5JMND

Fusidic acid bound acrb
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB
publication title Transport of lipophilic carboxylates is mediated by transmembrane helix 2 in multidrug transporter AcrB.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 47
structure length 158
sequence length 158
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5jmnD00
4K5BA 5EYLA 3NOGD 2F8YA 3JUEA 1IXVA 3F6QA 4YDWA 3TWUA 2DZOA 3DEPA 3ZUVB 1K3ZD 3EHRA 4J8YA 5CEAA 2B0OE 5CBOA 1MX2A 1QYMA 1MYOA 1MJ0A 3HG0D 4DRXE 2XENA 1D9SA 4U8VD 2ETBA 4O1PA 5D66A 3AAAC 4GPMA 1BI8B 4BERA 4HRNA 5ENPD 3TWSA 4U8YD 3D9HA 3T8KA 2F37A 4BETA 4HLLA 4TUMA 2P2CP 4C48B 1S70B 4HI9A 4ZHBA 3JXIA 1MX4A 3V31A 4HRMB 2ZGGA 4JB8P 4J7WA 5CEDB 3TWWA 5EIBE 4ATZD 4BESA 5BXOA 2DVWA 4HB5A 2DZNA 4DX1A 2V5QC 1N11A 2FO1E 1OY3D 3HRAA 4N5QA 3Q9NC 5ENTD 4CYMD 3TWRA 3B7BA 4BEPA 1YMPA 2PNNA 4O60A 3V30A 4A63B 2Y0BG 4DX7D 4UUCA 5AQ7A 2XZDG 2V4HC 3EHQA 4O1OA 3UXGA 1BI7B 5CBNA 2BKGA 2JABA 3TWXA 1IHBA 4F6RD 5KBAA 4OAUC 3SO8A 4LSZE 4OAVB 5ENOD 1OT8A 2KBXA 2Y1LE 1BU9A 4NIKA 2L6BA 3ZKJA 3UI2A 4U95D 4K5CA 3ZNGA 3IXEA 4LNUD 5HRYA 2VGEA 5AQ9A 4B93B 3EU9A 4HQDA 3B95A 4RLYA 2XEEA 3DEOA 4DX5D 1G3NB 5AAOA 4HRLA 3T9KA 2HE0A 4F1PA 4CZ2D 4Z68A 3JXJA 5EIDA 2RFMA 1IKND 1BD8A 5HKPA 3NBNB 5EYPF 4DUIA 4DX6D 1K1AA 1BLXB 3V2OA 1DC2A 2XEHA 4G8LA 4HI8A 4K5AB 1MX6A 1SW6A 5AQAA 1WG0A 4HBDA 1DCQA 1SVXA 1N0QA 1WDYA 5ENSD 5FIOA 1AWCB 1AP7A 5AARA 5KWDA 2J8SD 2XZTG 3J5PA 3LJNA 5AN8A 5JMND 5JA4D 3C5RA 3ZU7B 3KEAA 5FINA 2ETAA 2MYOA 3J5QB 4DX2A 4LG6A 5ENQD 2ETCA 4BSZB 4U96D 3AJIA 1YCSB 5ITZF 1K1BA 4YDYA 2KXPC 3TWQA 1A5EA 1YYHA 4QQIA 5HS0A 2NYJA 4HNAD 3UTMA 5CECB 2A5EA 1NFIE 3V79K 3NOCD 5KNHD 2BKKB 3TWVA 3Q9UC 2ZGDA 5EN5D 5KNGA 3W9FA 5AQBA 4ZFHA 4GMRA 4QFVA 1TR4A 5ENRD 2DWZA 1N0RA 3TWTA 2QYJA 2QC9A 5EILA 2RFAA 5CERB 2F8XK 1UOHA 4G8KA 5BXUA 3V2XA 2AJAA 3W9GA
chains in the Genus database with same CATH superfamily
4K5BA 4KVMA 1OCCE 2EQXA 2VSXE 3EHRA 4GTVA 4ANVA 4DRXE 3APDA 2EILE 3D9HA 4DLOA 3R7QA 1FVHA 1NP7A 3UX4A 3KSLA 2I6HA 1H2VC 3TG5A 4JZYA 3ZYQA 2DVWA 3FU0A 3R7RA 2FO1E 4AV7A 1HS6A 4CRWA 2XZDG 4G24A 3GZ1A 3CVPA 4RVBA 3SF4A 2IJGX 1U3DA 3R9MA 3N71A 3FTUA 3MX3A 3PEUB 2RG8A 2GRMA 4U0SA 4LNUD 5HRYA 3C3RA 3RRMB 3B13A 3UM2A 3I5PA 1WAO1 2X6FA 1KT1A 3EU5A 4Q96A 5HQ8A 2IU1A 1N0QA 5ENSD 4N3CA 5JMND 2XEVA 3S7BA 3CVQA 5JJ6A 2R2LA 5D0OD 1H6PA 3U9WA 3FDHA 1QBQA 4U8HA 2RFAA 4G8KA 3UM3A 2V8SE 2PQNA 4FHKA 1NL4A 4J6IA 3MGBA 3CIAA 3SD5A 3L82A 2V4LA 4A3VA 3DWLG 1TN8A 4J8EA 2YNQA 4U8YD 1PY1A 2BUGA 2MRIA 3FWVA 4OYSA 2P9KG 2P9NG 4U0ZA 2Y3AA 4FLBA 1LD8A 4ANXA 1Z5SC 3HRAA 4HOQA 4Q69A 3TWRA 1OXJA 3JUIA 4A63B 2WM9A 2OOEA 4GZ3A 3DXKG 3DPDA 2EIKE 3EIJA 4UQYA 3BU8A 2L6BA 4J8DA 4U95D 4XI9A 5CMWA 4FP7A 3DSXA 3PNTB 3CVXA 5FQ6A 2XS1A 3PS6A 1TNBA 3DRAA 4CGWA 1NA3A 3UQ3A 5HKPA 2R05A 1BLXB 2UWJG 4K5AB 4G23A 4YNDA 3FEYA 2IFUA 3DBSA 3RJVA 4FU3A 3FTZA 2P9UG 4HNAD 4JD2G 3NB2A 5KNHD 1IQUA 4TV3A 4C0EA 2I2OA 2F0YA 2Q7FA 3PE4A 4LUNU 3ZYMA 4HQDA 2IOLA 3ASNE 2XS8A 3ZVVA 3FFLA 3DSUA 4GCOA 3FH8A 4I6JA 4AVXA 3Q49B 5D66A 2XCBA 4GPMA 4BFRA 2DYSE 4FJYA 1WM5A 2ZGGA 4JHRA 1KPSB 4XX5A 4I9CA 3D9IA 4XIFA 2GGFA 1OY3D 5B1BE 5T8IA 3QK0A 4AJWA 3SBTB 2GRLA 3UPVA 3QC1A 4GB9A 2WXPA 3CR3A 3OTNA 4G2VA 3I4GA 3ASHA 3D9OA 3X2QE 5KJMA 5FQ8A 2FI7A 3LDZA 1A17A 2VSNA 3RKVA 2UY1B 1FPPA 4PS3A 4Y6CA 1ELKA 4ANWA 4DX5D 4HRLA 4DPRA 1UJJA 4RSYA 3LJ3A 4HS2A 3OXGA 4DUIA 2KATA 1DC2A 2YHCA 3PDNA 1N9AA 3RO3A 3OXFA 1E8WA 1JWGA 5BPPA 3QWWA 1IQRA 3LKUA 4BTBA 3ESKA 4WUYA 3PUKA 2C0LA 4EPZA 2BKKB 3D3MA 3CHPA 4UI9C 5CERB 3DSWA 1E8YA 1N54A 3NOGD 3Q7FA 1O1SA 3UIPC 3QWVA 1MYOA 4AY5A 3RO2A 4BETA 1N4QA 4HI9A 3LPZA 4N5CA 5G55A 1S64A 4J7WA 3PNLB 1U2VG 2XPZA 2V5QC 4CEMA 3CKCA 4KVOA 2X6HA 3TWXA 2H6IA 4LRZA 3SO8A 