2XZDG

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
DLGKKLLEATRAGQDDEVRILMANGADVNAMDDAGVTPLHLAAKRGHLEIVEVLLKHGADVNASDIWGRTPLHLAATVGHLEIVEVLLEYGADVNAQDKFGKTAFDISIDNGNEDLAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2xzdG00
1SVXA 5KWDA 4N5QA 4GMRA 1S70B 2ZGDA 5HKPA 4DX1A 2PNNA 2QYJA 2F8YA 3NOGD 4U8YD 1SW6A 5AARA 3ZU7B 4K5BA 2RFAA 3UXGA 1G3NB 3JXIA 3V31A 3T9KA 3F6QA 5KBAA 1N0RA 5AQBA 2XEEA 2Y1LE 1N0QA 5ENSD 5AQ7A 4TUMA 2ETBA 4G8KA 1BU9A 2VGEA 1IXVA 4QFVA 5AQ9A 4CYMD 1BI8B 4Z68A 2XZTG 4HBDA 4OAVB 3W9GA 3JXJA 4HRMB 4BESA 4ZFHA 5CECB 5ENPD 5BXUA 1MX6A 3V2XA 1AWCB 5EN5D 5CERB 3HG0D 3V79K 2P2CP 4O60A 2BKGA 2Y0BG 1YMPA 4BSZB 4HRNA 4JB8P 1DC2A 3EHRA 2XEHA 1K3ZD 2XENA 2F37A 2QC9A 5ENQD 1TR4A 2V5QC 4ZHBA 2F8XK 3TWVA 2ETAA 2V4HC 4HI9A 5EIBE 5EYPF 1N11A 3TWWA 2BKKB 3EU9A 3DEPA 5HRYA 2L6BA 3V30A 1YCSB 4LG6A 2ETCA 4F6RD 1UOHA 5AAOA 3UI2A 4UUCA 4K5AB 3J5QB 3DEOA 4NIKA 4LNUD 4A63B 4RLYA 4K5CA 4YDYA 5KNGA 4U8VD 4BERA 1D9SA 2DZNA 2KXPC 3C5RA 1WG0A 3J5PA 1MJ0A 5CEAA 5AN8A 5FINA 4YDWA 3V2OA 5ITZF 5JMND 2ZGGA 3ZUVB 1YYHA 3HRAA 2JABA 3TWXA 4U96D 1BI7B 4U95D 5ENOD 4B93B 4ATZD 5BXOA 1QYMA 4J7WA 4DX2A 4HNAD 4HQDA 4C48B 2B0OE 4O1OA 5JA4D 1BD8A 3TWTA 2NYJA 2J8SD 1BLXB 3TWRA 1DCQA 4HRLA 4F1PA 2A5EA 4OAUC 2XZDG 1MX4A 3Q9UC 1MX2A 5CBNA 2KBXA 4G8LA 5D66A 5FIOA 1IKND 1K1BA 3NOCD 3KEAA 4DX7D 2MYOA 3UTMA 3AJIA 1AP7A 1NFIE 5ENTD 1A5EA 2AJAA 2RFMA 1K1AA 3ZKJA 4CZ2D 5CEDB 4DRXE 4DX6D 5AQAA 4HB5A 5EYLA 3TWSA 4HLLA 3NBNB 4HI8A 5HS0A 1OT8A 4DX5D 3ZNGA 4GPMA 3TWUA 5EIDA 3Q9NC 3AAAC 5ENRD 4DUIA 3JUEA 3B95A 1IHBA 3EHQA 3IXEA 2DZOA 1MYOA 1OY3D 3D9HA 5KNHD 2HE0A 4QQIA 3LJNA 2FO1E 4J8YA 3SO8A 1WDYA 2DVWA 4LSZE 3T8KA 4BETA 5EILA 3W9FA 4BEPA 3B7BA 3TWQA 2DWZA 5CBOA 4O1PA
chains in the Genus database with same CATH superfamily
3HXEA 5KWDA 5AENA 1QBQA 2WMNA 1H2UA 3QOUA 4JEHA 4U0UA 5ENSD 4TUMA 3L17A 1OCZE 2CG2A 4EQFA 1LD7A 4GU5A 1HH8A 2VSOE 1Q2ZA 4GTMA 5ENNA 4AXHA 1OCCE 3BU8A 2ZIRA 2I2OA 3SFYA 1D8EA 4AIFA 3EU9A 3PVLA 3RRMB 3P2BA 3FTVA 3CQGB 4MKTA 4G23A 1Z6TA 5C2YA 3ASHA 3TWXA 4I6JA 4DJAA 4JHKA 2XCCA 2J9QA 3TG4A 3PEUB 1OXJA 4BX8A 3CV0A 3SI5A 3BG0B 3CVYA 1OWNA 4OAUC 4KZCA 1LD8A 3PZ1A 4UWHA 3E4BA 3Q73A 2WXPA 3I4GA 3QAQA 3AS8A 1MHQA 3DSSA 3C98A 5HS0A 4ILHB 3CK7A 1MYOA 4U0ZA 4A3TA 3QWVA 4WWOA 2WPVA 3C3RA 3FTYA 3ML9A 1SVXA 4AEZC 3AG1E 4I6GA 3PNLB 3FTZA 3NOGD 1UJJA 2ZISA 3PEVB 3F6QA 2QYUA 3ASGA 3OTNA 3QDNA 1TN6A 2EILE 1TNUA 1X81A 3PZDA 3CHRA 4A3VA 3KEZA 1INZA 1DNPA 4MS6A 2WXNA 4UWKA 1U3CA 2DYSE 5D0QD 4Q94A 3DEPA 4ANXA 4F6RD 4WNGA 1ZB1A 2OEWA 3LY9A 4IYPA 2I9CA 2L0IA 5FQ8A 3SF4A 4GPKA 4WNEA 3FU3A 2A5UA 3PE3A 3DRAA 2R02A 3ZHEB 5AYWD 3U4TA 3Q47B 5LCWC 5AJLA 1JCSA 3ZPJA 1NZNA 3EDTB 5ANRA 2A5EA 1E8YA 5D66A 3DSWA 4ACKA 3AJIA 4N3CA 1NFIE 5CRUA 3CHMA 5AQAA 3EU5A 4G26A 3VLEA 5KJKA 4GZ6A 1WY6A 2WQHA 1V55E 1S0PA 1OY3D 3SNXA 3ASOE 1UJKA 3MEKA 3W9FA 5HKPA 1W3BA 1S70B 3X2QE 3DWLG 1N0QA 2GRRB 3SFXA 5HQ8A 1BI8B 4GYYA 3W9GA 4N3BA 3CEQA 3E32A 2Y0BG 2BUGA 4JZYA 1IYGA 2MRIA 4JB8P 2CFUA 3EHRA 5ENQD 2WXKA 4UQXA 5JJ6A 1MZCA 3ZHEA 5KJLA 1FT2A 3ZYMA 4KXKB 3U3WA 3UIOC 2DZNA 1BPOA 2IONA 4G1TA 4N2SA 1YYHA 2JABA 1HS6A 4OVUA 3NAWA 3TAXA 4JHJA 4C48B 2PZIA 2AXUA 4PDXA 3ENEA 2LUHA 1BLXB 5D2MC 3S2AA 2Q7FA 4YVOA 4I9EA 4AOFA 3LXUX 4HOTA 1AP7A 4PH4B 1A5EA 5G04C 3CKCA 1N52A 4FHKA 4Y6WA 5JJ7A 2X6KA 2X6JA 2J4DA 2V8SE 2DYRE 4M3OA 4QQIA 2FO1E 4LSZE 3TWQA 2J49A 4FJYA 2PNNA 4J8EA 1H6OA 3G2UA 1FCHA 3ONKA 2OOEA 3ABLE 3ML8A 3AU4A 3LCAA 5FQ4A 4ANVA 5LP0A 3ZFWA 2XZTG 1JCRA 4LCTA 3E37A 2P9KG 2C0MA 3IBEA 3T5XA 1YMPA 4HRNA 4X8QA 3QB2A 2ONDA 4ATGA 1P5QA 2BKKB 5HRYA 3RU0A 1SZAA 4KT6B 2KZTB 1KZPA 1Z3XA 3APFA 4A63B 3U66A 4U8VD 4TV3A 3FUNA 3JYSA 5JMND 3G2VA 1E8XA 3CVVA 4D10C 3HYMB 4FA6A 3OXFA 3GW4A 5T4YA 