2WM9A

Structure of the complex between dock9 and cdc42.
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
423
structure length
407
Chain Sequence
b'STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 148
structure length 407
sequence length 423
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wm9A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wm9A01
2WMNA 2WMOA 2WM9A 3B13A 2YINA 3VHLA
chains in the Genus database with same CATH superfamily
4ILBA 4GA2A 4DV3T 4O60A 1O1RA 2PBIA 4TV9E 4EBAG 3UTMA 3R9MA 3GZSA 5JDNA 1A5EA 2L0TB 4FHKA 5EYPF 3U66A 3MZKB 3CVUA 1ZKEA 2LO6A 3IEEA 5CBNA 4X5TA 3D9MA 1ELKA 2FBWA 1IBMT 1FVFA 1N52A 4DV5T 2F8YA 3BEEA 3C3OA 2IHR1 2P9SG 3QARA 4LMKA 3B95A 2V5QC 3PE4A 5L3EB 4ADZA 5T3RA 1OEDE 5HAXA 3FUHA 4BT9A 3PUZF 4MLPA 3E32A 3NF1A 3ULQA 5FY0A 4DV7T 1MMNA 4IDOA 5FIOA 1TNBA 4OX9T 3ZCJA 2X6FA 2VQFT 4K0KT 1KLXA 2XZEA 2UY1B 4IIJE 3D9LA 2K24A 1SA5A 2UUBT 2XAJB 4AKRB 2V8SV 4GA0A 2YK0A 3OPCA 5LHGB 3RLFF 4GMLA 3IEGA 3SRZA 4QX7B 2V7IA 4UI9K 1NAFA 3ZYMA 4UWHA 1WG0A 2NW8A 4BTBA 5IY5E 4PDXA 3FB2A 4ZZCA 2BG9E 4I9EA 1TN7A 4HWDA 3OTNA 3JADA 4JB8P 4LNGA 1ZP0A 4EIWA 2PTFA 1OUVA 1TNOA 3LXUX 4WNKA 1K8KG 1OY3D 1QUUA 5AQAA 4C9BB 4PJNA 2I1JA 4A98A 4QWNB 2LM9A 5LP0A 5LOVE 2HH7A 5LB7B 3ZMVB 5EK3A 3NBNB 3ZN3A 2QA7A 3ESKA 5JR9B 2V6XA 1VOMA 5KCMA 3AE4A 4MRUA 2VVNA 4L9IA 5HS0A 4H63H 3AAIA 1IHBA 2RG8A 3CVLA 3AE2A 3RO3A 2LSYA 3AE6A 3SF4A 2Q9QC 3I0QA 2CWYA 3ZEFA 5AAOA 4LSZE 3JC6C 1KT0A 3AG4E 1SZ9A 4LF9T 4WAFA 1BR1A 4NPPA 3S2AA 4I9CA 1SA4A 2L8KA 4HB5A 3AEEA 4HEAA 3Q5WA 3Q7FA 1B7TA 4QH5A 5LGNB 4AQGA 4G8KA 4KP3C 1LVFA 3OXFA 3APCA 4ZI3D 2DL1A 2D9DA 1A17A 5HWYA 2VGYA 3MKQA 2IEJA 5GONE 4I4TE 2L9QA 3JQ1A 1HTJF 5JMND 5FVLA 1O5MA 4QQIA 3F57A 4AQYT 1N95A 3FWVA 3HI2A 1E90A 1TR4A 4G1TA 1BI8B 4GCNA 4JI5T 5L3DB 4L2LA 3EHNA 2XM2A 4YTMA 2BBHA 5KDMC 4LMJA 2VURA 2H6GA 3L54A 2XAGB 1X5BA 4C48B 3EDTB 3EUVA 4J2CA 3IKOB 3LPZA 3TWUA 4CXYA 4B3MT 3V2XA 4OYKA 1WAO1 2RA1A 1NEKA 2B1EA 5AFUL 2UXBT 3TWSA 2ZGDA 1Y64B 2X6HA 3DPDA 1FMWA 1NA0A 2MTQA 1ZOYA 2GW1A 4NACA 2FJEA 4D10C 1NZNA 5FZQA 3QK0A 4A1SA 1X79A 2XS8A 2BEDA 5DABA 4QX8B 4BFRA 3Q2MA 2LUHA 2NSZA 3RYFE 4K03A 4YJ2E 4Z8XA 4KHZF 3UU8A 4JZYA 2JRKA 2XQ7A 4I6EA 4BAYB 3BUAA 4H9PC 2HN1A 3GN5A 4I1MA 3TXNA 3NQPA 4TWFA 2HYZA 2XPZA 3ZW3A 4A56A 4GTRA 5J0ZA 5BPPA 5DIZA 2V5DA 3E08A 1IKND 3QWPA 3ZU7B 3X1DA 3RKOA 2LKHA 1OWLA 2E9XC 4EHMA 4FJOA 2Y69E 3PZ3A 4AKHA 1OXJA 3R7RA 3TG4A 3LDQB 4JI1T 3UU4A 4AKGA 5CBOA 3TLTA 2UUAT 3LYAA 3FXEB 3P4QA 3AS8A 1JCQA 2PM7A 5H6QB 3PUQA 1NFIE 4U8YD 4KHPT 5CHEE 2NP9A 2RPAA 2XGOA 2Y6XA 3H37A 1JNZA 5FJYA 5AQOB 2N2NA 1QZ2A 1SZAA 4CXWA 4HWFA 4IYPA 4G25A 3ZUVB 3D3MA 4FHJA 2JLBA 4LF8T 2IC6A 2XQYA 4YLHA 2V0PA 5ANRA 2C5KT 2R59A 2LHNA 1O3XA 2VASA 4DMVA 4Q69A 3PUKA 3T1HT 3P2BA 2GROB 4JEUA 3NZPA 1QLBA 3KVAA 3CKBA 3MKRA 4FLBA 4N3AA 4N2SA 3D9HA 3Q9NC 2F8XK 4HKAA 3PUSA 2Q9QA 2NR4A 3ANWA 1UGOA 2W63A 5DJQC 2F37A 3UINC 1YQ3A 2UXNB 2WXPA 4XKCA 3DPYA 3P50A 1XGWA 4H9QC 4CZZB 5EN5D 5C3JA 3DXKG 2MRIA 2M6IA 4KZ0A 2P9UG 2LAHA 1ELRA 5EDSA 2FO7A 3QOUA 3U3WA 3LJCA 2ACXA 2L6JA 4DV4T 3FZKB 5F3JA 3LVQE 3PZ1A 4BJNA 2WVIA 3UU6A 3ZLIA 3U78A 4GTSA 3ZPOA 4DBRA 1KEYA 2Y3AA 4N39A 4QHOA 4U63A 4HFVA 4PAGA 3T5VA 3LY8A 3TXMA 1HU3A 4DV1T 1HH8A 3TLSA 2WZIA 2WCAA 1E7UA 2PG8A 3RPUA 3T5XA 3PEVB 3RU0A 4XEIG 4HWCA 4UQXA 3K1SA 3AG1E 3C98B 3UM3A 2W4XA 2P9KG 2WQHA 3CVYA 4PUCA 3FZLB 2J4GA 1JCRA 3N9LA 2EHOB 4O4IE 5ADXL 4J6IA 4U0ZA 2HN2A 4N3CA 5L4EA 1ZEEA 4MLKA 4ILHB 4BSXA 3UUXA 3FTSA 3MX3A 2DBAA 3SOLA 4YTPA 5IHYA 3ZMZB 2A5EA 3E0ZA 3AU5A 2WAUA 2KXPB 2HHHT 3PUJA 1MMAA 2B76A 2W00A 1W9RA 2CFUA 4U7EB 1OEDC 2C0SA 4DUIA 3ONXA 2K5BB 4N5QA 1S35A 3RH3A 3FU5A 2IO2C 2W66A 2XHEA 3TJPA 3QB5A 2PJQA 5FQ7A 3L9TA 2WS3A 3X2QE 1KF6A 4AKIA 4DNDA 3RAUA 3RC3A 5KNGA 3VLDA 3EHRA 1S0PA 2IUBA 3KD7A 1Q2ZA 3EI0A 1O1SA 5FY7A 3RKVA 4DR7T 1KPSB 5EILA 4YXDA 4I50E 3CVPA 4U04A 3PZ4A 4UWLA 2I2OA 5BUZA 4CGVA 2P9BA 1UCUA 3FZFB 1SE7A 2E9XA 3SBSA 2H6FA 2KBXA 4TXRA 3AJIA 2X0YA 2KCKA 4EZJA 2BG9C 3HIZA 5LMNT 3ASFA 3L82A 4B89A 2WDQA 4TXQA 4U0SA 5BXOA 2FO1E 2YNQA 4GB9A 4YVQC 3RIAA 3C4XA 3URZA 3L22A 1XMOT 3P4RA 2CHXA 4GYRA 3VR9A 3TWVA 4CZ2D 3FUKA 1PY1A 4QFVA 1Y8MA 3OYZA 2GRMA 3CVNA 3PDNA 3ZXPA 5ARFA 5ABGA 4BX9A 4GYOA 2CCQA 4LNBA 2XQ8A 2DWZA 3FY4A 3BU8A 3FTZA 2X6IA 1BR2A 1I94T 1LKXA 4G2AA 3ZCIA 1RW2A 4WNEA 1M62A 2M6BA 5LJMA 2FULA 3ZHEB 1G73A 3FUIA 2Y0BG 4KMOA 1TN8A 3QWVA 3UULA 4EZLA 2OV9A 3AECA 3CMLA 1UJJA 2J62A 3D9IA 2I6HA 3EIQC 4HQDA 4JUYA 3FZHB 3AEAA 1AJ3A 5CA1E 2IOLA 3T8MA 2EIKE 4OVVA 2WXJA 5L3BB 3LG7A 4P0BA 4CCAA 2XZTG 4ISTA 2QYWA 3TWRA 2KM4A 3UUMA 2CHOA 5DQWA 4JXTA 3CLJA 3N9PA 5EYLA 1W09A 2WQ7A 4BESA 4E7SA 5LP6E 2Y8DA 5M4YA 2W2UA 3CV0A 3D9NA 1ZBPA 1INZA 4BEPA 1NWMX 2ZM8A 4AISA 2IONA 3C50A 4DUYT 2EHOA 2BVLA 3U9WA 3KSQA 4MBGA 3ZYQA 3QKYA 1QNFA 4TV3A 2WSSV 3ZKJA 4WBOA 4RLYA 1E2AA 5LBQB 2ES0A 3PJAJ 2VVSA 5BT1A 4MBQA 4L5GA 4ILGA 4F8HA 2Q7FA 1S70B 1D9SA 1UN8A 2FI7A 3GMIA 5ITZF 5AQUB 3DEPA 4EQFA 4BY6A 1GQEA 4AM9A 1FMVA 2IQCA 3ZSTA 3AVRA 1FJGT 3DSTA 3PE3A 2W67A 4C90A 3KINB 4JI8T 3LY9A 5KXJA 3UTKA 3OXLA 1FCHA 3E30A 4EZHA 2FBNA 2QRXA 2NC9A 1W0AA 4DV6T 3FTVA 2YQ8A 3NZUA 4PJMA 3HXBA 1OEDA 3L16A 3PVLA 3B13A 2AE9A 5L4HA 4GPKA 2UUCT 4J8EA 4YVOA 4AQFC 4DO0A 1J1JA 3O1HA 1HXIA 3DEOA 3DRAA 1WM5A 4BSZB 1N32T 4P0AA 1T8BA 2JPFA 4COFA 1E8ZA 3APDA 3F2EA 1YW0A 1N11A 2KC7A 3I3NA 2CXFA 5BW8C 4TNVA 1ELWA 2OCCE 4GKKT 4HFEA 3A7MA 2LSKA 4LFBT 2DNXA 1N4QA 3RIBA 3AEGA 2EQXA 4ATZD 1KZOA 1WY6A 4NRHB 5FQ8A 1SUMB 4F7AA 3UT4A 1WCRA 2DCFA 1UG3A 3EHMA 1WR6A 5HEJA 1N54A 2BG9A 1LTXA 2I9CA 4LFCT 3ZHEA 4J8DA 1P5QA 1YXRA 2ONDA 4CXXA 2RKKA 4QH1A 4PJLA 3FBLA 5HEOA 5FP3A 4KVOA 3LJ3A 2WMNA 2XQ4A 4PK4A 3AXJA 1IQRA 2EIME 3PZDA 1YQ4A 3LK2B 2X3MA 4G8LA 3RJVA 2HO1A 2M67A 4UIGA 4L9PA 3MCXA 4Z90A 4DV0T 3GA8A 4XI9A 4M1PA 5G05C 3VU7H 1QYMA 4HRNA 5LNKA 2VJ8A 3AE8A 4CDMA 2P9NG 3PDYA 4GMRA 3PRZA 3D9KA 4J8FA 4DX1A 4LF5T 4X1YE 2CMRA 1N94A 2QYUA 4EBAA 3UIPC 1PAQA 3IA3A 5IWAT 4YNDA 1D8EA 3KEAA 1WR0A 4F1PA 5LX8A 5FQ4A 2HPJA 4G11A 5ABHA 3PUXF 5A7DB 2WXNA 1YMPA 3SFYA 3SY2A 3N9NA 4DR6T 3MKQB 3L08A 3RRUA 2CRBA 2XY8B 2XQ5A 3FUNA 1U2VG 3QNUA 3ULEG 5F5WA 3M3ZB 5AQGB 5LHHB 5KJLA 4OFZA 1L5JA 3Q4AB 4DX7D 4Y6CA 3UQ3A 4P09A 3CR3A 4W9RA 4AV7A 1N33T 4YHJA 5LG3A 1Z8UA 5IUXA 5D66A 4B6XA 4F3VA 3H3MA 4AXPA 2V6YB 3RIUC 2X6KA 5FXVA 3FU0A 2AJAA 4FA6A 2H3RA 3PNTB 4L0RA 3CEQA 3RHWA 4ZI2D 1HNZT 4HOQA 3O4ZA 2PL2A 3KBTA 3G2UA 2YDSA 4DR3T 4B8AA 4N2QA 4L7TA 3MV3B 4PNIA 2WM9A 2MOWA 3CVVA 4LF6T 4MFRA 2LJLA 5AQBA 2JQQA 1DVPA 2E2EA 3CSTA 3B7SA 5KJMA 2KWIB 2GRLA 3B57A 2R2LA 5AQVB 3S4UA 4U0UA 1HO8A 2V5FA 4ABNA 2ZMAA 5FY1A 2ZU6B 3GN5B 4U8VD 5KNHD 4JI3T 4ZS2A 3G2VA 3VLFA 4U72A 2OVBA 4JC8A 4MHCA 3K3NA 4GYYA 3ML9A 3LSVA 5TAOA 1CUNA 3FXDB 4AQFA 3P1UA 4GTMA 3UU5A 2GRQB 1E7PA 4EB6E 2LRKA 4JI7T 5DQVA 2XTLA 4WZXA 4GZDA 3SWHA 3V31A 3AEDA 4FJZA 2X9YA 1IJ5A 5BXUA 3DJBA 2MYOA 5CGMA 4IE4A 5BNWA 3EHQA 1EZ3A 1HZ4A 4UVBB 3RRNB 3WXXA 1HS7A 4A1GA 2OLTA 1OWOA 5FT9A 4AP2A 4X1KE 3RF1A 5AQHB 3MGBA 1HCIA 3PUVF 2J49A 4A5XA 1VDYA 3EUHA 5ENRD 1AP7A 4UQZA 4OVUA 2BKKB 3JAEA 5AQRB 5EX0A 2VQ2A 3AAEB 3JQ0A 1N34T 2GRPB 3EJNA 3ZN1B 4XZ4A 3ABVA 1V9DA 4TRQA 3TWTA 3GZ2A 4JEUB 2R5SA 1XNRT 4ANVA 1HF8A 3KEZA 3T8OA 3Q78A 2VSYA 4B0ZA 1V54E 3FU6A 2KNDA 3S7BA 1U4QA 1AWCB 2Q9QB 4DVDA 2VKDA 2YEVC 3ANWB 3DSUA 5JDHA 2WXMA 2LNIA 3FHEA 3S7DA 4TZ4C 3I0OA 2Z6EA 3HR0A 4ZS3A 4LRZA 4OYSA 5CERB 3PUYF 4HFBA 4NURA 2C2LA 2V7KA 4ZXLA 1Z3XA 3Q5XA 2UXCT 3FUJA 4OYJA 5FL0A 3ZMSB 4ZEYA 2JQHA 3VHLA 2NXPA 3G2TA 4HFHA 3OKQA 2V6YA 3Q47B 5JHAA 4AI6A 1WRDA 4IULA 2V7JA 2QYJA 1QSDA 5M72A 2N1GA 3VKGA 2X68A 1JWFA 4ACLA 4QXCB 3LBXA 5CEAA 5EK2A 1RZ4A 3CK9A 5FNVE 2MHKA 4OK0A 4I1OB 3N9MA 4E7ZA 1OWPA 3UI2A 4X8QA 4IE5A 3WG7E 4EOZB 4HOTA 4J0UA 3RI5A 1IBKT 3ONKA 2YKSA 4TX5A 3UU3A 3JYSA 2VSXE 5JVDE 1K1AA 3Q5DA 2JQKA 3AG2E 1NI1A 2VGEA 5CCLA 3JAFA 1TEZA 1IYGA 2IU1A 4Y6WA 2VWAA 4Q96A 3Q15A 4ZHBA 1ZB1A 4H7XA 3UUXB 1KK7A 4EXTA 1IJ6A 4X65T 3UUNA 1TJFA 4KX6A 3KV9A 3Q49B 5G05J 2XEVA 3MKDA 4H9SE 4IDQA 3T9KA 2J9QA 4O8SA 3R7QA 1FVHA 2IAKA 1SA0E 3RRWA 5FXXA 1TYQG 3AG3E 3SFZA 4BT8A 4A63B 2MAWA 3L8RA 4CN6A 3B7UX 4H9OC 2XHEB 4EAHA 3FU3A 3C5RA 4EZKA 2CLYC 3JXIA 1MYOA 1SVXA 3CX7B 4KZCA 5LCWC 5CCMA 3ZJ2A 5L3GB 3V30A 5ENPD 3AS4A 2ZM0A 2VQET 4WW0A 1MIVA 2VSNA 3AA7B 4GAAA 4URKA 5E75A 3UUBA 4V3IA 2E9XB 2ZLYA 5BV0A 4GTPA 4DR5T 4MS6A 4WWNA 4K0UA 1N0QA 2X6JA 3W15B 3QC9A 2CBJA 1H0AA 2VTBA 2LOPA 4A55A 5ENNA 5ETWA 4AXHA 2R03A 4AVXA 2WXIA 2WWVA 1N0RA 1ZV4X 2DCPA 3ONJA 5B3SE 2CXLA 2JQ9A 4U96D 4JYAT 5KJNA 4O2AE 3DTOA 3QB2A 3EHZA 2PM6A 4HRLA 4V1Av 4N78D 3W9GA 4FULA 4ZOLE 3LVRE 4O4HE 1S63A 4RG9A 3FH5A 3HXCA 2VKJA 1CHUA 1G8XA 5AN8A 4GKJT 2CPTA 3N2GE 4ILIA 4ATGA 4WBNE 3ZT7A 2KINB 2ETCA 2LRLA 2NW9A 4GZCA 3KDSE 5LA6E 2FJDA 5HXRA 4ZZBA 2OA5A 