4N2SA

Crystal structure of tha8 in complex with zm1a-6 rna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
197
Chain Sequence
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQRQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALVEAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEAAVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARHLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for RNA recognition by a dimeric PPR-protein complex.
pubmed doi rcsb
source organism Brachypodium distachyon
molecule tags Splicing/rna
molecule keywords THA8 RNA binding protein
total genus 66
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2013-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n2sA00
5LCWC 3PE3A 3ASGA 1Y8MA 2Q7FA 3URZA 4RG9A 2FO7A 2E2EA 4U0ZA 2HYZA 3AS5A 3ZN3A 5ARFA 3UPVA 4WNFA 3NF1A 3S7FA 5BW8C 2YQ8A 2LNIA 3O48A 2KATA 2UWJG 3SZ7A 1QQEA 3ZHEA 4CDRA 5HI7A 2VGXB 4ABNA 5JJ6A 2UY1B 2FF4A 3Q15A 4XI0A 4UQXA 5DBKA 5FZSA 3TG5A 5KJNA 4B94A 2GW1A 3GZ2A 3ZFWA 4GZ6A 2ONDA 2XGMA 4NRHB 3PE4A 3RO2A 1WM5A 3SF4A 3CV0A 5EX0A 4I2WA 3U3WA 4GCNA 3GZ1A 2LSVA 4KXKB 5KJLA 5G05J 2XEVA 5EX3A 2KC7A 5EKQD 2R5SA 3LY8A 4UI9C 4N3CA 4O6FA 2C0LA 4HOUA 3Q5MA 4AM9A 5FZQA 4AY6A 4LEUA 5D0OD 3UUXA 3VTYA 4BTAA 5CCMA 3CVLA 4KYOB 2V5FA 4GCOA 4Y6WA 5FZRA 2L6JA 5M72A 4G23A 3TG4A 2C0MA 2VSNA 4RG6A 3LY7A 1A17A 2KCLA 1IHGA 5G05C 5A7DB 4I2ZA 3TGOA 4N5CA 4WNGA 2J9QA 2PQNA 4J8FA 3CVQA 3OXLA 2WPVA 2C2LA 2YHCA 4UI9J 3CK8A 1HZ4A 4G25A 1WAO1 1OUVA 3PDNA 2MHKA 1P5QA 3FWVA 4AY5A 4BT8A 1KLXA 5BT1A 3LYAA 4I1AA 4BWRA 2XGOA 2VQ2A 3BEEA 4GYYA 3QDNA 1KT1A 4JHRA 4UI9K 4GZ3A 2IFUA 4Y6CA 2FBNA 4HOQA 5ARGA 2PL2A 5FT9A 4CGVA 3ASHA 3K9IA 4BT9A 5A6CA 2QFCA 2LSUA 3MEKA 3Q4AB 2PQRA 4J8DA 2OOEA 4BTBA 2XGSA 1B89A 2I6HA 4I17A 3RU0A 4JA9A 5CCLA 4N39A 5BNWA 3GYZA 2P58C 4GZ5A 5AYWD 5LCWJ 4YNDA 4GYWA 2KCKA 1E96B 3GW4A 4GA2A 2NC9A 3MA5A 3RJVA 4YVQC 1ZBPA 5JJTA 3U4TA 1XNFA 4KBQA 4I9CA 1ELRA 2FEZA 3QKYA 3Q47B 3RIBA 3RKVA 3ASDA 1FCHA 3IEGA 3S7BA 2HR2A 4G1TA 2KCVA 3LKUA 4IN3B 4W9RA 4J8EA 1QZ2A 3HYMB 3CEQA 3OXGA 3CKCA 4U04A 3AS8A 5C1DA 4N3AA 1YA0A 3E4BA 4G24A 3LY9A 4JL0A 2XCCA 4AIFA 3MKRA 2Y4TA 2WQHA 3ZHEB 3CK9A 5G04C 4NQ0A 4U07A 5HQ8A 4HORA 1NA0A 3VTXA 2UY1A 3MV2B 1NZNA 2VGXA 3QWWA 5FJYA 5FTPA 3RO3A 4APOA 4G26A 3WXXA 4GYOA 4CGWA 3FFLA 4GA0A 2XCBA 3ZPJA 2AVPA 2PZIA 3LCAA 1ELWA 4HOTA 2DBAA 4HOSA 3R9AB 3OXFA 4GA1A 2JLBA 3Q49B 4GPKA 3ESKA 1HH8A 5G04J 1KT0A 3EDTB 3UQ3A 5KJKA 2IF4A 4H7YA 4JA7A 4UQZA 3JYSA 5KJMA 3CVPA 3S7DA 2FI7A 3MV3B 3ASFA 2VGYA 2HO1A 3LPZA 1PC2A 4G2VA 4XIFA 5DIZA 1TJCA 1ZU2A 3CKBA 3KD7A 3N71A 2VYIA 3QWPA 4I9EA 3CK7A 3AS4A 3CVNA 3TAXA 4N2SA 4UQYA 1W3BA 4H7XA 4J0UA 4N3BA 4XI9A 3ZGQA 5JJ7A 1IYGA 1HXIA 2XPIA 4YVOA 3S7JA 3ULQA 2BUGA 1NA3A 3FP3A 3KS2A 3QOUA 4WUYA 4U0UA 4ME2A 4F3VA 4N2QA 3QWVA 3KAEA 5CHEE 4WNDA 5D0QD 2VSYA 4A1SA 4EQFA 2Y4UA 4WNEA 4U0SA
chains in the Genus database with same CATH superfamily
1OY3D 3GZSA 2HYZA 3PZ2A 4URKA 5BW8C 1U3CA 2YQ8A 1HX8A 4GTMA 3ZHEA 3UT8A 2NSZA 2AXVA 4AVXA 1JUQA 1WY6A 3CHQA 3SHFA 2OVBA 4JD2G 3UT4A 3D9MA 4C9BB 3FEXA 2EINE 2PQNA 1KZPA 3Q9UC 4I6EA 3LVQE 3O4ZA 4JW1A 3OTNA 3C98A 3K9IA 2EIJE 4HXIA 4AXHA 4OAVB 4I17A 5BNWA 4GA2A 3CGHA 3HYMB 3OXGA 4AIFA 4LG6A 2WQHA 4U96D 2J08A 4NQ0A 4HORA 1NA0A 1NZNA 4GTSA 2XS8A 4CGWA 3FFLA 3UTMA 2DZOA 1PY1A 2P9LG 4PDXA 3ZIMA 4DLOA 5EIBE 3NB2A 3PS6A 3QC1A 4GPKA 4PS7A 1JWGA 3SO8A 1TNUA 3WXXA 5KJKA 4U63A 3U66A 4K5AB 1IYGA 3ULQA 3DRAA 4GZDA 2X3MA 2X6HA 4F3VA 5CHEE 3FUDA 4YDEA 1N4RA 5JMND 2XENA 3LVRE 2IONA 1N52A 2LNIA 1MX4A 3ASNE 3KSQA 1E8ZA 1E8XA 2GW1A 4GCNA 3F6QA 3P1UA 3UMVA 3LY8A 4U8YD 4O6FA 2C0LA 2XZTG 1AP7A 3L9TA 5FZQA 4U8HA 5D0OD 1HS6A 4ILIA 3ESLA 3CVQA 1OWMA 2YHCA 2KZTA 4G8KA 3Q7AA 3RAUA 3FU0A 2XPZA 3J5PA 3U9WA 3DSXA 3EHQA 4LCTA 3P2BA 2OOEA 3UIOC 3ZVVA 1NI1A 4N39A 2KCKA 4C0EA 3MCXA 1JPLA 2GGFA 3B7BA 5IY5E 1H19A 4F1SA 3PNLB 4G1TA 4ACLA 4IN3B 4J8EA 4U04A 2Y4TA 1H0AA 5ENSD 3EUVA 3I4RB 1MZCA 1K3ZD 5JA4D 3B7SA 3JQ0A 5EDSA 1BU9A 1MJ0A 4B89A 4LNGA 2KM4A 5KJMA 3ASFA 1SZ9A 1TJCA 5ENRD 3ULEG 2Y1LE 3ZKJA 3FUMA 4UWGA 3FY4A 1DC2A 3SFXA 4KVOA 3URZA 3D9NA 1OCRE 3VLDA 1SZAA 2VSXE 4RQIA 1Z3XA 1IQUA 4ABNA 3MX3A 4ANXA 3GZ2A 4DX7D 4KXKB 1X5BA 2ETCA 1E8WA 4AJWA 2KCLA 2VSOE 3FTYA 4TXPA 2P9UG 1FPPA 3IHVA 2WQ7A 3QNKA 4Y6CA 2LAIA 4JEHA 4J8DA 3DBSA 4RLYA 1S63A 1D8EA 3RJVA 4XKCA 3TXMA 1XNFA 4J6IA 1O1SA 3V31A 2L0IA 3RK6A 2XQ0A 3ZYMA 3I5PA 3IKOB 1DCEA 4JL0A 1SW6A 3C3OA 3Q78A 4CRWA 3SY2A 4UWHA 4K5CA 1Q2ZA 3T5VA 4GA0A 4BETA 3L6AA 3OXFA 3ZRHA 3EDTB 3CSTA 3DPYA 2FI7A 1UJJA 1KPSB 4N5QA 1O1TA 2VYIA 3CK7A 3ASOE 2P9KG 4DX5D 4YVOA 3V2OA 3FP3A 3IV0A 3C3RA 2WMNA 4BY6A 1UN8A 1N0RA 4K0RA 2IY0C 3FTZA 2RFMA 3JUEA 3ML8A 5JHAA 2ZGDA 2AXUA 3MGBA 2HM8A 2XEEA 1HFAA 4GTVA 3TWUA 3ZNGA 5HI7A 4UQXA 3ZFWA 1FVHA 4Z68A 3SF4A 4Q69A 4XKBA 3EU9A 3GZ1A 2LSVA 3HXDA 2KC7A 3L54A 4GTPA 2YNQA 5EYLA 3VTYA 3CVLA 4G23A 4WWPA 3LY7A 4E6HA 2C2LA 1WDYA 3Q9NC 3TWRA 4AY5A 4BWRA 2XGOA 3APCA 3QDNA 2A5UA 3QAQA 1LF8A 4BT9A 1YYHA 4HI8A 2P58C 4JEUA 4GYWA 4UUCA 5J90A 4ACKA 3BQOA 3CSFA 3Q47B 1OXJA 5T8IA 4GZCA 3WG7E 3FUKA 4G24A 3LY9A 3MKRA 3Q79A 4U07A 5HQ8A 3V79K 4WWNA 5CECB 2CHWA 3FTWA 2OCCE 5AJLA 3NAWA 1N94A 1OWOA 4EZLA 2VGYA 3BUAA 5AIJA 5DIZA 4KZCA 4EHMA 3TAXA 4UQYA 4Q94A 2VSYA 3PUJA 4J7WA 3HXBA 2CG3A 3ONKA 3PNTB 1OWLA 2VGXB 4HBDA 3TWTA 3UM1A 3PEVB 4FADA 4BX8A 3HXFA 1EDUA 2CHZA 3DXKG 