4BT9A 3D9IA 5JA4D 2NYJA 5FWQA 5FIOA 3KEAA 4DX7D 3UTMA 4MRUA 4HOQA 2RFMA 3ZKJA 2NXPA 4I2WA 2XGSA 5IY5E 2F0YA 3AS5A 3ESKA 5CMYA 4DI4A 3QARA 4GZ3A 3LKUA 2LAHA 4AJWA 3RKVA 4AP2A 3LY7A 4J8YA 2VQ2A 3CHSA 4BETA 3B7RL 4EZLA 3RK6A 3FUKA 3DPDA 2ZGDA 3ABKE 3CGHA 1ELWA 4U8YD 2XPZA 3D9MA 2NC9A 3VLDA 3UM3A 4BWRA 3DXMG 2VSYA 4B0ZA 1BU9A 4GB9A 2X6FA 2Y69E 2IO2C 4BESA 2VJ8A 1X5BA 4I43A 1O1RA 2CFZA 2KZTA 4BSZB 3CVQA 4NQ0A 2EQXA 4HORA 2QC9A 5KCMA 3D9JA 2H6IA 2R03A 3IHYA 5EIBE 4J8SA 4LG6A 4XX5A 4YDOA 3QWPA 3ZYKA 4RLYA 2C2LA 2R05A 2Y4UA 4HXIA 5M72A 3FHEA 1XGWA 2LAIA 3HRAA 3AU5A 2LXMA 3ULQA 3L08A 3DSUA 3TWTA 2R59A 3LYAA 3K9IA 3B13A 4HRLA 1EPUA 3Q4AB 3Q9UC 4JEUA 5EX3A 4G8LA 4Q96A 4PS7A 5ANLA 3ZYQA 2GROB 2AJAA 3RSEG 3FUJA 3NBNB 4GZCA 3ZNGA 4GPMA 2DCPA 1SA4A 2YNQA 2E2EA 2X3MA 4LEUA 2XGMA 4ABNA 5FQ7A 4EZKA 2CHXA 5FZSA 3E34A 5AIJA 1SW6A 1HE8A 4GZDA 3NZUA 3LS8A 2Y1LE 3FUIA 3AG3E 4DI3A 1E7VA 4R7LA 3UINC 4NRHB 2FEZA 4O60A 4HOUA 4AY5A 3RRUA 4URKA 3C3QA 4A1GA 4UQZA 2F8XK 1ZU2A 4GCOA 4B89A 1KZOA 4JW1A 1WM5A 3TWWA 1NP7A 3TL5A 1TNBA 2ZU6B 1H2VC 4K5CA 3KSQA 4KMOA 3L82A 5ITZF 1OWOA 3CK9A 3ZIMA 4U96D 3CHPA 3C72A 3RAUA 1L5JA 4B93B 4ATZD 5BXOA 3FTWA 4FU3A 2KM4A 5LCWJ 4JPSA 2MOWA 3QK0A 5CHEE 3FU0A 3BG1B 3TWRA 3UM2A 2Y4TA 4EPZA 1MX2A 3ZRHA 3SZ7A 1TNZA 4APFA 3WG7E 4A1SA 2HYZA 1WAO1 3S7BA 3JCKC 3CLJA 4DX5D 3ASDA 3HXDA 3R7QA 3SGHA 4FADA 1ELKA 2DVWA 1HXIA 4O1PA 3UM1A 1EF1C 2AXZA 2H6HA 4L7TA 3UT8A 4GTPA 5KBAA 4GMJA 5AQ7A 2IFUA 4DK5A 4EZJA 5BXUA 4U8HA 3FUMA 5G2NA 5EN5D 4UWFA 3V79K 4L1BA 3LJ3A 2GRMA 4YDEA 3PZ2A 1DC2A 2XEVA 1H6PA 1S64A 1PY1A 3Q5MA 1UOHA 5AAOA 3B7UX 3UPVA 1K8KG 1TEZA 3ULEG 3RIBA 4XKBA 3D9NA 2QY7A 4ACLA 1U3DA 4MBGA 2WXHA 3HXCA 3E30A 4JHRA 1H6KA 1A17A 1O5MA 2OVFA 5CMWA 3SD5A 2KCVA 4DX2A 3ABME 2J4BA 4TXQA 2FF4A 3FEYA 3JUIA 1TNOA 1XNFA 1IHGA 1UG3A 5A23A 4F7AA 2AWIA 4BTAA 5B3SE 3TGOA 2BEDA 4UI9K 2XRZA 2GW1A 3MYVA 5G04J 3EIQC 5EIDA 2YINA 2L9BA 3KAEA 4DUIA 5BUZA 1SZ9A 2DZOA 3DBSA 2KCLA 2CHWA 1QZ2A 1UN8A 3D9OA 2QFCA 4U63A 3LPZA 4XZ4A 1V54E 2WXMA 4BY6A 5AQBA 1N94A 3LVQE 4UI9J 2VGEA 4CYMD 4XE0A 4Z68A 3TXNA 3TG5A 4ZHBA 5KJNA 4GYOA 2B6CA 3T5VA 2VTBB 1E96B 2OCCE 2V0PA 3V30A 4J0UA 4CT0A 3P1UA 5JJTA 4BSXA 4G25A 4IN3B 3DXKG 4TUUA 2WQ6A 3O4ZA 3Q75A 3OXLA 4GTVA 4YDWA 4AV7A 2WXQA 3PREA 3UQ3A 1GW6A 4F3VA 4GA1A 4WNDA 1KPSB 4GTOA 2XPIA 2P9NG 4F1PA 3CVPA 2XZDG 4ANWA 4DLOA 4HS2A 1Z3YA 3ZW3A 4U7EB 3EIJA 3D9PA 4BFRA 1DVPA 4B8CB 3LDZA 1OCRE 5EYLA 3TWSA 5EX0A 4XIFA 3ASNE 4I1MA 4OYSA 1B89A 5BV1A 2GGFA 4N5QA 3FU6A 4E85A 3UMVA 5CCMA 2XEEA 3AG2E 3PUJA 2VTBA 4WWPA 4K0RA 4HBDA 4HRMB 3WXXA 3CSTA 4TXRA 5CERB 3HG0D 2L6JA 4RSYA 4APOA 3L6AA 5FQ6A 4Q69A 1TR4A 2VGXA 3VTXA 2ETCA 2E0IA 4L2LA 3I5PA 4UI9C 3DPYA 4LNUD 1D8DA 4H7YA 3C3OA 1OWLA 4G11A 1TNYA 3OAWA 3JQ0A 1UN9A 4GCNA 3LY8A 5KJMA 3PNTB 4U95D 3GZSA 4JD2G 5A7DB 4I6EA 2B0OE 2PQRA 3SFZA 4HVBA 4LNGA 1Z5SC 3L54A 5ARFA 1MX4A 4BTBA 3GYZA 1IKND 1TN8A 3NB2A 3FEXA 5CEDB 2X6IA 2ILRA 4JA9A 5T8IA 3MV2B 3ESLA 1N4RA 3B95A 3FY4A 2VYIA 2AW6A 2RG8A 1WDYA 4DPRA 3QNKA 2DWZA 3LEWA 3Q7FA 2UY1A 5AARA 4K5BA 2RFAA 3UXGA 2A4ZA 2QZAA 3T9KA 1NA3A 4RG9A 3MV3B 3FUDA 4KBQA 4BT8A 4QFVA 3HDXA 3JXJA 4ZFHA 2FBNA 2VSXE 3V2XA 2BKGA 3GZ1A 2WQ7A 2BTDA 5C1DA 3FH5A 2WMOA 4LUNU 5B1BE 2ETAA 2J08A 2V4HC 4I17A 3DSTA 5HI7A 3EHNA 1D9SA 3AG4E 3CVUA 4KZ0A 5CEAA 5AN8A 4AY6A 3FTSA 3ZUVB 1QYMA 4HNAD 4HQDA 1OWMA 3APDA 2IOLA 4J8FA 4UWLA 4IRUA 4RQIA 3BUAA 3U64A 2MYOA 4DX6D 3QWWA 2I1JA 4HLLA 3MGBA 4KVMA 3Q9NC 3FH8A 4CDRA 5KNHD 2WXIA 2HE0A 3R9MA 4FC8A 2JLBA 2FULA 3UT4A 5EILA 3ASFA 5T3RA 4EBAG 4C0MA 4V3IA 2HR2A 2QYJA 4O6FA 3ZU7B 4I9CA 2P9PG 4FJZA 4XKCA 5G55A 5H7PA 2H6FA 4GA2A 3ISMC 4C0EA 4M7CA 2P9UG 4WNFA 1QNFA 2MHKA 2FI7A 3CK8A 4ANUA 4I1OB 2KCKA 3IKOB 1IQRA 3TWVA 4HI9A 2EINE 