2WM9A

Structure of the complex between dock9 and cdc42.
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
423
structure length
407
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 148
structure length 407
sequence length 423
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wm9A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wm9A01
3B13A 2YINA 2WMNA 2WM9A 2WMOA 3VHLA
chains in the Genus database with same CATH superfamily
5AFUL 1HNXT 3ZNGA 2DIWA 4OYSA 2XRZA 2FO1E 4ADZA 4LFCT 3Q9DA 2W61A 3E22E 3PZ4A 4Z91A 2CXLA 3ASDA 4DLQA 2OOEA 2E5LT 3CVLA 1OEDB 2LJLA 1ELWA 2OCCE 4IE6A 1TNOA 2LEHA 2DLRA 2XQ5A 2ETCA 1VOMA 1ZKEA 2WWUA 4YLHA 1OCOE 1D9SA 4QXBB 1KFYA 4GPKA 4BESA 2XHEB 5FXZA 5D2MC 4YDYA 1GQEA 1UOHA 4Z68A 4HGAA 2V4HC 3C64A 4EAHA 3IEEA 1B89A 3B5MA 4LF7T 5JDNA 1S94A 3UM0A 4L0RA 1IHBA 2IAKA 2G0UA 2CPTA 5BMVE 1LD8A 4IYPA 3SHFA 4L2YA 2A3DA 4DO0A 1G8XA 5FNVE 1WG0A 3RYCE 4AKRB 1MZCA 2H6FA 5AQBA 3PURA 4HWCA 4XX5A 2XEEA 4K03A 1N4RA 3TWWA 1TNYA 2F8XK 2KATA 1NI1A 4ABNA 1LVKA 2C2LA 4GTOA 3LSVA 2W2UA 5JDQA 3ZT5A 3RKOA 3MK7C 2AW6A 5FKYA 2VGYA 1VCTA 2E5VA 2XCBA 5FZRA 2I6HA 4E7SA 4BSZB 3BG0B 5F3JA 2IO3C 1DCEA 5E75A 5FL1A 5BXUA 1G3NB 4MHCA 2NC9A 4PFOA 3ZMUB 4F8HA 4DX6D 4F7AA 1NFIE 3LVQE 3H37A 4TWDA 4JL0A 2CXDA 2E9XB 3EVYA 2CHZA 4JZYA 4AEZC 3LG7A 3IXEA 3ZKRA 3LYAA 4U63A 4HFEA 2XJ7A 2MOZA 5JDFA 4QKNA 1ZV4X 2XTLA 2NOXA 2IU1A 3GA8A 4TNWA 3NQPA 4PK5A 2A2FX 2KSRA 2YOEA 3Q5XA 3P4RA 3L17A 5LX8A 2L9QA 4YJ3E 3AE4A 4WNFA 3OKQA 3Q75A 1JPLA 2X67A 3LK42 4ZI3D 4XIFA 2XAGB 5LP0A 2V4LA 3OAWA 3R9AB 4I1OB 1IZNB 4FADA 3GMIA 4JI5T 4J6IA 4O6FA 2XY8B 2XS1A 2M6BA 4AOFA 2PL2A 2VB6A 3IEGA 5D0QD 2KWIB 3D3MA 5ENRD 4UVCB 2XEVA 3ZU7B 3CV0A 5BV0A 1E8XA 2VQFT 2EIKE 3W9FA 2CM0A 2P2CP 3CVWA 3ZPOA 4TRQA 1MQSA 2EQXA 3CGHA 3I3NA 1FT1A 4I6EA 4CRWA 3HRAA 3D9MA 2CWYA 3AA1B 4E7ZA 2DYRE 2L0TB 2FEZA 4ANUA 2I9CA 1IBKT 5ABEA 4WNGA 4U04A 3L3PA 4BAYB 3TLTA 2DWKA 4XAXB 4O4IE 4P1NA 2VQ2A 2E9XA 4Q96A 4X66T 2LSKA 2X6JA 3JQ1A 1W9RA 3G2UA 4XZCA 3NZQA 3EDTB 1DVPA 2BEDA 1JNZA 1MX2A 2VGEA 3J5PA 1LVFA 1IBMT 4BTBA 2NW9A 3DRAA 2LSJA 3P2BA 2GK9A 2E0IA 3ONJA 4EZLA 3UU4A 2YU1A 3ETUA 3AEGA 2HPJA 2NTYA 2CRBA 1E8ZA 3KV6A 4CI1B 3VLDA 5ENQD 3LBXA 2YDSA 3TWTA 3MXZA 5JQGE 4DPRA 1KK7A 3OYXA 2H3RA 3AE2A 4I2ZA 3PEVB 3TWRA 4U7YA 4F6RD 3EHRA 3SBSA 3SBTB 3L22A 1EYHA 2WB2A 1E1HB 3DTOA 3PRZA 3W15B 4EECA 3FEYA 5LGUB 5EILA 1HNWT 1X9BA 4H63H 2MPKA 4HWDA 2YQ8A 4IDNA 4X1KE 5AIJA 2ACZA 5CHEE 3S7JA 4DMVA 3PU8A 2ZM2A 4DR3T 4CZZB 2WMOA 1ZBPA 2EHOA 4K5AB 2FULA 1OWNA 3QWWA 1BI8B 2CHOA 2BG9A 4Q25A 1OWOA 2KMFA 1IYGA 1OWLA 4FHJA 3N9LA 4DV7T 2KZTB 3SWHA 4CCAA 2Y1LE 4JA7A 3APCA 1KT0A 4OAVB 4K0UA 4BX9A 3CVUA 2LSVA 2Y6XA 2WXPA 3MV3B 5LBMA 3ZYQA 2XQ0A 4HRMB 3QNKA 3UQ3A 2OEWA 1YMPA 2XPIA 4UWLA 1PAQA 2SPCA 5LMNT 5J0ZA 2B1EA 5AQTB 4DX1A 1B7TA 3AVSA 5HEHA 1N34T 2XS8A 2BG9B 5HRYA 4MS6A 3UT7A 4HN9A 2HO1A 4B0ZA 3UUXB 3CK6A 3UFGA 4IULA 1YD8G 4EZJA 2ZMAA 5LB7B 5EYPF 2VKHA 3RHWA 1US7B 2I0MA 4YT0A 4NURA 4MBGA 3RKGA 3BQKA 3FBZA 4LNUD 3L54A 1H2VC 5LCWJ 2Q9QA 2X68A 5HCJA 4URKA 1HCIA 2VGXA 4A55A 4CDMA 4YY3T 3DEPA 2KCVA 5DQWA 3WXXA 3J9X1 2XM2A 2RFMA 3RYIE 4NQ0A 5EX3A 4HRNA 3OBVE 4Q94A 3C3QA 2X9YA 2UUCT 2L6BA 3FU5A 4DUYT 3Q7AA 4HI9A 3D9KA 3QB5K 3RRWA 4LNBA 3V5SA 4ILBA 4FJZA 2EINE 2J08A 1ZP0A 4A98A 3F31A 2KM4A 4UI9J 4A5XA 2P9SG 1EPUA 5EDSA 3ZFWA 4F1PA 1KNPA 2DWGA 3QK0A 4D10C 1O1SA 3MA9A 1U3DA 3UQ7A 3ZYLA 4EYYR 1WFDA 3RQUA 4RG6A 3AE1A 2J4DA 4QHOA 1OT8A 4LNGA 3TGOA 3K9IA 3PUXF 2K5BB 3D0TA 1NA3A 3JYSA 2PM6A 3I0QA 4U74A 3AE7A 2FI7A 3C98B 2F0YA 4ATGA 3FZHB 3IA3A 4MLKA 2HM8A 2D5UA 2D9DA 5CFBA 5CECB 3O1JA 2JPFA 2Q9QC 2VKOA 3RIUA 1OXZA 4BEPA 5JRCA 3Q7FA 3B7SA 2BS2A 1IQUA 5LHHB 3MYVA 2VSYA 2WVIA 4FU3A 2LRLA 5AQ7A 5JR9C 2GGFA 5LJNA 2WDRA 3JAEA 3EHMA 5L3GB 3EDVA 2Y3AA 5G05J 4QH1A 4Z90A 2IC9A 1KNZA 3H3MA 2IOSA 3BQLA 4APFA 3TWXA 2QFCA 1HE8A 3IHRA 3T8MA 4LFAT 5AQSB 1YKHB 3X2QE 1HH8A 4JW1A 3Q5EA 4JHRA 5AQAA 2R02A 1T8BA 5FVLA 2MRIA 4CT0A 3TWQA 4GTMA 2LLYA 1OCRE 3P8CD 2ZU6B 3KSQA 3WAJA 1BR2A 2ES0A 4ILUA 2WXJA 2WXGA 4HRLA 3ZUVB 3FXDB 3ZIMA 4U95D 5HI7A 3U3WA 1VDYA 5JH7E 2HPLA 2MAWA 3FHEA 5AQQB 2K9AA 3D9LA 4HLEA 3AA6B 5C3JA 2EHOC 4AKIA 2P9NG 3VRAA 4GYOA 3A5XA 2X0YA 4H9NC 1UJKA 3CK9A 3KDSE 3CPZA 2WU5A 2YDRA 3RH3A 2BUGA 4GAAA 4YDWA 3A8YC 3EHNA 3GWHA 3AEFA 2Y8DA 2BDEA 2YU2A 3CLJA 3PZ1A 5T3RA 2CHNA 2VASA 2OLTA 2QC9A 3GN5A 4JB8P 4XI0A 1TEZA 4EZHA 3TLWA 3G2VA 3CK8A 2XEHA 2FBWA 2F4VT 4AQFA 1N0QA 5C1DA 4NXMT 1SZ9A 2V6YA 3RIFA 3MKQB 4WNDA 2WXMA 5AARA 3MJWA 2MTQA 3AE8A 2C5IT 1H2UA 4AQYT 4A63B 1Y6IA 3FUFA 4TXPA 3ESLA 4LUNU 4APOA 2NTXA 1K1BA 4YHHT 3UT8A 3CQXC 1JWFA 4I17A 3VRBA 2F8YA 3LDZA 5KXJA 5LOVE 2WQHA 4X20E 3AB3B 3N9NA 4EB6E 5EIDA 3HXFA 3NKZA 4TZ4C 3KV4A 3PV0F 3UXGA 4CZ2D 3AAAC 4LF9T 4G8KA 1IJ6A 2XQ3A 4DV5T 3W9GA 2N1GA 4BA9A 3AXJB 2XRYA 3V2XA 5FY1A 5L2LA 4KBQA 3UU3A 4YTMA 5KCMA 3QAQA 3CKBA 3NRYA 4L9IA 3UU8A 4DR2T 4I4TE 1IXVA 5D66A 4PK6A 3EU9A 3L6AA 1SUMB 2IY0C 1SA5A 1RW2A 4LF6T 1S35A 1UURA 4PH4B 3EUHA 2HE0A 4L23A 2PG8A 1LD7A 2MYSA 4YJ2E 3Q5DA 2VSNA 3SFDA 3ZN0B 1E8YA 4C48B 2NR4A 2WQYA 3DEOA 2JRKA 5A1LA 3LKUA 4U07A 3L39A 1T72A 4H7XA 5HXEA 2EIME 2CE7A 5HEUA 2QVAA 3FTXA 4ZS2A 1YCSB 4FULA 4HVBA 2Y0BG 2RPAA 2IF4A 5CCLA 3AS5A 5J90A 1V9DA 3AAIA 4PK4A 2LE8A 4A56A 2B6CA 3AJIA 4XE0A 4AI6A 4IHJE 3CHRA 4X1IE 3Q15A 3E08A 1D0YA 2DVWA 4UI9K 5DJQC 3RIAA 1OEDE 2HH7A 2UXNB 4A97A 4CN1A 1N4SA 5HS0A 1SQMA 1X5BA 5ANRA 4ZZCA 4U72A 3ZYKA 2P9LG 4E85A 3HKEE 4GK5E 2Y4UA 3AE3A 1MYOA 3IHVA 1AJ3A 5CA1E 4EIWA 1MMAA 3LJNA 5B1BE 1X79A 3BUAA 4J7WA 2H7VC 3EAMA 3QOFA 2OVBA 2E2EA 1XDOA 2WQ6A 5EK4A 3CSFA 4I50E 2EIJE 3P7IA 4Y6CA 1MIWA 3JADA 2UXDT 2VQET 1VRBA 2PNNA 2ZGDA 5ANLA 5CJ5A 1UX5A 4EGWA 4P0AA 1U4QA 3PVLA 3U66A 3CHQA 3P4SA 5G04C 2J4GA 3K8PC 3PZ2A 3PUYF 3ZW3A 4BT8A 2WS3A 3R6NA 2K48A 3CVVA 3FU0A 2X6IA 2LRKA 3DBSA 4F6RC 4K0KT 1H0AA 5FQ6A 3D9IA 1N94A 3JUIA 4P09A 3T1HT 1ZHCA 4B3MT 5JR9B 2L9BA 3SQVA 1FJGT 4WWOA 3B7UX 2BF0X 2V5QC 4KX6A 2XUEA 2YK0A 5ENSD 5HQ8A 5F8PA 4AY6A 3CX6B 3B57A 4YVQC 2NP9A 4HXIA 4YSZA 3Q9UC 5EN5D 3PUQA 1YKEB 4AKGA 3I0OA 2VVNA 3L16A 4ANVA 1LRZA 3S2AA 4TXQA 3E30A 4HOSA 4DR5T 3ZSTA 5ETWA 2QYUA 3PREA 3CVNA 1H2TC 3G2TA 4LCTA 4PNIA 2PZIA 2Y69E 4CEMA 4IN3B 2AVPA 3ZYMA 1Z5SC 2ZXWE 3EABA 4YNDA 3PUKA 4I2WA 1U2VG 2ODUA 3FUKA 3LCAA 3SO8A 3ABKE 4AIFA 4O4HE 3N9MA 3RIUC 1FPPA 3ONXA 2LSIA 2CFUA 4ZI7E 4CXXA 3TXNA 2V8SE 1N33T 2QY7A 2OV9A 2VGXB 4G63A 4G8LA 5FQ8A 2LAHA 5DQVA 1CHUA 2YN6A 4B6XA 5KDMC 4FP7A 2DZNA 4I43A 1L0VA 5L4EA 1WY6A 4HWIB 3RYFE 4O1OA 4JI2T 3U9WA 3K1SA 2XCCA 4JHKA 1YA0A 3MA5A 3J5QB 4ZEYA 4B93B 4U96D 4HFBA 4L9PA 3HR0A 2HHHT 2C0MA 3I9YA 3SOLA 4HFIA 1MIYA 4YXDA 2BKOA 3Q2MA 4J8SA 2J62A 3FXEB 2X0HA 3V5UA 3AVRA 4GZ5A 1IHGA 4BJMA 2A5EA 3AE9A 4GCOA 4MRUA 3KV5A 5HEOA 1YQ3A 3UULA 3T8OA 2IO2C 4TX5A 2W00A 1HS7A 3T8KA 4U0SA 1HG5A 5CERB 1W3BA 4OVVA 2WQ7A 3P1UA 4DR7T 3DPYA 4KXKB 1O1RA 4L7TA 2OVFA 4U7EB 3J7Yq 4ERRA 2LM2A 1UW4B 2P9BA 1MNEA 4BSXA 3I5PA 4A1SA 4LEUA 3VHLA 3VU7H 4HOQA 4ANXA 2X51A 2Q9QB 1QLBA 2WMNA 4EYUA 2DYSE 1HFAA 2ZLYA 1I6ZA 1IBLT 4XZ4A 3BQIA 