2WM9A

Structure of the complex between dock9 and cdc42.
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
423
structure length
407
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 148
structure length 407
sequence length 423
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wm9A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wm9A01
3VHLA 3B13A 2WMOA 2WMNA 2YINA 2WM9A
chains in the Genus database with same CATH superfamily
1Z0PA 2LE8A 2XQ6A 4FHJA 2ZU6B 2OV8A 2XM2A 4HVBA 3CK8A 2DWZA 2J09A 3Q5WA 4LEUA 2W67A 4KHPT 1ZEEA 1D0XA 3EHNA 5EIDA 5ENSD 5JDNA 2OLTA 4HN9A 4OK0A 3LDZA 3B13A 4ILAA 2GRQB 4KI0F 1TNOA 2I59A 2OA5A 3MA5A 4BERA 1KNRA 2CFUA 2WQ7A 4U96D 3T5VA 2LSIA 4DBQA 3NF1A 4AM9A 4C90A 1K1BA 5IUXA 3ONXA 5J0ZA 3ESLA 3E33A 4PDXA 1GW6A 3RRWA 1LTXA 4X8QA 3RYCE 5DABA 2B6CA 5JR9A 5LBQB 2VSOE 4ACLA 1FCHA 3EDTB 2W4XA 3Q9DA 3EDVA 4LG6A 5TAOA 4KVMA 3NKZA 4HOSA 4F53A 1E8XA 2VSXE 4GTSA 2XJ7A 3CHMA 4I6GA 4GCNA 3SBSA 4HOUA 4LRZA 1VRBA 4O4HE 1D1CA 3KS2A 4IE6A 4AIUA 3SO8A 3EUHA 3LFMA 3AA0B 3I9YA 3VHLA 4JVSA 5L3DB 4DUYT 5A6CA 1E7VA 4PFPA 2YU1A 3C64A 2XQ8A 2AE9A 5JDLA 3ABVA 4ANVA 2XSBA 3AE9A 4EECA 1MYOA 3NB2A 2CG3A 2J4BA 2V6XA 2R05A 1WY6A 4GA0A 1N34T 2UY1A 4KVOA 1W0BA 3GN5A 3N9PA 4A3VA 3HKDE 2LLYA 3AB3B 3CV0A 4HRMB 4LF6T 4I6JA 3BU8A 2WDQA 2CLYC 2VQ2A 5ADXL 3CX8B 3PDYA 1HFAA 2QA7A 1ZB1A 3SZ7A 1MZCA 1JWFA 4EHMA 4FI5A 4ANWA 3TXMA 3N9QA 2BVLA 2W66A 4BJMA 1U3DA 5JA4D 3EDUA 1L0VA 5AIJA 1HNZT 2VYIA 2H6GA 1XNFA 3QNUA 3FXDB 1MMNA 2RG8A 3AEEA 2CRBA 3CIRA 4F1SA 4TZ4C 4GYSA 1KLXA 2NXPA 5LYJE 2RFAA 3L17A 2LHRA 3MGBA 2JMHA 2VL8A 5HXHA 5AQJB 3FFLA 1HO8A 3ZVVA 4A55A 5CMWA 2KXPC 5CECB 2WWUA 4YTNA 2E9XA 1OEDE 2YEVC 4XE0A 3N71A 5CHEE 3S7BA 5DJQC 2PNNA 3RKOA 3CPZA 3TWUA 5J2UE 5JDMA 2C0LA 2IC6A 1I6ZA 2LM9A 4GOUA 4I55E 1KT0A 2FBNA 2KCVA 1N36T 3G2SA 1UJKA 3L09A 4UI9C 3UT4A 4A3TA 2XZEA 3SHFA 1FMVA 4A97A 4IDOA 2YDQA 4ATZD 3RRCA 4TV8E 4J7WA 1XDOA 5D0QD 4PJMA 3D9NA 4DBRA 4QHOA 4EOZB 3DSUA 3QWPA 4CEMA 3NBXX 2L6JA 3PJAJ 4V1Av 2VK9A 4X65T 2KNDA 3AG3E 3PU8A 3Q78A 4K0UA 1NL4A 4TNVA 4DV4T 4H9SE 3RO3A 1TEZA 5LXTE 3CVYA 4MS6A 2ZISA 5EDSA 4G11A 3LXUX 4GZ5A 5L3CB 2A3DA 1OXZA 5DBKA 2CLYB 2Y1LE 4BETA 3FTWA 3N2KE 5L47A 2FJDA 1OCZE 2V4HC 2IAKA 3TWVA 2IC9A 1N52A 1A17A 3AAAC 4H9NC 2Y3AA 2J62A 3S7FA 1X5BA 3ML9A 3T8KA 5L4HA 3DP7A 3MKQB 2DL1A 2WMNA 4HNAD 3P4SA 4JL0A 1O1TA 4O8SA 2XQ9A 3P4QA 2HPLA 5KNHD 5L3BB 3P4PA 4J6IA 4C9BB 3IEEA 2PL2A 4PFOA 4ZHQE 3O4XE 3MYVA 3CX6B 3B57A 2DVWA 3G2UA 1LF8A 1WCRA 4FULA 2KXPB 4ZS2A 3ZFWA 1Y64B 2BS2A 1QNFA 4B89A 3FZFB 1BPOA 2AJAA 4BT8A 3J5PA 2XEVA 3FTZA 3TG5A 4GIWA 2FULA 3PUYF 4GYWA 3E0ZA 3C98A 2LAHA 3LPZA 4NURA 5T4YA 3KV9A 5AQLB 3CSTA 5HXEA 3QB5K 1AJ3A 5L3GB 3D9PA 5DIZA 2UXCT 5FXWA 2OEWA 3BG1B 4CXXA 1N54A 4H9PC 3P2BA 4OYJA 5CJ5A 4DR4T 3G2WA 2MRIA 5L3FB 3O1HA 3JXJA 3M3ZB 4HKAA 3F31A 4DMWA 1O1RA 5A1LA 1NP7A 2CMRA 2H3RA 3Q75A 2EHOD 4HS2A 4HLEA 3K9IA 4LFCT 4B3RT 2VGYA 4GTVA 5JDQA 4UQYA 1N4QA 1T98A 2WPVA 2D0UA 4IDQA 5EX3A 2J08A 4HFEA 1BR1A 2LSJA 2NTYA 4U2ZA 2BZBA 3UU4A 4YHHT 5AQ7A 5ITZF 2CPTA 4ANJA 4N3AA 4HWCA 2WQHA 2XRZA 2WXRA 1YMPA 5CRVA 2A2FX 3HR0A 4F6RD 1XWMA 3I3NA 3ULQA 4G2VA 1ELRA 3CLJA 3MV3B 3SQVA 3AEDA 3AAAB 1UOHA 2FJBA 3VKHA 4N2QA 2JQ9A 5J1GA 4PJLA 4AKHA 3VLEA 4BWRA 5C1DA 3FUMA 2H7VC 1Z3YA 3HG0D 3IBEA 1E8ZA 2IF4A 2AW6A 1RZ4A 1INZA 1SVXA 5LNKA 5BMVE 4AY6A 4FC8A 4FU3A 4HFCA 3CK7A 1HZ4A 1G8XA 2N9DA 5EYPF 3UUXA 4UELA 4YLHA 3CMLA 1N4PA 4WNEA 3V2XA 3C50A 4QKNA 5ENRD 3UKUG 2VURA 4FADA 4QH1A 2BS4A 2QFCA 1NA3A 4IULA 3RH3A 3PH0C 3MKDA 1ZU2A 3C51A 5HEJA 2J1DG 4LMLA 3AE1A 5HXRA 4CGWA 3CVXA 4CDNA 1HXIA 1Z5SC 3L54A 2EINE 2WS3A 3LVQE 4G8KA 3GYZA 3ZKRA 5DQWA 3DTOA 5ABFB 3E34A 2IMLA 3B5MA 4HOTA 2X68A 1B89A 4PAGA 3Q5XA 3CQGB 2Q9QA 4X1YE 1OWNA 3NZQA 1KPSB 4P0AA 2R17C 1OEDC 2LAIA 4JEHB 5AQIB 2RP4A 1S63A 2PZIA 3QK0A 4XI0A 4CZ2D 3ZT5A 3ASOE 2WXFA 2LM2A 3UM3A 3ZIMA 5J90A 4B93B 1TJFA 2XHEB 4Z8XA 4HI8A 2VQET 4TRQA 2JMKA 3OTOT 4OYKA 1K8KG 4WUYA 4MFRA 1KK7A 5ARFA 4DRXE 4OHFA 2LHNA 5FXZA 1YKEB 1JUQA 3MV2B 5JHBA 5F8PA 2W62A 1EF1C 1T7SA 4GK0E 3PE0A 3FDHA 1D0YA 2E8IA 2A4ZA 3IEGA 5JDFA 2EHOC 4H63H 2VSYA 3DEOA 4UVBB 5LOVE 2W00A 1N4RA 1EDUA 3TLUA 3S7JA 3ONLC 4ILCA 1T72A 4JLEA 4JV5T 4LNGA 4XBFB 1XNRT 4BTAA 1D0ZA 3V5SA 4DIDB 5FQ4A 5HI7A 5LCWJ 3E22E 1ZBPA 5AQPB 2A5EA 2PFVA 1TN7A 4LFAT 3BG0B 5ENOD 2VL0A 3ONKA 3OAWA 4BTBA 4I50E 3Q15A 3UUMA 1D9SA 4HQDA 1G3NB 3ZC1A 3CVPA 4EB6E 3R6NA 4DLQA 2BKOA 3P4WA 3FZKB 4FJOA 3KSQA 2X0LB 4YJ2E 3F57A 5AQHB 4F6RC 3U64A 5D2MC 1E7PA 1NENA 5AN8A 4WYVA 2WVIA 3ETUA 3PEVB 4DR6T 5JQGE 4HFIA 4U8YD 4HFHA 1CUNA 4BESA 1LKXA 3SD5A 4PS3A 5E75A 2Z6EA 3SRZA 4G8LA 2V6YB 4L5GA 2E2AA 3PUWF 4U0ZA 2YN6A 2VKHA 2D0TA 4B8AA 4AXHA 2XAQB 1HR0T 2V26A 2UU9T 4Q25A 4C0EA 2RFMA 4WNDA 2HN2A 3I1AA 3PUVF 1BR4A 5LG4A 3FZHB 1QZ2A 3RYFE 4DNDA 2P9PG 2WXKA 2JQQA 2ETCA 2V5FA 4YDOA 1A5EA 1OWMA 1OEDB 3PVLA 2GRRB 4E6HA 2ZMAA 5EK4A 2YU2A 2E5VA 1IZNB 3RLFF 3RO2A 2SPCA 3PUXF 3SFYA 4TWDA 3BQKA 3A8YC 5HXCA 2WB5A 3NVOA 3DXMG 4N3BA 4XZ4A 3K3OA 4OVUA 3LG7A 4J8EA 3RRNB 4AIFA 1OCOE 4JEUA 4IDPA 3LJCA 3B7TA 3HKBE 5JJTA 4N39A 3UX4A 2V7KA 5EYLA 2VTBA 4NXNT 3EJNA 4EV6A 4GZ3A 5EKQD 3OPCA 5HWYA 2N2NA 2YHEA 3U9WA 3ZN0B 3PUKA 3AAIA 3RX6A 4LF5T 2V5CA 4A56A 4JHRA 2EHOB 3AE5A 4NXMT 1OCRE 5G2NA 3R84B 3CX7B 4OX9T 4U31A 2BKKB 1HX8A 3KINB 4I43A 4KZ0A 4HOQA 3BQOA 4ILUA 1SA5A 2IU1A 4ZXLA 1JCRA 1MX2A 3FUKA 1UN9A 2LSUA 3CHRA 3PZ3A 4MRUA 2B0OE 4I0UA 4ZHBA 3ZYLA 1G73A 4NIQA 3N9NA 3VTYA 3S7DA 4HWIB 4A63B 1HNWT 4ZZBA 2AVPA 4AQGA 5AFUL 3KV4A 2H6IA 3ONJA 5AARA 2LXLA 4AQFA 5BPPA 1N32T 4TNWA 4NPPA 5LJNA 3FU6A 4G25A 2VWAA 4PJNA 5M4YA 2GK9A 1O1SA 3QB2A 3ESKA 4QXHB 1WFDA 5BV0A 3JCKC 5ENPD 5LCYA 3HXCA 2CEAA 4XZCA 3F6QA 2XTLA 3HVEB 4I9EA 1XMQT 3UU6A 3JC6D 3L39A 5HAXA 2X66A 3JADA 1PAQA 4O6FA 3N9OA 2VGXB 2CXLA 2W0GA 4HFDA 2ETBA 3ABKE 4KT6B 4LMKA 5HKPA 3ZEFA 1MX4A 4UVCB 4JZYA 2C2LA 3ZPOA 4YT0A 3IF8B 3X1DA 2XY8B 2MOZA 4CXWA 3ULEG 1FMWA 2OVBA 5AQTB 2L8KA 4JI0T 1XZYA 2LRLA 3T1YT 1IKND 5LJMA 2WXNA 4AQYT 4Q69A 3W15B 2IOLA 2GRNB 1MNEA 2V7LA 3TWXA 2IJGX 3P7IA 2NTXA 5JRCB 3ASGA 1KT1A 1EYHA 1YW0A 3NRYA 5KJLA 2C0MA 2J8SD 2DWKA 1QUUA 3L22A 3RKGA 3TL5A 3NZPA 3RIAA 4KHZF 1SQMA 4NQ0A 3V30A 4UF0A 2DWGA 1YCSB 3Q7AA 3KFWX 4FHKA 5CEDB 3T9KA 1SUMB 2N1GA 2K24A 2NP9A 4AKRB 2E5LT 2J07A 4H9RC 5LX8A 3UTMA 5KJKA 3UM2A 4LF9T 5JR9C 3SOLA 1J1JA 3P50A 2VKDA 1JNZA 2XPKA 4AP2A 1GQEA 4JXTA 2R59A 3QKYA 2DLRA 1DCQA 4TUUA 3LK42 2V4LA 3H3AA 5L2LA 3FB2A 4X64T 1N95A 3AG4E 2PBIA 1HG5A 5FTPA 2PTFA 5ANRA 1IYGA 5HWXA 4DR5T 4DV5T 4PK6A 1UG3A 2V5QC 2R02A 4N5QA 3PEUB 2CHXA 5KJMA 3U3IA 2PQNA 3I4GA 5IY5E 2XGMA 3UU3A 5LOZA 4HWFA 5LP6E 4UWKA 1U4QA 3AU5A 4B8CB 2YHCA 5AQMB 4WNKA 2QZAA 3T8MA 2WDVA 3CKDA 1YA0A 4U3CA 3AE7A 3NWIA 2XQAA 4O4LE 5JH7E 1XNQT 2KMFA 3OTNA 4J0UA 4I4TE 3TWWA 3MJWA 3LEWA 3RSEG 2KZTA 1E1HB 2NOXA 1QYMA 4X5TA 3DEPA 4YDWA 4KBQA 3ZU7B 3Q2MA 3AA7B 1LVFA 4G2AA 4GMRA 2A72A 3JUEA 1JCSA 4YTPA 1KZPA 4MLKA 3D0TA 3VKGA 2ODVA 3FU5A 2FJAA 2VQFT 4GMJA 3WAJA 3JC6C 2V1DB 3JCFA 2AXVA 2M67A 3SFEA 3FUEA 2KM4A 3O1IA 4FP7A 3A5XA 1QSDA 5FL1A 4PNIA 4ISSA 1H2UA 4YDYA 5C2TA 1TNYA 2BEDA 1MJ0A 1WR6A 1FEWA 4QWNB 2X6FA 3FWVA 2WU2A 4HWDA 1IJ6A 3ANWB 2WXJA 3DPYA 2YOEA 3L9TA 3RK6A 1O3XA 4LF7T 3RKVA 2E0IA 3FU0A 4F3VA 1UW4B 2AXZA 4HFGA 4TWHA 1VCTA 1JWGA 4G24A 5JR9B 3UPVA 3ZYKA 4DJAA 4YY3T 1RW2A 2P9LG 3HXEA 4DR7T 3TLVA 2R5SA 1HNXT 3FP3A 2F37A 3KEAA 2LOSA 1H6OA 4F1PA 1I94T 4K0RA 2LSVA 4GA2A 4L9PA 4AKLA 3ZYQA 2M6IA 3FUFA 4QX7B 2CXDA 2CFZA 4MLPA 1NA0A 4O4IE 2MYSA 3CIAA 1IBMT 5AENA 3U66A 3EIJA 4ISTA 2H89A 5AQRB 4UV9B 3P1UA 5JMND 2X6IA 2A9UA 5LGTB 4KBMB 3UQ4A 3RHWA 2KBXA 4AEZC 1HG2A 4IL4A 3PDNA 2NW9A 2UY1B 1M62A 3GN5B 1DVPA 3UI2A 2CE7A 3DXKG 3UQ3A 3TLWA 4L2YA 4RLYA 1HE8A 3AG2E 4R7LA 5JJ7A 4JD2G 3TXNA 1ELWA 1JPLA 3EIQC 2X51A 3FUIA 3PRZA 4GTOA 5T3RA 2CHNA 3C4XA 3E4BA 4NACA 3KSLA 3ZMSB 3AEAA 5HCMA 4M7CA 4AY5A 2ES0A 4J8FA 2JQKA 4IGUA 3FUDA 3UT8A 2BG9C 2YQ8A 3MCXA 2P9IG 3TJPA 2CHOA 2LO6A 1XMOT 2KSRA 3I9WA 3SS1A 2OEVA 1HTJF 2QYJA 5G05J 3UT7A 1BU9A 4C48B 4JC8A 5KWDA 2XPYA 1ZP0A 1E90A 3UM0A 1EZ3A 2NW7A 5FMNA 4AKGA 5JVDE 4FJZA 3L6AA 4UWLA 5EN5D 3J7Yq 4XKBA 3EABA 2V7JA 1IQRA 1EPUA 4ABNA 3OYZA 5IWAT 1VOMA 4ZFHA 4X1IE 3PU3A 1TN8A 2MOWA 5FXXA 2MBGA 5FY7A 3QC1A 5CRUA 3DPDA 1D8EA 2X67A 1VDYA 3LJ3A 5CFBA 4JA7A 3UIOC 4AXPA 1HF8A 5CA1E 1FVHA 5EK2A 2C5JA 3Q5MA 1HU3A 3E37A 3ZHEB 2CBJA 1X81A 5KJNA 2ZGGA 1PY1A 1OWAA 3P8CD 3PZ1A 3PUJA 5E0OA 2VKJA 2LKGA 3TAXA 2P9UG 1YQ3A 2LKHA 2KATA 1MQSA 5B3SE 2KCKA 3R9MA 4ME2A 2GRPB 4ADZA 2FI7A 2XENA 4YVQC 2JQHA 2XAGB 2XEEA 4JI8T 4UUCA 4UEMA 3QOUA 3PZ2A 4EIWA 1BI8B 4N3CA 3AE2A 4QH5A 2WM9A 3NAWA 4OFZA 4P09A 4C0MA 3TGOA 1YXRA 3LK2B 1FVFA 3Q47B 2X6KA 4UWFA 1NEKA 3MACA 4GTTA 5E76A 3HRAA 4CXYA 4U7EB 3VU7H 4K0KT 3FBZA 1LD8A 3D9LA 3RPUA 4LERA 