3HHMA 4U07A 2IEJA 4EHMA 2WXGA 4FLHA 3G2SA 1WG0A 1UW4B 3FUHA 5CCLA 1MJ0A 2WXJA 3V2OA 2R5SA 2WXFA 4F53A 3E33A 4CDMA 1NL4A 1O1TA 3FWVA 3RRNB 4PS3A 2J8SD 3HVEB 2XS1A 2H6GA 1DCQA 5ARGA 3KS2A 4J6IA 4XEIG 2XS8A 3Q79A 4IULA 1RZ4A 2WB2A 1K1BA 3CVWA 3O48A 1HF8A 2WXLA 3EHQA 1IHBA 1N4QA 3IV0A 3B7TA 3VTYA 4BX9A 1JUQA 4GYWA 4RG6A 3KD7A 4I2ZA 3V31A 4N39A 4N3AA 2X6HA 2ETBA 2XCBA 1IXVA 5AQ9A 1E7UA 4I1AA 4JXTA 5CECB 4KYOB 5ENPD 2GRLA 3FDHA 1HG5A 2XEHA 5FJYA 3CVXA 5CRVA 2DIWA 3HXBA 1KT0A 5JHAA 3PUKA 3DSVA 3ZXPA 4NACA 4G24A 2RKKA 2LSVA 5KNGA 3C5RA 3FUFA 4FHJA 3HIZA 5A6CA 3DSXA 3PZ3A 5FINA 1DCEA 2M63A 3HVEA 2ZGGA 5ENOD 1OWPA 4JVSA 2OVBA 4FULA 4O1OA 1Y6IA 3CVNA 4PUCA 3R7RA 2J09A 3ONLA 4NURA 1N9AA 3FU5A 5DIZA 4J8DA 5D0OD 1NI1A 3BEEA 3QJZA 2PQNA 5ENTD 4CZ2D 2ZXWE 3L22A 4L2YA 3B7SA 2IQCA 4LNBA 3TWUA 3PE4A 5BPPA 3UX4A 4AVXA 4N2QA 3FUEA 4CGVA 3SO8A 1ELRA 3D3MA 3B7BA 4DRXE 3URZA 2P9LG 4JC8A 4TXPA 2IY0C 1G3NB 3ZEFA 3G2TA 1TJFA 4HLEA 4ME2A 4E6HA 2OV8A 3MKQB 3PZ4A 1N54A 4OAVB 1HG2A 2XHEA 4JL0A 2P2CP 2IF4A 5E75A 1K3ZD 2IU1A 1KT1A 1N4PA 3CVLA 5LOZA 4LERA 4AM9A 1YCSB 1H19A 4MLPA 3SBSA 3MKRA 4EBAA 1OUVA 3HXFA 2KXPC 2VSNA 3CQCB 4PS8A 3D9LA 4GMLA 2AXVA 2LNIA 2IOSA 3UT7A 3R9AB 4U0SA 3FULA 1N4SA 4K03A 3Q7AA 2XGOA 3I3NA 3L13A 2R2LA 5E76A 2VGXB 4CT4A 2P9SG 4B94A 3Q49B 5J08A 3FP3A 1OT8A 2DBAA 5B1AE 2P58C 2PL2A 3D9HA 2RD0A 1HFAA 4HFGA 3QKYA 3MKQA 3IEGA 2UWJG 4WWNA 2WVIA 4XI9A 1JPLA 2WM9A 1JCQA 3GZ2A 5BV0A 3EJNA 3ZGQA 3MZLB 4TRQA 4GTQA 1JWGA 1LTXA 3UKRG 2CHZA 3BQOA 5LX8A 2F37A 4KVOA 1E8ZA 4CRWA 2L6BA 3SQVA 2VGYA 3VLFA 4YVQC 4P29A 2BF0X 5EDSA 3S7JA 4UUCA 1HO8A 5FZQA 3RJVA 4BERA 3QC1A 3MA5A 2UY1B 4GA0A 2J07A 1YA0A 4RVBA 2GRPB 3EHMA 3Q15A 3CSFA 5G05J 4XI0A 3APCA 1HX8A 1H2TC 1O1SA 4U04A 2HO1A 4LRZA 3ZXSA 3LVRE 1K1AA 5FZRA 2YHCA 2WXOA 1OCOE 3JQ1A 2LO6A 4ILGA 2LSUA 3AAAC 3U9WA 4DLQA 3TXMA 5ENRD 3Q78A 4FLBA 3RO2A 2HM8A 5BW8C 1VDYA 1N95A 4BEPA 5CBOA 3L16A 4HOSA 4DX1A 4Y6CA 2XQ0A 5LFAA 2Y3AA 3JXIA 3I4RB 2YQ8A 1N0RA 5FT9A 4OVVA 3G2WA 3NF1A 4G8KA 1H0AA 5DBKA 1FPPA 4FP7A 4GTTA 4YNDA 1ZBPA 1HU3A 1U2VG 1KLXA 2XENA 2V5QC 1SA5A 3S7FA 2IJGX 3NZSA 2GRNB 5EYPF 1TYQG 3SHFA 3SY2A 5BT1A 3FTXA 4K5AB 3J5QB 3DEOA 3IHVA 1JWFA 2CG3A 3J5PA 3MCXA 5AJDA 5BNWA 1SQMA 1EDUA 2KATA 1NA0A 1RW2A 4GTSA 3KSLA 3EUVA 4GTRA 4H7XA 3MX3A 3NQPA 4JA7A 1TN7A 3UKUG 1IQUA 4J7WA 3UUXA 2I1KA 3PS6A 1PAQA 3ZN3A 4GZ5A 3CHQA 3UM0A 1PC2A 5CBNA 2LXLA 3NOCD 3CHOA 3CIAA 3MJWA 1E8WA 1FVHA 3FTUA 4A55A 2WXRA 2JEKA 1S63A 5G05C 4ILIA 2V5FA 4L9PA 3LJNA 3ZYLA 2C0LA 3SBTB 4GMRA 2KC7A 1E90A 2F8YA 1FT1A 3L9TA 4B8AA 4G2VA 4C9BB 3OXGA 3FFLA 1QQEA 3TJPA 2XRYA 2EIME 2R17C 3FH7A 3UIPC 1MX6A 1AWCB 2AVPA 3ULYA 3ZVVA 1Y8MA 2YHEA 5EKQD 5JHBA 4L23A 4CDNA 4CGWA 3T8MA 2I6HA 2L0TB 2NSZA 2OEVA 4UWGA 4N5CA 1N11A 2IO3C 4WAFA 3UI2A 4NIKA 4YDYA 2V4LA 1EYHA 3AS4A 1HZ4A 4GAAA 2FO7A 1TJCA 2P9IG 1BI7B 3CR3A 4W9RA 3D9KA 2X38A 1BD8A 1LF8A 4CEMA 2PM6A 3PH0C 3PDNA 3RO3A 3CKBA 2KBXA 4UQYA 4CCAA 2PM7A 4F1SA 1MQSA 4EECA 4HB5A 5FTPA 3N71A 2XPYA 4HI8A 1FVFA 3S7DA 3JUEA 3IXEA 3PRZA 5J90A 2EIJE 3T8KA 4WUYA 2EIKE 2GRQB
chains in the Genus database with same CATH topology
1SVXA 5KWDA 4N5QA 4GMRA 1S70B 2ZGDA 5HKPA 4DX1A 2PNNA 2QYJA 2F8YA 3NOGD 4U8YD 1SW6A 5AARA 3ZU7B 4K5BA 2RFAA 3UXGA 1G3NB 3JXIA 3V31A 3T9KA 3F6QA 5KBAA 1N0RA 5AQBA 2XEEA 2Y1LE 1N0QA 5ENSD 5AQ7A 4TUMA 2ETBA 4G8KA 1BU9A 2VGEA 1IXVA 4QFVA 5AQ9A 4CYMD 1BI8B 4Z68A 2XZTG 4HBDA 4OAVB 3W9GA 3JXJA 4HRMB 4BESA 4ZFHA 5CECB 5ENPD 5BXUA 1MX6A 3V2XA 1AWCB 5EN5D 5CERB 3HG0D 3V79K 2P2CP 4O60A 2BKGA 2Y0BG 1YMPA 4BSZB 4HRNA 4JB8P 1DC2A 3EHRA 2XEHA 1K3ZD 2XENA 2F37A 2QC9A 5ENQD 1TR4A 2V5QC 4ZHBA 2F8XK 3TWVA 2ETAA 2V4HC 4HI9A 5EIBE 5EYPF 1N11A 3TWWA 2BKKB 3EU9A 3DEPA 5HRYA 2L6BA 3V30A 1YCSB 4LG6A 2ETCA 