2YDQA 2ILRA 5L3BB 4EZ4A 5LP6E 4QXCB 3B7BA 4ILGA 4XKCA 3T5VA 1CUNA 4U7IA 5AQOB 2E8IA 4K5CA 2LKGA 3LBXB 4IE7A 3OTNA 4ZXLA 1WAO1 3QK6A 4N2SA 2FBNA 5L3DB 1INZA 4E6HA 5EX0A 1Y01A 3ASGA 2PJQA 3JUEA 5FINA 3I4GA 3CX7B 3ZJ1A 5EIBE 2FJAA 2GROB 3MCXA 5A6CA 1FT2A 3GYZA 2UXXB 2FJBA 4GOUA 4IE0A 4HWHA 4QFVA 1M62A 1D8DA 2KXPC 4HTEA 3TAXA 1QUUA 3PU3A 4GTSA 5IYZE 1JWGA 3N9QA 4GYYA 4AIUA 3QKYA 4JI4T 2W4XA 1EZ3A 4DI4A 1Z6TA 5FXVA 2XM1A 1WRDA 4KMOA 1JNRA 2JIWA 3EHZA 4XBFB 1XNRT 3FFLA 5AQNB 2YEVC 2GRLA 4B3RT 4DK5A 2CA5A 4TUYE 3DSWA 4G11A 2QZAA 1EF1C 3PUVF 3OVUA 2VKDA 3KBUA 4QWNB 2BKPA 3UT5E 3SZ7A 1E7PA 5FXXA 5LG4A 2E9XD 4I9CA 3DSXA 4ISTA 1G73A 1ELRA 4DR1T 4UF0B 2VTBA 1WYCA 1K3ZD 5CBNA 4DX2A 4DJAA 4TWFA 3RJVA 2W63A 5G2NA 1UX4A 5J1GA 4KMCA 1O1TA 3KS2A 3CK7A 3H3AA 2KXPB 3EIQC 4ACLA 3HKCE 4IL4A 2ONDA 1UUSA 1MMGA 4PJMA 1D8EA 2CXFA 4J8DA 4QH5A 4PJNA 4WNEA 4FI5A 1NA0A 3B13A 4RSYA 2LUHA 3ANWB 1K8KG 5AJLA 3NZUA 2XAFB 2Y48B 2BKKB 4C0EA 4UF0A 2VTBB 4H9RC 4ME2A 4FLHA 4QQIA 1E7UA 2B0OE 3FZLB 4G26A 2IONA 2RD0A 3PDNA 4UUCA 2V0PA 1FVFA 4HQDA 3LVRE 2ZM6T 5FTPA 5AQHB 5FY7A 1OUVA 4WUYA 4RLYA 4GZ6A 3V30A 5ENNA 2VJ8A 4DI3A 2HN2A 2LOSA 3DWLG 2L6JA 3NAWA 2VVSA 3ZN1B 3QB5A 1TNBA 4UVBB 2K3WA 5B3SE 2WP9A 4YTPA 4DX5D 3A7MA 3C50A 4A3VA 1HO8A 2XQ8A 4C0MA 4CQIA 3KD7A 3NZSA 2XHEA 1BR1A 4K0RA 1N4PA 2L8KA 4N5CA 4GYSA 4I55E 2V5FA 2V5CA 4LFBT 4KUMB 2LXLA 5ADXL 1UN9A 1N0RA 2AWIA 4I0UA 3K3QC 3T1YT 4G23A 3PE0A 1D1CA 2OA5A 4NIKA 1S70B 2H7OA 3LJ3A 4PW8A 3ZSSA 2X9XA 1UJJA 2N9DA 5AQGB 2I2OA 2J49A 5LA6E 2X66A 3PH0C 3KINB 4EZKA 3TG5A 4JI7T 2BBHA 5FIOA 3DXKG 3ASHA 2GW1A 1J1JA 3D9JA 4BX8A 4EEDA 4N3AA 3CR3A 1N95A 4ZI3C 3ZC0A 5JA4D 3AU4A 5BW8C 3AG3E 2P9UG 3CVPA 2VL0A 4LF4T 3MV2B 1YW0A 2XAQB 4F3VA 3ZLIA 5BR8T 4B3ST 3FH8A 3JCKC 4FHKA 1A17A 4B89A 4KP3C 1OY3D 2KZ7B 1Z3XA 2VYIA 2XGMA 5AYWD 3AEAA 3CX8B 2YHEA 4NRHB 1QZ2A 3UIPC 1O3XA 4G24A 3ETVA 2V6YB 2MYOA 2D0UA 2XQYA 3LDQB 3RIBA 3TL5A 1PC2A 3VR9A 1ELKA 2KLQA 4IGUA 2BKGA 4V3IA 4JEHA 3JAFA 2GRNB 3UM3A 1E96B 2V5DA 1SZAA 1N36T 2JQ9A 5AQJB 3S4UA 3RRMB 3ONKA 3RF1A 2MOWA 4X5TA 4JI3T 4EHMA 1L5JA 4B3TT 3AEBA 5EK2A 3JQ0A 2FJEA 4UQYA 4O2AE 4UIGA 1Z8UA 2A72A 1MHQA 3ZC1A 1JCSA 3TXMA 1R8IA 2V7KA 1H19A 1XGWA 4J0UA 2ETAA 1IQRA 3MACA 4N78D 4DBQA 3QC9A 2J47A 4EBAA 3E34A 5CMWA 4O8SA 3JXJA 4GMRA 3AG2E 3UPVA 4CDRA 3P4QA 4DVDA 5BPPA 4CT4A 1MMNA 5DABA 2YHCA 5J2TE 1BPOA 5G05C 1U5PA 4XEIG 5LGTB 3FUDA 4DV6T 3LXUX 1HX8A 2FUPA 1OCCE 3ZGQA 3ZJ2A 3ABLE 2Q9QD 3R9MA 4B8AA 3DP7A 3NOGD 4GTQA 4UI9C 2NSZA 3GN5B 2WU2A 3BEEA 3WG7E 4HBDA 4AISA 4DV4T 4KT6B 2IHR1 1W09A 4PDXA 3KFWX 4KHZF 5IHYA 3GZSA 4B94A 2CCQA 3NZPA 2IFUA 3N71A 3VTYA 4DR6T 2V7LA 5HEGA 3N2GE 1WYBA 2VSXE 3LY9A 3FUHA 5LYJE 3DSUA 4LRZA 3FULA 2ACXA 1IAPA 2W67A 3RI5A 3RGLA 2XQ7A 4RQIA 2CG3A 4P29A 2CLYC 3DJBA 4ILIA 5BV1A 1OWPA 4MFRA 4UWGA 3M65A 5IWAT 1E7VA 1W0BA 4C9BB 1QYMA 4TUMA 2J8SD 4DV2T 5LMUT 5AQRB 5ARGA 2ODVA 3QDNA 5LFAA 3L08A 1WM5A 1HF8A 5LJMA 4X1YE 4ASKA 4HS2A 1T7SA 4L2LA 4MLPA 3AE6A 4HEAA 4YDOA 5JREA 1UCUA 2XQ6A 4JC8A 1J5ET 5FYMA 1FVHA 4PS7A 2YKSA 4GYRA 5ENPD 1QBQA 4HORA 5LHIB 4O4LE 1HZ4A 1K1AA 5FMNA 2H88A 4R7LA 2KWHA 1JCRA 2OV8A 3UI2A 1M7KA 4BJNA 5F5WA 3VKGA 5HWXA 2JMHA 1Y8MA 4FLBA 2AE9A 1VCSA 4ZHQE 2MBGA 4GTVA 4X64T 4ANJA 3CHMA 3HKBE 4C90A 3IBEA 1H7CA 2NW7A 3F6QA 3TWSA 3AAEB 3FBLA 2CLYB 2XPZA 3PZDA 1E2AA 4KVMA 1H6OA 3V2OA 3O48A 4N3BA 4H9OC 3VLEA 4Y6WA 3OTOT 3KVAA 3OJAA 2LSYA 5LCWC 5G04J 1IKND 5L3EB 2KBXA 4GPMA 4OYJA 2X0LB 3HXEA 3C3OA 2V7JA 1OEDC 4O1PA 4G1TA 5LHGB 3PEUB 2WCAA 1FIOA 4AKHA 1HU3A 1E8WA 2EHOD 3QC1A 1V55E 4AM9A 2IDOB 1N54A 4U2YA 2HN1A 5L4HA 4AP2A 5HXRA 2H6IA 3PUJA 1UGOA 3U78A 2NWBA 5LCYA 2N2NA 4GZCA 4M1PA 5JHAA 2WXOA 5JJ6A 3RO2A 5TAOA 5G55A 4FA6A 3JXIA 4AQFC 2PBIA 3FUNA 5FY0A 1W0AA 2A5UA 2WXLA 1O5MA 5DBKA 2WY2A 1YXRA 3TLVA 3TJPA 4A1GA 3PUZF 3BG1B 3LS8A 2BS4A 4NUUA 2JJ9A 5FP3A 4CXWA 4BWRA 3CWZB 5AQIB 1LTXA 2X6HA 4JHJA 3TWVA 3LPZA 5HEJA 1S0PA 4LMKA 2VWAA 3T5XA 4UQXA 1SW6A 4DR4T 3CHOA 2RFAA 3Q47B 2UXBT 4MBQA 1MIVA 1HG2A 5KX5E 3OXLA 3EHQA 3AU5A 2WPVA 2WM9A 3FUIA 1MJ0A 4GKJT 2WDQA 1WDYA 3NWIA 3UUMA 3PUAA 3HI2A 3MJXA 2CHXA 4AKLA 4GB9A 5LNKA 3SNXA 4DMWA 1XZYA 3HKDE 4DV3T 3CHSA 2WXHA 5ABGA 2AXDS 1MNDA 3ABME 4RG9A 3ZHEB 3MX3A 5KWDA 2P9PG 1TN6A 1KNRA 2VURA 4UWHA 3UTMA 3APDA 3O4ZA 1TN8A 2RA1A 4JYAT 4UR9A 4UWFA 5H6QB 4ZZBA 1H6PA 2J1DG 3HHMA 1HTJF 3UQ4A 5M72A 4JA9A 3QB2A 2BTDA 2X6FA 5KBAA 3B7RL 5ABHA 3ULQA 3RRCA 3HXDA 2KINB 1SA4A 3ULEG 1TNZA 3ISMC 3R84B 4TWHA 2JEKA 4HWFA 3PNLB 4KZ0A 5KJLA 1SVXA 2IMLA 3SFEA 2XZTG 5KMGP 4Q69A 2UY1A 2WBLA 2DZOA 3ASNE 3HYMB 2QGSA 3CVXA 2CHWA 2YNQA 1ZOYA 2BG9E 4DIDB 4WWNA 2X38A 3Q9NC 3WI3A 1E90A 3E37A 3U4TA 3FEXA 4EXTA 4G2VA 4HLLA 5AQPB 5E76A 4ZI2C 4OK0A 2XASB 4L1BA 3UMVA 3ENEA 5M4YA 5J08A 3FTUA 5CRVA 3V31A 5BUZA 1SA0E 4L5GA 1QNFA 3EJNA 5FQ7A 1FCHA 1D1BA 2XQ9A 1TJFA 4U33A 1WLXA 3AEEA 4IDPA 1WCRA 4GKKT 4TV9E 5AENA 3SGHA 3UUBA 4GYWA 2M67A 3HL6A 2DBAA 4YFSA 2P9IG 4UEMA 3NB2A 4OYKA 4CN6A 3LK3B 3PTRB 5E0OA 3D9PA 4M3OA 2OEVA 4HI8A 4CDNA 2W62A 3UKUG 4I6GA 2NW8A 3LY7A 1KZPA 3C4XA 2EHOB 3IV0A 3AG4E 3NF1A 4KYOB 2I59A 5FL0A 4OHFA 2XZEA 4CI2B 4QH4A 3HVEB 4P0BA 4ISSA 1OCZE 3ASOE 3DSVA 4WAFA 1FEWA 3KSLA 3AECA 4GU5A 5KJMA 5AJDA 2W66A 5L47A 3TWUA 3VKHA 4AQGA 1HS6A 3C51A 3KAEA 3SI5A 4KI0F 2LHRA 5LOZA 3GW4A 4GCNA 4X62T 2XAJB 3AG1E 4YHJA 2JQQA 3CVRA 4UV9B 4AVXA 4OFZA 4I1AA 5BNWA 4HB5A 4WW0A 3C4ZA 5LG3A 3ASFA 3RSEG 4J2CA 2BG9C 3HXCA 3RRNB 2XSAA 5C8YE 3AS4A 5T4YA 2DNXA 3AEDA 3RYHE 4U8HA 4WBOA 3CSTA 1ZU2A 4N5QA 4AXHA 4PS8A 4GTTA 5A23A 3QUJA 1KEYA 4DNDA 3UM2A 5AQKB 2Z6EA 1XWMA 3PJAA 4ZOLE 5T8IA 2F37A 4GMJA 1OWAA 1Z0PA 2D0TA 3UFEA 3FUMA 5JDLA 3LK2B 3RC3A 2KCLA 5BXOA 3S7BA 3ZVVA 3ML8A 4WZXA 2IQCA 4H9QC 2Y4TA 3FZMB 2CG2A 4DX7D 4OVUA 4EQFA 3BU8A 3I1AA 2ZISA 4U31A 5DIZA 5L3FB 2R59A 4JLEA 5BT1A 4UXNB 2XENA 1JCQA 2P9KG 3MZLB 2M6IA 3O1HA 4RVBA 4NUVA 3PUWF 3VLFA 3FTZA 1T98A 3D9OA 3FDHA 3ZCIA 3L09A 4N2QA 1QQEA 3RK6A 1TYQG 1KPSB 4HFCA 1HNZT 3FP3A 1OEDA 2VL8A 2MHKA 3NBXX 3HG0D 5JDMA 3ONLA 3RC8A 5ENTD 2RP4A 1EDUA 4WBNE 2WDVA 5JDHA 4AV7A 3G2SA 3ZKJA 3RQWA 3MEKA 4DBRA 2R03A 4YSXA 3L9TA 3RAUA 4J8YA 3RKVA 2ZIRA 4KBMB 4H9PC 2XZDG 3ZMTB 3RPUA 4JUYA 3Q49B 4EV6A 1FMVA 4JI8T 2J4BA 2XAHB 4IIJE 5JRCB 2QA7A 3S7FA 3UU5A 5JVDE 3O9XA 4KVOA 2AXZA 1LKXA 2QYWA 3BK9A 3Q5MA 4LG6A 4HE8A 1N52A 3KV9A 4WYVA 3SF4A 5AQMB 2J07A 5EKQD 2WXKA 4TUUA 1NENA 2IIUA 1WR6A 4V1Av 3UX4A 2X9HA 2JQHA 3PDYA 4GIWA 5GONE 3X1DA 3ZCJA 2PFVA 1N32T 3FUJA 5JMND 3LFMA 2DWZA 3ZHEA 4MALA 4I1MA 5HXCA 3CIRA 2DHRA 4BY6A 4TV8E 5CEAA 5IUXA 3G2WA 4UQZA 3GZ1A 3ONLC 3S7DA 5AQUB 4LF5T 4NACA 4JBWF 4GZDA 2ETBA 2LO6A 3RLFF 2KZTA 2DCFA 3LEWA 4IDOA 3JC6C 1TR4A 3FU3A 3CVYA 3FZFB 5CB4E 3VTXA 1SHZC 3UU6A 4FJYA 4QX7B 2WXFA 2HR2A 4N3CA 1NP7A 4JPSA 2V8SV 2UUAT 3QWPA 3UUNA 1MX6A 2X6KA 2IEJA 2FO7A 3UINC 3DSTA 3UT4A 5A7DB 3Q79A 4B8CB 2UY1B 4YVOA 2IUBA 1XMQT 1OWMA 2I1KA 4IDZA 3PUSA 1X81A 3M3ZB 1MMDA 1TJCA 3N9PA 4F1SA 1XNFA 2RG8A 4OX9T 3TKLB 1PY1A 1DC2A 3R7QA 3NOCD 3CEQA 2H6GA 4EPZA 3AXJA 3QWVA 2D2SA 1IJ5A 3U64A 3EDUA 4GA1A 4GTRA 3MGBA 4TN7B 4MKTA 4U8VD 5KJKA 