5JMND

Fusidic acid bound acrb
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB
publication title Transport of lipophilic carboxylates is mediated by transmembrane helix 2 in multidrug transporter AcrB.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein
total genus 47
structure length 158
sequence length 158
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5jmnD00
1BI7B 3J5QB 5FINA 2Y1LE 4G8LA 5EYPF 2VGEA 3JXIA 1IXVA 4F1PA 5ENOD 2RFAA 4U8YD 5KNHD 3TWXA 5AQ9A 5AAOA 5CEDB 2FO1E 2BKGA 2XZTG 2XEEA 4J8YA 2DVWA 4U95D 4CZ2D 4LSZE 3TWQA 5AQ7A 3ZU7B 3HRAA 5EIDA 3TWWA 3ZKJA 2F37A 4HNAD 4HRMB 3T8KA 1IKND 2V5QC 1DC2A 3EHQA 2DZOA 4HRLA 5EILA 4HB5A 1MYOA 2PNNA 3NBNB 2ETBA 4UUCA 3F6QA 4TUMA 4O60A 4BETA 2NYJA 2ZGGA 5JA4D 3B7BA 5JMND 5KNGA 4U8VD 4YDWA 1MX4A 3NOCD 5CECB 2MYOA 3V31A 1A5EA 4BESA 3AAAC 5KWDA 1YMPA 1WDYA 3JUEA 2ETCA 5ENRD 1MX2A 1BD8A 5ENTD 5FIOA 4RLYA 4DRXE 5EIBE 2F8XK 5ENQD 4K5BA 4G8KA 1MJ0A 2ZGDA 4ZFHA 4Z68A 1TR4A 2BKKB 2QC9A 2XZDG 4HLLA 3B95A 1N0RA 1YYHA 2HE0A 2Y0BG 3IXEA 2L6BA 3Q9NC 4GPMA 3LJNA 2J8SD 2AJAA 5CEAA 4QQIA 1NFIE 4CYMD 3W9FA 4DX5D 1IHBA 4ZHBA 5HKPA 5HS0A 1D9SA 1YCSB 5ITZF 5EN5D 4DUIA 1WG0A 2RFMA 2A5EA 1N0QA 2KBXA 4BERA 4QFVA 5BXUA 1BI8B 3DEPA 3EU9A 3UTMA 3T9KA 3UI2A 4HQDA 5CERB 4HI9A 1BU9A 1MX6A 1UOHA 3TWVA 4ATZD 4DX2A 1DCQA 4J7WA 4N5QA 3TWRA 4BEPA 4YDYA 4O1PA 3NOGD 3ZUVB 5CBOA 2V4HC 1K3ZD 5AQBA 2KXPC 2QYJA 3C5RA 3TWTA 3AJIA 1SW6A 4BSZB 2JABA 4U96D 2XEHA 5AQAA 4OAVB 1K1AA 5AN8A 5EYLA 4K5CA 2XENA 4HI8A 5BXOA 4LNUD 4OAUC 3V2OA 1OT8A 1OY3D 1K1BA 5KBAA 3DEOA 4LG6A 5AARA 4DX1A 4NIKA 4GMRA 1AWCB 2F8YA 3HG0D 5ENPD 3V2XA 3V30A 3TWUA 1S70B 4B93B 4HRNA 4F6RD 3Q9UC 1QYMA 5D66A 3D9HA 3TWSA 4DX7D 4DX6D 4K5AB 4JB8P 3UXGA 1N11A 3EHRA 1BLXB 1SVXA 3JXJA 2P2CP 2B0OE 3J5PA 4C48B 3KEAA 4O1OA 3ZNGA 2DWZA 3SO8A 1G3NB 5HRYA 2DZNA 5ENSD 3W9GA 1AP7A 5CBNA 3V79K 4HBDA 2ETAA 4A63B
chains in the Genus database with same CATH superfamily
3SHFA 5G05C 3PEUB 4WAFA 5BV1A 5T3RA 3JXIA 3QKYA 5AQ9A 4PS7A 1O1SA 1U3DA 1W3BA 3ZKJA 5ARFA 1DC2A 4MS6A 2PNNA 3VLEA 1FT2A 5KJNA 3ZHEA 4U8VD 5CECB 4L2LA 4U7EB 2X6KA 3UIPC 2I1JA 4C9BB 1PAQA 3TXNA 4LERA 1XNFA 3G2SA 5FQ8A 3CK9A 3X2QE 4DUIA 1EPUA 1N94A 4HOTA 3ESKA 1BI8B 4FJZA 3T9KA 3SBTB 2KCLA 1JWGA 3TWVA 3OXGA 4YDYA 4EBAA 2KATA 3QOUA 1TJCA 3CVVA 3Q7AA 2P9LG 3LKUA 4KVMA 3ML9A 3MV2B 5KBAA 2J49A 2ZU6B 2OCCE 3MJWA 3TWUA 3E37A 1S70B 3DBSA 2XGSA 1TNOA 4GA1A 3D9HA 4TXPA 3HHMA 4L9PA 2WM9A 2IJGX 1E8WA 2ZIRA 4HOSA 2WQ7A 4CT0A 2V5FA 1BI7B 2Y1LE 1YA0A 4PDXA 2R02A 5CMWA 1OCCE 4N5CA 5KNHD 5KJKA 2HM8A 4GA0A 3CHRA 3HRAA 4WUYA 2HYZA 2V4LA 2NC9A 3L16A 4J8DA 3D9JA 1SZAA 1QQEA 1O1RA 1TN7A 3G2VA 5KWDA 4GZ6A 1SZ9A 1MX2A 2WB2A 2P9NG 2DYRE 2L6BA 3E4BA 3OTNA 3NF1A 2J8SD 2WMOA 2H6GA 2VSNA 5HS0A 4FU3A 3PREA 4U63A 3UM2A 5CCMA 4U0ZA 3S2AA 2AW6A 4G2VA 3SNXA 4J7WA 3PNTB 4J0UA 4W9RA 4YVOA 4O1PA 5CBOA 2QYJA 3TWTA 3CQGB 3G2UA 2OEWA 2XEHA 2L6JA 4K5CA 2XENA 4UI9K 3KSLA 4APOA 3ZPJA 3ESLA 3HG0D 4GTRA 4NACA 5ENPD 3V2XA 4B93B 2X3MA 4BTAA 1D8EA 3ULQA 2XHEA 4G11A 4UWKA 1TNBA 5BT1A 2J9QA 1OUVA 4GAAA 3C3RA 4RQIA 2GRPB 3TXMA 3EIQC 3ASGA 4ACKA 1UJJA 3FEXA 3SFYA 5KNGA 1S0PA 1MX4A 4DLQA 3Q75A 1HE8A 3Q78A 1OCZE 3KAEA 3LJNA 3CHQA 4ATGA 3FUFA 4JHKA 4TV3A 5D2MC 1YCSB 1WG0A 4G23A 4NQ0A 3UTMA 3L82A 2AXVA 1UOHA 4N5QA 2Q7FA 2WXNA 5B1AE 3NAWA 1HG2A 2CHZA 3C5RA 3U66A 5JJTA 3GZ1A 3DXKG 4APFA 4O6FA 3TG5A 5CRVA 4M3OA 1NI1A 1LD8A 3HVEB 5A7DB 3TJPA 4JEHA 4MKTA 3MGBA 1HU3A 3Q5MA 3VTYA 4L23A 3HYMB 3LJ3A 3W9GA 1ELWA 3PZ2A 5G2NA 5FZSA 3RIBA 3MCXA 2B6CA 4UQXA 1Y6IA 5AQ7A 4LNGA 3QDNA 4BX8A 3ZRHA 3DSXA 2LSUA 4XKBA 5BV0A 2HR2A 4Y6CA 4BETA 3B7BA 1DNPA 4A55A 1A5EA 4RLYA 1H0AA 2FULA 2BKKB 2Y0BG 3IXEA 3NB2A 3SF4A 3AU5A 4QQIA 1K8KG 4GYWA 3W9FA 4CYMD 4ZHBA 2CFZA 3HDXA 3CKCA 