4F6RD 1UOHA 5AAOA 3UI2A 4UUCA 4K5AB 3J5QB 3DEOA 4NIKA 4LNUD 4A63B 4RLYA 4K5CA 4YDYA 5KNGA 4U8VD 4BERA 1D9SA 2DZNA 2KXPC 3C5RA 1WG0A 3J5PA 1MJ0A 5CEAA 5AN8A 5FINA 4YDWA 3V2OA 5ITZF 5JMND 2ZGGA 3ZUVB 1YYHA 3HRAA 2JABA 3TWXA 4U96D 1BI7B 4U95D 5ENOD 4B93B 4ATZD 5BXOA 1QYMA 4J7WA 4DX2A 4HNAD 4HQDA 4C48B 2B0OE 4O1OA 5JA4D 1BD8A 3TWTA 2NYJA 2J8SD 1BLXB 3TWRA 1DCQA 4HRLA 4F1PA 2A5EA 4OAUC 2XZDG 1MX4A 3Q9UC 1MX2A 5CBNA 2KBXA 4G8LA 5D66A 5FIOA 1IKND 1K1BA 3NOCD 3KEAA 4DX7D 2MYOA 3UTMA 3AJIA 1AP7A 1NFIE 5ENTD 1A5EA 2AJAA 2RFMA 1K1AA 3ZKJA 4CZ2D 5CEDB 4DRXE 4DX6D 5AQAA 4HB5A 5EYLA 3TWSA 4HLLA 3NBNB 4HI8A 5HS0A 1OT8A 4DX5D 3ZNGA 4GPMA 3TWUA 5EIDA 3Q9NC 3AAAC 5ENRD 4DUIA 3JUEA 3B95A 1IHBA 3EHQA 3IXEA 2DZOA 1MYOA 1OY3D 3D9HA 5KNHD 2HE0A 4QQIA 3LJNA 2FO1E 4J8YA 3SO8A 1WDYA 2DVWA 4LSZE 3T8KA 4BETA 5EILA 3W9FA 4BEPA 3B7BA 3TWQA 2DWZA 5CBOA 4O1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVX A;  5KWD A;  4N5Q A;  4GMR A;  1S70 B;  2ZGD A;  5HKP A;  4DX1 A;  2PNN A;  2QYJ A;  2F8Y A;  3NOG D;  4U8Y D;  1SW6 A;  5AAR A;  3ZU7 B;  4K5B A;  2RFA A;  3UXG A;  1G3N B;  3JXI A;  3V31 A;  3T9K A;  3F6Q A;  5KBA A;  1N0R A;  5AQB A;  2XEE A;  2Y1L E;  1N0Q A;  5ENS D;  5AQ7 A;  4TUM A;  2ETB A;  4G8K A;  1BU9 A;  2VGE A;  1IXV A;  4QFV A;  5AQ9 A;  4CYM D;  1BI8 B;  4Z68 A;  2XZT G;  4HBD A;  4OAV B;  3W9G A;  3JXJ A;  4HRM B;  4BES A;  4ZFH A;  5CEC B;  5ENP D;  5BXU A;  1MX6 A;  3V2X A;  1AWC B;  5EN5 D;  5CER B;  3HG0 D;  3V79 K;  2P2C P;  4O60 A;  2BKG A;  2Y0B G;  1YMP A;  4BSZ B;  4HRN A;  4JB8 P;  1DC2 A;  3EHR A;  2XEH A;  1K3Z D;  2XEN A;  2F37 A;  2QC9 A;  5ENQ D;  1TR4 A;  2V5Q C;  4ZHB A;  2F8X K;  3TWV A;  2ETA A;  2V4H C;  4HI9 A;  5EIB E;  5EYP F;  1N11 A;  3TWW A;  2BKK B;  3EU9 A;  3DEP A;  5HRY A;  2L6B A;  3V30 A;  1YCS B;  4LG6 A;  2ETC A;  4F6R D;  1UOH A;  5AAO A;  3UI2 A;  4UUC A;  4K5A B;  3J5Q B;  3DEO A;  4NIK A;  4LNU D;  4A63 B;  4RLY A;  4K5C A;  4YDY A;  5KNG A;  4U8V D;  4BER A;  1D9S A;  2DZN A;  2KXP C;  3C5R A;  1WG0 A;  3J5P A;  1MJ0 A;  5CEA A;  5AN8 A;  5FIN A;  4YDW A;  3V2O A;  5ITZ F;  5JMN D;  2ZGG A;  3ZUV B;  1YYH A;  3HRA A;  2JAB A;  3TWX A;  4U96 D;  1BI7 B;  4U95 D;  5ENO D;  4B93 B;  4ATZ D;  5BXO A;  1QYM A;  4J7W A;  4DX2 A;  4HNA D;  4HQD A;  4C48 B;  2B0O E;  4O1O A;  5JA4 D;  1BD8 A;  3TWT A;  2NYJ A;  2J8S D;  1BLX B;  3TWR A;  1DCQ A;  4HRL A;  4F1P A;  2A5E A;  4OAU C;  2XZD G;  1MX4 A;  3Q9U C;  1MX2 A;  5CBN A;  2KBX A;  4G8L A;  5D66 A;  5FIO A;  1IKN D;  1K1B A;  3NOC D;  3KEA A;  4DX7 D;  2MYO A;  3UTM A;  3AJI A;  1AP7 A;  1NFI E;  5ENT D;  1A5E A;  2AJA A;  2RFM A;  1K1A A;  3ZKJ A;  4CZ2 D;  5CED B;  4DRX E;  4DX6 D;  5AQA A;  4HB5 A;  5EYL A;  3TWS A;  4HLL A;  3NBN B;  4HI8 A;  5HS0 A;  1OT8 A;  4DX5 D;  3ZNG A;  4GPM A;  3TWU A;  5EID A;  3Q9N C;  3AAA C;  5ENR D;  4DUI A;  3JUE A;  3B95 A;  1IHB A;  3EHQ A;  3IXE A;  2DZO A;  1MYO A;  1OY3 D;  3D9H A;  5KNH D;  2HE0 A;  4QQI A;  3LJN A;  2FO1 E;  4J8Y A;  3SO8 A;  1WDY A;  2DVW A;  4LSZ E;  3T8K A;  4BET A;  5EIL A;  3W9F A;  4BEP A;  3B7B A;  3TWQ A;  2DWZ A;  5CBO A;  4O1P A; 
#chains in the Genus database with same CATH topology