3I3NA 1UW4B 5JJTA 2IO3C 2NC9A 3I4RB 4K5CA 2KM4A 2P9PG 4JL0A 2VGEA 5AQ9A 1KZPA 1SZAA 3U3WA 3T5XA 3T9KA 4GZCA 3FTXA 3EIQC 3SQVA 3OAWA 1IKND 5FZRA 2UY1A 5C2YA 4CDNA 4LERA 4HBDA 3KD7A 1TJCA 2XHEA 5FJYA 2L0IA 1IHGA 3L08A 5EX3A 4A1SA 4TRQA 4WWOA 1HG5A 4CT4A 3CHOA 2OCCE 3LEWA 2IF4A 1L5JA 2X6JA 3SHFA 5CEAA 4I1OB 3BQOA 1JCSA 3S7DA 3TWSA 2P58C 3URZA 3UM1A 3PVLA 3MEKA 2LUHA 4O6FA 2QFCA 1LTXA 5AYWD 1S63A 4HB5A 2H6GA 3FH5A 3QAQA 3FH7A 3TL5A 4N5QA 1YA0A 3ASDA 1Y6IA 2CHXA 1N4SA 3P1UA 3GW4A 1XNFA 4LSZE 4OVUA 1OT8A 4NIKA 2IONA 3UI2A 4MS6A 3NAWA 2EINE 2A4ZA 4HOUA 4RLYA 1G3NB 2GRNB 3PZ3A 3AG4E 3SNXA 2WQ7A 1K1AA 4G8LA 4HI8A 1SW6A 1AP7A 4BT8A 4E6HA 3CEQA 1KLXA 4CDRA 4HOTA 4EBAG 3EDTB 4W9RA 3MCXA 5ENQD 4ILGA 5M72A 3ZW3A 3B7RL 1N4PA 1B89A 3W9FA 2J4BA 4C0MA 3ML9A 2J07A 4I17A 4KT6B 5ANLA 1MX2A 5DIZA 3HG0D 1E7UA 4N3BA 1MHQA 2WXRA 3RK6A 3T8KA 2WXKA 3C3QA 1TEZA 1H2TC 1U3CA 2YHEA 4I43A 3UT4A 4NQ0A 5EIBE 4KYOB 4FC8A 1W3BA 4UWLA 1Z3YA 1FCHA 2ZIRA 3L13A 4CYMD 3ZRHA 1YMPA 2V5FA 2WVIA 4GYYA 2KC7A 4A55A 4O1OA 2JABA 4ABNA 4F6RD 4WWPA 3B7TA 3G2SA 5KBAA 2WMOA 4R7LA 4ILIA 2QZAA 2PM6A 2FO7A 4YDOA 4B93B 4BX8A 4WNFA 4X8QA 2JLBA 2VTBB 4M7CA 4GTRA 3ISMC 2RFMA 3LXUX 3UKUG 3L9TA 2XCCA 2XEHA 3AS5A 4EZJA 1QNFA 3CQGB 1DCQA 4B89A 1TNZA 2VYIA 2YINA 3J5PA 3LJNA 5CCLA 5JA4D 3KEAA 3AS4A 4P29A 3ENEA 4YDYA 3PEVB 4HFGA 2NYJA 2HM8A 3CHQA 4GU5A 5D0QD 2B6CA 3TXMA 4BX9A 2DWZA 3TWTA 1OWNA 3KAEA 3GYZA 4B0ZA 2OVBA 2J08A 2AJAA 5KJNA 3S7JA 3RAUA 2VSYA 4Q94A 3F6QA 5KJLA 1V54E 1HZ4A 2PL2A 4AM9A 2LNIA 3JXIA 2X6KA 2BTDA 4BSXA 2OEWA 5HI7A 3FUHA 4UQXA 1E8XA 4MKTA 3EJNA 4PH4B 2XRYA 3VLDA 1DVPA 3E34A 1MZCA 3LYAA 4O60A 1TNYA 3ZIMA 5D2MC 4ACLA 3D9KA 3UIOC 3HXEA 2I9CA 3KS2A 4OAUC 2VSOE 1Y8MA 3U64A 5CHEE 2H6FA 4I1MA 1ELWA 3Q79A 3CSTA 5ANRA 4NRHB 2P9LG 4HOSA 4URKA 2RD0A 1OCOE 3HDXA 3CSFA 3Q78A 4GA1A 4Z68A 3NBNB 3CVUA 2E0IA 4DLQA 2VTBA 2WXJA 3FUMA 4D10C 1WG0A 5AARA 5AN8A 3ZXPA 4UWHA 4CCAA 2AVPA 3ABKE 4DX2A 4BSZB 4HORA 2ONDA 2KXPC 2XPIA 3UUXA 1YYHA 4GA0A 5H7PA 3B7SA 3ULYA 3V79K 3FUFA 3Q9UC 3B7UX 5KNGA 4J8FA 4GAAA 2L9BA 4K03A 1HU3A 5AJLA 3KEZA 4V3IA 1JUQA 3IKOB 5T4YA 4DI3A 3VTXA 5EX0A 4YDWA 4PDXA 2AXUA 2A5UA 1EDUA 5JJ7A 2VGXA 1H19A 2JEKA 4KXKB 5E76A 1QYMA 2ETBA 4G25A 1OWPA 4HRNA 4N2QA 2F37A 4APFA 1OWOA 2WXMA 3T8MA 1X81A 3HYMB 1O5MA 4NACA 3G2TA 4BTAA 2R59A 4DX1A 2EIJE 1NI1A 3RIBA 1LD7A 3JCKC 2V0PA 5FZSA 4L1BA 3V30A 1OCRE 2V4HC 3LVRE 3E30A 4F7AA 1IHBA 2KZTB 4KBQA 3KSQA 3E33A 2ZU6B 3PUJA 3FU5A 5BW8C 1HF8A 2BEDA 5EDSA 2XGOA 2XQ0A 3VTYA 4J0UA 4WNEA 1JCQA 4GMLA 2P9SG 3FY4A 4HLEA 1PAQA 4AP2A 5AQAA 1SVXA 1WDYA 4APOA 1UN9A 2FF4A 2MOWA 3NF1A 3CK7A 4LG6A 4U96D 2RKKA 3AG2E 4U07A 3UTMA 5CCMA 3NQPA 4MLPA 3JQ0A 3UT7A 2PM7A 4L2LA 1JPLA 4JW1A 4AOFA 3PREA 1TR4A 1N95A 4M3OA 4KZCA 1JCRA 3HVEB 3SGHA 3L16A 2HYZA 2J09A 4H7YA 4FULA 3Q5MA 3SBSA 3Q7AA 3TWUA 1UN8A 4WNGA 2MHKA 1MJ0A 1D9SA 4I1AA 1BI8B 3UT8A 4HLLA 1O1RA 2WXGA 3ZPJA 4ZHBA 4UI9J 5C1DA 1E90A 3ONKA 1ZU2A 3Q73A 4KMOA 5CRUA 3ZN3A 2Y0BG 4GTMA 4L23A 3GZSA 3FUJA 2KZTA 3UMVA 3SFZA 4GTSA 2J49A 3CLJA 2X38A 3CVNA 5LCWC 4N3AA 4GYWA 3ZXSA 2J9QA 1H0AA 3IHVA 1MX6A 3ASOE 5A6CA 2WQHA 3EHMA 4EECA 5ITZF 1H6OA 3CHMA 5CECB 5AJDA 4ACKA 3VLEA 2WQ6A 5FT9A 3ZFWA 4U0UA 1ELRA 2FEZA 1N0RA 3UKRG 3CVVA 3MA5A 2IOSA 2AXZA 3QWPA 5BNWA 3ZUVB 3AG1E 3PE3A 1N94A 3HVEA 3LY8A 4U8VD 4O1PA 4BERA 1E96B 4L7TA 3NZSA 5G05C 2P2CP 5G05J 4JB8P 4Y6WA 4AY6A 2FULA 3EHQA 5J90A 4AIFA 1BPOA 3FUKA 2BF0X 2VQ2A 4GTQA 1OWLA 5JHBA 3ABME 2LXLA 5ARFA 4HXIA 5T3RA 4BT9A 3ASGA 2HE0A 1TYQG 2DCPA 5EIDA 3TXNA 3T5VA 1AWCB 1GW6A 3L54A 1S0PA 2WXHA 3C5RA 3ZU7B 1K8KG 4HVBA 2ETCA 3JYSA 3CV0A 2VGYA 2WXOA 4YDEA 4QQIA 2IY0C 3PZ1A 4PS7A 2ZGDA 4JEHA 5EN5D 1HG2A 3L6AA 2KCVA 2QYJA 4B94A 2PZIA 4UWGA 4JEUA 3RRNB 1IXVA 3ZGQA 3IEGA 3PZ2A 3IBEA 