3UT8A 4I9CA 4YDOA 2XS1A 3PE4A 3URZA 4GZCA 2JLBA 2Y4UA 3ZYMA 2LO6A 1N54A 3KEZA 1LF8A 4ANWA 5BPPA 3QK0A 1IHGA 4LCTA 1E8ZA 3UX4A 3QC1A 4RG9A 1OT8A 4GZDA 3FUNA 4BFRA 3BU8A 4URKA 4DX1A 2PQRA 1FPPA 1E8YA 5CCLA 3E30A 5AYWD 4JB8P 4J8FA 2V8SE 4B0ZA 3JXJA 4BWRA 4O1OA 3UKUG 2KM4A 3FH8A 3L6AA 4EZJA 4N3AA 2WXRA 1WAO1 3AG4E 3B13A 3ABKE 5EYPF 5BUZA 2FEZA 1NL4A 1S64A 1ELRA 2X6FA 3JQ1A 2GRNB 5DBKA 2LSVA 2DZOA 3CK7A 4UWGA 4TUMA 5B1BE 3ONLA 2MYOA 4FLHA 3DSTA 3MEKA 5EIBE 1OWMA 4ANVA 3ASOE 2XZDG 2DYSE 4BT8A 1JWFA 1OWNA 2HO1A 1N95A 2KC7A 4LNBA 5T4YA 1N0QA 2OVBA 2E2EA 4BERA 2IONA 2YHEA 3Q15A 3Q7FA 1UG3A 4HQDA 5FWQA 3RO2A 4AEZC 3SGHA 3MA5A 1BU9A 4FHJA 1UW4B 4N39A 2KXPC 2MRIA 2WXJA 3R7QA 3C3QA 3CSFA 2KZTB 3ZIMA 2OEVA 2GRRB 4FLBA 1E7UA 3HXBA 2XQ0A 3APCA 4DX7D 4K5AB 3DPYA 2GRMA 4ACLA 2L0IA 4Q69A 3ZNGA 5HRYA 3J5QB 4GYOA 3PZDA 4ILIA 4B89A 1H6KA 4GTMA 1E96B 3QWWA 4IYPA 1HH8A 5G55A 4PH4B 2FF4A 4UWFA 3F6QA 2GGFA 3NOCD 5D0OD 1YMPA 3CVXA 5ENRD 3UKRG 4GTTA 4J8EA 4HLLA 1RZ4A 4A1GA 3TGOA 3FTUA 1HZ4A 1NFIE 4RSYA 1H2VC 4OYSA 4FADA 4M7CA 1E8XA 3CHMA 1NZNA 3FTXA 4HORA 3PH0C 4Q96A 3PNLB 1INZA 4FJYA 3QWPA 3O48A 3FTYA 3LYAA 1JCQA 1TNZA 3ABME 1ZBPA 5AQBA 5B3SE 2IOSA 2YNQA 1K1AA 2WXIA 3E32A 5EYLA 4FA6A 3C98A 4HVBA 2PL2A 4HS2A 4I1AA 3S7FA 4HOUA 2CFUA 4AP2A 3T5XA 5E76A 4JA7A 4XX5A 2QFCA 1KT1A 2H6IA 3EHRA 3PDNA 2P2CP 1TNYA 4N3BA 5ANLA 4A3TA 4C48B 5AJLA 2J08A 3PZ4A 3D3MA 4JC8A 5HI7A 5CBNA 4UI9J 5A23A 5JHBA 4G8LA 3KD7A 3N71A 2XEVA 1UN9A 2DVWA 4DJAA 2NXPA 2MOWA 4ANUA 3FUHA 5H7PA 4AIFA 3PZ3A 3IBEA 4HOQA 1IKND 3MV3B 3EHNA 3PRZA 4TRQA 4E6HA 3MX3A 1MYOA 1OCRE 2RG8A 3ZGQA 2EIJE 4GMLA 2NYJA 4BESA 3BEEA 3QARA 4U0UA 5FIOA 5ENQD 4K5BA 4ZFHA 1NA0A 1TR4A 3LVQE 3B95A 2P9KG 4B94A 2I9CA 2AJAA 4AXHA 1IHBA 4LRZA 2ONDA 5CHEE 4F7AA 2M63A 5FZRA 3B7SA 4GTSA 3R9MA 2IF4A 4NRHB 2R05A 1DCQA 3CVLA 3FUEA 2V4HC 1K3ZD 1SW6A 4CDMA 4XI0A 5AQAA 3IHYA 4HI8A 3V2OA 1K1BA 3CVNA 4ILGA 3FP3A 4ANXA 3TG4A 1V55E 1H2TC 3LS8A 2J4DA 1QYMA 3FULA 1H19A 1SVXA 4XIFA 1SA5A 3NQPA 2IFUA 4JEUA 4HBDA 3ZYLA 3ZVVA 4AY5A 4K03A 1IXVA 4I17A 4J8YA 3L54A 2UY1B 3TWWA 3EJNA 4KXKB 2GW1A 3QB2A 2ILRA 1HG5A 1JCSA 4BSXA 1Z5SC 2KZTA 3RU0A 3QNKA 5ENTD 1PY1A 4AM9A 2FI7A 1JPLA 1IYGA 4G8KA 3RJVA 2QC9A 2IOLA 5JHAA 3UPVA 1OWOA 4G26A 3UT7A 2RFMA 2L0TB 4KMOA 4MLPA 3ONKA 4RVBA 4I6EA 3S7DA 4I6GA 4ATZD 2V0PA 4DK5A 3CIAA 3PS6A 3FU6A 3JYSA 3AJIA 4CDRA 4PS3A 3FHEA 4LNUD 3DSSA 1ZB1A 5LOZA 3R9AB 3HXCA 4UQZA 4F6RD 5JJ6A 2BTDA 1N11A 4C0EA 2J07A 3SO8A 4BTBA 4L1BA 4A63B 5T8IA 4B8CB 2IO3C 3LY9A 4JVSA 4F1PA 5LX8A 3AS5A 2R5SA 2BKGA 2XZTG 3SZ7A 4KZ0A 3SI5A 4AVXA 4KBQA 4LUNU 1KZOA 3T8KA 4I1OB 3FTSA 3EHQA 1MZCA 3FU3A 1LD7A 3FUKA 4I9EA 4YDWA 1U2VG 3V31A 4DRXE 1TNUA 3APDA 3U9WA 2R59A 4U07A 1B89A 2P9SG 1E7VA 3FTWA 2A5EA 2AVPA 2DCPA 4FHKA 3QAQA 4I6JA 3EU9A 5IY5E 3ZXPA 4V3IA 4L2YA 1OXJA 2X6HA 5CRUA 1MX6A 5J08A 3C72A 4OVVA 3KS2A 5LCWJ 3ZFWA 1ZU2A 3FH5A 2FBNA 3CLJA 2P58C 1TN8A 1Z3YA 4G24A 4OAUC 2WXOA 3LCAA 4K0RA 2CHWA 1MQSA 5FT9A 3L13A 2XRZA 3I4GA 3EU5A 3UXGA 2WXMA 4EECA 4G1TA 2B0OE 3FU5A 2YHCA 4DI4A 1G3NB 2AXUA 1KT0A 1WM5A 3FEYA 1HO8A 2WXQA 4RG6A 4AY6A 5ENOD 1X5BA 2F0YA 3IV0A 2IQCA 3LVRE 1KPSB 3FU0A 4GU5A 3ABLE 2ZISA 4JPSA 2BEDA 5ENNA 1GW6A 1WY6A 3FH7A 1OWLA 3RRUA 3CSTA 3D9IA 3LY8A 4JHJA 2IU1A 2GRLA 3AG1E 2WXLA 4EHMA 2EILE 3WXXA 3LDZA 3RAUA 3PUKA 1YYHA 3Q9NC 3AU4A 5CEAA 4KYOB 3LXUX 2WQ6A 1KLXA 2P9PG 1QBQA 1H6PA 3UUXA 1QNFA 1BPOA 2XS8A 4XKCA 4GTOA 3SY2A 4Y6WA 5AIJA 3BG1B 3NZSA 3NOGD 2AXZA 3JUIA 1VDYA 3L08A 3GW4A 4MRUA 2UY1A 1KZPA 2JABA 4U96D 3I3NA 2XPYA 3G2WA 4FULA 4N2QA 3EHMA 2X6IA 4H7XA 5EKQD 3DPDA 5KCMA 2YQ8A 4KZCA 4CGWA 3Q9UC 3TWSA 3CHSA 4CT4A 4GYYA 2RKKA 2EQXA 2DWZA 1JCRA 5JJ7A 3DSWA 4JD2G 4OVUA 2J4BA 3V79K 3L9TA 4HXIA 5J90A 2VJ8A 3JCKC 3OXLA 1HS6A 4XI9A 4AJWA 