5JMND

Fusidic acid bound acrb
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
b'GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB
publication title Transport of lipophilic carboxylates is mediated by transmembrane helix 2 in multidrug transporter AcrB.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein
total genus 47
structure length 158
sequence length 158
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5jmnD00
2ZGDA 2BKGA 3NBNB 1BD8A 3KEAA 4YDYA 2QYJA 4O60A 3W9GA 2L6BA 5FINA 1IKND 4QQIA 4CZ2D 1AWCB 1YYHA 3V79K 4K5BA 5ENPD 5EYLA 1MX6A 2ETAA 3UTMA 3B7BA 5BXOA 3D9HA 1G3NB 1OY3D 1QYMA 1NFIE 3J5QB 3T9KA 3W9FA 4ATZD 3JXJA 2B0OE 5CECB 1TR4A 4NIKA 5ENOD 4A63B 4ZFHA 1MYOA 3TWRA 4F1PA 5CERB 3NOCD 3V2XA 4BESA 1IHBA 2AJAA 5JA4D 1N0QA 5JMND 1YCSB 4O1PA 3B95A 5KWDA 2A5EA 1N11A 4C48B 4HRNA 3TWQA 4O1OA 4U8YD 4GMRA 4DRXE 4HBDA 2J8SD 3JUEA 5AAOA 4BERA 2FO1E 2DZNA 4OAVB 5AQBA 5ENRD 2DVWA 1A5EA 4DX1A 1UOHA 2JABA 4UUCA 5HKPA 2V4HC 3Q9UC 4JB8P 2F8XK 2ZGGA 5KNGA 3NOGD 3TWXA 5BXUA 2KXPC 4TUMA 1S70B 2Y1LE 4K5CA 5AQAA 3HRAA 1N0RA 4DUIA 3EHRA 1WDYA 1MX2A 3ZU7B 5KBAA 5D66A 4HQDA 2ETBA 4N5QA 1BI7B 3IXEA 3TWTA 5ENTD 5HRYA 2PNNA 4HRLA 2XEHA 2DWZA 2ETCA 3TWWA 4LG6A 5EILA 1AP7A 2RFMA 3AJIA 5EYPF 4BEPA 3J5PA 4Z68A 4U8VD 1K1AA 1OT8A 4LNUD 1BLXB 1WG0A 1YMPA 4GPMA 4J7WA 4QFVA 2P2CP 3DEPA 3EU9A 3F6QA 5AARA 3TWVA 3ZNGA 5CEDB 4HI9A 3ZUVB 3SO8A 4HRMB 5FIOA 1BI8B 2HE0A 4BSZB 1SVXA 3UI2A 4HLLA 1DC2A 3JXIA 4G8KA 4G8LA 4ZHBA 2QC9A 3Q9NC 4DX5D 3ZKJA 3TWSA 5EIBE 2KBXA 2Y0BG 3UXGA 2NYJA 4U96D 4B93B 3C5RA 1SW6A 1K3ZD 2MYOA 4YDWA 2F37A 4OAUC 4HB5A 5KNHD 2BKKB 2XZDG 2XZTG 3DEOA 3V30A 2F8YA 2XEEA 3V31A 5ENSD 5CBNA 1DCQA 1K1BA 1IXVA 3HG0D 4HNAD 1MX4A 5AQ9A 4U95D 3EHQA 4BETA 5CEAA 4DX6D 3AAAC 4LSZE 5CBOA 4CYMD 5HS0A 3TWUA 4HI8A 4RLYA 5AQ7A 1MJ0A 2DZOA 5ITZF 3LJNA 2RFAA 2V5QC 5ENQD 4DX7D 1D9SA 4F6RD 3V2OA 2VGEA 3T8KA 1BU9A 5AN8A 4K5AB 4J8YA 5EIDA 4DX2A 5EN5D 2XENA
chains in the Genus database with same CATH superfamily
3KEAA 1QBQA 3LYAA 2QYJA 2FI7A 3MX3A 3ONKA 3JYSA 5J08A 1NP7A 1P5QA 5E76A 2RD0A 3B7BA 2BEDA 4ABNA 2MRIA 2WXJA 5CHEE 3QWPA 2UY1A 5ANLA 4A63B 1YA0A 4JW1A 3HHMA 4EQFA 2WXNA 3GW4A 3ZW3A 4CDRA 3PH0C 5AAOA 1FVFA 4XKCA 5FQ4A 5AQBA 2P9SG 1DVPA 3QK0A 3ZRHA 3CKBA 1TN6A 2BF0X 2XS1A 4DPRA 3RO2A 3UI2A 1HG2A 2PL2A 5EX0A 2LAIA 5M72A 2XZTG 1QNFA 2CFUA 2XEEA 4HORA 5CBNA 4I6EA 3EIJA 2R59A 2WXFA 1N4PA 4N2SA 4L9PA 3MV3B 3RRNB 4JA9A 4M3OA 4GTRA 2X6IA 4WWPA 2BKGA 2XHEA 3KS2A 3PNTB 4IULA 3LVQE 3BU8A 5EYLA 1G3NB 3AG4E 3CVXA 2JEKA 3PZ2A 5G05J 4AY6A 3QWVA 3V2XA 4GZCA 4ACKA 3APDA 2WXRA 3G2TA 3EJNA 3DSXA 4AM9A 4CGWA 3ONLA 3FFLA 5IY5E 1HX8A 1KLXA 2WMOA 2WXPA 1TNBA 3L82A 5G2NA 5EILA 1AP7A 4UI9C 3R7QA 4I1OB 1BLXB 3HXDA 4CT4A 2F0YA 2KCKA 1H2VC 3CK7A 3RRUA 2Y0BG 2DCPA 4HB5A 2XRYA 2BKKB 4YVOA 4KYOB 5ENSD 2L6JA 4HNAD 4GB9A 2J08A 2VSXE 4ANWA 1OCZE 2VJ8A 5T4YA 5AQ7A 3S2AA 2WXHA 4DX7D 4ANXA 2I9CA 1BU9A 5CCMA 4UQZA 2VSOE 2WMNA 5BUZA 4B89A 3C3OA 4B8CB 4PUCA 5FINA 3G2VA 2LAHA 1ELWA 4GYWA 1N94A 4WNDA 2XQ0A 4ACLA 2IO3C 4L2YA 2H6HA 2NXPA 2E2EA 3U64A 2PQRA 3O48A 4CT0A 3IHVA 3JUEA 3UKRG 4GPKA 5LX8A 3LY7A 2ZGGA 4I9CA 3DXKG 1H6PA 4F1SA 4TRQA 3S7JA 3HRAA 3ZYLA 2VQ2A 2X6JA 3EU5A 5KNGA 4GPMA 4J7WA 1Z3YA 4DI3A 3SO8A 1BI8B 2C0LA 2VGXB 2J49A 5ARGA 5H7PA 3R9AB 1IQRA 4K0RA 1V55E 2CFZA 1MHQA 4EZKA 2VSYA 4DLOA 2VTBB 2OCCE 3AS8A 4BT9A 3UT7A 3SZ7A 2L0IA 4UI9J 4X8QA 5D0QD 3U4TA 3KEZA 1H19A 1HZ4A 3PE4A 2Y3AA 1TJFA 4K5AB 4WWNA 4XIFA 4J8YA 3AS4A 4RG6A 3DSUA 4GCOA 4H7YA 3MCXA 1IKND 4U8HA 4L23A 1S0PA 4JPSA 3PVLA 3W9FA 3JXJA 3QNKA 3U66A 4I1MA 5C1DA 1W3BA 3OXGA 1UG3A 2WXQA 2EIJE 3SQVA 1OXJA 4Y6WA 3ASNE 1H6KA 2JABA 5T8IA 4KMOA 4RVBA 1H0AA 1O1TA 3NQPA 4TUMA 5ANRA 5EX3A 4H7XA 3PNLB 2XGSA 4HQDA 3L13A 2RG8A 3SFYA 