 3HXE A;  5KWD A;  5AEN A;  1QBQ A;  2WMN A;  1H2U A;  3QOU A;  4JEH A;  4U0U A;  5ENS D;  4TUM A;  3L17 A;  1OCZ E;  2CG2 A;  4EQF A;  1LD7 A;  4GU5 A;  1HH8 A;  2VSO E;  1Q2Z A;  4GTM A;  5ENN A;  4AXH A;  1OCC E;  3BU8 A;  2ZIR A;  2I2O A;  3SFY A;  1D8E A;  4AIF A;  3EU9 A;  3PVL A;  3RRM B;  3P2B A;  3FTV A;  3CQG B;  4MKT A;  4G23 A;  1Z6T A;  5C2Y A;  3ASH A;  3TWX A;  4I6J A;  4DJA A;  4JHK A;  2XCC A;  2J9Q A;  3TG4 A;  3PEU B;  1OXJ A;  4BX8 A;  3CV0 A;  3SI5 A;  3BG0 B;  3CVY A;  1OWN A;  4OAU C;  4KZC A;  1LD8 A;  3PZ1 A;  4UWH A;  3E4B A;  3Q73 A;  2WXP A;  3I4G A;  3QAQ A;  3AS8 A;  1MHQ A;  3DSS A;  3C98 A;  5HS0 A;  4ILH B;  3CK7 A;  1MYO A;  4U0Z A;  4A3T A;  3QWV A;  4WWO A;  2WPV A;  3C3R A;  3FTY A;  3ML9 A;  1SVX A;  4AEZ C;  3AG1 E;  4I6G A;  3PNL B;  3FTZ A;  3NOG D;  1UJJ A;  2ZIS A;  3PEV B;  3F6Q A;  2QYU A;  3ASG A;  3OTN A;  3QDN A;  1TN6 A;  2EIL E;  1TNU A;  1X81 A;  3PZD A;  3CHR A;  4A3V A;  3KEZ A;  1INZ A;  1DNP A;  4MS6 A;  2WXN A;  4UWK A;  1U3C A;  2DYS E;  5D0Q D;  4Q94 A;  3DEP A;  4ANX A;  4F6R D;  4WNG A;  1ZB1 A;  2OEW A;  3LY9 A;  4IYP A;  2I9C A;  2L0I A;  5FQ8 A;  3SF4 A;  4GPK A;  4WNE A;  3FU3 A;  2A5U A;  3PE3 A;  3DRA A;  2R02 A;  3ZHE B;  5AYW D;  3U4T A;  3Q47 B;  5LCW C;  5AJL A;  1JCS A;  3ZPJ A;  1NZN A;  3EDT B;  5ANR A;  2A5E A;  1E8Y A;  5D66 A;  3DSW A;  4ACK A;  3AJI A;  4N3C A;  1NFI E;  5CRU A;  3CHM A;  5AQA A;  3EU5 A;  4G26 A;  3VLE A;  5KJK A;  4GZ6 A;  1WY6 A;  2WQH A;  1V55 E;  1S0P A;  1OY3 D;  3SNX A;  3ASO E;  1UJK A;  3MEK A;  3W9F A;  5HKP A;  1W3B A;  1S70 B;  3X2Q E;  3DWL G;  1N0Q A;  2GRR B;  3SFX A;  5HQ8 A;  1BI8 B;  4GYY A;  3W9G A;  4N3B A;  3CEQ A;  3E32 A;  2Y0B G;  2BUG A;  4JZY A;  1IYG A;  2MRI A;  4JB8 P;  2CFU A;  3EHR A;  5ENQ D;  2WXK A;  4UQX A;  5JJ6 A;  1MZC A;  3ZHE A;  5KJL A;  1FT2 A;  3ZYM A;  4KXK B;  3U3W A;  3UIO C;  2DZN A;  1BPO A;  2ION A;  4G1T A;  4N2S A;  1YYH A;  2JAB A;  1HS6 A;  4OVU A;  3NAW A;  3TAX A;  4JHJ A;  4C48 B;  2PZI A;  2AXU A;  4PDX A;  3ENE A;  2LUH A;  1BLX B;  5D2M C;  3S2A A;  2Q7F A;  4YVO A;  4I9E A;  4AOF A;  3LXU X;  4HOT A;  1AP7 A;  4PH4 B;  1A5E A;  5G04 C;  3CKC A;  1N52 A;  4FHK A;  4Y6W A;  5JJ7 A;  2X6K A;  2X6J A;  2J4D A;  2V8S E;  2DYR E;  4M3O A;  4QQI A;  2FO1 E;  4LSZ E;  3TWQ A;  2J49 A;  4FJY A;  2PNN A;  4J8E A;  1H6O A;  3G2U A;  1FCH A;  3ONK A;  2OOE A;  3ABL E;  3ML8 A;  3AU4 A;  3LCA A;  5FQ4 A;  4ANV A;  5LP0 A;  3ZFW A;  2XZT G;  1JCR A;  4LCT A;  3E37 A;  2P9K G;  2C0M A;  3IBE A;  3T5X A;  1YMP A;  4HRN A;  4X8Q A;  3QB2 A;  2OND A;  4ATG A;  1P5Q A;  2BKK B;  5HRY A;  3RU0 A;  1SZA A;  4KT6 B;  2KZT B;  1KZP A;  1Z3X A;  3APF A;  4A63 B;  3U66 A;  4U8V D;  4TV3 A;  3FUN A;  3JYS A;  5JMN D;  3G2V A;  1E8X A;  3CVV A;  4D10 C;  3HYM B;  4FA6 A;  3OXF A;  3GW4 A;  5T4Y A;  4BT9 A;  3D9I A;  5JA4 D;  2NYJ A;  5FWQ A;  5FIO A;  3KEA A;  4DX7 D;  3UTM A;  4MRU A;  4HOQ A;  2RFM A;  3ZKJ A;  2NXP A;  4I2W A;  2XGS A;  5IY5 E;  2F0Y A;  3AS5 A;  3ESK A;  5CMY A;  4DI4 A;  3QAR A;  4GZ3 A;  3LKU A;  2LAH A;  4AJW A;  3RKV A;  4AP2 A;  3LY7 A;  4J8Y A;  2VQ2 A;  3CHS A;  4BET A;  3B7R L;  4EZL A;  3RK6 A;  3FUK A;  3DPD A;  2ZGD A;  3ABK E;  3CGH A;  1ELW A;  4U8Y D;  2XPZ A;  3D9M A;  2NC9 A;  3VLD A;  3UM3 A;  4BWR A;  3DXM G;  2VSY A;  4B0Z A;  1BU9 A;  4GB9 A;  2X6F A;  2Y69 E;  2IO2 C;  4BES A;  2VJ8 A;  1X5B A;  4I43 A;  1O1R A;  2CFZ A;  2KZT A;  4BSZ B;  3CVQ A;  4NQ0 A;  2EQX A;  4HOR A;  2QC9 A;  5KCM A;  3D9J A;  2H6I A;  2R03 A;  3IHY A;  5EIB E;  4J8S A;  4LG6 A;  4XX5 A;  4YDO A;  3QWP A;  3ZYK A;  4RLY A;  2C2L A;  2R05 A;  2Y4U A;  4HXI A;  5M72 A;  3FHE A;  1XGW A;  2LAI A;  3HRA A;  3AU5 A;  2LXM A;  3ULQ A;  3L08 A;  3DSU A;  3TWT A;  2R59 A;  3LYA A;  3K9I A;  3B13 A;  4HRL A;  1EPU A;  3Q4A B;  3Q9U C;  4JEU A;  5EX3 A;  4G8L A;  4Q96 A;  4PS7 A;  5ANL A;  3ZYQ A;  2GRO B;  2AJA A;  3RSE G;  3FUJ A;  3NBN B;  4GZC A;  3ZNG A;  4GPM A;  2DCP A;  1SA4 A;  2YNQ A;  2E2E A;  2X3M A;  4LEU A;  2XGM A;  4ABN A;  5FQ7 A;  4EZK A;  2CHX A;  5FZS A;  3E34 A;  5AIJ A;  1SW6 A;  1HE8 A;  4GZD A;  3NZU A;  3LS8 A;  2Y1L E;  