3VRAA 2Y8DA 4YHJA 1U3CA 1AP7A 4J8SA 2IIUA 3G2VA 2OCCE 4CT4A 2BG9B 1IQUA 3AAEB 3ASHA 3CK6A 2Q7FA 3RIUA 5BR8T 3Q4AB 1E7UA 4APFA 1D1BA 1WG0A 4NUVA 2WP9A 5CCMA 4UQXA 1N33T 3LBXA 2R6GF 5ABEA 3AJIA 2YDSA 5G04J 2KINB 3J9X1 3QC9A 3PREA 2V8SE 4GTQA 2GROB 3APCA 4J8YA 3CHQA 3APFA 3C98B 4HLLA 2NYJA 3QUJA 3GW4A 2X9YA 2Y0BG 1S64A 2P9BA 1M7KA 2WMOA 5ETWA 3GZ1A 4X1KE 3K3NA 4GMLA 4GKJT 1N0RA 2V0PA 3MK7C 4PUCA 3TWTA 5FQ6A 4J2CA 2WZIA 3RU0A 2ODUA 1KNZA 5D0OD 3LS8A 1N4SA 2KZ7B 1D1AA 1X79A 3K1SA 3IHRA 5JDHA 2UXDT 5CGMA 3N2OA 4EZ4A 2YK0A 5GONE 3IHVA 4BSZB 5EK3A 4U8HA 3WG7E 1UCUA 3GZSA 2H6HA 3AEFA 4YSYA 1T8BA 3HKCE 2DZNA 3CVNA 2J9QA 3DSWA 3CHSA 5L4EA 5JTGA 4H7YA 2ILRA 3UQ7A 5AAOA 5FY0A 4ILGA 3I0OA 4KMOA 3I4RB 5EX0A 3SGHA 3MJXA 5LBMA 3PNLB 4WW0A 2JEKA 3L82A 2BVMA 3ABLE 5FZRA 4EZJA 3ZJ1A 3AEGA 1WAO1 3W9GA 2C0SA 4YSXA 2VJ8A 3ZCIA 4DX2A 1Y01A 4GZDA 2IW5B 4DUIA 4I1OB 4IT4A 2E2EA 2IO2C 3SFZA 4Q94A 3SI5A 2XM1A 4TX5A 2NC9A 4TXPA 3ZMUB 3C72A 5FYMA 2UXXB 2NWBA 2GRLA 3PNTB 1WDYA 2LT3A 2VKOA 2WDRA 2UUCT 4DMVA 4JI4T 1V55E 5AQAA 4HTEA 4YXDA 3FUJA 5HS0A 4BX8A 2CHZA 1OY3D 2ACZA 3CVQA 3UIPC 2QGSA 3UUXB 4AVXA 5KBAA 3S4UA 4O60A 1VCSA 4A98A 3T5XA 4Q96A 3UUBA 3KV5A 2L9BA 3T8OA 4CN4A 4DX1A 2BBJA 2MTQA 3MA9A 3WAKA 2X6HA 3TLTA 5CBOA 2ZXWE 1Y6IA 4IRUA 2CXFA 2WQ6A 3FEYA 5ABHA 3EHRA 3CVLA 2WZHA 2WAUA 1IHBA 3ONLA 5AQOB 1BR0A 2H6FA 4ZI2D 4G26A 5FZSA 2K5BB 5CMYA 4DVDA 1DC2A 3JYSA 2L9QA 2FJEA 4HFVA 2BBHA 3TWRA 5HYAA 1AWCB 3VLFA 1IJ5A 3B95A 2X0YA 4IIJE 1B7TA 4IE0A 3HI2A 3B7SA 3EU5A 1FPPA 4GAAA 1ZV4X 4B3MT 5H7PA 1MMDA 2Q9QB 2WXLA 2BF0X 4DX6D 3SNXA 4WWPA 5AQQB 3JAEA 3B7UX 3WI3A 4F8HA 4COFA 5LGUB 1WYBA 4WZXA 3R7RA 2QYWA 3FXEB 5AQUB 2NW8A 4K03A 2IHR1 2LRKA 1TNZA 1US7B 3AXJA 1YKHB 3UU8A 5J2TE 3LY8A 3AE8A 4CI3B 4PJJA 4BA9A 4U0UA 5G55A 4KX6A 5LHGB 2X9WA 2Y6XA 2ZLYA 2BKPA 4N5CA 2YKSA 2ETAA 3HVEA 3RYIE 3SY2A 2RA1A 3VR9A 2QC9A 2KLQA 4EXTA 4L7TA 5JREA 4E7ZA 3QAQA 2WU5A 3HXBA 3Q73A 1UN8A 3UULA 1DNPA 4ZI3D 3HDXA 5LP0A 2YNQA 4K5AB 1WRDA 3ZN1B 3T1HT 4UI9J 3RIBA 1D8DA 4JI2T 1BD8A 1Z6TA 3LY9A 4WAFA 3RIFA 2VGEA 3ZMTB 4GPMA 3O1JA 3QNKA 4O2AE 1OWPA 3ZXPA 5HEGA 5KDMC 2WSSV 5M72A 1IXVA 5AQSB 5ENNA 2M6BA 3H3MA 3KVBA 4ILHB 1S35A 2WBLA 1W0AA 3DSSA 2IEJA 2VVSA 4AI6A 2LUHA 4HXIA 1IBKT 3LJNA 4GTPA 4IE5A 4RG6A 2Y4UA 3ZKJA 1HH8A 1SZAA 2BS3A 3MKRA 3LDQB 3O4ZA 3PUGA 4AQFC 3C3QA 5FQ8A 3LYAA 3AG1E 3OYXA 3OXFA 2PM6A 3UMVA 3PV0F 4GTMA 1Y8MA 2LSGA 3SFDA 4CI1B 2L0TB 3EVYA 4DV1T 4D10C 3E08A 3QOFA 3UT5E 1MIVA 5HRYA 3B7RL 4HGAA 2J4GA 2YDRA 3AE4A 2FO7A 3RYHE 3Q5EA 3ZSTA 1SHZC 5ENQD 3KEZA 1U2VG 5BXUA 4EYYR 5KX5E 4I2ZA 3KV6A 3LK3B 3NQPA 1WR0A 4HI9A 4OVVA 3M65A 2IUBA 2XUEA 4GYOA 3SFXA 2XZTG 3FBLA 5AQNB 3CKCA 1XDPA 3DRAA 4DI4A 2WWVA 2JABA 4CYMD 1NAFA 4ILBA 3UINC 3FHEA 2CCQA 4ZI2C 4W9RA 4EPZA 2FO1E 3IBPA 1TNUA 1Z3XA 2ZIRA 4GA1A 5LFAA 4JEUB 2PG8A 4DX7D 4IN3B 5EIBE 3ZGQA 1QBQA 3ZW3A 1LVKA 4UWHA 2W63A 4BFRA 1UURA 2E9XD 2QRXA 2Y69E 5LG3A 3S2AA 3UUNA 2D9DA 4IL9A 2VTBB 4FA6A 1U5PA 2RD0A 4JI1T 4L0RA 1H0AA 3UFGA 1O5MA 5FL0A 4KXKB 3CVWA 3L8RA 3JXIA 3GA8A 3RQWA 4N78D 3RF1A 3RRUA 3ZCJA 2UUBT 4KP3C 4YSZA 2IDOB 2F0YA 3CSFA 4Z90A 1Z8UA 2JLBA 3CWZB 4UVAB 4U33A 2PQRA 3BK9A 4EEDA 3ZXSA 4I43B 3TWQA 3CVVA 3LVRE 3CEQA 3D9IA 5IHYA 3RC3A 2I0MA 2UXNB 1IBLT 2YINA 3ZT7A 1YQ4A 4QH4A 4MKTA 3AVSA 4DK5A 4H63V 2W2UA 2HM8A 4AV7A 4XX5A 2RPAA 1K3ZD 4B3TT 4M3OA 3FH8A 3G2TA 4O1OA 5KNGA 4DR3T 5HEHA 4LSZE 3PUQA 4GZCA 2XS8A 4YNDA 5LB7B 4TUMA 3ZPJA 4ZI3C 3G06A 3IA3A 4PK5A 4WBOA 2V7MA 2WXQA 2LSKA 3FU3A 3ANWA 4OAVB 2ZM6T 2EILE 3FTVA 1SW6A 4ANUA 3E30A 4A1GA 3CQXC 4WWNA 1H6PA 3I0QA 4JI5T 2XAHB 3FUNA 4U04A 5ENTD 1E8YA 1J5ET 5C2YA 2JPFA 3O48A 2C5IT 5EZYE 3JAFA 3FTXA 1KNPA 1BR2A 3CVRA 2X3MA 2BKNA 1K1AA 4U7YA 3ZEFB 3AVRA 1HCIA 3QARA 3AA1B 1NFIE 2XGOA 5LA6E 2UWJG 2LOPA 3QDNA 4X62T 3BUAA 3ZSSA 5BT1A 3PZDA 2P9KG 1V9DA 3QWVA 3P4RA 3R9AB 2IY0C 2B76A 2CBIA 5JDGA 4JYAT 4AKIA 3FUHA 5LCWC 3FTYA 3TKLB 4YFSA 1KF6A 4GYRA 3D9OA 5HQ8A 2GGFA 3VLDA 4JUYA 4I17A 4CN6A 4V3IA 3C4WA 4FLHA 2D2SA 3L3PA 3RGLA 4ZI7E 3GZ2A 5FVKA 4IREA 2ZM8A 1IHGA 4UF0B 1SA4A 3GWHA 4XKCA 1UJJA 1QLBA 3JUIA 5BUZA 3UXGA 4HEAA 3KDSE 4B0ZA 3DSXA 2L3LA 4L9IA 2D5UA 2FEZA 2E9XC 4G23A 1OWOA 2WXHA 1WYCA 3OXGA 2HH7A 2VB6A 1ZKEA 3EHZA 1OWLA 3Q5DA 4TV9E 2QY7A 3NZSA 4JHJA 4I2WA 2A5UA 3ZRHA 2CA5A 2QVAA 1FJGT 3MKQA 4PK4A 5AQ9A 3DJBA 2HR2A 4E85A 1E8WA 4CN1A 4JB8P 4XEIG 3OBVE 1HS6A 2LXMA 3MEKA 4JI7T 1SA0E 1P5QA 4CI2B 4KZCA 3UTKA 5HXSA 1Q2ZA 3BEEA 4DV3T 4CCAA 3AE3A 4QXBB 3R7QA 2CG2A 2GW1A 4TN7B 4IDNA 2OVFA 3W9FA 4GKKT 5CEAA 4U95D 2OOEA 4EGWA 3C3OA 1S94A 2OV9A 4WNGA 3VTXA 3ZHEA 5J08A 3ULYA 1N9AA 3J5QB 3L16A 3Q49B 4N2SA 2KZTB 3EUVA 3PUZF 4XAXB 3RI5A 2WB2A 1H2VC 1NI1A 3NBNB 3FULA 4JA9A 1H6KA 2WXIA 3IXEA 5A23A 2XEHA 5KCMA 3K8PC 2PM7A 4RQIA 2RKKA 2DYRE 2V8SV 2AWIA 2P58C 5AQVB 1MIWA 1HS7A 1X9BA 5JJ6A 3ZC0A 4LMJA 4IHJE 1S0PA 3SWHA 3ABME 4O1PA 5AQBA 1UUSA 3V31A 2PJQA 4AJWA 4U72A 3NOCD 4RG9A 3CVUA 4AISA 1W9RA 4U2YA 2XRYA 3Q7FA 4GPKA 5CBNA 3RC8A 3Q9UC 2K9AA 1JNRA 3FHNA 4H9QC 2JRKA 2GRMA 3DSVA 4NRHB 2Q9QD 5BW8C 3D9MA 1YYHA 2E9XB 5CCLA 3CR3A 5FNVE 2F8YA 2MHKA 4A5XA 2BG9A 3EU9A 1J5WA 3A7MA 2XPZA 1W09A 4GYYA 4LNBA 4BEPA 3FZLB 2ZM0A 1MMGA 2WY2A 1TYQG 4IE4A 5HEUA 5ARGA 3OJAA 4DR2T 3KD7A 2IFUA 4ANXA 4WNFA 2X38A 3ZT6A 4U0SA 5ABGA 2CM0A 4DO0A 1H19A 3HXFA 5AYWD 2P9SG 5B1AE 3RRMB 4DV2T 2KCLA 2HO1A 5CB4E 3UU5A 1KFYA 1ELKA 4I6EA 4UXNB 2WXOA 3L13A 4YJ3E 3UKRG 4UV8B 3ETVA 2FBWA 3EAMA 2WXGA 3AA6B 2WQYA 3V5UA 1TJCA 3RJVA 2MPKA 4LFBT 3D3MA 4QFVA 4EZLA 3H37A 1H2TC 4ZOLE 3MZKB 5LHIB 4IE7A 2I6HA 3PUSA 4DLOA 3FTSA 4YDEA 3PUAA 2UXBT 3APDA 2I9CA 5LGNB 5ABFA 2FUPA 3MXZA 2QYUA 4CDMA 3AS8A 2B1EA 5AQGB 4ASKA 2J47A 5LHHB 2NSZA 3MX3A 3VR8A 4X66T 2EIKE 2WCAA 2AXUA 3FH5A 4JEHA 3RIUC 4U63A 4B94A 1TR4A 4GK5E 4CQIA 2L6BA 4Y6WA 2KWHA 3O9XA 2MYOA 2XHEA 4DI3A 4H7XA 2F8XK 3AEBA 3QK6A 3FEXA 3Q9NC 4FLBA 2P2CP 3FZMB 4CGVA 2LJLA 3EHQA 4E7SA 2J49A 4PS8A 3EHMA 4IYPA 4DX5D 4CDRA 2CWYA 5HEOA 1LRZA 5KXJA 1LD7A 4BT9A 5JHAA 5FP3A 1E2AA 2NR4A 4EBAG 4GCOA 1W3BA 4XIFA 4U74A 3C3RA 1KEYA 3SBTB 4MHCA 3KAEA 2FF4A 4GU5A 5L3EB 4HORA 4UQZA 1UGOA 2HN1A 3FY4A 1JCQA 1ZOYA 1V54E 3D9HA 2L0IA 2XASB 2BUGA 4TWFA 4EBAA 4RVBA 5LMNT 4KMCA 1MX6A 1WLXA 4O4JE 3FTUA 5H6RB 2Q9QC 4DV7T 4KYOB 1OXJA 2XQ4A 4QXCB 2UUAT 3E32A 3EI0A 2DNXA 5FVLA 2WXPA 2R2LA 3TLSA 2I2OA 4L2LA 4EYUA 3HHMA 5BXOA 3ZUVB 2XQYA 2LNIA 1UK5A 4Z68A 4RSYA 3KBTA 1R8IA 3UM1A 4U8VD 2V6YA 4OYSA 3URZA 4QX8B 3VRBA 4LF8T 2IQCA 3MZLB 4JHKA 4G1TA 5F3JA 1PC2A 3IKOB 1MHQA 4DV0T 4NIKA 4FJYA 3U3WA 3AE6A 5ANLA 4EZKA 4UWGA 5CA0E 1SE7A 1UX4A 4QQIA 5FINA 2EIJE 2IONA 3ZJ2A 3Q79A 3CHOA 4DUZT 4PW8A 2BKGA 3ASDA 4B6XA 4XI9A 1OEDA 1SZ9A 2CWOA 2CHWA 3PZ4A 4IDZA 4L23A 3U4TA 1S70B 4PS7A 4WBNE 4GTRA 2DBAA 4I1AA 1L5JA 4A1SA 1DU2A 3BQLA 1KZOA 2XGSA 3IHYA 2X9HA 4K5CA 4PH4B 3LY7A 3PURA 3LBXB 2MAWA 1BI7B 4YVOA 2BTDA 4JI6T 3LKUA 5EILA 3K3QC 2IO3C 3V2OA 3CGHA 2KWIB 1YD8G 2X9XA 2P9NG 4ZZCA 3PTRB 5D66A 5KMGP 3ML8A 2LEHA 2VSNA 2XAFB 4DR1T 4HE8A 2EHOA 1XGWA 3HYMB 2EQXA 2DCFA 5LMUT 1FT2A 3AS4A 3HA4A 4ERRA 4J8DA 3SF4A 3F2EA 4LUNU 4X20E 4DPRA 1TNBA 2H7OA 1N11A 4MALA 3PE3A 1H7CA 3OXLA 2V5DA 1TN6A 4P0BA 5BV1A 4P1NA 2W61A 2KT9A 3QJZA 1IAPA 2J4DA 3CHPA 1MIYA 2VVNA 4C91A 4O2BE 5H6QB 3ZMVB 5AJDA 4LNUD 3PJAA 3DWLG 1N94A 4HBDA 4M1PA 5FXVA 4ZEYA 1BLXB 5G05C 1E96B 1NZNA 4AOFA 3FH7A 4CT0A 4LF4T 3L08A 2HPJA 1QQEA 2JJ9A 4EAHA 3NOGD 5DQVA 4L1BA 2Y4TA 2X0HA 2XCCA 3ENEA 4APOA 2XSAA 2HE0A 4URKA 2XQ3A 3KVAA 3C4ZA 4OAUC 3U78A 3TG4A 3TWSA 2I1JA 3HXDA 4G63A 2LSYA 2G0UA 5IYZE 3N9MA 4I1MA 3JQ1A 2BDEA 4LCTA 4HFBA 4U07A 5B1BE 4K5BA 2VGXA 2Y48B 3NZUA 4ACKA 2DHRA 2ZGDA 5AQFB 4MBGA 3N2GE 2V7IA 3D9KA 3X2QE 3AU4A 4BY6A 5CERB 3AECA 4HRLA 3JQ0A 4GZ6A 3NRXA 5FWQA 3KBUA 4TUYE 2DZOA 4NUUA 1FT1A 4F7AA 5FIOA 4UI9K 1WM5A 4BSXA 4H9OC 4JI3T 3ASFA 2ACXA 4EEBA 2X6JA 2XQ5A 3N9LA 3OKQA 3I5PA 3RAUA 5JRCA 2DIWA 3CK9A 3ZMZB 4B3ST 2XQ0A 2C5KT 3OVUA 2I1KA 4BX9A 3QB5A 4ZS3A 5AQKB 2K48A 1OUVA 4MBQA 4BAYB 4HB5A 2AXDS 3UFEA 3BQIA 3PE4A 4EQFA 4CRWA 4UIGA 4CZZB 5C8YE 1UX5A 3ISMC 2HYZA 5F5WA 5AJLA 3DBSA 3HKEE 4YTMA 2DYSE 3GMIA 4JPSA 5FJYA 4Z91A 1OCCE 1CHUA 5HCJA 3RQUA 4TXQA 2VASA 3LSVA 2DCPA 4DV6T 3AXJB 3DSTA 2DI4A 3QWWA 2ONDA 3HL6A 4TXRA 3ZNGA 2XQ7A 3N5LA 2M63A 5FQ7A 1HX1B 1ZHCA 3ZLIA 3ZN3A 2XAJB 3PS6A 3C5RA 1N0QA 2R03A 3CQCB 5FT9A 2H88A 1FIOA 2HHHT 4EZHA 2BG9E 1NWMX 1MMAA 4P29A 5FY1A 2WXMA 4JW1A 4KUMB 5FKYA 1OT8A 3HIZA 5G04C 5BNWA 4I9CA 3B7BA 4JBWF 4Y6CA 3LCAA 3ASNE 4TV3A 4GB9A 3CKBA 1MNDA 2ZM2A 3ZYMA 2KC7A 2IOSA 5A7DB 4ATGA 2F4VT 3WXXA 2K3WA 4WWOA 5C3JA 2EIME 5T8IA 4HRNA 4BJNA 3V79K 2JIWA 4HWHA 2XS1A 3AS5A 5FZQA 2XZDG 3IV0A 4UR9A 2XPIA 2XCBA 3D9JA 1DCEA 4U7IA 4ILIA
chains in the Genus database with same CATH topology