4U8VD 1K1AA 3RIBA 2Y4UA 4BTBA 3SNXA 1E7UA 3UT8A 1HG5A 3D9JA 3JUIA 3UKUG 2IJGX 2ZXWE 5LFAA 2WXIA 3I4GA 3SBSA 4FHJA 3SGHA 1H6OA 3HXFA 5LOZA 2B6CA 2HO1A 3E34A 4AEZC 3CKCA 5ITZF 4C9BB 3GYZA 3Q73A 4CEMA 3PREA 3ABKE 3URZA 3UQ3A 4KZ0A 1NFIE 4CCAA 2B0OE 5AYWD 1PC2A 4NIKA 3ZYQA 4ZFHA 3CVPA 2A4ZA 4PS3A 5JMND 1FT2A 4YNDA 2A5EA 3HXEA 1QQEA 2V8SE 1QZ2A 3L6AA 1INZA 5ENRD 2GRPB 4I2ZA 4LCTA 3MJWA 1TNYA 3MKQB 3ULQA 4MKTA 2YHEA 4HLEA 3C72A 3PZ4A 1OUVA 3N71A 2LUHA 3LY8A 4GU5A 4GA0A 4ILIA 3EUVA 2A5UA 3ASFA 5FIOA 2J07A 1DC2A 4G8KA 1IQUA 2KBXA 2VSNA 2VGXA 4JEHA 3I5PA 5KNHD 4MBGA 3V30A 4XI9A 3IBEA 2LNIA 2LO6A 4A3VA 4W9RA 3CSFA 3CVQA 3MV2B 3QOUA 2Q7FA 5A7DB 3ASOE 3FUHA 4J8FA 3LVRE 3HVEB 2V5QC 3ZHEB 3T8KA 3VLDA 3UUXA 1OCOE 1N4QA 1TNOA 4WAFA 5G55A 2C2LA 1TJCA 3L16A 2EILE 4PH4B 3JCKC 4ME2A 3DSSA 4O1PA 4J8SA 3LS8A 4JC8A 2XCBA 4GAAA 4N5CA 3Q49B 4BERA 3C3QA 1IHGA 2YNQA 2X6HA 3CHMA 3TWXA 4HS2A 4FLHA 1E7VA 3UX4A 4HOTA 4I43A 4EZLA 4U0SA 3TL5A 5KJKA 5KBAA 3SF4A 3TWTA 1HH8A 2ZIRA 4I9EA 4LG6A 3RSEG 3AJIA 3D9MA 1WG0A 3D9OA 2AXUA 4HLLA 2R03A 4TXQA 3Q5MA 2NYJA 2XPZA 1IXVA 3HG0D 3CVUA 2X38A 4PDXA 3B7RL 2P9UG 3MGBA 5ARFA 4JHJA 4WNFA 2EINE 5HS0A 5JHAA 2LSVA 1KZPA 2AWIA 3CQCB 5HQ8A 3DPDA 4F6RD 3V2OA 3TGOA 2WM9A 5LCWC 2ZGDA 5D0OD 1Z3XA 2AXZA 4Q96A 2IF4A 3FU0A 3FUKA 1GW6A 3CVWA 4AP2A 3D9LA 1TR4A 4F53A 4FHKA 1BPOA 1YCSB 2Y69E 2LSUA 3B7UX 4EECA 2FO7A 5BV0A 4DRXE 4HBDA 3E37A 1PAQA 2OVBA 4BT8A 3QARA 3MYVA 1S63A 1NA3A 2FULA 4I17A 4GZ3A 3U9WA 4L1BA 1WDYA 1LF8A 1MX2A 1NA0A 3NZUA 4HRLA 1OWPA 3P2BA 1NZNA 2AVPA 1YMPA 5AARA 2HM8A 3T8MA 3CHOA 3Q4AB 1HFAA 4BY6A 1HO8A 4G8LA 2I1KA 4D10C 3TWSA 3DWLG 4G11A 1JPLA 2YINA 1SA5A 2H6FA 3V31A 1DCQA 1K1BA 3EHQA 2GRMA 1TYQG 3VLFA 4DJAA 3SBTB 2IOLA 2RFAA 3LXUX 3IV0A 3OXLA 1N4RA 4AOFA 1PY1A 1U3CA 3VTXA 4L2LA 1K8KG 3HVEA 5EIDA 2KATA 3ZHEA 5DBKA 3KAEA 3IEGA 4B8AA 5FQ7A 3W9GA 2ILRA 1HU3A 3APFA 1MX6A 2ETAA 1JUQA 4HOQA 5ENNA 3D9IA 5CECB 3CIAA 3TWRA 4JA7A 4M7CA 4BESA 1IHBA 1KT1A 1N0QA 3DBSA 3QAQA 4G1TA 5KWDA 2L0TB 5E75A 4O1OA 4APOA 2FO1E 3JQ1A 1Z6TA 2XEVA 5LCWJ 2BUGA 2KXPC 4K5CA 5AQAA 3RKVA 5AIJA 3PRZA 1VDYA 2IOSA 4G24A 1HXIA 5T3RA 4BX8A 1L5JA 3UM3A 3IXEA 3TWWA 3ESLA 3K9IA 4LNUD 5BW8C 1MZCA 4XZ4A 3S7BA 1RW2A 4P29A 4MLPA 3RO3A 3ZKJA 3NZSA 3PUKA 4XI0A 1UN9A 5CRVA 4YDWA 3DXMG 4U04A 1TEZA 3B7SA 2WXLA 3HIZA 4U95D 2OV8A 3LCAA 4CRWA 2QFCA 2KCVA 4AY5A 1KT0A 3G2SA 3FUJA 3OTNA 3UT4A 4GA2A 1NL4A 4UWLA 3L22A 3VLEA 4KXKB 3ZVVA 4I6JA 5AN8A 1OCRE 4EPZA 2RKKA 1OWNA 3HXCA 3FUMA 4YDYA 3NBNB 2PM6A 3ML8A 4ATGA 3G2UA 4GTMA 4FLBA 3HXBA 4QQIA 4I1AA 4URKA 5B1BE 1E8ZA 3DPYA 3J5QB 3ULEG 4UQXA 2XRZA 4C48B 3TWQA 3AG1E 2EIKE 4WWOA 5JJ6A 4A55A 2OOEA 5CMWA 4LNBA 4GTVA 1OWMA 2EQXA 3PS6A 4A1SA 4J0UA 2QZAA 3QC1A 5D66A 2ETBA 1BI7B 1V54E 2CHZA 4AXHA 2WVIA 4C0MA 2WQHA 4Y6CA 5EKQD 4Z68A 3ZNGA 3RK6A 3CK8A 4DK5A 3FTUA 2NSZA 4GTOA 2IFUA 4K03A 3TJPA 1K3ZD 3NAWA 2F37A 1JCRA 1SZAA 2XZDG 5AJDA 3G2WA 1E8WA 1IYGA 2GRQB 4EBAA 3Q75A 2IEJA 2X6KA 3IHYA 3OAWA 2GRRB 1UW4B 4XE0A 4CYMD 2WPVA 4AIFA 3FTZA 2R02A 4DI4A 2GGFA 3CK9A 4NACA 3ASDA 4BX9A 2P9PG 4JXTA 4CZ2D 3PE3A 2PZIA 3FU3A 4FADA 2OVFA 3FULA 4FC8A 3R7RA 4G25A 1JCQA 4I6GA 2KCLA 3FUEA 3JQ0A 4U8YD 1N9AA 3O4ZA 3SFZA 4XX5A 2R05A 3S7FA 4E6HA 3NB2A 4DX1A 2KM4A 4TUUA 3R9MA 2XCCA 3CLJA 3C98A 4JB8P 4UWFA 1XNFA 1D8EA 3EHMA 1LD7A 3CSTA 3ZU7B 4XKBA 4WNEA 2R5SA 5A23A 3PZ3A 4JHRA 1Q2ZA 3J5PA 4KVOA 2PM7A 3EU9A 3E33A 1KZOA 5CEDB 2J4DA 3ZUVB 4HRMB 2DYRE 4CGVA 3FUFA 3JXIA 3Q9NC 2QY7A 3P1UA 1ZU2A 2H6GA 3PZ1A 3CQGB 4JEUA 4N39A 3CV0A 3GZ2A 1MX4A 3CHRA 5JJ7A 3KD7A 3CR3A 4ANUA 2HYZA 2YHCA 4AV7A 2GRLA 3FUIA 3FDHA 2P9IG 3APCA 4EHMA 1N95A 4A1GA 4IN3B 4CDMA 2Y4TA 1LD8A 3FY4A 2V0PA 4TV3A 5BV1A 2KC7A 4HFGA 3LJ3A 3AG3E 3BQOA 3B7TA 3V79K 3DSWA 1TNUA 4GZDA 1O5MA 4HOUA 1OY3D 2I2OA 1HE8A 