4YT0A 3C3RA 3ONLC 3PUAA 2WDVA 4TUUA 3JXJA 3FHNA 1N36T 2IDOB 4F6RD 3UXGA 3EIJA 2X67A 3Q73A 4JD2G 4G2VA 4L23A 2CG2A 3NWIA 3BQIA 3DP7A 3NOCD 1MMDA 4XBFB 3HYMB 3C72A 1SQMA 4AY6A 4L2YA 5JA4D 4HOSA 4O6FA 1UX5A 3HA4A 2J08A 3D9JA 3D9OA 4YTNA 4DUZT 5AQ9A 1U5PA 2CBIA 1JCSA 3E4BA 4PS8A 4GTVA 4AJWA 4EEDA 3F31A 2XCCA 3L39A 4KVMA 5A23A 2HR2A 1J5ET 3TWQA 2WXRA 4GIWA 4UI9C 2YN6A 2LE8A 5HQ8A 1IXVA 4TUMA 4IDZA 3CQCB 2ACZA 3ZRHA 2DZOA 4UVAB 1Y6IA 1Z6TA 2B0OE 3CHOA 3AAAC 1HG2A 5KMGP 4JV5T 3LEWA 4JHRA 2XRZA 2XUEA 4NQ0A 2WMOA 5J2TE 2RD0A 4AY5A 4IREA 2I59A 1E96B 1XDOA 2Y4UA 4LNUD 1DU2A 2J09A 3OXGA 5JDGA 3ABME 3J5PA 3HRAA 4XIFA 2XQ6A 2KT9A 5AQSB 2KZ7B 3N71A 3J9X1 4HORA 3UT5E 1TNYA 4WWOA 3NAWA 3TKLB 1OWMA 2CE7A 2XASB 2LAIA 2BS3A 4IE0A 1H19A 5LCYA 4HWIB 1H7CA 4TUYE 4OAVB 1OEDB 4FLHA 4HFIA 4GPMA 4DK5A 4IGUA 3QAQA 5LG4A 3AS5A 4AOFA 1KFYA 2YDRA 3L17A 2WQYA 2X0LB 2H6HA 2CXDA 4UWKA 3P4SA 3NVOA 2E0IA 1E7VA 4I6GA 4O4JE 3MA5A 1HE8A 4EECA 4KI0F 4UQYA 2BVMA 4UWFA 3IBPA 2EIJE 3PJAA 2J07A 3E37A 4YY3T 3SHFA 3QWWA 4DLQA 5AQMB 4GCOA 3IF8B 3UKRG 2C0MA 2CG3A 1YYHA 4HE8A 5L2LA 1HFAA 1XMQT 4IN3B 3C4ZA 1IHGA 4PK6A 1N9AA 3PURA 2BG9B 2F0YA 4HTEA 4JVSA 3C3QA 1DC2A 2Q9QD 2ILRA 3QK6A 2ZM6T 2BS2A 1DCEA 2XAHB 1MMGA 3JC6D 4AIFA 4TWHA 4ZI3C 3UFEA 3AXJB 2OVFA 2KCVA 5AJDA 5A1LA 2IF4A 3C4WA 3R6NA 1H2UA 4CT0A 5ENOD 2D0UA 5ENQD 4DLOA 4FADA 3Q5EA 1KT1A 4UV8B 3GYZA 2WWUA 4A3TA 5F8PA 3ASGA 2QGSA 3MJWA 4UWGA 2L3LA 5AYWD 4I2WA 4O1PA 3D0TA 4QXBB 3FBZA 3O4XE 2QFCA 3UKUG 3Q79A 4GA1A 4U95D 3LKUA 3SD5A 2CM0A 2DLRA 3ONLA 3IXEA 5LCWJ 1LRZA 2Y48B 4DX5D 3KS2A 2IW5B 4DRXE 3MZLB 3B7TA 3TLUA 3VTYA 2E5VA 2LT3A 1W0BA 3LJNA 2PZIA 4IE6A 3HXDA 4RQIA 4XX5A 3L13A 3CVRA 3J7Yq 3LS8A 4QXHB 5J08A 3PE0A 2YU1A 3I1AA 4U3CA 1Y01A 3AE3A 4HGAA 2LM2A 2WXHA 2OEVA 2AXVA 2IC9A 3CHPA 3MXZA 3PUGA 4IDPA 4MALA 1JPLA 1OCCE 4O1OA 5H7PA 3ZIMA 5JDMA 1FEWA 4X62T 1QBQA 2JMHA 2DWGA 4DR4T 5C2YA 3ZJ1A 2VL0A 2P2CP 2VGXA 2XENA 1TNUA 3TWWA 2C0LA 2IOSA 3KVBA 1UN9A 4J7WA 2X9WA 3FTUA 2BBJA 5AQPB 1EDUA 4I43A 3SQVA 2XZDG 3K9IA 5FZSA 3SS1A 4JI4T 3DSSA 2CWOA 1VCTA 4PS7A 5ABFA 4A97A 2J1DG 4CN1A 2ZM2A 4IDNA 3FP3A 1IAPA 4B93B 1HX8A 4EYYR 5LXTE 3TLWA 4K5BA 4UUCA 3AA6B 5A6CA 4Q25A 2W0GA 1D0XA 3EVYA 1XNQT 2E9XD 2YU2A 1O1TA 3VLEA 3UM2A 5CEDB 5HEGA 5EZYE 4YSYA 1TN6A 3QB5K 4JHKA 1BD8A 5FWQA 3MV2B 2V7MA 3B7RL 1X9BA 4DI3A 4ERRA 1T7SA 1TNZA 2IY0C 4G63A 1UW4B 2BKGA 3AB3B 2LEHA 3EU5A 3FTXA 3RIFA 2DZNA 4UI9J 3QC1A 3AE5A 3HVEA 3ML8A 2FUPA 4TN7B 2KZTA 4KYOB 3CGHA 2XAFB 3NRYA 3TG5A 2DI4A 2KWHA 3E22E 2K48A 3OAWA 2QC9A 3L09A 2A5UA 1B89A 2WXOA 1JUQA 4DPRA 5HCMA 5HXEA 1XNFA 2XPIA 1MJ0A 3IHRA 4CYMD 5JRCA 1MZCA 4U74A 3EAMA 2V26A 4CGWA 3Q7AA 3RSEG 3RC8A 5E76A 3UIOC 4CRWA 3GW4A 3N9OA 4B8CB 4KBQA 3RO2A 3GWHA 3EABA 1US7B 2ZXWE 3CIAA 4X1IE 2BDEA 5JDFA 3VTXA 3FUMA 3NZQA 4PW8A 2G0UA 2XSBA 5JREA 2YHCA 3I9YA 5EX3A 5C8YE 3FUEA 4Z91A 3ZYKA 1D1BA 1MX2A 5G04C 4DX6D 2EHOD 2XQ3A 4DR1T 2PQNA 5AJLA 3TL5A 3AEFA 2HE0A 4YDYA 4BA9A 3EDVA 3PREA 1JNRA 3KV6A 3ZSSA 3R84B 4I0UA 3QNKA 4KBMB 5BMVE 3JCKC 3U4TA 4YFSA 3L6AA 3BG1B 4XE0A 1OCOE 3MYVA 2CHNA 4GU5A 2CHWA 3CK7A 2H7VC 5G2NA 2LXMA 1X81A 2L9BA 5HXHA 3V5SA 4DIDB 2NTYA 3F6QA 4LFAT 2PNNA 3ETVA 4P29A 3LBXB 1S64A 5HXCA 1WYBA 3UM0A 2BKOA 1IZNB 2GRNB 2VYIA 3BQOA 1VCSA 1TJCA 2KSRA 1OCZE 1D0YA 3DBSA 3V79K 3D9PA 4U7IA 4C91A 2YDQA 2R6GF 4X66T 4EPZA 4LF7T 1H6PA 3RQUA 2BZBA 2XQAA 4GYSA 5LOZA 2YOEA 5HXSA 2F4VT 2XRYA 4GK5E 2FJAA 4UV9B 2BTDA 2BKPA 2R05A 4XZCA 5FXZA 1W3BA 2W62A 2DYSE 3CK6A 1HR0T 2XEEA 3N2KE 1LD8A 2J4DA 3AU4A 3HXEA 4U33A 1QQEA 2XSAA 4HS2A 4ILAA 3ZN0B 2BKNA 2WDRA 4HWHA 5HCJA 3RGLA 3S7FA 4B3ST 4RSYA 5JR9C 1H6OA 2XGSA 4I55E 1HG5A 4O2BE 4G23A 1XDPA 1E8XA 5ANLA 5FL1A 1MX6A 2VL8A 3O1JA 2WPVA 3QDNA 4APFA 2OV8A 2P9IG 4CDNA 1YD8G 3BK9A 3HXFA 3FDHA 4O4LE 4PFOA 5LJNA 3E34A 1E8YA 2NOXA 2A3DA 3T1YT 4JI6T 1UUSA 3VRAA 4N5CA 3LK3B 5CMWA 3HKCE 1D1CA 5AQTB 2MBGA 4CI3B 4XI0A 1U3DA 3RKGA 3NKZA 5EIDA 4YDEA 3HG0D 3KAEA 2ETBA 4CDRA 2DWKA 4UXNB 3APFA 3ULYA 5AQQB 1NA3A 4AEZC 5CFBA 3MJXA 3CHMA 2D2SA 3NRXA 2VTBB 3L3PA 3A5XA 3MEKA 4U2ZA 1MNEA 1DCQA 2VB6A 5C1DA 4KMCA 5L47A 3TAXA 5FYMA 2LSJA 4JBWF 1E8WA 5CJ5A 2LSIA 2MOZA 4OAUC 2WXKA 2N9DA 3ZFWA 1MIWA 1N4PA 2XGMA 3SNXA 1FT1A 3PU8A 2KATA 3P4PA 4XKBA 3I9WA 1JWGA 2J47A 1SW6A 3RRCA 3NOGD 3ZYLA 4ILUA 2K3WA 4HVBA 4FC8A 3WI3A 2AXDS 2H7OA 5L3FB 3W9FA 3JUIA 4L1BA 4HOUA 5AARA 1OXZA 5LGUB 3UQ7A 3PNLB 3UT8A 3GZ1A 3PUWF 4C0MA 4H63V 5LHIB 1GW6A 2VSOE 3ASDA 3FUFA 1YA0A 4KXKB 5AIJA 2V4HC 3PU3A 4ASKA 2WU5A 1H2TC 2OOEA 4I1AA 4I6JA 3CVXA 2WBLA 4I2ZA 1PC2A 5E0OA 3SI5A 3SFEA 1N4SA 2WXFA 3CK8A 4HI9A 4G24A 1T72A 2L0IA 3ETUA 4R7LA 3OTOT 5FINA 3ZPJA 3CX6B 5ABEA 2UY1A 4NXMT 4CT4A 3RIUA 4YDWA 4M3OA 5B1BE 2NWBA 2CEAA 5T4YA 3CIRA 3IBEA 1YKEB 1H6KA 2ZGGA 2E8IA 4IL4A 3ASHA 4JA9A 3BQKA 2R17C 1IBLT 4C0EA 4ANWA 5EKQD 3EU9A 3ZMTB 2K9AA 4YSZA 2XPYA 4GZ6A 5BR8T 3QUJA 2ETAA 2P9PG 5D0QD 4JI0T 4CQIA 5G55A 3U3IA 2BUGA 4BERA 3DXMG 3ZVVA 2UWJG 3LK42 3ZGQA 2CFZA 1WLXA 2R02A 3PEUB 2L6BA 1LD7A 4WNFA 5JJ6A 2JMKA 3HDXA 3V2OA 3Q9DA 4EEBA 3HKBE 2M63A 5JR9A 2A4ZA 5LYJE 2V4LA 3C51A 3G2SA 1KNRA 2LOSA 4NIQA 5G04J 3N9QA 4BETA 3RQWA 4ANJA 5CMYA 4UVCB 2AVPA 3AA1B 1UOHA 1BI7B 4HFCA 3ASOE 4U07A 1Z0PA 2WB5A 3ABLE 5C2TA 4K5CA 2CLYB 5JJTA 4ME2A 4K0RA 1HS6A 3PH0C 4NIKA 3KSLA 2FF4A 4PFPA 3Q9UC 5LFAA 4HRMB 1UX4A 3NB2A 4GTOA 3FEXA 3NBXX 2ZISA 4YDOA 2CA5A 1FPPA 3SO8A 4PK5A 3RRMB 4F53A 5HWXA 2VKOA 3ZC1A 4E6HA 1BR4A 2XJ7A 1UJKA 1MQSA 3O48A 4GYWA 4HFDA 1OWNA 2RFMA 3FH8A 2X51A 4BX8A 3FTWA 2DHRA 4RVBA 3G2WA 4KT6B 2WY2A 3AE7A 3QOFA 4F1SA 1G3NB 5JQGE 3CWZB 4FU3A 2JIWA 3QJZA 1H2VC 1EF1C 1WDYA 4ZFHA 3BG0B 4DBQA 2V5CA 3MK7C 2AXZA 3ENEA 3OYXA 3I5PA 3UQ4A 1MX4A 5AQ7A 1NP7A 3RYIE 3FULA 1OT8A 2UXDT 3TLVA 2IO3C 4U8HA 4YSXA 2MPKA 3R9AB 2X9HA 5CB4E 2C5JA 1BR0A 2EHOC 4UELA 4MKTA 3AA0B 5LMUT 5LGTB 2JEKA 2LXLA 3KFWX 3OBVE 4B94A 1D0ZA 2SPCA 3HKDE 4RG6A 2RP4A 3AE1A 1WYCA 1FT2A 3FTYA 3V5UA 4B3RT 1BU9A 2KXPC 1LF8A 2JABA 3C64A 4GTQA 3FEYA 4CN4A 4LMLA 2DYRE 4J8SA 1XZYA 2BS4A 3U64A 4LEUA 4UR9A 4K5AB 3DWLG 4P1NA 4ZI2C 3P8CD 2WQ6A 1MHQA 2V8SE 5D2MC 1T98A 2WU2A 5JDQA 1UK5A 3DSXA 3MACA 1I6ZA 4U31A 2P58C 4TWDA 5FTPA 3FZMB 4GZ3A 1KNZA 5AENA 4ACKA 3O9XA 3UPVA 2A9UA 1FIOA 4J8YA 1XWMA 5JH7E 1K1BA 5EIBE 3B5MA 3RK6A 2IIUA 3FUDA 3I4RB 3CHQA 2J8SD 1U3CA 4DJAA 2PFVA 1V55E 2XEHA 3K3OA 5AQJB 5HEHA 3HHMA 1OCRE 3NZSA 2V7LA 1BLXB 2NW7A 5AQNB 5FVKA 3H3AA 2I1KA 3CHSA 4NUUA 3VKHA 2E5LT 4DX2A 2DIWA 2XQ9A 2H89A 4HFGA 1YKHB 3AAAB 4H7YA 4LUNU 2VGXB 2KCLA 2VK9A 3T8KA 4IHJE 5AQLB 3DSWA 4I43B 3CVWA 2EINE 2C5IT 4U7YA 3HKEE 5ABFB 4JEHB 3E33A 1YCSB 5JHBA 1LVKA 3TGOA 3AEBA 3MA9A 4EYUA 5HI7A 3LY7A 4EV6A 4ZHQE 4X20E 4WNDA 4HLLA 2E2AA 4Z68A 1Z3YA 2WXQA 4X64T 1M7KA 2A72A 1NENA 3B7BA 3ZXSA 2BF0X 2DVWA 1S94A 1HNWT 4LERA 3HL6A 4JHJA 2IFUA 5ENSD 2Y4TA 1Z5SC 2KMFA 4LF4T 2LSGA 3LFMA 5CRUA 2ZIRA 4HBDA 4A3VA 3N5LA 5IYZE 5FXWA 5KBAA 2H6IA 4YHHT 1HX1B 3DSVA 5ARGA 3ZKRA 2FJBA 3ZT6A 4U2YA 3HVEB 4YJ3E 4AIUA 3WAKA 3SGHA 4EGWA 1BPOA 4N3BA 4ZI7E 4ILCA 5B1AE 2ODUA 2KZTB 2AXUA 1VRBA 4E85A 2WP9A 4QH4A 1IQUA 4WNGA 3N2OA 4PS3A 5HYAA 4JA7A 2D0TA 3BQLA 3CQXC 3G06A 4JLEA 5J2UE 4FJYA 4APOA 4EZ4A 3RX6A 3O1IA 3JUEA 4CI2B 5HEUA 2V1DB 1L0VA 4LG6A 2X66A 3A8YC 5JRCB 4JW1A 4PJJA 5CA0E 2H88A 3RYCE 4ISSA 5D0OD 5KWDA 1HNXT 3IHYA 3KBUA 3PTRB 2IMLA 4JL0A 1D1AA 2X0HA 5J90A 4QKNA 5HKPA 5DBKA 3UM1A 3KV4A 1DNPA 2P9LG 3C98A 2QVAA 2D5UA 2B6CA 2HM8A 4DI4A 5BV1A 3SFDA 1J5WA 3CKCA 4HNAD 4UF0B 2RFAA 4TXPA 4WYVA 4UEMA 4CI1B 3UMVA 3CQGB 3UFGA 2X38A 2YINA 5FZRA 4IRUA 4Q94A 2XS1A 4PH4B 3SBTB 4JI2T 4OHFA 2XPKA 3Q5MA 2LSUA 1R8IA 4GOUA 4H9RC 3LCAA 3LDZA 4IT4A 5AQFB 2QZAA 2WZHA 3CSFA 3OJAA 2NYJA 3M65A 5JTGA 4NUVA 3FH7A 3SFXA 3IV0A 3CKDA 3OVUA 3IHVA 4G26A 1MIYA 3CHRA 3K8PC 3ZT5A 3TWXA 5KJKA 2A2FX 3ABKE 1OWAA 4ANUA 2KLQA 3ZMUB 4DV2T 3ASNE 3J5QB 2VKHA 5FMNA 1D8DA 4JEHA 4BTAA 2LLYA 5JDLA 3CPZA 4H9NC 2LSVA 3PZ2A 5ENTD 5JJ7A 3ISMC 1KZPA 5CRVA 2FEZA 4FI5A 3PS6A 3P4WA 4HI8A 3UX4A 4CEMA 5FKYA 2I0MA 5FQ6A 2MYSA 4KUMB 2J4BA 3S7JA 4HN9A 2PQRA 4DR2T 4B3TT 5KX5E 2XCBA 4IL9A 3SZ7A 4TNWA 2Y1LE 4WWPA 5AQIB 5J1GA 4BJMA 5CECB 5H6RB 4HXIA 4ANXA 4HLEA 2WXGA 2EILE 3AE9A 4LCTA 2NTXA 2IJGX 4GZ5A 4I17A 2UXXB 2CHZA 4AKLA 2UU9T 1SHZC 1ZU2A 3I4GA 3RYHE 2W61A 4XAXB 3ZNGA 3FFLA 2X9XA 2WXLA 4DMWA 5L3CB 1MNDA 1K3ZD 3P7IA 1E1HB 2AW6A 2AWIA 5EK4A 2WB2A 3VRBA 3EDUA 4TV8E 1NL4A 4GTTA 4BWRA 3PV0F 4FP7A 2QY7A 1UURA 2HPLA 3Q75A 4WUYA 2LHRA 3WAJA 2XM1A 1N4RA 2OEWA 3VR8A 2XQ0A 5HRYA 5LBMA 4GK0E 4IE7A 3ESLA 3K3QC 1WFDA 2GK9A 1ZHCA 2ODVA 2LKGA 1KNPA 3ZEFB 3UT7A 1EPUA 2YHEA 2XAQB 3CX8B 2JJ9A 3JCFA 3AVSA 4F6RC 4NXNT 5AQKB 2GGFA 4GMJA 5T8IA 3KV5A 1EYHA 3ZC0A 4JPSA 3CVQA 4M7CA 2GRRB 4UF0A
chains in the Genus database with same CATH topology
