2WM9A

Structure of the complex between dock9 and cdc42.
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
423
structure length
407
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
total genus 148
structure length 407
sequence length 423
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wm9A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wm9A01
2YINA 3B13A 2WM9A 3VHLA 2WMOA 2WMNA
chains in the Genus database with same CATH superfamily
3VTYA 4TWDA 2NW7A 3TKLB 1W3BA 3MEKA 4DR3T 5F8PA 3U9WA 1E2AA 2KT9A 3RO2A 3ZHEA 3EUVA 3TG5A 3MACA 2CFZA 2KCKA 5CRUA 5EX3A 3LJCA 3CK8A 5AQMB 2YDQA 4UVAB 3BUAA 3P1UA 4URKA 2XPZA 4FHKA 4U0SA 3EUHA 4DRXE 3UPVA 3TXMA 2M63A 4J8SA 3QC1A 1N4RA 4LNBA 2V7KA 4CDNA 3UIPC 3U3WA 4KZ0A 2FEZA 5ADXL 3UQ4A 5M4YA 2V0PA 4KBMB 5JDLA 1W09A 5ENTD 1JWFA 5CEDB 2XHEA 3FUMA 5EKQD 2YQ8A 1H19A 3L17A 4HS2A 5LNKA 3PE4A 2Q9QA 1U2VG 1KLXA 1L0VA 4I9EA 2LOPA 5AIJA 2LUHA 5HYAA 1BU9A 4YHJA 3HDXA 4JI4T 5HEUA 3J5QB 3ZRHA 1D1BA 2LXMA 4LF8T 2FJDA 4ZOLE 2CG3A 1Z8UA 2KNDA 3S2AA 3R6NA 1VRBA 4A56A 5HEJA 1BI8B 5KCMA 3RAUA 4JUYA 3MXZA 4JI6T 2C5KT 3CWZB 2DIWA 4WWPA 3RYFE 5CHEE 4O1PA 4M7CA 1WR0A 2C0MA 4YVOA 4LFCT 3W9FA 3SGHA 3DEOA 1N33T 3MCXA 4U07A 4B3TT 1U3DA 3P4QA 4GZCA 5FZQA 5LBQB 2LXLA 2CPTA 2CXLA 4QKNA 4DI3A 1FEWA 1MIWA 3MA9A 1H6OA 3CHRA 2DWGA 1ZP0A 4U8HA 2AXDS 3UUXA 2PQRA 3CX7B 4IDNA 2KC7A 4B0ZA 3ZMTB 5CRVA 3VR9A 3ZN0B 3ZN3A 3UT7A 1HZ4A 4GYSA 1ZV4X 2KWIB 4UR9A 5ETWA 1HX1B 1WCRA 3QARA 3F6QA 2V5FA 1DVPA 3C51A 4NPPA 2E9XA 1H2UA 1O1TA 5LCWC 2JQKA 2XQ5A 3QWPA 4YY3T 4E7ZA 1QSDA 4PJJA 3OBVE 3AVSA 3I0QA 5G05J 1QQEA 4ANUA 1MMNA 2WMOA 2I6HA 2J1DG 5FY7A 4IIJE 2NYJA 3CIRA 4ASKA 1FIOA 4ILGA 5L3CB 3LBXB 3ASOE 5T8IA 1NENA 3C4XA 4JEHB 1TJCA 1HNWT 4QFVA 1NZNA 4AKRB 2LAHA 4XKBA 4JI5T 5KJKA 3AE6A 4I50E 3OAWA 3ZC0A 4TNVA 2D0TA 5FQ7A 3E33A 4AKLA 2PJQA 5AYWD 2A4ZA 4PS7A 4NIQA 2CBJA 4ZZCA 3LJNA 2P9PG 3UU4A 5HXEA 5L3EB 3EDTB 3ZYKA 2BF0X 2CWOA 4X65T 5FQ8A 2QYJA 2MTQA 2CM0A 3L13A 4GU5A 5CA1E 4ACKA 3KS2A 2RKKA 4XEIG 2XM2A 1E8XA 1Z3XA 4FJYA 2IFUA 3FXDB 4DK5A 3QOFA 1E96B 5JTGA 1P5QA 3RYCE 2UWJG 1Y6IA 4HXIA 2BG9A 4ZI3C 2V8SE 5AQJB 4BTAA 2X66A 4J6IA 3RRMB 2ETBA 3RK6A 3QK0A 1ELRA 2FJEA 2CHXA 3OTOT 2XAFB 1MMAA 1LKXA 3CX8B 5AJLA 4ZI7E 2I0MA 4OYJA 2FBNA 2RFAA 5ANRA 2WXNA 2XRZA 3FFLA 2VL0A 3CHMA 4A1SA 4B3ST 3SO8A 1ZKEA 2VGYA 2MYOA 3JCKC 3R9AB 4HFIA 3ZN1B 3SWHA 1JCSA 2JQQA 3VLFA 2J09A 5CJ5A 4NQ0A 3V5SA 1N4PA 2XRYA 3FTYA 3SFXA 1HE8A 2P2CP 3RGLA 4DNDA 2J4DA 2EQXA 2I59A 4JA7A 1JCRA 2WZHA 4GTSA 3ZW3A 3PEVB 3ASDA 1V9DA 3C4WA 2H6FA 4JL0A 3ZJ2A 1YKHB 3JCFA 4GTOA 4DV2T 3CVLA 4CT0A 2XM1A 3PZDA 3CVPA 3AECA 2VL8A 3ZT7A 2WMNA 4AXPA 4AIUA 4F6RD 4COFA 3OXGA 3WXXA 5AQHB 5AQOB 4ZEYA 1OEDA 2VQ2A 4JI7T 2P9UG 1HXIA 3EHQA 5BT1A 4CI3B 3PUQA 1MQSA 4QQIA 3ZXPA 2M6BA 3RQWA 4MFRA 4Z68A 1V55E 2DHRA 2XPKA 4N5CA 3UKUG 3AEEA 3FTVA 2R03A 2V7MA 1N36T 3GA8A 5KX5E 4LRZA 2XQ8A 3LG7A 4IDZA 4X66T 4HB5A 5KJNA 4JBWF 3VHLA 3PEUB 5FP3A 4LF5T 4B8AA 3G06A 1PC2A 3N2GE 4YDYA 2CHOA 4DR4T 4OAVB 2DCFA 1UG3A 2MAWA 4UF0A 5LX8A 2SPCA 3G2TA 1L5JA 1XNRT 3LK3B 2WSSV 2C0LA 3C64A 1MZCA 4NACA 2F0YA 1XNFA 3C4ZA 1SE7A 1SW6A 2I9CA 4Q94A 1KPSB 5C3JA 2JQ9A 3AE3A 3SQVA 3O9XA 2DBAA 3NRYA 3DWLG 2EIKE 1D1AA 4HOSA 3IEEA 2LAIA 2R59A 5L3FB 4I55E 5HI7A 2KLQA 3BQLA 1Y8MA 3Q4AB 1E8WA 4FULA 3QC9A 4HFEA 1XZYA 1E1HB 4UVCB 1H7CA 4YHHT 4DUZT 1SZAA 2I2OA 2VTBA 4PDXA 1JUQA 4XI9A 2D9DA 3AE5A 5L2LA 4IE0A 1BLXB 2V5DA 1TEZA 2YN6A 3N9OA 4HWDA 5LP0A 4CXYA 4KHZF 3ABLE 2XAQB 5ABFB 3K3OA 4U3CA 3ZEFB 5KJLA 2MOWA 5J2UE 2CLYB 2H6GA 4LNGA 3BEEA 4JI3T 3DXMG 2WDRA 1WG0A 4DV4T 5BV1A 5LCYA 4HRNA 5JHBA 2BKKB 1WDYA 2V7IA 2K5BB 3AA6B 3RIUC 3V2XA 2VGXB 2WDVA 1VCSA 2H7VC 2YHCA 2RP4A 3BQKA 3W9GA 1OXZA 3RHWA 2WWUA 1Z5SC 2CXFA 4LCTA 3KINB 5LJMA 4B6XA 2XASB 2VWAA 3U78A 2X6HA 2X0LB 5LG3A 4AI6A 1H6KA 5CBOA 2WXPA 4LNUD 1HX8A 4FADA 1WRDA 4X1IE 2DVWA 2X6FA 2KINB 1N34T 2W00A 5L4HA 2J4GA 3NBXX 3NKZA 1N54A 1IJ5A 1ZU2A 3I3NA 5BV0A 3S7FA 3LY9A 1HG2A 4TV8E 4UEMA 4HWFA 4WNKA 2P58C 3EDUA 3ZKJA 2JABA 3QUJA 5CA0E 3AEDA 5FT9A 4WBNE 5L47A 3TWSA 3CX6B 1KNRA 4X62T 4J8EA 3HKBE 4LF9T 3PUYF 2MOZA 3FUNA 3CVUA 5LB7B 2RPAA 2V6YB 5FZSA 3PTRB 1VCTA 5L3GB 1QYMA 3RH3A 3FULA 1QBQA 2CFUA 3RKVA 5FQ6A 1TJFA 3CEQA 2P9SG 2V5CA 5BXOA 1D8DA 3QOUA 1WR6A 3IHYA 5BNWA 5LMNT 2XQ7A 1XMOT 5FIOA 4ISTA 3NAWA 3DJBA 2QC9A 5FL1A 3JC6C 1T8BA 3JUIA 2I1KA 4H9SE 5C8YE 4B8CB 3Q5EA 3UT4A 2DYSE 5EN5D 5H6QB 2A72A 3MZKB 1E90A 1TN7A 1O3XA 4CXWA 3Q15A 2Q9QC 4EAHA 3H3AA 2XZDG 4GKJT 2X6JA 2WXHA 4IL9A 2WB5A 4ERRA 1SZ9A 2NWBA 4QXHB 1X81A 4QH5A 5HWYA 2RFMA 2L0IA 4JA9A 4YJ2E 4Z8XA 3DRAA 4U8YD 4RG6A 4YLHA 3APFA 1BR2A 5IWAT 4LUNU 3OYZA 4Z90A 4N5QA 4RQIA 1I6ZA 3Q5XA 4HN9A 3P4SA 3AS5A 1KF6A 3Q2MA 3FU0A 4HFHA 2BKGA 2YDSA 3C50A 3LYAA 2KWHA 3KV4A 3Q7FA 3NZSA 2FO1E 3FZMB 2IJGX 3LKUA 1N52A 2MRIA 3AEBA 1YD8G 2IC6A 2JPFA 5AQUB 2HH7A 2IO2C 1UGOA 4F8HA 3PE3A 2WU2A 5AQ9A 4TNWA 4UXNB 3CKDA 5DABA 3L22A 4Q96A 4AOFA 2XZTG 5ANLA 4CZ2D 4HOTA 3N9PA 4GMJA 1FMWA 2QVAA 4GTQA 4YNDA 2DNXA 1NA0A 3VLEA 3CR3A 2X9WA 1TNBA 1LRZA 4GIWA 3GWHA 4APFA 4Q69A 3UM3A 1MX6A 4GTTA 2LO6A 2BS2A 2LM9A 3FEXA 4HORA 3AXJA 3FUFA 1IHBA 1UUSA 2E9XC 3GYZA 3Q49B 2XQ9A 5AQLB 5A7DB 1KZOA 3NZQA 3TWQA 4EYUA 3CQXC 4K0KT 2LSIA 4JI1T 3ETUA 5ARGA 1UOHA 4UI9J 3ZYQA 2YKSA 1QLBA 3B13A 2DWZA 3CSTA 5EYLA 1I94T 2I1JA 3PUXF 5F3JA 3DSWA 1KZPA 1IBMT 1X9BA 3ZXSA 1SHZC 3AAAC 1R8IA 5M72A 1B7TA 1K1AA 3AE2A 4XBFB 4JI2T 4UUCA 1OWOA 3D9MA 1W0AA 2DL1A 4KP3C 3QNUA 1HNXT 3MGBA 3QB5K 2IDOB 4I6EA 1GQEA 3IBEA 4DIDB 4B3MT 1RW2A 2GRQB 1FCHA 4UWGA 4ZI2C 3ANWB 3FHNA 4FJOA 1DC2A 2GW1A 5D0OD 1XMQT 3P4RA 3AA0B 3PVLA 2XUEA 5EIBE 4JPSA 4APOA 3AA7B 1AWCB 3UXGA 4U7IA 1TNYA 2KCVA 1D8EA 4G2AA 1TN8A 4HI9A 1N94A 4QH4A 3LBXA 2J49A 5J1GA 5JDHA 1IXVA 4JEHA 1NP7A 4AKHA 2FI7A 2IQCA 2GRLA 2VGEA 4K0RA 4RLYA 1E8YA 4LG6A 2LHRA 3W15B 2XQ3A 2VASA 3MKDA 4WBOA 2VJ8A 2FULA 3FH7A 4I6GA 3UQ7A 3FEYA 3QNKA 5D66A 4JEUB 3BK9A 4UWHA 2R2LA 1MMGA 2LSKA 3AEAA 4DBRA 4LEUA 1JPLA 5BPPA 5KJMA 4IREA 5B3SE 2YEVC 2VQFT 5HEHA 4HTEA 2C0SA 5AQRB 4XKCA 2PTFA 4I2WA 3QB2A 1US7B 3PUJA 2ZLYA 3P2BA 2IIUA 2L9QA 2XEEA 4F1PA 2FBWA 5ENPD 3MJWA 5JRCB 4KYOB 3RYHE 3HXFA 3PV0F 4LF7T 3PZ3A 1MX2A 3ZCIA 4OVUA 3TWXA 4JI0T 2LHNA 2PG8A 1Z0PA 2AVPA 4BAYB 2PL2A 1YXRA 2WCAA 2X9XA 3NF1A 4PK6A 3RF1A 4K0UA 2BUGA 3DBSA 2PBIA 3LCAA 3O4ZA 1BD8A 1OEDC 3FU3A 3FTXA 4EBAG 3PNLB 2OEWA 3IEGA 4GOUA 4A97A 3HHMA 2PFVA 1FVHA 4GPMA 2LEHA 5BR8T 2UUCT 2BVMA 4F53A 4WNEA 3OPCA 4UWKA 4K03A 2YU2A 2ZMAA 3HVEB 1SA5A 2HPLA 5CBNA 4GMLA 1IJ6A 3OYXA 3I0OA 2HM8A 3ONXA 2W61A 4P09A 2H6IA 4WAFA 1K3ZD 3TLVA 2E2EA 2XGMA 4PAGA 2X3MA 4HFGA 4I1OB 3GMIA 3NZUA 3C98B 2QYUA 3ZLIA 5AQAA 3EHMA 3FBLA 5C2TA 3D9IA 1PY1A 2OVFA 3MK7C 1T72A 2QFCA 3UIOC 4EOZB 4DBQA 1K1BA 2DZOA 3H3MA 1LVFA 3E4BA 2A3DA 4Q25A 2N9DA 2XAJB 3RRUA 2XQ0A 2DZNA 3QAQA 3SFZA 4WNGA 2KMFA 2JLBA 2L6BA 3L16A 5FXWA 3R9MA 2X51A 4U72A 4LMJA 2AXVA 5HRYA 3V79K 3UFEA 2VKOA 2GRPB 3Q47B 4U33A 5L3BB 3SZ7A 4EGWA 4U0UA 5G2NA 5FINA 3EU5A 5CCMA 4LSZE 5FTPA 3CK7A 2C5JA 1N9AA 2WB2A 1YMPA 1DCQA 1SA4A 4U2ZA 1X5BA 4GZ5A 2L3LA 3O1HA 4GCNA 4U31A 5EK4A 3IBPA 3EJNA 1W9RA 2QYWA 4O2AE 4WYVA 1ELWA 3UU8A 2XAHB 2FUPA 4BETA 2J62A 1OEDE 3OVUA 3CVXA 1NAFA 3E34A 4OAUC 1E8ZA 4AQYT 4I6JA 4CZZB 3AJIA 2WM9A 4GTMA 3EDVA 2QGSA 2LRLA 3VKGA 3JQ1A 1HR0T 3PUWF 1NWMX 3Q5DA 1N4QA 1KNZA 4O6FA 4TUUA 2BS3A 3TXNA 1HS7A 1OT8A 1FJGT 2IW5B 2X0HA 1IQUA 2ZISA 1NEKA 1YKEB 3LPZA 3UUBA 5ENNA 3L9TA 4P1NA 2Q7FA 3SF4A 2ACZA 4GB9A 2M6IA 1JCQA 4JHJA 4HOQA 3RI5A 3B7TA 4AY6A 5IYZE 5ENOD 5ABFA 3ONJA 3ZEFA 3EHRA 1S35A 3E08A 2UXXB 1DU2A 4CEMA 3NZPA 1HH8A 1WFDA 2IUBA 3K3NA 2CWYA 3PZ1A 4TN7B 2XEHA 5FY0A 3Q79A 1M62A 3DPYA 4DX5D 4DI4A 4BY6A 1CHUA 1OCCE 4J8DA 4CQIA 4EPZA 4G25A 3D9KA 3PDYA 2WXFA 3TWVA 5JHAA 4DR5T 2VGXA 1CUNA 2RA1A 4PFPA 4DUYT 3RJVA 2BTDA 2HE0A 1O1SA 2LRKA 4LERA 4BJMA 3AEGA 2XGOA 5LHGB 4CGWA 2W63A 3SBTB 4BFRA 4LMKA 1ZB1A 5ABHA 4WZXA 2QY7A 4LMLA 3ASHA 3CMLA 3SD5A 4KVMA 1MHQA 3CGHA 4K5BA 2ZM8A 4TUMA 2WXRA 5BW8C 3I5PA 2CRBA 1TR4A 3B5MA 3FWVA 3JUEA 4MS6A 3X1DA 3ONKA 3C5RA 4C90A 4I0UA 1IQRA 5JR9B 2D2SA 4H9OC 4YSZA 4IDQA 2XPIA 4C0EA 4TV9E 4C48B 1ZOYA 1D0XA 3DP7A 3A8YC 2W2UA 4DV7T 3FXEB 1SUMB 2WPVA 1IBKT 4ILBA 2IEJA 1N4SA 4IN3B 2EHOD 2KSRA 5AFUL 3OTNA 2Y0BG 1QNFA 2J07A 3B57A 4WWNA 2V6YA 1H0AA 2NOXA 3A7MA 2BZBA 3M3ZB 1MJ0A 4KT6B 5FZRA 3N9MA 4KMOA 3ZPJA 2YINA 2H6HA 2BKOA 4J8FA 4IHJE 1JWGA 2R17C 3S7BA 4A1GA 2VSNA 4QHOA 4NXMT 1HTJF 2EHOB 4PH4B 3ZVVA 4JHKA 1SA0E 5KNHD 3CK6A 5EK2A 2WXGA 2EINE 5T3RA 3O48A 3PDNA 4P29A 4CDMA 4EV6A 4BEPA 5ENRD 3BG1B 5AN8A 3UM0A 4GYWA 1DCEA 2Z6EA 5LGTB 4UV9B 3MKRA 4H9NC 4ATGA 1MYOA 2XGSA 2C2LA 4OVVA 1IZNB 4IE4A 2D0UA 5AQPB 4PJNA 5BXUA 3PZ2A 3PUAA 3KBTA 2LLYA 4O4JE 1TN6A 2MBGA 3ZYMA 3F2EA 3BQOA 4BT9A 4GPKA 1J5WA 4AQFA 2H89A 2H3RA 4TRQA 2E2AA 