3L9TA 2VTBA 3Q7AA 1SA4A 2FBNA 1N11A 3FTYA 3B13A 4DLQA 5FZRA 2OEVA 4NRHB 4ANVA 3RJVA 4UUCA 3HDXA 1RZ4A 2F8XK 2CG3A 2IO2C 4FJZA 4KVMA 1N0RA 3DSVA 3E30A 3CVYA 5FTPA 2X6FA 4N5QA 5FZSA 3VTYA 5ENTD 4BWRA 3MEKA 1NI1A 1O1RA 2CHXA 1JWFA 4BSXA 3ABME 3ABLE 3T5VA 5BNWA 3PDNA 4BSZB 3LDZA 4B0ZA 4U96D 1OWLA 2L9BA 3FTWA 2NC9A 3FHEA 4CDNA 4ILGA 2R17C 4N3BA 5EDSA 3TWUA 2WXOA 2DIWA 3BEEA 3EHNA 4YDOA 1OCCE 4Q69A 4L7TA 3BG0B 3WXXA 3CHPA 5KCMA 3SI5A 3CVVA 2IY0C 3CHSA 2XPIA 2BTDA 3UM2A 1UJJA 5EN5D 3PEUB 4UQYA 3UTMA 3CVLA 1ZB1A 1ZBPA 4ILHB 4JVSA 3CGHA 3Q7FA 5D2MC 1MYOA 3TXNA 1Z5SC 3I4RB 4UWHA 5DIZA 2AJAA 2WXMA 4MRUA 5AJLA 1U3DA 1E96B 4OAVB 1X5BA 2AW6A 1UJKA 5HKPA 1DCEA 2ZU6B 5BXUA 5B1AE 4V3IA 2XPYA 3T5XA 1EYHA 4NURA 4B94A 4OVVA 2FF4A 2ETCA 1N4SA 4E85A 2RFMA 4AVXA 5EYPF 4BEPA 4GZ5A 3ULYA 2LXMA 4HI9A 5CRUA 5AENA 3E32A 1DNPA 5JHBA 4N2QA 3L08A 3S7DA 4DX5D 3UMVA 2WQ7A 5FQ8A 5CCLA 1TN7A 5G04C 3UPVA 3MKQA 3FTXA 3UIOC 3ZEFA 5LP0A 4DX6D 5CBOA 4JD2G 3ISMC 3PEVB 2M63A 2CG2A 3FUDA 3CEQA 3LJNA 5BT1A 3I3NA 1D9SA 4GCNA 4UWKA 4F7AA 4DX2A 3Q15A 2P9KG 2XENA 1BD8A 3KSQA 1S64A 2P9NG 3UINC 4C0EA 2XS8A 1TNZA 2V5FA 2FEZA 3DSTA 3ZIMA 4WUYA 5ENOD 3FU6A 3PZDA 4LNGA 3SY2A 4UWGA 3AU5A 4GMRA 2DYSE 4KBQA 3ENEA 1D8DA 2DZNA 2WQ6A 3OXFA 3GZSA 3LKUA 3D3MA 2V4HC 3AG2E 2Y1LE 3EDTB 3SFXA 2XEHA 1X81A 1OT8A 4QFVA 4YDEA 4LERA 1OWOA 3CHQA 3TG5A 1SVXA 4EBAG 4B93B 3C5RA 2MYOA 4PS7A 3CVNA 3ZFWA 1FT1A 2QYUA 4JHKA 5AQ9A 5CEAA 3PUJA 4LSZE 4IYPA 1E90A 5B3SE 2V4LA 4HI8A 4RSYA 4RLYA 4EZJA 3FTSA 3QWWA 3FH7A 4N3CA 3ZYKA 5KJLA 1Y8MA 1ELRA 2EIME 4O6FA 4LRZA 2WB2A 5FJYA 3QB2A 4JZYA 2AXVA 3HYMB 4O60A 3FWVA 1E8YA 2P9LG 1YYHA 3DRAA 3MZLB 2MOWA 1SQMA 4ATZD 5BPPA 5G04J 1XGWA 5CERB 2GROB 3MA5A 1N54A 4JL0A 4HRNA 3FTVA 4RQIA 3BG1B 3ZYMA 2LXLA 3NOGD 4YVQC 4KZCA 2KZTB 3WG7E 1S70B 1FVHA 1ELKA 2HR2A 4APFA 2PQNA 4GTTA 2I1JA 5HRYA 4HOSA 2DWZA 3UIPC 4UI9K 3ZXSA 3D9PA 2P2CP 3F6QA 4GYYA 2WXKA 2HE0A 4PS8A 5CMYA 5FWQA 4ZHBA 3EIQC 2QC9A 2OEWA 3ML9A 2VYIA 3TAXA 3NF1A 2F8YA 2J09A 1O1SA 4BETA 3LPZA 1SZ9A 4TXRA 4J8EA 4GMLA 1B89A 3ZN3A 1LTXA 1WM5A 4J6IA 2L6BA 5FZQA 4HXIA 1FPPA 2UY1B 2J9QA 5ENPD 4OYSA 1FCHA 3QJZA 4HVBA 1QYMA 3RAUA 4F1PA 4F3VA 3LY9A 2ZISA 1EDUA 2MHKA 1HS6A 3ESKA 5JJTA 2VGYA 1U2VG 4I2WA 4N3AA 2CHWA 2J8SD 4MS6A 1A5EA 4GTSA 5FQ6A 1EPUA 3GZ1A 3TG4A 4U0ZA 3X2QE 1A17A 2X3MA 3AU4A 4DUIA 3EHRA 3QKYA 4NQ0A 1UN8A 2H6IA 2P58C 4FJYA 3UM0A 1H2TC 2JLBA 4G23A 3TWVA 3TXMA 1WAO1 1JCSA 2IQCA 4OAUC 2C0MA 3BUAA 5KJMA 4LUNU 4IRUA 4TXPA 4FU3A 5C2YA 3AAAC 3IKOB 3ASHA 2IU1A 2I6HA 5ENQD 3QDNA 3UM1A 3ASGA 2VGEA 3D9NA 3ZPJA 4FULA 4G2VA 2IONA 5A6CA 3L17A 1AWCB 4K5BA 4WNGA 4U0UA 4KT6B 3RU0A 3D9HA 3E4BA 5BXOA 3FH5A 2UWJG 3Q79A 3T9KA 3RRMB 5FT9A 1HF8A 3NOCD 2WXGA 4Q94A 5JA4D 3B95A 1Y6IA 3FUNA 3ZXPA 4U07A 4GZ6A 4R7LA 2GRNB 1EF1C 4XEIG 4U7EB 1JWGA 3FH8A 2DVWA 1UOHA 1E8XA 3Q9UC 4FP7A 4OVUA 2YQ8A 3SD5A 3ZGQA 3LEWA 2GW1A 2KZTA 4GTPA 2PNNA 4FA6A 3Q47B 4G26A 3L54A 3FP3A 3DEPA 4U63A 3KSLA 4J8DA 4LEUA 1H2UA 2J4BA 3FEYA 3FU5A 5KJNA 4GYOA 4BFRA 2E0IA 2ONDA 5EIBE 3UXGA 3SHFA 1SW6A 3DEOA 4GMJA 2XGOA 1N52A 3FEXA 5G05C 1MQSA 5HI7A 1WY6A 4RG9A 3C3RA 4GA1A 5J90A 4A3TA 1KPSB 3D9KA 4BTAA 1MJ0A 2DZOA 1TN8A 3U3WA 3AS5A 2R2LA 2DBAA 4AJWA 3Q78A 2XGMA 3MKRA 4GTQA
chains in the Genus database with same CATH topology