1TYQG 4U8VD 2V5FA 3ABME 1WG0A 4DX2A 2ZXWE 5H7PA 3FUIA 1EPUA 2GRQB 1TN7A 4BSXA 3PDNA 2MHKA 1JCSA 1MYOA 3UM2A 3LYAA 2J09A 5ARGA 2LSUA 2J8SD 1E90A 2GRMA 4JA9A 1BI7B 3FDHA 1E96B 4G8LA 3MA5A 2BF0X 3E32A 4R7LA 4APFA 1QZ2A 3ZXSA 3CKCA 3D3MA 4JPSA 2LXMA 5CRVA 3UT7A 4CCAA 1TN8A 5CBNA 3FU5A 2JLBA 3UQ3A 4NURA 4AOFA 3FUHA 3N71A 4NACA 3EIJA 2I2OA 5D66A 3DSTA 1S70B 2JABA 3FTVA 4TUMA 3QJZA 2FO7A 4U0ZA 3TWWA 4FJZA 3U64A 5LP0A 3DXMG 4CDMA 4CDRA 2XRYA 4JC8A 5EYPF 4U95D 2XGMA 2WXFA 1V54E 4NRHB 1WM5A 4YDWA 3TWXA 4CZ2D 4PUCA 2P9NG 4GTQA 2GRPB 2LUHA 5CCMA 3FUEA 5M72A 2AW6A 4FP7A 2DWZA 2CFZA 2J9QA 3OXLA 4G25A 4A3TA 1SA5A 4GPMA 1N4PA 1LD7A 4FLHA 1QYMA 3Q4AB 5ENQD 1SQMA 5ENPD 3JQ1A 1O5MA 1HF8A 3UINC 5AYWD 2NYJA 4YVQC 3EJNA 3U4TA 2XHEA 1MHQA 3HIZA 4GYOA 3CVXA 2F37A 4HQDA 4LSZE 3Q73A 4QQIA 3ZYKA 4MRUA 3ZYQA 4OAUC 1K1BA 4KZ0A 2LXLA 4WUYA 4FJYA 4ME2A 1UN9A 3C72A 1N4SA 2GROB 2I1KA 4DK5A 4MBGA 2F8YA 5B3SE 3SFZA 4KVMA 5AENA 3T9KA 3CV0A 3UI2A 3NBNB 3CVUA 1N4QA 3MKQB 3ZUVB 5G05J 3R7RA 4I1OB 2WXJA 1JWFA 3AG4E 4EZJA 2DYRE 3CHSA 1N54A 2GRNB 2WXKA 4GB9A 2WXPA 1D8DA 3CQGB 3GW4A 2FO1E 4I6JA 2J4DA 3FHEA 3S7BA 4EPZA 2Y69E 2EQXA 3CK9A 2EIKE 4DPRA 3FH7A 2XCBA 5FWQA 4ZHBA 2DBAA 1H2TC 3R9MA 4UWLA 2R2LA 1TNBA 5FIOA 5BPPA 4JXTA 1G3NB 1SVXA 4FULA 3AS4A 5CBOA 1U3DA 1RZ4A 2WXHA 3CHRA 4TXQA 2B6CA 1MX6A 3PUKA 4L2YA 4M3OA 2Y3AA 4TRQA 1UJKA 3D9LA 2B0OE 1H2VC 3QARA 4GZ6A 3RO2A 4BFRA 1BLXB 4XE0A 2FULA 3Q5MA 4AY6A 4LEUA 2WXOA 4GCOA 1TEZA 3FTSA 3TWSA 4WNGA 2WPVA 3L82A 3CK8A 3BEEA 1KT1A 4JHJA 5B1BE 5JHBA 3IXEA 5KWDA 3PRZA 3MYVA 2XGSA 3AU5A 4XZ4A 4F7AA 4L1BA 4B0ZA 4I9CA 2XEHA 3BU8A 3KEAA 2WXQA 3DWLG 3ABLE 4DJAA 2I1JA 4I43A 2XCCA 2VTBA 2ZIRA 3KSLA 3SNXA 3EU5A 2AVPA 3UKRG 4EBAG 2JEKA 2R03A 3G2WA 3MV3B 2HO1A 3SBSA 1EYHA 3CKBA 4I9EA 2IOSA 1BD8A 4H7XA 2EIME 1N0QA 4FHKA 4ZFHA 3OAWA 4MS6A 3KS2A 3AAAC 3KAEA 4JB8P 4WNDA 1EF1C 1JCQA 2AWIA 4EQFA 5BXUA 5KJLA 3ASGA 3HHMA 3C3QA 2P2CP 2WQ6A 1TN6A 3DEOA 2RFAA 3BG1B 2FF4A 1OT8A 2ONDA 5CEAA 3G2UA 5EX0A 3UXGA 1L5JA 4GAAA 1LD8A 3T8MA 3LS8A 5EKQD 2R5SA 4KYOB 2VSNA 4RG6A 4I6GA 4LUNU 4PS3A 5AQAA 3EIQC 1PAQA 1MQSA 3VLEA 3FH8A 1GW6A 5HRYA 5ANRA 2FBNA 3PVLA 2QFCA 3MEKA 4BTBA 3NQPA 5CMWA 4G11A 2GRLA 4F1PA 1VDYA 2L9BA 5BV1A 5FQ4A 5EILA 3ASDA 3RRNB 3LKUA 3AS8A 3APDA 4N3AA 4CT4A 3TL5A 1JCRA 3ZHEB 2L0TB 3I3NA 1NL4A 5ENOD 5HKPA 4DI4A 5LOZA 3PEUB 4C0MA 4HOTA 1YMPA 2AJAA 2DZNA 3ESKA 2IF4A 4L23A 5AQBA 2F0YA 4NIKA 2R05A 2V4HC 1W3BA 3CVYA 2XRZA 4CDNA 2KZTB 1DCQA 4WWOA 3E30A 4HFGA 5BUZA 3S7FA 3E33A 4TXRA 3HG0D 3IHYA 4XX5A 4BEPA 5LX8A 4FLBA 2WXNA 3ZYLA 3RRMB 2NXPA 4DRXE 4LERA 4DUIA 4BESA 2C0MA 5A23A 4F53A 4N5CA 5AARA 3I4GA 5G55A 2HE0A 4I1AA 4JHRA 4UI9K 4GZ3A 1OCZE 1MX2A 1Z3YA 1Z5SC 5FT9A 4CGVA 2X6KA 3HDXA 3UM0A 5CMYA 4ATGA 3EHMA 1B89A 1X81A 2MYOA 1AWCB 1HU3A 2XS1A 1QBQA 3LJ3A 3L13A 3HXCA 1Z6TA 2A4ZA 2IOLA 4W9RA 2RD0A 3CEQA 3E4BA 3D9JA 3PZ3A 3RO3A 2CG2A 5CEDB 4UWKA 2PZIA 3R9AB 2DCPA 2PM6A 1E7VA 3Q49B 5JJTA 2WVIA 3SBTB 2VTBB 4K03A 3SFYA 3S7JA 2L6BA 3DSSA 3HXEA 2RG8A 5AQ9A 3HVEA 1IHBA 2DIWA 3D9PA 5ANLA 2R59A 1UG3A 3UIPC 2BKKB 5DBKA 4J8SA 1U2VG 2V5QC 4E85A 4DLQA 2XEVA 1QNFA 3E37A 2YINA 4FA6A 3CVVA 2WB2A 5D2MC 5AN8A 2AXZA 3ZEFA 1A17A 4X8QA 3TGOA 4I2ZA 1A5EA 3FTXA 4J8FA 5AJDA 3D9KA 4FHJA 5KNHD 1KLXA 4GTRA 1BPOA 5T4YA 1HE8A 1NP7A 4O1PA 4FC8A 1TNOA 1S0PA 3RU0A 4XEIG 1K1AA 4QFVA 3FUJA 4V3IA 5EN5D 2HR2A 3FU3A 4HNAD 2BKGA 1YA0A 1DVPA 3D9HA 3UM3A 4IRUA 5G04C 1XGWA 4HS2A 4ANWA 3FH5A 3TWVA 1N11A 4UQZA 2V4LA 4GMRA 3JYSA 4F6RD 4G2VA 3FTUA 4CT0A 3MJWA 4HVBA 3CIAA 5E75A 3D9OA 2Y4UA 5LCWC 3JUIA 2QZAA 4DX1A 3ZN3A 2H6IA 3NF1A 3X2QE 4BX9A 2UWJG 3TXNA 4RSYA 5FINA 4XI0A 3TG5A 4HRNA 5KJNA 1OWNA 3L17A 2ETAA 5AQ7A 1HO8A 3U3WA 4B8CB 2IQCA 3CQCB 3TWQA 2KXPC 4LRZA 4BTAA 2WXGA 5FZRA 3TG4A 5G05C 1HG2A 2KBXA 3NZSA 1OUVA 4GMLA 1P5QA 2X6IA 4TUUA 2ILRA 3L22A 2EILE 4L2LA 4GYYA 4D10C 3MZLB 4PH4B 1H6OA 3C5RA 1ELKA 1FT1A 3GYZA 1UOHA 2R17C 3SI5A 1LTXA 4I1MA 4WAFA 3AU4A 3CHMA 2UY1A 2VGXA 5FJYA 4APOA 3LCAA 3FULA 4GA1A 3L16A 2YHEA 1KT0A 4JA7A 3S7DA 4CYMD 2IO2C 3AG1E 4A55A 3ZGQA 5JJ7A 1E7UA 4HI9A 4GMJA 4YDYA 1NA3A 5LFAA 3UKUG 2LAHA 2DYSE 3PE3A 3RSEG 5C2YA 5HS0A 5KCMA 3SQVA 3UPVA 2KATA 3PH0C 3SD5A 3IBEA 3ISMC 1TR4A 1K8KG 3CLJA 3ONLA 3PE4A 4I2WA 5BV0A 4YDOA 4UI9C 3FUNA 5T3RA 1FT2A 1OCOE 4Y6WA 4KT6B 1IHGA 4M7CA 3TJPA 2CHXA 4C48B 4HLEA 1IQRA 2IJGX 4B93B 3S2AA 3R7QA 2IFUA 4HLLA 2XZDG 4KBQA 5KBAA 3JXIA 4JVSA 3IEGA 4YNDA 3AJIA 5G2NA 3HRAA 3MV2B 3QWWA 5FTPA 1RW2A 5FQ6A 4H7YA 3EHNA 2P9PG 3KD7A 3SGHA 3QWPA 3CVNA 3JXJA 4XI9A 2H6FA 3RRUA 1S64A 4HB5A 2BUGA 4BERA 1KZOA 3J5QB 4A63B 1D9SA 4WNEA 4U0SA 3B7UX 1Y8MA 3D9IA 4RG9A 5FQ7A 3MKQA 3AS5A 5ARFA 3PZDA 4P29A 3DEPA 4MKTA 3SZ7A 1V55E 2IEJA 5JJ6A 2UY1B 5FZSA 4PS8A 2V0PA 3FEYA 4RVBA 5EX3A 3E34A 3AG2E 5A7DB 1TNYA 3VLFA 4ANUA 4JZYA 4UI9J 2OEWA 3CHPA 1DNPA 1HZ4A 1HG5A 2R02A 3FWVA 4BT8A 4HRLA 5ITZF 4GU5A 4DX6D 2ZGGA 2WXLA 2P9IG 4TV3A 5KNGA 2IO3C 2X6FA 3G2VA 2QYUA 3V30A 2RKKA 4FU3A 1ZBPA 3ML9A 1ELRA 4LNBA 1SA4A 3DSVA 3DSUA 2ZU6B 5C1DA 1Y6IA 1E8YA 5E76A 4G26A 2P9SG 3W9FA 3ZPJA 2X6JA 4KMOA 2MOWA 4A1GA 3G2SA 2OEVA 3FUFA 4J8YA 4XIFA 3VTXA 1INZA 5BXOA 3APFA 2V8SE 2J4BA 4L7TA 3QOUA 4OVUA 4K5BA 2QY7A 5D0QD 2A5EA 2E0IA 2CFUA 3HVEB 2PM7A 3V2XA 2WM9A 3ENEA 2Q7FA 3W9GA 5CRUA 4DI3A 3KEZA 4WNFA 2I9CA 2MRIA 3PZ4A 5ENTD 4GTOA 3NZUA 2WMOA 3B13A 3Q15A 2OVFA 2M63A 4B94A 3DSWA 1TNZA 1OCCE 2VJ8A 4EZKA 4O1OA 1ZB1A 