3D9NA 1OWMA 4JHJA 3SZ7A 4BWRA 4HRMB 5CEDB 5LP0A 5CMYA 2DZNA 4G26A 4F3VA 3D9JA 3D9LA 4N39A 3SY2A 2LO6A 3LY7A 3UXGA 5CBNA 4XZ4A 4NURA 1TN6A 5J08A 5BT1A 2Y1LE 1N4RA 4JHKA 1QQEA 2XRZA 3S2AA 1HXIA 4AXHA 3EU9A 3ASFA 3FU3A 4GYOA 3AU4A 1JWFA 3APCA 4E85A 3ULEG 5LFAA 3Q47B 2DBAA 2Y69E 3ESLA 5LOZA 1SA5A 5FINA 2ETAA 3BUAA 4G1TA 2M63A 1K1BA 1A5EA 5G04C 5G04J 5HS0A 5IY5E 2A5EA 1QZ2A 4QFVA 5ENRD 4CDMA 1RZ4A 1IYGA 2I1KA 4IRUA 4DK5A 5FQ7A 3FTYA 1Z3XA 3FHEA 1K3ZD 4J8YA 2H6HA 2X3MA 3QOUA 2WXNA 3ZHEB 4IN3B 2HR2A 3RU0A 4C48B 5BV1A 3TWWA 3WXXA 5BXOA 2VGXB 3RRUA 2PQRA 4B8CB 1KZOA 3Q15A 3SI5A 3APFA 3UINC 2LAHA 3LS8A 2LXMA 4H7XA 2IQCA 3PZDA 4FJZA 3ZYKA 4RQIA 3D9PA 1OUVA 2XEEA 2AWIA 1HE8A 3NZUA 1HO8A 3L22A 3JXJA 4EZLA 4DX6D 1H6KA 4AEZC 3TJPA 2HO1A 4XKBA 4TXPA 2DIWA 1FT1A 4GTOA 2EIME 4GCNA 5KCMA 2L6JA 2XGSA 4JPSA 2R03A 4I6GA 5E75A 3AU5A 3E32A 3TWVA 2IEJA 4GMRA 4L9PA 3OXLA 4GZ6A 1XGWA 3QARA 5BXUA 3LVQE 4RG6A 3UM0A 4LEUA 3CK8A 2DZOA 3DEPA 2B0OE 5CBOA 3FU6A 3SFYA 2CHZA 3QNKA 2NSZA 4F1SA 2I1JA 1WY6A 3ZEFA 4TUMA 4LNBA 3U4TA 1E8ZA 4CT0A 3CVYA 4GA2A 3ZHEA 4BESA 3HXBA 3ULQA 4JC8A 5B3SE 4JA9A 3Q9NC 4BEPA 3CQCB 2PNNA 1DNPA 1UJKA 3PRZA 1BI7B 5G2NA 2BKGA 3FULA 3U66A 3C72A 5BV0A 3RSEG 2XGMA 2CHWA 3IHYA 3MKQB 3ZKJA 1TNOA 3DSTA 3ZNGA 3IXEA 1N52A 4WWNA 5AAOA 2P9IG 4JVSA 4U04A 4UI9K 1V55E 4XE0A 2WMNA 5JHAA 3TGOA 3MKRA 3S7FA 5BUZA 3SFXA 3TG4A 1INZA 2KCKA 1D8DA 3FP3A 1SZ9A 4FA6A 1NFIE 4FADA 1SA4A 2Y4UA 3FTVA 5AQBA 4A1GA 1H2UA 1TNUA 3V2XA 5EKQD 2ZISA 4UWKA 3HXDA 3DSSA 4JXTA 2XENA 3JQ1A 4A3TA 2X6IA 1VDYA 3FEXA 4GMJA 4ME2A 2C0MA 1MX4A 4I2WA 3O4ZA 2ILRA 5AIJA 3FUNA 3C98A 3MZLB 3B7BA 2XPYA 3CHSA 5AQ7A 2J4DA 3PZ4A 5LX8A 1ZB1A 4OVVA 2CFUA 4MRUA 1RW2A 4IULA 1BU9A 2R5SA 4PUCA 4CGVA 3ML8A 3CGHA 3G2VA 3TAXA 3GZ2A 3MKQA 2QYUA 4F53A 1FT2A 3Q75A 1TN7A 1DCEA 1OCZE 2GW1A 1BD8A 1Z6TA 5EYPF 4J8SA 3MV3B 2CG2A 2KCLA 5KWDA 3DPYA 4EZKA 4JA7A 1X5BA 3AJIA 1O1TA 3CVWA 2R02A 2CFZA 4BY6A 5LCWJ 4TXQA 3O48A 4GTPA 4LNGA 4N2SA 4GZ5A 1SQMA 1NZNA 5EILA 5ENNA 4XEIG 3IV0A 3QKYA 1UOHA 3CHRA 1KT0A 2GRPB 3G2UA 5EYLA 2F8YA 4TXRA 1HH8A 2WXIA 4B8AA 4TUUA 3AS8A 4GZDA 2YQ8A 3DXMG 3AAAC 2VJ8A 5ENPD 3QJZA 5FZQA 4RG9A 1MQSA 3V31A 2GRRB 5B1AE 2GRQB 2R17C 4MBGA 4ATZD 3R9AB 1FVFA 1NA0A 3L17A 5ENTD 2OEVA 1EPUA 4ANUA 4DX7D 3HIZA 4G11A 3QDNA 2WB2A 4OAVB 5ENOD 5A23A 4GPKA 4K0RA 3P2BA 4IYPA 3DEOA 3K9IA 3FTWA 4UWFA 3AG3E 4F1PA 2L0TB 2OVFA 2QY7A 3FUIA 4I6EA 3FUEA 3V2OA 1LF8A 3Q4AB 5ARGA 3BG0B 2OV8A 3PH0C 5CRVA 1D8EA 2LAIA 3J5QB 4U63A 2E2EA 1PC2A 2IO2C 3FUDA 2WXLA 3HHMA 2WXFA 3CK9A 5FQ4A 2GROB 4ILHB 4ZFHA 3ABLE 3W9GA 4ATGA 2WXQA 3JUEA 4C9BB 3CVLA 3BEEA 4LCTA 2CG3A 4WAFA 4YVQC 3HXCA 4U7EB 1S70B 4EQFA 5AENA 3LY9A 1TJFA 2ZXWE 1N11A 5DBKA 3E37A 3VLFA 4UUCA 5FTPA 3WG7E 3ONLA 1EYHA 4WNDA 4XKCA 2KBXA 1UG3A 4PS8A 4GTTA 3ZYLA 3EHNA 3MJWA 2LSUA 4L2YA 4FHJA 2WPVA 3B95A 3FTSA 3HXFA 4DJAA 1EF1C 4CZ2D 2NXPA 5KJKA 1P5QA 3DSVA 4FLHA 4UQZA 2FBNA 3D9MA 3MYVA 3G2WA 5FIOA 4I2ZA 3C3OA 2J8SD 2XZTG 4I9EA 4DI4A 3E4BA 4EBAA 2MYOA 1Q2ZA 1YCSB 2C2LA 3TWQA 1HX8A 4KZ0A 2Y4TA 3LCAA 2LSVA 2DYRE 3NOCD 4EHMA 4YVOA 1HFAA 3QB2A 3CKBA 1E7VA 1ZBPA 3EUVA 5FWQA 2AXVA 2QC9A 4XI0A 3BG1B 5A7DB 3MV2B 2F8XK 2AW6A
chains in the Genus database with same CATH topology