3FUI A;  3AG3 E;  4DI3 A;  1E7V A;  4R7L A;  3UIN C;  4NRH B;  2FEZ A;  4O60 A;  4HOU A;  4AY5 A;  3RRU A;  4URK A;  3C3Q A;  4A1G A;  4UQZ A;  2F8X K;  1ZU2 A;  4GCO A;  4B89 A;  1KZO A;  4JW1 A;  1WM5 A;  3TWW A;  1NP7 A;  3TL5 A;  1TNB A;  2ZU6 B;  1H2V C;  4K5C A;  3KSQ A;  4KMO A;  3L82 A;  5ITZ F;  1OWO A;  3CK9 A;  3ZIM A;  4U96 D;  3CHP A;  3C72 A;  3RAU A;  1L5J A;  4B93 B;  4ATZ D;  5BXO A;  3FTW A;  4FU3 A;  2KM4 A;  5LCW J;  4JPS A;  2MOW A;  3QK0 A;  5CHE E;  3FU0 A;  3BG1 B;  3TWR A;  3UM2 A;  2Y4T A;  4EPZ A;  1MX2 A;  3ZRH A;  3SZ7 A;  1TNZ A;  4APF A;  3WG7 E;  4A1S A;  2HYZ A;  1WAO 1;  3S7B A;  3JCK C;  3CLJ A;  4DX5 D;  3ASD A;  3HXD A;  3R7Q A;  3SGH A;  4FAD A;  1ELK A;  2DVW A;  1HXI A;  4O1P A;  3UM1 A;  1EF1 C;  2AXZ A;  2H6H A;  4L7T A;  3UT8 A;  4GTP A;  5KBA A;  4GMJ A;  5AQ7 A;  2IFU A;  4DK5 A;  4EZJ A;  5BXU A;  4U8H A;  3FUM A;  5G2N A;  5EN5 D;  4UWF A;  3V79 K;  4L1B A;  3LJ3 A;  2GRM A;  4YDE A;  3PZ2 A;  1DC2 A;  2XEV A;  1H6P A;  1S64 A;  1PY1 A;  3Q5M A;  1UOH A;  5AAO A;  3B7U X;  3UPV A;  1K8K G;  1TEZ A;  3ULE G;  3RIB A;  4XKB A;  3D9N A;  2QY7 A;  4ACL A;  1U3D A;  4MBG A;  2WXH A;  3HXC A;  3E30 A;  4JHR A;  1H6K A;  1A17 A;  1O5M A;  2OVF A;  5CMW A;  3SD5 A;  2KCV A;  4DX2 A;  3ABM E;  2J4B A;  4TXQ A;  2FF4 A;  3FEY A;  3JUI A;  1TNO A;  1XNF A;  1IHG A;  1UG3 A;  5A23 A;  4F7A A;  2AWI A;  4BTA A;  5B3S E;  3TGO A;  2BED A;  4UI9 K;  2XRZ A;  2GW1 A;  3MYV A;  5G04 J;  3EIQ C;  5EID A;  2YIN A;  2L9B A;  3KAE A;  4DUI A;  5BUZ A;  1SZ9 A;  2DZO A;  3DBS A;  2KCL A;  2CHW A;  1QZ2 A;  1UN8 A;  3D9O A;  2QFC A;  4U63 A;  3LPZ A;  4XZ4 A;  1V54 E;  2WXM A;  4BY6 A;  5AQB A;  1N94 A;  3LVQ E;  4UI9 J;  2VGE A;  4CYM D;  4XE0 A;  4Z68 A;  3TXN A;  3TG5 A;  4ZHB A;  5KJN A;  4GYO A;  2B6C A;  3T5V A;  2VTB B;  1E96 B;  2OCC E;  2V0P A;  3V30 A;  4J0U A;  4CT0 A;  3P1U A;  5JJT A;  4BSX A;  4G25 A;  4IN3 B;  3DXK G;  4TUU A;  2WQ6 A;  3O4Z A;  3Q75 A;  3OXL A;  4GTV A;  4YDW A;  4AV7 A;  2WXQ A;  3PRE A;  3UQ3 A;  1GW6 A;  4F3V A;  4GA1 A;  4WND A;  1KPS B;  4GTO A;  2XPI A;  2P9N G;  4F1P A;  3CVP A;  2XZD G;  4ANW A;  4DLO A;  4HS2 A;  1Z3Y A;  3ZW3 A;  4U7E B;  3EIJ A;  3D9P A;  4BFR A;  1DVP A;  4B8C B;  3LDZ A;  1OCR E;  5EYL A;  3TWS A;  5EX0 A;  4XIF A;  3ASN E;  4I1M A;  4OYS A;  1B89 A;  5BV1 A;  2GGF A;  4N5Q A;  3FU6 A;  4E85 A;  3UMV A;  5CCM A;  2XEE A;  3AG2 E;  3PUJ A;  2VTB A;  4WWP A;  4K0R A;  4HBD A;  4HRM B;  3WXX A;  3CST A;  4TXR A;  5CER B;  3HG0 D;  2L6J A;  4RSY A;  4APO A;  3L6A A;  5FQ6 A;  4Q69 A;  1TR4 A;  2VGX A;  3VTX A;  2ETC A;  2E0I A;  4L2L A;  3I5P A;  4UI9 C;  3DPY A;  4LNU D;  1D8D A;  4H7Y A;  3C3O A;  1OWL A;  4G11 A;  1TNY A;  3OAW A;  3JQ0 A;  1UN9 A;  4GCN A;  3LY8 A;  5KJM A;  3PNT B;  4U95 D;  3GZS A;  4JD2 G;  5A7D B;  4I6E A;  2B0O E;  2PQR A;  3SFZ A;  4HVB A;  4LNG A;  1Z5S C;  3L54 A;  5ARF A;  1MX4 A;  4BTB A;  3GYZ A;  1IKN D;  1TN8 A;  3NB2 A;  3FEX A;  5CED B;  2X6I A;  2ILR A;  4JA9 A;  5T8I A;  3MV2 B;  3ESL A;  1N4R A;  3B95 A;  3FY4 A;  2VYI A;  2AW6 A;  2RG8 A;  1WDY A;  4DPR A;  3QNK A;  2DWZ A;  3LEW A;  3Q7F A;  2UY1 A;  5AAR A;  4K5B A;  2RFA A;  3UXG A;  2A4Z A;  2QZA A;  3T9K A;  1NA3 A;  4RG9 A;  3MV3 B;  3FUD A;  4KBQ A;  4BT8 A;  4QFV A;  3HDX A;  3JXJ A;  4ZFH A;  2FBN A;  2VSX E;  3V2X A;  2BKG A;  3GZ1 A;  2WQ7 A;  2BTD A;  5C1D A;  3FH5 A;  2WMO A;  4LUN U;  5B1B E;  2ETA A;  2J08 A;  2V4H C;  4I17 A;  3DST A;  5HI7 A;  3EHN A;  1D9S A;  3AG4 E;  3CVU A;  4KZ0 A;  5CEA A;  5AN8 A;  4AY6 A;  3FTS A;  3ZUV B;  1QYM A;  4HNA D;  4HQD A;  1OWM A;  3APD A;  2IOL A;  4J8F A;  4UWL A;  4IRU A;  4RQI