1Z0PA 2LE8A 4FHJA 2ZU6B 2OV8A 4HVBA 3CK8A 2J09A 3Q5WA 4LEUA 1ZEEA 1D0XA 3EHNA 5JDNA 4HN9A 4OK0A 3LDZA 3B13A 2I59A 2OA5A 3MA5A 2CFUA 2WQ7A 3T5VA 2LSIA 4DBQA 3NF1A 4AM9A 4C90A 3ONXA 3ESLA 4PDXA 1GW6A 3RRWA 3RYCE 5DABA 2VSOE 5JR9A 5LBQB 4ACLA 1FCHA 3EDTB 3Q9DA 3EDVA 5TAOA 4KVMA 4HOSA 4F53A 1E8XA 2VSXE 3SBSA 4I6GA 3CHMA 4GCNA 4HOUA 4LRZA 1VRBA 4O4HE 1D1CA 3KS2A 4IE6A 3EUHA 3LFMA 3AA0B 3I9YA 3VHLA 4JVSA 5L3DB 5A6CA 1E7VA 4PFPA 2YU1A 3C64A 5JDLA 4ANVA 4EECA 2CG3A 2J4BA 1WY6A 4GA0A 4KVOA 2UY1A 3GN5A 3N9PA 4A3VA 3HKDE 3AB3B 3CV0A 4I6JA 2CLYC 2VQ2A 5ADXL 3CX8B 3PDYA 1HFAA 2QA7A 3SZ7A 1JWFA 4FI5A 4ANWA 3TXMA 3N9QA 2BVLA 4BJMA 1U3DA 3EDUA 5AIJA 2VYIA 1XNFA 3FXDB 1MMNA 2RG8A 4F1SA 4TZ4C 4GYSA 1KLXA 2NXPA 5LYJE 3L17A 2LHRA 3MGBA 2JMHA 2VL8A 5HXHA 3ZVVA 3FFLA 1HO8A 4A55A 5CMWA 2WWUA 2E9XA 4XE0A 2YEVC 3N71A 5CHEE 3S7BA 5DJQC 3RKOA 3CPZA 5J2UE 5JDMA 2C0LA 2IC6A 2LM9A 4GOUA 4I55E 1KT0A 2FBNA 2KCVA 3G2SA 1UJKA 3L09A 4UI9C 3UT4A 4A3TA 3SHFA 1FMVA 3RRCA 4TV8E 5D0QD 4PJMA 3D9NA 4DBRA 4QHOA 4EOZB 3QWPA 4CEMA 3NBXX 2L6JA 4V1Av 2VK9A 2KNDA 3PU8A 4K0UA 4H9SE 3RO3A 1TEZA 5LXTE 3CVYA 4MS6A 5EDSA 4G11A 3LXUX 4GZ5A 5L3CB 2A3DA 1OXZA 5DBKA 2CLYB 3FTWA 3N2KE 2IAKA 2IC9A 1N52A 1A17A 4H9NC 2Y3AA 3S7FA 1X5BA 3ML9A 3DP7A 3MKQB 2WMNA 4JL0A 4O8SA 2HPLA 5L3BB 4J6IA 4C9BB 3IEEA 2PL2A 4PFOA 4ZHQE 3O4XE 3MYVA 3CX6B 3B57A 3G2UA 1LF8A 4FULA 2KXPB 4ZS2A 3ZFWA 1Y64B 1QNFA 4B89A 1BPOA 4BT8A 2XEVA 3FTZA 3TG5A 4GIWA 2FULA 4GYWA 3E0ZA 3C98A 2LAHA 3LPZA 4NURA 5T4YA 3KV9A 3CSTA 5HXEA 1AJ3A 5L3GB 3D9PA 5DIZA 5FXWA 3BG1B 4CXXA 1N54A 4H9PC 3P2BA 4OYJA 3G2WA 2MRIA 3O1HA 5L3FB 4HKAA 3F31A 4DMWA 5A1LA 1NP7A 2CMRA 2H3RA 2EHOD 4HS2A 4HLEA 3K9IA 2VGYA 5JDQA 4UQYA 2WPVA 1T98A 2D0UA 5EX3A 2J08A 1BR1A 2LSJA 2NTYA 2BZBA 4ANJA 4N3AA 2WQHA 2XRZA 2WXRA 2A2FX 3HR0A 3I3NA 3ULQA 4G2VA 1ELRA 3CLJA 3MV3B 3AAAB 4N2QA 3VKHA 4BWRA 5J1GA 4PJLA 4AKHA 3VLEA 5C1DA 3FUMA 2H7VC 1Z3YA 3IBEA 1E8ZA 2IF4A 2AW6A 1INZA 5LNKA 5BMVE 4AY6A 4FC8A 4FU3A 3CK7A 1HZ4A 1G8XA 2N9DA 3UUXA 4UELA 4YLHA 3CMLA 4WNEA 3C50A 4QKNA 4FADA 2QFCA 1NA3A 4IULA 3RH3A 3PH0C 3MKDA 1ZU2A 3C51A 2J1DG 5HXRA 4CGWA 3CVXA 4CDNA 1HXIA 3L54A 3LVQE 3GYZA 5DQWA 3DTOA 4HOTA 2X68A 1B89A 4PAGA 3Q5XA 3CQGB 2Q9QA 4X1YE 1OWNA 3NZQA 4P0AA 2R17C 2LAIA 4JEHB 3QK0A 2RP4A 2PZIA 4XI0A 2WXFA 3ZIMA 5J90A 1TJFA 2XHEB 4Z8XA 4TRQA 2JMKA 4OYKA 4WUYA 4MFRA 1KK7A 5ARFA 4OHFA 2LHNA 5FXZA 1YKEB 1JUQA 3MV2B 5JHBA 5F8PA 2W62A 1EF1C 4GK0E 3PE0A 3FDHA 1D0YA 2E8IA 2A4ZA 3IEGA 5JDFA 2EHOC 4H63H 2VSYA 4UVBB 5LOVE 2W00A 3S7JA 1EDUA 4JLEA 4XBFB 4BTAA 1D0ZA 3V5SA 5FQ4A 5HI7A 5LCWJ 3E22E 1ZBPA 2PFVA 3BG0B 3ONKA 3OAWA 4BTBA 4I50E 3Q15A 3UUMA 3ZC1A 3CVPA 4EB6E 3R6NA 4DLQA 4FJOA 2X0LB 4YJ2E 3F57A 4F6RC 3U64A 2WVIA 3ETUA 3PEVB 5JQGE 1CUNA 1LKXA 3SD5A 4PS3A 5E75A 2Z6EA 3SRZA 4L5GA 4U0ZA 2VKHA 2D0TA 4B8AA 4AXHA 2XAQB 2V26A 4C0EA 4WNDA 3I1AA 1BR4A 5LG4A 1QZ2A 3RYFE 4DNDA 2WXKA 2JQQA 2V5FA 1OWMA 3PVLA 4E6HA 2ZMAA 5EK4A 2YU2A 1IZNB 3RO2A 2SPCA 5HXCA 3BQKA 4N3BA 4XZ4A 3K3OA 4OVUA 3LG7A 4J8EA 3RRNB 4AIFA 4JEUA 3LJCA 3B7TA 3HKBE 5JJTA 4N39A 3UX4A 2V7KA 2VTBA 5EKQD 3EJNA 4GZ3A 5HWYA 2N2NA 2YHEA 3U9WA 3ZN0B 3PUKA 3AAIA 3RX6A 4A56A 4JHRA 2EHOB 5G2NA 3R84B 3CX7B 1HX8A 3KINB 4I43A 4KZ0A 4HOQA 4ILUA 2IU1A 3FUKA 1UN9A 2LSUA 3CHRA 4MRUA 3ZYLA 1G73A 3N9NA 3VTYA 3S7DA 2AVPA 4AQGA 5AFUL 3KV4A 4AQFA 5BPPA 3FU6A 5LJNA 4G25A 2VWAA 4PJNA 5M4YA 2GK9A 3QB2A 3ESKA 4QXHB 5BV0A 3JCKC 5LCYA 2CEAA 4XZCA 2XTLA 3HVEB 4I9EA 3JC6D 5HAXA 2X66A 1PAQA 4O6FA 3N9OA 2VGXB 2CXLA 2W0GA 4KT6B 3ZEFA 4UVCB 4JZYA 2C2LA 3ZPOA 3IF8B 2MOZA 4CXWA 1FMWA 2OVBA 2L8KA 5LJMA 2WXNA 4Q69A 3W15B 2IOLA 1MNEA 2V7LA 2IJGX 3P7IA 3ASGA 2NTXA 5JRCB 1KT1A 1EYHA 1YW0A 3NRYA 5KJLA 2C0MA 2DWKA 1QUUA 3L22A 3TL5A 3NZPA 1SQMA 4NQ0A 4UF0A 2DWGA 3KFWX 4FHKA 2N1GA 2K24A 2NP9A 4AKRB 2J07A 4H9RC 5LX8A 5KJKA 5JR9C 3SOLA 2VKDA 4AP2A 4JXTA 2R59A 3QKYA 2DLRA 4TUUA 3LK42 2V4LA 3H3AA 5L2LA 3FB2A 5FTPA 2PBIA 1HG5A 5ANRA 1IYGA 5HWXA 4PK6A 1UG3A 3PEUB 2CHXA 5KJMA 3U3IA 2PQNA 3I4GA 2XGMA 5LOZA 5LP6E 4UWKA 1U4QA 3AU5A 4B8CB 2YHCA 4WNKA 3T8MA 3CKDA 1YA0A 4O4LE 5JH7E 2KMFA 3OTNA 4J0UA 4I4TE 3MJWA 3LEWA 2KZTA 1E1HB 2NOXA 4KBQA 3Q2MA 3AA7B 1LVFA 4G2AA 2A72A 4MLKA 3D0TA 3VKGA 2ODVA 3FU5A 4GMJA 3WAJA 3JC6C 2V1DB 2AXVA 2M67A 3FUEA 2KM4A 3O1IA 4FP7A 3A5XA 1QSDA 4PNIA 4ISSA 1H2UA 1WR6A 1FEWA 4QWNB 2X6FA 3FWVA 1IJ6A 3ANWB 2WXJA 3RK6A 1O3XA 3RKVA 2E0IA 3FU0A 4F3VA 1UW4B 2AXZA 4HFGA 1JWGA 4G24A 5JR9B 3UPVA 3ZYKA 4DJAA 2R5SA 3FP3A 2LOSA 4K0RA 2LSVA 4GA2A 4AKLA 3ZYQA 3FUFA 4QX7B 2CXDA 2CFZA 4MLPA 1NA0A 4O4IE 2MYSA 3CIAA 5AENA 3U66A 3EIJA 4ISTA 4UV9B 3P1UA 2X6IA 5LGTB 4KBMB 4AEZC 1HG2A 3PDNA 2NW9A 2UY1B 3GN5B 1DVPA 2CE7A 3UQ3A 4L2YA 1HE8A 4R7LA 5JJ7A 3TXNA 1ELWA 1JPLA 3EIQC 2X51A 3FUIA 3PRZA 5T3RA 3C4XA 3E4BA 4NACA 3ZMSB 4AY5A 2ES0A 4J8FA 4IGUA 3FUDA 3UT8A 2YQ8A 3MCXA 3TJPA 2LO6A 3I9WA 3SS1A 1HTJF 5G05J 3UT7A 4JC8A 2XPYA 1E90A 1EZ3A 2NW7A 5FMNA 4AKGA 5JVDE 4FJZA 3L6AA 4UWLA 3J7Yq 4XKBA 1EPUA 2V7JA 1IQRA 4ABNA 3OYZA 1VOMA 4X1IE 3PU3A 2MOWA 5FXXA 2MBGA 5FY7A 3QC1A 3DPDA 2X67A 1VDYA 3LJ3A 4JA7A 4AXPA 1HF8A 5CA1E 1FVHA 5EK2A 2C5JA 3Q5MA 1HU3A 3ZHEB 5KJNA 1PY1A 1OWAA 3P8CD 3PUJA 5E0OA 2VKJA 3TAXA 2KATA 1MQSA 2KCKA 4ME2A 4ADZA 2FI7A 4YVQC 2XAGB 4UEMA 3QOUA 4EIWA 4N3CA 2WM9A 4OFZA 4P09A 4C0MA 3TGOA 3LK2B 1FVFA 3Q47B 2X6KA 4UWFA 3MACA 5E76A 4CXYA 3VU7H 3FBZA 3D9LA 4LERA 3RPUA 2Y8DA 4YHJA 1U3CA 4J8SA 3G2VA 4CT4A 1IQUA 3AAEB 3ASHA 2Q7FA 3Q4AB 1E7UA 4APFA 1D1BA 4NUVA 5CCMA 4UQXA 3LBXA 5G04J 2KINB 3J9X1 3QC9A 3PREA 2V8SE 3APCA 3CHQA 3APFA 3C98B 3QUJA 3GW4A 2X9YA 2P9BA 2WMOA 5ETWA 3GZ1A 4X1KE 3K3NA 4GMLA 2V0PA 3MK7C 4PUCA 5FQ6A 4J2CA 3RU0A 2ODUA 1KNZA 5D0OD 3LS8A 2KZ7B 1D1AA 1X79A 3IHRA 5JDHA 3IHVA 3N2OA 4EZ4A 2YK0A 5GONE 5EK3A 4U8HA 1UCUA 3GZSA 3HKCE 3CVNA 2J9QA 3CHSA 4H7YA 2ILRA 5FY0A 4ILGA 3I0OA 4KMOA 3I4RB 5EX0A 3SGHA 3MJXA 5LBMA 3PNLB 4WW0A 2JEKA 4EZJA 2BVMA 5FZRA 3ZJ1A 1WAO1 2C0SA 2VJ8A 3ZCIA 4GZDA 2IW5B 4I1OB 2E2EA 3SFZA 4Q94A 3SI5A 4TX5A 2NC9A 3ZMUB 5FYMA 2UXXB 2NWBA 2GRLA 3PNTB 2LT3A 2VKOA 4DMVA 4HTEA 3FUJA 4BX8A 2CHZA 3CVQA 2QGSA 3UUXB 4AVXA 3S4UA 3T5XA 4Q96A 3KV5A 2L9BA 3T8OA 2MTQA 3WAKA 3MA9A 2X6HA 4IRUA 1Y6IA 2CXFA 2WQ6A 3FEYA 3CVLA 2WAUA 3ONLA 1BR0A 5FZSA 4ZI2D 4G26A 2K5BB 5CMYA 4DVDA 3JYSA 2L9QA 4HFVA 5HYAA 3VLFA 1IJ5A 4IIJE 1B7TA 4IE0A 3HI2A 3B7SA 4GAAA 1ZV4X 1MMDA 2Q9QB 2WXLA 2BF0X 3SNXA 4WWPA 3B7UX 3WI3A 5LGUB 1WYBA 3R7RA 3FXEB 2NW8A 4K03A 1US7B 1YKHB 3LY8A 5J2TE 4CI3B 4PJJA 4BA9A 4U0UA 5G55A 5LHGB 2X9WA 2Y6XA 2ZLYA 4N5CA 3HVEA 3RYIE 2RA1A 2KLQA 4EXTA 4L7TA 5JREA 4E7ZA 3QAQA 1UN8A 3UULA 1DNPA 4ZI3D 3HDXA 5LP0A 2YNQA 4UI9J 1WRDA 3ZN1B 3RIBA 1Z6TA 3LY9A 4WAFA 3ZMTB 3O1JA 3QNKA 4O2AE 1OWPA 5KDMC 2WSSV 5M72A 5ENNA 3KVBA 4ILHB 1S35A 2WBLA 4AI6A 4HXIA 4IE5A 4RG6A 2Y4UA 1HH8A 1SZAA 3MKRA 3O4ZA 3PUGA 4AQFC 5FQ8A 3LYAA 3OYXA 3OXFA 2PM6A 3UMVA 1Y8MA 2LSGA 4CI1B 2L0TB 3EVYA 4D10C 3E08A 3UT5E 1MIVA 3B7RL 4HGAA 2FO7A 3RYHE 1SHZC 3KEZA 4EYYR 5KX5E 4I2ZA 3KV6A 3LK3B 3NQPA 4OVVA 3M65A 2XUEA 4GYOA 3FBLA 3CKCA 4DI4A 1NAFA 3FHEA 2CCQA 4ZI2C 4W9RA 4EPZA 3IBPA 1Z3XA 4GA1A 5LFAA 4JEUB 2PG8A 4IN3B 3ZGQA 3ZW3A 1LVKA 4UWHA 2W63A 4BFRA 2E9XD 3S2AA 3UUNA 2VTBB 4FA6A 1U5PA 2RD0A 4L0RA 1H0AA 4KXKB 3CVWA 3GA8A 4N78D 3RRUA 3ZCJA 4KP3C 3CSFA 2JLBA 3CWZB 4UVAB 2PQRA 3BK9A 3ZXSA 4I43B 3CVVA 3LVRE 3CEQA 3D9IA 5IHYA 3RC3A 2UXNB 2YINA 4MKTA 3AVSA 4DK5A 4H63V 2HM8A 4AV7A 4XX5A 4M3OA 3FH8A 3G2TA 3PUQA 4GZCA 4YNDA 3ZPJA 4ZI3C 3FU3A 4PK5A 2WXQA 4WBOA 2V7MA 2LSKA 3ANWA 3FTVA 4ANUA 4A1GA 3CQXC 4WWNA 3I0QA 2XAHB 3FUNA 4U04A 1E8YA 5C2YA 2JPFA 3O48A 2C5IT 5EZYE 3FTXA 1BR2A 3CVRA 2X3MA 3ZEFB 3AVRA 1HCIA 3QARA 3AA1B 2XGOA 5LA6E 2UWJG 2LOPA 3QDNA 5BT1A 3PZDA 1V9DA 3QWVA 3R9AB 5JDGA 4AKIA 3FUHA 5LCWC 3FTYA 3TKLB 4YFSA 3D9OA 4GYRA 5HQ8A 2GGFA 3VLDA 4JUYA 4I17A 4V3IA 3C4WA 4FLHA 2D2SA 3L3PA 4ZI7E 3GZ2A 2ZM8A 1IHGA 4UF0B 4XKCA 3GWHA 1UJJA 3JUIA 5BUZA 4HEAA 3KDSE 4B0ZA 2L3LA 4L9IA 2D5UA 2FEZA 2E9XC 4G23A 1OWOA 2WXHA 1WYCA 3OXGA 2HH7A 2VB6A 1ZKEA 1OWLA 4TV9E 2QY7A 3NZSA 4JHJA 4I2WA 2A5UA 3ZRHA 2CA5A 3MKQA 4PK4A 3DJBA 2HR2A 4E85A 1E8WA 3OBVE 1HS6A 3MEKA 1SA0E 1P5QA 4CI2B 4KZCA 3UTKA 5HXSA 3BEEA 4CCAA 4QXBB 3R7QA 2CG2A 2GW1A 4TN7B 2OVFA 2OOEA 1S94A 4WNGA 3VTXA 3ZHEA 5J08A 3L16A 3Q49B 4N2SA 2KZTB 4XAXB 2WB2A 1H2VC 3FULA 4JA9A 1H6KA 2WXIA 5A23A 5KCMA 3K8PC 2PM7A 2AWIA 2P58C 1HS7A 1MIWA 5JJ6A 3ZC0A 4IHJE 1S0PA 3SWHA 4AJWA 2PJQA 4U72A 4RG9A 3CVUA 2XRYA 4GPKA 3RC8A 2K9AA 3FHNA 4H9QC 2JRKA 2GRMA 4NRHB 2Q9QD 5BW8C 3D9MA 2E9XB 5CCLA 3CR3A 5FNVE 2MHKA 2XPZA 4GYYA 2ZM0A 1MMGA 4IE4A 5ARGA 3OJAA 3KD7A 2IFUA 4ANXA 4WNFA 2X38A 4U0SA 2CM0A 4DO0A 1H19A 5AYWD 3RRMB 2KCLA 2HO1A 5CB4E 1ELKA 4I6EA 4UXNB 2WXOA 3L13A 4YJ3E 4UV8B 3ETVA 2WXGA 3AA6B 3V5UA 1TJCA 3RJVA 3D3MA 4EZLA 4QFVA 3H37A 1H2TC 4ZOLE 3MZKB 5LHIB 4IE7A 3PUSA 2I6HA 4DLOA 3FTSA 3PUAA 3APDA 2I9CA 5LGNB 3MXZA 