4K5BA 5EYLA 3NOGD 2F8YA 3JUEA 1IXVA 3F6QA 4YDWA 3TWUA 2DZOA 3DEPA 3ZUVB 1K3ZD 3EHRA 4J8YA 5CEAA 2B0OE 5CBOA 1MX2A 1QYMA 1MYOA 1MJ0A 3HG0D 4DRXE 2XENA 1D9SA 4U8VD 2ETBA 4O1PA 5D66A 3AAAC 4GPMA 1BI8B 4BERA 4HRNA 5ENPD 3TWSA 4U8YD 3D9HA 3T8KA 2F37A 4BETA 4HLLA 4TUMA 2P2CP 4C48B 1S70B 4HI9A 4ZHBA 3JXIA 1MX4A 3V31A 4HRMB 2ZGGA 4JB8P 4J7WA 5CEDB 3TWWA 5EIBE 4ATZD 4BESA 5BXOA 2DVWA 4HB5A 2DZNA 4DX1A 2V5QC 1N11A 2FO1E 1OY3D 3HRAA 4N5QA 3Q9NC 5ENTD 4CYMD 3TWRA 3B7BA 4BEPA 1YMPA 2PNNA 4O60A 3V30A 4A63B 2Y0BG 4DX7D 4UUCA 5AQ7A 2XZDG 2V4HC 3EHQA 4O1OA 3UXGA 1BI7B 5CBNA 2BKGA 2JABA 3TWXA 1IHBA 4F6RD 5KBAA 4OAUC 3SO8A 4LSZE 4OAVB 5ENOD 1OT8A 2KBXA 2Y1LE 1BU9A 4NIKA 2L6BA 3ZKJA 3UI2A 4U95D 4K5CA 3ZNGA 3IXEA 4LNUD 5HRYA 2VGEA 5AQ9A 4B93B 3EU9A 4HQDA 3B95A 4RLYA 2XEEA 3DEOA 4DX5D 1G3NB 5AAOA 4HRLA 3T9KA 2HE0A 4F1PA 4CZ2D 4Z68A 3JXJA 5EIDA 2RFMA 1IKND 1BD8A 5HKPA 3NBNB 5EYPF 4DUIA 4DX6D 1K1AA 1BLXB 3V2OA 1DC2A 2XEHA 4G8LA 4HI8A 4K5AB 1MX6A 1SW6A 5AQAA 1WG0A 4HBDA 1DCQA 1SVXA 1N0QA 1WDYA 5ENSD 5FIOA 1AWCB 1AP7A 5AARA 5KWDA 2J8SD 2XZTG 3J5PA 3LJNA 5AN8A 5JMND 5JA4D 3C5RA 3ZU7B 3KEAA 5FINA 2ETAA 2MYOA 3J5QB 4DX2A 4LG6A 5ENQD 2ETCA 4BSZB 4U96D 3AJIA 1YCSB 5ITZF 1K1BA 4YDYA 2KXPC 3TWQA 1A5EA 1YYHA 4QQIA 5HS0A 2NYJA 4HNAD 3UTMA 5CECB 2A5EA 1NFIE 3V79K 3NOCD 5KNHD 2BKKB 3TWVA 3Q9UC 2ZGDA 5EN5D 5KNGA 3W9FA 5AQBA 4ZFHA 4GMRA 4QFVA 1TR4A 5ENRD 2DWZA 1N0RA 3TWTA 2QYJA 2QC9A 5EILA 2RFAA 5CERB 2F8XK 1UOHA 4G8KA 5BXUA 3V2XA 2AJAA 3W9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5B A;  5EYL A;  3NOG D;  2F8Y A;  3JUE A;  1IXV A;  3F6Q A;  4YDW A;  3TWU A;  2DZO A;  3DEP A;  3ZUV B;  1K3Z D;  3EHR A;  4J8Y A;  5CEA A;  2B0O E;  5CBO A;  1MX2 A;  1QYM A;  1MYO A;  1MJ0 A;  3HG0 D;  4DRX E;  2XEN A;  1D9S A;  4U8V D;  2ETB A;  4O1P A;  5D66 A;  3AAA C;  4GPM A;  1BI8 B;  4BER A;  4HRN A;  5ENP D;  3TWS A;  4U8Y D;  3D9H A;  3T8K A;  2F37 A;  4BET A;  4HLL A;  4TUM A;  2P2C P;  4C48 B;  1S70 B;  4HI9 A;  4ZHB A;  3JXI A;  1MX4 A;  3V31 A;  4HRM B;  2ZGG A;  4JB8 P;  4J7W A;  5CED B;  3TWW A;  5EIB E;  4ATZ D;  4BES A;  5BXO A;  2DVW A;  4HB5 A;  2DZN A;  4DX1 A;  2V5Q C;  1N11 A;  2FO1 E;  1OY3 D;  3HRA A;  4N5Q A;  3Q9N C;  5ENT D;  4CYM D;  3TWR A;  3B7B A;  4BEP A;  1YMP A;  2PNN A;  4O60 A;  3V30 A;  4A63 B;  2Y0B G;  4DX7 D;  4UUC A;  5AQ7 A;  2XZD G;  2V4H C;  3EHQ A;  4O1O A;  3UXG A;  1BI7 B;  5CBN A;  2BKG A;  2JAB A;  3TWX A;  1IHB A;  4F6R D;  5KBA A;  4OAU C;  3SO8 A;  4LSZ E;  4OAV B;  5ENO D;  1OT8 A;  2KBX A;  2Y1L E;  1BU9 A;  4NIK A;  2L6B A;  3ZKJ A;  3UI2 A;  4U95 D;  4K5C A;  3ZNG A;  3IXE A;  4LNU D;  5HRY A;  2VGE A;  5AQ9 A;  4B93 B;  3EU9 A;  4HQD A;  3B95 A;  4RLY A;  2XEE A;  3DEO A;  4DX5 D;  1G3N B;  5AAO A;  4HRL A;  3T9K A;  2HE0 A;  4F1P A;  4CZ2 D;  4Z68 A;  3JXJ A;  5EID A;  2RFM A;  1IKN D;  1BD8 A;  5HKP A;  3NBN B;  5EYP F;  4DUI A;  4DX6 D;  1K1A A;  1BLX B;  3V2O A;  1DC2 A;  2XEH A;  4G8L A;  4HI8 A;  4K5A B;  1MX6 A;  1SW6 A;  5AQA A;  1WG0 A;  4HBD A;  1DCQ A;  1SVX A;  1N0Q A;  1WDY A;  5ENS D;  5FIO A;  1AWC B;  1AP7 A;  5AAR A;  5KWD A;  2J8S D;  2XZT G;  3J5P A;  3LJN A;  5AN8 A;  5JMN D;  5JA4 D;  3C5R A;  3ZU7 B;  3KEA A;  5FIN A;  2ETA A;  2MYO A;  3J5Q B;  4DX2 A;  4LG6 A;  5ENQ D;  2ETC A;  4BSZ B;  4U96 D;  3AJI A;  1YCS B;  5ITZ F;  1K1B A;  4YDY A;  2KXP C;  3TWQ A;  1A5E A;  1YYH A;  4QQI A;  5HS0 A;  2NYJ A;  4HNA D;  3UTM A;  5CEC B;  2A5E A;  1NFI E;  3V79 K;  3NOC D;  5KNH D;  2BKK B;  3TWV A;  3Q9U C;  2ZGD A;  5EN5 D;  5KNG A;  3W9F A;  5AQB A;  4ZFH A;  4GMR A;  4QFV A;  1TR4 A;  5ENR D;  2DWZ A;  1N0R A;  3TWT A;  2QYJ A;  2QC9 A;  5EIL A;  2RFA A;  5CER B;  2F8X K;  1UOH A;  4G8K A;  5BXU A;  3V2X A;  2AJA A;  3W9G A; 
#chains in the Genus database with same CATH topology