1H6PA 2QC9A 4N3CA 1IXVA 2J07A 1OWPA 1H6KA 2L6JA 3LEWA 4Q96A 3T5XA 2WXMA 4B8AA 2X38A 3ASHA 3PREA 2PQRA 5J08A 2I6HA 1FVFA 5CCLA 3LXUX 3CHOA 3JCKC 2H6HA 3QKYA 3RKVA 4AEZC 3RIBA 1FCHA 2XPYA 2J49A 2Y0BG 3L08A 1ELWA 2VGEA 3ABKE 1HH8A 4ATZD 4O60A 3ZW3A 3CVPA 2QYJA 3LPZA 2WXRA 1ZU2A 2GRRB 3B7RL 4J0UA 4N3BA 3UX4A 2ETBA 2XPIA 3G2TA 4ILHB 2LO6A 2BTDA 3QWVA 4JHKA 4MLPA 1TJFA 4A1SA 4L9PA 3AG3E 2PNNA 2E2EA 3PZ1A 4EBAA 5CERB 4A3VA 3O48A 1QQEA 2F8XK 3Q75A 5LCWJ 3Q7FA 4AV7A 4EECA 4AP2A 3QB2A 4OYSA 4IULA 3NOCD 1BI8B 4HOUA 1O1RA 3ULYA 4AM9A 3UUXA 3B95A 4ILGA 1NFIE 4U7EB 1N9AA 3B7TA 1H2UA 5B1AE 3QK0A 1WAO1 3CR3A 1IKND 5BT1A 2VQ2A 4HOQA 2PL2A 5A6CA 1N95A 3DPDA 2OV8A 1YCSB 4OVVA 4UWFA 4GZ5A 2NC9A 5EIDA 3ZXPA 2DVWA 2FEZA 4GTTA 2KCVA 3T8KA 3CVWA 4LNUD 3FU6A 5FQ8A 5ENNA 4IYPA 2BEDA 4CEMA 3ZU7B 2ZISA 3NOGD 3BG0B 4HRMB 4HOSA 3LDZA 5G04J 3LJNA 4BSZB 1PC2A 5AAOA 4N2SA 2IU1A 1HXIA 4N2QA 2WXIA 4U0UA 1UW4B 4ANVA 2H6GA 3EHRA
chains in the Genus database with same CATH topology
3PE3A 3ASGA 3HHMA 3GZSA 5C2YA 5KCMA 2WQ6A 2HYZA 2CG3A 3ONKA 3UPVA 4URKA 5BW8C 1U3CA 2YQ8A 2KATA 3PH0C 1HX8A 3SD5A 3BG1B 3IBEA 3ZHEA 3PNTB 1OWLA 2VGXB 2FF4A 3UT8A 3CLJA 2NSZA 2AXVA 4AVXA 3ONLA 3PEVB 2ONDA 1JUQA 1WY6A 3CHQA 3PE4A 3SHFA 2OVBA 4FADA 3G2UA 5EX0A 4I2WA 4BX8A 1L5JA 4GAAA 1EDUA 2CHZA 3T8MA 5BV0A 3LS8A 5EKQD 2R5SA 3UT4A 4UI9C 3FUNA 3D9MA 5T3RA 4KYOB 4Y6WA 2V5FA 4C9BB 3FEXA 2VSNA 4RG6A 4KT6B 4I6GA 1IHGA 3TJPA 2CHXA 2PQNA 4LUNU 4PS3A 4HLEA 3EIQC 3FUIA 1PAQA 1EPUA 1IQRA 1MQSA 4BSXA 2IJGX 3PDNA 3VLEA 2MHKA 4I6EA 3LYAA 3S2AA 3LVQE 3O4ZA 4JW1A 3OTNA 3FH8A 1GW6A 3C98A 3R7QA 2IFUA 5ANRA 2J09A 2FBNA 3PVLA 5ARGA 3K9IA 2QFCA 2LSUA 3MEKA 5CMWA 4BTBA 3NQPA 4HXIA 4AXHA 1E90A 4I17A 2GRMA 4JA9A 5BNWA 3FDHA 1E96B 2GRLA 4GA2A 1VDYA 2L9BA 3CGHA 3MA5A 4G11A 5FQ4A 5BV1A 4KBQA 2BF0X 4JVSA 4R7LA 3ASDA 3IEGA 4APFA 3RRNB 3LKUA 4YNDA 1QZ2A 3HYMB 3OXGA 3ZXSA 3CKCA 3D3MA 3AS8A 4JPSA 3APDA 4N3AA 4AIFA 4CT4A 3TL5A 2WQHA 3ZHEB 2J08A 2L0TB 4NQ0A 5G2NA 1NA0A 4HORA 3MV2B 1NZNA 3QWWA 3I3NA 5FTPA 3UT7A 4CCAA 4CGWA 3FFLA 4DI4A 5LOZA 1PY1A 3PEUB 4PDXA 5FQ6A 3ZIMA 3FU5A 4C0MA 4HOTA 4DLOA 2JLBA 3PS6A 3QC1A 4GPKA 3ESKA 4PS7A 3UQ3A 1JWGA 2IF4A 4H7YA 4L23A 3EHNA 3WXXA 4NURA 4AOFA 3FUHA 3KD7A 3SGHA 3QWPA 3N71A 4U63A 5KJKA 3U66A 3CVNA 1W3BA 4NACA 4XI9A 3CVYA 2XRZA 3RRUA 1IYGA 3EIJA 4CDNA 3ULQA 2I2OA 4GZDA 2BUGA 2X3MA 2X6HA 4F3VA 5CHEE 2KZTB 3FTVA 3FUDA 4WNEA 4U0SA 3B7UX 1Y8MA 3QJZA 4WWOA 3D9IA 2FO7A 4RG9A 3MKQA 5FQ7A 4U0ZA 3AS5A 4HFGA 5ARFA 4FJZA 5BUZA 3LVRE 3U64A 2IONA 1N52A 3S7FA 5LP0A 3PZDA 2LNIA 4P29A 4MKTA 3IHYA 4XX5A 3SZ7A 4CDMA 4CDRA 2XRYA 5JJ6A 2UY1B 4JC8A 1E8ZA 5FZSA 5LX8A 1E8XA 2GW1A 2WXNA 4FLBA 3ZYLA 4PS8A 2XGMA 2V0PA 2WXFA 4NRHB 1WM5A 3FEYA 3RRMB 4RVBA 4GCNA 2NXPA 4PUCA 5EX3A 3P1UA 3UMVA 4LERA 3LY8A 4O6FA 2C0LA 5FZQA 4U8HA 5D0OD 5CCMA 1HS6A 3FUEA 4ILIA 5M72A 2AW6A 3ESLA 2C0MA 4FP7A 5A7DB 5A23A 3VLFA 4F53A 2CFZA 4JZYA 4N5CA 4ANUA 2J9QA 4UI9J 3CVQA 1OWMA 3OXLA 2YHCA 2KZTA 3CHPA 1DNPA 1HZ4A 4G25A 4A3TA 3I4GA 1HG5A 3FWVA 5G55A 4BT8A 3FU0A 4I1AA 2XPZA 4JHRA 4UI9K 4GU5A 4GZ3A 1Z3YA 3U9WA 2WXLA 5FT9A 4CGVA 4FLHA 2X6KA 3HDXA 3Q4AB 4LCTA 4TV3A 5CMYA 1SQMA 4ATGA 3EHMA 3P2BA 2OOEA 3JQ1A 3ZVVA 1B89A 1HF8A 2X6FA 4N39A 3G2VA 5AYWD 1HU3A 2KCKA 4FU3A 4YVQC 1ZBPA 3EJNA 3ML9A 3U4TA 3LJ3A 1ELRA 4C0EA 3L13A 3MCXA 1JPLA 1Z6TA 2GGFA 2A4ZA 1H19A 4F1SA 3PNLB 4G1TA 2XHEA 4ACLA 4IN3B 2IOLA 2ZU6B 4J8EA 2RD0A 1MHQA 3CEQA 4U04A 4W9RA 5C1DA 1Y6IA 3E4BA 3D9JA 1E8YA 2Y4TA 1H0AA 5E76A 3HIZA 3RO3A 4G26A 3I4RB 4GYOA 2CG2A 4UWKA 3ZPJA 2PZIA 3B7SA 3JQ0A 5EDSA 4B89A 3CVXA 2X6JA 3R9AB 2DCPA 2PM6A 4KMOA 2KM4A 1E7VA 2MOWA 3Q49B 4A1GA 5KJMA 3G2SA 3FUFA 3ASFA 1SZ9A 4XIFA 3ZYKA 5JJTA 4MRUA 1TJCA 3VTXA 2WVIA 3ZYQA 3SBTB 2VTBB 4K03A 4KZ0A 1INZA 3APFA 3FUMA 2V8SE 2J4BA 4L7TA 3S7JA 4UWGA 3FY4A 3QOUA 4WUYA 4OVUA 2QY7A 4FJYA 4ME2A 5D0QD 2RG8A 1UN9A 2CFUA 2E0IA 3HVEB 2PM7A 2WM9A 3ENEA 3HVEA 2Q7FA 4KVOA 3URZA 3D9NA 2I1KA 4DK5A 3VLDA 1SZAA 2DIWA 2VSXE 3KEZA 3D9PA 4WNFA 4DI3A 5ANLA 2I9CA 2R59A 1UG3A 2MRIA 1Z3XA 1IQUA 3NZUA 2WMOA 4ABNA 3B13A 3Q15A 5DBKA 3SFZA 4J8SA 2OVFA 2M63A 3MX3A 4B94A 4ANXA 3GZ2A 4KVMA 5AENA 2VJ8A 3CV0A 4EZKA 4E85A 3CVUA 4KXKB 3MKQB 5G05J 2XEVA 1QNFA 4DLQA 3R7RA 2YINA 4FA6A 4N3CA 3CVVA 2WB2A 2J07A 4I1OB 2WXJA 1X5BA 1OWPA 1H6KA 2L6JA 1E8WA 2AXZA 4AJWA 3ZEFA 1A17A 2KCLA 1JWFA 2VSOE 3TGOA 4I2ZA 3FTYA 3FTXA 4J8FA 3LEWA 4Q96A 5AJDA 3D9KA 4FHJA 3T5XA 3IHVA 2WXMA 4B8AA 1KLXA 4EZJA 1BPOA 2WQ7A 3QNKA 3CHSA 2X38A 5T4YA 4Y6CA 1HE8A 1NP7A 2LAIA 4FC8A 3ASHA 3PREA 4JEHA 1N54A 2WXKA 2PQRA 4J8DA 5J08A 4GB9A 1S0PA 2I6HA 3DBSA 1FVFA 3RU0A 5CCLA 2WXPA 3CQGB 3LXUX 4QFVA 3RJVA 3GW4A 3CHOA 4XKCA 3JCKC 1XNFA 4J6IA 3TXMA 4I6JA 3FUJA 3QKYA 3RKVA 4AEZC 4V3IA 3RIBA 2J4DA 2L0IA 1FCHA 3RK6A 2XQ0A 3FHEA 3S7BA 2HR2A 2XPYA 3FU3A 3ZYMA 4EPZA 3I5PA 3IKOB 2EQXA 2J49A 1YA0A 4JL0A 1DVPA 4CRWA 4IRUA 3CK9A 1XGWA 4UWHA 5G04C 4DPRA 4HS2A 4ANWA 3FH5A 3T5VA 3L08A 3FH7A 4GA0A 2XCBA 5FWQA 1ELWA 2DBAA 3L6AA 3OXFA 3ZRHA 1HH8A 1H2TC 3EDTB 4UQZA 2V4LA 3CSTA 4UWLA 3JYSA 3ZW3A 3CVPA 2FI7A 1UJJA 5BPPA 3LPZA 2WXRA 4JXTA 4G2VA 1ZU2A 3FTUA 4FULA 4CT0A 2VYIA 3CK7A 3AS4A 3MJWA 1U3DA 3B7RL 4J0UA 4N3BA 3UX4A 4HVBA 3CIAA 2XPIA 3G2TA 4ILHB 4YVOA 2WXHA 3CHRA 3FP3A 3IV0A 2LO6A 5E75A 2BTDA 3QWVA 4JHKA 4MLPA 1TJFA 4A1SA 3D9OA 3PUKA 2Y4UA 4L2YA 2WMNA 4BY6A 1UN8A 5LCWC 3JUIA 4K0RA 3FTZA 2E2EA 4M3OA 3ML8A 3ZN3A 4EBAA 