A;  3BUA A;  3U64 A;  2MYO A;  4DX6 D;  3QWW A;  2I1J A;  4HLL A;  3MGB A;  4KVM A;  3Q9N C;  3FH8 A;  4CDR A;  5KNH D;  2WXI A;  2HE0 A;  3R9M A;  4FC8 A;  2JLB A;  2FUL A;  3UT4 A;  5EIL A;  3ASF A;  5T3R A;  4EBA G;  4C0M A;  4V3I A;  2HR2 A;  2QYJ A;  4O6F A;  3ZU7 B;  4I9C A;  2P9P G;  4FJZ A;  4XKC A;  5G55 A;  5H7P A;  2H6F A;  4GA2 A;  3ISM C;  4C0E A;  4M7C A;  2P9U G;  4WNF A;  1QNF A;  2MHK A;  2FI7 A;  3CK8 A;  4ANU A;  4I1O B;  2KCK A;  3IKO B;  1IQR A;  3TWV A;  4HI9 A;  2EIN E;  3HHM A;  4U07 A;  2IEJ A;  4EHM A;  2WXG A;  4FLH A;  3G2S A;  1WG0 A;  1UW4 B;  3FUH A;  5CCL A;  1MJ0 A;  2WXJ A;  3V2O A;  2R5S A;  2WXF A;  4F53 A;  3E33 A;  4CDM A;  1NL4 A;  1O1T A;  3FWV A;  3RRN B;  4PS3 A;  2J8S D;  3HVE B;  2XS1 A;  2H6G A;  1DCQ A;  5ARG A;  3KS2 A;  4J6I A;  4XEI G;  2XS8 A;  3Q79 A;  4IUL A;  1RZ4 A;  2WB2 A;  1K1B A;  3CVW A;  3O48 A;  1HF8 A;  2WXL A;  3EHQ A;  1IHB A;  1N4Q A;  3IV0 A;  3B7T A;  3VTY A;  4BX9 A;  1JUQ A;  4GYW A;  4RG6 A;  3KD7 A;  4I2Z A;  3V31 A;  4N39 A;  4N3A A;  2X6H A;  2ETB A;  2XCB A;  1IXV A;  5AQ9 A;  1E7U A;  4I1A A;  4JXT A;  5CEC B;  4KYO B;  5ENP D;  2GRL A;  3FDH A;  1HG5 A;  2XEH A;  5FJY A;  3CVX A;  5CRV A;  2DIW A;  3HXB A;  1KT0 A;  5JHA A;  3PUK A;  3DSV A;  3ZXP A;  4NAC A;  4G24 A;  2RKK A;  2LSV A;  5KNG A;  3C5R A;  3FUF A;  4FHJ A;  3HIZ A;  5A6C A;  3DSX A;  3PZ3 A;  5FIN A;  1DCE A;  2M63 A;  3HVE A;  2ZGG A;  5ENO D;  1OWP A;  4JVS A;  2OVB A;  4FUL A;  4O1O A;  1Y6I A;  3CVN A;  4PUC A;  3R7R A;  2J09 A;  3ONL A;  4NUR A;  1N9A A;  3FU5 A;  5DIZ A;  4J8D A;  5D0O D;  1NI1 A;  3BEE A;  3QJZ A;  2PQN A;  5ENT D;  4CZ2 D;  2ZXW E;  3L22 A;  4L2Y A;  3B7S A;  2IQC A;  4LNB A;  3TWU A;  3PE4 A;  5BPP A;  3UX4 A;  4AVX A;  4N2Q A;  3FUE A;  4CGV A;  3SO8 A;  1ELR A;  3D3M A;  3B7B A;  4DRX E;  3URZ A;  2P9L G;  4JC8 A;  4TXP A;  2IY0 C;  1G3N B;  3ZEF A;  3G2T A;  1TJF A;  4HLE A;  4ME2 A;  4E6H A;  2OV8 A;  3MKQ B;  3PZ4 A;  1N54 A;  4OAV B;  1HG2 A;  2XHE A;  4JL0 A;  2P2C P;  2IF4 A;  5E75 A;  1K3Z D;  2IU1 A;  1KT1 A;  1N4P A;  3CVL A;  5LOZ A;  4LER A;  4AM9 A;  1YCS B;  1H19 A;  4MLP A;  3SBS A;  3MKR A;  4EBA A;  1OUV A;  3HXF A;  2KXP C;  2VSN A;  3CQC B;  4PS8 A;  3D9L A;  4GML A;  2AXV A;  2LNI A;  2IOS A;  3UT7 A;  3R9A B;  4U0S A;  3FUL A;  1N4S A;  4K03 A;  3Q7A A;  2XGO A;  3I3N A;  3L13 A;  2R2L A;  5E76 A;  2VGX B;  4CT4 A;  2P9S G;  4B94 A;  3Q49 B;  5J08 A;  3FP3 A;  1OT8 A;  2DBA A;  5B1A E;  2P58 C;  2PL2 A;  3D9H A;  2RD0 A;  1HFA A;  4HFG A;  3QKY A;  3MKQ A;  3IEG A;  2UWJ G;  4WWN A;  2WVI A;  4XI9 A;  1JPL A;  2WM9 A;  1JCQ A;  3GZ2 A;  5BV0 A;  3EJN A;  3ZGQ A;  3MZL B;  4TRQ A;  4GTQ A;  1JWG A;  1LTX A;  3UKR G;  2CHZ A;  3BQO A;  5LX8 A;  2F37 A;  4KVO A;  1E8Z A;  4CRW A;  2L6B A;  3SQV A;  2VGY A;  3VLF A;  4YVQ C;  4P29 A;  2BF0 X;  5EDS A;  3S7J A;  4UUC A;  1HO8 A;  5FZQ A;  3RJV A;  4BER A;  3QC1 A;  3MA5 A;  2UY1 B;  4GA0 A;  2J07 A;  1YA0 A;  4RVB A;  2GRP B;  3EHM A;  3Q15 A;  3CSF A;  5G05 J;  4XI0 A;  3APC A;  1HX8 A;  1H2T C;  1O1S A;  4U04 A;  2HO1 A;  4LRZ A;  3ZXS A;  3LVR E;  1K1A A;  5FZR A;  2YHC A;  2WXO A;  1OCO E;  3JQ1 A;  2LO6 A;  4ILG A;  2LSU A;  3AAA C;  3U9W A;  4DLQ A;  3TXM A;  5ENR D;  3Q78 A;  4FLB A;  3RO2 A;  2HM8 A;  5BW8 C;  1VDY A;  1N95 A;  4BEP A;  5CBO A;  3L16 A;  4HOS A;  4DX1 A;  4Y6C A;  2XQ0 A;  5LFA A;  2Y3A A;  3JXI A;  3I4R B;  2YQ8 A;  1N0R A;  5FT9 A;  4OVV A;  3G2W A;  3NF1 A;  4G8K A;  1H0A A;  5DBK A;  1FPP A;  4FP7 A;  4GTT A;  4YND A;  1ZBP A;  1HU3 A;  1U2V G;  1KLX A;  2XEN A;  2V5Q C;  1SA5 A;  3S7F A;  2IJG X;  3NZS A;  2GRN B;  5EYP F;  1TYQ G;  3SHF A;  