2ZGDA 2BKGA 3NBNB 1BD8A 3KEAA 4YDYA 2QYJA 4O60A 3W9GA 2L6BA 5FINA 1IKND 4QQIA 4CZ2D 1AWCB 1YYHA 3V79K 4K5BA 5ENPD 5EYLA 1MX6A 2ETAA 3UTMA 3B7BA 5BXOA 3D9HA 1G3NB 1OY3D 1QYMA 1NFIE 3J5QB 3T9KA 3W9FA 4ATZD 3JXJA 2B0OE 5CECB 1TR4A 4NIKA 5ENOD 4A63B 4ZFHA 1MYOA 3TWRA 4F1PA 5CERB 3NOCD 3V2XA 4BESA 1IHBA 2AJAA 5JA4D 1N0QA 5JMND 1YCSB 4O1PA 3B95A 5KWDA 2A5EA 1N11A 4C48B 4HRNA 3TWQA 4O1OA 4U8YD 4GMRA 4DRXE 4HBDA 2J8SD 3JUEA 5AAOA 4BERA 2FO1E 2DZNA 4OAVB 5AQBA 5ENRD 2DVWA 1A5EA 4DX1A 1UOHA 2JABA 4UUCA 5HKPA 2V4HC 3Q9UC 4JB8P 2F8XK 2ZGGA 5KNGA 3NOGD 3TWXA 5BXUA 2KXPC 4TUMA 1S70B 2Y1LE 4K5CA 5AQAA 3HRAA 1N0RA 4DUIA 3EHRA 1WDYA 1MX2A 3ZU7B 5KBAA 5D66A 4HQDA 2ETBA 4N5QA 1BI7B 3IXEA 3TWTA 5ENTD 5HRYA 2PNNA 4HRLA 2XEHA 2DWZA 2ETCA 3TWWA 4LG6A 5EILA 1AP7A 2RFMA 3AJIA 5EYPF 4BEPA 3J5PA 4Z68A 4U8VD 1K1AA 1OT8A 4LNUD 1BLXB 1WG0A 1YMPA 4GPMA 4J7WA 4QFVA 2P2CP 3DEPA 3EU9A 3F6QA 5AARA 3TWVA 3ZNGA 5CEDB 4HI9A 3ZUVB 3SO8A 4HRMB 5FIOA 1BI8B 2HE0A 4BSZB 1SVXA 3UI2A 4HLLA 1DC2A 3JXIA 4G8KA 4G8LA 4ZHBA 2QC9A 3Q9NC 4DX5D 3ZKJA 3TWSA 5EIBE 2KBXA 2Y0BG 3UXGA 2NYJA 4U96D 4B93B 3C5RA 1SW6A 1K3ZD 2MYOA 4YDWA 2F37A 4OAUC 4HB5A 5KNHD 2BKKB 2XZDG 2XZTG 3DEOA 3V30A 2F8YA 2XEEA 3V31A 5ENSD 5CBNA 1DCQA 1K1BA 1IXVA 3HG0D 4HNAD 1MX4A 5AQ9A 4U95D 3EHQA 4BETA 5CEAA 4DX6D 3AAAC 4LSZE 5CBOA 4CYMD 5HS0A 3TWUA 4HI8A 4RLYA 5AQ7A 1MJ0A 2DZOA 5ITZF 3LJNA 2RFAA 2V5QC 5ENQD 4DX7D 1D9SA 4F6RD 3V2OA 2VGEA 3T8KA 1BU9A 5AN8A 4K5AB 4J8YA 5EIDA 4DX2A 5EN5D 2XENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGD A;  2BKG A;  3NBN B;  1BD8 A;  3KEA A;  4YDY A;  2QYJ A;  4O60 A;  3W9G A;  2L6B A;  5FIN A;  1IKN D;  4QQI A;  4CZ2 D;  1AWC B;  1YYH A;  3V79 K;  4K5B A;  5ENP D;  5EYL A;  1MX6 A;  2ETA A;  3UTM A;  3B7B A;  5BXO A;  3D9H A;  1G3N B;  1OY3 D;  1QYM A;  1NFI E;  3J5Q B;  3T9K A;  3W9F A;  4ATZ D;  3JXJ A;  2B0O E;  5CEC B;  1TR4 A;  4NIK A;  5ENO D;  4A63 B;  4ZFH A;  1MYO A;  3TWR A;  4F1P A;  5CER B;  3NOC D;  3V2X A;  4BES A;  1IHB A;  2AJA A;  5JA4 D;  1N0Q A;  5JMN D;  1YCS B;  4O1P A;  3B95 A;  5KWD A;  2A5E A;  1N11 A;  4C48 B;  4HRN A;  3TWQ A;  4O1O A;  4U8Y D;  4GMR A;  4DRX E;  4HBD A;  2J8S D;  3JUE A;  5AAO A;  4BER A;  2FO1 E;  2DZN A;  4OAV B;  5AQB A;  5ENR D;  2DVW A;  1A5E A;  4DX1 A;  1UOH A;  2JAB A;  4UUC A;  5HKP A;  2V4H C;  3Q9U C;  4JB8 P;  2F8X K;  2ZGG A;  5KNG A;  3NOG D;  3TWX A;  5BXU A;  2KXP C;  4TUM A;  1S70 B;  2Y1L E;  4K5C A;  5AQA A;  3HRA A;  1N0R A;  4DUI A;  3EHR A;  1WDY A;  1MX2 A;  3ZU7 B;  5KBA A;  5D66 A;  4HQD A;  2ETB A;  4N5Q A;  1BI7 B;  3IXE A;  3TWT A;  5ENT D;  5HRY A;  2PNN A;  4HRL A;  2XEH A;  2DWZ A;  2ETC A;  3TWW A;  4LG6 A;  5EIL A;  1AP7 A;  2RFM A;  3AJI A;  5EYP F;  4BEP A;  3J5P A;  4Z68 A;  4U8V D;  1K1A A;  1OT8 A;  4LNU D;  1BLX B;  1WG0 A;  1YMP A;  4GPM A;  4J7W A;  4QFV A;  2P2C P;  3DEP A;  3EU9 A;  3F6Q A;  5AAR A;  3TWV A;  3ZNG A;  5CED B;  4HI9 A;  3ZUV B;  3SO8 A;  4HRM B;  5FIO A;  1BI8 B;  2HE0 A;  4BSZ B;  1SVX A;  3UI2 A;  4HLL A;  1DC2 A;  3JXI A;  4G8K A;  4G8L A;  4ZHB A;  2QC9 A;  3Q9N C;  4DX5 D;  3ZKJ A;  3TWS A;  5EIB E;  2KBX A;  2Y0B G;  3UXG A;  2NYJ A;  4U96 D;  4B93 B;  3C5R A;  1SW6 A;  1K3Z D;  2MYO A;  4YDW A;  2F37 A;  4OAU C;  4HB5 A;  5KNH D;  2BKK B;  2XZD G;  2XZT G;  3DEO A;  3V30 A;  2F8Y A;  2XEE A;  3V31 A;  5ENS D;  5CBN A;  1DCQ A;  1K1B A;  1IXV A;  3HG0 D;  4HNA D;  1MX4 A;  5AQ9 A;  4U95 D;  3EHQ A;  4BET A;  5CEA A;  4DX6 D;  3AAA C;  4LSZ E;  5CBO A;  4CYM D;  5HS0 A;  3TWU A;  4HI8 A;  4RLY A;  5AQ7 A;  1MJ0 A;  2DZO A;  5ITZ F;  3LJN A;  2RFA A;  2V5Q C;  5ENQ D;  4DX7 D;  1D9S A;  4F6R D;  3V2O A;  2VGE A;  3T8K A;  1BU9 A;  5AN8 A;  4K5A B;  4J8Y A;  5EID A;  4DX2 A;  5EN5 D;  2XEN A; 
#chains in the Genus database with same CATH topology