2KXPB 2NW8A 2Y8DA 3AE4A 4YTPA 4GZ3A 3X2QE 5HEGA 2UUBT 2F37A 4FLHA 2CBIA 4O4IE 4TWFA 3ZC1A 3LDZA 1YYHA 4M1PA 3N9QA 4D10C 3ZT6A 1OWAA 4OFZA 5L4EA 3L3PA 5C2YA 5T4YA 2VSYA 2P9BA 4H63V 4O4LE 1XNQT 1XDOA 4F1SA 3HXBA 5JDQA 4DLOA 4TX5A 4E85A 3QK6A 2EILE 2XEVA 2WQ6A 3AAAB 5L3DB 3CVWA 2HN2A 3BU8A 3SFEA 3AAIA 4A3VA 3T1HT 3Q7AA 2UXNB 3R84B 3KV6A 2HPJA 3K3QC 4A63B 4G24A 4PW8A 2G0UA 2KZTB 4DLQA 5HS0A 4FC8A 1OUVA 5EIDA 2R05A 3Q78A 4A3TA 5A6CA 5HAXA 2MPKA 3B95A 4EEDA 1IYGA 4DR2T 1OWNA 4JXTA 4N39A 2WAUA 2WDQA 3BG0B 2D5UA 1UK5A 4EIWA 4AM9A 3T8MA 4U96D 4MALA 4O4HE 3FHEA 4BT8A 2IO3C 2XQ4A 4FA6A 1IAPA 3VR8A 4ZS2A 2RD0A 1JNZA 5ARFA 2AXZA 1K8KG 2YNQA 5HQ8A 3SRZA 3ETVA 4AISA 4EZKA 1ZBPA 4YDOA 3FY4A 4GTVA 2WQHA 5AQGB 2B6CA 4ZS3A 4NUUA 3FZKB 3UI2A 3PU8A 4HVBA 3PRZA 1T98A 2GK9A 1NFIE 3ZKRA 2ZGGA 5HXHA 1EF1C 2YHEA 5AQIB 3S7JA 4DX6D 5JREA 4J8YA 2VVNA 4UVBB 3FTUA 2P9NG 3AE8A 4DPRA 5HXCA 3OXFA 4OK0A 3L8RA 4ANXA 1O1RA 4DX2A 3PS6A 3UU3A 4CI1B 3ASFA 4EBAA 1OWLA 2GRRB 3AG3E 1H2TC 1IBLT 3U3IA 4X1YE 2W0GA 2XPYA 3UMVA 3ANWA 3FBZA 2LNIA 1UX4A 1BR4A 2V26A 3OJAA 5FKYA 3DSUA 4FHJA 1E7UA 1G3NB 2Y4TA 2X6IA 5HXRA 3D9OA 5LGNB 1Y01A 3N2KE 4ANVA 1BI7B 3PJAJ 4PJMA 1WAO1 3UM1A 4ANWA 4IDPA 4JD2G 2H88A 5KBAA 1GW6A 3KDSE 2J9QA 4QXCB 2R6GF 2AWIA 5LCWJ 4EB6E 2X0YA 3GN5B 4HWCA 3ZNGA 4EECA 3WAJA 2N2NA 3ZT5A 4N2SA 5CB4E 3Q5MA 3JQ0A 4IT4A 3RQUA 4HWIB 1UN8A 2UXBT 2WXQA 4JEUA 3T5VA 2ONDA 3RKOA 4AJWA 3P8CD 4CGVA 1O5MA 5FJYA 3BQIA 3TLUA 3SBSA 2CHWA 2NC9A 3CHOA 4YT0A 5HXSA 3RLFF 3ZSSA 2CMRA 4V1Av 1HNZT 4U04A 3ZCJA 2J47A 3FU6A 3AB3B 3E32A 4K5CA 1G73A 4U8VD 1FPPA 4L0RA 3ULEG 1WYBA 3CVRA 4CN4A 3U66A 3RSEG 3L39A 4DV0T 2J08A 3B7UX 3PUSA 3IA3A 5JRCA 3D9JA 3D9PA 1KT1A 2BS4A 3Q9UC 4YDEA 4AY5A 2OCCE 3AE1A 4G23A 5TAOA 4HNAD 2K9AA 1HU3A 3TJPA 2W62A 3KBUA 5JVDE 3V31A 4RVBA 4DV3T 1TNOA 3ABME 4HFVA 3CQGB 3HXEA 4CT4A 3UM2A 5LMUT 3EIJA 2HN1A 4I17A 3EABA 2E8IA 3JADA 4ZXLA 2DYRE 1UJKA 3P50A 4DV1T 2VSXE 3PUGA 4P0AA 4ACLA 2MHKA 5E76A 5LGUB 3FDHA 3PH0C 2ES0A 4E7SA 1Y64B 2VYIA 2AW6A 3CIAA 5KNGA 2FJAA 4HWHA 2KATA 4X1KE 1DNPA 3TGOA 2LT3A 3HVEA 3K1SA 1S70B 1UURA 1BPOA 3LVQE 1OCOE 4F6RC 2UY1B 3CQCB 5AQSB 3RX6A 3MKQB 3I9WA 3UT5E 5G04C 3KEZA 5KDMC 5J90A 3FUKA 3MZLB 3UUMA 2Y6XA 3OXLA 3AA1B 5JMND 4IULA 2OV9A 3C98A 4BESA 1AP7A 5GONE 2CHZA 3LK42 3TLSA 3SFYA 5CERB 5KMGP 4G8LA 2LSVA 2WXIA 5CMWA 4EZJA 1MNEA 4ILUA 3UFGA 4B93B 2BBHA 2H7OA 4H9RC 5ENSD 2PNNA 3QWWA 3QWVA 1WM5A 4I1MA 4YVQC 4EQFA 2V6XA 4XX5A 4DX1A 4ZI3D 3VKHA 4KXKB 3AEFA 4R7LA 4IL4A 1H2VC 5DQWA 3MV3B 5JJ6A 3PU3A 3ESLA 3H37A 4MLKA 1T7SA 2JMKA 3APDA 3SNXA 5ABEA 4PNIA 4RSYA 4ZHBA 4JYAT 2E5LT 3LEWA 4WNFA 4DUIA 3KFWX 4A98A 2ZXWE 4UIGA 3LSVA 1YW0A 4UV8B 4FI5A 2CA5A 4XZCA 4DJAA 2JEKA 4XZ4A 4TXRA 4G1TA 4KHPT 3F57A 4G8KA 2LSJA 5DJQC 4U0ZA 2XY8B 5AARA 3V2OA 2K24A 2AXUA 4IDOA 4AV7A 3R7QA 3JAEA 4MBQA 4PJLA 2CCQA 1D0ZA 3K9IA 2CLYC 4CRWA 4AKIA 2BG9C 1YQ3A 4DR1T 3NBNB 3PNTB 4M3OA 2CXDA 4ILIA 2BVLA 2OA5A 4HFDA 1VOMA 3C3QA 5CMYA 4J2CA 3AG1E 2B0OE 4BA9A 5D2MC 1S64A 3FZFB 4WUYA 2BKPA 4H9PC 2WQYA 3ONLA 1D1CA 4KI0F 4I43B 2F8YA 2IAKA 2WY2A 4BTBA 4HOUA 3EVYA 3ZYLA 2WQ7A 3VU7H 4ILAA 1E7PA 2NXPA 4HRMB 4J0UA 2BBJA 2DLRA 3PE0A 2WWVA 3D9NA 3UUNA 3EIQC 2Y3AA 3AE7A 2ZM2A 4ISSA 3ASNE 3Q73A 3CHQA 5DIZA 2WS3A 3URZA 4NUVA 5AQQB 4KVOA 1J5ET 4G63A 3RPUA 3GW4A 3KEAA 3LJ3A 3L82A 3G2VA 2WXKA 4DV6T 1XGWA 2GRNB 2XS8A 3ASGA 1N0RA 2ETAA 3B7SA 3PREA 1FVFA 1BR0A 2WXOA 2ODUA 5F5WA 2PM6A 2P9IG 3WAKA 2W67A 4L7TA 4AEZC 5JJTA 1D9SA 2WXLA 2X9YA 1Z3YA 3N9LA 3NVOA 3HR0A 3QJZA 3TG4A 1HF8A 3FH5A 2HR2A 3E30A 5KWDA 4H63H 3RYIE 4L9IA 2PQNA 1G8XA 1JNRA 3FUHA 3ZU7B 4GYRA 2ZIRA 2FO7A 4GTPA 2Y4UA 3KAEA 5A1LA 4DVDA 2BG9E 5JR9A 4EXTA 4DV5T 1HS6A 2Y69E 4C91A 3AE9A 3ML8A 5EX0A 3MX3A 2JIWA 4FP7A 2ODVA 5ABGA 2IU1A 3U64A 4BSZB 1EYHA 4IGUA 3Q9DA 2JJ9A 5H6RB 5LP6E 4JW1A 3ZMVB 4UQYA 5J08A 3KD7A 2KZ7B 4LFAT 3FUIA 4Y6CA 3WG7E 4A5XA 3T9KA 3T5XA 3AG2E 4AQFC 3AXJB 1V54E 4QX7B 1TNUA 4ILHB 4HLEA 2EHOA 2UUAT 4AIFA 3FU5A 3QKYA 1KT0A 2LKHA 3F31A 4IYPA 4MLPA 4QH1A 1RZ4A 3Q5WA 1OXJA 2A5EA 4IRUA 1XWMA 1D0YA 4I4TE 1SQMA 2E5VA 4XIFA 5IY5E 3CSFA 4YTNA 3TWRA 4L2YA 2UU9T 2WU5A 4MKTA 5CFBA 4FJZA 3M65A 1M7KA 3FUJA 2DWKA 3MJXA 4PS3A 3DTOA 3AU5A 5FXXA 2C5IT 4JZYA 4HQDA 1EDUA 1KK7A 2YK0A 3RC8A 3U4TA 1OWPA 3IF8B 4JHRA 2L8KA 5AQNB 3CVQA 3UTMA 4IE7A 4XI0A 1B89A 1HG5A 4E6HA 2V7JA 5IHYA 3AG4E 4OYSA 1INZA 2NP9A 1KFYA 1WLXA 4GKKT 4AP2A 2NTXA 1LF8A 4U63A 5ENQD 2V8SV 2KZTA 3PZ4A 4GTRA 2CG2A 4GCOA 5JDNA 2XZEA 3D3MA 4UELA 2GGFA 5LG4A 3NB2A 3WI3A 4EEBA 4HBDA 2DCPA 3ZHEB 4ZFHA 5J0ZA 4JVSA 4GZDA 2V7LA 2F8XK 2XS1A 3GZSA 4CYMD 3E0ZA 3JC6D 5FMNA 2HO1A 2IOSA 5FXZA 1X79A 4Y6WA 4UWLA 4NIKA 3HXCA 3CPZA 4PUCA 2LSGA 4B89A 5AQKB 4TV3A 4DMVA 2XSAA 3GZ2A 4TZ4C 2Q9QD 3HIZA 4X20E 3ULYA 1MIYA 2BDEA 3HYMB 4DX7D 1IHGA 3VRAA 4CI2B 1UW4B 4GA1A 4ABNA 4G11A 2YOEA 2NTYA 3EU9A 4TXQA 3TWUA 5CEAA 5J2TE 2VKDA 5FYMA 3E22E 2XHEB 2N1GA 3IHVA 4MRUA 4WNDA 3MA5A 5H7PA 1MX4A 2IMLA 2ZM6T 5JDGA 4B3RT 5G04J 4JV5T 3CVNA 2Q9QB 2XAGB 3N5LA 3AS8A 2LJLA 3CLJA 2IC9A 1UN9A 4DR6T 4IE6A 4G26A 2NR4A 5FVKA 2J4BA 2R5SA 2OV8A 4UI9C 2IF4A 1N0QA 4NRHB 5HCJA 4DMWA 3L08A 3LFMA 2CHNA 3V5UA 4HGAA 3EI0A 1IKND 3IV0A 4GYYA 2VQET 1PAQA 3CKBA 3CHPA 5FY1A 3E37A 5B1AE 3FTSA 3TWTA 2L9BA 2V5QC 3D0TA 3CVVA 1NA3A 3ESKA 3L54A 5EZYE 4CDRA 2W66A 2E0IA 3MV2B 3VTXA 2P9KG 2WXJA 3SHFA 4DO0A 3C3RA 1AJ3A 2NW9A 4CXXA 5LYJE 2ZGDA 1J1JA 2VSOE 2UXCT 4I1AA 3UUXB 4WWOA 5AQTB 5FXVA 4LF6T 3GN5A 2E9XD 5LJNA 2R02A 5AQFB 4PK4A 3UQ3A 2K48A 4GK5E 3NRXA 3NWIA 2IY0C 3AU4A 5D0QD 1QZ2A 4EHMA 4AKGA 3QDNA 2F4VT 5JQGE 5KXJA 2B1EA 2J8SD 1N95A 5AQBA 5LOVE 5C1DA 3EAMA 2V4LA 3I9YA 2X38A 3EHZA 4QXBB 3TL5A 3PUVF 2E9XB 3HXDA 1N11A 3HKEE 4LF4T 4OX9T 2OOEA 3HKCE 3ZPOA 1WY6A 1N32T 1LTXA 3N9NA 4MHCA 3I4GA 4H9QC 4U2YA 1KEYA 2PZIA 3HKDE 3FP3A 3FTZA 4XE0A 3SS1A 1HFAA 3NOGD 2IONA 3RRWA 3PUZF 3RKGA 1ZEEA 3D9HA 3J5PA 3O1IA 2NSZA 4ZI2D 5FNVE 1UX5A 2X9HA 5LOZA 2A2FX 3PJAA 3UULA 3RIFA 1MIVA 2VKJA 2OEVA 4X5TA 2QA7A 4JLEA 5CGMA 3V30A 2UXDT 3SOLA 5LHIB 4X64T 2VK9A 2XQAA 4OHFA 3P4PA 3Q9NC 4ILCA 2QRXA 3CK9A 3ZUVB 1UJJA 2YDRA 3DSTA 2IHR1 2UY1A 3ZMZB 3ZSTA 2XCBA 3KV9A 1W0BA 3T1YT 4F7AA 3MKQA 3VLDA 5E0OA 2W4XA 3R7RA 4BSXA 5CECB 2JRKA 2ZM0A 3TAXA 2WBLA 4ME2A 2CEAA 3G2SA 2BG9B 3G2WA 1WYCA 3FUDA 4UQZA 4ZHQE 3EHNA 2BKNA 1U3CA 3IXEA 3PUKA 3L6AA 3UU5A 4PS8A 3UU6A 3ULQA 3ZGQA 4HFBA 3P4WA 4K5AB 2WZIA 5DQVA 5AENA 4AQGA 5LBMA 3APCA 5LA6E 2XQYA 1Z6TA 4MBGA 5JDMA 3ISMC 4HE8A 3N71A 2LOSA 2FJBA 4O2BE 4EZHA 1EPUA 4L9PA 4BJNA 2OVBA 3O4XE 4YTMA 5EYPF 3N2OA 3LY7A 3KVBA 4H7YA 1U5PA 3LK2B 4L23A 4YDWA 3T8OA 4W9RA 4V3IA 5IUXA 1S94A 1EZ3A 5HCMA 3J9X1 3HG0D 4KX6A 3ONLC 4N78D 3RC3A 2M67A 3RRNB 3ABVA 4O60A 2ILRA 4CN6A 1U4QA 3NOCD 2QZAA 4ZZBA 1NI1A 1S63A 4IE5A 5A23A 4EZLA 2XJ7A 3D9LA 4KUMB 3Q75A 4GK0E 1TYQG 3JYSA 4NURA 4I9CA 5FL0A 4KZCA 4L1BA 2PM7A 1OEDB 3NQPA 4N3AA 3ZMUB 5FVLA 3T8KA 4J7WA 2ZU6B 3B7BA 4L2LA 4C9BB 3UINC 4TWHA 4X8QA 4O1OA 3ZIMA 5G05C 3UKRG 4G2VA 1ELKA 1FT1A 4U74A 3RU0A 3IKOB 3C72A 3OKQA 3PURA 3C3OA 3S4UA 4I43A 5HEOA 2CE7A 2GRMA 3O1JA 3CHSA 1MNDA 4PK5A 4TXPA 4GMRA 1LD8A 3UX4A 3RIBA 4TUYE 3RIAA 1A17A 5ITZF 3DSSA 3KSLA 3FZHB 2V1DB 4UF0B 4ADZA 4N3CA 3TLTA 5G55A 3MYVA 1YCSB 3CVYA 3A5XA 2MYSA 5LFAA 2DI4A 2WXMA 4UWFA 4A55A 1TNZA 5JR9C 1HO8A 4EZ4A 4N2QA 3B7RL 1LD7A 2LSYA 3DXKG 4ANJA 4HEAA 3I1AA 3VRBA 5HWXA 3L09A 4F3VA 2X68A 2XTLA 1OWMA 4XAXB 4YSYA 2OLTA 4B94A 4PFOA 4P0BA 2EIME 2XCCA 3KVAA 1FT2A 1YA0A 2JQHA 3ABKE 4WW0A 3CV0A 3DSXA 2V4HC 3CKCA 3HL6A 3TWWA 3FUEA 2L6JA 1NL4A 3G2UA 4NXNT 2IOLA 3DPDA 5BMVE 4KMCA 4I2ZA 5CCLA 1LVKA 3AAEB 5FQ4A 2ACXA 4UI9K 4BWRA 4OYKA 1QUUA 5B1BE 4BERA 1E7VA 5AQVB 3JXIA 4GA2A 2VTBB 4HLLA 5EILA 4JC8A 2YU1A 3ZJ1A 3SI5A 4QWNB 3HI2A 2GROB 4KBQA 2VURA 2XSBA 3FB2A 2EHOC 3FTWA 3ENEA 4GAAA 2LKGA 3QB5A 2HHHT 5BUZA 4RG9A 2LSUA 3KSQA 2AE9A 3FZLB 2VVSA 1A5EA 3AS4A 4GA0A 3J7Yq 2KM4A 4GZ6A 5FWQA 5LXTE 3KV5A 2K3WA 3LXUX 1OY3D 4LFBT 5JA4D 4JB8P 1OCRE 3LVRE 4H7XA 3AVRA 4L5GA 3UT8A 3SY2A 5JJ7A 2VKHA 4CCAA 2RG8A 2Y48B 4AVXA 1HCIA 3GZ1A 2KXPC 4UQXA 2FF4A 1YQ4A 2X67A 2HYZA 4HFCA 2KCLA 2EIJE 4O8SA 4Z91A 1UCUA 1XDPA 3RO3A 3P7IA 1SVXA 3DEPA 3I4RB 4YSXA 5AJDA 1VDYA 2BEDA 1H6PA 5JH7E 2KBXA 5JDFA 4HRLA 2WP9A 4HI8A 3IHRA 1FMVA 4FLBA 1KNPA 4BX9A 5HKPA 4YXDA 4YFSA 3SFDA 2WVIA 4DR7T 3DSVA 3JXJA 3ML9A 3HA4A 2LE8A 2LM2A 2XQ6A 3RIUA 3HRAA 4HKAA 2P9LG 2JMHA 4N3BA 2L0TB 1S0PA 5EK3A 4BX8A 4EYYR 5AQ7A 4AXHA 1ZHCA 3LDQB 4U95D 4QX8B 5E75A 1MMDA 4C0MA 3LY8A 4U7YA 3ZMSB 3S7DA 2A9UA 3TLWA 3RRCA 4CN1A 4FU3A 3ZFWA 3JAFA 4JI8T 2AJAA 5DBKA 5AAOA 2Y1LE 1BR1A 1OCZE 2ETCA 2X6KA 3LS8A 4GYOA 5EDSA 2XENA 3UTKA 2B76A 2A5UA 3K8PC 1Q2ZA 4ATZD 4YJ3E 5LHHB 2VB6A 4U7EB 3FH8A
chains in the Genus database with same CATH topology