5JHAA 2AXUA 3MGBA 3NF1A 2Y3AA 4A3VA 4BX9A 3O48A 4TRQA 2HM8A 2UWJG 3TXNA 1HFAA 1UJKA 1QQEA 4RSYA 3D9LA 5HI7A 5LCWJ 4XI0A 4AV7A 3TG5A 5KJNA 4UQXA 4EECA 1H2VC 3ZFWA 1OWNA 3QARA 1FVHA 3L17A 4GZ6A 4AP2A 3RO2A 4BFRA 3QB2A 3SF4A 1HO8A 4Q69A 4OYSA 3U3WA 4XKBA 3GZ1A 2LSVA 4B8CB 4XE0A 2IQCA 2KC7A 3CQCB 4IULA 2FULA 3L54A 4LRZA 4HOUA 3Q5MA 4AM9A 2YNQA 4AY6A 4LEUA 3UUXA 3VTYA 2WXGA 4BTAA 4ILGA 2WXOA 3CVLA 4GCOA 5FZRA 4G23A 3TG4A 3B7TA 1H2UA 1TEZA 4WWPA 3FTSA 3LY7A 5G05C 4E6HA 1HG2A 4WNGA 2WPVA 2C2LA 3NZSA 3QK0A 3CK8A 1WAO1 1OUVA 3CR3A 4GMLA 4AY5A 1P5QA 2X6IA 4TUUA 2ILRA 3L22A 5BT1A 4BWRA 2XGOA 2VQ2A 3APCA 3BEEA 3QDNA 1KT1A 4GYYA 4L2LA 4JHJA 4D10C 2A5UA 3QAQA 3MZLB 4HOQA 1LF8A 2PL2A 5JHBA 5A6CA 4PH4B 4BT9A 3PRZA 3DPDA 2OV8A 1ELKA 3MYVA 2XGSA 3AU5A 4XZ4A 4OVVA 4UWFA 3GYZA 2P58C 4GZ5A 4JEUA 4L1BA 2R17C 4GYWA 4B0ZA 4F7AA 2NC9A 5J90A 4I9CA 4ACKA 2FEZA 3SI5A 3CSFA 3Q47B 2WXQA 5T8IA 4GZCA 2KCVA 4I1MA 3CVWA 3FUKA 4WAFA 4G24A 4DJAA 2I1JA 3FU6A 2XCCA 3LY9A 3AU4A 3MKRA 4I43A 2VTBA 5FQ8A 5ENNA 4U07A 5HQ8A 3CHMA 2UY1A 2VGXA 4IYPA 4WWNA 5FJYA 4APOA 4CEMA 3SNXA 2CHWA 3FTWA 2AVPA 3BG0B 3LCAA 3FULA 4HOSA 4GA1A 3L16A 4EBAG 3LDZA 5AJLA 2YHEA 1KT0A 5G04J 4JA7A 3S7DA 2JEKA 3MV3B 3G2WA 1OWOA 2VGYA 2HO1A 4EZLA 1PC2A 3SBSA 5DIZA 4KZCA 1EYHA 5AIJA 3CKBA 4I9EA 2IOSA 4A55A 3TAXA 4N2SA 4UQYA 4H7XA 3ZGQA 4FHKA 5JJ7A 1E7UA 2IU1A 1HXIA 3OAWA 4GMJA 4MS6A 4Q94A 1NA3A 3KS2A 5LFAA 4N2QA 2WXIA 4U0UA 1UW4B 3KAEA 4ANVA 2LAHA 4WNDA 1EF1C 2VSYA 2AWIA 4EQFA 3PUJA 5KJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCW C;  3PE3 A;  3ASG A;  1Y8M A;  2Q7F A;  3URZ A;  4RG9 A;  2FO7 A;  2E2E A;  4U0Z A;  2HYZ A;  3AS5 A;  3ZN3 A;  5ARF A;  3UPV A;  4WNF A;  3NF1 A;  3S7F A;  5BW8 C;  2YQ8 A;  2LNI A;  3O48 A;  2KAT A;  2UWJ G;  3SZ7 A;  1QQE A;  3ZHE A;  4CDR A;  5HI7 A;  2VGX B;  4ABN A;  5JJ6 A;  2UY1 B;  2FF4 A;  3Q15 A;  4XI0 A;  4UQX A;  5DBK A;  5FZS A;  3TG5 A;  5KJN A;  4B94 A;  2GW1 A;  3GZ2 A;  3ZFW A;  4GZ6 A;  2OND A;  2XGM A;  4NRH B;  3PE4 A;  3RO2 A;  1WM5 A;  3SF4 A;  3CV0 A;  5EX0 A;  4I2W A;  3U3W A;  4GCN A;  3GZ1 A;  2LSV A;  4KXK B;  5KJL A;  5G05 J;  2XEV A;  5EX3 A;  2KC7 A;  5EKQ D;  2R5S A;  3LY8 A;  4UI9 C;  4N3C A;  4O6F A;  2C0L A;  4HOU A;  3Q5M A;  4AM9 A;  5FZQ A;  4AY6 A;  4LEU A;  5D0O D;  3UUX A;  3VTY A;  4BTA A;  5CCM A;  3CVL A;  4KYO B;  2V5F A;  4GCO A;  4Y6W A;  5FZR A;  2L6J A;  5M72 A;  4G23 A;  3TG4 A;  2C0M A;  2VSN A;  4RG6 A;  3LY7 A;  1A17 A;  2KCL A;  1IHG A;  5G05 C;  5A7D B;  4I2Z A;  3TGO A;  4N5C A;  4WNG A;  2J9Q A;  2PQN A;  4J8F A;  3CVQ A;  3OXL A;  2WPV A;  2C2L A;  2YHC A;  4UI9 J;  3CK8 A;  1HZ4 A;  4G25 A;  1WAO 1;  1OUV A;  3PDN A;  2MHK A;  1P5Q A;  3FWV A;  4AY5 A;  4BT8 A;  1KLX A;  5BT1 A;  3LYA A;  4I1A A;  4BWR A;  2XGO A;  2VQ2 A;  3BEE A;  4GYY A;  3QDN A;  1KT1 A;  4JHR A;  4UI9 K;  4GZ3 A;  2IFU A;  4Y6C A;  2FBN A;  4HOQ A;  5ARG A;  2PL2 A;  5FT9 A;  4CGV A;  3ASH A;  3K9I A;  4BT9 A;  5A6C A;  2QFC A;  2LSU A;  3MEK A;  3Q4A B;  2PQR A;  4J8D A;  2OOE A;  4BTB A;  2XGS A;  1B89 A;  2I6H A;  4I17 A;  3RU0 A;  4JA9 A;  5CCL A;  4N39 A;  5BNW A;  3GYZ A;  2P58 C;  4GZ5 A;  5AYW D;  5LCW J;  4YND A;  4GYW A;  2KCK A;  1E96 B;  3GW4 A;  4GA2 A;  2NC9 A;  3MA5 A;  3RJV A;  4YVQ C;  1ZBP A;  5JJT A;  3U4T A;  1XNF A;  4KBQ A;  4I9C A;  1ELR A;  2FEZ A;  3QKY A;  3Q47 B;  3RIB A;  3RKV A;  3ASD A;  1FCH A;  3IEG A;  3S7B A;  2HR2 A;  4G1T A;  2KCV A;  3LKU A;  4IN3 B;  4W9R A;  4J8E A;  1QZ2 A;  3HYM B;  3CEQ A;  3OXG A;  3CKC A;  4U04 A;  3AS8 A;  5C1D A;  4N3A A;  1YA0 A;  3E4B A;  4G24 A;  3LY9 A;  4JL0 A;  2XCC A;  4AIF A;  3MKR A;  2Y4T A;  2WQH A;  3ZHE B;  3CK9 A;  5G04 C;  4NQ0 A;  4U07 A;  5HQ8 A;  4HOR A;  1NA0 A;  3VTX A;  2UY1 A;  3MV2 B;  1NZN A;  2VGX A;  3QWW A;  5FJY A;  5FTP A;  3RO3 A;  4APO A;  4G26 A;  3WXX A;  4GYO A;  4CGW A;  3FFL A;  4GA0 A;  2XCB A;  3ZPJ A;  2AVP A;  2PZI A;  3LCA A;  1ELW A;  4HOT A;  2DBA A;  4HOS A;  3R9A B;  3OXF A;  4GA1 A;  2JLB A;  3Q49 B;  4GPK A;  3ESK A;  1HH8 A;  5G04 J;  1KT0 A;  3EDT B;  3UQ3 A;  5KJK A;  2IF4 A;  4H7Y A;  4JA7 A;  4UQZ A;  3JYS A;  5KJM A;  3CVP A;  3S7D A;  2FI7 A;  3MV3 B;  3ASF A;  2VGY A;  2HO1 A;  3LPZ A;  1PC2 A;  4G2V A;  4XIF A;  5DIZ A;  1TJC A;  1ZU2 A;  3CKB A;  3KD7 A;  3N71 A;  2VYI A;  3QWP A;  4I9E A;  3CK7 A;  3AS4 A;  3CVN A;  3TAX A;  4N2S A;  4UQY A;  1W3B A;  4H7X A;  4J0U A;  4N3B A;  4XI9 A;  3ZGQ A;  5JJ7 A;  1IYG A;  1HXI A;  2XPI A;  4YVO A;  3S7J A;  3ULQ A;  2BUG A;  1NA3 A;  3FP3 A;  3KS2 A;  3QOU A;  4WUY A;  4U0U A;  4ME2 A;  4F3V A;  4N2Q A;  3QWV A;  3KAE A;  5CHE E;  4WND A;  5D0Q D;  2VSY A;  4A1S A;  4EQF A;  2Y4U A;  4WNE A;  4U0S A; 
#chains in the Genus database with same CATH topology