4GA2A 2PBIA 4TV9E 4EBAG 3GZSA 5JDNA 2L0TB 4FHKA 3U66A 3MZKB 3CVUA 1ZKEA 2LO6A 3IEEA 3D9MA 1ELKA 1N52A 1FVFA 3BEEA 3QARA 3PE4A 5L3EB 4ADZA 5T3RA 5HAXA 3FUHA 4BT9A 4MLPA 3NF1A 3ULQA 5FY0A 1MMNA 3ZCJA 2X6FA 1KLXA 2UY1B 4IIJE 3D9LA 2K24A 2XAJB 4AKRB 4GA0A 2YK0A 5LHGB 4GMLA 3IEGA 3SRZA 4QX7B 2V7IA 4UI9K 1NAFA 3ZYMA 4UWHA 2NW8A 4BTBA 4PDXA 3FB2A 4I9EA 3OTNA 4EIWA 1OUVA 3LXUX 4WNKA 1QUUA 4C9BB 4PJNA 2I1JA 4QWNB 2LM9A 5LP0A 5LOVE 2HH7A 3ZMVB 5EK3A 3ZN3A 2QA7A 3ESKA 5JR9B 1VOMA 5KCMA 4MRUA 4L9IA 4H63H 3AAIA 2RG8A 3CVLA 3RO3A 2LSYA 3SF4A 2Q9QC 3I0QA 2CWYA 3ZEFA 3JC6C 1KT0A 1SZ9A 4WAFA 1BR1A 3S2AA 4I9CA 2L8KA 4HEAA 3Q5WA 1B7TA 5LGNB 4AQGA 4KP3C 1LVFA 3OXFA 3APCA 4ZI3D 1A17A 5HWYA 2VGYA 3MKQA 5GONE 4I4TE 2L9QA 3JQ1A 1HTJF 3F57A 3FWVA 3HI2A 1E90A 4G1TA 4GCNA 5L3DB 4L2LA 3EHNA 5KDMC 3L54A 2XAGB 1X5BA 3EDTB 4J2CA 3IKOB 3LPZA 4CXYA 4OYKA 1WAO1 2RA1A 2B1EA 5AFUL 1Y64B 2X6HA 3DPDA 1FMWA 1NA0A 2MTQA 2GW1A 4NACA 4D10C 1NZNA 5FZQA 3QK0A 4A1SA 1X79A 5DABA 4QX8B 4BFRA 3Q2MA 2NSZA 3RYFE 4K03A 4YJ2E 4Z8XA 4JZYA 2JRKA 4I6EA 4BAYB 4H9PC 3GN5A 4I1MA 3TXNA 3NQPA 2HYZA 2XPZA 3ZW3A 4A56A 5BPPA 5DIZA 3E08A 3QWPA 3RKOA 1OWLA 2E9XC 4FJOA 4AKHA 3TG4A 3R7RA 4AKGA 3LYAA 3FXEB 3AS8A 2PM7A 5H6QB 3PUQA 5CHEE 2NP9A 2XGOA 2Y6XA 3H37A 5FJYA 1QZ2A 2N2NA 1SZAA 4CXWA 4IYPA 4G25A 3D3MA 4FHJA 2JLBA 2IC6A 2XQYA 4YLHA 2V0PA 5ANRA 2C5KT 2R59A 2LHNA 1O3XA 2VASA 4DMVA 4Q69A 3PUKA 3P2BA 4JEUA 3NZPA 3KVAA 3CKBA 4N3AA 3MKRA 4FLBA 4N2SA 4HKAA 3PUSA 2Q9QA 3ANWA 2W63A 5DJQC 2UXNB 2WXPA 4XKCA 1XGWA 4H9QC 4CZZB 2MRIA 4KZ0A 2LAHA 1ELRA 5EDSA 2FO7A 3QOUA 3U3WA 3LJCA 2ACXA 2L6JA 5F3JA 3LVQE 4BJNA 2WVIA 3ZLIA 3U78A 3ZPOA 4DBRA 4N39A 2Y3AA 4QHOA 4U63A 4HFVA 4PAGA 3T5VA 3LY8A 3TXMA 1HU3A 1HH8A 1E7UA 2PG8A 3RPUA 3T5XA 3PEVB 3RU0A 4UQXA 3C98B 2WQHA 3CVYA 4PUCA 3N9LA 2EHOB 4O4IE 5ADXL 4J6IA 4U0ZA 4N3CA 1ZEEA 4MLKA 4ILHB 4BSXA 3UUXA 3FTSA 3MX3A 2DBAA 3SOLA 5IHYA 3ZMZB 3AU5A 3E0ZA 2WAUA 2KXPB 3PUJA 1MMAA 2W00A 2CFUA 2C0SA 3ONXA 2K5BB 1S35A 3RH3A 3FU5A 2XHEA 3TJPA 2PJQA 5FQ7A 4AKIA 4DNDA 3RC3A 3VLDA 1S0PA 3KD7A 5FY7A 3RKVA 4I50E 3CVPA 4U04A 5BUZA 4UWLA 2I2OA 4CGVA 2P9BA 1UCUA 2E9XA 3SBSA 2KCKA 4EZJA 3HIZA 3ASFA 4B89A 4U0SA 2YNQA 4GB9A 4YVQC 3C4XA 3URZA 3L22A 2CHXA 4GYRA 3FUKA 1PY1A 4QFVA 1Y8MA 3OYZA 3CVNA 2GRMA 3PDNA 5ARFA 4BX9A 4GYOA 2CCQA 3FY4A 3FTZA 2X6IA 1BR2A 1LKXA 4G2AA 3ZCIA 4WNEA 5LJMA 2FULA 3ZHEB 1G73A 3FUIA 4KMOA 3QWVA 3UULA 4EZLA 3CMLA 1UJJA 3D9IA 2I6HA 3EIQC 4JUYA 1AJ3A 5CA1E 2IOLA 3T8MA 4OVVA 2WXJA 5L3BB 3LG7A 4P0BA 4CCAA 4ISTA 2KM4A 3UUMA 5DQWA 4JXTA 3CLJA 3N9PA 2WQ7A 4E7SA 5LP6E 2Y8DA 5M4YA 3CV0A 3D9NA 1ZBPA 1INZA 1NWMX 2ZM8A 2IONA 3C50A 2EHOA 2BVLA 3U9WA 3ZYQA 3QKYA 1QNFA 4TV3A 2WSSV 4WBOA 5LBQB 2ES0A 5BT1A 4MBQA 4L5GA 4ILGA 2Q7FA 1UN8A 2FI7A 3GMIA 4EQFA 4BY6A 4AM9A 1FMVA 2IQCA 3AVRA 3PE3A 4C90A 3KINB 3LY9A 3UTKA 3OXLA 1FCHA 4EZHA 2FBNA 2NC9A 3FTVA 2YQ8A 3NZUA 4PJMA 3L16A 3PVLA 3B13A 4GPKA 4J8EA 4YVOA 4AQFC 4DO0A 3O1HA 1HXIA 1WM5A 4P0AA 2JPFA 1E8ZA 3APDA 3F2EA 1YW0A 2KC7A 3I3NA 2CXFA 5BW8C 1ELWA 2LSKA 2DNXA 3RIBA 2EQXA 1WY6A 4NRHB 5FQ8A 4F7AA 3UT4A 2DCFA 1UG3A 3EHMA 1WR6A 1N54A 2I9CA 3ZHEA 4J8DA 1P5QA 2ONDA 4CXXA 4PJLA 3FBLA 5FP3A 4KVOA 3LJ3A 2WMNA 4PK4A 1IQRA 3PZDA 3LK2B 2X3MA 3RJVA 2HO1A 2M67A 4UIGA 3MCXA 3GA8A 4XI9A 4M1PA 5G05C 3VU7H 5LNKA 2VJ8A 4CDMA 3PDYA 3PRZA 3D9KA 4J8FA 4X1YE 2CMRA 4EBAA 1PAQA 4YNDA 5LX8A 5FQ4A 2HPJA 4G11A 5A7DB 2WXNA 3N9NA 3MKQB 3L08A 3RRUA 3FUNA 5LHHB 5KJLA 4OFZA 1L5JA 3Q4AB 4Y6CA 3UQ3A 4P09A 3CR3A 4W9RA 4AV7A 4YHJA 4B6XA 4F3VA 4AXPA 2X6KA 5FXVA 3FU0A 4FA6A 2H3RA 3PNTB 4L0RA 3CEQA 4ZI2D 4HOQA 3O4ZA 2PL2A 3KBTA 3G2UA 4B8AA 4N2QA 4L7TA 3MV3B 4PNIA 2WM9A 2MOWA 3CVVA 4MFRA 2LJLA 2JQQA 1DVPA 2E2EA 3CSTA 3B7SA 5KJMA 2KWIB 2GRLA 3B57A 3S4UA 4ABNA 4U0UA 1HO8A 2V5FA 2ZMAA 5FY1A 2ZU6B 3GN5B 4ZS2A 3G2VA 3VLFA 4U72A 2OVBA 4JC8A 4MHCA 3K3NA 4GYYA 3ML9A 5TAOA 1CUNA 3FXDB 4AQFA 3P1UA 4EB6E 5DQVA 2XTLA 4GZDA 3SWHA 4FJZA 2X9YA 1IJ5A 3DJBA 4IE4A 5BNWA 1EZ3A 1HZ4A 4UVBB 3RRNB 3WXXA 1HS7A 4A1GA 1OWOA 5FT9A 4AP2A 4X1KE 3MGBA 1HCIA 2J49A 1VDYA 3EUHA 4UQZA 4OVUA 5EX0A 2VQ2A 3AAEB 3JQ0A 4XZ4A 3EJNA 3ZN1B 1V9DA 4TRQA 3GZ2A 4JEUB 2R5SA 4ANVA 1HF8A 3KEZA 3T8OA 2VSYA 4B0ZA 3FU6A 2KNDA 3S7BA 1U4QA 2Q9QB 4DVDA 2VKDA 2YEVC 3ANWB 5JDHA 2WXMA 2LNIA 3FHEA 3S7DA 4TZ4C 3I0OA 2Z6EA 3HR0A 4ZS3A 4LRZA 4OYSA 4NURA 2C2LA 2V7KA 1Z3XA 3Q5XA 3FUJA 4OYJA 3ZMSB 3VHLA 2NXPA 3G2TA 3OKQA 3Q47B 5JHAA 4AI6A 1WRDA 4IULA 2V7JA 1QSDA 5M72A 2N1GA 3VKGA 2X68A 1JWFA 4ACLA 4QXCB 3LBXA 5EK2A 3CK9A 5FNVE 2MHKA 4OK0A 4I1OB 3N9MA 4E7ZA 1OWPA 4IE5A 4EOZB 4HOTA 4J0UA 3ONKA 4TX5A 3JYSA 2VSXE 5JVDE 5CCLA 1TEZA 1IYGA 2IU1A 4Y6WA 2VWAA 4Q96A 3Q15A 4H7XA 3UUXB 1KK7A 4EXTA 1IJ6A 3UUNA 1TJFA 5G05J 3KV9A 3Q49B 2XEVA 3MKDA 4H9SE 2J9QA 4O8SA 3R7QA 1FVHA 2IAKA 1SA0E 3RRWA 5FXXA 3SFZA 4BT8A 3B7UX 4H9OC 2XHEB 4EAHA 3FU3A 4EZKA 2CLYC 3CX7B 4KZCA 5LCWC 5CCMA 3ZJ2A 5L3GB 3AS4A 2ZM0A 4WW0A 1MIVA 2VSNA 3AA7B 4GAAA 4URKA 5E75A 4V3IA 2E9XB 2ZLYA 5BV0A 4MS6A 4WWNA 4K0UA 2X6JA 3W15B 3QC9A 1H0AA 2VTBA 2LOPA 4A55A 5ENNA 5ETWA 4AXHA 4AVXA 2WXIA 2DCPA 1ZV4X 2CXLA 5KJNA 4O2AE 3DTOA 3QB2A 2PM6A 4V1Av 4N78D 4FULA 4ZOLE 3LVRE 4O4HE 4RG9A 3FH5A 2VKJA 1G8XA 3N2GE 4ILIA 4ATGA 4WBNE 2KINB 2NW9A 4GZCA 3KDSE 5LA6E 5HXRA 2OA5A 3PUAA 4TUUA 3FHNA 3EIJA 2X67A 4G2VA 4L23A 2CG2A 3BQIA 3DP7A 1MMDA 4XBFB 3HYMB 1SQMA 4AY6A 4L2YA 4HOSA 4O6FA 1UX5A 3HA4A 2J08A 3D9JA 3D9OA 1U5PA 3E4BA 4PS8A 4AJWA 3F31A 2XCCA 4KVMA 5A23A 2HR2A 2WXRA 4GIWA 4UI9C 2LE8A 5HQ8A 4IDZA 3CQCB 3ZRHA 4UVAB 1Y6IA 1Z6TA 3CHOA 1HG2A 5KMGP 3LEWA 2XRZA 4JHRA 2XUEA 4NQ0A 2WMOA 5J2TE 2RD0A 4AY5A 2I59A 1E96B 2Y4UA 2J09A 3OXGA 5JDGA 4XIFA 2KT9A 2KZ7B 3N71A 3J9X1 4HORA 3UT5E 4WWOA 3TKLB 1OWMA 2CE7A 2XASB 2LAIA 4IE0A 1H19A 5LCYA 1H7CA 4TUYE 4FLHA 4DK5A 4IGUA 3QAQA 5LG4A 3AS5A 4AOFA 3L17A 2X0LB 2CXDA 4UWKA 2E0IA 1E7VA 4I6GA 4O4JE 3MA5A 1HE8A 4EECA 4UQYA 2BVMA 4UWFA 3IBPA 2J07A 3SHFA 3QWWA 4DLQA 4GCOA 3IF8B 2C0MA 2CG3A 4HE8A 5L2LA 1HFAA 4IN3B 3C4ZA 1IHGA 4PK6A 3PURA 4HTEA 4JVSA 2Q9QD 2ILRA 3QK6A 2XAHB 1MMGA 3JC6D 4AIFA 3UFEA 4ZI3C 2OVFA 2KCVA 5AJDA 5A1LA 2IF4A 3C4WA 3R6NA 1H2UA 4CT0A 2D0UA 4DLOA 4FADA 1KT1A 4UV8B 3GYZA 2WWUA 4A3TA 5F8PA 3ASGA 2QGSA 3MJWA 4UWGA 2L3LA 5AYWD 4I2WA 3D0TA 4QXBB 3FBZA 3O4XE 2QFCA 4GA1A 3SD5A 3LKUA 2CM0A 2DLRA 3ONLA 5LCWJ 1LRZA 2Y48B 3KS2A 2IW5B 3MZLB 3B7TA 3VTYA 2LT3A 2PZIA 4IE6A 4XX5A 3L13A 3CVRA 3J7Yq 3LS8A 4QXHB 5J08A 3PE0A 2YU1A 3I1AA 4HGAA 2WXHA 2AXVA 2IC9A 3CHPA 3MXZA 3PUGA 4MALA 1JPLA 3ZIMA 5JDMA 1FEWA 2JMHA 2DWGA 5C2YA 3ZJ1A 2VGXA 2C0LA 2IOSA 3KVBA 1UN9A 2X9WA 3FTUA 1EDUA 4I43A 3K9IA 5FZSA 3SS1A 2CWOA 4PS7A 2J1DG 2ZM2A 3FP3A 1IAPA 1HX8A 4EYYR 5LXTE 3AA6B 5A6CA 2W0GA 1D0XA 3EVYA 3VLEA 2E9XD 2YU2A 5EZYE 4JHKA 5FWQA 3MV2B 2V7MA 3B7RL 4DI3A 4ERRA 4G63A 1UW4B 3AB3B 2LEHA 3FTXA 4UI9J 3QC1A 3HVEA 3ML8A 4TN7B 2KZTA 4KYOB 3CGHA 2XAFB 3NRYA 3TG5A 2DI4A 2KWHA 3E22E 2K48A 3OAWA 3L09A 2A5UA 1B89A 2WXOA 1JUQA 4DPRA 5HXEA 1XNFA 2XPIA 3IHRA 5JRCA 4U74A 4CGWA 2V26A 3RC8A 5E76A 4CRWA 3GW4A 3N9OA 4B8CB 4KBQA 3RO2A 3GWHA 1US7B 3CIAA 4X1IE 2BDEA 5JDFA 3VTXA 3FUMA 3NZQA 4PW8A 2G0UA 5JREA 2YHCA 3I9YA 5EX3A 5C8YE 3FUEA 3ZYKA 1D1BA 5G04C 2EHOD 2PQNA 5AJLA 3TL5A 4BA9A 3EDVA 3PREA 3KV6A 3R84B 3QNKA 4KBMB 5BMVE 3JCKC 3U4TA 4YFSA 3L6AA 3BG1B 4XE0A 3MYVA 4GU5A 2CHWA 3CK7A 2H7VC 5G2NA 2L9BA 5HXHA 3V5SA 2NTYA 3ETVA 4P29A 3LBXB 5HXCA 1WYBA 1IZNB 2VYIA 1TJCA 1D0YA 3DBSA 3D9PA 4C91A 4EPZA 2BZBA 4GYSA 5LOZA 5HXSA 2XRYA 4GK5E 4UV9B 2BTDA 4XZCA 5FXZA 1W3BA 2W62A 3N2KE 2J4DA 3AU4A 1QQEA 4HS2A 3ZN0B 3S7FA 4RSYA 5JR9C 2XGSA 4I55E 1HG5A 4O2BE 4G23A 1E8XA 5ANLA 2VL8A 3O1JA 2WPVA 3QDNA 4APFA 2OV8A 4CDNA 1YD8G 3BK9A 3FDHA 4O4LE 4PFOA 5LJNA 1E8YA 2NOXA 2A3DA 4N5CA 3LK3B 5CMWA 3HKCE 1D1CA 2MBGA 4CI3B 4XI0A 1U3DA 3KAEA 4CDRA 2DWKA 4UXNB 3APFA 1NA3A 4AEZC 3MJXA 3CHMA 2D2SA 3NRXA 2VTBB 3L3PA 3A5XA 3MEKA 1MNEA 2VB6A 5C1DA 4KMCA 3TAXA 5FYMA 2LSJA 1E8WA 2LSIA 2MOZA 2WXKA 2N9DA 3ZFWA 1MIWA 2XGMA 3SNXA 3PU8A 2KATA 4XKBA 3I9WA 1JWGA 3RRCA 3ZYLA 4ILUA 4HVBA 4FC8A 3WI3A 5L3FB 2H7OA 3JUIA 4L1BA 4HOUA 1OXZA 5LGUB 3PNLB 3UT8A 3GZ1A 4C0MA 4H63V 5LHIB 1GW6A 2VSOE 3ASDA 3FUFA 1YA0A 4KXKB 5AIJA 3PU3A 4ASKA 2OOEA 1H2TC 4I1AA 4I6JA 3CVXA 2WBLA 4I2ZA 1PC2A 5E0OA 3SI5A 2WXFA 3CK8A 4G24A 2L0IA 3ETUA 4R7LA 3ZPJA 3CX6B 2UY1A 4CT4A 4M3OA 2NWBA 2CEAA 5T4YA 3IBEA 1YKEB 1H6KA 2E8IA 3ASHA 4JA9A 3BQKA 2R17C 4C0EA 4ANWA 5EKQD 3ZMTB 2K9AA 2XPYA 4GZ6A 3QUJA 5D0QD 4CQIA 5G55A 3U3IA 2BUGA 3ZVVA 2UWJG 3LK42 3ZGQA 2CFZA 1WLXA 3PEUB 4WNFA 5JJ6A 2JMKA 3HDXA 3Q9DA 3HKBE 2M63A 5JR9A 2A4ZA 5LYJE 2V4LA 3C51A 3G2SA 2LOSA 5G04J 3N9QA 4ANJA 5CMYA 4UVCB 2AVPA 3AA1B 4U07A 1Z0PA 2CLYB 5JJTA 4ME2A 4K0RA 1HS6A 3PH0C 2FF4A 4PFPA 5LFAA 1UX4A 3FEXA 3NBXX 2CA5A 4PK5A 3RRMB 4F53A 5HWXA 2VKOA 3ZC1A 4E6HA 1BR4A 1UJKA 1MQSA 3O48A 4GYWA 1OWNA 3FH8A 2X51A 4BX8A 3FTWA 2DHRA 4RVBA 