 3KEA A;  1QBQ A;  3LYA A;  2QYJ A;  2FI7 A;  3MX3 A;  3ONK A;  3JYS A;  5J08 A;  1NP7 A;  1P5Q A;  5E76 A;  2RD0 A;  3B7B A;  2BED A;  4ABN A;  2MRI A;  2WXJ A;  5CHE E;  3QWP A;  2UY1 A;  5ANL A;  4A63 B;  1YA0 A;  4JW1 A;  3HHM A;  4EQF A;  2WXN A;  3GW4 A;  3ZW3 A;  4CDR A;  3PH0 C;  5AAO A;  1FVF A;  4XKC A;  5FQ4 A;  5AQB A;  2P9S G;  1DVP A;  3QK0 A;  3ZRH A;  3CKB A;  1TN6 A;  2BF0 X;  2XS1 A;  4DPR A;  3RO2 A;  3UI2 A;  1HG2 A;  2PL2 A;  5EX0 A;  2LAI A;  5M72 A;  2XZT G;  1QNF A;  2CFU A;  2XEE A;  4HOR A;  5CBN A;  4I6E A;  3EIJ A;  2R59 A;  2WXF A;  1N4P A;  4N2S A;  4L9P A;  3MV3 B;  3RRN B;  4JA9 A;  4M3O A;  4GTR A;  2X6I A;  4WWP A;  2BKG A;  2XHE A;  3KS2 A;  3PNT B;  4IUL A;  3LVQ E;  3BU8 A;  5EYL A;  1G3N B;  3AG4 E;  3CVX A;  2JEK A;  3PZ2 A;  5G05 J;  4AY6 A;  3QWV A;  3V2X A;  4GZC A;  4ACK A;  3APD A;  2WXR A;  3G2T A;  3EJN A;  3DSX A;  4AM9 A;  4CGW A;  3ONL A;  3FFL A;  5IY5 E;  1HX8 A;  1KLX A;  2WMO A;  2WXP A;  1TNB A;  3L82 A;  5G2N A;  5EIL A;  1AP7 A;  4UI9 C;  3R7Q A;  4I1O B;  1BLX B;  3HXD A;  4CT4 A;  2F0Y A;  2KCK A;  1H2V C;  3CK7 A;  3RRU A;  2Y0B G;  2DCP A;  4HB5 A;  2XRY A;  2BKK B;  4YVO A;  4KYO B;  5ENS D;  2L6J A;  4HNA D;  4GB9 A;  2J08 A;  2VSX E;  4ANW A;  1OCZ E;  2VJ8 A;  5T4Y A;  5AQ7 A;  3S2A A;  2WXH A;  4DX7 D;  4ANX A;  2I9C A;  1BU9 A;  5CCM A;  4UQZ A;  2VSO E;  2WMN A;  5BUZ A;  4B89 A;  3C3O A;  4B8C B;  4PUC A;  5FIN A;  3G2V A;  2LAH A;  1ELW A;  4GYW A;  1N94 A;  4WND A;  2XQ0 A;  4ACL A;  2IO3 C;  4L2Y A;  2H6H A;  2NXP A;  2E2E A;  3U64 A;  2PQR A;  3O48 A;  4CT0 A;  3IHV A;  3JUE A;  3UKR G;  4GPK A;  5LX8 A;  3LY7 A;  2ZGG A;  4I9C A;  3DXK G;  1H6P A;  4F1S A;  4TRQ A;  3S7J A;  3HRA A;  3ZYL A;  2VQ2 A;  2X6J A;  3EU5 A;  5KNG A;  4GPM A;  4J7W A;  1Z3Y A;  4DI3 A;  3SO8 A;  1BI8 B;  2C0L A;  2VGX B;  2J49 A;  5ARG A;  5H7P A;  3R9A B;  1IQR A;  4K0R A;  1V55 E;  2CFZ A;  1MHQ A;  4EZK A;  2VSY A;  4DLO A;  2VTB B;  2OCC E;  3AS8 A;  4BT9 A;  3UT7 A;  3SZ7 A;  2L0I A;  4UI9 J;  4X8Q A;  5D0Q D;  3U4T A;  3KEZ A;  1H19 A;  1HZ4 A;  3PE4 A;  2Y3A A;  1TJF A;  4K5A B;  4WWN A;  4XIF A;  4J8Y A;  3AS4 A;  4RG6 A;  3DSU A;  4GCO A;  4H7Y A;  3MCX A;  1IKN D;  4U8H A;  4L23 A;  1S0P A;  4JPS A;  3PVL A;  3W9F A;  3JXJ A;  3QNK A;  3U66 A;  4I1M A;  5C1D A;  1W3B A;  3OXG A;  1UG3 A;  2WXQ A;  2EIJ E;  3SQV A;  1OXJ A;  4Y6W A;  3ASN E;  1H6K A;  2JAB A;  5T8I A;  4KMO A;  4RVB A;  1H0A A;  1O1T A;  3NQP A;  4TUM A;  5ANR A;  5EX3 A;  4H7X A;  3PNL B;  2XGS A;  4HQD A;  3L13 A;  2RG8 A;  3SFY A;  4U8V D;  1K1A A;  3RIB A;  2Y4U A;  4BTB A;  3SNX A;  1E7U A;  3UT8 A;  1HG5 A;  3D9J A;  3JUI A;  3UKU G;  2IJG X;  2ZXW E;  5LFA A;  2WXI A;  3I4G A;  3SBS A;  4FHJ A;  3SGH A;  1H6O A;  3HXF A;  5LOZ A;  2B6C A;  2HO1 A;  3E34 A;  4AEZ C;  3CKC A;  5ITZ F;  4C9B B;  3GYZ A;  3Q73 A;  4CEM A;  3PRE A;  3ABK E;  3URZ A;  3UQ3 A;  4KZ0 A;  1NFI E;  4CCA A;  2B0O E;  5AYW D;  1PC2 A;  4NIK A;  3ZYQ A;  4ZFH A;  3CVP A;  2A4Z A;  4PS3 A;  5JMN D;  1FT2 A;  4YND A;  2A5E A;  3HXE A;  1QQE A;  2V8S E;  1QZ2 A;  3L6A A;  1INZ A;  5ENR D;  2GRP B;  4I2Z A;  4LCT A;  3MJW A;  1TNY A;  3MKQ B;  3ULQ A;  4MKT A;  2YHE A;  4HLE A;  3C72 A;  3PZ4 A;  1OUV A;  3N71 A;  2LUH A;  3LY8 A;  4GU5 A;  4GA0 A;  4ILI A;  3EUV A;  2A5U A;  3ASF A;  5FIO A;  2J07 A;  1DC2 A;  4G8K A;  1IQU A;  2KBX A;  2VSN A;  2VGX A;  4JEH A;  3I5P A;  5KNH D;  4MBG A;  3V30 A;  4XI9 A;  3IBE A;  2LNI A;  2LO6 A;  4A3V A;  4W9R A;  3CSF A;  3CVQ A;  3MV2 B;  3QOU A;  2Q7F A;  5A7D B;  3ASO E;  3FUH A;  4J8F A;  3LVR E;  3HVE B;  2V5Q C;  3ZHE B;  3T8K A;  3VLD A;  3UUX A;  1OCO E;  1N4Q A;  1TNO A;  4WAF A;  5G55 A;  2C2L A;  1TJC A;  3L16 A;  2EIL E;  4PH4 B;  3JCK C;  4ME2 A;  3DSS A;  4O1P A;  4J8S A;  3LS8 A;  4JC8 A;  2XCB A;  4GAA A;  4N5C A;  3Q49 B;  4BER A;  3C3Q A;  1IHG A;  2YNQ A;  2X6H A;  3CHM A;  3TWX A;  4HS2 A;  4FLH A;  1E7V A;  3UX4 A;  4HOT A;  4I43 A;  4EZL A;  4U0S A;  3TL5 A;  5KJK A;  5KBA A;  3SF4 A;  3TWT A;  1HH8 A;  2ZIR A;  4I9E A;  4LG6 A;  3RSE G;  3AJI A;  