1V54E 1BR0A 3ZPJA 4CXYA 2ZGGA 2H6HA 4CYMD 3ZEFB 4ILCA 5ARFA 1S63A 4JI6T 4PJJA 3ZT7A 3RU0A 3V79K 4AJWA 3Q4AB 3IHYA 1D0ZA 3CHPA 2L0IA 3KVBA 1XDPA 4IL9A 1YYHA 5FZQA 3SY2A 5CEDB 2LT3A 3D9HA 3CKDA 1NWMX 4JI1T 3APFA 5FWQA 1S64A 2IC6A 3L82A 1I94T 3PNTB 5LGNB 5AQFB 3E0ZA 4LF8T 3FTVA 2FF4A 4OAUC 2PQNA 3SFXA 3ANWA 2V7MA 2DL1A 4GMLA 4CN4A 2L3LA 4JI0T 3PUGA 2XQ4A 4UV8B 5CGMA 5JDGA 2JMKA 5JR9A 5FZSA 4U0ZA 3AA7B 4AXPA 4PS3A 4WNKA 2VKJA 5FT9A 1HR0T 3QNUA 2UXCT 3EUVA 4BTAA 3OYZA 3PJAJ 3RX6A 4GA2A 2C5KT 4ZHBA 2J9QA 3PE3A 4NIQA 5EK3A 4U8YD 1XNQT 2GRPB 3HXBA 3AA0B 2XQAA 2XPYA 3FWVA 1Q2ZA 4G2AA 1ZEEA 3VR8A 3DXMG 4LMJA 2RKKA 2NXPA 3DPDA 4HOUA 4IE5A 3UM1A 4PJLA 3FH7A 5LXTE 1RZ4A 1SE7A 5HWYA 1AP7A 3OPCA 3SS1A 3E32A 3HVEA 4GA0A 5HKPA 2CWOA 1FMWA 4TV3A 1D0XA 3C98A 4X65T 4I9EA 1YQ4A 3CVQA 2BS3A 4JVSA 3CMLA 3FTSA 2C0SA 4BT9A 5ABFB 3ZRHA 2BVMA 3LJCA 5HAXA 4HNAD 4A3TA 5ITZF 3Q73A 5D0OD 3FHNA 3G06A 3NVOA 3N9OA 5B1AE 3NRXA 2GRMA 1DNPA 3ZXSA 3U3IA 2DI4A 4U2ZA 4YTNA 4NXNT 3JC6D 3D9NA 2V6XA 1NEKA 3NBNB 5JJTA 1A5EA 4HFGA 3PE4A 2DCPA 4NPPA 4W9RA 4ATZD 4FC8A 1UN8A 2K24A 3KEAA 4H9SE 4HFDA 5IY5E 1QSDA 3MKDA 3O1IA 2IJGX 3SD5A 4GZ3A 5ABFA 4IREA 2JLBA 4JEUA 3TLSA 1HX1B 3EI0A 4COFA 3CQGB 2IOLA 2CEAA 2R5SA 1H6KA 5AN8A 4DV0T 2WSSV 5J2UE 2LXMA 2LAIA 3GZ2A 2JABA 3FZKB 2UUBT 1BD8A 3UKRG 1ZB1A 1WR0A 2EILE 5FVKA 5AAOA 4ILAA 2ZM8A 4DUZT 4IDQA 5CA0E 3K3NA 4I6JA 2BZBA 1TN7A 5JHBA 3FU6A 5CMYA 3JCFA 3ZT6A 4HOTA 5EZYE 5KNGA 2R17C 3HIZA 2BBJA 4DRXE 3UUXA 2ZM0A 5HCMA 1UK5A 4ZS3A 4LSZE 3ABVA 3BQOA 3N2OA 3C5RA 4JEUB 1BI7B 1TNUA 2FJDA 2LSGA 1J5WA 2Q7FA 3EU5A 3IF8B 1P5QA 3AAAB 3ZMSB 2HYZA 1U3CA 2WXRA 4ACKA 4BETA 5FQ4A 3TG4A 3AE5A 1HXIA 3TLUA 4LERA 4X8QA 5AQ9A 4KZCA 3P4WA 2H89A 1D1AA 3ZMVB 3URZA 5H7PA 2PQRA 4U0UA 3CQCB 3QARA 2XSBA 2AJAA 4CGWA 5JTGA 3KBTA 4BERA 4Z8XA 5CRUA 4PFPA 1MX4A 3I4RB 4TXRA 1DU2A 4H7YA 3ZMZB 2KC7A 1OXJA 5HYAA 3KEZA 3QOUA 2E2AA 4IE4A 2A4ZA 3IBPA 4JXTA 1NZNA 2IW5B 3T9KA 4O4JE 3F57A 2PTFA 4QXHB 5CCMA 3Q78A 2WB5A 2XGSA 2LM9A 4DLOA 2PM7A 2LOPA 2JQKA 3ML9A 3FTWA 3N5LA 2WAUA 3E4BA 4XKBA 3DSSA 1BU9A 2LKHA 2BKNA 2WWVA 2C0LA 3FY4A 2J09A 2V7IA 4N39A 3AS8A 3O4XE 4EOZB 2LSUA 4XI9A 3EIJA 3ESKA 3PZ3A 2CMRA 4PAGA 2E9XC 3ULYA 1GW6A 2NYJA 3QJZA 2AXUA 1N11A 3MZKB 3IKOB 4K5BA 2KNDA 4WWPA 4GTPA 4UELA 1AWCB 2W0GA 1KLXA 3CIAA 3SFZA 2R6GF 5AQLB 3K3OA 1JUQA 4DUIA 4BFRA 2R05A 5EYLA 4F53A 5HXSA 5LBQB 4J8EA 3R7RA 4PUCA 3RRUA 4KHPT 5FJYA 2QRXA 4JEHB 5C2TA 5CBOA 1NL4A 4UVAB 3E33A 3FUEA 4YSYA 2C5JA 2P58C 3C4WA 2X9WA 2YINA 4J8FA 2V26A 4EEBA 5JJ7A 3F2EA 4AY5A 1KT1A 3FH5A 4U3CA 3C72A 3P50A 5L3CB 4GK0E 4O60A 5FXWA 2LNIA 5AQVB 1KZOA 1UG3A 3ZN3A 3P4PA 2UWJG 3FB2A 1N9AA 2XGOA 3L8RA 2XPKA 4O2BE 4LMLA 3WAKA 2M63A 2KT9A 2KCKA 3C3RA 4HKAA 3N2KE 3PS6A 4I43B 3B7TA 2WZIA 4ILHB 4FJOA 2GRRB 2R2LA 3CKCA 1LF8A 1Y64B 1XMOT 1BR4A 1DCQA 1N4QA 2CFZA 4ZI2D 4C91A 3B95A 3LY8A 3MKRA 4ZFHA 5KJNA 4H63V 4HFVA 2GRQB 3RO3A 4IT4A 3HA4A 3I9WA 3SFYA 1BLXB 3UTKA 2QYJA 3FTYA 5HXHA 5KNHD 4EBAG 4YDEA 2CBIA 2WXNA 4JV5T 4QX8B 2V1DB 3OXGA 4G25A 3SRZA 4UWKA 2I1JA 4CI3B 3UIOC 2CBJA 1KF6A 5ENOD 5C2YA 2X3MA 2A9UA 2AXVA 3Q5WA 4TNVA 4JD2G 2WXQA 4HFHA 2WZHA 4IRUA 4M7CA 2WXIA 4ANWA 2LHNA 3OXFA 3ZXPA 3MKQA 3ZEFA 2B76A 1Z3YA 3HDXA 2VK9A 2VSOE 3L13A 5H6RB 1NAFA 2BVLA 4CGVA 2UU9T 4DV1T
chains in the Genus database with same CATH topology
5AFUL 2DIWA 4OYSA 2XRZA 4ADZA 3Q9DA 2W61A 3E22E 2CXLA 3ASDA 4DLQA 2OOEA 3CVLA 2LJLA 1ELWA 4IE6A 2LEHA 2DLRA 1VOMA 1ZKEA 2WWUA 4YLHA 4QXBB 4GPKA 2XHEB 5FXZA 4HGAA 3C64A 4EAHA 3IEEA 1B89A 5JDNA 1S94A 4L0RA 2IAKA 2G0UA 5BMVE 4IYPA 3SHFA 4L2YA 2A3DA 4DO0A 1G8XA 5FNVE 3RYCE 4AKRB 3PURA 4XX5A 4K03A 2KATA 4ABNA 1LVKA 2C2LA 5JDQA 3RKOA 3MK7C 2AW6A 2VGYA 2XCBA 5FZRA 2I6HA 4E7SA 3BG0B 5F3JA 5E75A 4MHCA 2NC9A 4PFOA 3ZMUB 4F7AA 3LVQE 3H37A 4JL0A 2CXDA 2E9XB 3EVYA 2CHZA 4JZYA 4AEZC 3LG7A 3LYAA 4U63A 2MOZA 5JDFA 4QKNA 1ZV4X 2XTLA 2NOXA 2IU1A 3GA8A 3NQPA 4PK5A 2A2FX 3Q5XA 3L17A 5LX8A 2L9QA 4YJ3E 4WNFA 3OKQA 1JPLA 2X67A 3LK42 4ZI3D 4XIFA 2XAGB 5LP0A 2V4LA 3OAWA 3R9AB 4I1OB 1IZNB 4FADA 3GMIA 4J6IA 4O6FA 4AOFA 2PL2A 2VB6A 3IEGA 5D0QD 2KWIB 3D3MA 4UVCB 2XEVA 3CV0A 5BV0A 1E8XA 2CM0A 3CVWA 3ZPOA 4TRQA 1MQSA 2EQXA 3CGHA 3I3NA 4CRWA 4I6EA 3D9MA 2CWYA 3AA1B 4E7ZA 2L0TB 2FEZA 4ANUA 2I9CA 4WNGA 4U04A 3L3PA 4BAYB 2DWKA 4XAXB 4O4IE 2VQ2A 2E9XA 4Q96A 2LSKA 2X6JA 3JQ1A 3G2UA 4XZCA 3NZQA 3EDTB 1DVPA 1LVFA 4BTBA 2NW9A 2LSJA 3P2BA 2GK9A 2E0IA 4EZLA 2YU1A 3ETUA 2HPJA 2NTYA 1E8ZA 3KV6A 4CI1B 3VLDA 3LBXA 3MXZA 5JQGE 4DPRA 1KK7A 3OYXA 2H3RA 4I2ZA 3PEVB 3SBSA 3SBTB 3L22A 1EYHA 2WB2A 1E1HB 3DTOA 3PRZA 3W15B 4EECA 3FEYA 5LGUB 4H63H 2YQ8A 4X1KE 5AIJA 3S7JA 5CHEE 4DMVA 3PU8A 2ZM2A 4CZZB 2WMOA 1ZBPA 2EHOA 2FULA 1OWNA 3QWWA 1IYGA 1OWOA 2KMFA 1OWLA 4FHJA 3N9LA 2KZTB 3SWHA 4CCAA 4JA7A 3APCA 1KT0A 4K0UA 4BX9A 3CVUA 2LSVA 2Y6XA 2WXPA 3MV3B 5LBMA 3ZYQA 2XQ0A 3QNKA 3UQ3A 2XPIA 4UWLA 1PAQA 2SPCA 2B1EA 1B7TA 3AVSA 4MS6A 3UT7A 4HN9A 2HO1A 4B0ZA 3UUXB 4IULA 1YD8G 4EZJA 2ZMAA 2VKHA 1US7B 4NURA 3BQKA 3FBZA 3L54A 1H2VC 5LCWJ 2Q9QA 2X68A 4URKA 1HCIA 2VGXA 4A55A 4CDMA 2KCVA 5DQWA 3WXXA 3J9X1 3RYIE 4NQ0A 5EX3A 3OBVE 4Q94A 2X9YA 3FU5A 3D9KA 3RRWA 3V5SA 4FJZA 2J08A 3F31A 2KM4A 4UI9J 1EPUA 5EDSA 3ZFWA 3QK0A 2DWGA 4D10C 3MA9A 1U3DA 3ZYLA 4EYYR 4RG6A 2J4DA 4QHOA 3TGOA 3K9IA 2K5BB 3D0TA 1NA3A 3JYSA 2PM6A 3I0QA 4U74A 2FI7A 3C98B 4ATGA 4MLKA 2HM8A 2D5UA 3O1JA 2JPFA 2Q9QC 2VKOA 1OXZA 5JRCA 3B7SA 1IQUA 3MYVA 5LHHB 2VSYA 2WVIA 4FU3A 5JR9C 2GGFA 5LJNA 3EHMA 5L3GB 3EDVA 2Y3AA 5G05J 2IC9A 1KNZA 2IOSA 3BQLA 4APFA 2QFCA 1HE8A 3IHRA 3T8MA 1YKHB 1HH8A 4JW1A 4JHRA 2MRIA 4CT0A 3P8CD 2ZU6B 3WAJA 1BR2A 2ES0A 4ILUA 2WXJA 2WXGA 3ZIMA 3FXDB 5HI7A 3U3WA 1VDYA 5JH7E 2HPLA 3FHEA 2K9AA 3D9LA 4HLEA 3AA6B 2EHOC 4AKIA 4GYOA 3A5XA 4H9NC 1UJKA 3CK9A 3KDSE 3CPZA 3RH3A 2BUGA 4GAAA 3EHNA 3GWHA 2Y8DA 2BDEA 2YU2A 3CLJA 5T3RA 2VASA 1TEZA 3GN5A 4XI0A 4EZHA 3G2VA 3CK8A 4AQFA 5C1DA 1SZ9A 3MKQB 4WNDA 2WXMA 3MJWA 2MTQA 2C5IT 1H2UA 1Y6IA 3FUFA 3ESLA 4LUNU 4APOA 2NTXA 3UT8A 3CQXC 1JWFA 4I17A 3LDZA 5LOVE 2WQHA 4X20E 3AB3B 3N9NA 4EB6E 4TZ4C 3KV4A 1IJ6A 2N1GA 4BA9A 2XRYA 5FY1A 5L2LA 4KBQA 5KCMA 3QAQA 3CKBA 3NRYA 4L9IA 4I4TE 4PK6A 3L6AA 1S35A 4PH4B 3EUHA 4L23A 2PG8A 2MYSA 4YJ2E 2VSNA 3ZN0B 1E8YA 2JRKA 5A1LA 3LKUA 4U07A 4H7XA 5HXEA 2CE7A 3FTXA 4ZS2A 4FULA 4HVBA 5J90A 2IF4A 5CCLA 3AS5A 1V9DA 3AAIA 4PK4A 2LE8A 4A56A 4XE0A 4AI6A 4IHJE 3CHRA 4X1IE 3Q15A 3E08A 1D0YA 4UI9K 5DJQC 2HH7A 2UXNB 1SQMA 1X5BA 5ANRA 4U72A 3ZYKA 4E85A 3HKEE 4GK5E 2Y4UA 3IHVA 1AJ3A 5CA1E 4EIWA 1MMAA 1X79A 2WQ6A 2H7VC 2OVBA 2E2EA 5EK4A 3CSFA 4I50E 3P7IA 4Y6CA 1MIWA 1VRBA 5ANLA 1UX5A 4P0AA 1U4QA 3PVLA 3U66A 3CHQA 5G04C 3K8PC 3ZW3A 4BT8A 3R6NA 2K48A 3CVVA 3FU0A 2X6IA 3DBSA 4F6RC 1H0AA 5FQ6A 3D9IA 3JUIA 4P09A 1ZHCA 5JR9B 2L9BA 4WWOA 3B7UX 2BF0X 2XUEA 2YK0A 5HQ8A 5F8PA 4AY6A 3CX6B 3B57A 4YVQC 2NP9A 4HXIA 3PUQA 1YKEB 4AKGA 3L16A 3I0OA 4ANVA 1LRZA 3S2AA 4HOSA 5ETWA 3PREA 3CVNA 1H2TC 3G2TA 4LCTA 4PNIA 2PZIA 4CEMA 4IN3B 2AVPA 3ZYMA 4YNDA 3PUKA 4I2WA 2ODUA 3FUKA 3LCAA 4AIFA 4O4HE 3N9MA 3ONXA 2LSIA 2CFUA 4ZI7E 4CXXA 