3FWVA 3ISMC 2AWIA 3ASDA 4N2SA 2LAHA 4E85A 4U95D 3ZU7B 4HNAD 1U3CA 2NSZA 2BF0X 2GRQB 3FDHA 2QYUA 4HB5A 3RSEG 3OXFA 1NA3A 4UUCA 2ZGGA 2J09A 3NZUA 3R7RA 2XPIA 2OV8A 4DPRA 1MJ0A 2XRYA 3OAWA 3FTVA 4GPMA 2RD0A 3FFLA 4AOFA 3SD5A 3CVWA 4CGVA 5LCWC 3CGHA 1Q2ZA 5DIZA 4EZLA 5BXUA 3UI2A 3EIJA 4F1SA 2GROB 3HVEA 1HX8A 4JA9A 2CHXA 3UT4A 3SFXA 3ZW3A 3K9IA 4BEPA 4U0SA 2R2LA 3CVYA 4LEUA 1FCHA 1N4QA 4TXQA 4OAVB 1IQRA 1S63A 4I43A 4WNDA 3MYVA 4WWOA 2PM7A 4FC8A 3U4TA 3DEOA 2F8YA 3LPZA 4IN3B 1X81A 3G2TA 1PC2A 4CEMA 5G04J 4UQYA 2H6FA 4I1MA 1D8DA 1AP7A 1P5QA 3QWVA 2PZIA 5D0QD 2A4ZA 1TJFA 2KCKA 2LXLA 2VGEA 5AAOA 2BUGA 1UJKA 1N4PA 4CZ2D 3T5VA 4JZYA 3TWQA 3CHPA 2QZAA 3ENEA 3CEQA 2Y4TA 3MKQB 4O60A 2XCBA 1XGWA 3AAAC 4HLEA 4U04A 4DI3A 4NURA 3UINC 3ZXSA 3BG0B 2E0IA 3I4RB 4DX5D 4GTPA 3DWLG 3PEVB 4CDNA 4EZKA 2R03A 3AG3E 3UM3A 4GPKA 1FVFA 1IQUA 2L9BA 2CG2A 1SQMA 1N4RA 3CHOA 5EDSA 4JHRA 4GA2A 4YNDA 4IULA 1OCOE 4BT9A 5EX0A 4HRNA 4UWLA 4DX6D 4H7YA 1BLXB 4J8SA 3RO3A 3Q47B 5FQ7A 3SBSA 3CQCB 3E33A 2EINE 1JUQA 4CRWA 3PZ1A 4JXTA 2MHKA 2DIWA 4U8YD 3HXEA 4B8AA 2VGXB 4A3VA 3TAXA 2V5QC 2WPVA 2VQ2A 3D9LA 2UWJG 5EILA 3NBNB 5C2YA 3Q4AB 1FT1A 1N52A 1N4SA 3JUEA 4Z68A 4JL0A 2JEKA 1SA4A 2IY0C 4GTQA 4WNFA 1O5MA 2EIKE 3S7BA 3C3OA 5HKPA 5FJYA 1H2UA 2X38A 3APFA 4TXRA 4MBGA 4WNEA 4QFVA 4P29A 3IHVA 4U8HA 4HI9A 2WXKA 1L5JA 4PUCA 5BW8C 3ZUVB 2YINA 4F53A 1Z6TA 4BSZB 2VYIA 5AN8A 5G04C 5BXOA 3CKBA 4KT6B 5KJMA 3UMVA 2CG3A 3B7UX 4GMRA 3T8MA 4GMJA 3WG7E 3CVPA 1HXIA 3IKOB 3J5PA 4AV7A 1OWPA 2VSXE 4ME2A 3UQ3A 2VTBB 4R7LA 3RKVA 2DBAA 4TUUA 2RFAA 2Y69E 4UI9C 3ASNE 3DSVA 2OOEA 4LSZE 2H6HA 2XGMA 2I2OA 3EDTB 3S7JA 3ASHA 5FQ6A 3ZN3A 4ILHB 2XGOA 1EYHA 5E75A 2WXPA 4ABNA 4JW1A 1QZ2A 1DCEA 3D9OA 1LTXA 4GZ5A 3MKRA 2WXGA 5AJDA 1UN8A 1N0RA 4XZ4A 1ELKA 3UIOC 1TN6A 5LFAA 1N9AA 3FTZA 3FUMA 4I2WA 2KBXA 2X6JA 4PS8A 4XE0A 4WNGA 2FO7A 4DX2A 3CVUA 4GTVA 3TWRA 3E34A 1EF1C 4L7TA 3ZHEB 2XPZA 5C1DA 3HXDA 2PM6A 1EDUA 3MKQA 3LEWA 3JQ0A 3CR3A 3TL5A 3L17A 2IEJA 3RRNB 2OVFA 3IEGA 5ANRA 3VLFA 1Y8MA 5HQ8A 2XCCA 3P2BA 2WXFA 2PQNA 3RRMB 4YDEA 5FQ4A 3VTXA 3ZYKA 3KSQA 2LNIA 2LUHA 5FTPA 3UM1A 1Z3XA 3PE3A 5EIDA 4HRMB 1E90A 3D9KA 3RK6A 3L22A 5G05J 3ZEFA 1O1TA 1TYQG 3B7TA 2WXHA 3GZSA 5EX3A 5JA4D 5JMND 1TEZA 1RW2A 1MHQA 2ETCA 2VSYA 3D9MA 2ZGDA 2ZXWE 3D9PA 5LP0A 2I6HA 2WMNA 3CV0A 4J6IA 4XEIG 5EN5D 2P9IG 4A1SA 3DSUA 3D9NA 3P1UA 3GZ2A 5A6CA 4DLOA 3PVLA 3FY4A 2WQHA 4KVOA 3ULYA 2R17C 4EQFA 2Y3AA 3U64A 3B7RL 5FZQA 3AG2E 4I2ZA 3UM0A 3SQVA 2VGXA 1FVHA 2C0LA 1OY3D 4WWPA 5BNWA 4LG6A 5AARA 3Q73A 4NIKA 3LY7A 5AENA 1H6OA 2LXMA 1AWCB 3FUIA 4YVQC 3FUJA 2KCVA 3I5PA 3VLDA 3KEAA 4C0MA 4D10C 5ARGA 2DZNA 3HIZA 2LAIA 5FINA 3AS4A 4BX9A 3CK8A 3HXFA 1A17A 3TWXA 4GCNA 4F3VA 2FO1E 5CEDB 2XEEA 4HFGA 3U3WA 5CMYA 2F37A 4GZ3A 2EIME 2QY7A 4X8QA 4HRLA 4N3CA 4CCAA 2ETBA 2VGYA 3CVQA 1WDYA 1DVPA 1BD8A 2F8XK 3DXMG 4BY6A 2A5UA 3ZYQA 2I1KA 2HE0A 3ML8A 4G25A 1D9SA 4UWHA 5ITZF 5KJLA 3MZLB 4Q94A 2VSOE 3PUJA 3O4ZA 3ASFA 3DEPA 4GB9A 2WVIA 2VTBA 5CERB 3QJZA 4IRUA 3EUVA 5M72A 2C0MA 3FUDA 3DRAA 2IO2C 3GYZA 2C2LA 1V54E 1NP7A 3BUAA 4WWNA 3AS8A 4GCOA 3BQOA 1HF8A 3V30A 4FP7A 5D66A 4EPZA 3ULEG 3SFZA 4EBAG 2P9UG 3Q49B 1HFAA 3Q79A 5ENSD 2ETAA
chains in the Genus database with same CATH topology