4CDMA 3AS8A 2B1EA 2NSZA 3MX3A 4ASKA 5LHHB 4JEHA 2AXUA 3FH5A 4U63A 4B94A 4GK5E 4CQIA 4Y6WA 2KWHA 3O9XA 2XHEA 4DI3A 4H7XA 3QK6A 3FEXA 4FLBA 4CGVA 2LJLA 4E7SA 2J49A 4PS8A 3EHMA 4IYPA 4CDRA 2CWYA 5JHAA 1LRZA 4BT9A 5FP3A 4EBAG 4GCOA 1W3BA 4XIFA 4U74A 3SBTB 4MHCA 3KAEA 2FF4A 4GU5A 5L3EB 4HORA 4UQZA 3FY4A 2L0IA 2XASB 2BUGA 4EBAA 4RVBA 4KMCA 1WLXA 4O4JE 3FTUA 5H6RB 2Q9QC 4KYOB 4QXCB 2DNXA 2WXPA 2I2OA 4L2LA 4EYUA 3HHMA 2XQYA 2LNIA 4RSYA 3KBTA 4OYSA 3URZA 4QX8B 2IQCA 3MZLB 4JHKA 4G1TA 5F3JA 1PC2A 3IKOB 1MHQA 4FJYA 3U3WA 5ANLA 4EZKA 4UWGA 5CA0E 1UX4A 2IONA 3ZJ2A 3CHOA 4PW8A 3ASDA 4XI9A 4B6XA 1SZ9A 2CWOA 2CHWA 4L23A 4IDZA 3U4TA 4PS7A 4WBNE 2DBAA 4I1AA 1L5JA 4A1SA 3BQLA 2XGSA 3IHYA 2X9HA 4PH4B 3LY7A 3PURA 3LBXB 4YVOA 2BTDA 3LKUA 3K3QC 3CGHA 2KWIB 1YD8G 2X9XA 3PTRB 5KMGP 3ML8A 2LEHA 2VSNA 2XAFB 4HE8A 2EHOA 1XGWA 3HYMB 2EQXA 2DCFA 3AS4A 3HA4A 4ERRA 4J8DA 3SF4A 3F2EA 4LUNU 4X20E 4DPRA 2H7OA 4MALA 3PE3A 1H7CA 3OXLA 4P0BA 5BV1A 2W61A 2KT9A 3QJZA 1IAPA 2J4DA 3CHPA 1MIYA 4C91A 4O2BE 5H6QB 3ZMVB 5AJDA 4M1PA 5FXVA 5G05C 1E96B 1NZNA 4AOFA 3FH7A 4CT0A 3L08A 2HPJA 1QQEA 2JJ9A 4EAHA 5DQVA 4L1BA 2Y4TA 2XCCA 3ENEA 4APOA 4URKA 3KVAA 3C4ZA 3U78A 3TG4A 2I1JA 4G63A 2LSYA 2G0UA 5IYZE 3N9MA 4I1MA 3JQ1A 2BDEA 4LCTA 4U07A 2VGXA 2Y48B 3NZUA 4ACKA 2DHRA 3N2GE 2V7IA 3D9KA 3AU4A 4BY6A 3JQ0A 4GZ6A 3NRXA 5FWQA 3KBUA 4TUYE 4NUUA 4F7AA 4UI9K 1WM5A 4BSXA 4H9OC 3ASFA 2ACXA 2X6JA 3N9LA 3OKQA 3I5PA 5JRCA 2DIWA 3CK9A 3ZMZB 2XQ0A 4BX9A 2C5KT 2I1KA 4ZS3A 2K48A 1OUVA 4MBQA 4BAYB 3UFEA 3BQIA 3PE4A 4EQFA 4CRWA 4UIGA 4CZZB 5C8YE 1UX5A 2HYZA 5AJLA 3DBSA 3HKEE 3GMIA 4JPSA 5FJYA 2VASA 2DCPA 2DI4A 3QWWA 2ONDA 3HL6A 3N5LA 2M63A 5FQ7A 1ZHCA 3ZLIA 3ZN3A 2XAJB 3PS6A 3CQCB 5FT9A 1FIOA 4EZHA 1NWMX 1MMAA 4P29A 5FY1A 2WXMA 4JW1A 4KUMB 3HIZA 5G04C 5BNWA 4I9CA 4Y6CA 3LCAA 4TV3A 4GB9A 3CKBA 1MNDA 2ZM2A 3ZYMA 2KC7A 2IOSA 5A7DB 4ATGA 3WXXA 4WWOA 5T8IA 4BJNA 3AS5A 5FZQA 3IV0A 2XPIA 2XCBA 3D9JA 4ILIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHL A;  3B13 A;  2WMO A;  2WMN A;  2YIN A;  2WM9 A; 
#chains in the Genus database with same CATH topology
 1Z0P A;  2LE8 A;  2XQ6 A;  4FHJ A;  2ZU6 B;  2OV8 A;  2XM2 A;  4HVB A;  3CK8 A;  2DWZ A;  2J09 A;  3Q5W A;  4LEU A;  2W67 A;  4KHP T;  1ZEE A;  1D0X A;  3EHN A;  5EID A;  5ENS D;  5JDN A;  2OLT A;  4HN9 A;  4OK0 A;  3LDZ A;  3B13 A;  4ILA A;  2GRQ B;  4KI0 F;  1TNO A;  2I59 A;  2OA5 A;  3MA5 A;  4BER A;  1KNR A;  2CFU A;  2WQ7 A;  4U96 D;  3T5V A;  2LSI A;  4DBQ A;  3NF1 A;  4AM9 A;  4C90 A;  1K1B A;  5IUX A;  3ONX A;  5J0Z A;  3ESL A;  3E33 A;  4PDX A;  1GW6 A;  3RRW A;  1LTX A;  4X8Q A;  3RYC E;  5DAB A;  2B6C A;  5JR9 A;  5LBQ B;  2VSO E;  4ACL A;  1FCH A;  3EDT B;  2W4X A;  3Q9D A;  3EDV A;  4LG6 A;  5TAO A;  4KVM A;  3NKZ A;  4HOS A;  4F53 A;  1E8X A;  2VSX E;  4GTS A;  2XJ7 A;  3CHM A;  4I6G A;  4GCN A;  3SBS A;  4HOU A;  4LRZ A;  1VRB A;  4O4H E;  1D1C A;  3KS2 A;  4IE6 A;  4AIU A;  3SO8 A;  3EUH A;  3LFM A;  3AA0 B;  3I9Y A;  3VHL A;  4JVS A;  5L3D B;  4DUY T;  5A6C A;  1E7V A;  4PFP A;  2YU1 A;  3C64 A;  2XQ8 A;  2AE9 A;  5JDL A;  3ABV A;  4ANV A;  2XSB A;  3AE9 A;  4EEC A;  1MYO A;  3NB2 A;  2CG3 A;  2J4B A;  2V6X A;  2R05 A;  1WY6 A;  4GA0 A;  1N34 T;  2UY1 A;  4KVO A;  1W0B A;  3GN5 A;  3N9P A;  4A3V A;  3HKD E;  2LLY A;  3AB3 B;  3CV0 A;  4HRM B;  4LF6 T;  4I6J A;  3BU8 A;  2WDQ A;  2CLY C;  2VQ2 A;  5ADX L;  3CX8 B;  3PDY A;  1HFA A;  2QA7 A;  1ZB1 A;  3SZ7 A;  1MZC A;  1JWF A;  4EHM A;  4FI5 A;  4ANW A;  3TXM A;  3N9Q A;  2BVL A;  2W66 A;  4BJM A;  1U3D A;  5JA4 D;  3EDU A;  1L0V A;  5AIJ A;  1HNZ T;  2VYI A;  2H6G A;  1XNF A;  3QNU A;  3FXD B;  1MMN A;  2RG8 A;  3AEE A;  2CRB A;  3CIR A;  4F1S A;  4TZ4 C;  4GYS A;  1KLX A;  2NXP A;  5LYJ E;  2RFA A;  3L17 A;  2LHR A;  3MGB A;  2JMH A;  2VL8 A;  5HXH A;  5AQJ B;  3FFL A;  1HO8 A;  3ZVV A;  4A55 A;  5CMW A;  2KXP C;  5CEC B;  2WWU A;  4YTN A;  2E9X A;  1OED E;  2YEV C;  4XE0 A;  3N71 A;  5CHE E;  3S7B A;  5DJQ C;  2PNN A;  3RKO A;  3CPZ A;  3TWU A;  5J2U E;  5JDM A;  2C0L A;  2IC6 A;  1I6Z A;  2LM9 A;  4GOU A;  4I55 E;  1KT0 A;  2FBN A;  2KCV A;  1N36 T;  3G2S A;  1UJK A;  3L09 A;  4UI9 C;  3UT4 A;  4A3T A;  2XZE A;  3SHF A;  1FMV A;  4A97 A;  4IDO A;  2YDQ A;  4ATZ D;  3RRC A;  4TV8 E;  4J7W A;  1XDO A;  5D0Q D;  4PJM A;  3D9N A;  4DBR A;  4QHO A;  4EOZ B;  3DSU A;  3QWP A;  4CEM A;  3NBX X;  2L6J A;  3PJA J;  4V1A v;  2VK9 A;  4X65 T;  2KND A;  3AG3 E;  3PU8 A;  3Q78 A;  4K0U A;  1NL4 A;  4TNV A;  4DV4 T;  4H9S E;  3RO3 A;  1TEZ A;  5LXT E;  3CVY A;  4MS6 A;  2ZIS A;  5EDS A;  4G11 A;  3LXU X;  4GZ5 A;  5L3C B;  2A3D A;  1OXZ A;  5DBK A;  2CLY B;  2Y1L E;  4BET A;  3FTW A;  3N2K E;  5L47 A;  2FJD A;  1OCZ E;  2V4H C;  2IAK A;  3TWV A;  2IC9 A;  1N52 A;  1A17 A;  3AAA C;  4H9N C;  2Y3A A;  2J62 A;  3S7F A;  1X5B A;  3ML9 A;  3T8K A;  5L4H A;  3DP7 A;  3MKQ B;  2DL1 A;  2WMN A;  4HNA D;  3P4S A;  4JL0 A;  1O1T A;  4O8S A;  2XQ9 A;  3P4Q A;  2HPL A;  5KNH D;  5L3B B;  3P4P A;  4J6I A;  4C9B B;  3IEE A;  2PL2 A;  4PFO A;  4ZHQ E;  3O4X E;  3MYV A;  3CX6 B;  3B57 A;  2DVW A;  3G2U A;  1LF8 A;  1WCR A;  4FUL A;  2KXP B;  4ZS2 A;  3ZFW A;  1Y64 B;  2BS2 A;  1QNF A;  4B89 A;  3FZF B;  1BPO A;  2AJA A;  4BT8 A;  3J5P A;  2XEV A;  3FTZ A;  3TG5 A;  4GIW A;  2FUL A;  3PUY F;  4GYW A;  3E0Z A;  3C98 A;  2LAH A;  3LPZ A;  4NUR A;  5T4Y A;  3KV9 A;  5AQL B;  3CST A;  5HXE A;  3QB5 K;  1AJ3 A;  5L3G B;  3D9P A;  5DIZ A;  2UXC T;  5FXW A;  2OEW A;  3BG1 B;  4CXX A;  1N54 A;  4H9P C;  3P2B A;  4OYJ A;  5CJ5 A;  4DR4 T;  3G2W A;  2MRI A;  5L3F B;  3O1H A;  3JXJ A;  3M3Z B;  4HKA A;  3F31 A;  4DMW A;  1O1R A;  5A1L A;  1NP7 A;  2CMR A;  2H3R A;  3Q75 A;  2EHO D;  4HS2 A;  4HLE A;  3K9I A;  4LFC T;  4B3R T;  2VGY A;  4GTV A;  5JDQ A;  4UQY A;  1N4Q A;  1T98 A;  2WPV A;  2D0U A;  4IDQ A;  5EX3 A;  2J08 A;  4HFE A;  1BR1 A;  2LSJ A;  2NTY A;  4U2Z A;  2BZB A;  3UU4 A;  4YHH T;  5AQ7 A;  5ITZ F;  2CPT A;  4ANJ A;  4N3A A;  4HWC A;  2WQH A;  2XRZ A;  2WXR A;  1YMP A;  5CRV A;  2A2F X;  3HR0 A;  4F6R D;  1XWM A;  3I3N A;  3ULQ A;  4G2V A;  1ELR A;  3CLJ A;  3MV3 B;  3SQV A;  3AED A;  3AAA B;  1UOH A;  2FJB A;  3VKH A;  4N2Q A;  2JQ9 A;  5J1G A;  4PJL A;  4AKH A;  3VLE A;  4BWR A;  5C1D A;  3FUM A;  2H7V C;  1Z3Y A;  3HG0 D;  3IBE A;  1E8Z A;  2IF4 A;  2AW6 A;  1RZ4 A;  1INZ A;  1SVX A;  5LNK A;  5BMV E;  4AY6 A;  4FC8 A;  4FU3 A;  4HFC A;  3CK7 A;  1HZ4 A;  1G8X A;  2N9D A;  5EYP F;  3UUX A;  4UEL A;  4YLH A;  3CML A;  1N4P A;  4WNE A;  3V2X A;  3C50 A;  4QKN A;  5ENR D;  3UKU G;  2VUR A;  4FAD A;  4QH1 A;  2BS4 A;  2QFC A;  1NA3 A;  4IUL A;  3RH3 A;  3PH0 C;  3MKD A;  1ZU2 A;  3C51 A;  5HEJ A;  2J1D G;  4LML A;  3AE1 A;  5HXR A;  4CGW A;  3CVX A;  4CDN A;  1HXI A;  1Z5S C;  3L54 A;  2EIN E;  2WS3 A;  3LVQ E;  4G8K A;  3GYZ A;  3ZKR A;  5DQW A;  3DTO A;  5ABF B;  3E34 A;  2IML A;  3B5M A;  4HOT A;  2X68 A;  1B89 A;  4PAG A;  3Q5X A;  3CQG B;  2Q9Q A;  4X1Y E;  1OWN A;  3NZQ A;  1KPS B;  4P0A A;  2R17 C;  1OED C;  2LAI A;  4JEH B;  5AQI B;  2RP4 A;  1S63 A;  2PZI A;  3QK0 A;  4XI0 A;  4CZ2 D;  3ZT5 A;  3ASO E;  2WXF A;  2LM2 A;  3UM3 A;  3ZIM A;  5J90 A;  4B93 B;  1TJF A;  2XHE B;  4Z8X A;  4HI8 A;  2VQE T;  4TRQ A;  2JMK A;  3OTO T;  4OYK A;  1K8K G;  4WUY A;  4MFR A;  1KK7 A;  5ARF A;  4DRX E;  4OHF A;  2LHN A;  5FXZ A;  1YKE B;  1JUQ A;  3MV2 B;  5JHB A;  5F8P A;  2W62 A;  1EF1 C;  1T7S A;  4GK0 E;  3PE0 A;  3FDH A;  1D0Y A;  2E8I A;  2A4Z A;  3IEG A;  5JDF A;  2EHO C;  4H63 H;  2VSY A;  3DEO A;  4UVB B;  5LOV E;  2W00 A;  1N4R A;  1EDU A;  3TLU A;  3S7J A;  3ONL C;  4ILC A;  1T72 A;  4JLE A;  4JV5 T;  4LNG A;  4XBF B;  1XNR T;  4BTA A;  1D0Z A;  3V5S A;  4DID B;  5FQ4 A;  5HI7 A;  5LCW J;  3E22 E;  1ZBP A;  5AQP B;  2A5E A;  2PFV A;  1TN7 A;  4LFA T;  3BG0 B;  5ENO D;  2VL0 A;  3ONK A;  3OAW A;  4BTB A;  4I50 E;  3Q15 A;  3UUM A;  1D9S A;  4HQD A;  1G3N B;  3ZC1 A;  3CVP A;  4EB6 E;  3R6N A;  4DLQ A;  2BKO A;  3P4W A;  3FZK B;  4FJO A;  3KSQ A;  2X0L B;  4YJ2 E;  3F57 A;  5AQH B;  4F6R C;  3U64 A;  5D2M C;  1E7P A;  1NEN A;  5AN8 A;  4WYV A;  2WVI A;  3ETU A;  3PEV B;  4DR6 T;  5JQG E;  4HFI A;  4U8Y D;  4HFH A;  1CUN A;  4BES A;  1LKX A;  3SD5 A;  4PS3 A;  5E75 A;  2Z6E A;  3SRZ A;  4G8L A;  2V6Y B;  4L5G A;  2E2A A;  3PUW F;  4U0Z A;  2YN6 A;  2VKH A;  2D0T A;  4B8A A;  4AXH A;  2XAQ B;  1HR0 T;  2V26 A;  2UU9 T;  4Q25 A;  4C0E A;  2RFM A;  4WND A;  2HN2 A;  3I1A A;  3PUV F;  1BR4 A;  5LG4 A;  3FZH B;  1QZ2 A;  3RYF E;  4DND A;  2P9P G;  2WXK A;  2JQQ A;  2ETC A;  2V5F A;  4YDO A;  1A5E A;  1OWM A;  1OED B;  3PVL A;  2GRR B;  4E6H A;  2ZMA A;  5EK4 