 4K5B A;  4KVM A;  1OCC E;  2EQX A;  2VSX E;  3EHR A;  4GTV A;  4ANV A;  4DRX E;  3APD A;  2EIL E;  3D9H A;  4DLO A;  3R7Q A;  1FVH A;  1NP7 A;  3UX4 A;  3KSL A;  2I6H A;  1H2V C;  3TG5 A;  4JZY A;  3ZYQ A;  2DVW A;  3FU0 A;  3R7R A;  2FO1 E;  4AV7 A;  1HS6 A;  4CRW A;  2XZD G;  4G24 A;  3GZ1 A;  3CVP A;  4RVB A;  3SF4 A;  2IJG X;  1U3D A;  3R9M A;  3N71 A;  3FTU A;  3MX3 A;  3PEU B;  2RG8 A;  2GRM A;  4U0S A;  4LNU D;  5HRY A;  3C3R A;  3RRM B;  3B13 A;  3UM2 A;  3I5P A;  1WAO 1;  2X6F A;  1KT1 A;  3EU5 A;  4Q96 A;  5HQ8 A;  2IU1 A;  1N0Q A;  5ENS D;  4N3C A;  5JMN D;  2XEV A;  3S7B A;  3CVQ A;  5JJ6 A;  2R2L A;  5D0O D;  1H6P A;  3U9W A;  3FDH A;  1QBQ A;  4U8H A;  2RFA A;  4G8K A;  3UM3 A;  2V8S E;  2PQN A;  4FHK A;  1NL4 A;  4J6I A;  3MGB A;  3CIA A;  3SD5 A;  3L82 A;  2V4L A;  4A3V A;  3DWL G;  1TN8 A;  4J8E A;  2YNQ A;  4U8Y D;  1PY1 A;  2BUG A;  2MRI A;  3FWV A;  4OYS A;  2P9K G;  2P9N G;  4U0Z A;  2Y3A A;  4FLB A;  1LD8 A;  4ANX A;  1Z5S C;  3HRA A;  4HOQ A;  4Q69 A;  3TWR A;  1OXJ A;  3JUI A;  4A63 B;  2WM9 A;  2OOE A;  4GZ3 A;  3DXK G;  3DPD A;  2EIK E;  3EIJ A;  4UQY A;  3BU8 A;  2L6B A;  4J8D A;  4U95 D;  4XI9 A;  5CMW A;  4FP7 A;  3DSX A;  3PNT B;  3CVX A;  5FQ6 A;  2XS1 A;  3PS6 A;  1TNB A;  3DRA A;  4CGW A;  1NA3 A;  3UQ3 A;  5HKP A;  2R05 A;  1BLX B;  2UWJ G;  4K5A B;  4G23 A;  4YND A;  3FEY A;  2IFU A;  3DBS A;  3RJV A;  4FU3 A;  3FTZ A;  2P9U G;  4HNA D;  4JD2 G;  3NB2 A;  5KNH D;  1IQU A;  4TV3 A;  4C0E A;  2I2O A;  2F0Y A;  2Q7F A;  3PE4 A;  4LUN U;  3ZYM A;  4HQD A;  2IOL A;  3ASN E;  2XS8 A;  3ZVV A;  3FFL A;  3DSU A;  4GCO A;  3FH8 A;  4I6J A;  4AVX A;  3Q49 B;  5D66 A;  2XCB A;  4GPM A;  4BFR A;  2DYS E;  4FJY A;  1WM5 A;  2ZGG A;  4JHR A;  1KPS B;  4XX5 A;  4I9C A;  3D9I A;  4XIF A;  2GGF A;  1OY3 D;  5B1B E;  5T8I A;  3QK0 A;  4AJW A;  3SBT B;  2GRL A;  3UPV A;  3QC1 A;  4GB9 A;  2WXP A;  3CR3 A;  3OTN A;  4G2V A;  3I4G A;  3ASH A;  3D9O A;  3X2Q E;  5KJM A;  5FQ8 A;  2FI7 A;  3LDZ A;  1A17 A;  2VSN A;  3RKV A;  2UY1 B;  1FPP A;  4PS3 A;  4Y6C A;  1ELK A;  4ANW A;  4DX5 D;  4HRL A;  4DPR A;  1UJJ A;  4RSY A;  3LJ3 A;  4HS2 A;  3OXG A;  4DUI A;  2KAT A;  1DC2 A;  2YHC A;  3PDN A;  1N9A A;  3RO3 A;  3OXF A;  1E8W A;  1JWG A;  5BPP A;  3QWW A;  1IQR A;  3LKU A;  4BTB A;  3ESK A;  4WUY A;  3PUK A;  2C0L A;  4EPZ A;  2BKK B;  3D3M A;  3CHP A;  4UI9 C;  5CER B;  3DSW A;  1E8Y A;  1N54 A;  3NOG D;  3Q7F A;  1O1S A;  3UIP C;  3QWV A;  1MYO A;  4AY5 A;  3RO2 A;  4BET A;  1N4Q A;  4HI9 A;  3LPZ A;  4N5C A;  5G55 A;  1S64 A;  4J7W A;  3PNL B;  1U2V G;  2XPZ A;  2V5Q C;  4CEM A;  3CKC A;  4KVO A;  2X6H A;  3TWX A;  2H6I A;  4LRZ A;  3SO8 A;  3I3N A;  1UW4 B;  5JJT A;  2IO3 C;  2NC9 A;  3I4R B;  4K5C A;  2KM4 A;  2P9P G;  4JL0 A;  2VGE A;  5AQ9 A;  1KZP A;  1SZA A;  3U3W A;  3T5X A;  3T9K A;  4GZC A;  3FTX A;  3EIQ C;  3SQV A;  3OAW A;  1IKN D;  5FZR A;  2UY1 A;  5C2Y A;  4CDN A;  4LER A;  4HBD A;  3KD7 A;  1TJC A;  2XHE A;  5FJY A;  2L0I A;  1IHG A;  3L08 A;  5EX3 A;  4A1S A;  4TRQ A;  4WWO A;  1HG5 A;  4CT4 A;  3CHO A;  2OCC E;  3LEW A;  2IF4 A;  1L5J A;  2X6J A;  3SHF A;  5CEA A;  4I1O B;  3BQO A;  1JCS A;  3S7D A;  3TWS A;  2P58 C;  3URZ A;  3UM1 A;  3PVL A;  3MEK A;  2LUH A;  4O6F A;  2QFC A;  1LTX A;  5AYW D;  1S63 A;  4HB5 A;  2H6G A;  3FH5 A;  3QAQ A;  3FH7 A;  3TL5 A;  4N5Q A;  1YA0 A;  3ASD A;  1Y6I A;  2CHX A;  1N4S A;  3P1U A;  3GW4 A;  1XNF A;  4LSZ E;  4OVU A;  1OT8 A;  4NIK A;  2ION A;  3UI2 A;  4MS6 A;  3NAW A;  2EIN E;  2A4Z A;  4HOU A;  4RLY A;  1G3N B;  2GRN B;  3PZ3 A;  3AG4 E;  3SNX A;  2WQ7 A;  1K1A A;  4G8L A;  4HI8 A;  1SW6 A;  1AP7 A;  4BT8 A;  4E6H A;  3CEQ A;  1KLX A;  4CDR A;  4HOT A;  4EBA G;  3EDT B;  4W9R A;  3MCX A;  5ENQ D;  4ILG A;  5M72 A;  3ZW3 A;  3B7R L;  1N4P A;  1B89 A;  3W9F A;  2J4B A;  4C0M A;  3ML9 A;  2J07 A;  4I17 A;  4KT6 B;  5ANL A;  1MX2 A;  5DIZ A;  3HG0 D;  1E7U A;  4N3B A;  1MHQ A;  2WXR A;  3RK6 A;  3T8K A;  2WXK A;  3C3Q A;  1TEZ A;  1H2T C;  1U3C A;  2YHE A;  4I43 A;  3UT4 A;  4NQ0 A;  5EIB E;  4KYO B;  4FC8 A;  1W3B A;  4UWL A;  1Z3Y A;  1FCH A;  2ZIR A;  3L13 A;  