3SY2 A;  5BT1 A;  3FTX A;  4K5A B;  3J5Q B;  3DEO A;  3IHV A;  1JWF A;  2CG3 A;  3J5P A;  3MCX A;  5AJD A;  5BNW A;  1SQM A;  1EDU A;  2KAT A;  1NA0 A;  1RW2 A;  4GTS A;  3KSL A;  3EUV A;  4GTR A;  4H7X A;  3MX3 A;  3NQP A;  4JA7 A;  1TN7 A;  3UKU G;  1IQU A;  4J7W A;  3UUX A;  2I1K A;  3PS6 A;  1PAQ A;  3ZN3 A;  4GZ5 A;  3CHQ A;  3UM0 A;  1PC2 A;  5CBN A;  2LXL A;  3NOC D;  3CHO A;  3CIA A;  3MJW A;  1E8W A;  1FVH A;  3FTU A;  4A55 A;  2WXR A;  2JEK A;  1S63 A;  5G05 C;  4ILI A;  2V5F A;  4L9P A;  3LJN A;  3ZYL A;  2C0L A;  3SBT B;  4GMR A;  2KC7 A;  1E90 A;  2F8Y A;  1FT1 A;  3L9T A;  4B8A A;  4G2V A;  4C9B B;  3OXG A;  3FFL A;  1QQE A;  3TJP A;  2XRY A;  2EIM E;  2R17 C;  3FH7 A;  3UIP C;  1MX6 A;  1AWC B;  2AVP A;  3ULY A;  3ZVV A;  1Y8M A;  2YHE A;  5EKQ D;  5JHB A;  4L23 A;  4CDN A;  4CGW A;  3T8M A;  2I6H A;  2L0T B;  2NSZ A;  2OEV A;  4UWG A;  4N5C A;  1N11 A;  2IO3 C;  4WAF A;  3UI2 A;  4NIK A;  4YDY A;  2V4L A;  1EYH A;  3AS4 A;  1HZ4 A;  4GAA A;  2FO7 A;  1TJC A;  2P9I G;  1BI7 B;  3CR3 A;  4W9R A;  3D9K A;  2X38 A;  1BD8 A;  1LF8 A;  4CEM A;  2PM6 A;  3PH0 C;  3PDN A;  3RO3 A;  3CKB A;  2KBX A;  4UQY A;  4CCA A;  2PM7 A;  4F1S A;  1MQS A;  4EEC A;  4HB5 A;  5FTP A;  3N71 A;  2XPY A;  4HI8 A;  1FVF A;  3S7D A;  3JUE A;  3IXE A;  3PRZ A;  5J90 A;  2EIJ E;  3T8K A;  4WUY A;  2EIK E;  2GRQ B; 
#chains in the Genus database with same CATH homology
 1SVX A;  5KWD A;  4N5Q A;  4GMR A;  1S70 B;  2ZGD A;  5HKP A;  4DX1 A;  2PNN A;  2QYJ A;  2F8Y A;  3NOG D;  4U8Y D;  1SW6 A;  5AAR A;  3ZU7 B;  4K5B A;  2RFA A;  3UXG A;  1G3N B;  3JXI A;  3V31 A;  3T9K A;  3F6Q A;  5KBA A;  1N0R A;  5AQB A;  2XEE A;  2Y1L E;  1N0Q A;  5ENS D;  5AQ7 A;  4TUM A;  2ETB A;  4G8K A;  1BU9 A;  2VGE A;  1IXV A;  4QFV A;  5AQ9 A;  4CYM D;  1BI8 B;  4Z68 A;  2XZT G;  4HBD A;  4OAV B;  3W9G A;  3JXJ A;  4HRM B;  4BES A;  4ZFH A;  5CEC B;  5ENP D;  5BXU A;  1MX6 A;  3V2X A;  1AWC B;  5EN5 D;  5CER B;  3HG0 D;  3V79 K;  2P2C P;  4O60 A;  2BKG A;  2Y0B G;  1YMP A;  4BSZ B;  4HRN A;  4JB8 P;  1DC2 A;  3EHR A;  2XEH A;  1K3Z D;  2XEN A;  2F37 A;  2QC9 A;  5ENQ D;  1TR4 A;  2V5Q C;  4ZHB A;  2F8X K;  3TWV A;  2ETA A;  2V4H C;  4HI9 A;  5EIB E;  5EYP F;  1N11 A;  3TWW A;  2BKK B;  3EU9 A;  3DEP A;  5HRY A;  2L6B A;  3V30 A;  1YCS B;  4LG6 A;  2ETC A;  4F6R D;  1UOH A;  5AAO A;  3UI2 A;  4UUC A;  4K5A B;  3J5Q B;  3DEO A;  4NIK A;  4LNU D;  4A63 B;  4RLY A;  4K5C A;  4YDY A;  5KNG A;  4U8V D;  4BER A;  1D9S A;  2DZN A;  2KXP C;  3C5R A;  1WG0 A;  3J5P A;  1MJ0 A;  5CEA A;  5AN8 A;  5FIN A;  4YDW A;  3V2O A;  5ITZ F;  5JMN D;  2ZGG A;  3ZUV B;  1YYH A;  3HRA A;  2JAB A;  3TWX A;  4U96 D;  1BI7 B;  4U95 D;  5ENO D;  4B93 B;  4ATZ D;  5BXO A;  1QYM A;  4J7W A;  4DX2 A;  4HNA D;  4HQD A;  4C48 B;  2B0O E;  4O1O A;  5JA4 D;  1BD8 A;  3TWT A;  2NYJ A;  2J8S D;  1BLX B;  3TWR A;  1DCQ A;  4HRL A;  4F1P A;  2A5E A;  4OAU C;  2XZD G;  1MX4 A;  3Q9U C;  1MX2 A;  5CBN A;  2KBX A;  4G8L A;  5D66 A;  5FIO A;  1IKN D;  1K1B A;  3NOC D;  3KEA A;  4DX7 D;  2MYO A;  3UTM A;  3AJI A;  1AP7 A;  1NFI E;  5ENT D;  1A5E A;  2AJA A;  2RFM A;  1K1A A;  3ZKJ A;  4CZ2 D;  5CED B;  4DRX E;  4DX6 D;  5AQA A;  4HB5 A;  5EYL A;  3TWS A;  4HLL A;  3NBN B;  4HI8 A;  5HS0 A;  1OT8 A;  4DX5 D;  3ZNG A;  4GPM A;  3TWU A;  5EID A;  3Q9N C;  3AAA C;  5ENR D;  4DUI A;  3JUE A;  3B95 A;  1IHB A;  3EHQ A;  3IXE A;  2DZO A;  1MYO A;  1OY3 D;  3D9H A;  5KNH D;  2HE0 A;  4QQI A;  3LJN A;  2FO1 E;  4J8Y A;  3SO8 A;  1WDY A;  2DVW A;  4LSZ E;  3T8K A;  4BET A;  5EIL A;  3W9F A;  4BEP A;  3B7B A;  3TWQ A;  2DWZ A;  5CBO A;  4O1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...