3VTYA 2NW7A 3TKLB 1W3BA 3MEKA 5F8PA 3U9WA 2KT9A 3RO2A 3ZHEA 3TG5A 3MACA 2CFZA 2KCKA 5EX3A 3LJCA 3CK8A 4UVAB 3P1UA 4URKA 2XPZA 4FHKA 4U0SA 3EUHA 3UPVA 3TXMA 2M63A 4J8SA 3QC1A 2V7KA 4CDNA 3U3WA 4KZ0A 2FEZA 5ADXL 5M4YA 2V0PA 4KBMB 5JDLA 1JWFA 2XHEA 3FUMA 5EKQD 2YQ8A 1H19A 3L17A 4HS2A 5LNKA 3PE4A 2Q9QA 1KLXA 4I9EA 2LOPA 5AIJA 5HYAA 4YHJA 3HDXA 3ZRHA 1D1BA 2CG3A 4ZOLE 2KNDA 3S2AA 3R6NA 1VRBA 4A56A 5KCMA 4JUYA 3MXZA 2C5KT 3CWZB 2DIWA 4WWPA 3RYFE 5CHEE 2C0MA 4YVOA 3SGHA 3MCXA 4U07A 1U3DA 4GZCA 5FZQA 5LBQB 2CXLA 4QKNA 4DI3A 1FEWA 1MIWA 3MA9A 3CHRA 2DWGA 4U8HA 3UUXA 2PQRA 3CX7B 2KC7A 4B0ZA 3ZMTB 3ZN0B 3ZN3A 3UT7A 1HZ4A 4GYSA 1ZV4X 2KWIB 5ETWA 3QARA 2V5FA 1DVPA 3C51A 2E9XA 1H2UA 5LCWC 3QWPA 4E7ZA 1QSDA 4PJJA 3OBVE 3AVSA 3I0QA 5G05J 1QQEA 4ANUA 1MMNA 2WMOA 2I6HA 2J1DG 5FY7A 4IIJE 4ASKA 4ILGA 1FIOA 5L3CB 3LBXB 5T8IA 4JEHB 3C4XA 1TJCA 4QFVA 1NZNA 4AKRB 2LAHA 4XKBA 5KJKA 4I50E 3OAWA 3ZC0A 5FQ7A 2D0TA 4AKLA 2PJQA 5AYWD 2A4ZA 4PS7A 5HXEA 5L3EB 3EDTB 3ZYKA 2BF0X 2CWOA 5FQ8A 2MTQA 2CM0A 3L13A 4GU5A 5CA1E 4ACKA 3KS2A 1E8XA 1Z3XA 4FJYA 2IFUA 3FXDB 4DK5A 1E96B 1P5QA 3RYCE 2UWJG 1Y6IA 4HXIA 4ZI3C 2V8SE 4BTAA 2X66A 3RRMB 3RK6A 3QK0A 1ELRA 2CHXA 2XAFB 1MMAA 1LKXA 3CX8B 5AJLA 4ZI7E 4OYJA 2FBNA 5ANRA 2WXNA 2XRZA 3FFLA 3CHMA 4A1SA 1ZKEA 2VGYA 3R9AB 3JCKC 3ZN1B 3SWHA 2JQQA 3VLFA 2J09A 4NQ0A 3V5SA 2XRYA 3FTYA 1HE8A 2J4DA 4DNDA 2EQXA 2I59A 4JA7A 3ZW3A 3PEVB 3ASDA 1V9DA 3C4WA 4JL0A 3ZJ2A 1YKHB 3CVLA 4CT0A 3PZDA 3CVPA 2VL8A 2WMNA 4AXPA 3OXGA 3WXXA 2VQ2A 1HXIA 5BT1A 4CI3B 3PUQA 1MQSA 4MFRA 2DHRA 4N5CA 3FTVA 2V7MA 3GA8A 5KX5E 4LRZA 3LG7A 4IDZA 5KJNA 3VHLA 3PEUB 5FP3A 4B8AA 1PC2A 3N2GE 1UG3A 2DCFA 4UF0A 5LX8A 2SPCA 3G2TA 1L5JA 3LK3B 2WSSV 2C0LA 3C64A 4NACA 1XNFA 3C4ZA 2I9CA 4Q94A 3O9XA 2DBAA 3NRYA 1D1AA 4HOSA 3IEEA 2LAIA 2R59A 5L3FB 4I55E 5HI7A 2KLQA 3BQLA 1Y8MA 3Q4AB 1E8WA 4FULA 3QC9A 1E1HB 4UVCB 1H7CA 1SZAA 2I2OA 2VTBA 4PDXA 1JUQA 4XI9A 5L2LA 4IE0A 1TEZA 3N9OA 5LP0A 4CXYA 2XAQB 3K3OA 5KJLA 3ZEFB 2MOWA 5J2UE 2CLYB 3BEEA 5BV1A 5LCYA 5JHBA 2V7IA 2K5BB 3AA6B 2VGXB 2H7VC 2YHCA 2RP4A 3BQKA 1OXZA 2WWUA 2CXFA 4LCTA 3KINB 5LJMA 4B6XA 2XASB 2VWAA 3U78A 2X6HA 2X0LB 4AI6A 1H6KA 2WXPA 1HX8A 4FADA 1WRDA 4X1IE 2X6FA 2KINB 2W00A 3NBXX 1N54A 5BV0A 1ZU2A 1IJ5A 3I3NA 3S7FA 3LY9A 1HG2A 4TV8E 4UEMA 4WNKA 2P58C 3EDUA 3QUJA 5CA0E 5FT9A 4WBNE 3CX6B 4J8EA 3HKBE 2MOZA 3FUNA 3CVUA 5FZSA 3PTRB 5L3GB 3RH3A 3FULA 2CFUA 3RKVA 5FQ6A 1TJFA 3CEQA 3QOUA 1WR6A 3IHYA 5BNWA 4ISTA 3DJBA 3JC6C 3JUIA 2I1KA 4H9SE 5C8YE 4B8CB 3UT4A 5H6QB 2A72A 3MZKB 1E90A 1O3XA 4CXWA 3Q15A 2Q9QC 4EAHA 3H3AA 2WXHA 2X6JA 4ERRA 1SZ9A 2NWBA 4QXHB 5HWYA 2L0IA 4JA9A 4YJ2E 4Z8XA 4RG6A 4YLHA 3APFA 1BR2A 4LUNU 3OYZA 3Q5XA 4HN9A 3AS5A 3Q2MA 3FU0A 3C50A 3LYAA 2KWHA 3KV4A 3NZSA 2IJGX 3LKUA 1N52A 2MRIA 1YD8G 2IC6A 2JPFA 2HH7A 3PE3A 4UXNB 3CKDA 5DABA 3L22A 4Q96A 4AOFA 5ANLA 4HOTA 3N9PA 4GMJA 1FMWA 4YNDA 2DNXA 1NA0A 3VLEA 3CR3A 2X9WA 1LRZA 4GIWA 3GWHA 4APFA 4Q69A 2LO6A 3FEXA 2LM9A 4HORA 3FUFA 2E9XC 3GYZA 3Q49B 5A7DB 3NZQA 4EYUA 3CQXC 2LSIA 3ETUA 5ARGA 4UI9J 3ZYQA 3B13A 3CSTA 2I1JA 5F3JA 3ZXSA 1SHZC 5M72A 1B7TA 4XBFB 1OWOA 3D9MA 3MGBA 4KP3C 4I6EA 3IBEA 4UWGA 1FCHA 4ZI2C 3ANWB 3FHNA 4FJOA 2GW1A 5D0OD 3PVLA 3AA0B 2XUEA 4JPSA 4APOA 3AA7B 2KCVA 4G2AA 3LBXA 2J49A 5J1GA 5JDHA 4JEHA 1NP7A 4AKHA 2FI7A 2IQCA 2GRLA 4K0RA 1E8YA 2LHRA 3W15B 2VASA 3MKDA 4WBOA 2VJ8A 2FULA 3FH7A 4I6GA 3FEYA 3QNKA 4JEUB 3BK9A 4UWHA 1MMGA 2LSKA 4DBRA 4LEUA 5BPPA 1JPLA 5KJMA 2YEVC 4HTEA 2C0SA 4XKCA 4I2WA 3QB2A 1US7B 3PUJA 2ZLYA 3P2BA 2L9QA 3MJWA 5JRCB 4KYOB 3RYHE 3ZCIA 4OVUA 2LHNA 2PG8A 1Z0PA 2AVPA 4BAYB 2PL2A 2X9XA 3NF1A 4PK6A 4K0UA 2BUGA 3DBSA 2PBIA 3LCAA 3O4ZA 3FU3A 3FTXA 4EBAG 3PNLB 3IEGA 4GOUA 3HHMA 2PFVA 1FVHA 4F53A 2LEHA 2BVMA 4WNEA 4UWKA 4K03A 2YU2A 2ZMAA 3HVEB 2HPLA 4GMLA 1IJ6A 3OYXA 3I0OA 2HM8A 3ONXA 2W61A 4P09A 4WAFA 2E2EA 2XGMA 4PAGA 2X3MA 4HFGA 4I1OB 3GMIA 3NZUA 3C98B 3ZLIA 3EHMA 3FBLA 3D9IA 1PY1A 2OVFA 3MK7C 2QFCA 4EOZB 4DBQA 3E4BA 1LVFA 2A3DA 2N9DA 2XAJB 3RRUA 2XQ0A 3QAQA 3SFZA 4WNGA 2KMFA 2JLBA 3L16A 5FXWA 2X51A 4U72A 2AXVA 3UFEA 2VKOA 3Q47B 5L3BB 3SZ7A 5G2NA 4U0UA 5CCMA 5FTPA 3CK7A 2C5JA 2WB2A 1X5BA 4GZ5A 2L3LA 3O1HA 4GCNA 5EK4A 3IBPA 3EJNA 4O2AE 1ELWA 2XAHB 3CVXA 1NAFA 1E8ZA 4I6JA 4CZZB 2WM9A 3EDVA 2QGSA 3VKGA 3JQ1A 1NWMX 1KNZA 4O6FA 4TUUA 3TXNA 1HS7A 2IW5B 1IQUA 1YKEB 3LPZA 5ENNA 3SF4A 2Q7FA 4GB9A 4JHJA 4HOQA 3B7TA 4AY6A 5IYZE 3ZEFA 1S35A 3E08A 2UXXB 4CEMA 3NZPA 1HH8A 3K3NA 2CWYA 4TN7B 5FY0A 4DI4A 4BY6A 4J8DA 4CQIA 4EPZA 4G25A 3D9KA 3PDYA 2WXFA 5JHAA 2VGXA 1CUNA 2RA1A 4PFPA 3RJVA 2BTDA 4LERA 4BJMA 2XGOA 5LHGB 4CGWA 2W63A 3SBTB 4BFRA 2QY7A 3ASHA 3CMLA 3SD5A 4KVMA 1MHQA 3CGHA 2ZM8A 2WXRA 5BW8C 3I5PA 3FWVA 4MS6A 3ONKA 4C90A 1IQRA 5JR9B 2D2SA 4H9OC 2XPIA 4C0EA 4TV9E 1D0XA 3DP7A 3FXEB 2WPVA 4IN3B 2EHOD 5AFUL 3OTNA 1QNFA 2J07A 3B57A 4WWNA 1H0AA 2NOXA 2BZBA 4KT6B 5FZRA 3N9MA 4KMOA 3ZPJA 2YINA 4J8FA 4IHJE 1JWGA 2R17C 3S7BA 4A1GA 2VSNA 4QHOA 1HTJF 2EHOB 4PH4B 3ZVVA 4JHKA 1SA0E 5EK2A 2WXGA 5T3RA 3O48A 3PDNA 4P29A 4CDMA 3BG1B 4GYWA 2Z6EA 5LGTB 4UV9B 3MKRA 4H9NC 4ATGA 2XGSA 2C2LA 4OVVA 1IZNB 4IE4A 2D0UA 4PJNA 3PUAA 3KBTA 4O4JE 2MBGA 3ZYMA 3F2EA 4BT9A 4GPKA 4TRQA 4AQFA 2H3RA 2Y8DA 2KXPB 2NW8A 4GZ3A 4FLHA 3LDZA 4O4IE 3ZC1A 4M1PA 3N9QA 4D10C 1OWAA 4OFZA 3L3PA 5C2YA 5T4YA 2VSYA 2P9BA 4H63V 4O4LE 4F1SA 5JDQA 4DLOA 4TX5A 4E85A 3QK6A 2WQ6A 2XEVA 3AAAB 5L3DB 3CVWA 3AAIA 4A3VA 2UXNB 3R84B 3KV6A 2HPJA 3K3QC 4G24A 4PW8A 2G0UA 2KZTB 4DLQA 4FC8A 1OUVA 4A3TA 5A6CA 5HAXA 1IYGA 1OWNA 4JXTA 4N39A 2WAUA 3BG0B 2D5UA 4EIWA 4AM9A 3T8MA 4MALA 4O4HE 3FHEA 4BT8A 4FA6A 1IAPA 4ZS2A 2RD0A 5ARFA 2AXZA 2YNQA 5HQ8A 3SRZA 3ETVA 4EZKA 1ZBPA 3FY4A 2WQHA 4ZS3A 4NUUA 3PU8A 4HVBA 3PRZA 1T98A 2GK9A 5HXHA 1EF1C 2YHEA 3S7JA 5JREA 4UVBB 3FTUA 4DPRA 5HXCA 3OXFA 4OK0A 4ANXA 3PS6A 4CI1B 3ASFA 4EBAA 1OWLA 1H2TC 3U3IA 4X1YE 2W0GA 2XPYA 3UMVA 3ANWA 3FBZA 2LNIA 1UX4A 1BR4A 2V26A 3OJAA 4FHJA 1E7UA 2Y4TA 2X6IA 5HXRA 3D9OA 5LGNB 3N2KE 4ANVA 4PJMA 1WAO1 4ANWA 1GW6A 3KDSE 2J9QA 4QXCB 2AWIA 5LCWJ 4EB6E 4EECA 3GN5B 3WAJA 2N2NA 4N2SA 5CB4E 3Q5MA 3JQ0A 1UN8A 2WXQA 4JEUA 3T5VA 2ONDA 3RKOA 4AJWA 3P8CD 4CGVA 5FJYA 3BQIA 3SBSA 2CHWA 2NC9A 3CHOA 5HXSA 2CMRA 4V1Av 4U04A 3ZCJA 3FU6A 3AB3B 1G73A 4L0RA 1WYBA 3CVRA 3U66A 2J08A 3B7UX 3PUSA 5JRCA 3D9JA 3D9PA 1KT1A 4AY5A 4G23A 5TAOA 2K9AA 1HU3A 3TJPA 2W62A 3KBUA 5JVDE 4RVBA 4HFVA 3CQGB 4CT4A 3EIJA 4I17A 2E8IA 1UJKA 2VSXE 3PUGA 4P0AA 4ACLA 2MHKA 5E76A 5LGUB 3FDHA 3PH0C 2ES0A 4E7SA 1Y64B 2VYIA 2AW6A 3CIAA 2KATA 4X1KE 1DNPA 3TGOA 3HVEA 2LT3A 1BPOA 3LVQE 4F6RC 2UY1B 3CQCB 3RX6A 3MKQB 3I9WA 3UT5E 5G04C 3KEZA 5KDMC 5J90A 3FUKA 3MZLB 3UUMA 2Y6XA 3OXLA 3AA1B 4IULA 3C98A 5GONE 2CHZA 3LK42 5KMGP 2LSVA 2WXIA 5CMWA 4EZJA 1MNEA 4ILUA 4H9RC 2H7OA 3QWWA 3QWVA 1WM5A 4I1MA 4YVQC 4EQFA 4XX5A 4ZI3D 3VKHA 4KXKB 4R7LA 1H2VC 5DQWA 3MV3B 5JJ6A 3PU3A 3ESLA 3H37A 4MLKA 2JMKA 3APDA 3SNXA 4PNIA 4RSYA 3LEWA 4WNFA 3KFWX 4UIGA 1YW0A 4UV8B 4FI5A 2CA5A 4XZCA 4DJAA 2JEKA 4XZ4A 4G1TA 3F57A 2LSJA 5DJQC 4U0ZA 2K24A 2AXUA 4AV7A 3R7QA 4MBQA 4PJLA 2CCQA 1D0ZA 3K9IA 2CLYC 4CRWA 4AKIA 3PNTB 4M3OA 2CXDA 4ILIA 2BVLA 2OA5A 1VOMA 5CMYA 4J2CA 4BA9A 4WUYA 4H9PC 3ONLA 1D1CA 4BTBA 4I43B 2IAKA 4HOUA 3EVYA 3ZYLA 2WQ7A 3VU7H 2NXPA 4J0UA 4J6IA 2DLRA 3PE0A 3D9NA 3EIQC 3UUNA 2Y3AA 2ZM2A 4ISSA 3CHQA 5DIZA 3URZA 4NUVA 4KVOA 4G63A 3RPUA 3GW4A 3LJ3A 3G2VA 2WXKA 1XGWA 3ASGA 3B7SA 3PREA 1FVFA 1BR0A 2WXOA 2ODUA 2PM6A 3WAKA 4L7TA 4AEZC 5JJTA 2WXLA 2X9YA 1Z3YA 3N9LA 3HR0A 3QJZA 3TG4A 1HF8A 3FH5A 2HR2A 4H63H 3RYIE 4L9IA 2PQNA 1G8XA 3FUHA 4GYRA 2FO7A 2Y4UA 3KAEA 5A1LA 4DVDA 5JR9A 4EXTA 1HS6A 4C91A 3ML8A 5EX0A 3MX3A 4FP7A 2ODVA 2IU1A 3U64A 1EYHA 4IGUA 3Q9DA 2JJ9A 5H6RB 5LP6E 4JW1A 3ZMVB 4UQYA 5J08A 3KD7A 2KZ7B 3FUIA 4Y6CA 3T5XA 4AQFC 4QX7B 4ILHB 4HLEA 2EHOA 4AIFA 3FU5A 3QKYA 1KT0A 3F31A 4IYPA 4MLPA 3Q5WA 4IRUA 1D0YA 4I4TE 1SQMA 4XIFA 3CSFA 4L2YA 4MKTA 4FJZA 3M65A 3FUJA 2DWKA 3MJXA 4PS3A 3DTOA 3AU5A 5FXXA 2C5IT 4JZYA 1EDUA 1KK7A 2YK0A 3RC8A 3U4TA 1OWPA 3IF8B 4JHRA 2L8KA 3CVQA 4IE7A 4XI0A 1B89A 1HG5A 4E6HA 2V7JA 5IHYA 4OYSA 1INZA 2NP9A 1WLXA 4AP2A 2NTXA 1LF8A 4U63A 2KZTA 2CG2A 4GCOA 5JDNA 3D3MA 4UELA 2GGFA 5LG4A 3WI3A 2DCPA 3ZHEB 4JVSA 4GZDA 2V7LA 3GZSA 3E0ZA 3JC6D 5FMNA 2HO1A 2IOSA 5FXZA 1X79A 4Y6WA 4UWLA 3CPZA 4PUCA 2LSGA 4B89A 4TV3A 4DMVA 3GZ2A 4TZ4C 2Q9QD 3HIZA 4X20E 1MIYA 2BDEA 3HYMB 1IHGA 4CI2B 1UW4B 4GA1A 4ABNA 4G11A 2NTYA 5J2TE 2VKDA 5FYMA 3E22E 2XHEB 2N1GA 3IHVA 4MRUA 4WNDA 3MA5A 5JDGA 5G04J 3CVNA 2Q9QB 2XAGB 3N5LA 3AS8A 2LJLA 3CLJA 2IC9A 1UN9A 4IE6A 4G26A 2R5SA 2J4BA 2OV8A 4UI9C 2IF4A 4NRHB 3L08A 4DMWA 3LFMA 3V5UA 4HGAA 3IV0A 4GYYA 1PAQA 3CKBA 3CHPA 5FY1A 3FTSA 2L9BA 3D0TA 3CVVA 1NA3A 3ESKA 3L54A 5EZYE 4CDRA 2E0IA 3MV2B 3VTXA 2WXJA 3SHFA 4DO0A 1AJ3A 2NW9A 4CXXA 5LYJE 2VSOE 4I1AA 3UUXB 4WWOA 5FXVA 3GN5A 2E9XD 5LJNA 3UQ3A 4PK4A 2K48A 4GK5E 3NRXA 