3G2WA 4KT6B 4F1SA 5JQGE 3CWZB 4FU3A 3QJZA 1H2VC 1EF1C 3BG0B 4DBQA 2AXZA 3MK7C 3ENEA 3OYXA 3I5PA 1NP7A 3RYIE 3FULA 4U8HA 3R9AB 2X9HA 5CB4E 2C5JA 1BR0A 2EHOC 4UELA 4MKTA 3AA0B 5LGTB 2JEKA 3KFWX 3OBVE 4B94A 1D0ZA 2SPCA 3HKDE 4RG6A 2RP4A 1WYCA 3FTYA 3V5UA 1LF8A 3C64A 3FEYA 4J8SA 3U64A 4LEUA 4ZI2C 3P8CD 2WQ6A 1MHQA 2V8SE 1T98A 5JDQA 3MACA 2P58C 5FTPA 4GZ3A 1KNZA 5AENA 4ACKA 3O9XA 3UPVA 1FIOA 5JH7E 3RK6A 3FUDA 3I4RB 3CHQA 4DJAA 1U3CA 2PFVA 3K3OA 3NZSA 3HHMA 2V7LA 2NW7A 3H3AA 2I1KA 3CHSA 4NUUA 3VKHA 2DIWA 4HFGA 1YKHB 3AAAB 4H7YA 4LUNU 2VGXB 2KCLA 2VK9A 4IHJE 4I43B 3CVWA 2C5IT 3HKEE 4JEHB 5JHBA 1LVKA 3TGOA 3MA9A 4EYUA 5HI7A 3LY7A 4ZHQE 4X20E 4WNDA 1Z3YA 2WXQA 2A72A 3ZXSA 2BF0X 1S94A 4LERA 3HL6A 4JHJA 2IFUA 2Y4TA 2KMFA 2LSGA 3LFMA 4A3VA 3N5LA 5IYZE 5FXWA 5ARGA 3HVEB 4YJ3E 3WAKA 3SGHA 1BPOA 4N3BA 4ZI7E 2ODUA 2KZTB 2AXUA 1VRBA 4E85A 1IQUA 4WNGA 3N2OA 4PS3A 5HYAA 4JA7A 2D0TA 3BQLA 3CQXC 4JLEA 5J2UE 4FJYA 4APOA 4EZ4A 3RX6A 3O1IA 4CI2B 2V1DB 2X66A 5JRCB 4JW1A 4PJJA 5CA0E 3RYCE 4ISSA 5D0OD 3IHYA 3KBUA 3PTRB 4JL0A 1D1AA 5J90A 4QKNA 5DBKA 3KV4A 1DNPA 3C98A 2D5UA 2HM8A 4DI4A 5BV1A 3CKCA 4UF0B 4UEMA 4CI1B 3UMVA 3CQGB 2X38A 2YINA 5FZRA 4IRUA 4Q94A 4PH4B 3SBTB 4OHFA 3Q5MA 2LSUA 4GOUA 4H9RC 3LCAA 3LDZA 3CSFA 3OJAA 3M65A 3FH7A 4NUVA 3IV0A 3CKDA 3IHVA 4G26A 1MIYA 3CHRA 3K8PC 5KJKA 2A2FX 4ANUA 1OWAA 2KLQA 3ZMUB 2VKHA 5FMNA 4JEHA 4BTAA 3CPZA 4H9NC 5JDLA 2LSVA 5JJ7A 2FEZA 4FI5A 3PS6A 3UX4A 4CEMA 5FQ6A 2MYSA 4KUMB 2J4BA 3S7JA 4HN9A 2PQRA 2XCBA 5KX5E 3SZ7A 4WWPA 5J1GA 4BJMA 5H6RB 4HXIA 4ANXA 4HLEA 2WXGA 4LCTA 2NTXA 2IJGX 4GZ5A 4I17A 2UXXB 2CHZA 4AKLA 1SHZC 1ZU2A 3I4GA 3RYHE 2W61A 4XAXB 3FFLA 2X9XA 2WXLA 4DMWA 5L3CB 1MNDA 3P7IA 1E1HB 2AW6A 2AWIA 5EK4A 2WB2A 3EDUA 4TV8E 4BWRA 4FP7A 2QY7A 2HPLA 4WUYA 2LHRA 3WAJA 2XQ0A 5LBMA 4GK0E 3ESLA 3K3QC 4IE7A 2GK9A 1ZHCA 2ODVA 3ZEFB 3UT7A 1EPUA 2YHEA 2XAQB 3CX8B 2JJ9A 3AVSA 4F6RC 4GMJA 2GGFA 5T8IA 3KV5A 1EYHA 3ZC0A 4JPSA 3CVQA 4UF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMN A;  2WMO A;  2WM9 A;  3B13 A;  2YIN A;  3VHL A; 
#chains in the Genus database with same CATH topology
 4ILB A;  4GA2 A;  4DV3 T;  4O60 A;  1O1R A;  2PBI A;  4TV9 E;  4EBA G;  3UTM A;  3R9M A;  3GZS A;  5JDN A;  1A5E A;  2L0T B;  4FHK A;  5EYP F;  3U66 A;  3MZK B;  3CVU A;  1ZKE A;  2LO6 A;  3IEE A;  5CBN A;  4X5T A;  3D9M A;  1ELK A;  2FBW A;  1IBM T;  1FVF A;  1N52 A;  4DV5 T;  2F8Y A;  3BEE A;  3C3O A;  2IHR 1;  2P9S G;  3QAR A;  4LMK A;  3B95 A;  2V5Q C;  3PE4 A;  5L3E B;  4ADZ A;  5T3R A;  1OED E;  5HAX A;  3FUH A;  4BT9 A;  3PUZ F;  4MLP A;  3E32 A;  3NF1 A;  3ULQ A;  5FY0 A;  4DV7 T;  1MMN A;  4IDO A;  5FIO A;  1TNB A;  4OX9 T;  3ZCJ A;  2X6F A;  2VQF T;  4K0K T;  1KLX A;  2XZE A;  2UY1 B;  4IIJ E;  3D9L A;  2K24 A;  1SA5 A;  2UUB T;  2XAJ B;  4AKR B;  2V8S V;  4GA0 A;  2YK0 A;  3OPC A;  5LHG B;  3RLF F;  4GML A;  3IEG A;  3SRZ A;  4QX7 B;  2V7I A;  4UI9 K;  1NAF A;  3ZYM A;  4UWH A;  1WG0 A;  2NW8 A;  4BTB A;  5IY5 E;  4PDX A;  3FB2 A;  4ZZC A;  2BG9 E;  4I9E A;  1TN7 A;  4HWD A;  3OTN A;  3JAD A;  4JB8 P;  4LNG A;  1ZP0 A;  4EIW A;  2PTF A;  1OUV A;  1TNO A;  3LXU X;  4WNK A;  1K8K G;  1OY3 D;  1QUU A;  5AQA A;  4C9B B;  4PJN A;  2I1J A;  4A98 A;  4QWN B;  2LM9 A;  5LP0 A;  5LOV E;  2HH7 A;  5LB7 B;  3ZMV B;  5EK3 A;  3NBN B;  3ZN3 A;  2QA7 A;  3ESK A;  5JR9 B;  2V6X A;  1VOM A;  5KCM A;  3AE4 A;  4MRU A;  2VVN A;  4L9I A;  5HS0 A;  4H63 H;  3AAI A;  1IHB A;  2RG8 A;  3CVL A;  3AE2 A;  3RO3 A;  2LSY A;  3AE6 A;  3SF4 A;  2Q9Q C;  3I0Q A;  2CWY A;  3ZEF A;  5AAO A;  4LSZ E;  3JC6 C;  1KT0 A;  3AG4 E;  1SZ9 A;  4LF9 T;  4WAF A;  1BR1 A;  4NPP A;  3S2A A;  4I9C A;  1SA4 A;  2L8K A;  4HB5 A;  3AEE A;  4HEA A;  3Q5W A;  3Q7F A;  1B7T A;  4QH5 A;  5LGN B;  4AQG A;  4G8K A;  4KP3 C;  1LVF A;  3OXF A;  3APC A;  4ZI3 D;  2DL1 A;  2D9D A;  1A17 A;  5HWY A;  2VGY A;  3MKQ A;  2IEJ A;  5GON E;  4I4T E;  2L9Q A;  3JQ1 A;  1HTJ F;  5JMN D;  5FVL A;  1O5M A;  4QQI A;  3F57 A;  4AQY T;  1N95 A;  3FWV A;  3HI2 A;  1E90 A;  1TR4 A;  4G1T A;  1BI8 B;  4GCN A;  4JI5 T;  5L3D B;  4L2L A;  3EHN A;  2XM2 A;  4YTM A;  2BBH A;  5KDM C;  4LMJ A;  2VUR A;  2H6G A;  3L54 A;  2XAG B;  1X5B A;  4C48 B;  3EDT B;  3EUV A;  4J2C A;  3IKO B;  3LPZ A;  3TWU A;  4CXY A;  4B3M T;  3V2X A;  4OYK A;  1WAO 1;  2RA1 A;  1NEK A;  2B1E A;  5AFU L;  2UXB T;  3TWS A;  2ZGD A;  1Y64 B;  2X6H A;  3DPD A;  1FMW A;  1NA0 A;  2MTQ A;  1ZOY A;  2GW1 A;  4NAC A;  2FJE A;  4D10 C;  1NZN A;  5FZQ A;  3QK0 A;  4A1S A;  1X79 A;  2XS8 A;  2BED A;  5DAB A;  4QX8 B;  4BFR A;  3Q2M A;  2LUH A;  2NSZ A;  3RYF E;  4K03 A;  4YJ2 E;  4Z8X A;  4KHZ F;  3UU8 A;  4JZY A;  2JRK A;  2XQ7 A;  4I6E A;  4BAY B;  3BUA A;  4H9P C;  2HN1 A;  3GN5 A;  4I1M A;  3TXN A;  3NQP A;  4TWF A;  2HYZ A;  2XPZ A;  3ZW3 A;  4A56 A;  4GTR A;  5J0Z A;  5BPP A;  5DIZ A;  2V5D A;  3E08 A;  1IKN D;  3QWP A;  3ZU7 B;  3X1D A;  3RKO A;  2LKH A;  1OWL A;  2E9X C;  4EHM A;  4FJO A;  2Y69 E;  3PZ3 A;  4AKH A;  1OXJ A;  3R7R A;  3TG4 A;  3LDQ B;  4JI1 T;  3UU4 A;  4AKG A;  5CBO A;  3TLT A;  2UUA T;  3LYA A;  3FXE B;  3P4Q A;  3AS8 A;  1JCQ A;  2PM7 A;  5H6Q B;  3PUQ A;  1NFI E;  4U8Y D;  4KHP T;  5CHE E;  2NP9 A;  2RPA A;  2XGO A;  2Y6X A;  3H37 A;  1JNZ A;  5FJY A;  5AQO B;  2N2N A;  1QZ2 A;  1SZA A;  4CXW A;  4HWF A;  4IYP A;  4G25 A;  3ZUV B;  3D3M A;  4FHJ A;  2JLB A;  4LF8 T;  2IC6 A;  2XQY A;  4YLH A;  2V0P A;  5ANR A;  2C5K T;  2R59 A;  2LHN A;  1O3X A;  2VAS A;  4DMV A;  4Q69 A;  3PUK A;  3T1H T;  3P2B A;  2GRO B;  4JEU A;  3NZP A;  1QLB A;  3KVA A;  3CKB A;  3MKR A;  4FLB A;  4N3A A;  4N2S A;  3D9H A;  3Q9N C;  2F8X K;  4HKA A;  3PUS A;  2Q9Q A;  2NR4 A;  3ANW A;  1UGO A;  2W63 A;  5DJQ C;  2F37 A;  3UIN C;  1YQ3 A;  2UXN B;  2WXP A;  4XKC A;  3DPY A;  3P50 A;  1XGW A;  4H9Q C;  4CZZ B;  5EN5 D;  5C3J A;  3DXK G;  2MRI A;  2M6I A;  4KZ0 A;  2P9U G;  2LAH A;  1ELR A;  5EDS A;  2FO7 A;  3QOU A;  3U3W A;  3LJC A;  2ACX A;  2L6J A;  4DV4 T;  3FZK B;  5F3J A;  3LVQ E;  3PZ1 A;  4BJN A;  2WVI A;  3UU6 A;  3ZLI A;  3U78 A;  4GTS A;  3ZPO A;  4DBR A;  1KEY A;  2Y3A A;  4N39 A;  4QHO A;  4U63 A;  4HFV A;  4PAG A;  3T5V A;  3LY8 A;  3TXM A;  1HU3 A;  4DV1 T;  1HH8 A;  3TLS A;  2WZI A;  2WCA A;  1E7U A;  2PG8 A;  3RPU A;  3T5X A;  3PEV B;  3RU0 A;  4XEI G;  4HWC A;  4UQX A;  3K1S A;  3AG1 E;  3C98 B;  3UM3 A;  2W4X A;  2P9K G;  2WQH A;  3CVY A;  4PUC A;  3FZL B;  2J4G A;  1JCR A;  3N9L A;  2EHO B;  4O4I E;  5ADX L;  4J6I A;  4U0Z A;  2HN2 A;  4N3C A;  5L4E A;  1ZEE A;  4MLK A;  4ILH B;  4BSX A;  3UUX A;  3FTS A;  3MX3 A;  2DBA A;  3SOL A;  4YTP A;  5IHY A;  3ZMZ B;  2A5E A;  3E0Z A;  3AU5 A;  2WAU A;  2KXP B;  2HHH T;  3PUJ A;  1MMA A;  2B76 A;  2W00 A;  1W9R A;  2CFU A;  4U7E B;  1OED C;  2C0S A;  4DUI A;  3ONX A;  2K5B B;  4N5Q A;  1S35 A;  3RH3 A;  3FU5 A;  2IO2 C;  2W66 A;  2XHE A;  3TJP A;  3QB5 A;  2PJQ A;  5FQ7 A;  3L9T A;  2WS3 A;  3X2Q E;  1KF6 A;  4AKI A;  4DND A;  3RAU A;  3RC3 A;  5KNG A;  3VLD A;  3EHR A;  1S0P A;  2IUB A;  3KD7 A;  1Q2Z A;  3EI0 A;  1O1S A;  5FY7 A;  3RKV A;  4DR7 T;  1KPS B;  5EIL A;  4YXD A;  4I50 E;  3CVP A;  4U04 A;  3PZ4 A;  4UWL A;  2I2O A;  5BUZ A;  4CGV A;  2P9B A;  1UCU A;  3FZF B;  1SE7 A;  2E9X A;  3SBS A;  2H6F A;  2KBX A;  4TXR A;  3AJI A;  2X0Y A;  2KCK A;  4EZJ A;  2BG9 C;  3HIZ A;  5LMN T;  3ASF A;  3L82 A;  4B89 A;  2WDQ A;  4TXQ A;  4U0S A;  5BXO A;  2FO1 E;  2YNQ A;  4GB9 A;  4YVQ C;  3RIA A;  3C4X A;  3URZ A;  3L22 A;  1XMO T;  3P4R A;  2CHX A;  4GYR A;  3VR9 A;  3TWV A;  4CZ2 D;  3FUK A;  1PY1 A;  4QFV A;  1Y8M A;  3OYZ A;  2GRM A;  3CVN A;  3PDN A;  3ZXP A;  5ARF A;  5ABG A;  4BX9 A;  4GYO A;  2CCQ A;  4LNB A;  2XQ8 A;  2DWZ A;  3FY4 A;  3BU8 A;  3FTZ A;  2X6I A;  1BR2 A;  1I94 T;  1LKX A;  4G2A A;  3ZCI A;  1RW2 A;  4WNE A;  1M62 A;  2M6B A;  5LJM A;  2FUL A;  3ZHE B;  1G73 A;  3FUI A;  2Y0B G;  4KMO A;  1TN8 A;  3QWV A;  3UUL A;  4EZL A;  2OV9 A;  3AEC A;  3CML A;  1UJJ A;  2J62 A;  3D9I A;  2I6H A;  3EIQ C;  4HQD A;  4JUY A;  3FZH B;  3AEA A;  1AJ3 A;  5CA1 E;  2IOL A;  3T8M A;  2EIK E;  4OVV A;  2WXJ A;  5L3B B;  3LG7 A;  4P0B A;  4CCA A;  2XZT G;  4IST A;  2QYW A;  3TWR A;  2KM4 A;  3UUM A;  2CHO A;  5DQW A;  4JXT A;  3CLJ A;  3N9P A;  5EYL A;  1W09 A;  2WQ7 A;  4BES A;  4E7S A;  5LP6 E;  2Y8D A;  5M4Y A;  2W2U A;  3CV0 A;  3D9N A;  1ZBP A;  1INZ A;  4BEP A;  1NWM X;  2ZM8 A;  4AIS A;  2ION A;  3C50 A;  4DUY T;  2EHO A;  2BVL A;  3U9W A;  3KSQ A;  4MBG A;  3ZYQ A;  3QKY A;  1QNF A;  4TV3 A;  2WSS V;  3ZKJ A;  4WBO A;  4RLY A;  1E2A A;  5LBQ B;  2ES0 A;  3PJA J;  2VVS A;  5BT1 A;  4MBQ A;  4L5G A;  4ILG A;  4F8H A;  