3D9M A;  1WG0 A;  3D9O A;  2AXU A;  4HLL A;  2R03 A;  4TXQ A;  3Q5M A;  2NYJ A;  2XPZ A;  1IXV A;  3HG0 D;  3CVU A;  2X38 A;  4PDX A;  3B7R L;  2P9U G;  3MGB A;  5ARF A;  4JHJ A;  4WNF A;  2EIN E;  5HS0 A;  5JHA A;  2LSV A;  1KZP A;  2AWI A;  3CQC B;  5HQ8 A;  3DPD A;  4F6R D;  3V2O A;  3TGO A;  2WM9 A;  5LCW C;  2ZGD A;  5D0O D;  1Z3X A;  2AXZ A;  4Q96 A;  2IF4 A;  3FU0 A;  3FUK A;  1GW6 A;  3CVW A;  4AP2 A;  3D9L A;  1TR4 A;  4F53 A;  4FHK A;  1BPO A;  1YCS B;  2Y69 E;  2LSU A;  3B7U X;  4EEC A;  2FO7 A;  5BV0 A;  4DRX E;  4HBD A;  3E37 A;  1PAQ A;  2OVB A;  4BT8 A;  3QAR A;  3MYV A;  1S63 A;  1NA3 A;  2FUL A;  4I17 A;  4GZ3 A;  3U9W A;  4L1B A;  1WDY A;  1LF8 A;  1MX2 A;  1NA0 A;  3NZU A;  4HRL A;  1OWP A;  3P2B A;  1NZN A;  2AVP A;  1YMP A;  5AAR A;  2HM8 A;  3T8M A;  3CHO A;  3Q4A B;  1HFA A;  4BY6 A;  1HO8 A;  4G8L A;  2I1K A;  4D10 C;  3TWS A;  3DWL G;  4G11 A;  1JPL A;  2YIN A;  1SA5 A;  2H6F A;  3V31 A;  1DCQ A;  1K1B A;  3EHQ A;  2GRM A;  1TYQ G;  3VLF A;  4DJA A;  3SBT B;  2IOL A;  2RFA A;  3LXU X;  3IV0 A;  3OXL A;  1N4R A;  4AOF A;  1PY1 A;  1U3C A;  3VTX A;  4L2L A;  1K8K G;  3HVE A;  5EID A;  2KAT A;  3ZHE A;  5DBK A;  3KAE A;  3IEG A;  4B8A A;  5FQ7 A;  3W9G A;  2ILR A;  1HU3 A;  3APF A;  1MX6 A;  2ETA A;  1JUQ A;  4HOQ A;  5ENN A;  3D9I A;  5CEC B;  3CIA A;  3TWR A;  4JA7 A;  4M7C A;  4BES A;  1IHB A;  1KT1 A;  1N0Q A;  3DBS A;  3QAQ A;  4G1T A;  5KWD A;  2L0T B;  5E75 A;  4O1O A;  4APO A;  2FO1 E;  3JQ1 A;  1Z6T A;  2XEV A;  5LCW J;  2BUG A;  2KXP C;  4K5C A;  5AQA A;  3RKV A;  5AIJ A;  3PRZ A;  1VDY A;  2IOS A;  4G24 A;  1HXI A;  5T3R A;  4BX8 A;  1L5J A;  3UM3 A;  3IXE A;  3TWW A;  3ESL A;  3K9I A;  4LNU D;  5BW8 C;  1MZC A;  4XZ4 A;  3S7B A;  1RW2 A;  4P29 A;  4MLP A;  3RO3 A;  3ZKJ A;  3NZS A;  3PUK A;  4XI0 A;  1UN9 A;  5CRV A;  4YDW A;  3DXM G;  4U04 A;  1TEZ A;  3B7S A;  2WXL A;  3HIZ A;  4U95 D;  2OV8 A;  3LCA A;  4CRW A;  2QFC A;  2KCV A;  4AY5 A;  1KT0 A;  3G2S A;  3FUJ A;  3OTN A;  3UT4 A;  4GA2 A;  1NL4 A;  4UWL A;  3L22 A;  3VLE A;  4KXK B;  3ZVV A;  4I6J A;  5AN8 A;  1OCR E;  4EPZ A;  2RKK A;  1OWN A;  3HXC A;  3FUM A;  4YDY A;  3NBN B;  2PM6 A;  3ML8 A;  4ATG A;  3G2U A;  4GTM A;  4FLB A;  3HXB A;  4QQI A;  4I1A A;  4URK A;  5B1B E;  1E8Z A;  3DPY A;  3J5Q B;  3ULE G;  4UQX A;  2XRZ A;  4C48 B;  3TWQ A;  3AG1 E;  2EIK E;  4WWO A;  5JJ6 A;  4A55 A;  2OOE A;  5CMW A;  4LNB A;  4GTV A;  1OWM A;  2EQX A;  3PS6 A;  4A1S A;  4J0U A;  2QZA A;  3QC1 A;  5D66 A;  2ETB A;  1BI7 B;  1V54 E;  2CHZ A;  4AXH A;  2WVI A;  4C0M A;  2WQH A;  4Y6C A;  5EKQ D;  4Z68 A;  3ZNG A;  3RK6 A;  3CK8 A;  4DK5 A;  3FTU A;  2NSZ A;  4GTO A;  2IFU A;  4K03 A;  3TJP A;  1K3Z D;  3NAW A;  2F37 A;  1JCR A;  1SZA A;  2XZD G;  5AJD A;  3G2W A;  1E8W A;  1IYG A;  2GRQ B;  4EBA A;  3Q75 A;  2IEJ A;  2X6K A;  3IHY A;  3OAW A;  2GRR B;  1UW4 B;  4XE0 A;  4CYM D;  2WPV A;  4AIF A;  3FTZ A;  2R02 A;  4DI4 A;  2GGF A;  3CK9 A;  4NAC A;  3ASD A;  4BX9 A;  2P9P G;  4JXT A;  4CZ2 D;  3PE3 A;  2PZI A;  3FU3 A;  4FAD A;  2OVF A;  3FUL A;  4FC8 A;  3R7R A;  4G25 A;  1JCQ A;  4I6G A;  2KCL A;  3FUE A;  3JQ0 A;  4U8Y D;  1N9A A;  3O4Z A;  3SFZ A;  4XX5 A;  2R05 A;  3S7F A;  4E6H A;  3NB2 A;  4DX1 A;  2KM4 A;  4TUU A;  3R9M A;  2XCC A;  3CLJ A;  3C98 A;  4JB8 P;  4UWF A;  1XNF A;  1D8E A;  3EHM A;  1LD7 A;  3CST A;  3ZU7 B;  4XKB A;  4WNE A;  2R5S A;  5A23 A;  3PZ3 A;  4JHR A;  1Q2Z A;  3J5P A;  4KVO A;  2PM7 A;  3EU9 A;  3E33 A;  1KZO A;  5CED B;  2J4D A;  3ZUV B;  4HRM B;  2DYR E;  4CGV A;  3FUF A;  3JXI A;  3Q9N C;  2QY7 A;  3P1U A;  1ZU2 A;  2H6G A;  3PZ1 A;  3CQG B;  4JEU A;  4N39 A;  3CV0 A;  3GZ2 A;  1MX4 A;  3CHR A;  5JJ7 A;  3KD7 A;  