3AU4A 5D0QD 1QZ2A 4AKGA 3QDNA 5JQGE 2B1EA 5LOVE 5C1DA 2V4LA 3I9YA 2X38A 4QXBB 3TL5A 2E9XB 3HKEE 2OOEA 3HKCE 3ZPOA 1WY6A 3N9NA 4MHCA 3I4GA 4H9QC 2PZIA 3HKDE 3FP3A 3FTZA 4XE0A 3SS1A 1HFAA 2IONA 3RRWA 1ZEEA 3O1IA 2NSZA 4ZI2D 5FNVE 1UX5A 2X9HA 5LOZA 2A2FX 3UULA 1MIVA 2VKJA 2QA7A 4JLEA 3SOLA 5LHIB 2VK9A 4OHFA 3CK9A 1UJJA 2UY1A 2XCBA 3ZMZB 3KV9A 4F7AA 3MKQA 3VLDA 5E0OA 3R7RA 4BSXA 2JRKA 2ZM0A 3TAXA 2WBLA 4ME2A 2CEAA 3G2SA 3G2WA 3FUDA 1WYCA 4UQZA 4ZHQE 3EHNA 1U3CA 3PUKA 3L6AA 4PS8A 3ULQA 3ZGQA 5DQVA 5AENA 4AQGA 5LBMA 3APCA 5LA6E 2XQYA 1Z6TA 5JDMA 4HE8A 3N71A 2LOSA 4O2BE 4EZHA 1EPUA 4BJNA 2OVBA 3O4XE 3N2OA 3LY7A 3KVBA 4H7YA 1U5PA 3LK2B 4L23A 3T8OA 4W9RA 4V3IA 1S94A 1EZ3A 3J9X1 4N78D 3RC3A 2M67A 3RRNB 2ILRA 1U4QA 4IE5A 5A23A 4EZLA 3D9LA 4KUMB 4GK0E 3JYSA 4NURA 4I9CA 4L1BA 4KZCA 2PM7A 3NQPA 4N3AA 3ZMUB 2ZU6B 4L2LA 4C9BB 3ZIMA 5G05C 4G2VA 1ELKA 4U74A 3RU0A 3IKOB 3OKQA 3PURA 4I43A 3S4UA 2CE7A 2GRMA 3O1JA 3CHSA 1MNDA 4PK5A 3UX4A 3RIBA 4TUYE 1A17A 2V1DB 4UF0B 4ADZA 4N3CA 5G55A 3MYVA 3CVYA 3A5XA 2MYSA 5LFAA 2DI4A 2WXMA 4UWFA 4A55A 5JR9C 1HO8A 4EZ4A 4N2QA 3B7RL 2LSYA 4ANJA 4HEAA 3I1AA 5HWXA 3L09A 4F3VA 2X68A 2XTLA 1OWMA 4XAXB 4B94A 4PFOA 4P0BA 2XCCA 3KVAA 1YA0A 4WW0A 3CV0A 3CKCA 3HL6A 3FUEA 2L6JA 3G2UA 3DPDA 2IOLA 5BMVE 4KMCA 4I2ZA 5CCLA 1LVKA 3AAEB 5FQ4A 2ACXA 4UI9K 4BWRA 4OYKA 1QUUA 1E7VA 4GA2A 2VTBB 4JC8A 2YU1A 3ZJ1A 3SI5A 4QWNB 3HI2A 4KBQA 3FB2A 2EHOC 3FTWA 3ENEA 4GAAA 5BUZA 4RG9A 2LSUA 3AS4A 4GA0A 3J7Yq 2KM4A 4GZ6A 5FWQA 5LXTE 3KV5A 3LXUX 3LVRE 4H7XA 3AVRA 4L5GA 3UT8A 5JJ7A 2VKHA 4CCAA 2RG8A 2Y48B 4AVXA 1HCIA 3GZ1A 4UQXA 2FF4A 2X67A 2HYZA 2KCLA 4O8SA 1UCUA 3RO3A 3P7IA 3I4RB 5AJDA 1VDYA 5JH7E 5JDFA 3IHRA 1FMVA 4FLBA 4BX9A 4YFSA 2WVIA 3ML9A 3HA4A 2LE8A 4HKAA 2JMHA 4N3BA 2L0TB 1S0PA 5EK3A 4BX8A 4EYYR 4AXHA 1ZHCA 4QX8B 5E75A 1MMDA 4C0MA 3LY8A 3ZMSB 3S7DA 4FU3A 3RRCA 3ZFWA 5DBKA 1BR1A 2X6KA 3LS8A 4GYOA 5EDSA 3UTKA 2A5UA 3K8PC 4YJ3E 5LHHB 2VB6A 3FH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIN A;  3B13 A;  2WM9 A;  3VHL A;  2WMO A;  2WMN A; 
#chains in the Genus database with same CATH topology
 3VTY A;  4TWD A;  2NW7 A;  3TKL B;  1W3B A;  3MEK A;  4DR3 T;  5F8P A;  3U9W A;  1E2A A;  2KT9 A;  3RO2 A;  3ZHE A;  3EUV A;  3TG5 A;  3MAC A;  2CFZ A;  2KCK A;  5CRU A;  5EX3 A;  3LJC A;  3CK8 A;  5AQM B;  2YDQ A;  4UVA B;  3BUA A;  3P1U A;  4URK A;  2XPZ A;  4FHK A;  4U0S A;  3EUH A;  4DRX E;  3UPV A;  3TXM A;  2M63 A;  4J8S A;  3QC1 A;  1N4R A;  4LNB A;  2V7K A;  4CDN A;  3UIP C;  3U3W A;  4KZ0 A;  2FEZ A;  5ADX L;  3UQ4 A;  5M4Y A;  2V0P A;  4KBM B;  5JDL A;  1W09 A;  5ENT D;  1JWF A;  5CED B;  2XHE A;  3FUM A;  5EKQ D;  2YQ8 A;  1H19 A;  3L17 A;  4HS2 A;  5LNK A;  3PE4 A;  2Q9Q A;  1U2V G;  1KLX A;  1L0V A;  4I9E A;  2LOP A;  5AIJ A;  2LUH A;  5HYA A;  1BU9 A;  4YHJ A;  3HDX A;  4JI4 T;  5HEU A;  3J5Q B;  3ZRH A;  1D1B A;  2LXM A;  4LF8 T;  2FJD A;  4ZOL E;  2CG3 A;  1Z8U A;  2KND A;  3S2A A;  3R6N A;  1VRB A;  4A56 A;  5HEJ A;  1BI8 B;  5KCM A;  3RAU A;  4JUY A;  3MXZ A;  4JI6 T;  2C5K T;  3CWZ B;  2DIW A;  4WWP A;  3RYF E;  5CHE E;  4O1P A;  4M7C A;  1WR0 A;  2C0M A;  4YVO A;  4LFC T;  3W9F A;  3SGH A;  3DEO A;  1N33 T;  3MCX A;  4U07 A;  4B3T T;  1U3D A;  3P4Q A;  4GZC A;  5FZQ A;  5LBQ B;  2LXL A;  2CPT A;  2CXL A;  4QKN A;  4DI3 A;  1FEW A;  1MIW A;  3MA9 A;  1H6O A;  3CHR A;  2DWG A;  1ZP0 A;  4U8H A;  2AXD S;  3UUX A;  2PQR A;  3CX7 B;  4IDN A;  2KC7 A;  4B0Z A;  3ZMT B;  5CRV A;  3VR9 A;  3ZN0 B;  3ZN3 A;  3UT7 A;  1HZ4 A;  4GYS A;  1ZV4 X;  2KWI B;  4UR9 A;  5ETW A;  1HX1 B;  1WCR A;  3QAR A;  3F6Q A;  2V5F A;  1DVP A;  3C51 A;  4NPP A;  2E9X A;  1H2U A;  1O1T A;  5LCW C;  2JQK A;  2XQ5 A;  3QWP A;  4YY3 T;  4E7Z A;  1QSD A;  4PJJ A;  3OBV E;  3AVS A;  3I0Q A;  5G05 J;  1QQE A;  4ANU A;  1MMN A;  2WMO A;  2I6H A;  2J1D G;  5FY7 A;  4IIJ E;  2NYJ A;  3CIR A;  4ASK A;  1FIO A;  4ILG A;  5L3C B;  3LBX B;  3ASO E;  5T8I A;  1NEN A;  3C4X A;  4JEH B;  1TJC A;  1HNW T;  4QFV A;  1NZN A;  4AKR B;  2LAH A;  4XKB A;  4JI5 T;  5KJK A;  3AE6 A;  4I50 E;  3OAW A;  3ZC0 A;  4TNV A;  2D0T A;  5FQ7 A;  3E33 A;  4AKL A;  2PJQ A;  5AYW D;  2A4Z A;  4PS7 A;  4NIQ A;  2CBJ A;  4ZZC A;  3LJN A;  2P9P G;  3UU4 A;  5HXE A;  5L3E B;  3EDT B;  3ZYK A;  2BF0 X;  2CWO A;  4X65 T;  5FQ8 A;  2QYJ A;  2MTQ A;  2CM0 A;  3L13 A;  4GU5 A;  5CA1 E;  4ACK A;  3KS2 A;  2RKK A;  4XEI G;  2XM2 A;  1E8X A;  1Z3X A;  4FJY A;  2IFU A;  3FXD B;  4DK5 A;  3QOF A;  1E96 B;  5JTG A;  1P5Q A;  3RYC E;  2UWJ G;  1Y6I A;  4HXI A;  2BG9 A;  4ZI3 C;  2V8S E;  5AQJ B;  4BTA A;  2X66 A;  4J6I A;  3RRM B;  2ETB A;  3RK6 A;  3QK0 A;  1ELR A;  2FJE A;  2CHX A;  3OTO T;  2XAF B;  1MMA A;  1LKX A;  3CX8 B;  5AJL A;  4ZI7 E;  2I0M A;  4OYJ A;  2FBN A;  2RFA A;  5ANR A;  2WXN A;  2XRZ A;  3FFL A;  2VL0 A;  3CHM A;  4A1S A;  4B3S T;  3SO8 A;  1ZKE A;  2VGY A;  2MYO A;  3JCK C;  3R9A B;  4HFI A;  3ZN1 B;  3SWH A;  1JCS A;  2JQQ A;  3VLF A;  2J09 A;  5CJ5 A;  4NQ0 A;  3V5S A;  1N4P A;  2XRY A;  3FTY A;  3SFX A;  1HE8 A;  2P2C P;  3RGL A;  4DND A;  2J4D A;  2EQX A;  2I59 A;  4JA7 A;  1JCR A;  2WZH A;  4GTS A;  3ZW3 A;  3PEV B;  3ASD A;  1V9D A;  3C4W A;  2H6F A;  4JL0 A;  3ZJ2 A;  1YKH B;  3JCF A;  4GTO A;  4DV2 T;  3CVL A;  4CT0 A;  2XM1 A;  3PZD A;  3CVP A;  3AEC A;  2VL8 A;  3ZT7 A;  2WMN A;  4AXP A;  4AIU A;  4F6R D;  4COF A;  3OXG A;  3WXX A;  5AQH B;  5AQO B;  4ZEY A;  1OED A;  2VQ2 A;  4JI7 T;  2P9U G;  1HXI A;  3EHQ A;  5BT1 A;  4CI3 B;  3PUQ A;  1MQS A;  4QQI A;  3ZXP A;  2M6B A;  3RQW A;  4MFR A;  4Z68 A;  1V55 E;  2DHR A;  2XPK A;  4N5C A;  3UKU G;  3AEE A;  3FTV A;  2R03 A;  2V7M A;  1N36 T;  3GA8 A;  5KX5 E;  4LRZ A;  2XQ8 A;  3LG7 A;  4IDZ A;  4X66 T;  4HB5 A;  5KJN A;  4JBW F;  3VHL A;  3PEU B;  5FP3 A;  4LF5 T;  4B8A A;  3G06 A;  1PC2 A;  3N2G E;  4YDY A;  2CHO A;  4DR4 T;  4OAV B;  2DCF A;  1UG3 A;  2MAW A;  4UF0 A;  5LX8 A;  2SPC A;  3G2T A;  1L5J A;  1XNR T;  3LK3 B;  2WSS V;  2C0L A;  3C64 A;  1MZC A;  4NAC A;  2F0Y A;  1XNF A;  3C4Z A;  1SE7 A;  1SW6 A;  2I9C A;  4Q94 A;  1KPS B;  5C3J A;  2JQ9 A;  3AE3 A;  3SQV A;  3O9X A;  2DBA A;  3NRY A;  3DWL G;  2EIK E;  1D1A A;  4HOS A;  3IEE A;  2LAI A;  2R59 A;  5L3F B;  4I55 E;  5HI7 A;  2KLQ A;  3BQL A;  1Y8M A;  3Q4A B;  1E8W A;  4FUL A;  3QC9 A;  4HFE A;  1XZY A;  1E1H B;  4UVC B;  1H7C A;  4YHH T;  4DUZ T;  1SZA A;  2I2O A;  2VTB A;  4PDX A;  1JUQ A;  4XI9 A;  2D9D A;  3AE5 A;  5L2L A;  4IE0 A;  1BLX B;  2V5D A;  1TEZ A;  2YN6 A;  3N9O A;  4HWD A;  5LP0 A;  4CXY A;  4KHZ F;  3ABL E;  2XAQ B;  5ABF B;  3K3O A;  4U3C A;  3ZEF B;  5KJL A;  2MOW A;  5J2U E;  2CLY B;  2H6G A;  4LNG A;  3BEE A;  4JI3 T;  3DXM G;  2WDR A;  1WG0 A;  4DV4 T;  5BV1 A;  5LCY A;  4HRN A;  5JHB A;  2BKK B;  1WDY A;  2V7I A;  2K5B B;  3AA6 B;  3RIU C;  3V2X A;  2VGX B;  2WDV A;  1VCS A;  2H7V C;  2YHC A;  2RP4 A;  3BQK A;  3W9G A;  1OXZ A;  3RHW A;  2WWU A;  1Z5S C;  2CXF A;  4LCT A;  3KIN B;  5LJM A;  4B6X A;  2XAS B;  2VWA A;  3U78 A;  2X6H A;  2X0L B;  5LG3 A;  4AI6 A;  1H6K A;  5CBO A;  2WXP A;  4LNU D;  1HX8 A;  4FAD A;  1WRD A;  4X1I E;  2DVW A;  2X6F A;  2KIN B;  1N34 T;  2W00 A;  5L4H A;  2J4G A;  3NBX X;  3NKZ A;  1N54 A;  1IJ5 A;  1ZU2 A;  3I3N A;  5BV0 A;  3S7F A;  3LY9 A;  1HG2 A;  4TV8 E;  4UEM A;  4HWF A;  4WNK A;  2P58 C;  3EDU A;  3ZKJ A;  2JAB A;  3QUJ A;  5CA0 E;  3AED A;  5FT9 A;  4WBN E;  5L47 A;  3TWS A;  3CX6 B;  1KNR A;  4X62 T;  4J8E A;  3HKB E;  4LF9 T;  3PUY F;  2MOZ A;  3FUN A;  3CVU A;  5LB7 B;  2RPA A;  2V6Y B;  5FZS A;  3PTR B;  1VCT A;  5L3G B;  1QYM A;  3RH3 A;  3FUL A;  1QBQ A;  2CFU A;  3RKV A;  5FQ6 A;  1TJF A;  3CEQ A;  2P9S G;  2V5C A;  5BXO A;  1D8D A;  3QOU A;  1WR6 A;  3IHY A;  5BNW A;  5LMN T;  2XQ7 A;  1XMO T;  5FIO A;  4IST A;  3NAW A;  3DJB A;  2QC9 A;  5FL1 A;  3JC6 C;  1T8B A;  3JUI A;  2I1K A;  4H9S E;  5C8Y E;  4B8C B;  3Q5E A;  3UT4 A;  2DYS E;  5EN5 D;  5H6Q B;  2A72 A;  3MZK B;  1E90 A;  1TN7 A;  1O3X A;  4CXW A;  3Q15 A;  2Q9Q C;  4EAH A;  3H3A A;  2XZD G;  4GKJ T;  2X6J A;  2WXH A;  4IL9 A;  2WB5 A;  4ERR A;  1SZ9 A;  2NWB A;  4QXH B;  1X81 A;  4QH5 A;  5HWY A;  2RFM A;  2L0I A;  4JA9 A;  4YJ2 E;  4Z8X A;  3DRA A;  4U8Y D;  4RG6 A;  4YLH A;  3APF A;  1BR2 A;  5IWA T;  4LUN U;  3OYZ A;  4Z90 A;  4N5Q A;  4RQI A;  1I6Z A;  3Q5X A;  4HN9 A;  3P4S A;  3AS5 A;  1KF6 A;  3Q2M A;  3FU0 A;  4HFH A;  2BKG A;  2YDS A;  3C50 A;  3LYA A;  2KWH A;  3KV4 A;  3Q7F A;  3NZS A;  2FO1 E;  3FZM B;  2IJG X;  3LKU A;  1N52 A;  2MRI A;  3AEB A;  1YD8 G;  2IC6 A;  2JPF A;  5AQU B;  2HH7 A;  2IO2 C;  1UGO A;  4F8H A;  3PE3 A;  2WU2 A;  5AQ9 A;  4TNW A;  4UXN B;  3CKD