2Q7F A;  1S70 B;  1D9S A;  1UN8 A;  2FI7 A;  3GMI A;  5ITZ F;  5AQU B;  3DEP A;  4EQF A;  4BY6 A;  1GQE A;  4AM9 A;  1FMV A;  2IQC A;  3ZST A;  3AVR A;  1FJG T;  3DST A;  3PE3 A;  2W67 A;  4C90 A;  3KIN B;  4JI8 T;  3LY9 A;  5KXJ A;  3UTK A;  3OXL A;  1FCH A;  3E30 A;  4EZH A;  2FBN A;  2QRX A;  2NC9 A;  1W0A A;  4DV6 T;  3FTV A;  2YQ8 A;  3NZU A;  4PJM A;  3HXB A;  1OED A;  3L16 A;  3PVL A;  3B13 A;  2AE9 A;  5L4H A;  4GPK A;  2UUC T;  4J8E A;  4YVO A;  4AQF C;  4DO0 A;  1J1J A;  3O1H A;  1HXI A;  3DEO A;  3DRA A;  1WM5 A;  4BSZ B;  1N32 T;  4P0A A;  1T8B A;  2JPF A;  4COF A;  1E8Z A;  3APD A;  3F2E A;  1YW0 A;  1N11 A;  2KC7 A;  3I3N A;  2CXF A;  5BW8 C;  4TNV A;  1ELW A;  2OCC E;  4GKK T;  4HFE A;  3A7M A;  2LSK A;  4LFB T;  2DNX A;  1N4Q A;  3RIB A;  3AEG A;  2EQX A;  4ATZ D;  1KZO A;  1WY6 A;  4NRH B;  5FQ8 A;  1SUM B;  4F7A A;  3UT4 A;  1WCR A;  2DCF A;  1UG3 A;  3EHM A;  1WR6 A;  5HEJ A;  1N54 A;  2BG9 A;  1LTX A;  2I9C A;  4LFC T;  3ZHE A;  4J8D A;  1P5Q A;  1YXR A;  2OND A;  4CXX A;  2RKK A;  4QH1 A;  4PJL A;  3FBL A;  5HEO A;  5FP3 A;  4KVO A;  3LJ3 A;  2WMN A;  2XQ4 A;  4PK4 A;  3AXJ A;  1IQR A;  2EIM E;  3PZD A;  1YQ4 A;  3LK2 B;  2X3M A;  4G8L A;  3RJV A;  2HO1 A;  2M67 A;  4UIG A;  4L9P A;  3MCX A;  4Z90 A;  4DV0 T;  3GA8 A;  4XI9 A;  4M1P A;  5G05 C;  3VU7 H;  1QYM A;  4HRN A;  5LNK A;  2VJ8 A;  3AE8 A;  4CDM A;  2P9N G;  3PDY A;  4GMR A;  3PRZ A;  3D9K A;  4J8F A;  4DX1 A;  4LF5 T;  4X1Y E;  2CMR A;  1N94 A;  2QYU A;  4EBA A;  3UIP C;  1PAQ A;  3IA3 A;  5IWA T;  4YND A;  1D8E A;  3KEA A;  1WR0 A;  4F1P A;  5LX8 A;  5FQ4 A;  2HPJ A;  4G11 A;  5ABH A;  3PUX F;  5A7D B;  2WXN A;  1YMP A;  3SFY A;  3SY2 A;  3N9N A;  4DR6 T;  3MKQ B;  3L08 A;  3RRU A;  2CRB A;  2XY8 B;  2XQ5 A;  3FUN A;  1U2V G;  3QNU A;  3ULE G;  5F5W A;  3M3Z B;  5AQG B;  5LHH B;  5KJL A;  4OFZ A;  1L5J A;  3Q4A B;  4DX7 D;  4Y6C A;  3UQ3 A;  4P09 A;  3CR3 A;  4W9R A;  4AV7 A;  1N33 T;  4YHJ A;  5LG3 A;  1Z8U A;  5IUX A;  5D66 A;  4B6X A;  4F3V A;  3H3M A;  4AXP A;  2V6Y B;  3RIU C;  2X6K A;  5FXV A;  3FU0 A;  2AJA A;  4FA6 A;  2H3R A;  3PNT B;  4L0R A;  3CEQ A;  3RHW A;  4ZI2 D;  1HNZ T;  4HOQ A;  3O4Z A;  2PL2 A;  3KBT A;  3G2U A;  2YDS A;  4DR3 T;  4B8A A;  4N2Q A;  4L7T A;  3MV3 B;  4PNI A;  2WM9 A;  2MOW A;  3CVV A;  4LF6 T;  4MFR A;  2LJL A;  5AQB A;  2JQQ A;  1DVP A;  2E2E A;  3CST A;  3B7S A;  5KJM A;  2KWI B;  2GRL A;  3B57 A;  2R2L A;  5AQV B;  3S4U A;  4U0U A;  1HO8 A;  2V5F A;  4ABN A;  2ZMA A;  5FY1 A;  2ZU6 B;  3GN5 B;  4U8V D;  5KNH D;  4JI3 T;  4ZS2 A;  3G2V A;  3VLF A;  4U72 A;  2OVB A;  4JC8 A;  4MHC A;  3K3N A;  4GYY A;  3ML9 A;  3LSV A;  5TAO A;  1CUN A;  3FXD B;  4AQF A;  3P1U A;  4GTM A;  3UU5 A;  2GRQ B;  1E7P A;  4EB6 E;  2LRK A;  4JI7 T;  5DQV A;  2XTL A;  4WZX A;  4GZD A;  3SWH A;  3V31 A;  3AED A;  4FJZ A;  2X9Y A;  1IJ5 A;  5BXU A;  3DJB A;  2MYO A;  5CGM A;  4IE4 A;  5BNW A;  3EHQ A;  1EZ3 A;  1HZ4 A;  4UVB B;  3RRN B;  3WXX A;  1HS7 A;  4A1G A;  2OLT A;  1OWO A;  5FT9 A;  4AP2 A;  4X1K E;  3RF1 A;  5AQH B;  3MGB A;  1HCI A;  3PUV F;  2J49 A;  4A5X A;  1VDY A;  3EUH A;  5ENR D;  1AP7 A;  4UQZ A;  4OVU A;  2BKK B;  3JAE A;  5AQR B;  5EX0 A;  2VQ2 A;  3AAE B;  3JQ0 A;  1N34 T;  2GRP B;  3EJN A;  3ZN1 B;  4XZ4 A;  3ABV A;  1V9D A;  4TRQ A;  3TWT A;  3GZ2 A;  4JEU B;  2R5S A;  1XNR T;  4ANV A;  1HF8 A;  3KEZ A;  3T8O A;  3Q78 A;  2VSY A;  4B0Z A;  1V54 E;  3FU6 A;  2KND A;  3S7B A;  1U4Q A;  1AWC B;  2Q9Q B;  4DVD A;  2VKD A;  2YEV C;  3ANW B;  3DSU A;  5JDH A;  2WXM A;  2LNI A;  3FHE A;  3S7D A;  4TZ4 C;  3I0O A;  2Z6E A;  3HR0 A;  4ZS3 A;  4LRZ A;  4OYS A;  5CER B;  3PUY F;  4HFB A;  4NUR A;  2C2L A;  2V7K A;  4ZXL A;  1Z3X A;  3Q5X A;  2UXC T;  3FUJ A;  4OYJ A;  5FL0 A;  3ZMS B;  4ZEY A;  2JQH A;  3VHL A;  2NXP A;  3G2T A;  4HFH A;  3OKQ A;  2V6Y A;  3Q47 B;  5JHA A;  4AI6 A;  1WRD A;  4IUL A;  2V7J A;  2QYJ A;  1QSD A;  5M72 A;  2N1G A;  3VKG A;  2X68 A;  1JWF A;  4ACL A;  4QXC B;  3LBX A;  5CEA A;  5EK2 A;  1RZ4 A;  3CK9 A;  5FNV E;  2MHK A;  4OK0 A;  4I1O B;  3N9M A;  4E7Z A;  1OWP A;  3UI2 A;  4X8Q A;  4IE5 A;  3WG7 E;  4EOZ B;  4HOT A;  4J0U A;  3RI5 A;  1IBK T;  3ONK A;  2YKS A;  4TX5 A;  3UU3 A;  3JYS A;  2VSX E;  5JVD E;  1K1A A;  3Q5D A;  2JQK A;  3AG2 E;  1NI1 A;  2VGE A;  5CCL A;  3JAF A;  1TEZ A;  1IYG A;  2IU1 A;  4Y6W A;  2VWA A;  4Q96 A;  3Q15 A;  4ZHB A;  1ZB1 A;  4H7X A;  3UUX B;  1KK7 A;  4EXT A;  1IJ6 A;  4X65 T;  3UUN A;  1TJF A;  4KX6 A;  3KV9 A;  3Q49 B;  5G05 J;  2XEV A;  3MKD A;  4H9S E;  4IDQ A;  3T9K A;  2J9Q A;  4O8S A;  3R7Q A;  1FVH A;  2IAK A;  1SA0 E;  3RRW A;  5FXX A;  1TYQ G;  3AG3 E;  3SFZ A;  4BT8 A;  4A63 B;  2MAW A;  3L8R A;  4CN6 A;  3B7U X;  4H9O C;  2XHE B;  4EAH A;  3FU3 A;  3C5R A;  4EZK A;  2CLY C;  3JXI A;  1MYO A;  1SVX A;  3CX7 B;  4KZC A;  5LCW C;  5CCM A;  3ZJ2 A;  5L3G B;  3V30 A;  5ENP D;  3AS4 A;  2ZM0 A;  2VQE T;  4WW0 A;  1MIV A;  2VSN A;  3AA7 B;  4GAA A;  4URK A;  5E75 A;  3UUB A;  4V3I A;  2E9X B;  2ZLY A;  5BV0 A;  4GTP A;  4DR5 T;  4MS6 A;  4WWN A;  4K0U A;  1N0Q A;  2X6J A;  3W15 B;  3QC9 A;  2CBJ A;  1H0A A;  2VTB A;  2LOP A;  4A55 A;  5ENN A;  5ETW A;  4AXH A;  2R03 A;  4AVX A;  2WXI A;  2WWV A;  1N0R A;  1ZV4 X;  2DCP A;  3ONJ A;  5B3S E;  2CXL A;  2JQ9 A;  4U96 D;  4JYA T;  5KJN A;  4O2A E;  3DTO A;  3QB2 A;  3EHZ A;  2PM6 A;  4HRL A;  4V1A v;  4N78 D;  3W9G A;  4FUL A;  4ZOL E;  3LVR E;  4O4H E;  1S63 A;  4RG9 A;  3FH5 A;  3HXC A;  2VKJ A;  1CHU A;  1G8X A;  5AN8 A;  4GKJ T;  2CPT A;  3N2G E;  4ILI A;  4ATG A;  4WBN E;  3ZT7 A;  2KIN B;  2ETC A;  2LRL A;  2NW9 A;  4GZC A;  3KDS E;  5LA6 E;  2FJD A;  5HXR A;  4ZZB A;  2OA5 A;  4YT0 A;  3C3R A;  3ONL C;  3PUA A;  2WDV A;  4TUU A;  3JXJ A;  3FHN A;  1N36 T;  2IDO B;  4F6R D;  3UXG A;  3EIJ A;  2X67 A;  3Q73 A;  4JD2 G;  4G2V A;  4L23 A;  2CG2 A;  3NWI A;  3BQI A;  3DP7 A;  3NOC D;  1MMD A;  4XBF B;  3HYM B;  3C72 A;  1SQM A;  4AY6 A;  4L2Y A;  5JA4 D;  4HOS A;  4O6F A;  1UX5 A;  3HA4 A;  2J08 A;  3D9J A;  3D9O A;  4YTN A;  4DUZ T;  5AQ9 A;  1U5P A;  2CBI A;  1JCS A;  3E4B A;  4PS8 A;  4GTV A;  4AJW A;  4EED A;  3F31 A;  2XCC A;  3L39 A;  4KVM A;  5A23 A;  2HR2 A;  1J5E T;  3TWQ A;  2WXR A;  4GIW A;  4UI9 C;  2YN6 A;  2LE8 A;  5HQ8 A;  1IXV A;  4TUM A;  4IDZ A;  3CQC B;  2ACZ A;  3ZRH A;  2DZO A;  4UVA B;  1Y6I A;  1Z6T A;  2B0O E;  3CHO A;  3AAA C;  1HG2 A;  5KMG P;  4JV5 T;  3LEW A;  4JHR A;  2XRZ A;  2XUE A;  4NQ0 A;  2WMO A;  5J2T E;  2RD0 A;  4AY5 A;  4IRE A;  2I59 A;  1E96 B;  1XDO A;  2Y4U A;  4LNU D;  1DU2 A;  2J09 A;  3OXG A;  5JDG A;  3ABM E;  3J5P A;  3HRA A;  4XIF A;  2XQ6 A;  2KT9 A;  5AQS B;  2KZ7 B;  3N71 A;  3J9X 1;  4HOR A;  3UT5 E;  1TNY A;  4WWO A;  3NAW A;  3TKL B;  1OWM A;  2CE7 A;  2XAS B;  2LAI A;  2BS3 A;  4IE0 A;  1H19 A;  5LCY A;  4HWI B;  1H7C A;  4TUY E;  4OAV B;  1OED B;  4FLH A;  4HFI A;  4GPM A;  4DK5 A;  4IGU A;  3QAQ A;  5LG4 A;  3AS5 A;  4AOF A;  1KFY A;  2YDR A;  3L17 A;  2WQY A;  2X0L B;  2H6H A;  2CXD A;  4UWK A;  3P4S A;  3NVO A;  2E0I A;  1E7V A;  4I6G A;  4O4J E;  3MA5 A;  1HE8 A;  4EEC A;  4KI0 F;  4UQY A;  2BVM A;  4UWF A;  3IBP A;  2EIJ E;  3PJA A;  2J07 A;  3E37 A;  4YY3 T;  3SHF A;  3QWW A;  4DLQ A;  5AQM B;  4GCO A;  3IF8 B;  3UKR G;  2C0M A;  2CG3 A;  1YYH A;  4HE8 A;  5L2L A;  1HFA A;  1XMQ T;  4IN3 B;  3C4Z A;  1IHG A;  4PK6 A;  1N9A A;  3PUR A;  2BG9 B;  2F0Y A;  4HTE A;  4JVS A;  3C3Q A;  1DC2 A;  2Q9Q D;  2ILR A;  3QK6 A;  2ZM6 T;  2BS2 A;  1DCE A;  2XAH B;  1MMG A;  3JC6 D;  4AIF A;  4TWH A;  4ZI3 C;  3UFE A;  3AXJ B;  2OVF A;  2KCV A;  5AJD A;  5A1L A;  2IF4 A;  3C4W A;  3R6N A;  1H2U A;  4CT0 A;  5ENO D;  2D0U A;  5ENQ D;  4DLO A;  4FAD A;  3Q5E A;  1KT1 A;  4UV8 B;  3GYZ A;  2WWU A;  4A3T A;  5F8P A;  3ASG A;  2QGS A;  3MJW A;  4UWG A;  2L3L A;  5AYW D;  4I2W A;  4O1P A;  3D0T A;  4QXB B;  3FBZ A;  3O4X E;  2QFC A;  3UKU G;  3Q79 A;  4GA1 A;  4U95 D;  3LKU A;  3SD5 A;  2CM0 A;  2DLR A;  3ONL A;  3IXE A;  5LCW J;  1LRZ A;  2Y48 B;  4DX5 D;  3KS2 A;  2IW5 B;  4DRX E;  3MZL B;  3B7T A;  3TLU A;  3VTY A;  2E5V A;  2LT3 A;  1W0B A;  3LJN A;  2PZI A;  4IE6 A;  3HXD A;  4RQI A;  4XX5 A;  3L13 A;  3CVR A;  3J7Y q;  3LS8 A;  4QXH B;  5J08 A;  3PE0 A;  2YU1 A;  3I1A A;  4U3C A;  1Y01 A;  3AE3 A;  4HGA A;  2LM2 A;  2WXH A;  2OEV A;  2AXV A;  2IC9 A;  3CHP A;  3MXZ A;  3PUG A;  4IDP A;  4MAL A;  1JPL A;  1OCC E;  4O1O A;  5H7P A;  3ZIM A;  5JDM A;  1FEW A;  4X62 T;  1QBQ A;  2JMH A;  2DWG A;  4DR4 T;  5C2Y A;  3ZJ1 A;  2VL0 A;  2P2C P;  2VGX A;  2XEN A;  1TNU A;  3TWW A;  2C0L A;  2IOS A;  3KVB A;  1UN9 A;  4J7W A;  2X9W A;  3FTU A;  2BBJ A;  5AQP B;  1EDU A;  4I43 A;  3SQV A;  2XZD G;  3K9I A;  5FZS A;  3SS1 A;  4JI4 T;  3DSS A;  2CWO A;  1VCT A;  4PS7 A;  5ABF A;  4A97 A;  2J1D G;  4CN1 A;  2ZM2 A;  4IDN A;  3FP3 A;  1IAP A;  4B93 B;  1HX8 A;  4EYY R;  5LXT E;  3TLW A;  4K5B A;  4UUC A;  3AA6 B;  5A6C A;  4Q25 A;  2W0G A;  1D0X A;  3EVY A;  1XNQ T;  2E9X D;  2YU2 A;  1O1T A;  3VLE A;  3UM2 A;  5CED B;  5HEG A;  5EZY E;  4YSY A;  1TN6 A;  3QB5 K;  4JHK A;  1BD8 A;  5FWQ A;  3MV2 B;  2V7M A;  3B7R L;  1X9B A;  4DI3 A;  4ERR A;  1T7S A;  1TNZ A;  2IY0 C;  4G63 A;  1UW4 B;  2BKG A;  3AB3 B;  2LEH A;  3EU5 A;  3FTX A;  3RIF A;  2DZN A;  4UI9 J;  3QC1 A;  3AE5 A;  3HVE A;  3ML8 A;  2FUP A;  4TN7 B;  2KZT A;  4KYO B;  3CGH A;  2XAF B;  3NRY A;  3TG5 A;  2DI4 A;  2KWH A;  3E22 E;  2K48 A;  3OAW A;  2QC9 A;  3L09 A;  2A5U A;  1B89 A;  2WXO A;  1JUQ A;  4DPR A;  5HCM A;  5HXE A;  1XNF A;  2XPI A;  1MJ0 A;  3IHR A;  4CYM D;  5JRC A;  1MZC A;  4U74 A;  3EAM A;  2V26 A;  4CGW A;  3Q7A A;  3RSE G;  3RC8 A;  5E76 A;  3UIO C;  4CRW A;  3GW4 A;  3N9O A;  4B8C B;  4KBQ A;  3RO2 A;  3GWH A;  3EAB A;  1US7 B;  2ZXW E;  3CIA A;  4X1I E;  2BDE A;  5JDF A;  3VTX A;  3FUM A;  3NZQ A;  4PW8 A;  2G0U A;  2XSB A;  5JRE A;  2YHC A;  3I9Y A;  5EX3 A;  5C8Y E;  3FUE A;  4Z91 A;  3ZYK A;  1D1B A;  1MX2 A;  5G04 C;  4DX6 D;  2EHO D;  2XQ3 A;  4DR1 T;  2PQN A;  5AJL A;  3TL5 A;  3AEF A;  2HE0 A;  4YDY A;  4BA9 A;  3EDV A;  3PRE A;  1JNR A;  3KV6 A;  3ZSS A;  3R84 B;  4I0U A;  3QNK A;  4KBM B;  5BMV E;  3JCK C;  3U4T A;  4YFS A;  3L6A A;  3BG1 B;  4XE0 A;  1OCO E;  3MYV A;  2CHN A;  4GU5 A;  2CHW A;  3CK7 A;  2H7V C;  5G2N A;  2LXM A;  1X81 A;  2L9B A;  5HXH A;  3V5S A;  4DID B;  2NTY A;  3F6Q A;  4LFA T;  2PNN A;  3ETV A;  4P29 A;  3LBX B;  1S64 A;  5HXC A;  1WYB A;  3UM0 A;  2BKO A;  1IZN B;  2GRN B;  2VYI A;  3BQO A;  1VCS A;  1TJC A;  2KSR A;  1OCZ E;  1D0Y A;  3DBS A;  3V79 K;  3D9P A;  4U7I A;  4C91 A;  2YDQ A;  2R6G F;  4X66 T;  4EPZ A;  4LF7 T;  1H6P A;  3RQU A;  2BZB A;  2XQA A;  4GYS A;  5LOZ A;  2YOE A;  5HXS A;  2F4V T;  2XRY A;  4GK5 E;  2FJA A;  4UV9 B;  2BTD A;  2BKP A;  2R05 A;  4XZC A;  5FXZ A;  1W3B A;  2W62 A;  2DYS E;  3CK6 A;  1HR0 T;  2XEE A;  3N2K E;  1LD8 A;  2J4D A;  3AU4 A;  3HXE A;  4U33 A;  1QQE A;  2XSA A;  4HS2 A;  4ILA A;  3ZN0 B;  2BKN A;  2WDR A;  4HWH A;  5HCJ A;  3RGL A;  3S7F A;  4B3S T;  4RSY A;  5JR9 C;  1H6O A;  2XGS A;  4I55 E;  1HG5 A;  4O2B E;  4G23 A;  1XDP A;  1E8X A;  5ANL A;  5FL1 A;  1MX6 A;  2VL8 A;  3O1J A;  2WPV A;  3QDN A;  4APF A;  2OV8 A;  2P9I G;  4CDN A;  1YD8 G;  3BK9 A;  3HXF A;  3FDH A;  4O4L E;  4PFO A;  5LJN A;  3E34 A;  1E8Y A;  2NOX A;  2A3D A;  3T1Y T;  4JI6 T;  1UUS A;  3VRA A;  4N5C A;  3LK3 B;  5CMW A;  3HKC E;  1D1C A;  5AQT B;  2MBG A;  4CI3 B;  4XI0 A;  1U3D A;  3RKG A;  3NKZ A;  5EID A;  4YDE A;  3HG0 D;  3KAE A;  2ETB A;  4CDR A;  2DWK A;  4UXN B;  3APF A;  3ULY A;  5AQQ B;  1NA3 A;  4AEZ C;  5CFB A;  3MJX A;  3CHM A;  2D2S A;  3NRX A;  2VTB B;  3L3P A;  3A5X A;  3MEK A;  4U2Z A;  1MNE A;  1DCQ A;  2VB6 A;  5C1D A;  4KMC A;  5L47 A;  3TAX A;  5FYM A;  2LSJ A;  4JBW F;  1E8W A;  5CJ5 A;  2LSI A;  2MOZ A;  4OAU C;  2WXK A;  2N9D A;  3ZFW A;  1MIW A;  1N4P A;  2XGM A;  3SNX A;  1FT1 A;  3PU8 A;  2KAT A;  3P4P A;  4XKB A;  3I9W A;  1JWG A;  2J47 A;  1SW6 A;  3RRC A;  3NOG D;  3ZYL A;  4ILU A;  2K3W A;  4HVB A;  4FC8 A;  3WI3 A;  2AXD S;  2H7O A;  5L3F B;  3W9F A;  3JUI A;  4L1B A;  4HOU A;  5AAR A;  1OXZ A;  5LGU B;  3UQ7 A;  3PNL B;  3UT8 A;  3GZ1 A;  3PUW F;  4C0M A;  4H63 V;  5LHI B;  1GW6 A;  2VSO E;  3ASD A;  3FUF A;  1YA0 A;  4KXK B;  5AIJ A;  2V4H C;  3PU3 A;  4ASK A;  2WU5 A;  1H2T C;  2OOE A;  4I1A A;  4I6J A;  3CVX A;  2WBL A;  4I2Z A;  1PC2 A;  5E0O A;  3SI5 A;  3SFE A;  1N4S A;  2WXF A;  3CK8 A;  4HI9 A;  4G24 A;  1T72 A;  2L0I A;  3ETU A;  4R7L A;  3OTO T;  5FIN A;  3ZPJ A;  3CX6 B;  5ABE A;  2UY1 A;  4NXM T;  4CT4 A;  3RIU A;  4YDW A;  4M3O A;  5B1B E;  2NWB A;  2CEA A;  5T4Y A;  3CIR A;  3IBE A;  1YKE B;  1H6K A;  2ZGG A;  2E8I A;  4IL4 A;  3ASH A;  4JA9 A;  3BQK A;  2R17 C;  1IBL T;  4C0E A;  4ANW A;  5EKQ D;  3EU9 A;  3ZMT B;  2K9A A;  4YSZ A;  2XPY A;  4GZ6 A;  5BR8 T;  3QUJ A;  2ETA A;  2P9P G;  5D0Q D;  4JI0 T;  4CQI A;  5G55 A;  3U3I A;  2BUG A;  4BER A;  3DXM G;  3ZVV A;  2UWJ G;  3LK4 2;  3ZGQ A;  2CFZ A;  1WLX A;  2R02 A;  3PEU B;  2L6B A;  1LD7 A;  4WNF A;  5JJ6 A;  2JMK A;  3HDX A;  3V2O A;  3Q9D A;  4EEB A;  3HKB E;  2M63 A;  5JR9 A;  2A4Z A;  5LYJ E;  2V4L A;  3C51 A;  3G2S A;  1KNR A;  2LOS A;  4NIQ A;  5G04 J;  3N9Q A;  4BET A;  3RQW A;  4ANJ A;  5CMY A;  4UVC B;  2AVP A;  3AA1 B;  1UOH A;  1BI7 B;  4HFC A;  3ASO E;  4U07 A;  1Z0P A;  2WB5 A;  3ABL E;  5C2T A;  4K5C A;  2CLY B;  5JJT A;  4ME2 A;  4K0R A;  1HS6 A;  3PH0 C;  4NIK A;  3KSL A;  2FF4 A;  4PFP A;  3Q9U C;  5LFA A;  4HRM B;  1UX4 A;  3NB2 A;  4GTO A;  3FEX A;  3NBX X;  2ZIS A;  4YDO A;  2CA5 A;  1FPP A;  3SO8 A;  4PK5 A;  3RRM B;  4F53 A;  5HWX A;  2VKO A;  3ZC1 A;  4E6H A;  1BR4 A;  2XJ7 A;  1UJK A;  1MQS A;  3O48 A;  4GYW A;  4HFD A;  1OWN A;  2RFM A;  3FH8 A;  2X51 A;  4BX8 A;  3FTW A;  2DHR A;  4RVB A;  3G2W A;  4KT6 B;  2WY2 A;  3AE7 A;  3QOF A;  4F1S A;  1G3N B;  5JQG E;  3CWZ B;  4FU3 A;  2JIW A;  3QJZ A;  1H2V C;  1EF1 C;  1WDY A;  4ZFH A;  3BG0 B;  4DBQ A;  2V5C A;  3MK7 C;  2AXZ A;  3ENE A;  3OYX A;  3I5P A;  3UQ4 A;  1MX4 A;  5AQ7 A;  1NP7 A;  3RYI E;  3FUL A;  1OT8 A;  2UXD T;  3TLV A;  2IO3 C;  4U8H A;  4YSX A;  2MPK A;  3R9A B;  2X9H A;  5CB4 E;  2C5J A;  1BR0 A;  2EHO C;  4UEL A;  4MKT A;  3AA0 B;  5LMU T;  5LGT B;  2JEK A;  2LXL A;  3KFW X;  3OBV E;  4B94 A;  1D0Z A;  2SPC A;  3HKD E;  4RG6 A;  2RP4 A;  3AE1 A;  1WYC A;  1FT2 A;  3FTY A;  3V5U A;  4B3R T;  1BU9 A;  2KXP C;  1LF8 A;  2JAB A;  3C64 A;  4GTQ A;  3FEY A;  4CN4 A;  4LML A;  2DYR E;  4J8S A;  1XZY A;  2BS4 A;  3U64 A;  4LEU A;  4UR9 A;  4K5A B;  3DWL G;  4P1N A;  4ZI2 C;  3P8C D;  2WQ6 A;  1MHQ A;  2V8S E;  5D2M C;  1T98 A;  2WU2 A;  5JDQ A;  1UK5 A;  3DSX A;  3MAC A;  1I6Z A;  4U31 A;  2P58 C;  4TWD A;  5FTP A;  3FZM B;  4GZ3 A;  1KNZ A;  5AEN A;  4ACK A;  3O9X A;  3UPV A;  2A9U A;  1FIO A;  4J8Y A;  1XWM A;  5JH7 E;  1K1B A;  5EIB E;  3B5M A;  3RK6 A;  2IIU A;  3FUD A;  3I4R B;  3CHQ A;  2J8S D;  1U3C A;  4DJA A;  2PFV A;  1V55 E;  2XEH A;  3K3O A;  5AQJ B;  5HEH A;  3HHM A;  1OCR E;  3NZS A;  2V7L A;  1BLX B;  2NW7 A;  5AQN B;  5FVK A;  3H3A A;  2I1K A;  3CHS A;  4NUU A;  3VKH A;  2E5L T;  4DX2 A;  2DIW A;  2XQ9 A;  2H89 A;  4HFG A;  1YKH B;  3AAA B;  4H7Y A;  4LUN U;  2VGX B;  2KCL A;  2VK9 A;  3T8K A;  4IHJ E;  5AQL B;  3DSW A;  4I43 B;  3CVW A;  2EIN E;  2C5I T;  4U7Y A;  3HKE E;  5ABF B;  4JEH B;  3E33 A;  1YCS B;  5JHB A;  1LVK A;  3TGO A;  3AEB A;  3MA9 A;  4EYU A;  5HI7 A;  3LY7 A;  4EV6 A;  4ZHQ E;  4X20 E;  4WND A;  4HLL A;  2E2A A;  4Z68 A;  1Z3Y A;  2WXQ A;  4X64 T;  1M7K A;  2A72 A;  1NEN A;  3B7B A;  3ZXS A;  2BF0 X;  2DVW A;  1S94 A;  1HNW T;  4LER A;  3HL6 A;  4JHJ A;  2IFU A;  5ENS D;  2Y4T A;  1Z5S C;  2KMF A;  4LF4 T;  2LSG A;  3LFM A;  5CRU A;  2ZIR A;  4HBD A;  4A3V A;  3N5L A;  5IYZ E;  5FXW A;  5KBA A;  2H6I A;  4YHH T;  1HX1 B;  3DSV A;  5ARG A;  3ZKR A;  2FJB A;  3ZT6 A;  4U2Y A;  3HVE B;  4YJ3 E;  4AIU A;  3WAK A;  3SGH A;  4EGW A;  1BPO A;  4N3B A;  4ZI7 E;  4ILC A;  5B1A E;  2ODU A;  2KZT B;  2AXU A;  1VRB A;  4E85 A;  2WP9 A;  4QH4 A;  1IQU A;  4WNG A;  3N2O A;  4PS3 A;  5HYA A;  4JA7 A;  2D0T A;  3BQL A;  3CQX C;  3G06 A;  4JLE A;  5J2U E;  4FJY A;  4APO A;  4EZ4 A;  3RX6 A;  3O1I A;  3JUE A;  4CI2 B;  5HEU A;  2V1D B;  1L0V A;  4LG6 A;  2X66 A;  3A8Y C;  5JRC B;  4JW1 A;  4PJJ A;  5CA0 E;  2H88 A;  3RYC E;  4ISS A;  5D0O D;  5KWD A;  1HNX T;  3IHY A;  3KBU A;  3PTR B;  2IML A;  4JL0 A;  1D1A A;  2X0H A;  5J90 A;  4QKN A;  5HKP A;  5DBK A;  3UM1 A;  3KV4 A;  1DNP A;  2P9L G;  3C98 A;  2QVA A;  2D5U A;  2B6C A;  2HM8 A;  4DI4 A;  5BV1 A;  3SFD A;  1J5W A;  3CKC A;  4HNA D;  4UF0 B;  2RFA A;  4TXP A;  4WYV A;  4UEM A;  4CI1 B;  3UMV A;  3CQG B;  3UFG A;  2X38 A;  2YIN A;  5FZR A;  4IRU A;  4Q94 A;  2XS1 A;  4PH4 B;  3SBT B;  4JI2 T;  4OHF A;  2XPK A;  3Q5M A;  2LSU A;  1R8I A;  4GOU A;  4H9R C;  3LCA A;  3LDZ A;  4IT4 A;  5AQF B;  2QZA A;  2WZH A;  3CSF A;  3OJA A;  2NYJ A;  3M65 A;  5JTG A;  4NUV A;  3FH7 A;  3SFX A;  3IV0 A;  3CKD A;  3OVU A;  3IHV A;  4G26 A;  1MIY A;  3CHR A;  3K8P C;  3ZT5 A;  3TWX A;  5KJK A;  2A2F X;  3ABK E;  1OWA A;  4ANU A;  2KLQ A;  3ZMU B;  4DV2 T;  3ASN E;  3J5Q B;  2VKH A;  5FMN A;  1D8D A;  4JEH A;  4BTA A;  2LLY A;  5JDL A;  3CPZ A;  4H9N C;  2LSV A;  3PZ2 A;  5ENT D;  5JJ7 A;  3ISM C;  1KZP A;  5CRV A;  2FEZ A;  4FI5 A;  3PS6 A;  3P4W A;  4HI8 A;  3UX4 A;  4CEM A;  5FKY A;  2I0M A;  5FQ6 A;  2MYS A;  4KUM B;  2J4B A;  3S7J A;  4HN9 A;  2PQR A;  4DR2 T;  4B3T T;  5KX5 E;  2XCB A;  4IL9 A;  3SZ7 A;  4TNW A;  2Y1L E;  4WWP A;  5AQI B;  5J1G A;  4BJM A;  5CEC B;  5H6R B;  4HXI A;  4ANX A;  4HLE A;  2WXG A;  2EIL E;  3AE9 A;  4LCT A;  2NTX A;  2IJG X;  4GZ5 A;  4I17 A;  2UXX B;  2CHZ A;  4AKL A;  2UU9 T;  1SHZ C;  1ZU2 A;  3I4G A;  3RYH E;  2W61 A;  4XAX B;  3ZNG A;  3FFL A;  2X9X A;  2WXL A;  4DMW A;  5L3C B;  1MND A;  1K3Z D;  3P7I A;  1E1H B;  2AW6 A;  2AWI A;  5EK4 A;  2WB2 A;  3VRB A;  3EDU A;  4TV8 E;  1NL4 A;  4GTT A;  4BWR A;  3PV0 F;  4FP7 A;  2QY7 A;  1UUR A;  2HPL A;  3Q75 A;  4WUY A;  2LHR A;  3WAJ A;  2XM1 A;  1N4R A;  2OEW A;  3VR8 A;  2XQ0 A;  5HRY A;  5LBM A;  4GK0 E;  4IE7 A;  3ESL A;  3K3Q C;  1WFD A;  2GK9 A;  1ZHC A;  2ODV A;  2LKG A;  1KNP A;  3ZEF B;  3UT7 A;  1EPU A;  2YHE A;  2XAQ B;  3CX8 B;  2JJ9 A;  3JCF A;  3AVS A;  4F6R C;  4NXN T;  5AQK B;  2GGF A;  4GMJ A;  5T8I A;  3KV5 A;  1EYH A;  3ZC0 A;  4JPS A;  3CVQ A;  4M7C A;  2GRR B;  4UF0 A; 