 1OY3 D;  3GZS A;  2HYZ A;  3PZ2 A;  4URK A;  5BW8 C;  1U3C A;  2YQ8 A;  1HX8 A;  4GTM A;  3ZHE A;  3UT8 A;  2NSZ A;  2AXV A;  4AVX A;  1JUQ A;  1WY6 A;  3CHQ A;  3SHF A;  2OVB A;  4JD2 G;  3UT4 A;  3D9M A;  4C9B B;  3FEX A;  2EIN E;  2PQN A;  1KZP A;  3Q9U C;  4I6E A;  3LVQ E;  3O4Z A;  4JW1 A;  3OTN A;  3C98 A;  3K9I A;  2EIJ E;  4HXI A;  4AXH A;  4OAV B;  4I17 A;  5BNW A;  4GA2 A;  3CGH A;  3HYM B;  3OXG A;  4AIF A;  4LG6 A;  2WQH A;  4U96 D;  2J08 A;  4NQ0 A;  4HOR A;  1NA0 A;  1NZN A;  4GTS A;  2XS8 A;  4CGW A;  3FFL A;  3UTM A;  2DZO A;  1PY1 A;  2P9L G;  4PDX A;  3ZIM A;  4DLO A;  5EIB E;  3NB2 A;  3PS6 A;  3QC1 A;  4GPK A;  4PS7 A;  1JWG A;  3SO8 A;  1TNU A;  3WXX A;  5KJK A;  4U63 A;  3U66 A;  4K5A B;  1IYG A;  3ULQ A;  3DRA A;  4GZD A;  2X3M A;  2X6H A;  4F3V A;  5CHE E;  3FUD A;  4YDE A;  1N4R A;  5JMN D;  2XEN A;  3LVR E;  2ION A;  1N52 A;  2LNI A;  1MX4 A;  3ASN E;  3KSQ A;  1E8Z A;  1E8X A;  2GW1 A;  4GCN A;  3F6Q A;  3P1U A;  3UMV A;  3LY8 A;  4U8Y D;  4O6F A;  2C0L A;  2XZT G;  1AP7 A;  3L9T A;  5FZQ A;  4U8H A;  5D0O D;  1HS6 A;  4ILI A;  3ESL A;  3CVQ A;  1OWM A;  2YHC A;  2KZT A;  4G8K A;  3Q7A A;  3RAU A;  3FU0 A;  2XPZ A;  3J5P A;  3U9W A;  3DSX A;  3EHQ A;  4LCT A;  3P2B A;  2OOE A;  3UIO C;  3ZVV A;  1NI1 A;  4N39 A;  2KCK A;  4C0E A;  3MCX A;  1JPL A;  2GGF A;  3B7B A;  5IY5 E;  1H19 A;  4F1S A;  3PNL B;  4G1T A;  4ACL A;  4IN3 B;  4J8E A;  4U04 A;  2Y4T A;  1H0A A;  5ENS D;  3EUV A;  3I4R B;  1MZC A;  1K3Z D;  5JA4 D;  3B7S A;  3JQ0 A;  5EDS A;  1BU9 A;  1MJ0 A;  4B89 A;  4LNG A;  2KM4 A;  5KJM A;  3ASF A;  1SZ9 A;  1TJC A;  5ENR D;  3ULE G;  2Y1L E;  3ZKJ A;  3FUM A;  4UWG A;  3FY4 A;  1DC2 A;  3SFX A;  4KVO A;  3URZ A;  3D9N A;  1OCR E;  3VLD A;  1SZA A;  2VSX E;  4RQI A;  1Z3X A;  1IQU A;  4ABN A;  3MX3 A;  4ANX A;  3GZ2 A;  4DX7 D;  4KXK B;  1X5B A;  2ETC A;  1E8W A;  4AJW A;  2KCL A;  2VSO E;  3FTY A;  4TXP A;  2P9U G;  1FPP A;  3IHV A;  2WQ7 A;  3QNK A;  4Y6C A;  2LAI A;  4JEH A;  4J8D A;  3DBS A;  4RLY A;  1S63 A;  1D8E A;  3RJV A;  4XKC A;  3TXM A;  1XNF A;  4J6I A;  1O1S A;  3V31 A;  2L0I A;  3RK6 A;  2XQ0 A;  3ZYM A;  3I5P A;  3IKO B;  1DCE A;  4JL0 A;  1SW6 A;  3C3O A;  3Q78 A;  4CRW A;  3SY2 A;  4UWH A;  4K5C A;  1Q2Z A;  3T5V A;  4GA0 A;  4BET A;  3L6A A;  3OXF A;  3ZRH A;  3EDT B;  3CST A;  3DPY A;  2FI7 A;  1UJJ A;  1KPS B;  4N5Q A;  1O1T A;  2VYI A;  3CK7 A;  3ASO E;  2P9K G;  4DX5 D;  4YVO A;  3V2O A;  3FP3 A;  3IV0 A;  3C3R A;  2WMN A;  4BY6 A;  1UN8 A;  1N0R A;  4K0R A;  2IY0 C;  3FTZ A;  2RFM A;  3JUE A;  3ML8 A;  5JHA A;  2ZGD A;  2AXU A;  3MGB A;  2HM8 A;  2XEE A;  1HFA A;  4GTV A;  3TWU A;  3ZNG A;  5HI7 A;  4UQX A;  3ZFW A;  1FVH A;  4Z68 A;  3SF4 A;  4Q69 A;  4XKB A;  3EU9 A;  3GZ1 A;  2LSV A;  3HXD A;  2KC7 A;  3L54 A;  4GTP A;  2YNQ A;  5EYL A;  3VTY A;  3CVL A;  4G23 A;  4WWP A;  3LY7 A;  4E6H A;  2C2L A;  1WDY A;  3Q9N C;  3TWR A;  4AY5 A;  4BWR A;  2XGO A;  3APC A;  3QDN A;  2A5U A;  3QAQ A;  1LF8 A;  4BT9 A;  1YYH A;  4HI8 A;  2P58 C;  4JEU A;  4GYW A;  4UUC A;  5J90 A;  4ACK A;  3BQO A;  3CSF A;  3Q47 B;  1OXJ A;  5T8I A;  4GZC A;  3WG7 E;  3FUK A;  4G24 A;  3LY9 A;  3MKR A;  3Q79 A;  4U07 A;  5HQ8 A;  3V79 K;  4WWN A;  5CEC B;  2CHW A;  3FTW A;  2OCC E;  5AJL A;  3NAW A;  1N94 A;  1OWO A;  4EZL A;  2VGY A;  3BUA A;  5AIJ A;  5DIZ A;  4KZC A;  4EHM A;  3TAX A;  4UQY A;  4Q94 A;  2VSY A;  3PUJ A;  4J7W A;  3HXB A;  2CG3 A;  3ONK A;  3PNT B;  1OWL A;  2VGX B;  4HBD A;  3TWT A;  3UM1 A;  3PEV B;  4FAD A;  4BX8 A;  3HXF A;  1EDU A;  2CHZ A;  3DXK G;  1TYQ G;  4U8V D;  2V5F A;  3ABM E;  1WG0 A;  4DX2 A;  2ZXW E;  5H7P A;  3FUI A;  1EPU A;  2GRQ B;  1TN7 A;  4BSX A;  3PDN A;  2MHK A;  1JCS A;  1MYO A;  3UM2 A;  3LYA A;  2J09 A;  5ARG A;  2LSU A;  2J8S D;  1E90 A;  2GRM A;  4JA9 A;  1BI7 B;  3FDH A;  1E96 B;  4G8L A;  3MA5 A;  2BF0 X;  3E32 A;  4R7L A;  4APF A;  1QZ2 A;  3ZXS A;  3CKC A;  3D3M A;  4JPS A;  2LXM A;  5CRV A;  3UT7 A;  4CCA A;  1TN8 A;  5CBN A;  3FU5 A;  2JLB A;  3UQ3 A;  4NUR A;  4AOF A;  3FUH A;  3N71 A;  4NAC A;  3EIJ A;  2I2O A;  5D66 A;  3DST A;  1S70 B;  2JAB A;  3FTV A;  4TUM A;  3QJZ A;  2FO7 A;  4U0Z A;  3TWW A;  4FJZ A;  3U64 A;  5LP0 A;  3DXM G;  4CDM A;  4CDR A;  2XRY A;  4JC8 A;  5EYP F;  4U95 D;  2XGM A;  2WXF A;  1V54 E;  4NRH B;  1WM5 A;  4YDW A;  3TWX A;  4CZ2 D;  4PUC A;  2P9N G;  4GTQ A;  2GRP B;  2LUH A;  5CCM A;  3FUE A;  5M72 A;  2AW6 A;  4FP7 A;  2DWZ A;  2CFZ A;  2J9Q A;  3OXL A;  4G25 A;  4A3T A;  1SA5 A;  4GPM A;  1N4P A;  1LD7 A;  4FLH A;  1QYM A;  3Q4A B;  5ENQ D;  1SQM A;  5ENP D;  3JQ1 A;  1O5M A;  1HF8 A;  3UIN C;  5AYW D;  2NYJ A;  4YVQ C;  3EJN A;  3U4T A;  2XHE A;  1MHQ A;  3HIZ A;  4GYO A;  3CVX A;  2F37 A;  4HQD A;  4LSZ E;  3Q73 A;  4QQI A;  3ZYK A;  4MRU A;  3ZYQ A;  4OAU C;  1K1B A;  4KZ0 A;  2LXL A;  4WUY A;  4FJY A;  4ME2 A;  1UN9 A;  3C72 A;  1N4S A;  2GRO B;  2I1K A;  4DK5 A;  4MBG A;  2F8Y A;  5B3S E;  3SFZ A;  4KVM A;  5AEN A;  3T9K A;  3CV0 A;  3UI2 A;  3NBN B;  3CVU A;  1N4Q A;  3MKQ B;  3ZUV B;  5G05 J;  3R7R A;  4I1O B;  2WXJ A;  1JWF A;  3AG4 E;  4EZJ A;  2DYR E;  3CHS A;  1N54 A;  2GRN B;  2WXK A;  4GB9 A;  2WXP A;  1D8D A;  3CQG B;  3GW4 A;  2FO1 E;  4I6J A;  2J4D A;  3FHE A;  3S7B A;  4EPZ A;  2Y69 E;  2EQX A;  3CK9 A;  2EIK E;  4DPR A;  3FH7 A;  2XCB A;  5FWQ A;  4ZHB A;  2DBA A;  1H2T C;  3R9M A;  4UWL A;  2R2L A;  1TNB A;  5FIO A;  5BPP A;  4JXT A;  1G3N B;  1SVX A;  4FUL A;  3AS4 A;  5CBO A;  1U3D A;  1RZ4 A;  2WXH A;  3CHR A;  4TXQ A;  2B6C A;  1MX6 A;  3PUK A;  4L2Y A;  4M3O A;  2Y3A A;  4TRQ A;  1UJK A;  3D9L A;  2B0O E;  1H2V C;  3QAR A;  4GZ6 A;  3RO2 A;  4BFR A;  1BLX B;  4XE0 A;  2FUL A;  3Q5M A;  4AY6 A;  4LEU A;  2WXO A;  4GCO A;  1TEZ A;  3FTS A;  3TWS A;  4WNG A;  2WPV A;  3L82 A;  3CK8 A;  3BEE A;  1KT1 A;  4JHJ A;  