4BEP A;  4G8K A;  5BXU A;  4HB5 A;  5FIN A;  3TWV A;  2Y1L E;  2QC9 A;  3V79 K;  1WDY A;  3NOC D;  4J7W A;  4YDY A;  1OY3 D;  2B0O E;  5EID A;  2A5E A;  2XZD G;  4HQD A;  2Y0B G;  1YYH A;  4GPM A;  1BI8 B;  2VGE A;  2XZT G;  4HLL A;  4CYM D;  5ENR D;  5CEA A;  2RFA A;  4HRN A;  3UI2 A;  1D9S A;  3V31 A;  4U8Y D;  1MYO A;  4QFV A;  1BD8 A;  4ATZ D;  3EU9 A;  2F37 A;  2KBX A;  4HRL A;  1G3N B;  4LG6 A;  1MX2 A;  1MX4 A;  2HE0 A;  3Q9U C;  4HNA D;  5HS0 A;  3ZU7 B;  4C48 B;  5ITZ F;  2J8S D;  1N11 A;  5KWD A;  4GMR A;  3B95 A;  3ZNG A;  5CEC B;  3ZKJ A;  4B93 B;  1IXV A;  5KBA A;  4O1P A;  3D9H A;  4DX7 D;  2L6B A;  5ENO D;  5KNG A;  1WG0 A;  4O1O A;  2BKG A;  3T8K A;  4DX6 D;  4K5A B;  3Q9N C;  1YCS B;  2NYJ A;  3F6Q A;  2ETB A;  3J5P A;  5ENS D;  5AQA A;  3TWT A;  4DX1 A;  1YMP A;  3V2O A;  5BXO A;  4DX2 A;  4O60 A;  5HRY A;  1SVX A;  4DUI A;  1A5E A;  5AQ9 A;  3EHR A;  4K5C A;  4BSZ B;  4JB8 P;  5CED B;  3TWW A;  5KNH D;  3ZUV B;  4OAU C;  3NOG D;  3JUE A;  5HKP A;  1MX6 A;  2MYO A;  3UXG A;  3SO8 A;  2V5Q C;  4YDW A;  4QQI A;  5FIO A;  3J5Q B;  3AJI A;  1K1B A;  4TUM A;  1AP7 A;  1OT8 A;  1DCQ A;  1K1A A;  5AAR A;  3V30 A;  4ZFH A;  1IKN D;  5AAO A;  2QYJ A;  5EYP F;  5EYL A;  3TWX A;  4A63 B;  2F8Y A;  1MJ0 A;  1UOH A;  2DZO A;  4N5Q A;  1N0R A;  5JMN D;  3W9F A;  3B7B A;  5EIL A;  3LJN A;  2RFM A;  2BKK B;  4HI8 A;  4U8V D;  5CBN A;  1SW6 A;  4HI9 A;  3IXE A;  3TWU A;  1AWC B;  2P2C P;  4F6R D;  2DZN A;  4U95 D;  2PNN A;  3DEO A;  4G8L A;  1NFI E;  3TWQ A;  4BER A;  4LNU D;  2DVW A;  4RLY A;  4U96 D;  5AQ7 A;  4HRM B;  2ZGD A;  4F1P A;  4ZHB A;  2XEH A;  2ZGG A;  5ENT D;  4BES A;  2XEE A;  1BI7 B;  5EIB E;  5JA4 D;  2F8X K;  1QYM A;  2ETA A;  3JXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...