#chains in the Genus database with same CATH homology
 4GA2 A;  2PBI A;  4TV9 E;  4EBA G;  3GZS A;  5JDN A;  2L0T B;  4FHK A;  3U66 A;  3MZK B;  3CVU A;  1ZKE A;  2LO6 A;  3IEE A;  3D9M A;  1ELK A;  1N52 A;  1FVF A;  3BEE A;  3QAR A;  3PE4 A;  5L3E B;  4ADZ A;  5T3R A;  5HAX A;  3FUH A;  4BT9 A;  4MLP A;  3NF1 A;  3ULQ A;  5FY0 A;  1MMN A;  3ZCJ A;  2X6F A;  1KLX A;  2UY1 B;  4IIJ E;  3D9L A;  2K24 A;  2XAJ B;  4AKR B;  4GA0 A;  2YK0 A;  5LHG B;  4GML A;  3IEG A;  3SRZ A;  4QX7 B;  2V7I A;  4UI9 K;  1NAF A;  3ZYM A;  4UWH A;  2NW8 A;  4BTB A;  4PDX A;  3FB2 A;  4I9E A;  3OTN A;  4EIW A;  1OUV A;  3LXU X;  4WNK A;  1QUU A;  4C9B B;  4PJN A;  2I1J A;  4QWN B;  2LM9 A;  5LP0 A;  5LOV E;  2HH7 A;  3ZMV B;  5EK3 A;  3ZN3 A;  2QA7 A;  3ESK A;  5JR9 B;  1VOM A;  5KCM A;  4MRU A;  4L9I A;  4H63 H;  3AAI A;  2RG8 A;  3CVL A;  3RO3 A;  2LSY A;  3SF4 A;  2Q9Q C;  3I0Q A;  2CWY A;  3ZEF A;  3JC6 C;  1KT0 A;  1SZ9 A;  4WAF A;  1BR1 A;  3S2A A;  4I9C A;  2L8K A;  4HEA A;  3Q5W A;  1B7T A;  5LGN B;  4AQG A;  4KP3 C;  1LVF A;  3OXF A;  3APC A;  4ZI3 D;  1A17 A;  5HWY A;  2VGY A;  3MKQ A;  5GON E;  4I4T E;  2L9Q A;  3JQ1 A;  1HTJ F;  3F57 A;  3FWV A;  3HI2 A;  1E90 A;  4G1T A;  4GCN A;  5L3D B;  4L2L A;  3EHN A;  5KDM C;  3L54 A;  2XAG B;  1X5B A;  3EDT B;  4J2C A;  3IKO B;  3LPZ A;  4CXY A;  4OYK A;  1WAO 1;  2RA1 A;  2B1E A;  5AFU L;  1Y64 B;  2X6H A;  3DPD A;  1FMW A;  1NA0 A;  2MTQ A;  2GW1 A;  4NAC A;  4D10 C;  1NZN A;  5FZQ A;  3QK0 A;  4A1S A;  1X79 A;  5DAB A;  4QX8 B;  4BFR A;  3Q2M A;  2NSZ A;  3RYF E;  4K03 A;  4YJ2 E;  4Z8X A;  4JZY A;  2JRK A;  4I6E A;  4BAY B;  4H9P C;  3GN5 A;  4I1M A;  3TXN A;  3NQP A;  2HYZ A;  2XPZ A;  3ZW3 A;  4A56 A;  5BPP A;  5DIZ A;  3E08 A;  3QWP A;  3RKO A;  1OWL A;  2E9X C;  4FJO A;  4AKH A;  3TG4 A;  3R7R A;  4AKG A;  3LYA A;  3FXE B;  3AS8 A;  2PM7 A;  5H6Q B;  3PUQ A;  5CHE E;  2NP9 A;  2XGO A;  2Y6X A;  3H37 A;  5FJY A;  1QZ2 A;  2N2N A;  1SZA A;  4CXW A;  4IYP A;  4G25 A;  3D3M A;  4FHJ A;  2JLB A;  2IC6 A;  2XQY A;  4YLH A;  2V0P A;  5ANR A;  2C5K T;  2R59 A;  2LHN A;  1O3X A;  2VAS A;  4DMV A;  4Q69 A;  3PUK A;  3P2B A;  4JEU A;  3NZP A;  3KVA A;  3CKB A;  4N3A A;  3MKR A;  4FLB A;  4N2S A;  4HKA A;  3PUS A;  2Q9Q A;  3ANW A;  2W63 A;  5DJQ C;  2UXN B;  2WXP A;  4XKC A;  1XGW A;  4H9Q C;  4CZZ B;  2MRI A;  4KZ0 A;  2LAH A;  1ELR A;  5EDS A;  2FO7 A;  3QOU A;  3U3W A;  3LJC A;  2ACX A;  2L6J A;  5F3J A;  3LVQ E;  4BJN A;  2WVI A;  3ZLI A;  3U78 A;  3ZPO A;  4DBR A;  4N39 A;  2Y3A A;  4QHO A;  4U63 A;  4HFV A;  4PAG A;  3T5V A;  3LY8 A;  3TXM A;  1HU3 A;  1HH8 A;  1E7U A;  2PG8 A;  3RPU A;  3T5X A;  3PEV B;  3RU0 A;  4UQX A;  3C98 B;  2WQH A;  3CVY A;  4PUC A;  3N9L A;  2EHO B;  4O4I E;  5ADX L;  4J6I A;  4U0Z A;  4N3C A;  1ZEE A;  4MLK A;  4ILH B;  4BSX A;  3UUX A;  3FTS A;  3MX3 A;  2DBA A;  3SOL A;  5IHY A;  3ZMZ B;  3AU5 A;  3E0Z A;  2WAU A;  2KXP B;  3PUJ A;  1MMA A;  2W00 A;  2CFU A;  2C0S A;  3ONX A;  2K5B B;  1S35 A;  3RH3 A;  3FU5 A;  2XHE A;  3TJP A;  2PJQ A;  5FQ7 A;  4AKI A;  4DND A;  3RC3 A;  3VLD A;  1S0P A;  3KD7 A;  5FY7 A;  3RKV A;  4I50 E;  3CVP A;  4U04 A;  5BUZ A;  4UWL A;  2I2O A;  4CGV A;  2P9B A;  1UCU A;  2E9X A;  3SBS A;  2KCK A;  4EZJ A;  3HIZ A;  3ASF A;  4B89 A;  4U0S A;  2YNQ A;  4GB9 A;  4YVQ C;  3C4X A;  3URZ A;  3L22 A;  2CHX A;  4GYR A;  3FUK A;  1PY1 A;  4QFV A;  1Y8M A;  3OYZ A;  3CVN A;  2GRM A;  3PDN A;  5ARF A;  4BX9 A;  4GYO A;  2CCQ A;  3FY4 A;  3FTZ A;  2X6I A;  1BR2 A;  1LKX A;  4G2A A;  3ZCI A;  4WNE A;  5LJM A;  2FUL A;  3ZHE B;  1G73 A;  3FUI A;  4KMO A;  3QWV A;  3UUL A;  4EZL A;  3CML A;  1UJJ A;  3D9I A;  2I6H A;  3EIQ C;  4JUY A;  1AJ3 A;  5CA1 E;  2IOL A;  3T8M A;  4OVV A;  2WXJ A;  5L3B B;  3LG7 A;  4P0B A;  4CCA A;  4IST A;  2KM4 A;  3UUM A;  5DQW A;  4JXT A;  3CLJ A;  3N9P A;  2WQ7 A;  4E7S A;  5LP6 E;  2Y8D A;  5M4Y A;  3CV0 A;  3D9N A;  1ZBP A;  1INZ A;  1NWM X;  2ZM8 A;  2ION A;  3C50 A;  2EHO A;  2BVL A;  3U9W A;  3ZYQ A;  3QKY A;  1QNF A;  4TV3 A;  2WSS V;  4WBO A;  5LBQ B;  2ES0 A;  5BT1 A;  4MBQ A;  4L5G A;  4ILG A;  2Q7F A;  1UN8 A;  2FI7 A;  3GMI A;  4EQF A;  4BY6 A;  4AM9 A;  1FMV A;  2IQC A;  3AVR A;  3PE3 A;  4C90 A;  3KIN B;  3LY9 A;  3UTK A;  3OXL A;  1FCH A;  4EZH A;  2FBN A;  2NC9 A;  3FTV A;  2YQ8 A;  3NZU A;  4PJM A;  3L16 A;  3PVL A;  3B13 A;  4GPK A;  4J8E A;  4YVO A;  4AQF C;  4DO0 A;  3O1H A;  1HXI A;  1WM5 A;  4P0A A;  2JPF A;  1E8Z A;  3APD A;  3F2E A;  1YW0 A;  2KC7 A;  3I3N A;  2CXF A;  5BW8 C;  1ELW A;  2LSK A;  2DNX A;  3RIB A;  2EQX A;  1WY6 A;  4NRH B;  5FQ8 A;  4F7A A;  3UT4 A;  2DCF A;  1UG3 A;  3EHM A;  1WR6 A;  1N54 A;  2I9C A;  3ZHE A;  4J8D A;  1P5Q A;  2OND A;  4CXX A;  4PJL A;  3FBL A;  5FP3 A;  4KVO A;  3LJ3 A;  2WMN A;  4PK4 A;  1IQR A;  3PZD A;  3LK2 B;  2X3M A;  3RJV A;  2HO1 A;  2M67 A;  4UIG A;  3MCX A;  3GA8 A;  4XI9 A;  4M1P A;  5G05 C;  3VU7 H;  5LNK A;  2VJ8 A;  4CDM A;  3PDY A;  3PRZ A;  3D9K A;  4J8F A;  4X1Y E;  2CMR A;  4EBA A;  1PAQ A;  4YND A;  5LX8 A;  5FQ4 A;  2HPJ A;  4G11 A;  5A7D B;  2WXN A;  3N9N A;  3MKQ B;  3L08 A;  3RRU A;  3FUN A;  5LHH B;  5KJL A;  4OFZ A;  1L5J A;  3Q4A B;  4Y6C A;  3UQ3 A;  4P09 A;  3CR3 A;  4W9R A;  4AV7 A;  4YHJ A;  4B6X A;  4F3V A;  4AXP A;  2X6K A;  5FXV A;  3FU0 A;  4FA6 A;  2H3R A;  3PNT B;  4L0R A;  3CEQ A;  4ZI2 D;  4HOQ A;  3O4Z A;  2PL2 A;  3KBT A;  3G2U A;  4B8A A;  4N2Q A;  4L7T A;  3MV3 B;  4PNI A;  2WM9 A;  2MOW A;  3CVV A;  4MFR A;  2LJL A;  2JQQ A;  1DVP A;  2E2E A;  3CST A;  3B7S A;  5KJM A;  2KWI B;  2GRL A;  3B57 A;  3S4U A;  4ABN A;  4U0U A;  1HO8 A;  2V5F A;  2ZMA A;  5FY1 A;  2ZU6 B;  3GN5 B;  4ZS2 A;  3G2V A;  3VLF A;  4U72 A;  2OVB A;  4JC8 A;  4MHC A;  3K3N A;  4GYY A;  3ML9 A;  5TAO A;  1CUN A;  3FXD B;  4AQF A;  3P1U A;  4EB6 E;  5DQV A;  2XTL A;  4GZD A;  3SWH A;  4FJZ A;  2X9Y A;  1IJ5 A;  3DJB A;  4IE4 A;  5BNW A;  1EZ3 A;  1HZ4 A;  4UVB B;  3RRN B;  3WXX A;  1HS7 A;  4A1G A;  1OWO A;  5FT9 A;  4AP2 A;  4X1K E;  3MGB A;  1HCI A;  2J49 A;  1VDY A;  3EUH A;  4UQZ A;  4OVU A;  5EX0 A;  2VQ2 A;  3AAE B;  3JQ0 A;  4XZ4 A;  3EJN A;  3ZN1 B;  1V9D A;  4TRQ A;  3GZ2 A;  4JEU B;  2R5S A;  4ANV A;  1HF8 A;  3KEZ A;  3T8O A;  2VSY A;  4B0Z A;  3FU6 A;  2KND A;  3S7B A;  1U4Q A;  2Q9Q B;  4DVD A;  2VKD A;  2YEV C;  3ANW B;  5JDH A;  2WXM A;  2LNI A;  3FHE A;  3S7D A;  4TZ4 C;  3I0O A;  2Z6E A;  3HR0 A;  4ZS3 A;  4LRZ A;  4OYS A;  4NUR A;  2C2L A;  2V7K A;  1Z3X A;  3Q5X A;  3FUJ A;  4OYJ A;  3ZMS B;  3VHL A;  2NXP A;  3G2T A;  3OKQ A;  3Q47 B;  5JHA A;  4AI6 A;  1WRD A;  4IUL A;  2V7J A;  1QSD A;  5M72 A;  2N1G A;  3VKG A;  2X68 A;  1JWF A;  4ACL A;  4QXC B;  3LBX A;  5EK2 A;  3CK9 A;  5FNV E;  2MHK A;  4OK0 A;  4I1O B;  3N9M A;  4E7Z A;  1OWP A;  4IE5 A;  4EOZ B;  4HOT A;  4J0U A;  3ONK A;  4TX5 A;  3JYS A;  2VSX E;  5JVD E;  5CCL A;  1TEZ A;  1IYG A;  2IU1 A;  4Y6W A;  2VWA A;  4Q96 A;  3Q15 A;  4H7X A;  3UUX B;  1KK7 A;  4EXT A;  1IJ6 A;  3UUN A;  1TJF A;  5G05 J;  3KV9 A;  3Q49 B;  2XEV A;  3MKD A;  4H9S E;  2J9Q A;  4O8S A;  3R7Q A;  1FVH A;  2IAK A;  1SA0 E;  3RRW A;  5FXX A;  3SFZ A;  4BT8 A;  3B7U X;  4H9O C;  2XHE B;  4EAH A;  3FU3 A;  4EZK A;  2CLY C;  3CX7 B;  4KZC A;  5LCW C;  5CCM A;  3ZJ2 A;  5L3G B;  3AS4 A;  2ZM0 A;  4WW0 A;  1MIV A;  2VSN A;  3AA7 B;  4GAA A;  4URK A;  5E75 A;  4V3I A;  2E9X B;  2ZLY A;  5BV0 A;  4MS6 A;  4WWN A;  