A;  2YU2 A;  2E5V A;  1IZN B;  3RLF F;  3RO2 A;  2SPC A;  3PUX F;  3SFY A;  4TWD A;  3BQK A;  3A8Y C;  5HXC A;  2WB5 A;  3NVO A;  3DXM G;  4N3B A;  4XZ4 A;  3K3O A;  4OVU A;  3LG7 A;  4J8E A;  3RRN B;  4AIF A;  1OCO E;  4JEU A;  4IDP A;  3LJC A;  3B7T A;  3HKB E;  5JJT A;  4N39 A;  3UX4 A;  2V7K A;  5EYL A;  2VTB A;  4NXN T;  3EJN A;  4EV6 A;  4GZ3 A;  5EKQ D;  3OPC A;  5HWY A;  2N2N A;  2YHE A;  3U9W A;  3ZN0 B;  3PUK A;  3AAI A;  3RX6 A;  4LF5 T;  2V5C A;  4A56 A;  4JHR A;  2EHO B;  3AE5 A;  4NXM T;  1OCR E;  5G2N A;  3R84 B;  3CX7 B;  4OX9 T;  4U31 A;  2BKK B;  1HX8 A;  3KIN B;  4I43 A;  4KZ0 A;  4HOQ A;  3BQO A;  4ILU A;  1SA5 A;  2IU1 A;  4ZXL A;  1JCR A;  1MX2 A;  3FUK A;  1UN9 A;  2LSU A;  3CHR A;  3PZ3 A;  4MRU A;  2B0O E;  4I0U A;  4ZHB A;  3ZYL A;  1G73 A;  4NIQ A;  3N9N A;  3VTY A;  3S7D A;  4HWI B;  4A63 B;  1HNW T;  4ZZB A;  2AVP A;  4AQG A;  5AFU L;  3KV4 A;  2H6I A;  3ONJ A;  5AAR A;  2LXL A;  4AQF A;  5BPP A;  1N32 T;  4TNW A;  4NPP A;  5LJN A;  3FU6 A;  4G25 A;  2VWA A;  4PJN A;  5M4Y A;  2GK9 A;  1O1S A;  3QB2 A;  3ESK A;  4QXH B;  1WFD A;  5BV0 A;  3JCK C;  5ENP D;  5LCY A;  3HXC A;  2CEA A;  4XZC A;  3F6Q A;  2XTL A;  3HVE B;  4I9E A;  1XMQ T;  3UU6 A;  3JC6 D;  3L39 A;  5HAX A;  2X66 A;  3JAD A;  1PAQ A;  4O6F A;  3N9O A;  2VGX B;  2CXL A;  2W0G A;  4HFD A;  2ETB A;  3ABK E;  4KT6 B;  4LMK A;  5HKP A;  3ZEF A;  1MX4 A;  4UVC B;  4JZY A;  2C2L A;  3ZPO A;  4YT0 A;  3IF8 B;  3X1D A;  2XY8 B;  2MOZ A;  4CXW A;  3ULE G;  1FMW A;  2OVB A;  5AQT B;  2L8K A;  4JI0 T;  1XZY A;  2LRL A;  3T1Y T;  1IKN D;  5LJM A;  2WXN A;  4AQY T;  4Q69 A;  3W15 B;  2IOL A;  2GRN B;  1MNE A;  2V7L A;  3TWX A;  2IJG X;  3P7I A;  2NTX A;  5JRC B;  3ASG A;  1KT1 A;  1EYH A;  1YW0 A;  3NRY A;  5KJL A;  2C0M A;  2J8S D;  2DWK A;  1QUU A;  3L22 A;  3RKG A;  3TL5 A;  3NZP A;  3RIA A;  4KHZ F;  1SQM A;  4NQ0 A;  3V30 A;  4UF0 A;  2DWG A;  1YCS B;  3Q7A A;  3KFW X;  4FHK A;  5CED B;  3T9K A;  1SUM B;  2N1G A;  2K24 A;  2NP9 A;  4AKR B;  2E5L T;  2J07 A;  4H9R C;  5LX8 A;  3UTM A;  5KJK A;  3UM2 A;  4LF9 T;  5JR9 C;  3SOL A;  1J1J A;  3P50 A;  2VKD A;  1JNZ A;  2XPK A;  4AP2 A;  1GQE A;  4JXT A;  2R59 A;  3QKY A;  2DLR A;  1DCQ A;  4TUU A;  3LK4 2;  2V4L A;  3H3A A;  5L2L A;  3FB2 A;  4X64 T;  1N95 A;  3AG4 E;  2PBI A;  1HG5 A;  5FTP A;  2PTF A;  5ANR A;  1IYG A;  5HWX A;  4DR5 T;  4DV5 T;  4PK6 A;  1UG3 A;  2V5Q C;  2R02 A;  4N5Q A;  3PEU B;  2CHX A;  5KJM A;  3U3I A;  2PQN A;  3I4G A;  5IY5 E;  2XGM A;  3UU3 A;  5LOZ A;  4HWF A;  5LP6 E;  4UWK A;  1U4Q A;  3AU5 A;  4B8C B;  2YHC A;  5AQM B;  4WNK A;  2QZA A;  3T8M A;  2WDV A;  3CKD A;  1YA0 A;  4U3C A;  3AE7 A;  3NWI A;  2XQA A;  4O4L E;  5JH7 E;  1XNQ T;  2KMF A;  3OTN A;  4J0U A;  4I4T E;  3TWW A;  3MJW A;  3LEW A;  3RSE G;  2KZT A;  1E1H B;  2NOX A;  1QYM A;  4X5T A;  3DEP A;  4YDW A;  4KBQ A;  3ZU7 B;  3Q2M A;  3AA7 B;  1LVF A;  4G2A A;  4GMR A;  2A72 A;  3JUE A;  1JCS A;  4YTP A;  1KZP A;  4MLK A;  3D0T A;  3VKG A;  2ODV A;  3FU5 A;  2FJA A;  2VQF T;  4GMJ A;  3WAJ A;  3JC6 C;  2V1D B;  3JCF A;  2AXV A;  2M67 A;  3SFE A;  3FUE A;  2KM4 A;  3O1I A;  4FP7 A;  3A5X A;  1QSD A;  5FL1 A;  4PNI A;  4ISS A;  1H2U A;  4YDY A;  5C2T A;  1TNY A;  2BED A;  1MJ0 A;  1WR6 A;  1FEW A;  4QWN B;  2X6F A;  3FWV A;  2WU2 A;  4HWD A;  1IJ6 A;  3ANW B;  2WXJ A;  3DPY A;  2YOE A;  3L9T A;  3RK6 A;  1O3X A;  4LF7 T;  3RKV A;  2E0I A;  3FU0 A;  4F3V A;  1UW4 B;  2AXZ A;  4HFG A;  4TWH A;  1VCT A;  1JWG A;  4G24 A;  5JR9 B;  3UPV A;  3ZYK A;  4DJA A;  4YY3 T;  1RW2 A;  2P9L G;  3HXE A;  4DR7 T;  3TLV A;  2R5S A;  1HNX T;  3FP3 A;  2F37 A;  3KEA A;  2LOS A;  1H6O A;  4F1P A;  1I94 T;  4K0R A;  2LSV A;  4GA2 A;  4L9P A;  4AKL A;  3ZYQ A;  2M6I A;  3FUF A;  4QX7 B;  2CXD A;  2CFZ A;  4MLP A;  1NA0 A;  4O4I E;  2MYS A;  3CIA A;  1IBM T;  5AEN A;  3U66 A;  3EIJ A;  4IST A;  2H89 A;  5AQR B;  4UV9 B;  3P1U A;  5JMN D;  2X6I A;  2A9U A;  5LGT B;  4KBM B;  3UQ4 A;  3RHW A;  2KBX A;  4AEZ C;  1HG2 A;  4IL4 A;  3PDN A;  2NW9 A;  2UY1 B;  1M62 A;  3GN5 B;  1DVP A;  3UI2 A;  2CE7 A;  3DXK G;  3UQ3 A;  3TLW A;  4L2Y A;  4RLY A;  1HE8 A;  3AG2 E;  4R7L A;  5JJ7 A;  4JD2 G;  3TXN A;  1ELW A;  1JPL A;  3EIQ C;  2X51 A;  3FUI A;  3PRZ A;  4GTO A;  5T3R A;  2CHN A;  3C4X A;  3E4B A;  4NAC A;  3KSL A;  3ZMS B;  3AEA A;  5HCM A;  4M7C A;  4AY5 A;  2ES0 A;  4J8F A;  2JQK A;  4IGU A;  3FUD A;  3UT8 A;  2BG9 C;  2YQ8 A;  3MCX A;  2P9I G;  3TJP A;  2CHO A;  2LO6 A;  1XMO T;  2KSR A;  3I9W A;  3SS1 A;  2OEV A;  1HTJ F;  2QYJ A;  5G05 J;  3UT7 A;  1BU9 A;  4C48 B;  4JC8 A;  5KWD A;  2XPY A;  1ZP0 A;  1E90 A;  3UM0 A;  1EZ3 A;  2NW7 A;  5FMN A;  4AKG A;  5JVD E;  4FJZ A;  3L6A A;  4UWL A;  5EN5 D;  3J7Y q;  4XKB A;  3EAB A;  2V7J A;  1IQR A;  1EPU A;  4ABN A;  3OYZ A;  5IWA T;  1VOM A;  4ZFH A;  4X1I E;  3PU3 A;  1TN8 A;  2MOW A;  5FXX A;  2MBG A;  5FY7 A;  3QC1 A;  5CRU A;  3DPD A;  1D8E A;  2X67 A;  1VDY A;  3LJ3 A;  5CFB A;  4JA7 A;  3UIO C;  4AXP A;  1HF8 A;  5CA1 E;  1FVH A;  5EK2 A;  2C5J A;  3Q5M A;  1HU3 A;  3E37 A;  3ZHE B;  2CBJ A;  1X81 A;  5KJN A;  2ZGG A;  1PY1 A;  1OWA A;  3P8C D;  3PZ1 A;  3PUJ A;  5E0O A;  2VKJ A;  2LKG A;  3TAX A;  2P9U G;  1YQ3 A;  2LKH A;  2KAT A;  1MQS A;  5B3S E;  2KCK A;  3R9M A;  4ME2 A;  2GRP B;  4ADZ A;  2FI7 A;  2XEN A;  4YVQ C;  2JQH A;  2XAG B;  2XEE A;  4JI8 T;  4UUC A;  4UEM A;  3QOU A;  3PZ2 A;  4EIW A;  1BI8 B;  4N3C A;  3AE2 A;  4QH5 A;  2WM9 A;  3NAW A;  4OFZ A;  4P09 A;  4C0M A;  3TGO A;  1YXR A;  3LK2 B;  1FVF A;  3Q47 B;  2X6K A;  4UWF A;  1NEK A;  3MAC A;  4GTT A;  5E76 A;  3HRA A;  4CXY A;  4U7E B;  3VU7 H;  4K0K T;  3FBZ A;  1LD8 A;  3D9L A;  3RPU A;  4LER A;  3VRA A;  2Y8D A;  4YHJ A;  1U3C A;  1AP7 A;  4J8S A;  2IIU A;  3G2V A;  2OCC E;  4CT4 A;  2BG9 B;  1IQU A;  3AAE B;  3ASH A;  3CK6 A;  2Q7F A;  3RIU A;  5BR8 T;  3Q4A B;  1E7U A;  4APF A;  1D1B A;  1WG0 A;  4NUV A;  2WP9 A;  5CCM A;  4UQX A;  1N33 T;  3LBX A;  2R6G F;  5ABE A;  3AJI A;  2YDS A;  5G04 J;  2KIN B;  3J9X 1;  3QC9 A;  3PRE A;  2V8S E;  4GTQ A;  2GRO B;  3APC A;  4J8Y A;  3CHQ A;  3APF A;  3C98 B;  4HLL A;  2NYJ A;  3QUJ A;  3GW4 A;  2X9Y A;  2Y0B G;  1S64 A;  2P9B A;  1M7K A;  2WMO A;  5ETW A;  3GZ1 A;  4X1K E;  3K3N A;  4GML A;  4GKJ T;  1N0R A;  2V0P A;  3MK7 C;  4PUC A;  3TWT A;  5FQ6 A;  4J2C A;  2WZI A;  3RU0 A;  2ODU A;  1KNZ A;  5D0O D;  3LS8 A;  1N4S A;  2KZ7 B;  1D1A A;  1X79 A;  3K1S A;  3IHR A;  5JDH A;  2UXD T;  5CGM A;  3N2O A;  4EZ4 A;  2YK0 A;  5GON E;  3IHV A;  4BSZ B;  5EK3 A;  4U8H A;  3WG7 E;  1UCU A;  3GZS A;  2H6H A;  3AEF A;  4YSY A;  1T8B A;  3HKC E;  2DZN A;  3CVN A;  2J9Q A;  3DSW A;  3CHS A;  5L4E A;  5JTG A;  4H7Y A;  2ILR A;  3UQ7 A;  5AAO A;  5FY0 A;  4ILG A;  3I0O A;  4KMO A;  3I4R B;  5EX0 A;  3SGH A;  3MJX A;  5LBM A;  3PNL B;  4WW0 A;  2JEK A;  3L82 A;  2BVM A;  3ABL E;  5FZR A;  4EZJ A;  3ZJ1 A;  3AEG A;  1WAO 1;  3W9G A;  2C0S A;  4YSX A;  2VJ8 A;  3ZCI A;  4DX2 A;  1Y01 A;  4GZD A;  2IW5 B;  4DUI A;  4I1O B;  4IT4 A;  2E2E A;  2IO2 C;  3SFZ A;  4Q94 A;  3SI5 A;  2XM1 A;  4TX5 A;  2NC9 A;  4TXP A;  3ZMU B;  3C72 A;  5FYM A;  2UXX B;  2NWB A;  2GRL A;  3PNT B;  1WDY A;  2LT3 A;  2VKO A;  2WDR A;  2UUC T;  4DMV A;  4JI4 T;  1V55 E;  5AQA A;  4HTE A;  4YXD A;  3FUJ A;  5HS0 A;  4BX8 A;  2CHZ A;  1OY3 D;  2ACZ A;  3CVQ A;  3UIP C;  2QGS A;  3UUX B;  4AVX A;  5KBA A;  3S4U A;  4O60 A;  1VCS A;  4A98 A;  3T5X A;  4Q96 A;  3UUB A;  3KV5 A;  2L9B A;  3T8O A;  4CN4 A;  4DX1 A;  2BBJ A;  2MTQ A;  3MA9 A;  3WAK A;  2X6H A;  3TLT A;  5CBO A;  2ZXW E;  1Y6I A;  4IRU A;  2CXF A;  2WQ6 A;  3FEY A;  5ABH A;  3EHR A;  3CVL A;  2WZH A;  2WAU A;  1IHB A;  3ONL A;  5AQO B;  1BR0 A;  2H6F A;  4ZI2 D;  4G26 A;  5FZS A;  2K5B B;  5CMY A;  4DVD A;  1DC2 A;  3JYS A;  2L9Q A;  2FJE A;  4HFV A;  2BBH A;  3TWR A;  5HYA A;  1AWC B;  3VLF A;  1IJ5 A;  3B95 A;  2X0Y A;  4IIJ E;  1B7T A;  4IE0 A;  3HI2 A;  3B7S A;  3EU5 A;  1FPP A;  4GAA A;  1ZV4 X;  4B3M T;  5H7P A;  1MMD A;  2Q9Q B;  2WXL A;  2BF0 X;  4DX6 D;  3SNX A;  4WWP A;  5AQQ B;  3JAE A;  3B7U X;  3WI3 A;  4F8H A;  4COF A;  5LGU B;  1WYB A;  4WZX A;  3R7R A;  2QYW A;  3FXE B;  5AQU B;  2NW8 A;  4K03 A;  2IHR 1;  2LRK A;  1TNZ A;  1US7 B;  3AXJ A;  1YKH B;  3UU8 A;  5J2T E;  3LY8 A;  3AE8 A;  4CI3 B;  4PJJ A;  4BA9 A;  4U0U A;  5G55 A;  4KX6 A;  5LHG B;  2X9W A;  2Y6X A;  2ZLY A;  2BKP A;  4N5C A;  2YKS A;  2ETA A;  3HVE A;  3RYI E;  3SY2 A;  2RA1 A;  3VR9 A;  2QC9 A;  2KLQ A;  4EXT A;  4L7T A;  5JRE A;  4E7Z A;  3QAQ A;  2WU5 A;  3HXB A;  3Q73 A;  1UN8 A;  3UUL A;  1DNP A;  4ZI3 D;  3HDX