5B1B E;  5JHB A;  3IXE A;  5KWD A;  3PRZ A;  3MYV A;  2XGS A;  3AU5 A;  4XZ4 A;  4F7A A;  4L1B A;  4B0Z A;  4I9C A;  2XEH A;  3BU8 A;  3KEA A;  2WXQ A;  3DWL G;  3ABL E;  4DJA A;  2I1J A;  4I43 A;  2XCC A;  2VTB A;  2ZIR A;  3KSL A;  3SNX A;  3EU5 A;  2AVP A;  3UKR G;  4EBA G;  2JEK A;  2R03 A;  3G2W A;  3MV3 B;  2HO1 A;  3SBS A;  1EYH A;  3CKB A;  4I9E A;  2IOS A;  1BD8 A;  4H7X A;  2EIM E;  1N0Q A;  4FHK A;  4ZFH A;  3OAW A;  4MS6 A;  3KS2 A;  3AAA C;  3KAE A;  4JB8 P;  4WND A;  1EF1 C;  1JCQ A;  2AWI A;  4EQF A;  5BXU A;  5KJL A;  3ASG A;  3HHM A;  3C3Q A;  2P2C P;  2WQ6 A;  1TN6 A;  3DEO A;  2RFA A;  3BG1 B;  2FF4 A;  1OT8 A;  2OND A;  5CEA A;  3G2U A;  5EX0 A;  3UXG A;  1L5J A;  4GAA A;  1LD8 A;  3T8M A;  3LS8 A;  5EKQ D;  2R5S A;  4KYO B;  2VSN A;  4RG6 A;  4I6G A;  4LUN U;  4PS3 A;  5AQA A;  3EIQ C;  1PAQ A;  1MQS A;  3VLE A;  3FH8 A;  1GW6 A;  5HRY A;  5ANR A;  2FBN A;  3PVL A;  2QFC A;  3MEK A;  4BTB A;  3NQP A;  5CMW A;  4G11 A;  2GRL A;  4F1P A;  1VDY A;  2L9B A;  5BV1 A;  5FQ4 A;  5EIL A;  3ASD A;  3RRN B;  3LKU A;  3AS8 A;  3APD A;  4N3A A;  4CT4 A;  3TL5 A;  1JCR A;  3ZHE B;  2L0T B;  3I3N A;  1NL4 A;  5ENO D;  5HKP A;  4DI4 A;  5LOZ A;  3PEU B;  4C0M A;  4HOT A;  1YMP A;  2AJA A;  2DZN A;  3ESK A;  2IF4 A;  4L23 A;  5AQB A;  2F0Y A;  4NIK A;  2R05 A;  2V4H C;  1W3B A;  3CVY A;  2XRZ A;  4CDN A;  2KZT B;  1DCQ A;  4WWO A;  3E30 A;  4HFG A;  5BUZ A;  3S7F A;  3E33 A;  4TXR A;  3HG0 D;  3IHY A;  4XX5 A;  4BEP A;  5LX8 A;  4FLB A;  2WXN A;  3ZYL A;  3RRM B;  2NXP A;  4DRX E;  4LER A;  4DUI A;  4BES A;  2C0M A;  5A23 A;  4F53 A;  4N5C A;  5AAR A;  3I4G A;  5G55 A;  2HE0 A;  4I1A A;  4JHR A;  4UI9 K;  4GZ3 A;  1OCZ E;  1MX2 A;  1Z3Y A;  1Z5S C;  5FT9 A;  4CGV A;  2X6K A;  3HDX A;  3UM0 A;  5CMY A;  4ATG A;  3EHM A;  1B89 A;  1X81 A;  2MYO A;  1AWC B;  1HU3 A;  2XS1 A;  1QBQ A;  3LJ3 A;  3L13 A;  3HXC A;  1Z6T A;  2A4Z A;  2IOL A;  4W9R A;  2RD0 A;  3CEQ A;  3E4B A;  3D9J A;  3PZ3 A;  3RO3 A;  2CG2 A;  5CED B;  4UWK A;  2PZI A;  3R9A B;  2DCP A;  2PM6 A;  1E7V A;  3Q49 B;  5JJT A;  2WVI A;  3SBT B;  2VTB B;  4K03 A;  3SFY A;  3S7J A;  2L6B A;  3DSS A;  3HXE A;  2RG8 A;  5AQ9 A;  3HVE A;  1IHB A;  2DIW A;  3D9P A;  5ANL A;  2R59 A;  1UG3 A;  3UIP C;  2BKK B;  5DBK A;  4J8S A;  1U2V G;  2V5Q C;  4E85 A;  4DLQ A;  2XEV A;  1QNF A;  3E37 A;  2YIN A;  4FA6 A;  3CVV A;  2WB2 A;  5D2M C;  5AN8 A;  2AXZ A;  3ZEF A;  1A17 A;  4X8Q A;  3TGO A;  4I2Z A;  1A5E A;  3FTX A;  4J8F A;  5AJD A;  3D9K A;  4FHJ A;  5KNH D;  1KLX A;  4GTR A;  1BPO A;  5T4Y A;  1HE8 A;  1NP7 A;  4O1P A;  4FC8 A;  1TNO A;  1S0P A;  3RU0 A;  4XEI G;  1K1A A;  4QFV A;  3FUJ A;  4V3I A;  5EN5 D;  2HR2 A;  3FU3 A;  4HNA D;  2BKG A;  1YA0 A;  1DVP A;  3D9H A;  3UM3 A;  4IRU A;  5G04 C;  1XGW A;  4HS2 A;  4ANW A;  3FH5 A;  3TWV A;  1N11 A;  4UQZ A;  2V4L A;  4GMR A;  3JYS A;  4F6R D;  4G2V A;  3FTU A;  4CT0 A;  3MJW A;  4HVB A;  3CIA A;  5E75 A;  3D9O A;  2Y4U A;  5LCW C;  3JUI A;  2QZA A;  4DX1 A;  3ZN3 A;  2H6I A;  3NF1 A;  3X2Q E;  4BX9 A;  2UWJ G;  3TXN A;  4RSY A;  5FIN A;  4XI0 A;  3TG5 A;  4HRN A;  5KJN A;  1OWN A;  3L17 A;  2ETA A;  5AQ7 A;  1HO8 A;  3U3W A;  4B8C B;  2IQC A;  3CQC B;  3TWQ A;  2KXP C;  4LRZ A;  4BTA A;  2WXG A;  5FZR A;  3TG4 A;  5G05 C;  1HG2 A;  2KBX A;  3NZS A;  1OUV A;  4GML A;  1P5Q A;  2X6I A;  4TUU A;  2ILR A;  3L22 A;  2EIL E;  4L2L A;  4GYY A;  4D10 C;  3MZL B;  4PH4 B;  1H6O A;  3C5R A;  1ELK A;  1FT1 A;  3GYZ A;  1UOH A;  2R17 C;  3SI5 A;  1LTX A;  4I1M A;  4WAF A;  3AU4 A;  3CHM A;  2UY1 A;  2VGX A;  5FJY A;  4APO A;  3LCA A;  3FUL A;  4GA1 A;  3L16 A;  2YHE A;  1KT0 A;  4JA7 A;  3S7D A;  4CYM D;  2IO2 C;  3AG1 E;  4A55 A;  3ZGQ A;  5JJ7 A;  1E7U A;  4HI9 A;  4GMJ A;  4YDY A;  1NA3 A;  5LFA A;  3UKU G;  2LAH A;  2DYS E;  3PE3 A;  3RSE G;  5C2Y A;  5HS0 A;  5KCM A;  3SQV A;  3UPV A;  2KAT A;  3PH0 C;  3SD5 A;  3IBE A;  3ISM C;  1TR4 A;  1K8K G;  3CLJ A;  3ONL A;  3PE4 A;  4I2W A;  5BV0 A;  4YDO A;  4UI9 C;  3FUN A;  5T3R A;  1FT2 A;  1OCO E;  4Y6W A;  4KT6 B;  1IHG A;  4M7C A;  3TJP A;  2CHX A;  4C48 B;  4HLE A;  1IQR A;  2IJG X;  4B93 B;  3S2A A;  3R7Q A;  2IFU A;  4HLL A;  2XZD G;  4KBQ A;  5KBA A;  3JXI A;  4JVS A;  3IEG A;  4YND A;  3AJI A;  5G2N A;  3HRA A;  3MV2 B;  3QWW A;  5FTP A;  1RW2 A;  5FQ6 A;  4H7Y A;  3EHN A;  2P9P G;  3KD7 A;  3SGH A;  3QWP A;  3CVN A;  3JXJ A;  4XI9 A;  2H6F A;  3RRU A;  1S64 A;  4HB5 A;  2BUG A;  4BER A;  1KZO A;  3J5Q B;  4A63 B;  1D9S A;  4WNE A;  4U0S A;  3B7U X;  1Y8M A;  3D9I A;  4RG9 A;  5FQ7 A;  3MKQ A;  3AS5 A;  5ARF A;  3PZD A;  4P29 A;  3DEP A;  4MKT A;  3SZ7 A;  1V55 E;  2IEJ A;  5JJ6 A;  2UY1 B;  5FZS A;  4PS8 A;  2V0P A;  3FEY A;  4RVB A;  5EX3 A;  3E34 A;  3AG2 E;  5A7D B;  1TNY A;  3VLF A;  4ANU A;  4JZY A;  4UI9 J;  2OEW A;  3CHP A;  1DNP A;  1HZ4 A;  1HG5 A;  2R02 A;  3FWV A;  4BT8 A;  4HRL A;  5ITZ F;  4GU5 A;  4DX6 D;  2ZGG A;  2WXL A;  2P9I G;  4TV3 A;  5KNG A;  2IO3 C;  2X6F A;  3G2V A;  2QYU A;  3V30 A;  2RKK A;  4FU3 A;  1ZBP A;  3ML9 A;  1ELR A;  4LNB A;  1SA4 A;  3DSV A;  3DSU A;  2ZU6 B;  5C1D A;  1Y6I A;  1E8Y A;  5E76 A;  4G26 A;  2P9S G;  3W9F A;  3ZPJ A;  2X6J A;  4KMO A;  2MOW A;  4A1G A;  3G2S A;  2OEV A;  3FUF A;  4J8Y A;  4XIF A;  3VTX A;  1INZ A;  5BXO A;  3APF