4K0U A;  2X6J A;  3W15 B;  3QC9 A;  1H0A A;  2VTB A;  2LOP A;  4A55 A;  5ENN A;  5ETW A;  4AXH A;  4AVX A;  2WXI A;  2DCP A;  1ZV4 X;  2CXL A;  5KJN A;  4O2A E;  3DTO A;  3QB2 A;  2PM6 A;  4V1A v;  4N78 D;  4FUL A;  4ZOL E;  3LVR E;  4O4H E;  4RG9 A;  3FH5 A;  2VKJ A;  1G8X A;  3N2G E;  4ILI A;  4ATG A;  4WBN E;  2KIN B;  2NW9 A;  4GZC A;  3KDS E;  5LA6 E;  5HXR A;  2OA5 A;  3PUA A;  4TUU A;  3FHN A;  3EIJ A;  2X67 A;  4G2V A;  4L23 A;  2CG2 A;  3BQI A;  3DP7 A;  1MMD A;  4XBF B;  3HYM B;  1SQM A;  4AY6 A;  4L2Y A;  4HOS A;  4O6F A;  1UX5 A;  3HA4 A;  2J08 A;  3D9J A;  3D9O A;  1U5P A;  3E4B A;  4PS8 A;  4AJW A;  3F31 A;  2XCC A;  4KVM A;  5A23 A;  2HR2 A;  2WXR A;  4GIW A;  4UI9 C;  2LE8 A;  5HQ8 A;  4IDZ A;  3CQC B;  3ZRH A;  4UVA B;  1Y6I A;  1Z6T A;  3CHO A;  1HG2 A;  5KMG P;  3LEW A;  2XRZ A;  4JHR A;  2XUE A;  4NQ0 A;  2WMO A;  5J2T E;  2RD0 A;  4AY5 A;  2I59 A;  1E96 B;  2Y4U A;  2J09 A;  3OXG A;  5JDG A;  4XIF A;  2KT9 A;  2KZ7 B;  3N71 A;  3J9X 1;  4HOR A;  3UT5 E;  4WWO A;  3TKL B;  1OWM A;  2CE7 A;  2XAS B;  2LAI A;  4IE0 A;  1H19 A;  5LCY A;  1H7C A;  4TUY E;  4FLH A;  4DK5 A;  4IGU A;  3QAQ A;  5LG4 A;  3AS5 A;  4AOF A;  3L17 A;  2X0L B;  2CXD A;  4UWK A;  2E0I A;  1E7V A;  4I6G A;  4O4J E;  3MA5 A;  1HE8 A;  4EEC A;  4UQY A;  2BVM A;  4UWF A;  3IBP A;  2J07 A;  3SHF A;  3QWW A;  4DLQ A;  4GCO A;  3IF8 B;  2C0M A;  2CG3 A;  4HE8 A;  5L2L A;  1HFA A;  4IN3 B;  3C4Z A;  1IHG A;  4PK6 A;  3PUR A;  4HTE A;  4JVS A;  2Q9Q D;  2ILR A;  3QK6 A;  2XAH B;  1MMG A;  3JC6 D;  4AIF A;  3UFE A;  4ZI3 C;  2OVF A;  2KCV A;  5AJD A;  5A1L A;  2IF4 A;  3C4W A;  3R6N A;  1H2U A;  4CT0 A;  2D0U A;  4DLO A;  4FAD A;  1KT1 A;  4UV8 B;  3GYZ A;  2WWU A;  4A3T A;  5F8P A;  3ASG A;  2QGS A;  3MJW A;  4UWG A;  2L3L A;  5AYW D;  4I2W A;  3D0T A;  4QXB B;  3FBZ A;  3O4X E;  2QFC A;  4GA1 A;  3SD5 A;  3LKU A;  2CM0 A;  2DLR A;  3ONL A;  5LCW J;  1LRZ A;  2Y48 B;  3KS2 A;  2IW5 B;  3MZL B;  3B7T A;  3VTY A;  2LT3 A;  2PZI A;  4IE6 A;  4XX5 A;  3L13 A;  3CVR A;  3J7Y q;  3LS8 A;  4QXH B;  5J08 A;  3PE0 A;  2YU1 A;  3I1A A;  4HGA A;  2WXH A;  2AXV A;  2IC9 A;  3CHP A;  3MXZ A;  3PUG A;  4MAL A;  1JPL A;  3ZIM A;  5JDM A;  1FEW A;  2JMH A;  2DWG A;  5C2Y A;  3ZJ1 A;  2VGX A;  2C0L A;  2IOS A;  3KVB A;  1UN9 A;  2X9W A;  3FTU A;  1EDU A;  4I43 A;  3K9I A;  5FZS A;  3SS1 A;  2CWO A;  4PS7 A;  2J1D G;  2ZM2 A;  3FP3 A;  1IAP A;  1HX8 A;  4EYY R;  5LXT E;  3AA6 B;  5A6C A;  2W0G A;  1D0X A;  3EVY A;  3VLE A;  2E9X D;  2YU2 A;  5EZY E;  4JHK A;  5FWQ A;  3MV2 B;  2V7M A;  3B7R L;  4DI3 A;  4ERR A;  4G63 A;  1UW4 B;  3AB3 B;  2LEH A;  3FTX A;  4UI9 J;  3QC1 A;  3HVE A;  3ML8 A;  4TN7 B;  2KZT A;  4KYO B;  3CGH A;  2XAF B;  3NRY A;  3TG5 A;  2DI4 A;  2KWH A;  3E22 E;  2K48 A;  3OAW A;  3L09 A;  2A5U A;  1B89 A;  2WXO A;  1JUQ A;  4DPR A;  5HXE A;  1XNF A;  2XPI A;  3IHR A;  5JRC A;  4U74 A;  4CGW A;  2V26 A;  3RC8 A;  5E76 A;  4CRW A;  3GW4 A;  3N9O A;  4B8C B;  4KBQ A;  3RO2 A;  3GWH A;  1US7 B;  3CIA A;  4X1I E;  2BDE A;  5JDF A;  3VTX A;  3FUM A;  3NZQ A;  4PW8 A;  2G0U A;  5JRE A;  2YHC A;  3I9Y A;  5EX3 A;  5C8Y E;  3FUE A;  3ZYK A;  1D1B A;  5G04 C;  2EHO D;  2PQN A;  5AJL A;  3TL5 A;  4BA9 A;  3EDV A;  3PRE A;  3KV6 A;  3R84 B;  3QNK A;  4KBM B;  5BMV E;  3JCK C;  3U4T A;  4YFS A;  3L6A A;  3BG1 B;  4XE0 A;  3MYV A;  4GU5 A;  2CHW A;  3CK7 A;  2H7V C;  5G2N A;  2L9B A;  5HXH A;  3V5S A;  2NTY A;  3ETV A;  4P29 A;  3LBX B;  5HXC A;  1WYB A;  1IZN B;  2VYI A;  1TJC A;  1D0Y A;  3DBS A;  3D9P A;  4C91 A;  4EPZ A;  2BZB A;  4GYS A;  5LOZ A;  5HXS A;  2XRY A;  4GK5 E;  4UV9 B;  2BTD A;  4XZC A;  5FXZ A;  1W3B A;  2W62 A;  3N2K E;  2J4D A;  3AU4 A;  1QQE A;  4HS2 A;  3ZN0 B;  3S7F A;  4RSY A;  5JR9 C;  2XGS A;  4I55 E;  1HG5 A;  4O2B E;  4G23 A;  1E8X A;  5ANL A;  2VL8 A;  3O1J A;  2WPV A;  3QDN A;  4APF A;  2OV8 A;  4CDN A;  1YD8 G;  3BK9 A;  3FDH A;  4O4L E;  4PFO A;  5LJN A;  1E8Y A;  2NOX A;  2A3D A;  4N5C A;  3LK3 B;  5CMW A;  3HKC E;  1D1C A;  2MBG A;  4CI3 B;  4XI0 A;  1U3D A;  3KAE A;  4CDR A;  2DWK A;  4UXN B;  3APF A;  1NA3 A;  4AEZ C;  3MJX A;  3CHM A;  2D2S A;  3NRX A;  2VTB B;  3L3P A;  3A5X A;  3MEK A;  1MNE A;  2VB6 A;  5C1D A;  4KMC A;  3TAX A;  5FYM A;  2LSJ A;  1E8W A;  2LSI A;  2MOZ A;  2WXK A;  2N9D A;  3ZFW A;  1MIW A;  2XGM A;  3SNX A;  3PU8 A;  2KAT A;  4XKB A;  3I9W A;  1JWG A;  3RRC A;  3ZYL A;  4ILU A;  4HVB A;  4FC8 A;  3WI3 A;  5L3F B;  2H7O A;  3JUI A;  4L1B A;  4HOU A;  1OXZ A;  5LGU B;  3PNL B;  3UT8 A;  3GZ1 A;  4C0M A;  4H63 V;  5LHI B;  1GW6 A;  2VSO E;  3ASD A;  3FUF A;  1YA0 A;  4KXK B;  5AIJ A;  3PU3 A;  4ASK A;  2OOE A;  1H2T C;  4I1A A;  4I6J A;  3CVX A;  2WBL A;  4I2Z A;  1PC2 A;  5E0O A;  3SI5 A;  2WXF A;  3CK8 A;  4G24 A;  2L0I A;  3ETU A;  4R7L A;  3ZPJ A;  3CX6 B;  2UY1 A;  4CT4 A;  4M3O A;  2NWB A;  2CEA A;  5T4Y A;  3IBE A;  1YKE B;  1H6K A;  2E8I A;  3ASH A;  4JA9 A;  3BQK A;  2R17 C;  4C0E A;  4ANW A;  5EKQ D;  3ZMT B;  2K9A A;  2XPY A;  4GZ6 A;  3QUJ A;  5D0Q D;  4CQI A;  5G55 A;  3U3I A;  2BUG A;  3ZVV A;  2UWJ G;  3LK4 2;  3ZGQ A;  2CFZ A;  1WLX A;  3PEU B;  4WNF A;  5JJ6 A;  2JMK A;  3HDX A;  3Q9D A;  3HKB E;  2M63 A;  5JR9 A;  2A4Z A;  5LYJ E;  2V4L A;  3C51 A;  3G2S A;  2LOS A;  5G04 J;  3N9Q A;  4ANJ A;  5CMY A;  4UVC B;  2AVP A;  3AA1 B;  4U07 A;  1Z0P A;  2CLY B;  5JJT A;  4ME2 A;  4K0R A;  1HS6 A;  3PH0 C;  2FF4 A;  4PFP A;  5LFA A;  1UX4 A;  3FEX A;  3NBX X;  2CA5 A;  4PK5 A;  3RRM B;  4F53 A;  5HWX A;  2VKO A;  3ZC1 A;  4E6H A;  1BR4 A;  1UJK A;  1MQS A;  3O48 A;  4GYW A;  1OWN A;  3FH8 A;  2X51 A;  4BX8 A;  3FTW A;  2DHR A;  4RVB A;  3G2W A;  4KT6 B;  4F1S A;  5JQG E;  3CWZ B;  4FU3 A;  3QJZ A;  1H2V C;  1EF1 C;  3BG0 B;  4DBQ A;  2AXZ A;  3MK7 C;  3ENE A;  3OYX A;  3I5P A;  1NP7 A;  3RYI E;  3FUL A;  4U8H A;  3R9A B;  2X9H A;  5CB4 E;  2C5J A;  1BR0 A;  2EHO C;  4UEL A;  4MKT A;  3AA0 B;  5LGT B;  2JEK A;  3KFW X;  3OBV E;  4B94 A;  1D0Z A;  2SPC A;  3HKD E;  4RG6 A;  2RP4 A;  1WYC A;  3FTY A;  3V5U A;  1LF8 A;  3C64 A;  3FEY A;  4J8S A;  3U64 A;  4LEU A;  4ZI2 C;  3P8C D;  2WQ6 A;  1MHQ A;  2V8S E;  1T98 A;  5JDQ A;  3MAC A;  2P58 C;  5FTP A;  4GZ3 A;  1KNZ A;  5AEN A;  4ACK A;  3O9X A;  3UPV A;  1FIO A;  5JH7 E;  3RK6 A;  3FUD A;  3I4R B;  3CHQ A;  4DJA A;  1U3C A;  2PFV A;  3K3O A;  3NZS A;  3HHM A;  2V7L A;  2NW7 A;  3H3A A;  2I1K A;  3CHS A;  4NUU A;  3VKH A;  2DIW A;  4HFG A;  1YKH B;  3AAA B;  4H7Y A;  4LUN U;  2VGX B;  2KCL A;  2VK9 A;  4IHJ E;  4I43 B;  3CVW A;  2C5I T;  3HKE E;  4JEH B;  5JHB A;  1LVK A;  3TGO A;  3MA9 A;  4EYU A;  5HI7 A;  3LY7 A;  4ZHQ E;  4X20 E;  4WND A;  1Z3Y A;  2WXQ A;  2A72 A;  3ZXS A;  2BF0 X;  1S94 A;  4LER A;  3HL6 A;  4JHJ A;  2IFU A;  2Y4T A;  2KMF A;  2LSG A;  3LFM A;  4A3V A;  3N5L A;  5IYZ E;  5FXW A;  5ARG A;  3HVE B;  4YJ3 E;  3WAK A;  3SGH A;  1BPO A;  4N3B A;  4ZI7 E;  2ODU A;  2KZT B;  2AXU A;  1VRB A;  4E85 A;  1IQU A;  4WNG A;  3N2O A;  4PS3 A;  5HYA A;  4JA7 A;  2D0T A;  3BQL A;  3CQX C;  4JLE A;  5J2U E;  4FJY A;  4APO A;  4EZ4 A;  3RX6 A;  3O1I A;  4CI2 B;  2V1D B;  2X66 A;  5JRC B;  4JW1 A;  4PJJ A;  5CA0 E;  3RYC E;  4ISS A;  5D0O D;  3IHY A;  3KBU A;  3PTR B;  4JL0 A;  1D1A A;  5J90 A;  4QKN A;  5DBK A;  3KV4 A;  1DNP A;  3C98 A;  2D5U A;  2HM8 A;  4DI4 A;  5BV1 A;  3CKC A;  4UF0 B;  4UEM A;  4CI1 B;  3UMV A;  3CQG B;  2X38 A;  2YIN A;  5FZR A;  4IRU A;  4Q94 A;  4PH4 B;  3SBT B;  4OHF A;  3Q5M A;  2LSU A;  4GOU A;  4H9R C;  3LCA A;  3LDZ A;  3CSF A;  3OJA A;  3M65 A;  3FH7 A;  4NUV A;  3IV0 A;  3CKD A;  3IHV A;  4G26 A;  1MIY A;  3CHR A;  3K8P C;  5KJK A;  2A2F X;  4ANU A;  1OWA A;  2KLQ A;  3ZMU B;  2VKH A;  5FMN A;  4JEH A;  4BTA A;  3CPZ A;  4H9N C;  5JDL A;  2LSV A;  5JJ7 A;  2FEZ A;  4FI5 A;  3PS6 A;  3UX4 A;  4CEM A;  5FQ6 A;  2MYS A;  4KUM B;  2J4B A;  3S7J A;  4HN9 A;  2PQR A;  2XCB A;  5KX5 E;  3SZ7 A;  4WWP A;  5J1G A;  4BJM A;  5H6R B;  4HXI A;  4ANX A;  4HLE A;  2WXG A;  4LCT A;  2NTX A;  2IJG X;  4GZ5 A;  4I17 A;  2UXX B;  2CHZ A;  4AKL A;  1SHZ C;  1ZU2 A;  3I4G A;  3RYH E;  2W61 A;  4XAX B;  3FFL A;  2X9X A;  2WXL A;  4DMW A;  5L3C B;  1MND A;  3P7I A;  1E1H B;  2AW6 A;  2AWI A;  5EK4 A;  2WB2 A;  3EDU A;  4TV8 E;  4BWR A;  4FP7 A;  2QY7 A;  2HPL A;  4WUY A;  2LHR A;  3WAJ A;  2XQ0 A;  5LBM A;  4GK0 E;  3ESL A;  3K3Q C;  4IE7 A;  2GK9 A;  1ZHC A;  2ODV A;  3ZEF B;  3UT7 A;  1EPU A;  2YHE A;  2XAQ B;  3CX8 B;  2JJ9 A;  3AVS A;  4F6R C;  4GMJ A;  2GGF A;  5T8I A;  3KV5 A;  1EYH A;  3ZC0 A;  4JPS A;  3CVQ A;  4UF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...