A;  5DAB A;  3L22 A;  4Q96 A;  4AOF A;  2XZT G;  5ANL A;  4CZ2 D;  4HOT A;  3N9P A;  4GMJ A;  1FMW A;  2QVA A;  4GTQ A;  4YND A;  2DNX A;  1NA0 A;  3VLE A;  3CR3 A;  2X9W A;  1TNB A;  1LRZ A;  4GIW A;  3GWH A;  4APF A;  4Q69 A;  3UM3 A;  1MX6 A;  4GTT A;  2LO6 A;  2BS2 A;  2LM9 A;  3FEX A;  4HOR A;  3AXJ A;  3FUF A;  1IHB A;  1UUS A;  2E9X C;  3GYZ A;  3Q49 B;  2XQ9 A;  5AQL B;  5A7D B;  1KZO A;  3NZQ A;  3TWQ A;  4EYU A;  3CQX C;  4K0K T;  2LSI A;  4JI1 T;  3ETU A;  5ARG A;  1UOH A;  4UI9 J;  3ZYQ A;  2YKS A;  1QLB A;  3B13 A;  2DWZ A;  3CST A;  5EYL A;  1I94 T;  2I1J A;  3PUX F;  5F3J A;  3DSW A;  1KZP A;  1IBM T;  1X9B A;  3ZXS A;  1SHZ C;  3AAA C;  1R8I A;  5M72 A;  1B7T A;  1K1A A;  3AE2 A;  4XBF B;  4JI2 T;  4UUC A;  1OWO A;  3D9M A;  1W0A A;  2DL1 A;  4KP3 C;  3QNU A;  1HNX T;  3MGB A;  3QB5 K;  2IDO B;  4I6E A;  1GQE A;  3IBE A;  4DID B;  4B3M T;  1RW2 A;  2GRQ B;  1FCH A;  4UWG A;  4ZI2 C;  3ANW B;  3FHN A;  4FJO A;  1DC2 A;  2GW1 A;  5D0O D;  1XMQ T;  3P4R A;  3AA0 B;  3PVL A;  2XUE A;  5EIB E;  4JPS A;  4APO A;  3AA7 B;  1AWC B;  3UXG A;  4U7I A;  1TNY A;  2KCV A;  1D8E A;  4G2A A;  1TN8 A;  4HI9 A;  1N94 A;  4QH4 A;  3LBX A;  2J49 A;  5J1G A;  5JDH A;  1IXV A;  4JEH A;  1NP7 A;  4AKH A;  2FI7 A;  2IQC A;  2GRL A;  2VGE A;  4K0R A;  4RLY A;  1E8Y A;  4LG6 A;  2LHR A;  3W15 B;  2XQ3 A;  2VAS A;  3MKD A;  4WBO A;  2VJ8 A;  2FUL A;  3FH7 A;  4I6G A;  3UQ7 A;  3FEY A;  3QNK A;  5D66 A;  4JEU B;  3BK9 A;  4UWH A;  2R2L A;  1MMG A;  2LSK A;  3AEA A;  4DBR A;  4LEU A;  1JPL A;  5BPP A;  5KJM A;  4IRE A;  5B3S E;  2YEV C;  2VQF T;  5HEH A;  4HTE A;  2C0S A;  5AQR B;  4XKC A;  2PTF A;  4I2W A;  3QB2 A;  1US7 B;  3PUJ A;  2ZLY A;  3P2B A;  2IIU A;  2L9Q A;  2XEE A;  4F1P A;  2FBW A;  5ENP D;  3MJW A;  5JRC B;  4KYO B;  3RYH E;  3HXF A;  3PV0 F;  4LF7 T;  3PZ3 A;  1MX2 A;  3ZCI A;  4OVU A;  3TWX A;  4JI0 T;  2LHN A;  2PG8 A;  1Z0P A;  2AVP A;  4BAY B;  2PL2 A;  1YXR A;  2WCA A;  2X9X A;  3NF1 A;  4PK6 A;  3RF1 A;  4K0U A;  2BUG A;  3DBS A;  2PBI A;  3LCA A;  3O4Z A;  1BD8 A;  1OED C;  3FU3 A;  3FTX A;  4EBA G;  3PNL B;  2OEW A;  3IEG A;  4GOU A;  4A97 A;  3HHM A;  2PFV A;  1FVH A;  4GPM A;  2LEH A;  5BR8 T;  2UUC T;  2BVM A;  4F53 A;  4WNE A;  3OPC A;  4UWK A;  4K03 A;  2YU2 A;  2ZMA A;  3HVE B;  1SA5 A;  2HPL A;  5CBN A;  4GML A;  1IJ6 A;  3OYX A;  3I0O A;  2HM8 A;  3ONX A;  2W61 A;  4P09 A;  2H6I A;  4WAF A;  1K3Z D;  3TLV A;  2E2E A;  2XGM A;  4PAG A;  2X3M A;  4HFG A;  4I1O B;  3GMI A;  3NZU A;  3C98 B;  2QYU A;  3ZLI A;  5AQA A;  3EHM A;  3FBL A;  5C2T A;  3D9I A;  1PY1 A;  2OVF A;  3MK7 C;  1T72 A;  2QFC A;  3UIO C;  4EOZ B;  4DBQ A;  1K1B A;  2DZO A;  3H3M A;  1LVF A;  3E4B A;  2A3D A;  4Q25 A;  2N9D A;  2XAJ B;  3RRU A;  2XQ0 A;  2DZN A;  3QAQ A;  3SFZ A;  4WNG A;  2KMF A;  2JLB A;  2L6B A;  3L16 A;  5FXW A;  3R9M A;  2X51 A;  4U72 A;  4LMJ A;  2AXV A;  5HRY A;  3V79 K;  3UFE A;  2VKO A;  2GRP B;  3Q47 B;  4U33 A;  5L3B B;  3SZ7 A;  4EGW A;  4U0U A;  5G2N A;  5FIN A;  3EU5 A;  5CCM A;  4LSZ E;  5FTP A;  3CK7 A;  2C5J A;  1N9A A;  2WB2 A;  1YMP A;  1DCQ A;  1SA4 A;  4U2Z A;  1X5B A;  4GZ5 A;  2L3L A;  3O1H A;  4GCN A;  4U31 A;  5EK4 A;  3IBP A;  3EJN A;  1W9R A;  2QYW A;  4O2A E;  4WYV A;  1ELW A;  3UU8 A;  2XAH B;  2FUP A;  4BET A;  2J62 A;  1OED E;  3OVU A;  3CVX A;  1NAF A;  3E34 A;  4OAU C;  1E8Z A;  4AQY T;  4I6J A;  4CZZ B;  3AJI A;  2WM9 A;  4GTM A;  3EDV A;  2QGS A;  2LRL A;  3VKG A;  3JQ1 A;  1HR0 T;  3PUW F;  1NWM X;  3Q5D A;  1N4Q A;  1KNZ A;  4O6F A;  4TUU A;  2BS3 A;  3TXN A;  1HS7 A;  1OT8 A;  1FJG T;  2IW5 B;  2X0H A;  1IQU A;  2ZIS A;  1NEK A;  1YKE B;  3LPZ A;  3UUB A;  5ENN A;  3L9T A;  4P1N A;  2Q7F A;  3SF4 A;  2ACZ A;  4GB9 A;  2M6I A;  1JCQ A;  4JHJ A;  4HOQ A;  3RI5 A;  3B7T A;  4AY6 A;  5IYZ E;  5ENO D;  5ABF A;  3ONJ A;  3ZEF A;  3EHR A;  1S35 A;  3E08 A;  2UXX B;  1DU2 A;  4CEM A;  3NZP A;  1HH8 A;  1WFD A;  2IUB A;  3K3N A;  2CWY A;  3PZ1 A;  4TN7 B;  2XEH A;  5FY0 A;  3Q79 A;  1M62 A;  3DPY A;  4DX5 D;  4DI4 A;  4BY6 A;  1CHU A;  1OCC E;  4J8D A;  4CQI A;  4EPZ A;  4G25 A;  3D9K A;  3PDY A;  2WXF A;  3TWV A;  5JHA A;  4DR5 T;  2VGX A;  1CUN A;  2RA1 A;  4PFP A;  4DUY T;  3RJV A;  2BTD A;  2HE0 A;  1O1S A;  2LRK A;  4LER A;  4BJM A;  3AEG A;  2XGO A;  5LHG B;  4CGW A;  2W63 A;  3SBT B;  4BFR A;  4LMK A;  1ZB1 A;  5ABH A;  4WZX A;  2QY7 A;  4LML A;  3ASH A;  3CML A;  3SD5 A;  4KVM A;  1MHQ A;  3CGH A;  4K5B A;  2ZM8 A;  4TUM A;  2WXR A;  5BW8 C;  3I5P A;  2CRB A;  1TR4 A;  3B5M A;  3FWV A;  3JUE A;  4MS6 A;  3X1D A;  3ONK A;  3C5R A;  4C90 A;  4I0U A;  1IQR A;  5JR9 B;  2D2S A;  4H9O C;  4YSZ A;  4IDQ A;  2XPI A;  4C0E A;  4TV9 E;  4C48 B;  1ZOY A;  1D0X A;  3DP7 A;  3A8Y C;  2W2U A;  4DV7 T;  3FXE B;  1SUM B;  2WPV A;  1IBK T;  4ILB A;  2IEJ A;  1N4S A;  4IN3 B;  2EHO D;  2KSR A;  5AFU L;  3OTN A;  2Y0B G;  1QNF A;  2J07 A;  3B57 A;  4WWN A;  2V6Y A;  1H0A A;  2NOX A;  3A7M A;  2BZB A;  3M3Z B;  1MJ0 A;  4KT6 B;  5FZR A;  3N9M A;  4KMO A;  3ZPJ A;  2YIN A;  2H6H A;  2BKO A;  4J8F A;  4IHJ E;  1JWG A;  2R17 C;  3S7B A;  4A1G A;  2VSN A;  4QHO A;  4NXM T;  1HTJ F;  2EHO B;  4PH4 B;  3ZVV A;  4JHK A;  1SA0 E;  5KNH D;  3CK6 A;  5EK2 A;  2WXG A;  2EIN E;  5T3R A;  3O48 A;  3PDN A;  4P29 A;  4CDM A;  4EV6 A;  4BEP A;  5ENR D;  3BG1 B;  5AN8 A;  3UM0 A;  4GYW A;  1DCE A;  2Z6E A;  5LGT B;  4UV9 B;  3MKR A;  4H9N C;  4ATG A;  1MYO A;  2XGS A;  2C2L A;  4OVV A;  1IZN B;  4IE4 A;  2D0U A;  5AQP B;  4PJN A;  5BXU A;  3PZ2 A;  3PUA A;  3KBT A;  2LLY A;  4O4J E;  1TN6 A;  2MBG A;  3ZYM A;  3F2E A;  3BQO A;  4BT9 A;  4GPK A;  1J5W A;  4AQF A;  2H89 A;  2H3R A;  4TRQ A;  2E2A A;  2KXP B;  2NW8 A;  2Y8D A;  3AE4 A;  4YTP A;  4GZ3 A;  3X2Q E;  5HEG A;  2UUB T;  2F37 A;  4FLH A;  2CBI A;  4O4I E;  4TWF A;  3ZC1 A;  3LDZ A;  1YYH A;  4M1P A;  3N9Q A;  4D10 C;  3ZT6 A;  1OWA A;  4OFZ A;  5L4E A;  3L3P A;  5C2Y A;  5T4Y A;  2VSY A;  2P9B A;  4H63 V;  4O4L E;  1XNQ T;  1XDO A;  4F1S A;  3HXB A;  5JDQ A;  4DLO A;  4TX5 A;  4E85 A;  3QK6 A;  2EIL E;  2XEV A;  2WQ6 A;  3AAA B;  5L3D B;  3CVW A;  2HN2 A;  3BU8 A;  3SFE A;  3AAI A;  4A3V A;  3T1H T;  3Q7A A;  2UXN B;  3R84 B;  3KV6 A;  2HPJ A;  3K3Q C;  4A63 B;  4G24 A;  4PW8 A;  2G0U A;  2KZT B;  4DLQ A;  5HS0 A;  4FC8 A;  1OUV A;  5EID A;  2R05 A;  3Q78 A;  4A3T A;  5A6C A;  5HAX A;  2MPK A;  3B95 A;  4EED A;  1IYG A;  4DR2 T;  1OWN A;  4JXT A;  4N39 A;  2WAU A;  2WDQ A;  3BG0 B;  2D5U A;  1UK5 A;  4EIW A;  4AM9 A;  3T8M A;  4U96 D;  4MAL A;  4O4H E;  3FHE A;  4BT8 A;  2IO3 C;  2XQ4 A;  4FA6 A;  1IAP A;  3VR8 A;  4ZS2 A;  2RD0 A;  1JNZ A;  5ARF A;  2AXZ A;  1K8K G;  2YNQ A;  5HQ8 A;  3SRZ A;  3ETV A;  4AIS A;  4EZK A;  1ZBP A;  4YDO A;  3FY4 A;  4GTV A;  2WQH A;  5AQG B;  2B6C A;  4ZS3 A;  4NUU A;  3FZK B;  3UI2 A;  3PU8 A;  4HVB A;  3PRZ A;  1T98 A;  2GK9 A;  1NFI E;  3ZKR A;  2ZGG A;  5HXH A;  1EF1 C;  2YHE A;  5AQI B;  3S7J A;  4DX6 D;  5JRE A;  4J8Y A;  2VVN A;  4UVB B;  3FTU A;  2P9N G;  3AE8 A;  4DPR A;  5HXC A;  3OXF A;  4OK0 A;  3L8R A;  4ANX A;  1O1R A;  4DX2 A;  3PS6 A;  3UU3 A;  4CI1 B;  3ASF A;  4EBA A;  1OWL A;  2GRR B;  3AG3 E;  1H2T C;  1IBL T;  3U3I A;  4X1Y E;  2W0G A;  2XPY A;  3UMV A;  3ANW A;  3FBZ A;  2LNI A;  1UX4 A;  1BR4 A;  2V26 A;  3OJA A;  5FKY A;  3DSU A;  4FHJ A;  1E7U A;  1G3N B;  2Y4T A;  2X6I A;  5HXR A;  3D9O A;  5LGN B;  1Y01 A;  3N2K E;  4ANV A;  1BI7 B;  3PJA J;  4PJM A;  1WAO 1;  3UM1 A;  4ANW A;  4IDP A;  4JD2 G;  2H88 A;  5KBA A;  1GW6 A;  3KDS E;  2J9Q A;  4QXC B;  2R6G F;  2AWI A;  5LCW J;  4EB6 E;  2X0Y A;  3GN5 B;  4HWC A;  3ZNG A;  4EEC A;  3WAJ A;  2N2N A;  3ZT5 A;  4N2S A;  5CB4 E;  3Q5M A;  3JQ0 A;  4IT4 A;  3RQU A;  4HWI B;  1UN8 A;  2UXB T;  2WXQ A;  4JEU A;  3T5V A;  2OND A;  3RKO A;  4AJW A;  3P8C D;  4CGV A;  1O5M A;  5FJY A;  3BQI A;  3TLU A;  3SBS A;  2CHW A;  2NC9 A;  3CHO A;  4YT0 A;  5HXS A;  3RLF F;  3ZSS A;  2CMR A;  4V1A v;  1HNZ T;  4U04 A;  3ZCJ A;  2J47 A;  3FU6 A;  3AB3 B;  3E32 A;  4K5C A;  1G73 A;  4U8V D;  1FPP A;  4L0R A;  3ULE G;  1WYB A;  3CVR A;  4CN4 A;  3U66 A;  3RSE G;  3L39 A;  4DV0 T;  2J08 A;  3B7U X;  3PUS A;  3IA3 A;  5JRC A;  3D9J A;  3D9P A;  1KT1 A;  2BS4 A;  3Q9U C;  4YDE A;  4AY5 A;  2OCC E;  3AE1 A;  4G23 A;  5TAO A;  4HNA D;  2K9A A;  1HU3 A;  3TJP A;  2W62 A;  3KBU A;  5JVD E;  3V31 A;  4RVB A;  4DV3 T;  1TNO A;  3ABM E;  4HFV A;  3CQG B;  3HXE A;  4CT4 A;  3UM2 A;  5LMU T;  3EIJ A;  2HN1 A;  4I17 A;  3EAB A;  2E8I A;  3JAD A;  4ZXL A;  2DYR E;  1UJK A;  3P50 A;  4DV1 T;  2VSX E;  3PUG A;  4P0A A;  4ACL A;  2MHK A;  5E76 A;  