4CYM D;  3ZRH A;  1YMP A;  2V5F A;  2WVI A;  4GYY A;  2KC7 A;  4A55 A;  4O1O A;  2JAB A;  4ABN A;  4F6R D;  4WWP A;  3B7T A;  3G2S A;  5KBA A;  2WMO A;  4R7L A;  4ILI A;  2QZA A;  2PM6 A;  2FO7 A;  4YDO A;  4B93 B;  4BX8 A;  4WNF A;  4X8Q A;  2JLB A;  2VTB B;  4M7C A;  4GTR A;  3ISM C;  2RFM A;  3LXU X;  3UKU G;  3L9T A;  2XCC A;  2XEH A;  3AS5 A;  4EZJ A;  1QNF A;  3CQG B;  1DCQ A;  4B89 A;  1TNZ A;  2VYI A;  2YIN A;  3J5P A;  3LJN A;  5CCL A;  5JA4 D;  3KEA A;  3AS4 A;  4P29 A;  3ENE A;  4YDY A;  3PEV B;  4HFG A;  2NYJ A;  2HM8 A;  3CHQ A;  4GU5 A;  5D0Q D;  2B6C A;  3TXM A;  4BX9 A;  2DWZ A;  3TWT A;  1OWN A;  3KAE A;  3GYZ A;  4B0Z A;  2OVB A;  2J08 A;  2AJA A;  5KJN A;  3S7J A;  3RAU A;  2VSY A;  4Q94 A;  3F6Q A;  5KJL A;  1V54 E;  1HZ4 A;  2PL2 A;  4AM9 A;  2LNI A;  3JXI A;  2X6K A;  2BTD A;  4BSX A;  2OEW A;  5HI7 A;  3FUH A;  4UQX A;  1E8X A;  4MKT A;  3EJN A;  4PH4 B;  2XRY A;  3VLD A;  1DVP A;  3E34 A;  1MZC A;  3LYA A;  4O60 A;  1TNY A;  3ZIM A;  5D2M C;  4ACL A;  3D9K A;  3UIO C;  3HXE A;  2I9C A;  3KS2 A;  4OAU C;  2VSO E;  1Y8M A;  3U64 A;  5CHE E;  2H6F A;  4I1M A;  1ELW A;  3Q79 A;  3CST A;  5ANR A;  4NRH B;  2P9L G;  4HOS A;  4URK A;  2RD0 A;  1OCO E;  3HDX A;  3CSF A;  3Q78 A;  4GA1 A;  4Z68 A;  3NBN B;  3CVU A;  2E0I A;  4DLQ A;  2VTB A;  2WXJ A;  3FUM A;  4D10 C;  1WG0 A;  5AAR A;  5AN8 A;  3ZXP A;  4UWH A;  4CCA A;  2AVP A;  3ABK E;  4DX2 A;  4BSZ B;  4HOR A;  2OND A;  2KXP C;  2XPI A;  3UUX A;  1YYH A;  4GA0 A;  5H7P A;  3B7S A;  3ULY A;  3V79 K;  3FUF A;  3Q9U C;  3B7U X;  5KNG A;  4J8F A;  4GAA A;  2L9B A;  4K03 A;  1HU3 A;  5AJL A;  3KEZ A;  4V3I A;  1JUQ A;  3IKO B;  5T4Y A;  4DI3 A;  3VTX A;  5EX0 A;  4YDW A;  4PDX A;  2AXU A;  2A5U A;  1EDU A;  5JJ7 A;  2VGX A;  1H19 A;  2JEK A;  4KXK B;  5E76 A;  1QYM A;  2ETB A;  4G25 A;  1OWP A;  4HRN A;  4N2Q A;  2F37 A;  4APF A;  1OWO A;  2WXM A;  3T8M A;  1X81 A;  3HYM B;  1O5M A;  4NAC A;  3G2T A;  4BTA A;  2R59 A;  4DX1 A;  2EIJ E;  1NI1 A;  3RIB A;  1LD7 A;  3JCK C;  2V0P A;  5FZS A;  4L1B A;  3V30 A;  1OCR E;  2V4H C;  3LVR E;  3E30 A;  4F7A A;  1IHB A;  2KZT B;  4KBQ A;  3KSQ A;  3E33 A;  2ZU6 B;  3PUJ A;  3FU5 A;  5BW8 C;  1HF8 A;  2BED A;  5EDS A;  2XGO A;  2XQ0 A;  3VTY A;  4J0U A;  4WNE A;  1JCQ A;  4GML A;  2P9S G;  3FY4 A;  4HLE A;  1PAQ A;  4AP2 A;  5AQA A;  1SVX A;  1WDY A;  4APO A;  1UN9 A;  2FF4 A;  2MOW A;  3NF1 A;  3CK7 A;  4LG6 A;  4U96 D;  2RKK A;  3AG2 E;  4U07 A;  3UTM A;  5CCM A;  3NQP A;  4MLP A;  3JQ0 A;  3UT7 A;  2PM7 A;  4L2L A;  1JPL A;  4JW1 A;  4AOF A;  3PRE A;  1TR4 A;  1N95 A;  4M3O A;  4KZC A;  1JCR A;  3HVE B;  3SGH A;  3L16 A;  2HYZ A;  2J09 A;  4H7Y A;  4FUL A;  3Q5M A;  3SBS A;  3Q7A A;  3TWU A;  1UN8 A;  4WNG A;  2MHK A;  1MJ0 A;  1D9S A;  4I1A A;  1BI8 B;  3UT8 A;  4HLL A;  1O1R A;  2WXG A;  3ZPJ A;  4ZHB A;  4UI9 J;  5C1D A;  1E90 A;  3ONK A;  1ZU2 A;  3Q73 A;  4KMO A;  5CRU A;  3ZN3 A;  2Y0B G;  4GTM A;  4L23 A;  3GZS A;  3FUJ A;  2KZT A;  3UMV A;  3SFZ A;  4GTS A;  2J49 A;  3CLJ A;  2X38 A;  3CVN A;  5LCW C;  4N3A A;  4GYW A;  3ZXS A;  2J9Q A;  1H0A A;  3IHV A;  1MX6 A;  3ASO E;  5A6C A;  2WQH A;  3EHM A;  4EEC A;  5ITZ F;  1H6O A;  3CHM A;  5CEC B;  5AJD A;  4ACK A;  3VLE A;  2WQ6 A;  5FT9 A;  3ZFW A;  4U0U A;  1ELR A;  2FEZ A;  1N0R A;  3UKR G;  3CVV A;  3MA5 A;  2IOS A;  2AXZ A;  3QWP A;  5BNW A;  3ZUV B;  3AG1 E;  3PE3 A;  1N94 A;  3HVE A;  3LY8 A;  4U8V D;  4O1P A;  4BER A;  1E96 B;  4L7T A;  3NZS A;  5G05 C;  2P2C P;  5G05 J;  4JB8 P;  4Y6W A;  4AY6 A;  2FUL A;  3EHQ A;  5J90 A;  4AIF A;  1BPO A;  3FUK A;  2BF0 X;  2VQ2 A;  4GTQ A;  1OWL A;  5JHB A;  3ABM E;  2LXL A;  5ARF A;  4HXI A;  5T3R A;  4BT9 A;  