3TXNA 2V8SE 2QY7A 2VGXB 4G63A 5FQ8A 2LAHA 5DQVA 4B6XA 5KDMC 4FP7A 4I43A 1WY6A 3RYFE 3U9WA 2XCCA 4JHKA 1YA0A 3MA5A 3HR0A 2C0MA 3I9YA 3SOLA 1MIYA 3Q2MA 4J8SA 3FXEB 3V5UA 4GZ5A 3AVRA 1IHGA 4BJMA 4GCOA 4MRUA 3KV5A 3UULA 3T8OA 4TX5A 2W00A 1HS7A 4U0SA 1HG5A 1W3BA 4OVVA 2WQ7A 3P1UA 4KXKB 4L7TA 2OVFA 3J7Yq 4ERRA 1UW4B 2P9BA 1MNEA 4BSXA 3I5PA 4A1SA 4LEUA 3VHLA 3VU7H 4HOQA 4ANXA 2X51A 2Q9QB 2WMNA 4EYUA 1HFAA 2ZLYA 4XZ4A 3BQIA 2ILRA 5L3BB 4EZ4A 5LP6E 4QXCB 4ILGA 4XKCA 3T5VA 1CUNA 2E8IA 3LBXB 4IE7A 3OTNA 1WAO1 3QK6A 4N2SA 2FBNA 5L3DB 1INZA 4E6HA 5EX0A 3ASGA 2PJQA 3I4GA 3CX7B 3ZJ1A 3MCXA 5A6CA 3GYZA 2UXXB 4IE0A 4GOUA 4QFVA 4HTEA 3TAXA 1QUUA 3PU3A 5IYZE 1JWGA 3N9QA 4GYYA 3QKYA 1EZ3A 4DI4A 1Z6TA 5FXVA 1WRDA 4KMOA 4XBFB 3FFLA 2YEVC 2GRLA 4DK5A 2CA5A 4TUYE 4G11A 1EF1C 2VKDA 3KBUA 4QWNB 3UT5E 3SZ7A 5FXXA 5LG4A 2E9XD 4I9CA 4ISTA 1G73A 1ELRA 4UF0B 2VTBA 1WYCA 4DJAA 3RJVA 2W63A 5G2NA 1UX4A 5J1GA 4KMCA 3KS2A 3CK7A 3H3AA 2KXPB 3EIQC 4ACLA 3HKCE 2ONDA 1MMGA 4PJMA 2CXFA 4J8DA 4PJNA 4WNEA 4FI5A 1NA0A 3B13A 4RSYA 3ANWB 5AJLA 3NZUA 2Y48B 2XAFB 4C0EA 4UF0A 2VTBB 4H9RC 4ME2A 4FLHA 1E7UA 4G26A 2IONA 2RD0A 3PDNA 2V0PA 1FVFA 3LVRE 5FTPA 5FY7A 1OUVA 4WUYA 4GZ6A 5ENNA 2VJ8A 4DI3A 2LOSA 2L6JA 3ZN1B 4UVBB 3C50A 4A3VA 1HO8A 4C0MA 4CQIA 3KD7A 3NZSA 2XHEA 4K0RA 1BR1A 4N5CA 2L8KA 4GYSA 4I55E 2V5FA 4KUMB 5ADXL 1UN9A 2AWIA 3K3QC 4G23A 3PE0A 1D1CA 2OA5A 2H7OA 3LJ3A 4PW8A 2X9XA 1UJJA 2N9DA 2I2OA 2J49A 5LA6E 2X66A 3PH0C 3KINB 4EZKA 3TG5A 3ASHA 2GW1A 3D9JA 4BX8A 4N3AA 3CR3A 4ZI3C 3ZC0A 3AU4A 5BW8C 3CVPA 3MV2B 1YW0A 2XAQB 4F3VA 3ZLIA 3FH8A 3JCKC 4FHKA 1A17A 4B89A 4KP3C 2KZ7B 1Z3XA 2VYIA 2XGMA 5AYWD 3CX8B 2YHEA 4NRHB 1QZ2A 1O3XA 4G24A 3ETVA 2D0UA 2XQYA 3RIBA 3TL5A 1PC2A 1ELKA 2KLQA 4IGUA 4V3IA 4JEHA 1E96B 1SZAA 3S4UA 3RRMB 3ONKA 2MOWA 1L5JA 5EK2A 3JQ0A 4UQYA 4O2AE 4UIGA 2A72A 1MHQA 3ZC1A 3TXMA 2V7KA 1H19A 1XGWA 4J0UA 1IQRA 3MACA 4N78D 4DBQA 3QC9A 4EBAA 5CMWA 4O8SA 3UPVA 4CDRA 4DVDA 5BPPA 4CT4A 1MMNA 5DABA 2YHCA 5J2TE 1BPOA 5G05C 1U5PA 5LGTB 3FUDA 3LXUX 1HX8A 3ZGQA 3ZJ2A 2Q9QD 4B8AA 3DP7A 4UI9C 2NSZA 3GN5B 3BEEA 4KT6B 4PDXA 3KFWX 5IHYA 3GZSA 4B94A 2CCQA 3NZPA 2IFUA 3N71A 3VTYA 2V7LA 3N2GE 1WYBA 2VSXE 3LY9A 3FUHA 5LYJE 4LRZA 3FULA 2ACXA 1IAPA 2CG3A 4P29A 2CLYC 3DJBA 4ILIA 5BV1A 1OWPA 4MFRA 4UWGA 3M65A 1E7VA 4C9BB 5ARGA 2ODVA 3QDNA 5LFAA 3L08A 1WM5A 1HF8A 5LJMA 4X1YE 4ASKA 4HS2A 4L2LA 4MLPA 4HEAA 5JREA 1UCUA 4JC8A 5FYMA 1FVHA 4PS7A 4GYRA 4HORA 5LHIB 4O4LE 1HZ4A 5FMNA 4R7LA 2KWHA 2OV8A 4BJNA 3VKGA 5HWXA 2JMHA 1Y8MA 4FLBA 4ZHQE 2MBGA 4ANJA 3CHMA 3HKBE 4C90A 3IBEA 1H7CA 2NW7A 3AAEB 3FBLA 2CLYB 2XPZA 3PZDA 4KVMA 3O48A 4N3BA 4H9OC 3VLEA 4Y6WA 3KVAA 3OJAA 2LSYA 5LCWC 5G04J 5L3EB 4OYJA 2X0LB 2V7JA 4G1TA 5LHGB 3PEUB 1FIOA 4AKHA 1HU3A 1E8WA 2EHOD 3QC1A 4AM9A 1N54A 4AP2A 5HXRA 3PUJA 3U78A 2NWBA 5LCYA 2N2NA 4GZCA 4M1PA 5JHAA 2WXOA 5JJ6A 3RO2A 5TAOA 5G55A 4FA6A 4AQFC 2PBIA 3FUNA 5FY0A 2A5UA 2WXLA 5DBKA 3TJPA 4A1GA 3BG1B 3LS8A 4NUUA 2JJ9A 5FP3A 4CXWA 4BWRA 3CWZB 2X6HA 4JHJA 3LPZA 1S0PA 2VWAA 3T5XA 4UQXA 3CHOA 3Q47B 4MBQA 1MIVA 1HG2A 5KX5E 3OXLA 3AU5A 2WPVA 2WM9A 3FUIA 3UUMA 3PUAA 3HI2A 3MJXA 2CHXA 4AKLA 4GB9A 5LNKA 3SNXA 3HKDE 4DMWA 3CHSA 2WXHA 1MNDA 4RG9A 3ZHEB 3MX3A 4UWHA 3APDA 3O4ZA 2RA1A 4UWFA 5H6QB 2J1DG 3HHMA 1HTJF 5M72A 4JA9A 3QB2A 2BTDA 2X6FA 3B7RL 3ULQA 3RRCA 2KINB 3R84B 2JEKA 3PNLB 4KZ0A 5KJLA 5KMGP 4Q69A 3HYMB 2UY1A 2WBLA 2QGSA 3CVXA 2CHWA 2YNQA 4WWNA 2X38A 3WI3A 1E90A 3U4TA 3FEXA 4EXTA 4G2VA 5E76A 4ZI2C 4OK0A 2XASB 4L1BA 3UMVA 3ENEA 5M4YA 5J08A 3FTUA 5BUZA 1SA0E 4L5GA 1QNFA 3EJNA 5FQ7A 1FCHA 1D1BA 1TJFA 1WLXA 4TV9E 5AENA 3SGHA 4GYWA 2M67A 3HL6A 2DBAA 4YFSA 4UEMA 4OYKA 3LK3B 3PTRB 5E0OA 3D9PA 4M3OA 4CDNA 2W62A 4I6GA 2NW8A 3LY7A 3C4XA 2EHOB 3IV0A 3NF1A 4KYOB 2I59A 4OHFA 4CI2B 3HVEB 4P0BA 4ISSA 4WAFA 1FEWA 4GU5A 5KJMA 5AJDA 3VKHA 4AQGA 1HS6A 3C51A 3KAEA 3SI5A 2LHRA 5LOZA 3GW4A 4GCNA 2XAJB 4YHJA 2JQQA 3CVRA 4UV9B 4AVXA 4OFZA 4I1AA 5BNWA 4WW0A 3C4ZA 3ASFA 4J2CA 3RRNB 5T4YA 5C8YE 3AS4A 2DNXA 3RYHE 4U8HA 4WBOA 3CSTA 1ZU2A 4AXHA 4PS8A 5A23A 3QUJA 4DNDA 2Z6EA 4ZOLE 5T8IA 4GMJA 1OWAA 1Z0PA 3FUMA 2D0TA 3UFEA 5JDLA 3LK2B 3RC3A 2KCLA 3S7BA 3ZVVA 3ML8A 2IQCA 4H9QC 2Y4TA 2CG2A 4OVUA 4EQFA 3I1AA 5DIZA 5L3FB 2R59A 4JLEA 5BT1A 4UXNB 3MZLB 3O1HA 4RVBA 4NUVA 3VLFA 3FTZA 1T98A 3D9OA 3FDHA 3ZCIA 3L09A 4N2QA 1QQEA 3RK6A 3FP3A 2VL8A 2MHKA 3NBXX 5JDMA 3ONLA 3RC8A 2RP4A 1EDUA 4WBNE 5JDHA 4AV7A 3G2SA 3MEKA 4DBRA 3RKVA 4KBMB 4H9PC 3ZMTB 3RPUA 4JUYA 3Q49B 1FMVA 2J4BA 2XAHB 4IIJE 5JRCB 2QA7A 3S7FA 5JVDE 3O9XA 4KVOA 2AXZA 1LKXA 3BK9A 3Q5MA 4HE8A 1N52A 3KV9A 3SF4A 2J07A 5EKQD 2WXKA 4TUUA 4V1Av 3UX4A 1WR6A 2X9HA 4GIWA 3PDYA 5GONE 3ZCJA 2PFVA 3FUJA 3ZHEA 3LFMA 4MALA 4I1MA 5HXCA 2DHRA 4BY6A 4TV8E 3G2WA 4UQZA 3GZ1A 3S7DA 4NACA 4GZDA 2LO6A 2KZTA 2DCFA 3LEWA 3JC6C 3FU3A 3CVYA 5CB4E 3VTXA 1SHZC 4FJYA 4QX7B 2WXFA 2HR2A 4N3CA 1NP7A 4JPSA 3QWPA 3UUNA 2X6KA 2FO7A 3UT4A 5A7DB 4B8CB 2UY1B 4YVOA 1OWMA 2I1KA 4IDZA 3PUSA 1MMDA 1TJCA 3N9PA 4F1SA 1XNFA 2RG8A 3TKLB 1PY1A 3R7QA 3CEQA 4EPZA 3QWVA 2D2SA 1IJ5A 3U64A 3EDUA 4GA1A 3MGBA 4TN7B 4MKTA 5KJKA 1BR0A 3ZPJA 4CXYA 3ZEFB 5ARFA 4PJJA 3RU0A 4AJWA 3Q4AB 3IHYA 1D0ZA 3CHPA 2L0IA 3KVBA 5FZQA 2LT3A 3CKDA 1NWMX 3APFA 5FWQA 2IC6A 3PNTB 5LGNB 3E0ZA 3FTVA 2FF4A 2PQNA 3ANWA 2V7MA 4GMLA 2L3LA 3PUGA 4UV8B 5JDGA 2JMKA 5JR9A 5FZSA 4U0ZA 3AA7B 4AXPA 4PS3A 4WNKA 2VKJA 5FT9A 4BTAA 3OYZA 3RX6A 4GA2A 2C5KT 2J9QA 3PE3A 5EK3A 3AA0B 2XPYA 3FWVA 4G2AA 1ZEEA 4HOUA 2NXPA 3DPDA 4IE5A 4PJLA 3FH7A 5LXTE 5HWYA 4GA0A 3SS1A 3HVEA 2CWOA 1FMWA 4TV3A 1D0XA 3C98A 4I9EA 3CVQA 4JVSA 3CMLA 3FTSA 2C0SA 4BT9A 3ZRHA 2BVMA 3LJCA 5HAXA 4A3TA 5D0OD 3FHNA 3N9OA 3NRXA 2GRMA 1DNPA 3ZXSA 3U3IA 2DI4A 3JC6D 3D9NA 5JJTA 4HFGA 3PE4A 2DCPA 4W9RA 4FC8A 1UN8A 2K24A 4H9SE 1QSDA 3MKDA 3O1IA 2IJGX 3SD5A 4GZ3A 2JLBA 4JEUA 3CQGB 2IOLA 2R5SA 2CEAA 1H6KA 2WSSV 5J2UE 2LAIA 3GZ2A 2ZM8A 5CA0E 3K3NA 4I6JA 2BZBA 5JHBA 3FU6A 5CMYA 4HOTA 5EZYE 2R17C 3HIZA 3UUXA 2ZM0A 4ZS3A 3N2OA 4JEUB 2LSGA 2Q7FA 3IF8B 1P5QA 3AAAB 3ZMSB 2HYZA 1U3CA 2WXRA 4ACKA 5FQ4A 3TG4A 1HXIA 4LERA 4KZCA 1D1AA 3ZMVB 3URZA 2PQRA 4U0UA 3CQCB 3QARA 4CGWA 3KBTA 4Z8XA 4PFPA 3I4RB 4H7YA 3ZMZB 2KC7A 3KEZA 5HYAA 3QOUA 4IE4A 2A4ZA 3IBPA 4JXTA 1NZNA 2IW5B 4O4JE 3F57A 4QXHB 5CCMA 2XGSA 2LM9A 4DLOA 2PM7A 2LOPA 3ML9A 3FTWA 3N5LA 2WAUA 3E4BA 4XKBA 2C0LA 3FY4A 2J09A 2V7IA 4N39A 3AS8A 3O4XE 4EOZB 2LSUA 4XI9A 3EIJA 3ESKA 2CMRA 4PAGA 2E9XC 1GW6A 3QJZA 2AXUA 3IKOB 3MZKB 2KNDA 4WWPA 4UELA 2W0GA 1KLXA 3CIAA 3SFZA 1JUQA 3K3OA 4BFRA 4F53A 5HXSA 5LBQB 4J8EA 3R7RA 4PUCA 3RRUA 5FJYA 4JEHB 4UVAB 3FUEA 2P58C 2C5JA 3C4WA 2X9WA 2YINA 4J8FA 2V26A 5JJ7A 3F2EA 4AY5A 1KT1A 3FH5A 5L3CB 4GK0E 5FXWA 2LNIA 1UG3A 3ZN3A 2UWJG 3FB2A 2XGOA 4O2BE 3WAKA 2M63A 2KT9A 2KCKA 4HKAA 3N2KE 3PS6A 4I43B 3B7TA 4ILHB 4FJOA 3CKCA 1LF8A 1Y64B 1BR4A 2CFZA 4ZI2D 4C91A 3LY8A 3MKRA 5KJNA 4H63V 4HFVA 3RO3A 3HA4A 3I9WA 3UTKA 3FTYA 5HXHA 4EBAG 2WXNA 4QX8B 2V1DB 3OXGA 4G25A 3SRZA 4UWKA 2I1JA 4CI3B 5C2YA 2X3MA 2AXVA 3Q5WA 2WXQA 4IRUA 2WXIA 4ANWA 2LHNA 3OXFA 3MKQA 3ZEFA 3HDXA 1Z3YA 2VK9A 2VSOE 3L13A 5H6RB 1NAFA 2BVLA 4CGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B13 A;  2YIN A;  2WMN A;  2WM9 A;  2WMO A;  3VHL A; 