A;  2V8S E;  2J4B A;  4L7T A;  3QOU A;  4OVU A;  4K5B A;  2QY7 A;  5D0Q D;  2A5E A;  2E0I A;  2CFU A;  3HVE B;  2PM7 A;  3V2X A;  2WM9 A;  3ENE A;  2Q7F A;  3W9G A;  5CRU A;  4DI3 A;  3KEZ A;  4WNF A;  2I9C A;  2MRI A;  3PZ4 A;  5ENT D;  4GTO A;  3NZU A;  2WMO A;  3B13 A;  3Q15 A;  2OVF A;  2M63 A;  4B94 A;  3DSW A;  1TNZ A;  1OCC E;  2VJ8 A;  4EZK A;  4O1O A;  1ZB1 A;  1H6P A;  2QC9 A;  4N3C A;  1IXV A;  2J07 A;  1OWP A;  1H6K A;  2L6J A;  3LEW A;  4Q96 A;  3T5X A;  2WXM A;  4B8A A;  2X38 A;  3ASH A;  3PRE A;  2PQR A;  5J08 A;  2I6H A;  1FVF A;  5CCL A;  3LXU X;  3CHO A;  3JCK C;  2H6H A;  3QKY A;  3RKV A;  4AEZ C;  3RIB A;  1FCH A;  2XPY A;  2J49 A;  2Y0B G;  3L08 A;  1ELW A;  2VGE A;  3ABK E;  1HH8 A;  4ATZ D;  4O60 A;  3ZW3 A;  3CVP A;  2QYJ A;  3LPZ A;  2WXR A;  1ZU2 A;  2GRR B;  3B7R L;  4J0U A;  4N3B A;  3UX4 A;  2ETB A;  2XPI A;  3G2T A;  4ILH B;  2LO6 A;  2BTD A;  3QWV A;  4JHK A;  4MLP A;  1TJF A;  4A1S A;  4L9P A;  3AG3 E;  2PNN A;  2E2E A;  3PZ1 A;  4EBA A;  5CER B;  4A3V A;  3O48 A;  1QQE A;  2F8X K;  3Q75 A;  5LCW J;  3Q7F A;  4AV7 A;  4EEC A;  4AP2 A;  3QB2 A;  4OYS A;  4IUL A;  3NOC D;  1BI8 B;  4HOU A;  1O1R A;  3ULY A;  4AM9 A;  3UUX A;  3B95 A;  4ILG A;  1NFI E;  4U7E B;  1N9A A;  3B7T A;  1H2U A;  5B1A E;  3QK0 A;  1WAO 1;  3CR3 A;  1IKN D;  5BT1 A;  2VQ2 A;  4HOQ A;  2PL2 A;  5A6C A;  1N95 A;  3DPD A;  2OV8 A;  1YCS B;  4OVV A;  4UWF A;  4GZ5 A;  2NC9 A;  5EID A;  3ZXP A;  2DVW A;  2FEZ A;  4GTT A;  2KCV A;  3T8K A;  3CVW A;  4LNU D;  3FU6 A;  5FQ8 A;  5ENN A;  4IYP A;  2BED A;  4CEM A;  3ZU7 B;  2ZIS A;  3NOG D;  3BG0 B;  4HRM B;  4HOS A;  3LDZ A;  5G04 J;  3LJN A;  4BSZ B;  1PC2 A;  5AAO A;  4N2S A;  2IU1 A;  1HXI A;  4N2Q A;  2WXI A;  4U0U A;  1UW4 B;  4ANV A;  2H6G A;  3EHR A; 
#chains in the Genus database with same CATH homology
 3PE3 A;  3ASG A;  3HHM A;  3GZS A;  5C2Y A;  5KCM A;  2WQ6 A;  2HYZ A;  2CG3 A;  3ONK A;  3UPV A;  4URK A;  5BW8 C;  1U3C A;  2YQ8 A;  2KAT A;  3PH0 C;  1HX8 A;  3SD5 A;  3BG1 B;  3IBE A;  3ZHE A;  3PNT B;  1OWL A;  2VGX B;  2FF4 A;  3UT8 A;  3CLJ A;  2NSZ A;  2AXV A;  4AVX A;  3ONL A;  3PEV B;  2OND A;  1JUQ A;  1WY6 A;  3CHQ A;  3PE4 A;  3SHF A;  2OVB A;  4FAD A;  3G2U A;  5EX0 A;  4I2W A;  4BX8 A;  1L5J A;  4GAA A;  1EDU A;  2CHZ A;  3T8M A;  5BV0 A;  3LS8 A;  5EKQ D;  2R5S A;  3UT4 A;  4UI9 C;  3FUN A;  3D9M A;  5T3R A;  4KYO B;  4Y6W A;  2V5F A;  4C9B B;  3FEX A;  2VSN A;  4RG6 A;  4KT6 B;  4I6G A;  1IHG A;  3TJP A;  2CHX A;  2PQN A;  4LUN U;  4PS3 A;  4HLE A;  3EIQ C;  3FUI A;  1PAQ A;  1EPU A;  1IQR A;  1MQS A;  4BSX A;  2IJG X;  3PDN A;  3VLE A;  2MHK A;  4I6E A;  3LYA A;  3S2A A;  3LVQ E;  3O4Z A;  4JW1 A;  3OTN A;  3FH8 A;  1GW6 A;  3C98 A;  3R7Q A;  2IFU A;  5ANR A;  2J09 A;  2FBN A;  3PVL A;  5ARG A;  3K9I A;  2QFC A;  2LSU A;  3MEK A;  5CMW A;  4BTB A;  3NQP A;  4HXI A;  4AXH A;  1E90 A;  4I17 A;  2GRM A;  4JA9 A;  5BNW A;  3FDH A;  1E96 B;  2GRL A;  4GA2 A;  1VDY A;  2L9B A;  3CGH A;  3MA5 A;  4G11 A;  5FQ4 A;  5BV1 A;  4KBQ A;  2BF0 X;  4JVS A;  4R7L A;  3ASD A;  3IEG A;  4APF A;  3RRN B;  3LKU A;  4YND A;  1QZ2 A;  3HYM B;  3OXG A;  3ZXS A;  3CKC A;  3D3M A;  3AS8 A;  4JPS A;  3APD A;  4N3A A;  4AIF A;  4CT4 A;  3TL5 A;  2WQH A;  3ZHE B;  2J08 A;  2L0T B;  4NQ0 A;  5G2N A;  1NA0 A;  4HOR A;  3MV2 B;  1NZN A;  3QWW A;  3I3N A;  5FTP A;  3UT7 A;  4CCA A;  4CGW A;  3FFL A;  4DI4 A;  5LOZ A;  1PY1 A;  3PEU B;  4PDX A;  5FQ6 A;  3ZIM A;  3FU5 A;  4C0M A;  4HOT A;  4DLO A;  2JLB A;  3PS6 A;  3QC1 A;  4GPK A;  3ESK A;  4PS7 A;  3UQ3 A;  1JWG A;  2IF4 A;  4H7Y A;  4L23 A;  3EHN A;  3WXX A;  4NUR A;  4AOF A;  3FUH A;  3KD7 A;  3SGH A;  3QWP A;  3N71 A;  4U63 A;  5KJK A;  3U66 A;  3CVN A;  1W3B A;  4NAC A;  4XI9 A;  3CVY A;  2XRZ A;  3RRU A;  1IYG A;  3EIJ A;  4CDN A;  3ULQ A;  2I2O A;  4GZD A;  2BUG A;  2X3M A;  2X6H A;  4F3V A;  5CHE E;  2KZT B;  3FTV A;  3FUD A;  4WNE A;  4U0S A;  3B7U X;  1Y8M A;  3QJZ A;  4WWO A;  3D9I A;  2FO7 A;  4RG9 A;  3MKQ A;  5FQ7 A;  4U0Z A;  3AS5 A;  4HFG A;  5ARF A;  4FJZ A;  5BUZ A;  3LVR E;  3U64 A;  2ION A;  1N52 A;  3S7F A;  5LP0 A;  3PZD A;  2LNI A;  4P29 A;  4MKT A;  3IHY A;  4XX5 A;  3SZ7 A;  4CDM A;  4CDR A;  2XRY A;  5JJ6 A;  2UY1 B;  4JC8 A;  1E8Z A;  5FZS A;  5LX8 A;  1E8X A;  2GW1 A;  2WXN A;  4FLB A;  3ZYL A;  4PS8 A;  2XGM A;  2V0P A;  2WXF A;  4NRH B;  1WM5 A;  3FEY A;  3RRM B;  4RVB A;  4GCN A;  2NXP A;  4PUC A;  5EX3 A;  3P1U A;  3UMV A;  4LER A;  3LY8 A;  4O6F A;  2C0L A;  5FZQ A;  4U8H A;  5D0O D;  5CCM A;  1HS6 A;  3FUE A;  4ILI A;  5M72 A;  2AW6 A;  3ESL A;  2C0M A;  4FP7 A;  5A7D B;  5A23 A;  3VLF A;  4F53 A;  2CFZ A;  4JZY A;  4N5C A;  4ANU A;  2J9Q A;  4UI9 J;  3CVQ A;  1OWM A;  3OXL A;  2YHC A;  2KZT A;  3CHP A;  1DNP A;  1HZ4 A;  4G25 A;  4A3T A;  3I4G A;  1HG5 A;  3FWV A;  5G55 A;  4BT8 A;  3FU0 A;  4I1A A;  2XPZ A;  4JHR A;  4UI9 K;  4GU5 A;  4GZ3 A;  1Z3Y A;  3U9W A;  2WXL A;  5FT9 A;  4CGV A;  4FLH A;  2X6K A;  3HDX A;  3Q4A B;  4LCT A;  4TV3 A;  5CMY A;  1SQM A;  4ATG A;  3EHM A;  3P2B A;  2OOE A;  3JQ1 A;  3ZVV A;  1B89 A;  1HF8 A;  2X6F A;  4N39 A;  3G2V A;  5AYW D;  1HU3 A;  2KCK A;  4FU3 A;  4YVQ C;  1ZBP A;  3EJN A;  3ML9 A;  3U4T A;  3LJ3 A;  1ELR A;  4C0E A;  3L13 A;  3MCX A;  1JPL A;  1Z6T A;  2GGF A;  