A;  5LP0 A;  2YNQ A;  4K5A B;  1WRD A;  3ZN1 B;  3T1H T;  4UI9 J;  3RIB A;  1D8D A;  4JI2 T;  1BD8 A;  1Z6T A;  3LY9 A;  4WAF A;  3RIF A;  2VGE A;  3ZMT B;  4GPM A;  3O1J A;  3QNK A;  4O2A E;  1OWP A;  3ZXP A;  5HEG A;  5KDM C;  2WSS V;  5M72 A;  1IXV A;  5AQS B;  5ENN A;  2M6B A;  3H3M A;  3KVB A;  4ILH B;  1S35 A;  2WBL A;  1W0A A;  3DSS A;  2IEJ A;  2VVS A;  4AI6 A;  2LUH A;  4HXI A;  1IBK T;  3LJN A;  4GTP A;  4IE5 A;  4RG6 A;  2Y4U A;  3ZKJ A;  1HH8 A;  1SZA A;  2BS3 A;  3MKR A;  3LDQ B;  3O4Z A;  3PUG A;  4AQF C;  3C3Q A;  5FQ8 A;  3LYA A;  3AG1 E;  3OYX A;  3OXF A;  2PM6 A;  3UMV A;  3PV0 F;  4GTM A;  1Y8M A;  2LSG A;  3SFD A;  4CI1 B;  2L0T B;  3EVY A;  4DV1 T;  4D10 C;  3E08 A;  3QOF A;  3UT5 E;  1MIV A;  5HRY A;  3B7R L;  4HGA A;  2J4G A;  2YDR A;  3AE4 A;  2FO7 A;  3RYH E;  3Q5E A;  3ZST A;  1SHZ C;  5ENQ D;  3KEZ A;  1U2V G;  5BXU A;  4EYY R;  5KX5 E;  4I2Z A;  3KV6 A;  3LK3 B;  3NQP A;  1WR0 A;  4HI9 A;  4OVV A;  3M65 A;  2IUB A;  2XUE A;  4GYO A;  3SFX A;  2XZT G;  3FBL A;  5AQN B;  3CKC A;  1XDP A;  3DRA A;  4DI4 A;  2WWV A;  2JAB A;  4CYM D;  1NAF A;  4ILB A;  3UIN C;  3FHE A;  2CCQ A;  4ZI2 C;  4W9R A;  4EPZ A;  2FO1 E;  3IBP A;  1TNU A;  1Z3X A;  2ZIR A;  4GA1 A;  5LFA A;  4JEU B;  2PG8 A;  4DX7 D;  4IN3 B;  5EIB E;  3ZGQ A;  1QBQ A;  3ZW3 A;  1LVK A;  4UWH A;  2W63 A;  4BFR A;  1UUR A;  2E9X D;  2QRX A;  2Y69 E;  5LG3 A;  3S2A A;  3UUN A;  2D9D A;  4IL9 A;  2VTB B;  4FA6 A;  1U5P A;  2RD0 A;  4JI1 T;  4L0R A;  1H0A A;  3UFG A;  1O5M A;  5FL0 A;  4KXK B;  3CVW A;  3L8R A;  3JXI A;  3GA8 A;  3RQW A;  4N78 D;  3RF1 A;  3RRU A;  3ZCJ A;  2UUB T;  4KP3 C;  4YSZ A;  2IDO B;  2F0Y A;  3CSF A;  4Z90 A;  1Z8U A;  2JLB A;  3CWZ B;  4UVA B;  4U33 A;  2PQR A;  3BK9 A;  4EED A;  3ZXS A;  4I43 B;  3TWQ A;  3CVV A;  3LVR E;  3CEQ A;  3D9I A;  5IHY A;  3RC3 A;  2I0M A;  2UXN B;  1IBL T;  2YIN A;  3ZT7 A;  1YQ4 A;  4QH4 A;  4MKT A;  3AVS A;  4DK5 A;  4H63 V;  2W2U A;  2HM8 A;  4AV7 A;  4XX5 A;  2RPA A;  1K3Z D;  4B3T T;  4M3O A;  3FH8 A;  3G2T A;  4O1O A;  5KNG A;  4DR3 T;  5HEH A;  4LSZ E;  3PUQ A;  4GZC A;  2XS8 A;  4YND A;  5LB7 B;  4TUM A;  3ZPJ A;  4ZI3 C;  3G06 A;  3IA3 A;  4PK5 A;  4WBO A;  2V7M A;  2WXQ A;  2LSK A;  3FU3 A;  3ANW A;  4OAV B;  2ZM6 T;  2EIL E;  3FTV A;  1SW6 A;  4ANU A;  3E30 A;  4A1G A;  3CQX C;  4WWN A;  1H6P A;  3I0Q A;  4JI5 T;  2XAH B;  3FUN A;  4U04 A;  5ENT D;  1E8Y A;  1J5E T;  5C2Y A;  2JPF A;  3O48 A;  2C5I T;  5EZY E;  3JAF A;  3FTX A;  1KNP A;  1BR2 A;  3CVR A;  2X3M A;  2BKN A;  1K1A A;  4U7Y A;  3ZEF B;  3AVR A;  1HCI A;  3QAR A;  3AA1 B;  1NFI E;  2XGO A;  5LA6 E;  2UWJ G;  2LOP A;  3QDN A;  4X62 T;  3BUA A;  3ZSS A;  5BT1 A;  3PZD A;  2P9K G;  1V9D A;  3QWV A;  3P4R A;  3R9A B;  2IY0 C;  2B76 A;  2CBI A;  5JDG A;  4JYA T;  4AKI A;  3FUH A;  5LCW C;  3FTY A;  3TKL B;  4YFS A;  1KF6 A;  4GYR A;  3D9O A;  5HQ8 A;  2GGF A;  3VLD A;  4JUY A;  4I17 A;  4CN6 A;  4V3I A;  3C4W A;  4FLH A;  2D2S A;  3L3P A;  3RGL A;  4ZI7 E;  3GZ2 A;  5FVK A;  4IRE A;  2ZM8 A;  1IHG A;  4UF0 B;  1SA4 A;  3GWH A;  4XKC A;  1UJJ A;  1QLB A;  3JUI A;  5BUZ A;  3UXG A;  4HEA A;  3KDS E;  4B0Z A;  3DSX A;  2L3L A;  4L9I A;  2D5U A;  2FEZ A;  2E9X C;  4G23 A;  1OWO A;  2WXH A;  1WYC A;  3OXG A;  2HH7 A;  2VB6 A;  1ZKE A;  3EHZ A;  1OWL A;  3Q5D A;  4TV9 E;  2QY7 A;  3NZS A;  4JHJ A;  4I2W A;  2A5U A;  3ZRH A;  2CA5 A;  2QVA A;  1FJG T;  3MKQ A;  4PK4 A;  5AQ9 A;  3DJB A;  2HR2 A;  4E85 A;  1E8W A;  4CN1 A;  4JB8 P;  4XEI G;  3OBV E;  1HS6 A;  2LXM A;  3MEK A;  4JI7 T;  1SA0 E;  1P5Q A;  4CI2 B;  4KZC A;  3UTK A;  5HXS A;  1Q2Z A;  3BEE A;  4DV3 T;  4CCA A;  3AE3 A;  4QXB B;  3R7Q A;  2CG2 A;  2GW1 A;  4TN7 B;  4IDN A;  2OVF A;  3W9F A;  4GKK T;  5CEA A;  4U95 D;  2OOE A;  4EGW A;  3C3O A;  1S94 A;  2OV9 A;  4WNG A;  3VTX A;  3ZHE A;  5J08 A;  3ULY A;  1N9A A;  3J5Q B;  3L16 A;  3Q49 B;  4N2S A;  2KZT B;  3EUV A;  3PUZ F;  4XAX B;  3RI5 A;  2WB2 A;  1H2V C;  1NI1 A;  3NBN B;  3FUL A;  4JA9 A;  1H6K A;  2WXI A;  3IXE A;  5A23 A;  2XEH A;  5KCM A;  3K8P C;  2PM7 A;  4RQI A;  2RKK A;  2DYR E;  2V8S V;  2AWI A;  2P58 C;  5AQV B;  1MIW A;  1HS7 A;  1X9B A;  5JJ6 A;  3ZC0 A;  4LMJ A;  4IHJ E;  1S0P A;  3SWH A;  3ABM E;  4O1P A;  5AQB A;  1UUS A;  3V31 A;  2PJQ A;  4AJW A;  4U72 A;  3NOC D;  4RG9 A;  3CVU A;  4AIS A;  1W9R A;  4U2Y A;  2XRY A;  3Q7F A;  4GPK A;  5CBN A;  3RC8 A;  3Q9U C;  2K9A A;  1JNR A;  3FHN A;  4H9Q C;  2JRK A;  2GRM A;  3DSV A;  4NRH B;  2Q9Q D;  5BW8 C;  3D9M A;  1YYH A;  2E9X B;  5CCL A;  3CR3 A;  5FNV E;  2F8Y A;  2MHK A;  4A5X A;  2BG9 A;  3EU9 A;  1J5W A;  3A7M A;  2XPZ A;  1W09 A;  4GYY A;  4LNB A;  4BEP A;  3FZL B;  2ZM0 A;  1MMG A;  2WY2 A;  1TYQ G;  4IE4 A;  5HEU A;  5ARG A;  3OJA A;  4DR2 T;  3KD7 A;  2IFU A;  4ANX A;  4WNF A;  2X38 A;  3ZT6 A;  4U0S A;  5ABG A;  2CM0 A;  4DO0 A;  1H19 A;  3HXF A;  5AYW D;  2P9S G;  5B1A E;  3RRM B;  4DV2 T;  2KCL A;  2HO1 A;  5CB4 E;  3UU5 A;  1KFY A;  1ELK A;  4I6E A;  4UXN B;  2WXO A;  3L13 A;  4YJ3 E;  3UKR G;  4UV8 B;  3ETV A;  2FBW A;  3EAM A;  2WXG A;  3AA6 B;  2WQY A;  3V5U A;  1TJC A;  3RJV A;  2MPK A;  4LFB T;  3D3M A;  4QFV A;  4EZL A;  3H37 A;  1H2T C;  4ZOL E;  3MZK B;  5LHI B;  4IE7 A;  2I6H A;  3PUS A;  4DLO A;  3FTS A;  4YDE A;  3PUA A;  2UXB T;  3APD A;  2I9C A;  5LGN B;  5ABF A;  2FUP A;  3MXZ A;  2QYU A;  4CDM A;  3AS8 A;  2B1E A;  5AQG B;  4ASK A;  2J47 A;  5LHH B;  2NSZ A;  3MX3 A;  3VR8 A;  4X66 T;  2EIK E;  2WCA A;  2AXU A;  3FH5 A;  4JEH A;  3RIU C;  4U63 A;  4B94 A;  1TR4 A;  4GK5 E;  4CQI A;  2L6B A;  4Y6W A;  2KWH A;  3O9X A;  2MYO A;  2XHE A;  4DI3 A;  4H7X A;  2F8X K;  3AEB A;  3QK6 A;  3FEX A;  3Q9N C;  4FLB A;  2P2C P;  3FZM B;  4CGV A;  2LJL A;  3EHQ A;  4E7S A;  2J49 A;  4PS8 A;  3EHM A;  4IYP A;  4DX5 D;  4CDR A;  2CWY A;  5HEO A;  1LRZ A;  5KXJ A;  1LD7 A;  4BT9 A;  5JHA A;  5FP3 A;  1E2A A;  2NR4 A;  4EBA G;  4GCO A;  1W3B A;  4XIF A;  4U74 A;  3C3R A;  1KEY A;  3SBT B;  4MHC A;  3KAE A;  2FF4 A;  4GU5 A;  5L3E B;  4HOR A;  4UQZ A;  1UGO A;  2HN1 A;  3FY4 A;  1JCQ A;  1ZOY A;  1V54 E;  3D9H A;  2L0I A;  2XAS B;  2BUG A;  4TWF A;  4EBA A;  4RVB A;  5LMN T;  4KMC A;  1MX6 A;  1WLX A;  4O4J E;  3FTU A;  5H6R B;  2Q9Q C;  4DV7 T;  4KYO B;  1OXJ A;  2XQ4 A;  4QXC B;  2UUA T;  3E32 A;  3EI0 A;  2DNX A;  5FVL A;  2WXP A;  2R2L A;  3TLS A;  2I2O A;  4L2L A;  4EYU A;  3HHM A;  5BXO A;  3ZUV B;  2XQY A;  2LNI A;  1UK5 A;  4Z68 A;  4RSY A;  3KBT A;  1R8I A;  3UM1 A;  4U8V D;  2V6Y A;  4OYS A;  3URZ A;  4QX8 B;  3VRB A;  4LF8 T;  2IQC A;  3MZL B;  4JHK A;  4G1T A;  5F3J A;  1PC2 A;  3IKO B;  1MHQ A;  4DV0 T;  4NIK A;  4FJY A;  3U3W A;  3AE6 A;  5ANL A;  4EZK A;  4UWG A;  5CA0 E;  1SE7 A;  1UX4 A;  4QQI A;  5FIN A;  2EIJ E;  2ION A;  3ZJ2 A;  3Q79 A;  3CHO A;  4DUZ T;  4PW8 A;  2BKG A;  3ASD A;  4B6X A;  4XI9 A;  1OED A;  1SZ9 A;  2CWO A;  2CHW A;  3PZ4 A;  4IDZ A;  4L23 A;  3U4T A;  1S70 B;  4PS7 A;  4WBN E;  4GTR A;  2DBA A;  4I1A A;  1L5J A;  4A1S A;  1DU2 A;  3BQL A;  1KZO A;  2XGS A;  3IHY A;  2X9H A;  4K5C A;  4PH4 B;  3LY7 A;  3PUR A;  3LBX B;  2MAW A;  1BI7 B;  4YVO A;  2BTD A;  4JI6 T;  3LKU A;  5EIL A;  3K3Q C;  2IO3 C;  3V2O A;  3CGH A;  2KWI B;  1YD8 G;  2X9X A;  2P9N G;  4ZZC A;  3PTR B;  5D66 A;  5KMG P;  3ML8 A;  2LEH A;  2VSN A;  2XAF B;  4DR1 T;  4HE8 A;  2EHO A;  1XGW A;  3HYM B;  2EQX A;  2DCF A;  5LMU T;  1FT2 A;  3AS4 A;  3HA4 A;  4ERR A;  4J8D A;  3SF4 A;  3F2E A;  4LUN U;  4X20 E;  4DPR A;  1TNB A;  2H7O A;  1N11 A;  4MAL A;  3PE3 A;  1H7C A;  3OXL A;  2V5D A;  1TN6 A;  4P0B A;  5BV1 A;  4P1N A;  2W61 A;  2KT9 A;  3QJZ A;  1IAP A;  2J4D A;  3CHP A;  1MIY A;  2VVN A;  4C91 A;  4O2B E;  5H6Q B;  3ZMV B;  5AJD A;  4LNU D;  3PJA A;  3DWL G;  1N94 A;  4HBD A;  4M1P A;  5FXV A;  4ZEY A;  1BLX B;  5G05 C;  1E96 B;  1NZN A;  4AOF A;  3FH7 A;  4CT0 A;  4LF4 T;  3L08 A;  2HPJ A;  1QQE A;  2JJ9 A;  4EAH A;  3NOG D;  5DQV A;  4L1B A;  2Y4T A;  2X0H A;  2XCC A;  3ENE A;  4APO A;  2XSA A;  2HE0 A;  4URK A;  2XQ3 A;  3KVA A;  3C4Z A;  4OAU C;  3U78 A;  3TG4 A;  3TWS A;  2I1J A;  3HXD A;  4G63 A;  2LSY A;  2G0U A;  5IYZ E;  3N9M A;  4I1M A;  3JQ1 A;  2BDE A;  4LCT A;  4HFB A;  4U07 A;  5B1B E;  4K5B A;  2VGX A;  2Y48 B;  3NZU A;  4ACK A;  2DHR A;  2ZGD A;  5AQF B;  4MBG A;  3N2G E;  2V7I A;  3D9K A;  3X2Q E;  3AU4 A;  4BY6 A;  5CER B;  3AEC A;  4HRL A;  3JQ0 A;  4GZ6 A;  3NRX A;  5FWQ A;  3KBU A;  4TUY E;  2DZO A;  4NUU A;  1FT1 A;  4F7A A;  5FIO A;  4UI9 K;  1WM5 A;  4BSX A;  4H9O C;  4JI3 T;  3ASF A;  2ACX A;  4EEB A;  2X6J A;  2XQ5 A;  3N9L A;  3OKQ A;  3I5P A;  3RAU A;  5JRC A;  2DIW A;  3CK9 A;  3ZMZ B;  4B3S T;  2XQ0 A;  2C5K T;  3OVU A;  2I1K A;  4BX9 A;  3QB5 A;  4ZS3 A;  5AQK B;  2K48 A;  1OUV A;  4MBQ A;  4BAY B;  4HB5 A;  2AXD S;  3UFE A;  3BQI A;  3PE4 A;  4EQF A;  4CRW A;  4UIG A;  4CZZ B;  5C8Y E;  1UX5 A;  3ISM C;  2HYZ A;  5F5W A;  5AJL A;  3DBS A;  3HKE E;  4YTM A;  2DYS E;  3GMI A;  4JPS A;  5FJY A;  4Z91 A;  1OCC E;  1CHU A;  5HCJ A;  3RQU A;  4TXQ A;  2VAS A;  3LSV A;  2DCP A;  4DV6 T;  3AXJ B;  3DST A;  2DI4 A;  3QWW A;  2OND A;  3HL6 A;  4TXR A;  3ZNG A;  2XQ7 A;  3N5L A;  2M63 A;  5FQ7 A;  1HX1 B;  1ZHC A;  3ZLI A;  3ZN3 A;  2XAJ B;  3PS6 A;  3C5R A;  1N0Q A;  2R03 A;  3CQC B;  5FT9 A;  2H88 A;  1FIO A;  2HHH T;  4EZH A;  2BG9 E;  1NWM X;  1MMA A;  4P29 A;  5FY1 A;  2WXM A;  4JW1 A;  4KUM B;  5FKY A;  1OT8 A;  3HIZ A;  5G04 C;  5BNW A;  4I9C A;  3B7B A;  4JBW F;  4Y6C A;  3LCA A;  3ASN E;  4TV3 A;  4GB9 A;  3CKB A;  1MND A;  2ZM2 A;  3ZYM A;  2KC7 A;  2IOS A;  5A7D B;  4ATG A;  2F4V T;  3WXX A;  2K3W A;  4WWO A;  5C3J A;  2EIM E;  5T8I A;  4HRN A;  4BJN A;  3V79 K;  2JIW A;  4HWH A;  2XS1 A;  3AS5 A;  5FZQ A;  2XZD G;  3IV0 A;  4UR9 A;  2XPI A;  2XCB A;  3D9J A;  1DCE A;  4U7I A;  4ILI A; 