#chains in the Genus database with same CATH topology
 5AFU L;  1HNX T;  3ZNG A;  2DIW A;  4OYS A;  2XRZ A;  2FO1 E;  4ADZ A;  4LFC T;  3Q9D A;  2W61 A;  3E22 E;  3PZ4 A;  4Z91 A;  2CXL A;  3ASD A;  4DLQ A;  2OOE A;  2E5L T;  3CVL A;  1OED B;  2LJL A;  1ELW A;  2OCC E;  4IE6 A;  1TNO A;  2LEH A;  2DLR A;  2XQ5 A;  2ETC A;  1VOM A;  1ZKE A;  2WWU A;  4YLH A;  1OCO E;  1D9S A;  4QXB B;  1KFY A;  4GPK A;  4BES A;  2XHE B;  5FXZ A;  5D2M C;  4YDY A;  1GQE A;  1UOH A;  4Z68 A;  4HGA A;  2V4H C;  3C64 A;  4EAH A;  3IEE A;  1B89 A;  3B5M A;  4LF7 T;  5JDN A;  1S94 A;  3UM0 A;  4L0R A;  1IHB A;  2IAK A;  2G0U A;  2CPT A;  5BMV E;  1LD8 A;  4IYP A;  3SHF A;  4L2Y A;  2A3D A;  4DO0 A;  1G8X A;  5FNV E;  1WG0 A;  3RYC E;  4AKR B;  1MZC A;  2H6F A;  5AQB A;  3PUR A;  4HWC A;  4XX5 A;  2XEE A;  4K03 A;  1N4R A;  3TWW A;  1TNY A;  2F8X K;  2KAT A;  1NI1 A;  4ABN A;  1LVK A;  2C2L A;  4GTO A;  3LSV A;  2W2U A;  5JDQ A;  3ZT5 A;  3RKO A;  3MK7 C;  2AW6 A;  5FKY A;  2VGY A;  1VCT A;  2E5V A;  2XCB A;  5FZR A;  2I6H A;  4E7S A;  4BSZ B;  3BG0 B;  5F3J A;  2IO3 C;  1DCE A;  5E75 A;  5FL1 A;  5BXU A;  1G3N B;  4MHC A;  2NC9 A;  4PFO A;  3ZMU B;  4F8H A;  4DX6 D;  4F7A A;  1NFI E;  3LVQ E;  3H37 A;  4TWD A;  4JL0 A;  2CXD A;  2E9X B;  3EVY A;  2CHZ A;  4JZY A;  4AEZ C;  3LG7 A;  3IXE A;  3ZKR A;  3LYA A;  4U63 A;  4HFE A;  2XJ7 A;  2MOZ A;  5JDF A;  4QKN A;  1ZV4 X;  2XTL A;  2NOX A;  2IU1 A;  3GA8 A;  4TNW A;  3NQP A;  4PK5 A;  2A2F X;  2KSR A;  2YOE A;  3Q5X A;  3P4R A;  3L17 A;  5LX8 A;  2L9Q A;  4YJ3 E;  3AE4 A;  4WNF A;  3OKQ A;  3Q75 A;  1JPL A;  2X67 A;  3LK4 2;  4ZI3 D;  4XIF A;  2XAG B;  5LP0 A;  2V4L A;  3OAW A;  3R9A B;  4I1O B;  1IZN B;  4FAD A;  3GMI A;  4JI5 T;  4J6I A;  4O6F A;  2XY8 B;  2XS1 A;  2M6B A;  4AOF A;  2PL2 A;  2VB6 A;  3IEG A;  5D0Q D;  2KWI B;  3D3M A;  5ENR D;  4UVC B;  2XEV A;  3ZU7 B;  3CV0 A;  5BV0 A;  1E8X A;  2VQF T;  2EIK E;  3W9F A;  2CM0 A;  2P2C P;  3CVW A;  3ZPO A;  4TRQ A;  1MQS A;  2EQX A;  3CGH A;  3I3N A;  1FT1 A;  4I6E A;  4CRW A;  3HRA A;  3D9M A;  2CWY A;  3AA1 B;  4E7Z A;  2DYR E;  2L0T B;  2FEZ A;  4ANU A;  2I9C A;  1IBK T;  5ABE A;  4WNG A;  4U04 A;  3L3P A;  4BAY B;  3TLT A;  2DWK A;  4XAX B;  4O4I E;  4P1N A;  2VQ2 A;  2E9X A;  4Q96 A;  4X66 T;  2LSK A;  2X6J A;  3JQ1 A;  1W9R A;  3G2U A;  4XZC A;  3NZQ A;  3EDT B;  1DVP A;  2BED A;  1JNZ A;  1MX2 A;  2VGE A;  3J5P A;  1LVF A;  1IBM T;  4BTB A;  2NW9 A;  3DRA A;  2LSJ A;  3P2B A;  2GK9 A;  2E0I A;  3ONJ A;  4EZL A;  3UU4 A;  2YU1 A;  3ETU A;  3AEG A;  2HPJ A;  2NTY A;  2CRB A;  1E8Z A;  3KV6 A;  4CI1 B;  3VLD A;  5ENQ D;  3LBX A;  2YDS A;  3TWT A;  3MXZ A;  5JQG E;  4DPR A;  1KK7 A;  3OYX A;  2H3R A;  3AE2 A;  4I2Z A;  3PEV B;  3TWR A;  4U7Y A;  4F6R D;  3EHR A;  3SBS A;  3SBT B;  3L22 A;  1EYH A;  2WB2 A;  1E1H B;  3DTO A;  3PRZ A;  3W15 B;  4EEC A;  3FEY A;  5LGU B;  5EIL A;  1HNW T;  1X9B A;  4H63 H;  2MPK A;  4HWD A;  2YQ8 A;  4IDN A;  4X1K E;  5AIJ A;  2ACZ A;  5CHE E;  3S7J A;  4DMV A;  3PU8 A;  2ZM2 A;  4DR3 T;  4CZZ B;  2WMO A;  1ZBP A;  2EHO A;  4K5A B;  2FUL A;  1OWN A;  3QWW A;  1BI8 B;  2CHO A;  2BG9 A;  4Q25 A;  1OWO A;  2KMF A;  1IYG A;  1OWL A;  4FHJ A;  3N9L A;  4DV7 T;  2KZT B;  3SWH A;  4CCA A;  2Y1L E;  4JA7 A;  3APC A;  1KT0 A;  4OAV B;  4K0U A;  4BX9 A;  3CVU A;  2LSV A;  2Y6X A;  2WXP A;  3MV3 B;  5LBM A;  3ZYQ A;  2XQ0 A;  4HRM B;  3QNK A;  3UQ3 A;  2OEW A;  1YMP A;  2XPI A;  4UWL A;  1PAQ A;  2SPC A;  5LMN T;  5J0Z A;  2B1E A;  5AQT B;  4DX1 A;  1B7T A;  3AVS A;  5HEH A;  1N34 T;  2XS8 A;  2BG9 B;  5HRY A;  4MS6 A;  3UT7 A;  4HN9 A;  2HO1 A;  4B0Z A;  3UUX B;  3CK6 A;  3UFG A;  4IUL A;  1YD8 G;  4EZJ A;  2ZMA A;  5LB7 B;  5EYP F;  2VKH A;  3RHW A;  1US7 B;  2I0M A;  4YT0 A;  4NUR A;  4MBG A;  3RKG A;  3BQK A;  3FBZ A;  4LNU D;  3L54 A;  1H2V C;  5LCW J;  2Q9Q A;  2X68 A;  5HCJ A;  4URK A;  1HCI A;  2VGX A;  4A55 A;  4CDM A;  4YY3 T;  3DEP A;  2KCV A;  5DQW A;  3WXX A;  3J9X 1;  2XM2 A;  2RFM A;  3RYI E;  4NQ0 A;  5EX3 A;  4HRN A;  3OBV E;  4Q94 A;  3C3Q A;  2X9Y A;  2UUC T;  2L6B A;  3FU5 A;  4DUY T;  3Q7A A;  4HI9 A;  3D9K A;  3QB5 K;  3RRW A;  4LNB A;  3V5S A;  4ILB A;  4FJZ A;  2EIN E;  2J08 A;  1ZP0 A;  4A98 A;  3F31 A;  2KM4 A;  4UI9 J;  4A5X A;  2P9S G;  1EPU A;  5EDS A;  3ZFW A;  4F1P A;  1KNP A;  2DWG A;  3QK0 A;  4D10 C;  1O1S A;  3MA9 A;  1U3D A;  3UQ7 A;  3ZYL A;  4EYY R;  1WFD A;  3RQU A;  4RG6 A;  3AE1 A;  2J4D A;  4QHO A;  1OT8 A;  4LNG A;  3TGO A;  3K9I A;  3PUX F;  2K5B B;  3D0T A;  1NA3 A;  3JYS A;  2PM6 A;  3I0Q A;  4U74 A;  3AE7 A;  2FI7 A;  3C98 B;  2F0Y A;  4ATG A;  3FZH B;  3IA3 A;  4MLK A;  2HM8 A;  2D5U A;  2D9D A;  5CFB A;  5CEC B;  3O1J A;  2JPF A;  2Q9Q C;  2VKO A;  3RIU A;  1OXZ A;  4BEP A;  5JRC A;  3Q7F A;  3B7S A;  2BS2 A;  1IQU A;  5LHH B;  3MYV A;  2VSY A;  2WVI A;  4FU3 A;  2LRL A;  5AQ7 A;  5JR9 C;  2GGF A;  5LJN A;  2WDR A;  3JAE A;  3EHM A;  5L3G B;  3EDV A;  2Y3A A;  5G05 J;  4QH1 A;  4Z90 A;  2IC9 A;  1KNZ A;  3H3M A;  2IOS A;  3BQL A;  4APF A;  3TWX A;  2QFC A;  1HE8 A;  3IHR A;  3T8M A;  4LFA T;  5AQS B;  1YKH B;  3X2Q E;  1HH8 A;  4JW1 A;  3Q5E A;  4JHR A;  5AQA A;  2R02 A;  1T8B A;  5FVL A;  2MRI A;  4CT0 A;  3TWQ A;  4GTM A;  2LLY A;  1OCR E;  3P8C D;  2ZU6 B;  3KSQ A;  3WAJ A;  1BR2 A;  2ES0 A;  4ILU A;  2WXJ A;  2WXG A;  4HRL A;  3ZUV B;  3FXD B;  3ZIM A;  4U95 D;  5HI7 A;  3U3W A;  1VDY A;  5JH7 E;  2HPL A;  2MAW A;  3FHE A;  5AQQ B;  2K9A A;  3D9L A;  4HLE A;  3AA6 B;  5C3J A;  2EHO C;  4AKI A;  2P9N G;  3VRA A;  4GYO A;  3A5X A;  2X0Y A;  4H9N C;  1UJK A;  3CK9 A;  3KDS E;  3CPZ A;  2WU5 A;  2YDR A;  3RH3 A;  2BUG A;  4GAA A;  4YDW A;  3A8Y C;  3EHN A;  3GWH A;  3AEF A;  2Y8D A;  2BDE A;  2YU2 A;  3CLJ A;  3PZ1 A;  5T3R A;  2CHN A;  2VAS A;  2OLT A;  2QC9 A;  3GN5 A;  4JB8 P;  4XI0 A;  1TEZ A;  4EZH A;  3TLW A;  3G2V A;  3CK8 A;  2XEH A;  2FBW A;  2F4V T;  4AQF A;  1N0Q A;  5C1D A;  4NXM T;  1SZ9 A;  2V6Y A;  3RIF A;  3MKQ B;  4WND A;  2WXM A;  5AAR A;  3MJW A;  2MTQ A;  3AE8 A;  2C5I T;  1H2U A;  4AQY T;  4A63 B;  1Y6I A;  3FUF A;  4TXP A;  3ESL A;  4LUN U;  4APO A;  2NTX A;  1K1B A;  4YHH T;  3UT8 A;  3CQX C;  1JWF A;  4I17 A;  3VRB A;  2F8Y A;  3LDZ A;  5KXJ A;  5LOV E;  2WQH A;  4X20 E;  3AB3 B;  3N9N A;  4EB6 E;  5EID A;  3HXF A;  3NKZ A;  4TZ4 C;  3KV4 A;  3PV0 F;  3UXG A;  4CZ2 D;  3AAA C;  4LF9 T;  4G8K A;  1IJ6 A;  2XQ3 A;  4DV5 T;  3W9G A;  2N1G A;  4BA9 A;  3AXJ B;  2XRY A;  3V2X A;  5FY1 A;  5L2L A;  4KBQ A;  3UU3 A;  4YTM A;  5KCM A;  3QAQ A;  3CKB A;  3NRY A;  4L9I A;  3UU8 A;  4DR2 T;  4I4T E;  1IXV A;  5D66 A;  4PK6 A;  3EU9 A;  3L6A A;  1SUM B;  2IY0 C;  1SA5 A;  1RW2 A;  4LF6 T;  1S35 A;  1UUR A;  4PH4 B;  3EUH A;  2HE0 A;  4L23 A;  2PG8 A;  1LD7 A;  2MYS A;  4YJ2 E;  3Q5D A;  2VSN