3CR3 A;  4ANU A;  2HYZ A;  2YHC A;  4AV7 A;  2GRL A;  3FUI A;  3FDH A;  2P9I G;  3APC A;  4EHM A;  1N95 A;  4A1G A;  4IN3 B;  4CDM A;  2Y4T A;  1LD8 A;  3FY4 A;  2V0P A;  4TV3 A;  5BV1 A;  2KC7 A;  4HFG A;  3LJ3 A;  3AG3 E;  3BQO A;  3B7T A;  3V79 K;  3DSW A;  1TNU A;  4GZD A;  1O5M A;  4HOU A;  1OY3 D;  2I2O A;  1HE8 A;  3L9T A;  2VTB A;  3Q7A A;  1SA4 A;  2FBN A;  1N11 A;  3FTY A;  3B13 A;  4DLQ A;  5FZR A;  2OEV A;  4NRH B;  4ANV A;  3RJV A;  4UUC A;  3HDX A;  1RZ4 A;  2F8X K;  2CG3 A;  2IO2 C;  4FJZ A;  4KVM A;  1N0R A;  3DSV A;  3E30 A;  3CVY A;  5FTP A;  2X6F A;  4N5Q A;  5FZS A;  3VTY A;  5ENT D;  4BWR A;  3MEK A;  1NI1 A;  1O1R A;  2CHX A;  1JWF A;  4BSX A;  3ABM E;  3ABL E;  3T5V A;  5BNW A;  3PDN A;  4BSZ B;  3LDZ A;  4B0Z A;  4U96 D;  1OWL A;  2L9B A;  3FTW A;  2NC9 A;  3FHE A;  4CDN A;  4ILG A;  2R17 C;  4N3B A;  5EDS A;  3TWU A;  2WXO A;  2DIW A;  3BEE A;  3EHN A;  4YDO A;  1OCC E;  4Q69 A;  4L7T A;  3BG0 B;  3WXX A;  3CHP A;  5KCM A;  3SI5 A;  3CVV A;  2IY0 C;  3CHS A;  2XPI A;  2BTD A;  3UM2 A;  1UJJ A;  5EN5 D;  3PEU B;  4UQY A;  3UTM A;  3CVL A;  1ZB1 A;  1ZBP A;  4ILH B;  4JVS A;  3CGH A;  3Q7F A;  5D2M C;  1MYO A;  3TXN A;  1Z5S C;  3I4R B;  4UWH A;  5DIZ A;  2AJA A;  2WXM A;  4MRU A;  5AJL A;  1U3D A;  1E96 B;  4OAV B;  1X5B A;  2AW6 A;  1UJK A;  5HKP A;  1DCE A;  2ZU6 B;  5BXU A;  5B1A E;  4V3I A;  2XPY A;  3T5X A;  1EYH A;  4NUR A;  4B94 A;  4OVV A;  2FF4 A;  2ETC A;  1N4S A;  4E85 A;  2RFM A;  4AVX A;  5EYP F;  4BEP A;  4GZ5 A;  3ULY A;  2LXM A;  4HI9 A;  5CRU A;  5AEN A;  3E32 A;  1DNP A;  5JHB A;  4N2Q A;  3L08 A;  3S7D A;  4DX5 D;  3UMV A;  2WQ7 A;  5FQ8 A;  5CCL A;  1TN7 A;  5G04 C;  3UPV A;  3MKQ A;  3FTX A;  3UIO C;  3ZEF A;  5LP0 A;  4DX6 D;  5CBO A;  4JD2 G;  3ISM C;  3PEV B;  2M63 A;  2CG2 A;  3FUD A;  3CEQ A;  3LJN A;  5BT1 A;  3I3N A;  1D9S A;  4GCN A;  4UWK A;  4F7A A;  4DX2 A;  3Q15 A;  2P9K G;  2XEN A;  1BD8 A;  3KSQ A;  1S64 A;  2P9N G;  3UIN C;  4C0E A;  2XS8 A;  1TNZ A;  2V5F A;  2FEZ A;  3DST A;  3ZIM A;  4WUY A;  5ENO D;  3FU6 A;  3PZD A;  4LNG A;  3SY2 A;  4UWG A;  3AU5 A;  4GMR A;  2DYS E;  4KBQ A;  3ENE A;  1D8D A;  2DZN A;  2WQ6 A;  3OXF A;  3GZS A;  3LKU A;  3D3M A;  2V4H C;  3AG2 E;  2Y1L E;  3EDT B;  3SFX A;  2XEH A;  1X81 A;  1OT8 A;  4QFV A;  4YDE A;  4LER A;  1OWO A;  3CHQ A;  3TG5 A;  1SVX A;  4EBA G;  4B93 B;  3C5R A;  2MYO A;  4PS7 A;  3CVN A;  3ZFW A;  1FT1 A;  2QYU A;  4JHK A;  5AQ9 A;  5CEA A;  3PUJ A;  4LSZ E;  4IYP A;  1E90 A;  5B3S E;  2V4L A;  4HI8 A;  4RSY A;  4RLY A;  4EZJ A;  3FTS A;  3QWW A;  3FH7 A;  4N3C A;  3ZYK A;  5KJL A;  1Y8M A;  1ELR A;  2EIM E;  4O6F A;  4LRZ A;  2WB2 A;  5FJY A;  3QB2 A;  4JZY A;  2AXV A;  3HYM B;  4O60 A;  3FWV A;  1E8Y A;  2P9L G;  1YYH A;  3DRA A;  3MZL B;  2MOW A;  1SQM A;  4ATZ D;  5BPP A;  5G04 J;  1XGW A;  5CER B;  2GRO B;  3MA5 A;  1N54 A;  4JL0 A;  4HRN A;  3FTV A;  4RQI A;  3BG1 B;  3ZYM A;  2LXL A;  3NOG D;  4YVQ C;  4KZC A;  2KZT B;  3WG7 E;  1S70 B;  1FVH A;  1ELK A;  2HR2 A;  4APF A;  2PQN A;  4GTT A;  2I1J A;  5HRY A;  4HOS A;  2DWZ A;  3UIP C;  4UI9 K;  3ZXS A;  3D9P A;  2P2C P;  3F6Q A;  4GYY A;  2WXK A;  2HE0 A;  4PS8 A;  5CMY A;  5FWQ A;  4ZHB A;  3EIQ C;  2QC9 A;  2OEW A;  3ML9 A;  2VYI A;  3TAX A;  3NF1 A;  2F8Y A;  2J09 A;  1O1S A;  4BET A;  3LPZ A;  1SZ9 A;  4TXR A;  4J8E A;  4GML A;  1B89 A;  3ZN3 A;  1LTX A;  1WM5 A;  4J6I A;  2L6B A;  5FZQ A;  4HXI A;  1FPP A;  2UY1 B;  2J9Q A;  5ENP D;  4OYS A;  1FCH A;  3QJZ A;  4HVB A;  1QYM A;  3RAU A;  4F1P A;  4F3V A;  3LY9 A;  2ZIS A;  1EDU A;  2MHK A;  1HS6 A;  3ESK A;  5JJT A;  2VGY A;  1U2V G;  4I2W A;  4N3A A;  2CHW A;  2J8S D;  4MS6 A;  1A5E A;  4GTS A;  5FQ6 A;  1EPU