1BI7B 3J5QB 5FINA 2Y1LE 4G8LA 5EYPF 2VGEA 3JXIA 1IXVA 4F1PA 5ENOD 2RFAA 4U8YD 5KNHD 3TWXA 5AQ9A 5AAOA 5CEDB 2FO1E 2BKGA 2XZTG 2XEEA 4J8YA 2DVWA 4U95D 4CZ2D 4LSZE 3TWQA 5AQ7A 3ZU7B 3HRAA 5EIDA 3TWWA 3ZKJA 2F37A 4HNAD 4HRMB 3T8KA 1IKND 2V5QC 1DC2A 3EHQA 2DZOA 4HRLA 5EILA 4HB5A 1MYOA 2PNNA 3NBNB 2ETBA 4UUCA 3F6QA 4TUMA 4O60A 4BETA 2NYJA 2ZGGA 5JA4D 3B7BA 5JMND 5KNGA 4U8VD 4YDWA 1MX4A 3NOCD 5CECB 2MYOA 3V31A 1A5EA 4BESA 3AAAC 5KWDA 1YMPA 1WDYA 3JUEA 2ETCA 5ENRD 1MX2A 1BD8A 5ENTD 5FIOA 4RLYA 4DRXE 5EIBE 2F8XK 5ENQD 4K5BA 4G8KA 1MJ0A 2ZGDA 4ZFHA 4Z68A 1TR4A 2BKKB 2QC9A 2XZDG 4HLLA 3B95A 1N0RA 1YYHA 2HE0A 2Y0BG 3IXEA 2L6BA 3Q9NC 4GPMA 3LJNA 2J8SD 2AJAA 5CEAA 4QQIA 1NFIE 4CYMD 3W9FA 4DX5D 1IHBA 4ZHBA 5HKPA 5HS0A 1D9SA 1YCSB 5ITZF 5EN5D 4DUIA 1WG0A 2RFMA 2A5EA 1N0QA 2KBXA 4BERA 4QFVA 5BXUA 1BI8B 3DEPA 3EU9A 3UTMA 3T9KA 3UI2A 4HQDA 5CERB 4HI9A 1BU9A 1MX6A 1UOHA 3TWVA 4ATZD 4DX2A 1DCQA 4J7WA 4N5QA 3TWRA 4BEPA 4YDYA 4O1PA 3NOGD 3ZUVB 5CBOA 2V4HC 1K3ZD 5AQBA 2KXPC 2QYJA 3C5RA 3TWTA 3AJIA 1SW6A 4BSZB 2JABA 4U96D 2XEHA 5AQAA 4OAVB 1K1AA 5AN8A 5EYLA 4K5CA 2XENA 4HI8A 5BXOA 4LNUD 4OAUC 3V2OA 1OT8A 1OY3D 1K1BA 5KBAA 3DEOA 4LG6A 5AARA 4DX1A 4NIKA 4GMRA 1AWCB 2F8YA 3HG0D 5ENPD 3V2XA 3V30A 3TWUA 1S70B 4B93B 4HRNA 4F6RD 3Q9UC 1QYMA 5D66A 3D9HA 3TWSA 4DX7D 4DX6D 4K5AB 4JB8P 3UXGA 1N11A 3EHRA 1BLXB 1SVXA 3JXJA 2P2CP 2B0OE 3J5PA 4C48B 3KEAA 4O1OA 3ZNGA 2DWZA 3SO8A 1G3NB 5HRYA 2DZNA 5ENSD 3W9GA 1AP7A 5CBNA 3V79K 4HBDA 2ETAA 4A63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI7 B;  3J5Q B;  5FIN A;  2Y1L E;  4G8L A;  5EYP F;  2VGE A;  3JXI A;  1IXV A;  4F1P A;  5ENO D;  2RFA A;  4U8Y D;  5KNH D;  3TWX A;  5AQ9 A;  5AAO A;  5CED B;  2FO1 E;  2BKG A;  2XZT G;  2XEE A;  4J8Y A;  2DVW A;  4U95 D;  4CZ2 D;  4LSZ E;  3TWQ A;  5AQ7 A;  3ZU7 B;  3HRA A;  5EID A;  3TWW A;  3ZKJ A;  2F37 A;  4HNA D;  4HRM B;  3T8K A;  1IKN D;  2V5Q C;  1DC2 A;  3EHQ A;  2DZO A;  4HRL A;  5EIL A;  4HB5 A;  1MYO A;  2PNN A;  3NBN B;  2ETB A;  4UUC A;  3F6Q A;  4TUM A;  4O60 A;  4BET A;  2NYJ A;  2ZGG A;  5JA4 D;  3B7B A;  5JMN D;  5KNG A;  4U8V D;  4YDW A;  1MX4 A;  3NOC D;  5CEC B;  2MYO A;  3V31 A;  1A5E A;  4BES A;  3AAA C;  5KWD A;  1YMP A;  1WDY A;  3JUE A;  2ETC A;  5ENR D;  1MX2 A;  1BD8 A;  5ENT D;  5FIO A;  4RLY A;  4DRX E;  5EIB E;  2F8X K;  5ENQ D;  4K5B A;  4G8K A;  1MJ0 A;  2ZGD A;  4ZFH A;  4Z68 A;  1TR4 A;  2BKK B;  2QC9 A;  2XZD G;  4HLL A;  3B95 A;  1N0R A;  1YYH A;  2HE0 A;  2Y0B G;  3IXE A;  2L6B A;  3Q9N C;  4GPM A;  3LJN A;  2J8S D;  2AJA A;  5CEA A;  4QQI A;  1NFI E;  4CYM D;  3W9F A;  4DX5 D;  1IHB A;  4ZHB A;  5HKP A;  5HS0 A;  1D9S A;  1YCS B;  5ITZ F;  5EN5 D;  4DUI A;  1WG0 A;  2RFM A;  2A5E A;  1N0Q A;  2KBX A;  4BER A;  4QFV A;  5BXU A;  1BI8 B;  3DEP A;  3EU9 A;  3UTM A;  3T9K A;  3UI2 A;  4HQD A;  5CER B;  4HI9 A;  1BU9 A;  1MX6 A;  1UOH A;  3TWV A;  4ATZ D;  4DX2 A;  1DCQ A;  4J7W A;  4N5Q A;  3TWR A;  4BEP A;  4YDY A;  4O1P A;  3NOG D;  3ZUV B;  5CBO A;  2V4H C;  1K3Z D;  5AQB A;  2KXP C;  2QYJ A;  3C5R A;  3TWT A;  3AJI A;  1SW6 A;  4BSZ B;  2JAB A;  4U96 D;  2XEH A;  5AQA A;  4OAV B;  1K1A A;  5AN8 A;  5EYL A;  4K5C A;  2XEN A;  4HI8 A;  5BXO A;  4LNU D;  4OAU C;  3V2O A;  1OT8 A;  1OY3 D;  1K1B A;  5KBA A;  3DEO A;  4LG6 A;  5AAR A;  4DX1 A;  4NIK A;  4GMR A;  1AWC B;  2F8Y A;  3HG0 D;  5ENP D;  3V2X A;  3V30 A;  3TWU A;  1S70 B;  4B93 B;  4HRN A;  4F6R D;  3Q9U C;  1QYM A;  5D66 A;  3D9H A;  3TWS A;  4DX7 D;  4DX6 D;  4K5A B;  4JB8 P;  3UXG A;  1N11 A;  3EHR A;  1BLX B;  1SVX A;  3JXJ A;  2P2C P;  2B0O E;  3J5P A;  4C48 B;  3KEA A;  4O1O A;  3ZNG A;  2DWZ A;  3SO8 A;  1G3N B;  5HRY A;  2DZN A;  5ENS D;  3W9G A;  1AP7 A;  5CBN A;  3V79 K;  4HBD A;  2ETA A;  4A63 B; 
#chains in the Genus database with same CATH topology