A;  3SFD A;  3ZN0 B;  1E8Y A;  4C48 B;  2NR4 A;  2WQY A;  3DEO A;  2JRK A;  5A1L A;  3LKU A;  4U07 A;  3L39 A;  1T72 A;  4H7X A;  5HXE A;  2EIM E;  2CE7 A;  5HEU A;  2QVA A;  3FTX A;  4ZS2 A;  1YCS B;  4FUL A;  4HVB A;  2Y0B G;  2RPA A;  2IF4 A;  5CCL A;  3AS5 A;  5J90 A;  1V9D A;  3AAI A;  4PK4 A;  2LE8 A;  4A56 A;  2B6C A;  3AJI A;  4XE0 A;  4AI6 A;  4IHJ E;  3CHR A;  4X1I E;  3Q15 A;  3E08 A;  1D0Y A;  2DVW A;  4UI9 K;  5DJQ C;  3RIA A;  1OED E;  2HH7 A;  2UXN B;  4A97 A;  4CN1 A;  1N4S A;  5HS0 A;  1SQM A;  1X5B A;  5ANR A;  4ZZC A;  4U72 A;  3ZYK A;  2P9L G;  4E85 A;  3HKE E;  4GK5 E;  2Y4U A;  3AE3 A;  1MYO A;  3IHV A;  1AJ3 A;  5CA1 E;  4EIW A;  1MMA A;  3LJN A;  5B1B E;  1X79 A;  3BUA A;  4J7W A;  2H7V C;  3EAM A;  3QOF A;  2OVB A;  2E2E A;  1XDO A;  2WQ6 A;  5EK4 A;  3CSF A;  4I50 E;  2EIJ E;  3P7I A;  4Y6C A;  1MIW A;  3JAD A;  2UXD T;  2VQE T;  1VRB A;  2PNN A;  2ZGD A;  5ANL A;  5CJ5 A;  1UX5 A;  4EGW A;  4P0A A;  1U4Q A;  3PVL A;  3U66 A;  3CHQ A;  3P4S A;  5G04 C;  2J4G A;  3K8P C;  3PZ2 A;  3PUY F;  3ZW3 A;  4BT8 A;  2WS3 A;  3R6N A;  2K48 A;  3CVV A;  3FU0 A;  2X6I A;  2LRK A;  3DBS A;  4F6R C;  4K0K T;  1H0A A;  5FQ6 A;  3D9I A;  1N94 A;  3JUI A;  4P09 A;  3T1H T;  1ZHC A;  4B3M T;  5JR9 B;  2L9B A;  3SQV A;  1FJG T;  4WWO A;  3B7U X;  2BF0 X;  2V5Q C;  4KX6 A;  2XUE A;  2YK0 A;  5ENS D;  5HQ8 A;  5F8P A;  4AY6 A;  3CX6 B;  3B57 A;  4YVQ C;  2NP9 A;  4HXI A;  4YSZ A;  3Q9U C;  5EN5 D;  3PUQ A;  1YKE B;  4AKG A;  3I0O A;  2VVN A;  3L16 A;  4ANV A;  1LRZ A;  3S2A A;  4TXQ A;  3E30 A;  4HOS A;  4DR5 T;  3ZST A;  5ETW A;  2QYU A;  3PRE A;  3CVN A;  1H2T C;  3G2T A;  4LCT A;  4PNI A;  2PZI A;  2Y69 E;  4CEM A;  4IN3 B;  2AVP A;  3ZYM A;  1Z5S C;  2ZXW E;  3EAB A;  4YND A;  3PUK A;  4I2W A;  1U2V G;  2ODU A;  3FUK A;  3LCA A;  3SO8 A;  3ABK E;  4AIF A;  4O4H E;  3N9M A;  3RIU C;  1FPP A;  3ONX A;  2LSI A;  2CFU A;  4ZI7 E;  4CXX A;  3TXN A;  2V8S E;  1N33 T;  2QY7 A;  2OV9 A;  2VGX B;  4G63 A;  4G8L A;  5FQ8 A;  2LAH A;  5DQV A;  1CHU A;  2YN6 A;  4B6X A;  5KDM C;  4FP7 A;  2DZN A;  4I43 A;  1L0V A;  5L4E A;  1WY6 A;  4HWI B;  3RYF E;  4O1O A;  4JI2 T;  3U9W A;  3K1S A;  2XCC A;  4JHK A;  1YA0 A;  3MA5 A;  3J5Q B;  4ZEY A;  4B93 B;  4U96 D;  4HFB A;  4L9P A;  3HR0 A;  2HHH T;  2C0M A;  3I9Y A;  3SOL A;  4HFI A;  1MIY A;  4YXD A;  2BKO A;  3Q2M A;  4J8S A;  2J62 A;  3FXE B;  2X0H A;  3V5U A;  3AVR A;  4GZ5 A;  1IHG A;  4BJM A;  2A5E A;  3AE9 A;  4GCO A;  4MRU A;  3KV5 A;  5HEO A;  1YQ3 A;  3UUL A;  3T8O A;  2IO2 C;  4TX5 A;  2W00 A;  1HS7 A;  3T8K A;  4U0S A;  1HG5 A;  5CER B;  1W3B A;  4OVV A;  2WQ7 A;  3P1U A;  4DR7 T;  3DPY A;  4KXK B;  1O1R A;  4L7T A;  2OVF A;  4U7E B;  3J7Y q;  4ERR A;  2LM2 A;  1UW4 B;  2P9B A;  1MNE A;  4BSX A;  3I5P A;  4A1S A;  4LEU A;  3VHL A;  3VU7 H;  4HOQ A;  4ANX A;  2X51 A;  2Q9Q B;  1QLB A;  2WMN A;  4EYU A;  2DYS E;  1HFA A;  2ZLY A;  1I6Z A;  1IBL T;  4XZ4 A;  3BQI A;  2YDQ A;  2ILR A;  5L3B B;  4EZ4 A;  5LP6 E;  4QXC B;  3B7B A;  4ILG A;  4XKC A;  3T5V A;  1CUN A;  4U7I A;  5AQO B;  2E8I A;  4K5C A;  2LKG A;  3LBX B;  4IE7 A;  3OTN A;  4ZXL A;  1WAO 1;  3QK6 A;  4N2S A;  2FBN A;  5L3D B;  1INZ A;  4E6H A;  5EX0 A;  1Y01 A;  3ASG A;  2PJQ A;  3JUE A;  5FIN A;  3I4G A;  3CX7 B;  3ZJ1 A;  5EIB E;  2FJA A;  2GRO B;  3MCX A;  5A6C A;  1FT2 A;  3GYZ A;  2UXX B;  2FJB A;  4GOU A;  4IE0 A;  4HWH A;  4QFV A;  1M62 A;  1D8D A;  2KXP C;  4HTE A;  3TAX A;  1QUU A;  3PU3 A;  4GTS A;  5IYZ E;  1JWG A;  3N9Q A;  4GYY A;  4AIU A;  3QKY A;  4JI4 T;  2W4X A;  1EZ3 A;  4DI4 A;  1Z6T A;  5FXV A;  2XM1 A;  1WRD A;  4KMO A;  1JNR A;  2JIW A;  3EHZ A;  4XBF B;  1XNR T;  3FFL A;  5AQN B;  2YEV C;  2GRL A;  4B3R T;  4DK5 A;  2CA5 A;  4TUY E;  3DSW A;  4G11 A;  2QZA A;  1EF1 C;  3PUV F;  3OVU A;  2VKD A;  3KBU A;  4QWN B;  2BKP A;  3UT5 E;  3SZ7 A;  1E7P A;  5FXX A;  5LG4 A;  2E9X D;  4I9C A;  3DSX A;  4IST A;  1G73 A;  1ELR A;  4DR1 T;  4UF0 B;  2VTB A;  1WYC A;  1K3Z D;  5CBN A;  4DX2 A;  4DJA A;  4TWF A;  3RJV A;  2W63 A;  5G2N A;  1UX4 A;  5J1G A;  4KMC A;  1O1T A;  3KS2 A;  3CK7 A;  3H3A A;  2KXP B;  3EIQ C;  4ACL A;  3HKC E;  4IL4 A;  2OND A;  1UUS A;  1MMG A;  4PJM A;  1D8E A;  2CXF A;  4J8D A;  4QH5 A;  4PJN A;  4WNE A;  4FI5 A;  1NA0 A;  3B13 A;  4RSY A;  2LUH A;  3ANW B;  1K8K G;  5AJL A;  3NZU A;  2XAF B;  2Y48 B;  2BKK B;  4C0E A;  4UF0 A;  2VTB B;  4H9R C;  4ME2 A;  4FLH A;  4QQI A;  1E7U A;  2B0O E;  3FZL B;  4G26 A;  2ION A;  2RD0 A;  3PDN A;  4UUC A;  2V0P A;  1FVF A;  4HQD A;  3LVR E;  2ZM6 T;  5FTP A;  5AQH B;  5FY7 A;  1OUV A;  4WUY A;  4RLY A;  4GZ6 A;  3V30 A;  5ENN A;  2VJ8 A;  4DI3 A;  2HN2 A;  2LOS A;  3DWL G;  2L6J A;  3NAW A;  2VVS A;  3ZN1 B;  3QB5 A;  1TNB A;  4UVB B;  2K3W A;  5B3S E;  2WP9 A;  4YTP A;  4DX5 D;  3A7M A;  3C50 A;  4A3V A;  1HO8 A;  2XQ8 A;  4C0M A;  4CQI A;  3KD7 A;  3NZS A;  2XHE A;  1BR1 A;  4K0R A;  1N4P A;  2L8K A;  4N5C A;  4GYS A;  4I55 E;  2V5F A;  2V5C A;  4LFB T;  4KUM B;  2LXL A;  5ADX L;  1UN9 A;  1N0R A;  2AWI A;  4I0U A;  3K3Q C;  3T1Y T;  4G23 A;  3PE0 A;  1D1C A;  2OA5 A;  4NIK A;  1S70 B;  2H7O A;  3LJ3 A;  4PW8 A;  3ZSS A;  2X9X A;  1UJJ A;  2N9D A;  5AQG B;  2I2O A;  2J49 A;  5LA6 E;  2X66 A;  3PH0 C;  3KIN B;  4EZK A;  3TG5 A;  4JI7 T;  2BBH A;  5FIO A;  3DXK G;  3ASH A;  2GW1 A;  1J1J A;  3D9J A;  4BX8 A;  4EED A;  4N3A A;  3CR3 A;  1N95 A;  4ZI3 C;  3ZC0 A;  5JA4 D;  3AU4 A;  5BW8 C;  3AG3 E;  2P9U G;  3CVP A;  2VL0 A;  4LF4 T;  3MV2 B;  1YW0 A;  2XAQ B;  4F3V A;  3ZLI A;  5BR8 T;  4B3S T;  3FH8 A;  3JCK C;  4FHK A;  1A17 A;  4B89 A;  4KP3 C;  1OY3 D;  2KZ7 B;  1Z3X A;  2VYI A;  2XGM A;  5AYW D;  3AEA A;  3CX8 B;  2YHE A;  4NRH B;  1QZ2 A;  3UIP C;  1O3X A;  4G24 A;  3ETV A;  2V6Y B;  2MYO A;  2D0U A;  2XQY A;  3LDQ B;  3RIB A;  3TL5 A;  1PC2 A;  3VR9 A;  1ELK A;  2KLQ A;  4IGU A;  2BKG A;  4V3I A;  4JEH A;  3JAF A;  2GRN B;  3UM3 A;  1E96 B;  2V5D A;  1SZA A;  1N36 T;  2JQ9 A;  5AQJ B;  3S4U A;  3RRM B;  3ONK A;  3RF1 A;  2MOW A;  4X5T A;  4JI3 T;  4EHM A;  1L5J A;  4B3T T;  3AEB A;  5EK2 A;  3JQ0 A;  2FJE A;  4UQY A;  4O2A E;  4UIG A;  1Z8U A;  2A72 A;  1MHQ A;  3ZC1 A;  1JCS A;  3TXM A;  1R8I A;  2V7K A;  1H19 A;  1XGW A;  4J0U A;  2ETA A;  1IQR A;  3MAC A;  4N78 D;  4DBQ A;  3QC9 A;  2J47 A;  4EBA A;  3E34 A;  5CMW A;  4O8S A;  3JXJ A;  4GMR A;  3AG2 E;  3UPV A;  4CDR A;  3P4Q A;  4DVD A;  5BPP A;  4CT4 A;  1MMN A;  5DAB A;  2YHC A;  5J2T E;  1BPO A;  5G05 C;  1U5P A;  4XEI G;  5LGT B;  3FUD A;  4DV6 T;  3LXU X;  1HX8 A;  2FUP A;  1OCC E;  3ZGQ A;  3ZJ2 A;  3ABL E;  2Q9Q D;  3R9M A;  4B8A A;  3DP7 A;  3NOG D;  4GTQ A;  4UI9 C;  2NSZ A;  3GN5 B;  2WU2 A;  3BEE A;  3WG7 E;  4HBD A;  4AIS A;  4DV4 T;  4KT6 B;  2IHR 1;  1W09 A;  4PDX A;  3KFW X;  4KHZ F;  5IHY A;  3GZS A;  4B94 A;  2CCQ A;  3NZP A;  2IFU A;  3N71 A;  3VTY A;  4DR6 T;  2V7L A;  5HEG A;  3N2G E;  1WYB A;  2VSX E;  3LY9 A;  3FUH