A;  3GZ1 A;  3TG4 A;  4U0Z A;  3X2Q E;  1A17 A;  2X3M A;  3AU4 A;  4DUI A;  3EHR A;  3QKY A;  4NQ0 A;  1UN8 A;  2H6I A;  2P58 C;  4FJY A;  3UM0 A;  1H2T C;  2JLB A;  4G23 A;  3TWV A;  3TXM A;  1WAO 1;  1JCS A;  2IQC A;  4OAU C;  2C0M A;  3BUA A;  5KJM A;  4LUN U;  4IRU A;  4TXP A;  4FU3 A;  5C2Y A;  3AAA C;  3IKO B;  3ASH A;  2IU1 A;  2I6H A;  5ENQ D;  3QDN A;  3UM1 A;  3ASG A;  2VGE A;  3D9N A;  3ZPJ A;  4FUL A;  4G2V A;  2ION A;  5A6C A;  3L17 A;  1AWC B;  4K5B A;  4WNG A;  4U0U A;  4KT6 B;  3RU0 A;  3D9H A;  3E4B A;  5BXO A;  3FH5 A;  2UWJ G;  3Q79 A;  3T9K A;  3RRM B;  5FT9 A;  1HF8 A;  3NOC D;  2WXG A;  4Q94 A;  5JA4 D;  3B95 A;  1Y6I A;  3FUN A;  3ZXP A;  4U07 A;  4GZ6 A;  4R7L A;  2GRN B;  1EF1 C;  4XEI G;  4U7E B;  1JWG A;  3FH8 A;  2DVW A;  1UOH A;  1E8X A;  3Q9U C;  4FP7 A;  4OVU A;  2YQ8 A;  3SD5 A;  3ZGQ A;  3LEW A;  2GW1 A;  2KZT A;  4GTP A;  2PNN A;  4FA6 A;  3Q47 B;  4G26 A;  3L54 A;  3FP3 A;  3DEP A;  4U63 A;  3KSL A;  4J8D A;  4LEU A;  1H2U A;  2J4B A;  3FEY A;  3FU5 A;  5KJN A;  4GYO A;  4BFR A;  2E0I A;  2OND A;  5EIB E;  3UXG A;  3SHF A;  1SW6 A;  3DEO A;  4GMJ A;  2XGO A;  1N52 A;  3FEX A;  5G05 C;  1MQS A;  5HI7 A;  1WY6 A;  4RG9 A;  3C3R A;  4GA1 A;  5J90 A;  4A3T A;  1KPS B;  3D9K A;  4BTA A;  1MJ0 A;  2DZO A;  1TN8 A;  3U3W A;  3AS5 A;  2R2L A;  2DBA A;  4AJW A;  3Q78 A;  2XGM A;  3MKR A;  4GTQ A; 
#chains in the Genus database with same CATH homology
 2ZGD A;  2BKG A;  3NBN B;  1BD8 A;  3KEA A;  4YDY A;  2QYJ A;  4O60 A;  3W9G A;  2L6B A;  5FIN A;  1IKN D;  4QQI A;  4CZ2 D;  1AWC B;  1YYH A;  3V79 K;  4K5B A;  5ENP D;  5EYL A;  1MX6 A;  2ETA A;  3UTM A;  3B7B A;  5BXO A;  3D9H A;  1G3N B;  1OY3 D;  1QYM A;  1NFI E;  3J5Q B;  3T9K A;  3W9F A;  4ATZ D;  3JXJ A;  2B0O E;  5CEC B;  1TR4 A;  4NIK A;  5ENO D;  4A63 B;  4ZFH A;  1MYO A;  3TWR A;  4F1P A;  5CER B;  3NOC D;  3V2X A;  4BES A;  1IHB A;  2AJA A;  5JA4 D;  1N0Q A;  5JMN D;  1YCS B;  4O1P A;  3B95 A;  5KWD A;  2A5E A;  1N11 A;  4C48 B;  4HRN A;  3TWQ A;  4O1O A;  4U8Y D;  4GMR A;  4DRX E;  4HBD A;  2J8S D;  3JUE A;  5AAO A;  4BER A;  2FO1 E;  2DZN A;  4OAV B;  5AQB A;  5ENR D;  2DVW A;  1A5E A;  4DX1 A;  1UOH A;  2JAB A;  4UUC A;  5HKP A;  2V4H C;  3Q9U C;  4JB8 P;  2F8X K;  2ZGG A;  5KNG A;  3NOG D;  3TWX A;  5BXU A;  2KXP C;  4TUM A;  1S70 B;  2Y1L E;  4K5C A;  5AQA A;  3HRA A;  1N0R A;  4DUI A;  3EHR A;  1WDY A;  1MX2 A;  3ZU7 B;  5KBA A;  5D66 A;  4HQD A;  2ETB A;  4N5Q A;  1BI7 B;  3IXE A;  3TWT A;  5ENT D;  5HRY A;  2PNN A;  4HRL A;  2XEH A;  2DWZ A;  2ETC A;  3TWW A;  4LG6 A;  5EIL A;  1AP7 A;  2RFM A;  3AJI A;  5EYP F;  4BEP A;  3J5P A;  4Z68 A;  4U8V D;  1K1A A;  1OT8 A;  4LNU D;  1BLX B;  1WG0 A;  1YMP A;  4GPM A;  4J7W A;  4QFV A;  2P2C P;  3DEP A;  3EU9 A;  3F6Q A;  5AAR A;  3TWV A;  3ZNG A;  5CED B;  4HI9 A;  3ZUV B;  3SO8 A;  4HRM B;  5FIO A;  1BI8 B;  2HE0 A;  4BSZ B;  1SVX A;  3UI2 A;  4HLL A;  1DC2 A;  3JXI A;  4G8K A;  4G8L A;  4ZHB A;  2QC9 A;  3Q9N C;  4DX5 D;  3ZKJ A;  3TWS A;  5EIB E;  2KBX A;  2Y0B G;  3UXG A;  2NYJ A;  4U96 D;  4B93 B;  3C5R A;  1SW6 A;  1K3Z D;  2MYO A;  4YDW A;  2F37 A;  4OAU C;  4HB5 A;  5KNH D;  2BKK B;  2XZD G;  2XZT G;  3DEO A;  3V30 A;  2F8Y A;  2XEE A;  3V31 A;  5ENS D;  5CBN A;  1DCQ A;  1K1B A;  1IXV A;  3HG0 D;  4HNA D;  1MX4 A;  5AQ9 A;  4U95 D;  3EHQ A;  4BET A;  5CEA A;  4DX6 D;  3AAA C;  4LSZ E;  5CBO A;  4CYM D;  5HS0 A;  3TWU A;  4HI8 A;  4RLY A;  5AQ7 A;  1MJ0 A;  2DZO A;  5ITZ F;  3LJN A;  2RFA A;  2V5Q C;  5ENQ D;  4DX7 D;  1D9S A;  4F6R D;  3V2O A;  2VGE A;  3T8K A;  1BU9 A;  5AN8 A;  4K5A B;  4J8Y A;  5EID A;  4DX2 A;  5EN5 D;  2XEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...