5LGU B;  3FDH A;  3PH0 C;  2ES0 A;  4E7S A;  1Y64 B;  2VYI A;  2AW6 A;  3CIA A;  5KNG A;  2FJA A;  4HWH A;  2KAT A;  4X1K E;  1DNP A;  3TGO A;  2LT3 A;  3HVE A;  3K1S A;  1S70 B;  1UUR A;  1BPO A;  3LVQ E;  1OCO E;  4F6R C;  2UY1 B;  3CQC B;  5AQS B;  3RX6 A;  3MKQ B;  3I9W A;  3UT5 E;  5G04 C;  3KEZ A;  5KDM C;  5J90 A;  3FUK A;  3MZL B;  3UUM A;  2Y6X A;  3OXL A;  3AA1 B;  5JMN D;  4IUL A;  2OV9 A;  3C98 A;  4BES A;  1AP7 A;  5GON E;  2CHZ A;  3LK4 2;  3TLS A;  3SFY A;  5CER B;  5KMG P;  4G8L A;  2LSV A;  2WXI A;  5CMW A;  4EZJ A;  1MNE A;  4ILU A;  3UFG A;  4B93 B;  2BBH A;  2H7O A;  4H9R C;  5ENS D;  2PNN A;  3QWW A;  3QWV A;  1WM5 A;  4I1M A;  4YVQ C;  4EQF A;  2V6X A;  4XX5 A;  4DX1 A;  4ZI3 D;  3VKH A;  4KXK B;  3AEF A;  4R7L A;  4IL4 A;  1H2V C;  5DQW A;  3MV3 B;  5JJ6 A;  3PU3 A;  3ESL A;  3H37 A;  4MLK A;  1T7S A;  2JMK A;  3APD A;  3SNX A;  5ABE A;  4PNI A;  4RSY A;  4ZHB A;  4JYA T;  2E5L T;  3LEW A;  4WNF A;  4DUI A;  3KFW X;  4A98 A;  2ZXW E;  4UIG A;  3LSV A;  1YW0 A;  4UV8 B;  4FI5 A;  2CA5 A;  4XZC A;  4DJA A;  2JEK A;  4XZ4 A;  4TXR A;  4G1T A;  4KHP T;  3F57 A;  4G8K A;  2LSJ A;  5DJQ C;  4U0Z A;  2XY8 B;  5AAR A;  3V2O A;  2K24 A;  2AXU A;  4IDO A;  4AV7 A;  3R7Q A;  3JAE A;  4MBQ A;  4PJL A;  2CCQ A;  1D0Z A;  3K9I A;  2CLY C;  4CRW A;  4AKI A;  2BG9 C;  1YQ3 A;  4DR1 T;  3NBN B;  3PNT B;  4M3O A;  2CXD A;  4ILI A;  2BVL A;  2OA5 A;  4HFD A;  1VOM A;  3C3Q A;  5CMY A;  4J2C A;  3AG1 E;  2B0O E;  4BA9 A;  5D2M C;  1S64 A;  3FZF B;  4WUY A;  2BKP A;  4H9P C;  2WQY A;  3ONL A;  1D1C A;  4KI0 F;  4I43 B;  2F8Y A;  2IAK A;  2WY2 A;  4BTB A;  4HOU A;  3EVY A;  3ZYL A;  2WQ7 A;  3VU7 H;  4ILA A;  1E7P A;  2NXP A;  4HRM B;  4J0U A;  2BBJ A;  2DLR A;  3PE0 A;  2WWV A;  3D9N A;  3UUN A;  3EIQ C;  2Y3A A;  3AE7 A;  2ZM2 A;  4ISS A;  3ASN E;  3Q73 A;  3CHQ A;  5DIZ A;  2WS3 A;  3URZ A;  4NUV A;  5AQQ B;  4KVO A;  1J5E T;  4G63 A;  3RPU A;  3GW4 A;  3KEA A;  3LJ3 A;  3L82 A;  3G2V A;  2WXK A;  4DV6 T;  1XGW A;  2GRN B;  2XS8 A;  3ASG A;  1N0R A;  2ETA A;  3B7S A;  3PRE A;  1FVF A;  1BR0 A;  2WXO A;  2ODU A;  5F5W A;  2PM6 A;  2P9I G;  3WAK A;  2W67 A;  4L7T A;  4AEZ C;  5JJT A;  1D9S A;  2WXL A;  2X9Y A;  1Z3Y A;  3N9L A;  3NVO A;  3HR0 A;  3QJZ A;  3TG4 A;  1HF8 A;  3FH5 A;  2HR2 A;  3E30 A;  5KWD A;  4H63 H;  3RYI E;  4L9I A;  2PQN A;  1G8X A;  1JNR A;  3FUH A;  3ZU7 B;  4GYR A;  2ZIR A;  2FO7 A;  4GTP A;  2Y4U A;  3KAE A;  5A1L A;  4DVD A;  2BG9 E;  5JR9 A;  4EXT A;  4DV5 T;  1HS6 A;  2Y69 E;  4C91 A;  3AE9 A;  3ML8 A;  5EX0 A;  3MX3 A;  2JIW A;  4FP7 A;  2ODV A;  5ABG A;  2IU1 A;  3U64 A;  4BSZ B;  1EYH A;  4IGU A;  3Q9D A;  2JJ9 A;  5H6R B;  5LP6 E;  4JW1 A;  3ZMV B;  4UQY A;  5J08 A;  3KD7 A;  2KZ7 B;  4LFA T;  3FUI A;  4Y6C A;  3WG7 E;  4A5X A;  3T9K A;  3T5X A;  3AG2 E;  4AQF C;  3AXJ B;  1V54 E;  4QX7 B;  1TNU A;  4ILH B;  4HLE A;  2EHO A;  2UUA T;  4AIF A;  3FU5 A;  3QKY A;  1KT0 A;  2LKH A;  3F31 A;  4IYP A;  4MLP A;  4QH1 A;  1RZ4 A;  3Q5W A;  1OXJ A;  2A5E A;  4IRU A;  1XWM A;  1D0Y A;  4I4T E;  1SQM A;  2E5V A;  4XIF A;  5IY5 E;  3CSF A;  4YTN A;  3TWR A;  4L2Y A;  2UU9 T;  2WU5 A;  4MKT A;  5CFB A;  4FJZ A;  3M65 A;  1M7K A;  3FUJ A;  2DWK A;  3MJX A;  4PS3 A;  3DTO A;  3AU5 A;  5FXX A;  2C5I T;  4JZY A;  4HQD A;  1EDU A;  1KK7 A;  2YK0 A;  3RC8 A;  3U4T A;  1OWP A;  3IF8 B;  4JHR A;  2L8K A;  5AQN B;  3CVQ A;  3UTM A;  4IE7 A;  4XI0 A;  1B89 A;  1HG5 A;  4E6H A;  2V7J A;  5IHY A;  3AG4 E;  4OYS A;  1INZ A;  2NP9 A;  1KFY A;  1WLX A;  4GKK T;  4AP2 A;  2NTX A;  1LF8 A;  4U63 A;  5ENQ D;  2V8S V;  2KZT A;  3PZ4 A;  4GTR A;  2CG2 A;  4GCO A;  5JDN A;  2XZE A;  3D3M A;  4UEL A;  2GGF A;  5LG4 A;  3NB2 A;  3WI3 A;  4EEB A;  4HBD A;  2DCP A;  3ZHE B;  4ZFH A;  5J0Z A;  4JVS A;  4GZD A;  2V7L A;  2F8X K;  2XS1 A;  3GZS A;  4CYM D;  3E0Z A;  3JC6 D;  5FMN A;  2HO1 A;  2IOS A;  5FXZ A;  1X79 A;  4Y6W A;  4UWL A;  4NIK A;  3HXC A;  3CPZ A;  4PUC A;  2LSG A;  4B89 A;  5AQK B;  4TV3 A;  4DMV A;  2XSA A;  3GZ2 A;  4TZ4 C;  2Q9Q D;  3HIZ A;  4X20 E;  3ULY A;  1MIY A;  2BDE A;  3HYM B;  4DX7 D;  1IHG A;  3VRA A;  4CI2 B;  1UW4 B;  4GA1 A;  4ABN A;  4G11 A;  2YOE A;  2NTY A;  3EU9 A;  4TXQ A;  3TWU A;  5CEA A;  5J2T E;  2VKD A;  5FYM A;  3E22 E;  2XHE B;  2N1G A;  3IHV A;  4MRU A;  4WND A;  3MA5 A;  5H7P A;  1MX4 A;  2IML A;  2ZM6 T;  5JDG A;  4B3R T;  5G04 J;  4JV5 T;  3CVN A;  2Q9Q B;  2XAG B;  3N5L A;  3AS8 A;  2LJL A;  3CLJ A;  2IC9 A;  1UN9 A;  4DR6 T;  4IE6 A;  4G26 A;  2NR4 A;  5FVK A;  2J4B A;  2R5S A;  2OV8 A;  4UI9 C;  2IF4 A;  1N0Q A;  4NRH B;  5HCJ A;  4DMW A;  3L08 A;  3LFM A;  2CHN A;  3V5U A;  4HGA A;  3EI0 A;  1IKN D;  3IV0 A;  4GYY A;  2VQE T;  1PAQ A;  3CKB A;  3CHP A;  5FY1 A;  3E37 A;  5B1A E;  3FTS A;  3TWT A;  2L9B A;  2V5Q C;  3D0T A;  3CVV A;  1NA3 A;  3ESK A;  3L54 A;  5EZY E;  4CDR A;  2W66 A;  2E0I A;  3MV2 B;  3VTX A;  2P9K G;  2WXJ A;  3SHF A;  4DO0 A;  3C3R A;  1AJ3 A;  2NW9 A;  4CXX A;  5LYJ E;  2ZGD A;  1J1J A;  2VSO E;  2UXC T;  4I1A A;  3UUX B;  4WWO A;  5AQT B;  5FXV A;  4LF6 T;  3GN5 A;  2E9X D;  5LJN A;  2R02 A;  5AQF B;  4PK4 A;  3UQ3 A;  2K48 A;  4GK5 E;  3NRX A;  3NWI A;  2IY0 C;  3AU4 A;  5D0Q D;  1QZ2 A;  4EHM A;  4AKG A;  3QDN A;  2F4V T;  5JQG E;  5KXJ A;  2B1E A;  2J8S D;  1N95 A;  5AQB A;  5LOV E;  5C1D A;  3EAM A;  2V4L A;  3I9Y A;  2X38 A;  3EHZ A;  4QXB B;  3TL5 A;  3PUV F;  2E9X B;  3HXD A;  1N11 A;  3HKE E;  4LF4 T;  4OX9 T;  2OOE A;  3HKC E;  3ZPO A;  1WY6 A;  1N32 T;  1LTX A;  3N9N A;  4MHC A;  3I4G A;  4H9Q C;  4U2Y A;  1KEY A;  2PZI A;  3HKD E;  3FP3 A;  3FTZ A;  4XE0 A;  3SS1 A;  1HFA A;  3NOG D;  2ION A;  3RRW A;  3PUZ F;  3RKG A;  1ZEE A;  3D9H A;  3J5P A;  3O1I A;  2NSZ A;  4ZI2 D;  5FNV E;  1UX5 A;  2X9H A;  5LOZ A;  2A2F X;  3PJA A;  3UUL A;  3RIF A;  1MIV A;  2VKJ A;  2OEV A;  4X5T A;  2QA7 A;  4JLE A;  5CGM A;  3V30 A;  2UXD T;  3SOL A;  5LHI B;  4X64 T;  2VK9 A;  2XQA A;  4OHF A;  3P4P A;  3Q9N C;  4ILC A;  2QRX A;  3CK9 A;  3ZUV B;  1UJJ A;  2YDR A;  3DST A;  2IHR 1;  2UY1 A;  3ZMZ B;  3ZST A;  2XCB A;  3KV9 A;  1W0B A;  3T1Y T;  4F7A A;  3MKQ A;  3VLD A;  5E0O A;  2W4X A;  3R7R A;  4BSX A;  5CEC B;  2JRK A;  2ZM0 A;  3TAX A;  2WBL A;  4ME2 A;  2CEA A;  3G2S A;  2BG9 B;  3G2W A;  1WYC A;  3FUD A;  4UQZ A;  4ZHQ E;  3EHN A;  2BKN A;  1U3C A;  3IXE A;  3PUK A;  3L6A A;  3UU5 A;  4PS8 A;  3UU6 A;  3ULQ A;  3ZGQ A;  4HFB A;  3P4W A;  4K5A B;  2WZI A;  5DQV A;  5AEN A;  4AQG A;  5LBM A;  3APC A;  5LA6 E;  2XQY A;  1Z6T A;  4MBG A;  5JDM A;  3ISM C;  4HE8 A;  3N71 A;  2LOS A;  2FJB A;  4O2B E;  4EZH A;  1EPU A;  4L9P A;  4BJN A;  2OVB A;  3O4X E;  4YTM A;  5EYP F;  3N2O A;  3LY7 A;  3KVB A;  4H7Y A;  1U5P A;  3LK2 B;  4L23 A;  4YDW A;  3T8O A;  4W9R A;  4V3I A;  5IUX A;  1S94 A;  1EZ3 A;  5HCM A;  3J9X 1;  3HG0 D;  4KX6 A;  3ONL C;  4N78 D;  3RC3 A;  2M67 A;  3RRN B;  3ABV A;  4O60 A;  2ILR A;  4CN6 A;  1U4Q A;  3NOC D;  2QZA A;  4ZZB A;  1NI1 A;  1S63 A;  4IE5 A;  5A23 A;  4EZL A;  2XJ7 A;  3D9L A;  4KUM B;  3Q75 A;  4GK0 E;  1TYQ G;  3JYS A;  4NUR A;  4I9C A;  5FL0 A;  4KZC A;  4L1B A;  2PM7 A;  1OED B;  3NQP A;  4N3A A;  3ZMU B;  5FVL A;  3T8K A;  4J7W A;  2ZU6 B;  3B7B A;  4L2L A;  4C9B B;  3UIN C;  4TWH A;  4X8Q A;  4O1O A;  3ZIM A;  5G05 C;  3UKR G;  4G2V A;  1ELK A;  1FT1 A;  4U74 A;  3RU0 A;  3IKO B;  3C72 A;  3OKQ A;  3PUR A;  3C3O A;  3S4U A;  4I43 A;  5HEO A;  2CE7 A;  2GRM A;  3O1J A;  3CHS A;  1MND A;  4PK5 A;  4TXP A;  4GMR A;  1LD8 A;  3UX4 A;  3RIB A;  4TUY E;  3RIA A;  1A17 A;  5ITZ F;  3DSS A;  3KSL A;  3FZH B;  2V1D B;  4UF0 B;  4ADZ A;  4N3C A;  3TLT A;  5G55 A;  3MYV A;  1YCS B;  3CVY A;  3A5X A;  2MYS A;  5LFA A;  2DI4 A;  2WXM A;  4UWF A;  4A55 A;  1TNZ A;  5JR9 C;  1HO8 A;  4EZ4 A;  4N2Q A;  3B7R L;  1LD7 A;  2LSY A;  3DXK G;  4ANJ A;  4HEA A;  3I1A A;  3VRB A;  5HWX A;  3L09 A;  4F3V A;  2X68 A;  2XTL A;  1OWM A;  4XAX B;  4YSY A;  2OLT A;  4B94 A;  4PFO A;  4P0B A;  2EIM E;  2XCC A;  3KVA A;  1FT2 A;  1YA0 A;  2JQH A;  3ABK E;  4WW0 A;  3CV0 A;  3DSX A;  2V4H C;  3CKC A;  3HL6 A;  3TWW A;  3FUE A;  2L6J A;  1NL4 A;  3G2U A;  4NXN T;  2IOL A;  3DPD A;  5BMV E;  4KMC A;  4I2Z A;  5CCL A;  1LVK A;  3AAE B;  5FQ4 A;  2ACX A;  4UI9 K;  4BWR A;  4OYK A;  1QUU A;  5B1B E;  4BER A;  1E7V A;  5AQV B;  3JXI A;  4GA2 A;  2VTB B;  4HLL A;  5EIL A;  4JC8 A;  2YU1 A;  3ZJ1 A;  3SI5 A;  4QWN B;  3HI2 A;  2GRO B;  4KBQ A;  2VUR A;  2XSB A;  3FB2 A;  2EHO C;  3FTW A;  3ENE A;  4GAA A;  2LKG A;  3QB5 A;  2HHH T;  5BUZ A;  4RG9 A;  2LSU A;  3KSQ A;  2AE9 A;  3FZL B;  2VVS A;  1A5E A;  3AS4 A;  4GA0 A;  3J7Y q;  2KM4 A;  4GZ6 A;  5FWQ A;  5LXT E;  3KV5 A;  2K3W A;  3LXU X;  1OY3 D;  4LFB T;  5JA4 D;  4JB8 P;  1OCR E;  3LVR E;  4H7X A;  3AVR A;  4L5G A;  3UT8 A;  3SY2 A;  5JJ7 A;  2VKH A;  4CCA A;  2RG8 A;  2Y48 B;  4AVX A;  1HCI A;  3GZ1 A;  2KXP C;  4UQX A;  2FF4 A;  1YQ4 A;  2X67 A;  2HYZ A;  4HFC A;  2KCL A;  2EIJ E;  4O8S A;  4Z91 A;  1UCU A;  1XDP A;  3RO3 A;  3P7I A;  1SVX A;  3DEP A;  3I4R B;  4YSX A;  5AJD A;  1VDY A;  2BED A;  1H6P A;  5JH7 E;  2KBX A;  5JDF A;  4HRL A;  2WP9 A;  4HI8 A;  3IHR A;  1FMV A;  4FLB A;  1KNP A;  4BX9 A;  5HKP A;  4YXD A;  4YFS A;  3SFD A;  2WVI A;  4DR7 T;  3DSV A;  3JXJ A;  3ML9 A;  3HA4 A;  2LE8 A;  2LM2 A;  2XQ6 A;  3RIU A;  3HRA A;  4HKA A;  2P9L G;  2JMH A;  4N3B A;  2L0T B;  1S0P A;  5EK3 A;  4BX8 A;  4EYY R;  5AQ7 A;  4AXH A;  1ZHC A;  3LDQ B;  4U95 D;  4QX8 B;  5E75 A;  1MMD A;  4C0M A;  3LY8 A;  4U7Y A;  3ZMS B;  3S7D A;  2A9U A;  3TLW A;  3RRC A;  4CN1 A;  4FU3 A;  3ZFW A;  3JAF A;  4JI8 T;  2AJA A;  5DBK A;  5AAO A;  2Y1L E;  1BR1 A;  1OCZ E;  2ETC A;  2X6K A;  3LS8 A;  4GYO A;  5EDS A;  2XEN A;  3UTK A;  2B76 A;  2A5U A;  3K8P C;  1Q2Z A;  4ATZ D;  4YJ3 E;  5LHH B;  2VB6 A;  4U7E B;  3FH8 A; 