A;  5LYJ E;  3DSU A;  4LRZ A;  3FUL A;  2ACX A;  1IAP A;  2W67 A;  3RI5 A;  3RGL A;  2XQ7 A;  4RQI A;  2CG3 A;  4P29 A;  2CLY C;  3DJB A;  4ILI A;  5BV1 A;  1OWP A;  4MFR A;  4UWG A;  3M65 A;  5IWA T;  1E7V A;  1W0B A;  4C9B B;  1QYM A;  4TUM A;  2J8S D;  4DV2 T;  5LMU T;  5AQR B;  5ARG A;  2ODV A;  3QDN A;  5LFA A;  3L08 A;  1WM5 A;  1HF8 A;  5LJM A;  4X1Y E;  4ASK A;  4HS2 A;  1T7S A;  4L2L A;  4MLP A;  3AE6 A;  4HEA A;  4YDO A;  5JRE A;  1UCU A;  2XQ6 A;  4JC8 A;  1J5E T;  5FYM A;  1FVH A;  4PS7 A;  2YKS A;  4GYR A;  5ENP D;  1QBQ A;  4HOR A;  5LHI B;  4O4L E;  1HZ4 A;  1K1A A;  5FMN A;  2H88 A;  4R7L A;  2KWH A;  1JCR A;  2OV8 A;  3UI2 A;  1M7K A;  4BJN A;  5F5W A;  3VKG A;  5HWX A;  2JMH A;  1Y8M A;  4FLB A;  2AE9 A;  1VCS A;  4ZHQ E;  2MBG A;  4GTV A;  4X64 T;  4ANJ A;  3CHM A;  3HKB E;  4C90 A;  3IBE A;  1H7C A;  2NW7 A;  3F6Q A;  3TWS A;  3AAE B;  3FBL A;  2CLY B;  2XPZ A;  3PZD A;  1E2A A;  4KVM A;  1H6O A;  3V2O A;  3O48 A;  4N3B A;  4H9O C;  3VLE A;  4Y6W A;  3OTO T;  3KVA A;  3OJA A;  2LSY A;  5LCW C;  5G04 J;  1IKN D;  5L3E B;  2KBX A;  4GPM A;  4OYJ A;  2X0L B;  3HXE A;  3C3O A;  2V7J A;  1OED C;  4O1P A;  4G1T A;  5LHG B;  3PEU B;  2WCA A;  1FIO A;  4AKH A;  1HU3 A;  1E8W A;  2EHO D;  3QC1 A;  1V55 E;  4AM9 A;  2IDO B;  1N54 A;  4U2Y A;  2HN1 A;  5L4H A;  4AP2 A;  5HXR A;  2H6I A;  3PUJ A;  1UGO A;  3U78 A;  2NWB A;  5LCY A;  2N2N A;  4GZC A;  4M1P A;  5JHA A;  2WXO A;  5JJ6 A;  3RO2 A;  5TAO A;  5G55 A;  4FA6 A;  3JXI A;  4AQF C;  2PBI A;  3FUN A;  5FY0 A;  1W0A A;  2A5U A;  2WXL A;  1O5M A;  5DBK A;  2WY2 A;  1YXR A;  3TLV A;  3TJP A;  4A1G A;  3PUZ F;  3BG1 B;  3LS8 A;  2BS4 A;  4NUU A;  2JJ9 A;  5FP3 A;  4CXW A;  4BWR A;  3CWZ B;  5AQI B;  1LTX A;  2X6H A;  4JHJ A;  3TWV A;  3LPZ A;  5HEJ A;  1S0P A;  4LMK A;  2VWA A;  3T5X A;  4UQX A;  1SW6 A;  4DR4 T;  3CHO A;  2RFA A;  3Q47 B;  2UXB T;  4MBQ A;  1MIV A;  1HG2 A;  5KX5 E;  3OXL A;  3EHQ A;  3AU5 A;  2WPV A;  2WM9 A;  3FUI A;  1MJ0 A;  4GKJ T;  2WDQ A;  1WDY A;  3NWI A;  3UUM A;  3PUA A;  3HI2 A;  3MJX A;  2CHX A;  4AKL A;  4GB9 A;  5LNK A;  3SNX A;  4DMW A;  1XZY A;  3HKD E;  4DV3 T;  3CHS A;  2WXH A;  5ABG A;  2AXD S;  1MND A;  3ABM E;  4RG9 A;  3ZHE B;  3MX3 A;  5KWD A;  2P9P G;  1TN6 A;  1KNR A;  2VUR A;  4UWH A;  3UTM A;  3APD A;  3O4Z A;  1TN8 A;  2RA1 A;  4JYA T;  4UR9 A;  4UWF A;  5H6Q B;  4ZZB A;  1H6P A;  2J1D G;  3HHM A;  1HTJ F;  3UQ4 A;  5M72 A;  4JA9 A;  3QB2 A;  2BTD A;  2X6F A;  5KBA A;  3B7R L;  5ABH A;  3ULQ A;  3RRC A;  3HXD A;  2KIN B;  1SA4 A;  3ULE G;  1TNZ A;  3ISM C;  3R84 B;  4TWH A;  2JEK A;  4HWF A;  3PNL B;  4KZ0 A;  5KJL A;  1SVX A;  2IML A;  3SFE A;  2XZT G;  5KMG P;  4Q69 A;  2UY1 A;  2WBL A;  2DZO A;  3ASN E;  3HYM B;  2QGS A;  3CVX A;  2CHW A;  2YNQ A;  1ZOY A;  2BG9 E;  4DID B;  4WWN A;  2X38 A;  3Q9N C;  3WI3 A;  1E90 A;  3E37 A;  3U4T A;  3FEX A;  4EXT A;  4G2V A;  4HLL A;  5AQP B;  5E76 A;  4ZI2 C;  4OK0 A;  2XAS B;  4L1B A;  3UMV A;  3ENE A;  5M4Y A;  5J08 A;  3FTU A;  5CRV A;  3V31 A;  5BUZ A;  1SA0 E;  4L5G A;  1QNF A;  3EJN A;  5FQ7 A;  1FCH A;  1D1B A;  2XQ9 A;  1TJF A;  4U33 A;  1WLX A;  3AEE A;  4IDP A;  1WCR A;  4GKK T;  4TV9 E;  5AEN A;  3SGH A;  3UUB A;  4GYW A;  2M67 A;  3HL6 A;  2DBA A;  4YFS A;  2P9I G;  4UEM A;  3NB2 A;  4OYK A;  4CN6 A;  3LK3 B;  3PTR B;  5E0O A;  3D9P A;  4M3O A;  2OEV A;  4HI8 A;  4CDN A;  2W62 A;  3UKU G;  4I6G A;  2NW8 A;  3LY7 A;  1KZP A;  3C4X A;  2EHO B;  3IV0 A;  3AG4 E;  3NF1 A;  4KYO B;  2I59 A;  5FL0 A;  4OHF A;  2XZE A;  4CI2 B;  4QH4 A;  3HVE B;  4P0B A;  4ISS A;  1OCZ E;  3ASO E;  3DSV A;  4WAF A;  1FEW A;  3KSL A;  3AEC A;  4GU5 A;  5KJM A;  5AJD A;  2W66 A;  5L47 A;  3TWU A;  3VKH A;  4AQG A;  1HS6 A;  3C51 A;  3KAE A;  3SI5 A;  4KI0 F;  2LHR A;  5LOZ A;  3GW4 A;  4GCN A;  4X62 T;  2XAJ B;  3AG1 E;  4YHJ A;  2JQQ A;  3CVR A;  4UV9 B;  4AVX A;  4OFZ A;  4I1A A;  5BNW A;  4HB5 A;  4WW0 A;  3C4Z A;  5LG3 A;  3ASF A;  3RSE G;  4J2C A;  2BG9 C;  3HXC A;  3RRN B;  2XSA A;  5C8Y E;  3AS4 A;  5T4Y A;  2DNX A;  3AED A;  3RYH E;  4U8H A;  4WBO A;  3CST A;  1ZU2 A;  4N5Q A;  4AXH A;  4PS8 A;  4GTT A;  5A23 A;  3QUJ A;  1KEY A;  4DND A;  3UM2 A;  5AQK B;  2Z6E A;  1XWM A;  3PJA A;  4ZOL E;  5T8I A;  2F37 A;  4GMJ A;  1OWA A;  1Z0P A;  2D0T A;  3UFE A;  3FUM A;  5JDL A;  3LK2 B;  3RC3 A;  2KCL A;  5BXO A;  3S7B A;  3ZVV A;  3ML8 A;  4WZX A;  2IQC A;  4H9Q C;  2Y4T A;  3FZM B;  2CG2 A;  4DX7 D;  4OVU A;  4EQF A;  3BU8 A;  3I1A A;  2ZIS A;  4U31 A;  5DIZ A;  5L3F B;  2R59 A;  4JLE A;  5BT1 A;  4UXN B;  2XEN A;  1JCQ A;  2P9K G;  3MZL B;  2M6I A;  3O1H A;  4RVB A;  4NUV A;  3PUW F;  3VLF A;  3FTZ A;  1T98 A;  3D9O A;  3FDH A;  3ZCI A;  3L09 A;  4N2Q A;  1QQE A;  3RK6 A;  1TYQ G;  1KPS B;  4HFC A;  1HNZ T;  3FP3 A;  1OED A;  2VL8 A;  2MHK A;  3NBX X;  3HG0 D;  5JDM A;  3ONL A;  3RC8 A;  5ENT D;  2RP4 A;  1EDU A;  4WBN E;  2WDV A;  5JDH A;  4AV7 A;  3G2S A;  3ZKJ A;  3RQW A;  3MEK A;  4DBR A;  2R03 A;  4YSX A;  3L9T A;  3RAU A;  4J8Y A;  3RKV A;  2ZIR A;  4KBM B;  4H9P C;  2XZD G;  3ZMT B;  3RPU A;  4JUY A;  3Q49 B;  4EV6 A;  1FMV A;  4JI8 T;  2J4B A;  2XAH B;  4IIJ E;  5JRC B;  2QA7 A;  3S7F A;  3UU5 A;  5JVD E;  3O9X A;  4KVO A;  2AXZ A;  1LKX A;  2QYW A;  3BK9 A;  3Q5M A;  4LG6 A;  4HE8 A;  1N52 A;  3KV9 A;  4WYV A;  3SF4 A;  5AQM B;  2J07 A;  5EKQ D;  2WXK A;  4TUU A;  1NEN A;  2IIU A;  1WR6 A;  4V1A v;  3UX4 A;  2X9H A;  2JQH A;  3PDY A;  4GIW A;  5GON E;  3X1D A;  3ZCJ A;  2PFV A;  1N32 T;  3FUJ A;  5JMN D;  3LFM A;  2DWZ A;  3ZHE A;  4MAL A;  4I1M A;  5HXC A;  3CIR A;  2DHR A;  4BY6 A;  4TV8 E;  5CEA A;  5IUX A;  3G2W A;  4UQZ A;  3GZ1 A;  3ONL C;  3S7D A;  5AQU B;  4LF5 T;  4NAC A;  4JBW F;  4GZD A;  2ETB A;  2LO6 A;  3RLF F;  2KZT A;  2DCF A;  3LEW A;  4IDO A;  3JC6 C;  1TR4 A;  3FU3 A;  3CVY A;  3FZF B;  5CB4 E;  3VTX A;  1SHZ C;  3UU6 A;  4FJY A;  4QX7 B;  2WXF A;  2HR2 A;  4N3C A;  1NP7 A;  4JPS A;  2V8S V;  2UUA T;  3QWP A;  3UUN A;  1MX6 A;  2X6K A;  2IEJ A;  2FO7 A;  3UIN C;  3DST A;  3UT4 A;  5A7D B;  3Q79 A;  4B8C B;  2UY1 B;  4YVO A;  2IUB A;  1XMQ T;  1OWM A;  2I1K A;  4IDZ A;  3PUS A;  1X81 A;  3M3Z B;  1MMD A;  1TJC A;  3N9P A;  4F1S A;  1XNF A;  2RG8 A;  4OX9 T;  3TKL B;  1PY1 A;  1DC2 A;  3R7Q A;  3NOC D;  3CEQ A;  2H6G A;  4EPZ A;  3AXJ A;  3QWV A;  2D2S A;  1IJ5 A;  3U64 A;  3EDU A;  4GA1 A;  4GTR A;  3MGB A;  4TN7 B;  4MKT A;  4U8V D;  5KJK A;  1V54 E;  1BR0 A;  3ZPJ A;  4CXY A;  2ZGG A;  2H6H A;  4CYM D;  3ZEF B;  4ILC A;  5ARF A;  1S63 A;  4JI6 T;  4PJJ A;  3ZT7 A;  3RU0 A;  3V79 K;  4AJW A;  3Q4A B;  3IHY A;  1D0Z A;  3CHP A;  2L0I A;  3KVB A;  1XDP A;  4IL9 A;  1YYH A;  5FZQ A;  3SY2 A;  5CED B;  2LT3 A;  3D9H A;  3CKD A;  1NWM X;  4JI1 T;  3APF A;  5FWQ A;  1S64 A;  2IC6 A;  3L82 A;  1I94 T;  3PNT B;  5LGN B;  5AQF B;  3E0Z A;  4LF8 T;  3FTV A;  2FF4 A;  4OAU C;  2PQN A;  3SFX A;  3ANW A;  2V7M A;  2DL1 A;  4GML