 3SHF A;  5G05 C;  3PEU B;  4WAF A;  5BV1 A;  5T3R A;  3JXI A;  3QKY A;  5AQ9 A;  4PS7 A;  1O1S A;  1U3D A;  1W3B A;  3ZKJ A;  5ARF A;  1DC2 A;  4MS6 A;  2PNN A;  3VLE A;  1FT2 A;  5KJN A;  3ZHE A;  4U8V D;  5CEC B;  4L2L A;  4U7E B;  2X6K A;  3UIP C;  2I1J A;  4C9B B;  1PAQ A;  3TXN A;  4LER A;  1XNF A;  3G2S A;  5FQ8 A;  3CK9 A;  3X2Q E;  4DUI A;  1EPU A;  1N94 A;  4HOT A;  3ESK A;  1BI8 B;  4FJZ A;  3T9K A;  3SBT B;  2KCL A;  1JWG A;  3TWV A;  3OXG A;  4YDY A;  4EBA A;  2KAT A;  3QOU A;  1TJC A;  3CVV A;  3Q7A A;  2P9L G;  3LKU A;  4KVM A;  3ML9 A;  3MV2 B;  5KBA A;  2J49 A;  2ZU6 B;  2OCC E;  3MJW A;  3TWU A;  3E37 A;  1S70 B;  3DBS A;  2XGS A;  1TNO A;  4GA1 A;  3D9H A;  4TXP A;  3HHM A;  4L9P A;  2WM9 A;  2IJG X;  1E8W A;  2ZIR A;  4HOS A;  2WQ7 A;  4CT0 A;  2V5F A;  1BI7 B;  2Y1L E;  1YA0 A;  4PDX A;  2R02 A;  5CMW A;  1OCC E;  4N5C A;  5KNH D;  5KJK A;  2HM8 A;  4GA0 A;  3CHR A;  3HRA A;  4WUY A;  2HYZ A;  2V4L A;  2NC9 A;  3L16 A;  4J8D A;  3D9J A;  1SZA A;  1QQE A;  1O1R A;  1TN7 A;  3G2V A;  5KWD A;  4GZ6 A;  1SZ9 A;  1MX2 A;  2WB2 A;  2P9N G;  2DYR E;  2L6B A;  3E4B A;  3OTN A;  3NF1 A;  2J8S D;  2WMO A;  2H6G A;  2VSN A;  5HS0 A;  4FU3 A;  3PRE A;  4U63 A;  3UM2 A;  5CCM A;  4U0Z A;  3S2A A;  2AW6 A;  4G2V A;  3SNX A;  4J7W A;  3PNT B;  4J0U A;  4W9R A;  4YVO A;  4O1P A;  5CBO A;  2QYJ A;  3TWT A;  3CQG B;  3G2U A;  2OEW A;  2XEH A;  2L6J A;  4K5C A;  2XEN A;  4UI9 K;  3KSL A;  4APO A;  3ZPJ A;  3ESL A;  3HG0 D;  4GTR A;  4NAC A;  5ENP D;  3V2X A;  4B93 B;  2X3M A;  4BTA A;  1D8E A;  3ULQ A;  2XHE A;  4G11 A;  4UWK A;  1TNB A;  5BT1 A;  2J9Q A;  1OUV A;  4GAA A;  3C3R A;  4RQI A;  2GRP B;  3TXM A;  3EIQ C;  3ASG A;  4ACK A;  1UJJ A;  3FEX A;  3SFY A;  5KNG A;  1S0P A;  1MX4 A;  4DLQ A;  3Q75 A;  1HE8 A;  3Q78 A;  1OCZ E;  3KAE A;  3LJN A;  3CHQ A;  4ATG A;  3FUF A;  4JHK A;  4TV3 A;  5D2M C;  1YCS B;  1WG0 A;  4G23 A;  4NQ0 A;  3UTM A;  3L82 A;  2AXV A;  1UOH A;  4N5Q A;  2Q7F A;  2WXN A;  5B1A E;  3NAW A;  1HG2 A;  2CHZ A;  3C5R A;  3U66 A;  5JJT A;  3GZ1 A;  3DXK G;  4APF A;  4O6F A;  3TG5 A;  5CRV A;  4M3O A;  1NI1 A;  1LD8 A;  3HVE B;  5A7D B;  3TJP A;  4JEH A;  4MKT A;  3MGB A;  1HU3 A;  3Q5M A;  3VTY A;  4L23 A;  3HYM B;  3LJ3 A;  3W9G A;  1ELW A;  3PZ2 A;  5G2N A;  5FZS A;  3RIB A;  3MCX A;  2B6C A;  4UQX A;  1Y6I A;  5AQ7 A;  4LNG A;  3QDN A;  4BX8 A;  3ZRH A;  3DSX A;  2LSU A;  4XKB A;  5BV0 A;  2HR2 A;  4Y6C A;  4BET A;  3B7B A;  1DNP A;  4A55 A;  1A5E A;  4RLY A;  1H0A A;  2FUL A;  2BKK B;  2Y0B G;  3IXE A;  3NB2 A;  3SF4 A;  3AU5 A;  4QQI A;  1K8K G;  4GYW A;  3W9F A;  4CYM D;  4ZHB A;  2CFZ A;  3HDX A;  3CKC A;  3UT8 A;  4I9C A;  4YDO A;  2XS1 A;  3PE4 A;  3URZ A;  4GZC A;  2JLB A;  2Y4U A;  3ZYM A;  2LO6 A;  1N54 A;  3KEZ A;  1LF8 A;  4ANW A;  5BPP A;  3QK0 A;  1IHG A;  4LCT A;  1E8Z A;  3UX4 A;  3QC1 A;  4RG9 A;  1OT8 A;  4GZD A;  3FUN A;  4BFR A;  3BU8 A;  4URK A;  4DX1 A;  2PQR A;  1FPP A;  1E8Y A;  5CCL A;  3E30 A;  5AYW D;  4JB8 P;  4J8F A;  2V8S E;  4B0Z A;  3JXJ A;  4BWR A;  4O1O A;  3UKU G;  2KM4 A;  3FH8 A;  3L6A A;  4EZJ A;  4N3A A;  2WXR A;  1WAO 1;  3AG4 E;  3B13 A;  3ABK E;  5EYP F;  5BUZ A;  2FEZ A;  1NL4 A;  1S64 A;  1ELR A;  2X6F A;  3JQ1 A;  2GRN B;  5DBK A;  2LSV A;  2DZO A;  3CK7 A;  4UWG A;  4TUM A;  5B1B E;  3ONL A;  2MYO A;  4FLH A;  3DST A;  3MEK A;  5EIB E;  1OWM A;  4ANV A;  3ASO E;  2XZD G;  2DYS E;  4BT8 A;  1JWF A;  1OWN A;  2HO1 A;  1N95 A;  2KC7 A;  4LNB A;  5T4Y A;  1N0Q A;  2OVB A;  2E2E A;  4BER A;  2ION A;  2YHE A;  3Q15 A;  3Q7F A;  1UG3 A;  4HQD A;  5FWQ A;  3RO2 A;  4AEZ C;  3SGH A;  3MA5 A;  1BU9 A;  4FHJ A;  1UW4 B;  4N39 A;  2KXP C;  2MRI A;  2WXJ A;  3R7Q A;  3C3Q A;  3CSF A;  2KZT B;  3ZIM A;  2OEV A;  2GRR B;  4FLB A;  1E7U A;  3HXB A;  2XQ0 A;  3APC A;  4DX7 D;  4K5A B;  3DPY A;  2GRM A;  4ACL A;  2L0I A;  4Q69 A;  3ZNG A;  5HRY A;  3J5Q B;  4GYO A;  3PZD A;  4ILI A;  4B89 A;  1H6K A;  4GTM A;  1E96 B;  3QWW A;  4IYP A;  1HH8 A;  5G55 A;  4PH4 B;  2FF4 A;  4UWF A;  3F6Q A;  2GGF A;  3NOC D;  5D0O D;  1YMP A;  3CVX A;  5ENR D;  3UKR G;  4GTT A;  4J8E A;  4HLL