#chains in the Genus database with same CATH homology
 3VTY A;  2NW7 A;  3TKL B;  1W3B A;  3MEK A;  5F8P A;  3U9W A;  2KT9 A;  3RO2 A;  3ZHE A;  3TG5 A;  3MAC A;  2CFZ A;  2KCK A;  5EX3 A;  3LJC A;  3CK8 A;  4UVA B;  3P1U A;  4URK A;  2XPZ A;  4FHK A;  4U0S A;  3EUH A;  3UPV A;  3TXM A;  2M63 A;  4J8S A;  3QC1 A;  2V7K A;  4CDN A;  3U3W A;  4KZ0 A;  2FEZ A;  5ADX L;  5M4Y A;  2V0P A;  4KBM B;  5JDL A;  1JWF A;  2XHE A;  3FUM A;  5EKQ D;  2YQ8 A;  1H19 A;  3L17 A;  4HS2 A;  5LNK A;  3PE4 A;  2Q9Q A;  1KLX A;  4I9E A;  2LOP A;  5AIJ A;  5HYA A;  4YHJ A;  3HDX A;  3ZRH A;  1D1B A;  2CG3 A;  4ZOL E;  2KND A;  3S2A A;  3R6N A;  1VRB A;  4A56 A;  5KCM A;  4JUY A;  3MXZ A;  2C5K T;  3CWZ B;  2DIW A;  4WWP A;  3RYF E;  5CHE E;  2C0M A;  4YVO A;  3SGH A;  3MCX A;  4U07 A;  1U3D A;  4GZC A;  5FZQ A;  5LBQ B;  2CXL A;  4QKN A;  4DI3 A;  1FEW A;  1MIW A;  3MA9 A;  3CHR A;  2DWG A;  4U8H A;  3UUX A;  2PQR A;  3CX7 B;  2KC7 A;  4B0Z A;  3ZMT B;  3ZN0 B;  3ZN3 A;  3UT7 A;  1HZ4 A;  4GYS A;  1ZV4 X;  2KWI B;  5ETW A;  3QAR A;  2V5F A;  1DVP A;  3C51 A;  2E9X A;  1H2U A;  5LCW C;  3QWP A;  4E7Z A;  1QSD A;  4PJJ A;  3OBV E;  3AVS A;  3I0Q A;  5G05 J;  1QQE A;  4ANU A;  1MMN A;  2WMO A;  2I6H A;  2J1D G;  5FY7 A;  4IIJ E;  4ASK A;  4ILG A;  1FIO A;  5L3C B;  3LBX B;  5T8I A;  4JEH B;  3C4X A;  1TJC A;  4QFV A;  1NZN A;  4AKR B;  2LAH A;  4XKB A;  5KJK A;  4I50 E;  3OAW A;  3ZC0 A;  5FQ7 A;  2D0T A;  4AKL A;  2PJQ A;  5AYW D;  2A4Z A;  4PS7 A;  5HXE A;  5L3E B;  3EDT B;  3ZYK A;  2BF0 X;  2CWO A;  5FQ8 A;  2MTQ A;  2CM0 A;  3L13 A;  4GU5 A;  5CA1 E;  4ACK A;  3KS2 A;  1E8X A;  1Z3X A;  4FJY A;  2IFU A;  3FXD B;  4DK5 A;  1E96 B;  1P5Q A;  3RYC E;  2UWJ G;  1Y6I A;  4HXI A;  4ZI3 C;  2V8S E;  4BTA A;  2X66 A;  3RRM B;  3RK6 A;  3QK0 A;  1ELR A;  2CHX A;  2XAF B;  1MMA A;  1LKX A;  3CX8 B;  5AJL A;  4ZI7 E;  4OYJ A;  2FBN A;  5ANR A;  2WXN A;  2XRZ A;  3FFL A;  3CHM A;  4A1S A;  1ZKE A;  2VGY A;  3R9A B;  3JCK C;  3ZN1 B;  3SWH A;  2JQQ A;  3VLF A;  2J09 A;  4NQ0 A;  3V5S A;  2XRY A;  3FTY A;  1HE8 A;  2J4D A;  4DND A;  2EQX A;  2I59 A;  4JA7 A;  3ZW3 A;  3PEV B;  3ASD A;  1V9D A;  3C4W A;  4JL0 A;  3ZJ2 A;  1YKH B;  3CVL A;  4CT0 A;  3PZD A;  3CVP A;  2VL8 A;  2WMN A;  4AXP A;  3OXG A;  3WXX A;  2VQ2 A;  1HXI A;  5BT1 A;  4CI3 B;  3PUQ A;  1MQS A;  4MFR A;  2DHR A;  4N5C A;  3FTV A;  2V7M A;  3GA8 A;  5KX5 E;  4LRZ A;  3LG7 A;  4IDZ A;  5KJN A;  3VHL A;  3PEU B;  5FP3 A;  4B8A A;  1PC2 A;  3N2G E;  1UG3 A;  2DCF A;  4UF0 A;  5LX8 A;  2SPC A;  3G2T A;  1L5J A;  3LK3 B;  2WSS V;  2C0L A;  3C64 A;  4NAC A;  1XNF A;  3C4Z A;  2I9C A;  4Q94 A;  3O9X A;  2DBA A;  3NRY A;  1D1A A;  4HOS A;  3IEE A;  2LAI A;  2R59 A;  5L3F B;  4I55 E;  5HI7 A;  2KLQ A;  3BQL A;  1Y8M A;  3Q4A B;  1E8W A;  4FUL A;  3QC9 A;  1E1H B;  4UVC B;  1H7C A;  1SZA A;  2I2O A;  2VTB A;  4PDX A;  1JUQ A;  4XI9 A;  5L2L A;  4IE0 A;  1TEZ A;  3N9O A;  5LP0 A;  4CXY A;  2XAQ B;  3K3O A;  5KJL A;  3ZEF B;  2MOW A;  5J2U E;  2CLY B;  3BEE A;  5BV1 A;  5LCY A;  5JHB A;  2V7I A;  2K5B B;  3AA6 B;  2VGX B;  2H7V C;  2YHC A;  2RP4 A;  3BQK A;  1OXZ A;  2WWU A;  2CXF A;  4LCT A;  3KIN B;  5LJM A;  4B6X A;  2XAS B;  2VWA A;  3U78 A;  2X6H A;  2X0L B;  4AI6 A;  1H6K A;  2WXP A;  1HX8 A;  4FAD A;  1WRD A;  4X1I E;  2X6F A;  2KIN B;  2W00 A;  3NBX X;  1N54 A;  5BV0 A;  1ZU2 A;  1IJ5 A;  3I3N A;  3S7F A;  3LY9 A;  1HG2 A;  4TV8 E;  4UEM A;  4WNK A;  2P58 C;  3EDU A;  3QUJ A;  5CA0 E;  5FT9 A;  4WBN E;  3CX6 B;  4J8E A;  3HKB E;  2MOZ A;  3FUN A;  3CVU A;  5FZS A;  3PTR B;  5L3G B;  3RH3 A;  3FUL A;  2CFU A;  3RKV A;  5FQ6 A;  1TJF A;  3CEQ A;  3QOU A;  1WR6 A;  3IHY A;  5BNW A;  4IST A;  3DJB A;  3JC6 C;  3JUI A;  2I1K A;  4H9S E;  5C8Y E;  4B8C B;  3UT4 A;  5H6Q B;  2A72 A;  3MZK B;  1E90 A;  1O3X A;  4CXW A;  3Q15 A;  2Q9Q C;  4EAH A;  3H3A A;  2WXH A;  2X6J A;  4ERR A;  1SZ9 A;  2NWB A;  4QXH B;  5HWY A;  2L0I A;  4JA9 A;  4YJ2 E;  4Z8X A;  4RG6 A;  4YLH A;  3APF A;  1BR2 A;  4LUN U;  3OYZ A;  3Q5X A;  4HN9 A;  3AS5 A;  3Q2M A;  3FU0 A;  3C50 A;  3LYA A;  2KWH A;  3KV4 A;  3NZS A;  2IJG X;  3LKU A;  1N52 A;  2MRI A;  1YD8 G;  2IC6 A;  2JPF A;  2HH7 A;  3PE3 A;  4UXN B;  3CKD A;  5DAB A;  3L22 A;  4Q96 A;  4AOF A;  5ANL A;  4HOT A;  3N9P A;  4GMJ A;  1FMW A;  4YND A;  2DNX A;  1NA0 A;  3VLE A;  3CR3 A;  2X9W A;  1LRZ A;  4GIW A;  3GWH A;  4APF A;  4Q69 A;  2LO6 A;  3FEX A;  2LM9 A;  4HOR A;  3FUF A;  2E9X C;  3GYZ A;  3Q49 B;  5A7D B;  3NZQ A;  4EYU A;  3CQX C;  2LSI A;  3ETU A;  5ARG A;  4UI9 J;  3ZYQ A;  3B13 A;  3CST A;  2I1J A;  5F3J A;  3ZXS A;  1SHZ C;  5M72 A;  1B7T A;  4XBF B;  1OWO A;  3D9M A;  3MGB A;  4KP3 C;  4I6E A;  3IBE A;  4UWG A;  1FCH A;  4ZI2 C;  3ANW B;  3FHN A;  4FJO A;  2GW1 A;  5D0O D;  3PVL A;  3AA0 B;  2XUE A;  4JPS A;  4APO A;  3AA7 B;  2KCV A;  4G2A A;  3LBX A;  2J49 A;  5J1G A;  5JDH A;  4JEH A;  1NP7 A;  4AKH A;  2FI7 A;  2IQC A;  2GRL A;  4K0R A;  1E8Y A;  2LHR A;  3W15 B;  2VAS A;  3MKD A;  4WBO A;  2VJ8 A;  2FUL A;  3FH7 A;  4I6G A;  3FEY A;  3QNK A;  4JEU B;  3BK9 A;  4UWH A;  1MMG A;  2LSK A;  4DBR A;  4LEU A;  5BPP A;  1JPL A;  5KJM A;  2YEV C;  4HTE A;  2C0S A;  4XKC A;  4I2W A;  3QB2 A;  1US7 B;  3PUJ A;  2ZLY A;  3P2B A;  2L9Q A;  3MJW A;  5JRC B;  4KYO B;  3RYH E;  3ZCI A;  4OVU A;  2LHN A;  2PG8 A;  1Z0P A;  2AVP A;  4BAY B;  2PL2 A;  2X9X A;  3NF1 A;  4PK6 A;  4K0U A;  2BUG A;  3DBS A;  2PBI A;  3LCA A;  3O4Z A;  3FU3 A;  3FTX A;  4EBA G;  3PNL B;  3IEG A;  4GOU A;  3HHM A;  2PFV A;  1FVH A;  4F53 A;  2LEH A;  2BVM A;  4WNE A;  4UWK A;  4K03 A;  2YU2 A;  2ZMA A;  3HVE B;  2HPL A;  4GML A;  1IJ6 A;  3OYX A;  3I0O A;  2HM8 A;  3ONX A;  2W61 A;  4P09 A;  4WAF A;  2E2E A;  2XGM A;  4PAG A;  2X3M A;  4HFG A;  4I1O B;  3GMI A;  3NZU A;  3C98 B;  3ZLI A;  3EHM A;  3FBL A;  3D9I A;  1PY1 A;  2OVF A;  3MK7 C;  2QFC A;  4EOZ B;  4DBQ A;  3E4B A;  1LVF A;  2A3D A;  2N9D A;  2XAJ B;  3RRU A;  2XQ0 A;  3QAQ A;  3SFZ A;  4WNG A;  2KMF A;  2JLB A;  3L16 A;  5FXW A;  2X51 A;  4U72 A;  2AXV A;  3UFE A;  2VKO A;  3Q47 B;  5L3B B;  3SZ7 A;  5G2N A;  4U0U A;  5CCM A;  5FTP A;  3CK7 A;  2C5J A;  2WB2 A;  1X5B A;  4GZ5 A;  2L3L A;  3O1H A;  4GCN A;  5EK4 A;  3IBP A;  3EJN A;  4O2A E;  1ELW A;  2XAH B;  3CVX A;  1NAF A;  1E8Z A;  4I6J A;  4CZZ B;  2WM9 A;  3EDV A;  2QGS A;  3VKG A;  3JQ1 A;  1NWM X;  1KNZ A;  4O6F A;  4TUU A;  3TXN A;  1HS7 A;  2IW5 B;  1IQU A;  1YKE B;  3LPZ A;  5ENN A;  3SF4 A;  2Q7F A;  4GB9 A;  4JHJ A;  4HOQ A;  3B7T A;  4AY6 A;  5IYZ E;  3ZEF A;  1S35 A;  3E08 A;  2UXX B;  4CEM A;  3NZP A;  1HH8 A;  3K3N A;  2CWY A;  4TN7 B;  5FY0 A;  4DI4 A;  4BY6 A;  4J8D A;  4CQI A;  4EPZ A;  4G25 A;  3D9K A;  3PDY A;  2WXF A;  5JHA A;  2VGX A;  1CUN A;  2RA1 A;  4PFP A;  3RJV A;  2BTD A;  4LER A;  4BJM A;  2XGO A;  5LHG B;  4CGW A;  2W63 A;  3SBT B;  4BFR A;  2QY7 A;  3ASH A;  3CML A;  3SD5 A;  4KVM A;  1MHQ A;  3CGH A;  2ZM8 A;  2WXR A;  5BW8 C;  3I5P A;  3FWV A;  4MS6 A;  3ONK A;  4C90 A;  1IQR A;  5JR9 B;  2D2S A;  4H9O C;  2XPI A;  4C0E A;  4TV9 E;  1D0X A;  3DP7 A;  3FXE B;  2WPV A;  4IN3 B;  2EHO D;  5AFU L;  3OTN A;  1QNF A;  2J07 A;  3B57 A;  4WWN A;  1H0A A;  2NOX A;  2BZB A;  4KT6 B;  5FZR A;  3N9M A;  4KMO A;  3ZPJ A;  2YIN A;  4J8F A;  4IHJ E;  1JWG A;  2R17 C;  3S7B A;  4A1G A;  2VSN A;  4QHO A;  1HTJ F;  2EHO B;  4PH4 B;  3ZVV A;  4JHK A;  1SA0 E;  5EK2 A;  