2A4Z A;  1H19 A;  4F1S A;  3PNL B;  4G1T A;  2XHE A;  4ACL A;  4IN3 B;  2IOL A;  2ZU6 B;  4J8E A;  2RD0 A;  1MHQ A;  3CEQ A;  4U04 A;  4W9R A;  5C1D A;  1Y6I A;  3E4B A;  3D9J A;  1E8Y A;  2Y4T A;  1H0A A;  5E76 A;  3HIZ A;  3RO3 A;  4G26 A;  3I4R B;  4GYO A;  2CG2 A;  4UWK A;  3ZPJ A;  2PZI A;  3B7S A;  3JQ0 A;  5EDS A;  4B89 A;  3CVX A;  2X6J A;  3R9A B;  2DCP A;  2PM6 A;  4KMO A;  2KM4 A;  1E7V A;  2MOW A;  3Q49 B;  4A1G A;  5KJM A;  3G2S A;  3FUF A;  3ASF A;  1SZ9 A;  4XIF A;  3ZYK A;  5JJT A;  4MRU A;  1TJC A;  3VTX A;  2WVI A;  3ZYQ A;  3SBT B;  2VTB B;  4K03 A;  4KZ0 A;  1INZ A;  3APF A;  3FUM A;  2V8S E;  2J4B A;  4L7T A;  3S7J A;  4UWG A;  3FY4 A;  3QOU A;  4WUY A;  4OVU A;  2QY7 A;  4FJY A;  4ME2 A;  5D0Q D;  2RG8 A;  1UN9 A;  2CFU A;  2E0I A;  3HVE B;  2PM7 A;  2WM9 A;  3ENE A;  3HVE A;  2Q7F A;  4KVO A;  3URZ A;  3D9N A;  2I1K A;  4DK5 A;  3VLD A;  1SZA A;  2DIW A;  2VSX E;  3KEZ A;  3D9P A;  4WNF A;  4DI3 A;  5ANL A;  2I9C A;  2R59 A;  1UG3 A;  2MRI A;  1Z3X A;  1IQU A;  3NZU A;  2WMO A;  4ABN A;  3B13 A;  3Q15 A;  5DBK A;  3SFZ A;  4J8S A;  2OVF A;  2M63 A;  3MX3 A;  4B94 A;  4ANX A;  3GZ2 A;  4KVM A;  5AEN A;  2VJ8 A;  3CV0 A;  4EZK A;  4E85 A;  3CVU A;  4KXK B;  3MKQ B;  5G05 J;  2XEV A;  1QNF A;  4DLQ A;  3R7R A;  2YIN A;  4FA6 A;  4N3C A;  3CVV A;  2WB2 A;  2J07 A;  4I1O B;  2WXJ A;  1X5B A;  1OWP A;  1H6K A;  2L6J A;  1E8W A;  2AXZ A;  4AJW A;  3ZEF A;  1A17 A;  2KCL A;  1JWF A;  2VSO E;  3TGO A;  4I2Z A;  3FTY A;  3FTX A;  4J8F A;  3LEW A;  4Q96 A;  5AJD A;  3D9K A;  4FHJ A;  3T5X A;  3IHV A;  2WXM A;  4B8A A;  1KLX A;  4EZJ A;  1BPO A;  2WQ7 A;  3QNK A;  3CHS A;  2X38 A;  5T4Y A;  4Y6C A;  1HE8 A;  1NP7 A;  2LAI A;  4FC8 A;  3ASH A;  3PRE A;  4JEH A;  1N54 A;  2WXK A;  2PQR A;  4J8D A;  5J08 A;  4GB9 A;  1S0P A;  2I6H A;  3DBS A;  1FVF A;  3RU0 A;  5CCL A;  2WXP A;  3CQG B;  3LXU X;  4QFV A;  3RJV A;  3GW4 A;  3CHO A;  4XKC A;  3JCK C;  1XNF A;  4J6I A;  3TXM A;  4I6J A;  3FUJ A;  3QKY A;  3RKV A;  4AEZ C;  4V3I A;  3RIB A;  2J4D A;  2L0I A;  1FCH A;  3RK6 A;  2XQ0 A;  3FHE A;  3S7B A;  2HR2 A;  2XPY A;  3FU3 A;  3ZYM A;  4EPZ A;  3I5P A;  3IKO B;  2EQX A;  2J49 A;  1YA0 A;  4JL0 A;  1DVP A;  4CRW A;  4IRU A;  3CK9 A;  1XGW A;  4UWH A;  5G04 C;  4DPR A;  4HS2 A;  4ANW A;  3FH5 A;  3T5V A;  3L08 A;  3FH7 A;  4GA0 A;  2XCB A;  5FWQ A;  1ELW A;  2DBA A;  3L6A A;  3OXF A;  3ZRH A;  1HH8 A;  1H2T C;  3EDT B;  4UQZ A;  2V4L A;  3CST A;  4UWL A;  3JYS A;  3ZW3 A;  3CVP A;  2FI7 A;  1UJJ A;  5BPP A;  3LPZ A;  2WXR A;  4JXT A;  4G2V A;  1ZU2 A;  3FTU A;  4FUL A;  4CT0 A;  2VYI A;  3CK7 A;  3AS4 A;  3MJW A;  1U3D A;  3B7R L;  4J0U A;  4N3B A;  3UX4 A;  4HVB A;  3CIA A;  2XPI A;  3G2T A;  4ILH B;  4YVO A;  2WXH A;  3CHR A;  3FP3 A;  3IV0 A;  2LO6 A;  5E75 A;  2BTD A;  3QWV A;  4JHK A;  4MLP A;  1TJF A;  4A1S A;  3D9O A;  3PUK A;  2Y4U A;  4L2Y A;  2WMN A;  4BY6 A;  1UN8 A;  5LCW C;  3JUI A;  4K0R A;  3FTZ A;  2E2E A;  4M3O A;  3ML8 A;  3ZN3 A;  4EBA A;  5JHA A;  2AXU A;  3MGB A;  3NF1 A;  2Y3A A;  4A3V A;  4BX9 A;  3O48 A;  4TRQ A;  2HM8 A;  2UWJ G;  3TXN A;  1HFA A;  1UJK A;  1QQE A;  4RSY A;  3D9L A;  5HI7 A;  5LCW J;  4XI0 A;  4AV7 A;  3TG5 A;  5KJN A;  4UQX A;  4EEC A;  1H2V C;  3ZFW A;  1OWN A;  3QAR A;  1FVH A;  3L17 A;  4GZ6 A;  4AP2 A;  3RO2 A;  4BFR A;  3QB2 A;  3SF4 A;  1HO8 A;  4Q69 A;  4OYS A;  3U3W A;  4XKB A;  3GZ1 A;  2LSV A;  4B8C B;  4XE0 A;  2IQC A;  2KC7 A;  3CQC B;  4IUL A;  2FUL A;  3L54 A;  4LRZ A;  4HOU A;  3Q5M A;  4AM9 A;  2YNQ A;  4AY6 A;  4LEU A;  3UUX A;  3VTY A;  2WXG A;  4BTA A;  4ILG A;  2WXO A;  3CVL A;  4GCO A;  5FZR A;  4G23 A;  3TG4 A;  3B7T A;  1H2U A;  1TEZ A;  4WWP A;  3FTS A;  3LY7 A;  5G05 C;  4E6H A;  1HG2 A;  4WNG A;  2WPV A;  2C2L A;  3NZS A;  3QK0 A;  3CK8 A;  1WAO 1;  1OUV A;  3CR3 A;  4GML A;  4AY5 A;  1P5Q A;  2X6I A;  4TUU A;  2ILR A;  3L22 A;  5BT1 A;  4BWR A;  2XGO A;  2VQ2 A;  3APC A;  3BEE A;  3QDN A;  1KT1 A;  4GYY A;  4L2L A;  4JHJ A;  4D10 C;  2A5U A;  3QAQ A;  3MZL B;  4HOQ A;  1LF8 A;  2PL2 A;  5JHB A;  5A6C A;  4PH4 B;  4BT9 A;  3PRZ A;  3DPD A;  2OV8 A;  1ELK A;  3MYV A;  2XGS A;  3AU5 A;  4XZ4 A;  4OVV A;  4UWF A;  3GYZ A;  2P58 C;  4GZ5 A;  4JEU A;  4L1B A;  2R17 C;  4GYW A;  4B0Z A;  4F7A A;  2NC9 A;  5J90 A;  4I9C A;  4ACK A;  2FEZ A;  3SI5 A;  3CSF A;  3Q47 B;  2WXQ A;  5T8I A;  4GZC A;  2KCV A;  4I1M A;  3CVW A;  3FUK A;  4WAF A;  4G24 A;  4DJA A;  2I1J A;  3FU6 A;  2XCC A;  3LY9 A;  3AU4 A;  3MKR A;  4I43 A;  2VTB A;  5FQ8 A;  5ENN A;  4U07 A;  5HQ8 A;  3CHM A;  2UY1 A;  2VGX A;  4IYP A;  4WWN A;  5FJY A;  4APO A;  4CEM A;  3SNX A;  2CHW A;  3FTW A;  2AVP A;  3BG0 B;  3LCA A;  3FUL A;  4HOS A;  4GA1 A;  3L16 A;  4EBA G;  3LDZ A;  5AJL A;  2YHE A;  1KT0 A;  5G04 J;  4JA7 A;  3S7D A;  2JEK A;  3MV3 B;  3G2W A;  1OWO A;  2VGY A;  2HO1 A;  4EZL A;  1PC2 A;  3SBS A;  5DIZ A;  4KZC A;  1EYH A;  5AIJ A;  3CKB A;  4I9E A;  2IOS A;  4A55 A;  3TAX A;  4N2S A;  4UQY A;  4H7X A;  3ZGQ A;  4FHK A;  5JJ7 A;  1E7U A;  2IU1 A;  1HXI A;  3OAW A;  4GMJ A;  4MS6 A;  4Q94 A;  1NA3 A;  3KS2 A;  5LFA A;  4N2Q A;  2WXI A;  4U0U A;  1UW4 B;  3KAE A;  4ANV A;  2LAH A;  4WND A;  1EF1 C;  2VSY A;  2AWI A;  4EQF A;  3PUJ A;  5KJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...