#chains in the Genus database with same CATH homology
 1Z0P A;  2LE8 A;  4FHJ A;  2ZU6 B;  2OV8 A;  4HVB A;  3CK8 A;  2J09 A;  3Q5W A;  4LEU A;  1ZEE A;  1D0X A;  3EHN A;  5JDN A;  4HN9 A;  4OK0 A;  3LDZ A;  3B13 A;  2I59 A;  2OA5 A;  3MA5 A;  2CFU A;  2WQ7 A;  3T5V A;  2LSI A;  4DBQ A;  3NF1 A;  4AM9 A;  4C90 A;  3ONX A;  3ESL A;  4PDX A;  1GW6 A;  3RRW A;  3RYC E;  5DAB A;  2VSO E;  5JR9 A;  5LBQ B;  4ACL A;  1FCH A;  3EDT B;  3Q9D A;  3EDV A;  5TAO A;  4KVM A;  4HOS A;  4F53 A;  1E8X A;  2VSX E;  3SBS A;  4I6G A;  3CHM A;  4GCN A;  4HOU A;  4LRZ A;  1VRB A;  4O4H E;  1D1C A;  3KS2 A;  4IE6 A;  3EUH A;  3LFM A;  3AA0 B;  3I9Y A;  3VHL A;  4JVS A;  5L3D B;  5A6C A;  1E7V A;  4PFP A;  2YU1 A;  3C64 A;  5JDL A;  4ANV A;  4EEC A;  2CG3 A;  2J4B A;  1WY6 A;  4GA0 A;  4KVO A;  2UY1 A;  3GN5 A;  3N9P A;  4A3V A;  3HKD E;  3AB3 B;  3CV0 A;  4I6J A;  2CLY C;  2VQ2 A;  5ADX L;  3CX8 B;  3PDY A;  1HFA A;  2QA7 A;  3SZ7 A;  1JWF A;  4FI5 A;  4ANW A;  3TXM A;  3N9Q A;  2BVL A;  4BJM A;  1U3D A;  3EDU A;  5AIJ A;  2VYI A;  1XNF A;  3FXD B;  1MMN A;  2RG8 A;  4F1S A;  4TZ4 C;  4GYS A;  1KLX A;  2NXP A;  5LYJ E;  3L17 A;  2LHR A;  3MGB A;  2JMH A;  2VL8 A;  5HXH A;  3ZVV A;  3FFL A;  1HO8 A;  4A55 A;  5CMW A;  2WWU A;  2E9X A;  4XE0 A;  2YEV C;  3N71 A;  5CHE E;  3S7B A;  5DJQ C;  3RKO A;  3CPZ A;  5J2U E;  5JDM A;  2C0L A;  2IC6 A;  2LM9 A;  4GOU A;  4I55 E;  1KT0 A;  2FBN A;  2KCV A;  3G2S A;  1UJK A;  3L09 A;  4UI9 C;  3UT4 A;  4A3T A;  3SHF A;  1FMV A;  3RRC A;  4TV8 E;  5D0Q D;  4PJM A;  3D9N A;  4DBR A;  4QHO A;  4EOZ B;  3QWP A;  4CEM A;  3NBX X;  2L6J A;  4V1A v;  2VK9 A;  2KND A;  3PU8 A;  4K0U A;  4H9S E;  3RO3 A;  1TEZ A;  5LXT E;  3CVY A;  4MS6 A;  5EDS A;  4G11 A;  3LXU X;  4GZ5 A;  5L3C B;  2A3D A;  1OXZ A;  5DBK A;  2CLY B;  3FTW A;  3N2K E;  2IAK A;  2IC9 A;  1N52 A;  1A17 A;  4H9N C;  2Y3A A;  3S7F A;  1X5B A;  3ML9 A;  3DP7 A;  3MKQ B;  2WMN A;  4JL0 A;  4O8S A;  2HPL A;  5L3B B;  4J6I A;  4C9B B;  3IEE A;  2PL2 A;  4PFO A;  4ZHQ E;  3O4X E;  3MYV A;  3CX6 B;  3B57 A;  3G2U A;  1LF8 A;  4FUL A;  2KXP B;  4ZS2 A;  3ZFW A;  1Y64 B;  1QNF A;  4B89 A;  1BPO A;  4BT8 A;  2XEV A;  3FTZ A;  3TG5 A;  4GIW A;  2FUL A;  4GYW A;  3E0Z A;  3C98 A;  2LAH A;  3LPZ A;  4NUR A;  5T4Y A;  3KV9 A;  3CST A;  5HXE A;  1AJ3 A;  5L3G B;  3D9P A;  5DIZ A;  5FXW A;  3BG1 B;  4CXX A;  1N54 A;  4H9P C;  3P2B A;  4OYJ A;  3G2W A;  2MRI A;  3O1H A;  5L3F B;  4HKA A;  3F31 A;  4DMW A;  5A1L A;  1NP7 A;  2CMR A;  2H3R A;  2EHO D;  4HS2 A;  4HLE A;  3K9I A;  2VGY A;  5JDQ A;  4UQY A;  2WPV A;  1T98 A;  2D0U A;  5EX3 A;  2J08 A;  1BR1 A;  2LSJ A;  2NTY A;  2BZB A;  4ANJ A;  4N3A A;  2WQH A;  2XRZ A;  2WXR A;  2A2F X;  3HR0 A;  3I3N A;  3ULQ A;  4G2V A;  1ELR A;  3CLJ A;  3MV3 B;  3AAA B;  4N2Q A;  3VKH A;  4BWR A;  5J1G A;  4PJL A;  4AKH A;  3VLE A;  5C1D A;  3FUM A;  2H7V C;  1Z3Y A;  3IBE A;  1E8Z A;  2IF4 A;  2AW6 A;  1INZ A;  5LNK A;  5BMV E;  4AY6 A;  4FC8 A;  4FU3 A;  3CK7 A;  1HZ4 A;  1G8X A;  2N9D A;  3UUX A;  4UEL A;  4YLH A;  3CML A;  4WNE A;  3C50 A;  4QKN A;  4FAD A;  2QFC A;  1NA3 A;  4IUL A;  3RH3 A;  3PH0 C;  3MKD A;  1ZU2 A;  3C51 A;  2J1D G;  5HXR A;  4CGW A;  3CVX A;  4CDN A;  1HXI A;  3L54 A;  3LVQ E;  3GYZ A;  5DQW A;  3DTO A;  4HOT A;  2X68 A;  1B89 A;  4PAG A;  3Q5X A;  3CQG B;  2Q9Q A;  4X1Y E;  1OWN A;  3NZQ A;  4P0A A;  2R17 C;  2LAI A;  4JEH B;  3QK0 A;  2RP4 A;  2PZI A;  4XI0 A;  2WXF A;  3ZIM A;  5J90 A;  1TJF A;  2XHE B;  4Z8X A;  4TRQ A;  2JMK A;  4OYK A;  4WUY A;  4MFR A;  1KK7 A;  5ARF A;  4OHF A;  2LHN A;  5FXZ A;  1YKE B;  1JUQ A;  3MV2 B;  5JHB A;  5F8P A;  2W62 A;  1EF1 C;  4GK0 E;  3PE0 A;  3FDH A;  1D0Y A;  2E8I A;  2A4Z A;  3IEG A;  5JDF A;  2EHO C;  4H63 H;  2VSY A;  4UVB B;  5LOV E;  2W00 A;  3S7J A;  1EDU A;  4JLE A;  4XBF B;  4BTA A;  1D0Z A;  3V5S A;  5FQ4 A;  5HI7 A;  5LCW J;  3E22 E;  1ZBP A;  2PFV A;  3BG0 B;  3ONK A;  3OAW A;  4BTB A;  4I50 E;  3Q15 A;  3UUM A;  3ZC1 A;  3CVP A;  4EB6 E;  3R6N A;  4DLQ A;  4FJO A;  2X0L B;  4YJ2 E;  3F57 A;  4F6R C;  3U64 A;  2WVI A;  3ETU A;  3PEV B;  5JQG E;  1CUN A;  1LKX A;  3SD5 A;  4PS3 A;  5E75 A;  2Z6E A;  3SRZ A;  4L5G A;  4U0Z A;  2VKH A;  2D0T A;  4B8A A;  4AXH A;  2XAQ B;  2V26 A;  4C0E A;  4WND A;  3I1A A;  1BR4 A;  5LG4 A;  1QZ2 A;  3RYF E;  4DND A;  2WXK A;  2JQQ A;  2V5F A;  1OWM A;  3PVL A;  4E6H A;  2ZMA A;  5EK4 A;  2YU2 A;  1IZN B;  3RO2 A;  2SPC A;  5HXC A;  3BQK A;  4N3B A;  4XZ4 A;  3K3O A;  4OVU A;  3LG7 A;  4J8E A;  3RRN B;  4AIF A;  4JEU A;  3LJC A;  3B7T A;  3HKB E;  5JJT A;  4N39 A;  3UX4 A;  2V7K A;  2VTB A;  5EKQ D;  3EJN A;  4GZ3 A;  5HWY A;  2N2N A;  2YHE A;  3U9W A;  3ZN0 B;  3PUK A;  3AAI A;  3RX6 A;  4A56 A;  4JHR A;  2EHO B;  5G2N A;  3R84 B;  3CX7 B;  1HX8 A;  3KIN B;  4I43 A;  4KZ0 A;  4HOQ A;  4ILU A;  2IU1 A;  3FUK A;  1UN9 A;  2LSU A;  3CHR A;  4MRU A;  3ZYL A;  1G73 A;  3N9N A;  3VTY A;  3S7D A;  2AVP A;  4AQG A;  5AFU L;  3KV4 A;  4AQF A;  5BPP A;  3FU6 A;  5LJN A;  4G25 A;  2VWA A;  4PJN A;  5M4Y A;  2GK9 A;  3QB2 A;  3ESK A;  4QXH B;  5BV0 A;  3JCK C;  5LCY A;  2CEA A;  4XZC A;  2XTL A;  3HVE B;  4I9E A;  3JC6 D;  5HAX A;  2X66 A;  1PAQ A;  4O6F A;  3N9O A;  2VGX B;  2CXL A;  2W0G A;  4KT6 B;  3ZEF A;  4UVC B;  4JZY A;  2C2L A;  3ZPO A;  3IF8 B;  2MOZ A;  4CXW A;  1FMW A;  2OVB A;  2L8K A;  5LJM A;  2WXN A;  4Q69 A;  3W15 B;  2IOL A;  1MNE A;  2V7L A;  2IJG X;  3P7I A;  3ASG A;  2NTX A;  5JRC B;  1KT1 A;  1EYH A;  1YW0 A;  3NRY A;  5KJL A;  2C0M A;  2DWK A;  1QUU A;  3L22 A;  3TL5 A;  3NZP A;  1SQM A;  4NQ0 A;  4UF0 A;  2DWG A;  3KFW X;  4FHK A;  2N1G A;  2K24 A;  2NP9 A;  4AKR B;  2J07 A;  4H9R C;  5LX8 A;  5KJK A;  5JR9 C;  3SOL A;  2VKD A;  4AP2 A;  4JXT A;  2R59 A;  3QKY A;  2DLR A;  4TUU A;  3LK4 2;  2V4L A;  3H3A A;  5L2L A;  3FB2 A;  5FTP A;  2PBI A;  1HG5 A;  5ANR A;  1IYG A;  5HWX A;  4PK6 A;  1UG3 A;  3PEU B;  2CHX A;  5KJM A;  3U3I A;  2PQN A;  3I4G A;  2XGM A;  5LOZ A;  5LP6 E;  4UWK A;  1U4Q A;  3AU5 A;  4B8C B;  2YHC A;  4WNK A;  3T8M A;  3CKD A;  1YA0 A;  4O4L E;  5JH7 E;  2KMF A;  3OTN A;  4J0U A;  4I4T E;  3MJW A;  3LEW A;  2KZT A;  1E1H B;  2NOX A;  4KBQ A;  3Q2M A;  3AA7 B;  1LVF A;  4G2A A;  2A72 A;  4MLK A;  3D0T A;  3VKG A;  2ODV A;  3FU5 A;  4GMJ A;  3WAJ A;  3JC6 C;  2V1D B;  2AXV A;  2M67 A;  3FUE A;  2KM4 A;  3O1I A;  4FP7 A;  3A5X A;  1QSD A;  4PNI A;  4ISS A;  1H2U A;  1WR6 A;  1FEW A;  4QWN B;  2X6F A;  3FWV A;  1IJ6 A;  3ANW B;  2WXJ A;  3RK6 A;  1O3X A;  3RKV A;  2E0I A;  3FU0 A;  4F3V A;  1UW4 B;  2AXZ A;  4HFG A;  1JWG A;  4G24 A;  5JR9 B;  3UPV A;  3ZYK A;  4DJA A;  2R5S A;  3FP3 A;  2LOS A;  4K0R A;  2LSV A;  4GA2 A;  4AKL A;  3ZYQ A;  3FUF A;  4QX7 B;  2CXD A;  2CFZ A;  4MLP A;  1NA0 A;  4O4I E;  2MYS A;  3CIA A;  5AEN A;  3U66 A;  3EIJ A;  4IST A;  4UV9 B;  3P1U A;  2X6I A;  5LGT B;  4KBM B;  4AEZ C;  1HG2 A;  3PDN A;  2NW9 A;  2UY1 B;  3GN5 B;  1DVP A;  2CE7 A;  3UQ3 A;  4L2Y A;  1HE8 A;  4R7L A;  5JJ7 A;  3TXN A;  1ELW A;  1JPL A;  3EIQ C;  2X51 A;  3FUI A;  3PRZ A;  5T3R A;  3C4X A;  3E4B A;  4NAC A;  3ZMS B;  4AY5 A;  2ES0 A;  4J8F A;  4IGU A;  3FUD A;  3UT8 A;  2YQ8 A;  3MCX A;  3TJP A;  2LO6 A;  3I9W A;  3SS1 A;  1HTJ F;  5G05 J;  3UT7 A;  4JC8 A;  2XPY A;  1E90 A;  1EZ3 A;  2NW7 A;  5FMN A;  4AKG A;  5JVD E;  4FJZ A;  3L6A A;  4UWL A;  3J7Y q;  4XKB A;  1EPU A;  2V7J A;  1IQR A;  4ABN A;  3OYZ A;  1VOM A;  4X1I E;  3PU3 A;  2MOW A;  5FXX A;  2MBG A;  5FY7 A;  3QC1 A;  3DPD A;  2X67 A;  1VDY A;  3LJ3 A;  4JA7 A;  4AXP A;  1HF8 A;  5CA1 E;  1FVH A;  5EK2 A;  2C5J A;  3Q5M A;  1HU3 A;  3ZHE B;  5KJN A;  1PY1 A;  1OWA A;  3P8C D;  3PUJ A;  5E0O A;  2VKJ A;  3TAX A;  2KAT A;  1MQS A;  2KCK A;  4ME2 A;  4ADZ A;  2FI7 A;  4YVQ C;  2XAG B;  4UEM A;  3QOU A;  4EIW A;  4N3C A;  2WM9 A;  4OFZ A;  4P09 A;  4C0M A;  3TGO A;  3LK2 B;  1FVF A;  3Q47 B;  2X6K A;  4UWF A;  3MAC A;  5E76 A;  4CXY A;  3VU7 H;  3FBZ A;  3D9L A;  4LER A;  3RPU A;  2Y8D A;  4YHJ A;  1U3C A;  4J8S A;  3G2V A;  4CT4 A;  1IQU A;  3AAE B;  3ASH A;  2Q7F A;  3Q4A B;  1E7U A;  4APF A;  1D1B A;  4NUV A;  5CCM A;  4UQX A;  3LBX A;  5G04 J;  2KIN B;  3J9X 1;  3QC9 A;  3PRE A;  2V8S E;  3APC A;  3CHQ A;  3APF A;  3C98 B;  3QUJ A;  3GW4 A;  2X9Y A;  2P9B A;  2WMO A;  5ETW A;  3GZ1 A;  4X1K E;  3K3N A;  4GML A;  2V0P A;  3MK7 C;  4PUC A;  5FQ6 A;  4J2C A;  3RU0 A;  2ODU A;  1KNZ A;  5D0O D;  3LS8 A;  2KZ7 B;  1D1A A;  1X79 A;  3IHR A;  5JDH A;  3IHV A;  3N2O A;  4EZ4 A;  2YK0 A;  5GON E;  5EK3 A;  4U8H A;  1UCU A;  3GZS A;  3HKC E;  3CVN A;  2J9Q A;  3CHS A;  4H7Y A;  2ILR A;  5FY0 A;  4ILG A;  3I0O A;  4KMO A;  3I4R B;  5EX0 A;  3SGH A;  3MJX A;  5LBM A;  3PNL B;  4WW0 A;  2JEK A;  4EZJ A;  2BVM A;  5FZR A;  3ZJ1 A;  1WAO 1;  2C0S A;  2VJ8 A;  3ZCI A;  4GZD A;  2IW5 B;  4I1O B;  2E2E A;  3SFZ A;  4Q94 A;  3SI5 A;  4TX5 A;  2NC9 A;  3ZMU B;  5FYM A;  2UXX B;  2NWB A;  2GRL A;  3PNT B;  2LT3 A;  2VKO A;  4DMV A;  4HTE A;  3FUJ A;  4BX8 A;  2CHZ A;  3CVQ A;  2QGS A;  3UUX B;  4AVX A;  3S4U A;  3T5X A;  4Q96 A;  3KV5 A;  2L9B A;  3T8O A;  2MTQ A;  3WAK A;  3MA9 A;  2X6H A;  4IRU A;  1Y6I A;  2CXF A;  2WQ6 A;  3FEY A;  3CVL A;  2WAU A;  3ONL A;  1BR0 A;  5FZS A;  4ZI2 D;  4G26 A;  2K5B B;  5CMY A;  4DVD A;  3JYS A;  2L9Q A;  4HFV A;  5HYA A;  3VLF A;  1IJ5 A;  4IIJ E;  1B7T A;  4IE0 A;  3HI2 A;  3B7S A;  4GAA A;  1ZV4 X;  1MMD A;  2Q9Q B;  2WXL A;  2BF0 X;  3SNX A;  4WWP A;  3B7U X;  3WI3 A;  5LGU B;  1WYB A;  3R7R A;  3FXE B;  2NW8 A;  4K03 A;  1US7 B;  1YKH B;  3LY8 A;  5J2T E;  4CI3 B;  4PJJ A;  4BA9 A;  4U0U A;  5G55 A;  5LHG B;  2X9W A;  2Y6X A;  2ZLY A;  4N5C A;  3HVE A;  3RYI E;  2RA1 A;  2KLQ A;  4EXT A;  4L7T A;  5JRE A;  4E7Z A;  3QAQ A;  1UN8 A;  3UUL A;  1DNP A;  4ZI3 D;  3HDX A;  5LP0 A;  2YNQ A;  4UI9 J;  1WRD A;  3ZN1 B;  3RIB A;  1Z6T A;  3LY9 A;  4WAF A;  3ZMT B;  3O1J A;  3QNK A;  4O2A E;  1OWP A;  5KDM C;  2WSS V;  5M72 A;  5ENN A;  3KVB A;  4ILH B;  1S35 A;  2WBL A;  4AI6 A;  4HXI A;  4IE5 A;  4RG6 A;  2Y4U A;  1HH8 A;  1SZA A;  3MKR A;  3O4Z A;  3PUG A;  4AQF C;  5FQ8 A;  3LYA A;  3OYX A;  3OXF A;  2PM6 A;  3UMV A;  1Y8M A;  2LSG A;  4CI1 B;  2L0T B;  3EVY A;  4D10 C;  3E08 A;  3UT5 E;  1MIV A;  3B7R L;  4HGA A;  2FO7 A;  3RYH E;  1SHZ C;  3KEZ A;  4EYY R;  5KX5 E;  4I2Z A;  3KV6 A;  3LK3 B;  3NQP A;  4OVV A;  3M65 A;  2XUE A;  4GYO A;  3FBL A;  3CKC A;  4DI4 A;  1NAF A;  3FHE A;  2CCQ A;  4ZI2 C;  4W9R A;  4EPZ A;  3IBP A;  1Z3X A;  4GA1 A;  5LFA A;  4JEU B;  2PG8 A;  4IN3 B;  3ZGQ A;  3ZW3 A;  1LVK A;  4UWH A;  2W63 A;  4BFR A;  2E9X D;  3S2A A;  3UUN A;  2VTB B;  4FA6 A;  1U5P A;  2RD0 A;  4L0R A;  1H0A A;  4KXK B;  3CVW A;  3GA8 A;  4N78 D;  3RRU A;  3ZCJ A;  4KP3 C;  3CSF A;  2JLB A;  3CWZ B;  4UVA B;  2PQR A;  3BK9 A;  3ZXS A;  4I43 B;  3CVV A;  3LVR E;  3CEQ A;  3D9I A;  5IHY A;  3RC3 A;  2UXN B;  2YIN A;  4MKT A;  3AVS A;  4DK5 A;  4H63 V;  2HM8 A;  4AV7 A;  4XX5 A;  4M3O A;  3FH8 A;  3G2T A;  3PUQ A;  4GZC A;  4YND A;  3ZPJ A;  4ZI3 C;  3FU3 A;  4PK5 A;  2WXQ A;  4WBO A;  2V7M A;  2LSK A;  3ANW A;  3FTV A;  4ANU A;  4A1G A;  3CQX C;  4WWN A;  3I0Q A;  2XAH B;  3FUN A;  4U04 A;  1E8Y A;  5C2Y A;  2JPF A;  3O48 A;  2C5I T;  5EZY E;  3FTX A;  1BR2 A;  3CVR A;  2X3M A;  3ZEF B;  3AVR A;  1HCI A;  3QAR A;  3AA1 B;  2XGO A;  5LA6 E;  2UWJ G;  2LOP A;  3QDN A;  5BT1 A;  3PZD A;  1V9D A;  3QWV A;  3R9A B;  5JDG A;  4AKI A;  3FUH A;  5LCW C;  3FTY A;  3TKL B;  4YFS A;  3D9O A;  4GYR A;  5HQ8 A;  2GGF A;  3VLD A;  4JUY A;  4I17 A;  4V3I A;  3C4W A;  4FLH A;  2D2S A;  3L3P A;  4ZI7 E;  3GZ2 A;  2ZM8 A;  1IHG A;  4UF0 B;  4XKC A;  3GWH A;  1UJJ A;  3JUI A;  5BUZ A;  4HEA A;  3KDS E;  4B0Z A;  2L3L A;  4L9I A;  2D5U A;  2FEZ A;  2E9X C;  4G23 A;  1OWO A;  2WXH A;  1WYC A;  3OXG A;  2HH7 A;  2VB6 A;  1ZKE A;  1OWL A;  4TV9 E;  2QY7 A;  3NZS A;  4JHJ A;  4I2W A;  2A5U A;  3ZRH A;  2CA5 A;  3MKQ A;  4PK4 A;  3DJB A;  2HR2 A;  4E85 A;  1E8W A;  3OBV E;  1HS6 A;  3MEK A;  1SA0 E;  1P5Q A;  4CI2 B;  4KZC A;  3UTK A;  5HXS A;  3BEE A;  4CCA A;  4QXB B;  3R7Q A;  2CG2 A;  2GW1 A;  4TN7 B;  2OVF A;  2OOE A;  1S94 A;  4WNG A;  3VTX A;  3ZHE A;  5J08 A;  3L16 A;  3Q49 B;  4N2S A;  2KZT B;  4XAX B;  2WB2 A;  1H2V C;  3FUL A;  4JA9 A;  1H6K A;  2WXI A;  5A23 A;  5KCM A;  3K8P C;  2PM7 A;  2AWI A;  2P58 C;  1HS7 A;  1MIW A;  5JJ6 A;  3ZC0 A;  4IHJ E;  1S0P A;  3SWH A;  4AJW A;  2PJQ A;  4U72 A;  4RG9 A;  3CVU A;  2XRY A;  4GPK A;  3RC8 A;  2K9A A;  3FHN A;  4H9Q C;  2JRK A;  2GRM A;  4NRH B;  2Q9Q D;  5BW8 C;  3D9M A;  2E9X B;  5CCL A;  3CR3 A;  5FNV E;  2MHK A;  2XPZ A;  4GYY A;  2ZM0 A;  1MMG A;  4IE4 A;  5ARG A;  3OJA A;  3KD7 A;  2IFU A;  4ANX A;  4WNF A;  2X38 A;  4U0S A;  2CM0 A;  4DO0 A;  1H19 A;  5AYW D;  3RRM B;  2KCL A;  2HO1 A;  5CB4 E;  1ELK A;  4I6E A;  4UXN B;  2WXO A;  3L13 A;  4YJ3 E;  4UV8 B;  3ETV A;  2WXG A;  3AA6 B;  3V5U A;  1TJC A;  3RJV A;  3D3M A;  4EZL A;  4QFV A;  3H37 A;  1H2T C;  4ZOL E;  3MZK B;  5LHI B;  4IE7 A;  3PUS A;  2I6H A;  4DLO A;  3FTS A;  3PUA A;  3APD A;  2I9C A;  5LGN B;  3MXZ A;  4CDM A;  3AS8 A;  2B1E A;  2NSZ A;  3MX3 A;  4ASK A;  5LHH B;  4JEH A;  2AXU A;  3FH5 A;  4U63 A;  4B94 A;  4GK5 E;  4CQI A;  4Y6W A;  2KWH A;  3O9X A;  2XHE A;  4DI3 A;  4H7X A;  3QK6 A;  3FEX A;  4FLB A;  4CGV A;  2LJL A;  4E7S A;  2J49 A;  4PS8 A;  3EHM A;  4IYP A;  4CDR A;  2CWY A;  5JHA A;  1LRZ A;  4BT9 A;  5FP3 A;  4EBA G;  4GCO A;  1W3B A;  4XIF A;  4U74 A;  3SBT B;  4MHC A;  3KAE A;  2FF4 A;  4GU5 A;  5L3E B;  4HOR A;  4UQZ A;  3FY4 A;  2L0I A;  2XAS B;  2BUG A;  4EBA A;  4RVB A;  4KMC A;  1WLX A;  4O4J E;  3FTU A;  5H6R B;  2Q9Q C;  4KYO B;  4QXC B;  2DNX A;  2WXP A;  2I2O A;  4L2L A;  4EYU A;  3HHM A;  2XQY A;  2LNI A;  4RSY A;  3KBT A;  4OYS A;  3URZ A;  4QX8 B;  2IQC A;  3MZL B;  4JHK A;  4G1T A;  5F3J A;  1PC2 A;  3IKO B;  1MHQ A;  4FJY A;  3U3W A;  5ANL A;  4EZK A;  4UWG A;  5CA0 E;  1UX4 A;  2ION A;  3ZJ2 A;  3CHO A;  4PW8 A;  3ASD A;  4XI9 A;  4B6X A;  1SZ9 A;  2CWO A;  2CHW A;  4L23 A;  4IDZ A;  3U4T A;  4PS7 A;  4WBN E;  2DBA A;  4I1A A;  1L5J A;  4A1S A;  3BQL A;  2XGS A;  3IHY A;  2X9H A;  4PH4 B;  3LY7 A;  3PUR A;  3LBX B;  4YVO A;  2BTD A;  3LKU A;  3K3Q C;  3CGH A;  2KWI B;  1YD8 G;  2X9X A;  3PTR B;  5KMG P;  3ML8 A;  2LEH A;  2VSN A;  2XAF B;  4HE8 A;  2EHO A;  1XGW A;  3HYM B;  2EQX A;  2DCF A;  3AS4 A;  3HA4 A;  4ERR A;  4J8D A;  3SF4 A;  3F2E A;  4LUN U;  4X20 E;  4DPR A;  2H7O A;  4MAL A;  3PE3 A;  1H7C A;  3OXL A;  4P0B A;  5BV1 A;  2W61 A;  2KT9 A;  3QJZ A;  1IAP A;  2J4D A;  3CHP A;  1MIY A;  4C91 A;  4O2B E;  5H6Q B;  3ZMV B;  5AJD A;  4M1P A;  5FXV A;  5G05 C;  1E96 B;  1NZN A;  4AOF A;  3FH7 A;  4CT0 A;  3L08 A;  2HPJ A;  1QQE A;  2JJ9 A;  4EAH A;  5DQV A;  4L1B A;  2Y4T A;  2XCC A;  3ENE A;  4APO A;  4URK A;  3KVA A;  3C4Z A;  3U78 A;  3TG4 A;  2I1J A;  4G63 A;  2LSY A;  2G0U A;  5IYZ E;  3N9M A;  4I1M A;  3JQ1 A;  2BDE A;  4LCT A;  4U07 A;  2VGX A;  2Y48 B;  3NZU A;  4ACK A;  2DHR A;  3N2G E;  2V7I A;  3D9K A;  3AU4 A;  4BY6 A;  3JQ0 A;  4GZ6 A;  3NRX A;  5FWQ A;  3KBU A;  4TUY E;  4NUU A;  4F7A A;  4UI9 K;  1WM5 A;  4BSX A;  4H9O C;  3ASF A;  2ACX A;  2X6J A;  3N9L A;  3OKQ A;  3I5P A;  5JRC A;  2DIW A;  3CK9 A;  3ZMZ B;  2XQ0 A;  4BX9 A;  2C5K T;  2I1K A;  4ZS3 A;  2K48 A;  1OUV A;  4MBQ A;  4BAY B;  3UFE A;  3BQI A;  3PE4 A;  4EQF A;  4CRW A;  4UIG A;  4CZZ B;  5C8Y E;  1UX5 A;  2HYZ A;  5AJL A;  3DBS A;  3HKE E;  3GMI A;  4JPS A;  5FJY A;  2VAS A;  2DCP A;  2DI4 A;  3QWW A;  2OND A;  3HL6 A;  3N5L A;  2M63 A;  5FQ7 A;  1ZHC A;  3ZLI A;  3ZN3 A;  2XAJ B;  3PS6 A;  3CQC B;  5FT9 A;  1FIO A;  4EZH A;  1NWM X;  1MMA A;  4P29 A;  5FY1 A;  2WXM A;  4JW1 A;  4KUM B;  3HIZ A;  5G04 C;  5BNW A;  4I9C A;  4Y6C A;  3LCA A;  4TV3 A;  4GB9 A;  3CKB A;  1MND A;  2ZM2 A;  3ZYM A;  2KC7 A;  2IOS A;  5A7D B;  4ATG A;  3WXX A;  4WWO A;  5T8I A;  4BJN A;  3AS5 A;  5FZQ A;  3IV0 A;  2XPI A;  2XCB A;  3D9J A;  4ILI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...