2WXG A;  5T3R A;  3O48 A;  3PDN A;  4P29 A;  4CDM A;  3BG1 B;  4GYW A;  2Z6E A;  5LGT B;  4UV9 B;  3MKR A;  4H9N C;  4ATG A;  2XGS A;  2C2L A;  4OVV A;  1IZN B;  4IE4 A;  2D0U A;  4PJN A;  3PUA A;  3KBT A;  4O4J E;  2MBG A;  3ZYM A;  3F2E A;  4BT9 A;  4GPK A;  4TRQ A;  4AQF A;  2H3R A;  2Y8D A;  2KXP B;  2NW8 A;  4GZ3 A;  4FLH A;  3LDZ A;  4O4I E;  3ZC1 A;  4M1P A;  3N9Q A;  4D10 C;  1OWA A;  4OFZ A;  3L3P A;  5C2Y A;  5T4Y A;  2VSY A;  2P9B A;  4H63 V;  4O4L E;  4F1S A;  5JDQ A;  4DLO A;  4TX5 A;  4E85 A;  3QK6 A;  2WQ6 A;  2XEV A;  3AAA B;  5L3D B;  3CVW A;  3AAI A;  4A3V A;  2UXN B;  3R84 B;  3KV6 A;  2HPJ A;  3K3Q C;  4G24 A;  4PW8 A;  2G0U A;  2KZT B;  4DLQ A;  4FC8 A;  1OUV A;  4A3T A;  5A6C A;  5HAX A;  1IYG A;  1OWN A;  4JXT A;  4N39 A;  2WAU A;  3BG0 B;  2D5U A;  4EIW A;  4AM9 A;  3T8M A;  4MAL A;  4O4H E;  3FHE A;  4BT8 A;  4FA6 A;  1IAP A;  4ZS2 A;  2RD0 A;  5ARF A;  2AXZ A;  2YNQ A;  5HQ8 A;  3SRZ A;  3ETV A;  4EZK A;  1ZBP A;  3FY4 A;  2WQH A;  4ZS3 A;  4NUU A;  3PU8 A;  4HVB A;  3PRZ A;  1T98 A;  2GK9 A;  5HXH A;  1EF1 C;  2YHE A;  3S7J A;  5JRE A;  4UVB B;  3FTU A;  4DPR A;  5HXC A;  3OXF A;  4OK0 A;  4ANX A;  3PS6 A;  4CI1 B;  3ASF A;  4EBA A;  1OWL A;  1H2T C;  3U3I A;  4X1Y E;  2W0G A;  2XPY A;  3UMV A;  3ANW A;  3FBZ A;  2LNI A;  1UX4 A;  1BR4 A;  2V26 A;  3OJA A;  4FHJ A;  1E7U A;  2Y4T A;  2X6I A;  5HXR A;  3D9O A;  5LGN B;  3N2K E;  4ANV A;  4PJM A;  1WAO 1;  4ANW A;  1GW6 A;  3KDS E;  2J9Q A;  4QXC B;  2AWI A;  5LCW J;  4EB6 E;  4EEC A;  3GN5 B;  3WAJ A;  2N2N A;  4N2S A;  5CB4 E;  3Q5M A;  3JQ0 A;  1UN8 A;  2WXQ A;  4JEU A;  3T5V A;  2OND A;  3RKO A;  4AJW A;  3P8C D;  4CGV A;  5FJY A;  3BQI A;  3SBS A;  2CHW A;  2NC9 A;  3CHO A;  5HXS A;  2CMR A;  4V1A v;  4U04 A;  3ZCJ A;  3FU6 A;  3AB3 B;  1G73 A;  4L0R A;  1WYB A;  3CVR A;  3U66 A;  2J08 A;  3B7U X;  3PUS A;  5JRC A;  3D9J A;  3D9P A;  1KT1 A;  4AY5 A;  4G23 A;  5TAO A;  2K9A A;  1HU3 A;  3TJP A;  2W62 A;  3KBU A;  5JVD E;  4RVB A;  4HFV A;  3CQG B;  4CT4 A;  3EIJ A;  4I17 A;  2E8I A;  1UJK A;  2VSX E;  3PUG A;  4P0A A;  4ACL A;  2MHK A;  5E76 A;  5LGU B;  3FDH A;  3PH0 C;  2ES0 A;  4E7S A;  1Y64 B;  2VYI A;  2AW6 A;  3CIA A;  2KAT A;  4X1K E;  1DNP A;  3TGO A;  3HVE A;  2LT3 A;  1BPO A;  3LVQ E;  4F6R C;  2UY1 B;  3CQC B;  3RX6 A;  3MKQ B;  3I9W A;  3UT5 E;  5G04 C;  3KEZ A;  5KDM C;  5J90 A;  3FUK A;  3MZL B;  3UUM A;  2Y6X A;  3OXL A;  3AA1 B;  4IUL A;  3C98 A;  5GON E;  2CHZ A;  3LK4 2;  5KMG P;  2LSV A;  2WXI A;  5CMW A;  4EZJ A;  1MNE A;  4ILU A;  4H9R C;  2H7O A;  3QWW A;  3QWV A;  1WM5 A;  4I1M A;  4YVQ C;  4EQF A;  4XX5 A;  4ZI3 D;  3VKH A;  4KXK B;  4R7L A;  1H2V C;  5DQW A;  3MV3 B;  5JJ6 A;  3PU3 A;  3ESL A;  3H37 A;  4MLK A;  2JMK A;  3APD A;  3SNX A;  4PNI A;  4RSY A;  3LEW A;  4WNF A;  3KFW X;  4UIG A;  1YW0 A;  4UV8 B;  4FI5 A;  2CA5 A;  4XZC A;  4DJA A;  2JEK A;  4XZ4 A;  4G1T A;  3F57 A;  2LSJ A;  5DJQ C;  4U0Z A;  2K24 A;  2AXU A;  4AV7 A;  3R7Q A;  4MBQ A;  4PJL A;  2CCQ A;  1D0Z A;  3K9I A;  2CLY C;  4CRW A;  4AKI A;  3PNT B;  4M3O A;  2CXD A;  4ILI A;  2BVL A;  2OA5 A;  1VOM A;  5CMY A;  4J2C A;  4BA9 A;  4WUY A;  4H9P C;  3ONL A;  1D1C A;  4BTB A;  4I43 B;  2IAK A;  4HOU A;  3EVY A;  3ZYL A;  2WQ7 A;  3VU7 H;  2NXP A;  4J0U A;  4J6I A;  2DLR A;  3PE0 A;  3D9N A;  3EIQ C;  3UUN A;  2Y3A A;  2ZM2 A;  4ISS A;  3CHQ A;  5DIZ A;  3URZ A;  4NUV A;  4KVO A;  4G63 A;  3RPU A;  3GW4 A;  3LJ3 A;  3G2V A;  2WXK A;  1XGW A;  3ASG A;  3B7S A;  3PRE A;  1FVF A;  1BR0 A;  2WXO A;  2ODU A;  2PM6 A;  3WAK A;  4L7T A;  4AEZ C;  5JJT A;  2WXL A;  2X9Y A;  1Z3Y A;  3N9L A;  3HR0 A;  3QJZ A;  3TG4 A;  1HF8 A;  3FH5 A;  2HR2 A;  4H63 H;  3RYI E;  4L9I A;  2PQN A;  1G8X A;  3FUH A;  4GYR A;  2FO7 A;  2Y4U A;  3KAE A;  5A1L A;  4DVD A;  5JR9 A;  4EXT A;  1HS6 A;  4C91 A;  3ML8 A;  5EX0 A;  3MX3 A;  4FP7 A;  2ODV A;  2IU1 A;  3U64 A;  1EYH A;  4IGU A;  3Q9D A;  2JJ9 A;  5H6R B;  5LP6 E;  4JW1 A;  3ZMV B;  4UQY A;  5J08 A;  3KD7 A;  2KZ7 B;  3FUI A;  4Y6C A;  3T5X A;  4AQF C;  4QX7 B;  4ILH B;  4HLE A;  2EHO A;  4AIF A;  3FU5 A;  3QKY A;  1KT0 A;  3F31 A;  4IYP A;  4MLP A;  3Q5W A;  4IRU A;  1D0Y A;  4I4T E;  1SQM A;  4XIF A;  3CSF A;  4L2Y A;  4MKT A;  4FJZ A;  3M65 A;  3FUJ A;  2DWK A;  3MJX A;  4PS3 A;  3DTO A;  3AU5 A;  5FXX A;  2C5I T;  4JZY A;  1EDU A;  1KK7 A;  2YK0 A;  3RC8 A;  3U4T A;  1OWP A;  3IF8 B;  4JHR A;  2L8K A;  3CVQ A;  4IE7 A;  4XI0 A;  1B89 A;  1HG5 A;  4E6H A;  2V7J A;  5IHY A;  4OYS A;  1INZ A;  2NP9 A;  1WLX A;  4AP2 A;  2NTX A;  1LF8 A;  4U63 A;  2KZT A;  2CG2 A;  4GCO A;  5JDN A;  3D3M A;  4UEL A;  2GGF A;  5LG4 A;  3WI3 A;  2DCP A;  3ZHE B;  4JVS A;  4GZD A;  2V7L A;  3GZS A;  3E0Z A;  3JC6 D;  5FMN A;  2HO1 A;  2IOS A;  5FXZ A;  1X79 A;  4Y6W A;  4UWL A;  3CPZ A;  4PUC A;  2LSG A;  4B89 A;  4TV3 A;  4DMV A;  3GZ2 A;  4TZ4 C;  2Q9Q D;  3HIZ A;  4X20 E;  1MIY A;  2BDE A;  3HYM B;  1IHG A;  4CI2 B;  1UW4 B;  4GA1 A;  4ABN A;  4G11 A;  2NTY A;  5J2T E;  2VKD A;  5FYM A;  3E22 E;  2XHE B;  2N1G A;  3IHV A;  4MRU A;  4WND A;  3MA5 A;  5JDG A;  5G04 J;  3CVN A;  2Q9Q B;  2XAG B;  3N5L A;  3AS8 A;  2LJL A;  3CLJ A;  2IC9 A;  1UN9 A;  4IE6 A;  4G26 A;  2R5S A;  2J4B A;  2OV8 A;  4UI9 C;  2IF4 A;  4NRH B;  3L08 A;  4DMW A;  3LFM A;  3V5U A;  4HGA A;  3IV0 A;  4GYY A;  1PAQ A;  3CKB A;  3CHP A;  5FY1 A;  3FTS A;  2L9B A;  3D0T A;  3CVV A;  1NA3 A;  3ESK A;  3L54 A;  5EZY E;  4CDR A;  2E0I A;  3MV2 B;  3VTX A;  2WXJ A;  3SHF A;  4DO0 A;  1AJ3 A;  2NW9 A;  4CXX A;  5LYJ E;  2VSO E;  4I1A A;  3UUX B;  4WWO A;  5FXV A;  3GN5 A;  2E9X D;  5LJN A;  3UQ3 A;  4PK4 A;  2K48 A;  4GK5 E;  3NRX A;  3AU4 A;  5D0Q D;  1QZ2 A;  4AKG A;  3QDN A;  5JQG E;  2B1E A;  5LOV E;  5C1D A;  2V4L A;  3I9Y A;  2X38 A;  4QXB B;  3TL5 A;  2E9X B;  3HKE E;  2OOE A;  3HKC E;  3ZPO A;  1WY6 A;  3N9N A;  4MHC A;  3I4G A;  4H9Q C;  2PZI A;  3HKD E;  3FP3 A;  3FTZ A;  4XE0 A;  3SS1 A;  1HFA A;  2ION A;  3RRW A;  1ZEE A;  3O1I A;  2NSZ A;  4ZI2 D;  5FNV E;  1UX5 A;  2X9H A;  5LOZ A;  2A2F X;  3UUL A;  1MIV A;  2VKJ A;  2QA7 A;  4JLE A;  3SOL A;  5LHI B;  2VK9 A;  4OHF A;  3CK9 A;  1UJJ A;  2UY1 A;  2XCB A;  3ZMZ B;  3KV9 A;  4F7A A;  3MKQ A;  3VLD A;  5E0O A;  3R7R A;  4BSX A;  2JRK A;  2ZM0 A;  3TAX A;  2WBL A;  4ME2 A;  2CEA A;  3G2S A;  3G2W A;  3FUD A;  1WYC A;  4UQZ A;  4ZHQ E;  3EHN A;  1U3C A;  3PUK A;  3L6A A;  4PS8 A;  3ULQ A;  3ZGQ A;  5DQV A;  5AEN A;  4AQG A;  5LBM A;  3APC A;  5LA6 E;  2XQY A;  1Z6T A;  5JDM A;  4HE8 A;  3N71 A;  2LOS A;  4O2B E;  4EZH A;  1EPU A;  4BJN A;  2OVB A;  3O4X E;  3N2O A;  3LY7 A;  3KVB A;  4H7Y A;  1U5P A;  3LK2 B;  4L23 A;  3T8O A;  4W9R A;  4V3I A;  1S94 A;  1EZ3 A;  3J9X 1;  4N78 D;  3RC3 A;  2M67 A;  3RRN B;  2ILR A;  1U4Q A;  4IE5 A;  5A23 A;  4EZL A;  3D9L A;  4KUM B;  4GK0 E;  3JYS A;  4NUR A;  4I9C A;  4L1B A;  4KZC A;  2PM7 A;  3NQP A;  4N3A A;  3ZMU B;  2ZU6 B;  4L2L A;  4C9B B;  3ZIM A;  5G05 C;  4G2V A;  1ELK A;  4U74 A;  3RU0 A;  3IKO B;  3OKQ A;  3PUR A;  4I43 A;  3S4U A;  2CE7 A;  2GRM A;  3O1J A;  3CHS A;  1MND A;  4PK5 A;  3UX4 A;  3RIB A;  4TUY E;  1A17 A;  2V1D B;  4UF0 B;  4ADZ A;  4N3C A;  5G55 A;  3MYV A;  3CVY A;  3A5X A;  2MYS A;  5LFA A;  2DI4 A;  2WXM A;  4UWF A;  4A55 A;  5JR9 C;  1HO8 A;  4EZ4 A;  4N2Q A;  3B7R L;  2LSY A;  4ANJ A;  4HEA A;  3I1A A;  5HWX A;  3L09 A;  4F3V A;  2X68 A;  2XTL A;  1OWM A;  4XAX B;  4B94 A;  4PFO A;  4P0B A;  2XCC A;  3KVA A;  1YA0 A;  4WW0 A;  3CV0 A;  3CKC A;  3HL6 A;  3FUE A;  2L6J A;  3G2U A;  3DPD A;  2IOL A;  5BMV E;  4KMC A;  4I2Z A;  5CCL A;  1LVK A;  3AAE B;  5FQ4 A;  2ACX A;  4UI9 K;  4BWR A;  4OYK A;  1QUU A;  1E7V A;  4GA2 A;  2VTB B;  4JC8 A;  2YU1 A;  3ZJ1 A;  3SI5 A;  4QWN B;  3HI2 A;  4KBQ A;  3FB2 A;  2EHO C;  3FTW A;  3ENE A;  4GAA A;  5BUZ A;  4RG9 A;  2LSU A;  3AS4 A;  4GA0 A;  3J7Y q;  2KM4 A;  4GZ6 A;  5FWQ A;  5LXT E;  3KV5 A;  3LXU X;  3LVR E;  4H7X A;  3AVR A;  4L5G A;  3UT8 A;  5JJ7 A;  2VKH A;  4CCA A;  2RG8 A;  2Y48 B;  4AVX A;  1HCI A;  3GZ1 A;  4UQX A;  2FF4 A;  2X67 A;  2HYZ A;  2KCL A;  4O8S A;  1UCU A;  3RO3 A;  3P7I A;  3I4R B;  5AJD A;  1VDY A;  5JH7 E;  5JDF A;  3IHR A;  1FMV A;  4FLB A;  4BX9 A;  4YFS A;  2WVI A;  3ML9 A;  3HA4 A;  2LE8 A;  4HKA A;  2JMH A;  4N3B A;  2L0T B;  1S0P A;  5EK3 A;  4BX8 A;  4EYY R;  4AXH A;  1ZHC A;  4QX8 B;  5E75 A;  1MMD A;  4C0M A;  3LY8 A;  3ZMS B;  3S7D A;  4FU3 A;  3RRC A;  3ZFW A;  5DBK A;  1BR1 A;  2X6K A;  3LS8 A;  4GYO A;  5EDS A;  3UTK A;  2A5U A;  3K8P C;  4YJ3 E;  5LHH B;  2VB6 A;  3FH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...