A;  1RZ4 A;  4A1G A;  3TGO A;  3FTU A;  1HZ4 A;  1NFI E;  4RSY A;  1H2V C;  4OYS A;  4FAD A;  4M7C A;  1E8X A;  3CHM A;  1NZN A;  3FTX A;  4HOR A;  3PH0 C;  4Q96 A;  3PNL B;  1INZ A;  4FJY A;  3QWP A;  3O48 A;  3FTY A;  3LYA A;  1JCQ A;  1TNZ A;  3ABM E;  1ZBP A;  5AQB A;  5B3S E;  2IOS A;  2YNQ A;  1K1A A;  2WXI A;  3E32 A;  5EYL A;  4FA6 A;  3C98 A;  4HVB A;  2PL2 A;  4HS2 A;  4I1A A;  3S7F A;  4HOU A;  2CFU A;  4AP2 A;  3T5X A;  5E76 A;  4JA7 A;  4XX5 A;  2QFC A;  1KT1 A;  2H6I A;  3EHR A;  3PDN A;  2P2C P;  1TNY A;  4N3B A;  5ANL A;  4A3T A;  4C48 B;  5AJL A;  2J08 A;  3PZ4 A;  3D3M A;  4JC8 A;  5HI7 A;  5CBN A;  4UI9 J;  5A23 A;  5JHB A;  4G8L A;  3KD7 A;  3N71 A;  2XEV A;  1UN9 A;  2DVW A;  4DJA A;  2NXP A;  2MOW A;  4ANU A;  3FUH A;  5H7P A;  4AIF A;  3PZ3 A;  3IBE A;  4HOQ A;  1IKN D;  3MV3 B;  3EHN A;  3PRZ A;  4TRQ A;  4E6H A;  3MX3 A;  1MYO A;  1OCR E;  2RG8 A;  3ZGQ A;  2EIJ E;  4GML A;  2NYJ A;  4BES A;  3BEE A;  3QAR A;  4U0U A;  5FIO A;  5ENQ D;  4K5B A;  4ZFH A;  1NA0 A;  1TR4 A;  3LVQ E;  3B95 A;  2P9K G;  4B94 A;  2I9C A;  2AJA A;  4AXH A;  1IHB A;  4LRZ A;  2OND A;  5CHE E;  4F7A A;  2M63 A;  5FZR A;  3B7S A;  4GTS A;  3R9M A;  2IF4 A;  4NRH B;  2R05 A;  1DCQ A;  3CVL A;  3FUE A;  2V4H C;  1K3Z D;  1SW6 A;  4CDM A;  4XI0 A;  5AQA A;  3IHY A;  4HI8 A;  3V2O A;  1K1B A;  3CVN A;  4ILG A;  3FP3 A;  4ANX A;  3TG4 A;  1V55 E;  1H2T C;  3LS8 A;  2J4D A;  1QYM A;  3FUL A;  1H19 A;  1SVX A;  4XIF A;  1SA5 A;  3NQP A;  2IFU A;  4JEU A;  4HBD A;  3ZYL A;  3ZVV A;  4AY5 A;  4K03 A;  1IXV A;  4I17 A;  4J8Y A;  3L54 A;  2UY1 B;  3TWW A;  3EJN A;  4KXK B;  2GW1 A;  3QB2 A;  2ILR A;  1HG5 A;  1JCS A;  4BSX A;  1Z5S C;  2KZT A;  3RU0 A;  3QNK A;  5ENT D;  1PY1 A;  4AM9 A;  2FI7 A;  1JPL A;  1IYG A;  4G8K A;  3RJV A;  2QC9 A;  2IOL A;  5JHA A;  3UPV A;  1OWO A;  4G26 A;  3UT7 A;  2RFM A;  2L0T B;  4KMO A;  4MLP A;  3ONK A;  4RVB A;  4I6E A;  3S7D A;  4I6G A;  4ATZ D;  2V0P A;  4DK5 A;  3CIA A;  3PS6 A;  3FU6 A;  3JYS A;  3AJI A;  4CDR A;  4PS3 A;  3FHE A;  4LNU D;  3DSS A;  1ZB1 A;  5LOZ A;  3R9A B;  3HXC A;  4UQZ A;  4F6R D;  5JJ6 A;  2BTD A;  1N11 A;  4C0E A;  2J07 A;  3SO8 A;  4BTB A;  4L1B A;  4A63 B;  5T8I A;  4B8C B;  2IO3 C;  3LY9 A;  4JVS A;  4F1P A;  5LX8 A;  3AS5 A;  2R5S A;  2BKG A;  2XZT G;  3SZ7 A;  4KZ0 A;  3SI5 A;  4AVX A;  4KBQ A;  4LUN U;  1KZO A;  3T8K A;  4I1O B;  3FTS A;  3EHQ A;  1MZC A;  3FU3 A;  1LD7 A;  3FUK A;  4I9E A;  4YDW A;  1U2V G;  3V31 A;  4DRX E;  1TNU A;  3APD A;  3U9W A;  2R59 A;  4U07 A;  1B89 A;  2P9S G;  1E7V A;  3FTW A;  2A5E A;  2AVP A;  2DCP A;  4FHK A;  3QAQ A;  4I6J A;  3EU9 A;  5IY5 E;  3ZXP A;  4V3I A;  4L2Y A;  1OXJ A;  2X6H A;  5CRU A;  1MX6 A;  5J08 A;  3C72 A;  4OVV A;  3KS2 A;  5LCW J;  3ZFW A;  1ZU2 A;  3FH5 A;  2FBN A;  3CLJ A;  2P58 C;  1TN8 A;  1Z3Y A;  4G24 A;  4OAU C;  2WXO A;  3LCA A;  4K0R A;  2CHW A;  1MQS A;  5FT9 A;  3L13 A;  2XRZ A;  3I4G A;  3EU5 A;  3UXG A;  2WXM A;  4EEC A;  4G1T A;  2B0O E;  3FU5 A;  2YHC A;  4DI4 A;  1G3N B;  2AXU A;  1KT0 A;  1WM5 A;  3FEY A;  1HO8 A;  2WXQ A;  4RG6 A;  4AY6 A;  5ENO D;  1X5B A;  2F0Y A;  3IV0 A;  2IQC A;  3LVR E;  1KPS B;  3FU0 A;  4GU5 A;  3ABL E;  2ZIS A;  4JPS A;  2BED A;  5ENN A;  1GW6 A;  1WY6 A;  3FH7 A;  1OWL A;  3RRU A;  3CST A;  3D9I A;  3LY8 A;  4JHJ A;  2IU1 A;  2GRL A;  3AG1 E;  2WXL A;  4EHM A;  2EIL E;  3WXX A;  3LDZ A;  3RAU A;  3PUK A;  1YYH A;  3Q9N C;  3AU4 A;  5CEA A;  4KYO B;  3LXU X;  2WQ6 A;  1KLX A;  2P9P G;  1QBQ A;  1H6P A;  3UUX A;  1QNF A;  1BPO A;  2XS8 A;  4XKC A;  4GTO A;  3SY2 A;  4Y6W A;  5AIJ A;  3BG1 B;  3NZS A;  3NOG D;  2AXZ A;  3JUI A;  1VDY A;  3L08 A;  3GW4 A;  4MRU A;  2UY1 A;  