3ASG A;  2HE0 A;  1TYQ G;  2DCP A;  5EID A;  3TXN A;  3T5V A;  1AWC B;  1GW6 A;  3L54 A;  1S0P A;  2WXH A;  3C5R A;  3ZU7 B;  1K8K G;  4HVB A;  2ETC A;  3JYS A;  3CV0 A;  2VGY A;  2WXO A;  4YDE A;  4QQI A;  2IY0 C;  3PZ1 A;  4PS7 A;  2ZGD A;  4JEH A;  5EN5 D;  1HG2 A;  3L6A A;  2KCV A;  2QYJ A;  4B94 A;  2PZI A;  4UWG A;  4JEU A;  3RRN B;  1IXV A;  3ZGQ A;  3IEG A;  3PZ2 A;  3IBE A;  3D9N A;  1OWM A;  4JHJ A;  3SZ7 A;  4BWR A;  4HRM B;  5CED B;  5LP0 A;  5CMY A;  2DZN A;  4G26 A;  4F3V A;  3D9J A;  3D9L A;  4N39 A;  3SY2 A;  2LO6 A;  3LY7 A;  3UXG A;  5CBN A;  4XZ4 A;  4NUR A;  1TN6 A;  5J08 A;  5BT1 A;  2Y1L E;  1N4R A;  4JHK A;  1QQE A;  2XRZ A;  3S2A A;  1HXI A;  4AXH A;  3EU9 A;  3ASF A;  3FU3 A;  4GYO A;  3AU4 A;  1JWF A;  3APC A;  4E85 A;  3ULE G;  5LFA A;  3Q47 B;  2DBA A;  2Y69 E;  3ESL A;  5LOZ A;  1SA5 A;  5FIN A;  2ETA A;  3BUA A;  4G1T A;  2M63 A;  1K1B A;  1A5E A;  5G04 C;  5G04 J;  5HS0 A;  5IY5 E;  2A5E A;  1QZ2 A;  4QFV A;  5ENR D;  4CDM A;  1RZ4 A;  1IYG A;  2I1K A;  4IRU A;  4DK5 A;  5FQ7 A;  3FTY A;  1Z3X A;  3FHE A;  1K3Z D;  4J8Y A;  2H6H A;  2X3M A;  3QOU A;  2WXN A;  3ZHE B;  4IN3 B;  2HR2 A;  3RU0 A;  4C48 B;  5BV1 A;  3TWW A;  3WXX A;  5BXO A;  2VGX B;  3RRU A;  2PQR A;  4B8C B;  1KZO A;  3Q15 A;  3SI5 A;  3APF A;  3UIN C;  2LAH A;  3LS8 A;  2LXM A;  4H7X A;  2IQC A;  3PZD A;  4FJZ A;  3ZYK A;  4RQI A;  3D9P A;  1OUV A;  2XEE A;  2AWI A;  1HE8 A;  3NZU A;  1HO8 A;  3L22 A;  3JXJ A;  4EZL A;  4DX6 D;  1H6K A;  4AEZ C;  3TJP A;  2HO1 A;  4XKB A;  4TXP A;  2DIW A;  1FT1 A;  4GTO A;  2EIM E;  4GCN A;  5KCM A;  2L6J A;  2XGS A;  4JPS A;  2R03 A;  4I6G A;  5E75 A;  3AU5 A;  3E32 A;  3TWV A;  2IEJ A;  4GMR A;  4L9P A;  3OXL A;  4GZ6 A;  1XGW A;  3QAR A;  5BXU A;  3LVQ E;  4RG6 A;  3UM0 A;  4LEU A;  3CK8 A;  2DZO A;  3DEP A;  2B0O E;  5CBO A;  3FU6 A;  3SFY A;  2CHZ A;  3QNK A;  2NSZ A;  4F1S A;  2I1J A;  1WY6 A;  3ZEF A;  4TUM A;  4LNB A;  3U4T A;  1E8Z A;  4CT0 A;  3CVY A;  4GA2 A;  3ZHE A;  4BES A;  3HXB A;  3ULQ A;  4JC8 A;  5B3S E;  4JA9 A;  3Q9N C;  4BEP A;  3CQC B;  2PNN A;  1DNP A;  1UJK A;  3PRZ A;  1BI7 B;  5G2N A;  2BKG A;  3FUL A;  3U66 A;  3C72 A;  5BV0 A;  3RSE G;  2XGM A;  2CHW A;  3IHY A;  3MKQ B;  3ZKJ A;  1TNO A;  3DST A;  3ZNG A;  3IXE A;  1N52 A;  4WWN A;  5AAO A;  2P9I G;  4JVS A;  4U04 A;  4UI9 K;  1V55 E;  4XE0 A;  2WMN A;  5JHA A;  3TGO A;  3MKR A;  3S7F A;  5BUZ A;  3SFX A;  3TG4 A;  1INZ A;  2KCK A;  1D8D A;  3FP3 A;  1SZ9 A;  4FA6 A;  1NFI E;  4FAD A;  1SA4 A;  2Y4U A;  3FTV A;  5AQB A;  4A1G A;  1H2U A;  1TNU A;  3V2X A;  5EKQ D;  2ZIS A;  4UWK A;  3HXD A;  3DSS A;  4JXT A;  2XEN A;  3JQ1 A;  4A3T A;  2X6I A;  1VDY A;  3FEX A;  4GMJ A;  4ME2 A;  2C0M A;  1MX4 A;  4I2W A;  3O4Z A;  2ILR A;  5AIJ A;  3FUN A;  3C98 A;  3MZL B;  3B7B A;  2XPY A;  3CHS A;  5AQ7 A;  2J4D A;  3PZ4 A;  5LX8 A;  1ZB1 A;  4OVV A;  2CFU A;  4MRU A;  1RW2 A;  4IUL A;  1BU9 A;  2R5S A;  4PUC A;  4CGV A;  3ML8 A;  3CGH A;  3G2V A;  3TAX A;  3GZ2 A;  3MKQ A;  2QYU A;  4F53 A;  1FT2 A;  3Q75 A;  1TN7 A;  1DCE A;  1OCZ E;  2GW1 A;  1BD8 A;  1Z6T A;  5EYP F;  4J8S A;  3MV3 B;  2CG2 A;  2KCL A;  5KWD A;  3DPY A;  4EZK A;  4JA7 A;  1X5B A;  3AJI A;  1O1T A;  3CVW A;  2R02 A;  2CFZ A;  4BY6 A;  5LCW J;  4TXQ A;  3O48 A;  4GTP A;  4LNG A;  4N2S A;  4GZ5 A;  1SQM A;  1NZN A;  5EIL A;  5ENN A;  4XEI G;  3IV0 A;  3QKY A;  1UOH A;  3CHR A;  1KT0 A;  2GRP B;  3G2U A;  5EYL A;  2F8Y A;  4TXR A;  1HH8 A;  2WXI A;  4B8A A;  4TUU A;  3AS8 A;  4GZD A;  2YQ8 A;  3DXM G;  3AAA C;  2VJ8 A;  5ENP D;  3QJZ A;  5FZQ A;  4RG9 A;  1MQS A;  3V31 A;  2GRR B;  5B1A E;  2GRQ B;  2R17 C;  4MBG A;  4ATZ D;  3R9A B;  1FVF A;  1NA0 A;  3L17 A;  5ENT D;  2OEV A;  1EPU A;  4ANU A;  4DX7 D;  3HIZ A;  4G11 A;  3QDN A;  2WB2 A;  4OAV B;  5ENO D;  5A23 A;  4GPK A;  4K0R A;  3P2B A;  4IYP A;  3DEO A;  3K9I A;  3FTW A;  4UWF A;  3AG3 E;  4F1P A;  2L0T B;  2OVF A;  2QY7 A;  3FUI A;  4I6E A;  3FUE A;  3V2O A;  1LF8 A;  3Q4A B;  5ARG A;  3BG0 B;  2OV8 A;  3PH0 C;  5CRV A;  1D8E A;  2LAI A;  3J5Q B;  4U63 A;  2E2E A;  1PC2 A;  2IO2 C;  3FUD A;  2WXL A;  3HHM A;  2WXF A;  3CK9 A;  5FQ4 A;  2GRO B;  4ILH B;  4ZFH A;  3ABL E;  3W9G A;  4ATG A;  2WXQ A;  3JUE A;  4C9B B;  3CVL A;  3BEE A;  4LCT A;  2CG3 A;  4WAF A;  4YVQ C;  3HXC A;  4U7E B;  1S70 B;  4EQF A;  5AEN A;  3LY9 A;  1TJF A;  2ZXW E;  1N11 A;  5DBK A;  3E37 A;  3VLF A;  4UUC A;  5FTP A;  3WG7 E;  3ONL A;  1EYH A;  4WND A;  4XKC A;  2KBX A;  1UG3 A;  4PS8 A;  4GTT A;  3ZYL A;  3EHN A;  3MJW A;  2LSU A;  4L2Y A;  4FHJ A;  2WPV A;  3B95 A;  3FTS A;  3HXF A;  4DJA A;  1EF1 C;  4CZ2 D;  2NXP A;  5KJK A;  1P5Q A;  3DSV A;  4FLH A;  4UQZ A;  2FBN A;  3D9M A;  3MYV A;  3G2W A;  5FIO A;  4I2Z A;  3C3O A;  2J8S D;  2XZT G;  4I9E A;  4DI4 A;  3E4B A;  4EBA A;  2MYO A;  1Q2Z A;  1YCS B;  2C2L A;  3TWQ A;  1HX8 A;  4KZ0 A;  2Y4T A;  3LCA A;  2LSV A;  2DYR E;  3NOC D;  4EHM A;  4YVO A;  1HFA A;  3QB2 A;  3CKB A;  1E7V A;  1ZBP A;  3EUV A;  5FWQ A;  2AXV A;  2QC9 A;  4XI0 A;  3BG1 B;  5A7D B;  3MV2 B;  2F8X K;  2AW6 A; 
#chains in the Genus database with same CATH homology
 4K5B A;  5EYL A;  3NOG D;  2F8Y A;  3JUE A;  1IXV A;  3F6Q A;  4YDW A;  3TWU A;  2DZO A;  3DEP A;  3ZUV B;  1K3Z D;  3EHR A;  4J8Y A;  5CEA A;  2B0O E;  5CBO A;  1MX2 A;  1QYM A;  1MYO A;  1MJ0 A;  3HG0 D;  4DRX E;  2XEN A;  1D9S A;  4U8V D;  2ETB A;  4O1P A;  5D66 A;  3AAA C;  4GPM A;  1BI8 B;  4BER A;  4HRN A;  5ENP D;  3TWS A;  4U8Y D;  3D9H A;  3T8K A;  2F37 A;  4BET A;  4HLL A;  4TUM A;  2P2C P;  4C48 B;  1S70 B;  4HI9 A;  4ZHB A;  3JXI A;  1MX4 A;  3V31 A;  4HRM B;  2ZGG A;  4JB8 P;  4J7W A;  5CED B;  3TWW A;  5EIB E;  4ATZ D;  4BES A;  5BXO A;  2DVW A;  4HB5 A;  2DZN A;  4DX1 A;  2V5Q C;  1N11 A;  2FO1 E;  1OY3 D;  3HRA A;  4N5Q A;  3Q9N C;  5ENT D;  4CYM D;  3TWR A;  3B7B A;  4BEP A;  1YMP A;  2PNN A;  4O60 A;  3V30 A;  4A63 B;  2Y0B G;  4DX7 D;  4UUC A;  5AQ7 A;  2XZD G;  2V4H C;  3EHQ A;  4O1O A;  3UXG A;  1BI7 B;  5CBN A;  2BKG A;  2JAB A;  3TWX A;  1IHB A;  4F6R D;  5KBA A;  4OAU C;  3SO8 A;  4LSZ E;  4OAV B;  5ENO D;  1OT8 A;  2KBX A;  2Y1L E;  1BU9 A;  4NIK A;  2L6B A;  3ZKJ A;  3UI2 A;  4U95 D;  4K5C A;  3ZNG A;  3IXE A;  4LNU D;  5HRY A;  2VGE A;  5AQ9 A;  4B93 B;  3EU9 A;  4HQD A;  3B95 A;  4RLY A;  2XEE A;  3DEO A;  4DX5 D;  1G3N B;  5AAO A;  4HRL A;  3T9K A;  2HE0 A;  4F1P A;  4CZ2 D;  4Z68 A;  3JXJ A;  5EID A;  2RFM A;  1IKN D;  1BD8 A;  5HKP A;  3NBN B;  5EYP F;  4DUI A;  4DX6 D;  1K1A A;  1BLX B;  3V2O A;  1DC2 A;  2XEH A;  4G8L A;  4HI8 A;  4K5A B;  1MX6 A;  1SW6 A;  5AQA A;  1WG0 A;  4HBD A;  1DCQ A;  1SVX A;  1N0Q A;  1WDY A;  5ENS D;  5FIO A;  1AWC B;  1AP7 A;  5AAR A;  5KWD A;  2J8S D;  2XZT G;  3J5P A;  3LJN A;  5AN8 A;  5JMN D;  5JA4 D;  3C5R A;  3ZU7 B;  3KEA A;  5FIN A;  2ETA A;  2MYO A;  3J5Q B;  4DX2 A;  4LG6 A;  5ENQ D;  2ETC A;  4BSZ B;  4U96 D;  3AJI A;  1YCS B;  5ITZ F;  1K1B A;  4YDY A;  2KXP C;  3TWQ A;  1A5E A;  1YYH A;  4QQI A;  5HS0 A;  2NYJ A;  4HNA D;  3UTM A;  5CEC B;  2A5E A;  1NFI E;  3V79 K;  3NOC D;  5KNH D;  2BKK B;  3TWV A;  3Q9U C;  2ZGD A;  5EN5 D;  5KNG A;  3W9F A;  5AQB A;  4ZFH A;  4GMR A;  4QFV A;  1TR4 A;  5ENR D;  2DWZ A;  1N0R A;  3TWT A;  2QYJ A;  2QC9 A;  5EIL A;  2RFA A;  5CER B;  2F8X K;  1UOH A;  4G8K A;  5BXU A;  3V2X A;  2AJA A;  3W9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...