1KZP A;  2JAB A;  4U96 D;  3I3N A;  2XPY A;  3G2W A;  4FUL A;  4N2Q A;  3EHM A;  2X6I A;  4H7X A;  5EKQ D;  3DPD A;  5KCM A;  2YQ8 A;  4KZC A;  4CGW A;  3Q9U C;  3TWS A;  3CHS A;  4CT4 A;  4GYY A;  2RKK A;  2EQX A;  2DWZ A;  1JCR A;  5JJ7 A;  3DSW A;  4JD2 G;  4OVU A;  2J4B A;  3V79 K;  3L9T A;  4HXI A;  5J90 A;  2VJ8 A;  3JCK C;  3OXL A;  1HS6 A;  4XI9 A;  4AJW A;  3FWV A;  3ISM C;  2AWI A;  3ASD A;  4N2S A;  2LAH A;  4E85 A;  4U95 D;  3ZU7 B;  4HNA D;  1U3C A;  2NSZ A;  2BF0 X;  2GRQ B;  3FDH A;  2QYU A;  4HB5 A;  3RSE G;  3OXF A;  1NA3 A;  4UUC A;  2ZGG A;  2J09 A;  3NZU A;  3R7R A;  2XPI A;  2OV8 A;  4DPR A;  1MJ0 A;  2XRY A;  3OAW A;  3FTV A;  4GPM A;  2RD0 A;  3FFL A;  4AOF A;  3SD5 A;  3CVW A;  4CGV A;  5LCW C;  3CGH A;  1Q2Z A;  5DIZ A;  4EZL A;  5BXU A;  3UI2 A;  3EIJ A;  4F1S A;  2GRO B;  3HVE A;  1HX8 A;  4JA9 A;  2CHX A;  3UT4 A;  3SFX A;  3ZW3 A;  3K9I A;  4BEP A;  4U0S A;  2R2L A;  3CVY A;  4LEU A;  1FCH A;  1N4Q A;  4TXQ A;  4OAV B;  1IQR A;  1S63 A;  4I43 A;  4WND A;  3MYV A;  4WWO A;  2PM7 A;  4FC8 A;  3U4T A;  3DEO A;  2F8Y A;  3LPZ A;  4IN3 B;  1X81 A;  3G2T A;  1PC2 A;  4CEM A;  5G04 J;  4UQY A;  2H6F A;  4I1M A;  1D8D A;  1AP7 A;  1P5Q A;  3QWV A;  2PZI A;  5D0Q D;  2A4Z A;  1TJF A;  2KCK A;  2LXL A;  2VGE A;  5AAO A;  2BUG A;  1UJK A;  1N4P A;  4CZ2 D;  3T5V A;  4JZY A;  3TWQ A;  3CHP A;  2QZA A;  3ENE A;  3CEQ A;  2Y4T A;  3MKQ B;  4O60 A;  2XCB A;  1XGW A;  3AAA C;  4HLE A;  4U04 A;  4DI3 A;  4NUR A;  3UIN C;  3ZXS A;  3BG0 B;  2E0I A;  3I4R B;  4DX5 D;  4GTP A;  3DWL G;  3PEV B;  4CDN A;  4EZK A;  2R03 A;  3AG3 E;  3UM3 A;  4GPK A;  1FVF A;  1IQU A;  2L9B A;  2CG2 A;  1SQM A;  1N4R A;  3CHO A;  5EDS A;  4JHR A;  4GA2 A;  4YND A;  4IUL A;  1OCO E;  4BT9 A;  5EX0 A;  4HRN A;  4UWL A;  4DX6 D;  4H7Y A;  1BLX B;  4J8S A;  3RO3 A;  3Q47 B;  5FQ7 A;  3SBS A;  3CQC B;  3E33 A;  2EIN E;  1JUQ A;  4CRW A;  3PZ1 A;  4JXT A;  2MHK A;  2DIW A;  4U8Y D;  3HXE A;  4B8A A;  2VGX B;  4A3V A;  3TAX A;  2V5Q C;  2WPV A;  2VQ2 A;  3D9L A;  2UWJ G;  5EIL A;  3NBN B;  5C2Y A;  3Q4A B;  1FT1 A;  1N52 A;  1N4S A;  3JUE A;  4Z68 A;  4JL0 A;  2JEK A;  1SA4 A;  2IY0 C;  4GTQ A;  4WNF A;  1O5M A;  2EIK E;  3S7B A;  3C3O A;  5HKP A;  5FJY A;  1H2U A;  2X38 A;  3APF A;  4TXR A;  4MBG A;  4WNE A;  4QFV A;  4P29 A;  3IHV A;  4U8H A;  4HI9 A;  2WXK A;  1L5J A;  4PUC A;  5BW8 C;  3ZUV B;  2YIN A;  4F53 A;  1Z6T A;  4BSZ B;  2VYI A;  5AN8 A;  5G04 C;  5BXO A;  3CKB A;  4KT6 B;  5KJM A;  3UMV A;  2CG3 A;  3B7U X;  4GMR A;  3T8M A;  4GMJ A;  3WG7 E;  3CVP A;  1HXI A;  3IKO B;  3J5P A;  4AV7 A;  1OWP A;  2VSX E;  4ME2 A;  3UQ3 A;  2VTB B;  4R7L A;  3RKV A;  2DBA A;  4TUU A;  2RFA A;  2Y69 E;  4UI9 C;  3ASN E;  3DSV A;  2OOE A;  4LSZ E;  2H6H A;  2XGM A;  2I2O A;  3EDT B;  3S7J A;  3ASH A;  5FQ6 A;  3ZN3 A;  4ILH B;  2XGO A;  1EYH A;  5E75 A;  2WXP A;  4ABN A;  4JW1 A;  1QZ2 A;  1DCE A;  3D9O A;  1LTX A;  4GZ5 A;  3MKR A;  2WXG A;  5AJD A;  1UN8 A;  1N0R A;  4XZ4 A;  1ELK A;  3UIO C;  1TN6 A;  5LFA A;  1N9A A;  3FTZ A;  3FUM A;  4I2W A;  2KBX A;  2X6J A;  4PS8 A;  4XE0 A;  4WNG A;  2FO7 A;  4DX2 A;  3CVU A;  4GTV A;  3TWR A;  3E34 A;  1EF1 C;  4L7T A;  3ZHE B;  2XPZ A;  5C1D A;  3HXD A;  2PM6 A;  1EDU A;  3MKQ A;  3LEW A;  3JQ0 A;  3CR3 A;  3TL5 A;  3L17 A;  2IEJ A;  3RRN B;  2OVF A;  3IEG A;  5ANR A;  3VLF A;  1Y8M A;  5HQ8 A;  2XCC A;  3P2B A;  2WXF A;  2PQN A;  3RRM B;  4YDE A;  5FQ4 A;  3VTX A;  3ZYK A;  3KSQ A;  2LNI A;  2LUH A;  5FTP A;  3UM1 A;  1Z3X A;  3PE3 A;  5EID A;  4HRM B;  1E90 A;  3D9K A;  3RK6 A;  3L22 A;  5G05 J;  3ZEF A;  1O1T A;  1TYQ G;  3B7T A;  2WXH A;  3GZS A;  5EX3 A;  5JA4 D;  5JMN D;  1TEZ A;  1RW2 A;  1MHQ A;  2ETC A;  2VSY A;  3D9M A;  2ZGD A;  2ZXW E;  3D9P A;  5LP0 A;  2I6H A;  2WMN A;  3CV0 A;  4J6I A;  4XEI G;  5EN5 D;  2P9I G;  4A1S A;  3DSU A;  3D9N A;  3P1U A;  3GZ2 A;  5A6C A;  4DLO A;  3PVL A;  3FY4 A;  2WQH A;  4KVO A;  3ULY A;  2R17 C;  4EQF A;  2Y3A A;  3U64 A;  3B7R L;  5FZQ A;  3AG2 E;  4I2Z A;  3UM0 A;  3SQV A;  2VGX A;  1FVH A;  2C0L A;  1OY3 D;  4WWP A;  5BNW A;  4LG6 A;  5AAR A;  3Q73 A;  4NIK A;  3LY7 A;  5AEN A;  1H6O A;  2LXM A;  1AWC B;  3FUI A;  4YVQ C;  3FUJ A;  2KCV A;  3I5P A;  3VLD A;  3KEA A;  4C0M A;  4D10 C;  5ARG A;  2DZN A;  3HIZ A;  2LAI A;  5FIN A;  3AS4 A;  4BX9 A;  3CK8 A;  3HXF A;  1A17 A;  3TWX A;  4GCN A;  4F3V A;  2FO1 E;  5CED B;  2XEE A;  4HFG A;  3U3W A;  5CMY A;  2F37 A;  4GZ3 A;  2EIM E;  2QY7 A;  4X8Q A;  4HRL A;  4N3C A;  4CCA A;  2ETB A;  2VGY A;  3CVQ A;  1WDY A;  1DVP A;  1BD8 A;  2F8X K;  3DXM G;  4BY6 A;  2A5U A;  3ZYQ A;  2I1K A;  2HE0 A;  3ML8 A;  4G25 A;  1D9S A;  4UWH A;  5ITZ F;  5KJL A;  3MZL B;  4Q94 A;  2VSO E;  3PUJ A;  3O4Z A;  3ASF A;  3DEP A;  4GB9 A;  2WVI A;  2VTB A;  5CER B;  3QJZ A;  4IRU A;  3EUV A;  5M72 A;  2C0M A;  3FUD A;  3DRA A;  2IO2 C;  3GYZ A;  2C2L A;  1V54 E;  1NP7 A;  3BUA A;  4WWN A;  3AS8 A;  4GCO A;  3BQO A;  1HF8 A;  3V30 A;  4FP7 A;  5D66 A;  4EPZ A;  3ULE G;  3SFZ A;  4EBA G;  2P9U G;  3Q49 B;  1HFA A;  3Q79 A;  5ENS D;  2ETA A; 
#chains in the Genus database with same CATH homology
 1BI7 B;  3J5Q B;  5FIN A;  2Y1L E;  4G8L A;  5EYP F;  2VGE A;  3JXI A;  1IXV A;  4F1P A;  5ENO D;  2RFA A;  4U8Y D;  5KNH D;  3TWX A;  5AQ9 A;  5AAO A;  5CED B;  2FO1 E;  2BKG A;  2XZT G;  2XEE A;  4J8Y A;  2DVW A;  4U95 D;  4CZ2 D;  4LSZ E;  3TWQ A;  5AQ7 A;  3ZU7 B;  3HRA A;  5EID A;  3TWW A;  3ZKJ A;  2F37 A;  4HNA D;  4HRM B;  3T8K A;  1IKN D;  2V5Q C;  1DC2 A;  3EHQ A;  2DZO A;  4HRL A;  5EIL A;  4HB5 A;  1MYO A;  2PNN A;  3NBN B;  2ETB A;  4UUC A;  3F6Q A;  4TUM A;  4O60 A;  4BET A;  2NYJ A;  2ZGG A;  5JA4 D;  3B7B A;  5JMN D;  5KNG A;  4U8V D;  4YDW A;  1MX4 A;  3NOC D;  5CEC B;  2MYO A;  3V31 A;  1A5E A;  4BES A;  3AAA C;  5KWD A;  1YMP A;  1WDY A;  3JUE A;  2ETC A;  5ENR D;  1MX2 A;  1BD8 A;  5ENT D;  5FIO A;  4RLY A;  4DRX E;  5EIB E;  2F8X K;  5ENQ D;  4K5B A;  4G8K A;  1MJ0 A;  2ZGD A;  4ZFH A;  4Z68 A;  1TR4 A;  2BKK B;  2QC9 A;  2XZD G;  4HLL A;  3B95 A;  1N0R A;  1YYH A;  2HE0 A;  2Y0B G;  3IXE A;  2L6B A;  3Q9N C;  4GPM A;  3LJN A;  2J8S D;  2AJA A;  5CEA A;  4QQI A;  1NFI E;  4CYM D;  3W9F A;  4DX5 D;  1IHB A;  4ZHB A;  5HKP A;  5HS0 A;  1D9S A;  1YCS B;  5ITZ F;  5EN5 D;  4DUI A;  1WG0 A;  2RFM A;  2A5E A;  1N0Q A;  2KBX A;  4BER A;  4QFV A;  5BXU A;  1BI8 B;  3DEP A;  3EU9 A;  3UTM A;  3T9K A;  3UI2 A;  4HQD A;  5CER B;  4HI9 A;  1BU9 A;  1MX6 A;  1UOH A;  3TWV A;  4ATZ D;  4DX2 A;  1DCQ A;  4J7W A;  4N5Q A;  3TWR A;  4BEP A;  4YDY A;  4O1P A;  3NOG D;  3ZUV B;  5CBO A;  2V4H C;  1K3Z D;  5AQB A;  2KXP C;  2QYJ A;  3C5R A;  3TWT A;  3AJI A;  1SW6 A;  4BSZ B;  2JAB A;  4U96 D;  2XEH A;  5AQA A;  4OAV B;  1K1A A;  5AN8 A;  5EYL A;  4K5C A;  2XEN A;  4HI8 A;  5BXO A;  4LNU D;  4OAU C;  3V2O A;  1OT8 A;  1OY3 D;  1K1B A;  5KBA A;  3DEO A;  4LG6 A;  5AAR A;  4DX1 A;  4NIK A;  4GMR A;  1AWC B;  2F8Y A;  3HG0 D;  5ENP D;  3V2X A;  3V30 A;  3TWU A;  1S70 B;  4B93 B;  4HRN A;  4F6R D;  3Q9U C;  1QYM A;  5D66 A;  3D9H A;  3TWS A;  4DX7 D;  4DX6 D;  4K5A B;  4JB8 P;  3UXG A;  1N11 A;  3EHR A;  1BLX B;  1SVX A;  3JXJ A;  2P2C P;  2B0O E;  3J5P A;  4C48 B;  3KEA A;  4O1O A;  3ZNG A;  2DWZ A;  3SO8 A;  1G3N B;  5HRY A;  2DZN A;  5ENS D;  3W9G A;  1AP7 A;  5CBN A;  3V79 K;  4HBD A;  2ETA A;  4A63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...