A;  4CN4 A;  2L3L A;  4JI0 T;  3PUG A;  2XQ4 A;  4UV8 B;  5CGM A;  5JDG A;  2JMK A;  5JR9 A;  5FZS A;  4U0Z A;  3AA7 B;  4AXP A;  4PS3 A;  4WNK A;  2VKJ A;  5FT9 A;  1HR0 T;  3QNU A;  2UXC T;  3EUV A;  4BTA A;  3OYZ A;  3PJA J;  3RX6 A;  4GA2 A;  2C5K T;  4ZHB A;  2J9Q A;  3PE3 A;  4NIQ A;  5EK3 A;  4U8Y D;  1XNQ T;  2GRP B;  3HXB A;  3AA0 B;  2XQA A;  2XPY A;  3FWV A;  1Q2Z A;  4G2A A;  1ZEE A;  3VR8 A;  3DXM G;  4LMJ A;  2RKK A;  2NXP A;  3DPD A;  4HOU A;  4IE5 A;  3UM1 A;  4PJL A;  3FH7 A;  5LXT E;  1RZ4 A;  1SE7 A;  5HWY A;  1AP7 A;  3OPC A;  3SS1 A;  3E32 A;  3HVE A;  4GA0 A;  5HKP A;  2CWO A;  1FMW A;  4TV3 A;  1D0X A;  3C98 A;  4X65 T;  4I9E A;  1YQ4 A;  3CVQ A;  2BS3 A;  4JVS A;  3CML A;  3FTS A;  2C0S A;  4BT9 A;  5ABF B;  3ZRH A;  2BVM A;  3LJC A;  5HAX A;  4HNA D;  4A3T A;  5ITZ F;  3Q73 A;  5D0O D;  3FHN A;  3G06 A;  3NVO A;  3N9O A;  5B1A E;  3NRX A;  2GRM A;  1DNP A;  3ZXS A;  3U3I A;  2DI4 A;  4U2Z A;  4YTN A;  4NXN T;  3JC6 D;  3D9N A;  2V6X A;  1NEK A;  3NBN B;  5JJT A;  1A5E A;  4HFG A;  3PE4 A;  2DCP A;  4NPP A;  4W9R A;  4ATZ D;  4FC8 A;  1UN8 A;  2K24 A;  3KEA A;  4H9S E;  4HFD A;  5IY5 E;  1QSD A;  3MKD A;  3O1I A;  2IJG X;  3SD5 A;  4GZ3 A;  5ABF A;  4IRE A;  2JLB A;  4JEU A;  3TLS A;  1HX1 B;  3EI0 A;  4COF A;  3CQG B;  2IOL A;  2CEA A;  2R5S A;  1H6K A;  5AN8 A;  4DV0 T;  2WSS V;  5J2U E;  2LXM A;  2LAI A;  3GZ2 A;  2JAB A;  3FZK B;  2UUB T;  1BD8 A;  3UKR G;  1ZB1 A;  1WR0 A;  2EIL E;  5FVK A;  5AAO A;  4ILA A;  2ZM8 A;  4DUZ T;  4IDQ A;  5CA0 E;  3K3N A;  4I6J A;  2BZB A;  1TN7 A;  5JHB A;  3FU6 A;  5CMY A;  3JCF A;  3ZT6 A;  4HOT A;  5EZY E;  5KNG A;  2R17 C;  3HIZ A;  2BBJ A;  4DRX E;  3UUX A;  2ZM0 A;  5HCM A;  1UK5 A;  4ZS3 A;  4LSZ E;  3ABV A;  3BQO A;  3N2O A;  3C5R A;  4JEU B;  1BI7 B;  1TNU A;  2FJD A;  2LSG A;  1J5W A;  2Q7F A;  3EU5 A;  3IF8 B;  1P5Q A;  3AAA B;  3ZMS B;  2HYZ A;  1U3C A;  2WXR A;  4ACK A;  4BET A;  5FQ4 A;  3TG4 A;  3AE5 A;  1HXI A;  3TLU A;  4LER A;  4X8Q A;  5AQ9 A;  4KZC A;  3P4W A;  2H89 A;  1D1A A;  3ZMV B;  3URZ A;  5H7P A;  2PQR A;  4U0U A;  3CQC B;  3QAR A;  2XSB A;  2AJA A;  4CGW A;  5JTG A;  3KBT A;  4BER A;  4Z8X A;  5CRU A;  4PFP A;  1MX4 A;  3I4R B;  4TXR A;  1DU2 A;  4H7Y A;  3ZMZ B;  2KC7 A;  1OXJ A;  5HYA A;  3KEZ A;  3QOU A;  2E2A A;  4IE4 A;  2A4Z A;  3IBP A;  4JXT A;  1NZN A;  2IW5 B;  3T9K A;  4O4J E;  3F57 A;  2PTF A;  4QXH B;  5CCM A;  3Q78 A;  2WB5 A;  2XGS A;  2LM9 A;  4DLO A;  2PM7 A;  2LOP A;  2JQK A;  3ML9 A;  3FTW A;  3N5L A;  2WAU A;  3E4B A;  4XKB A;  3DSS A;  1BU9 A;  2LKH A;  2BKN A;  2WWV A;  2C0L A;  3FY4 A;  2J09 A;  2V7I A;  4N39 A;  3AS8 A;  3O4X E;  4EOZ B;  2LSU A;  4XI9 A;  3EIJ A;  3ESK A;  3PZ3 A;  2CMR A;  4PAG A;  2E9X C;  3ULY A;  1GW6 A;  2NYJ A;  3QJZ A;  2AXU A;  1N11 A;  3MZK B;  3IKO B;  4K5B A;  2KND A;  4WWP A;  4GTP A;  4UEL A;  1AWC B;  2W0G A;  1KLX A;  3CIA A;  3SFZ A;  2R6G F;  5AQL B;  3K3O A;  1JUQ A;  4DUI A;  4BFR A;  2R05 A;  5EYL A;  4F53 A;  5HXS A;  5LBQ B;  4J8E A;  3R7R A;  4PUC A;  3RRU A;  4KHP T;  5FJY A;  2QRX A;  4JEH B;  5C2T A;  5CBO A;  1NL4 A;  4UVA B;  3E33 A;  3FUE A;  4YSY A;  2C5J A;  2P58 C;  3C4W A;  2X9W A;  2YIN A;  4J8F A;  2V26 A;  4EEB A;  5JJ7 A;  3F2E A;  4AY5 A;  1KT1 A;  3FH5 A;  4U3C A;  3C72 A;  3P50 A;  5L3C B;  4GK0 E;  4O60 A;  5FXW A;  2LNI A;  5AQV B;  1KZO A;  1UG3 A;  3ZN3 A;  3P4P A;  2UWJ G;  3FB2 A;  1N9A A;  2XGO A;  3L8R A;  2XPK A;  4O2B E;  4LML A;  3WAK A;  2M63 A;  2KT9 A;  2KCK A;  3C3R A;  4HKA A;  3N2K E;  3PS6 A;  4I43 B;  3B7T A;  2WZI A;  4ILH B;  4FJO A;  2GRR B;  2R2L A;  3CKC A;  1LF8 A;  1Y64 B;  1XMO T;  1BR4 A;  1DCQ A;  1N4Q A;  2CFZ A;  4ZI2 D;  4C91 A;  3B95 A;  3LY8 A;  3MKR A;  4ZFH A;  5KJN A;  4H63 V;  4HFV A;  2GRQ B;  3RO3 A;  4IT4 A;  3HA4 A;  3I9W A;  3SFY A;  1BLX B;  3UTK A;  2QYJ A;  3FTY A;  5HXH A;  5KNH D;  4EBA G;  4YDE A;  2CBI A;  2WXN A;  4JV5 T;  4QX8 B;  2V1D B;  3OXG A;  4G25 A;  3SRZ A;  4UWK A;  2I1J A;  4CI3 B;  3UIO C;  2CBJ A;  1KF6 A;  5ENO D;  5C2Y A;  2X3M A;  2A9U A;  2AXV A;  3Q5W A;  4TNV A;  4JD2 G;  2WXQ A;  4HFH A;  2WZH A;  4IRU A;  4M7C A;  2WXI A;  4ANW A;  2LHN A;  3OXF A;  3ZXP A;  3MKQ A;  3ZEF A;  2B76 A;  1Z3Y A;  3HDX A;  2VK9 A;  2VSO E;  3L13 A;  5H6R B;  1NAF A;  2BVL A;  4CGV A;  2UU9 T;  4DV1 T; 
#chains in the Genus database with same CATH homology
 5AFU L;  2DIW A;  4OYS A;  2XRZ A;  4ADZ A;  3Q9D A;  2W61 A;  3E22 E;  2CXL A;  3ASD A;  4DLQ A;  2OOE A;  3CVL A;  2LJL A;  1ELW A;  4IE6 A;  2LEH A;  2DLR A;  1VOM A;  1ZKE A;  2WWU A;  4YLH A;  4QXB B;  4GPK A;  2XHE B;  5FXZ A;  4HGA A;  3C64 A;  4EAH A;  3IEE A;  1B89 A;  5JDN A;  1S94 A;  4L0R A;  2IAK A;  2G0U A;  5BMV E;  4IYP A;  3SHF A;  4L2Y A;  2A3D A;  4DO0 A;  1G8X A;  5FNV E;  3RYC E;  4AKR B;  3PUR A;  4XX5 A;  4K03 A;  2KAT A;  4ABN A;  1LVK A;  2C2L A;  5JDQ A;  3RKO A;  3MK7 C;  2AW6 A;  2VGY A;  2XCB A;  5FZR A;  2I6H A;  4E7S A;  3BG0 B;  5F3J A;  5E75 A;  4MHC A;  2NC9 A;  4PFO A;  3ZMU B;  4F7A A;  3LVQ E;  3H37 A;  4JL0 A;  2CXD A;  2E9X B;  3EVY A;  2CHZ A;  4JZY A;  4AEZ C;  3LG7 A;  3LYA A;  4U63 A;  2MOZ A;  5JDF A;  4QKN A;  1ZV4 X;  2XTL A;  2NOX A;  2IU1 A;  3GA8 A;  3NQP A;  4PK5 A;  2A2F X;  3Q5X A;  3L17 A;  5LX8 A;  2L9Q A;  4YJ3 E;  4WNF A;  3OKQ A;  1JPL A;  2X67 A;  3LK4 2;  4ZI3 D;  4XIF A;  2XAG B;  5LP0 A;  2V4L A;  3OAW A;  3R9A B;  4I1O B;  1IZN B;  4FAD A;  3GMI A;  4J6I A;  4O6F A;  4AOF A;  2PL2 A;  2VB6 A;  3IEG A;  5D0Q D;  2KWI B;  3D3M A;  4UVC B;  2XEV A;  3CV0 A;  5BV0 A;  1E8X A;  2CM0 A;  3CVW A;  3ZPO A;  4TRQ A;  1MQS A;  2EQX A;  3CGH A;  3I3N A;  4CRW A;  4I6E A;  3D9M A;  2CWY A;  3AA1 B;  4E7Z A;  2L0T B;  2FEZ A;  4ANU A;  2I9C A;  4WNG A;  4U04 A;  3L3P A;  4BAY B;  2DWK A;  4XAX B;  4O4I E;  2VQ2 A;  2E9X A;  4Q96 A;  2LSK A;  2X6J A;  3JQ1 A;  3G2U A;  4XZC A;  3NZQ A;  3EDT B;  1DVP A;  1LVF A;  4BTB A;  2NW9 A;  2LSJ A;  3P2B A;  2GK9 A;  2E0I A;  4EZL A;  2YU1 A;  3ETU A;  2HPJ A;  2NTY A;  1E8Z A;  3KV6 A;  4CI1 B;  3VLD A;  3LBX A;  3MXZ A;  5JQG E;  4DPR A;  1KK7 A;  3OYX A;  2H3R A;  4I2Z A;  3PEV B;  3SBS A;  3SBT B;  3L22 A;  1EYH A;  2WB2 A;  1E1H B;  3DTO A;  3PRZ A;  3W15 B;  4EEC A;  3FEY A;  5LGU B;  4H63 H;  2YQ8 A;  4X1K E;  5AIJ A;  3S7J A;  5CHE E;  4DMV A;  3PU8 A;  2ZM2 A;  4CZZ B;  2WMO A;  1ZBP A;  2EHO A;  2FUL A;  1OWN A;  3QWW A;  1IYG A;  1OWO A;  2KMF A;  1OWL A;  4FHJ A;  3N9L A;  2KZT B;  3SWH A;  4CCA A;  4JA7 A;  3APC A;  1KT0 A;  4K0U A;  4BX9 A;  3CVU A;  2LSV A;  2Y6X A;  2WXP A;  3MV3 B;  5LBM A;  3ZYQ A;  2XQ0 A;  3QNK A;  3UQ3 A;  2XPI A;  4UWL A;  1PAQ A;  2SPC A;  2B1E A;  1B7T A;  3AVS A;  4MS6 A;  3UT7 A;  4HN9 A;  2HO1 A;  4B0Z A;  3UUX B;  4IUL A;  1YD8 G;  4EZJ A;  2ZMA A;  2VKH A;  1US7 B;  4NUR A;  3BQK A;  3FBZ A;  3L54 A;  1H2V C;  5LCW J;  2Q9Q A;  2X68 A;  4URK A;  1HCI A;  2VGX A;  4A55 A;  4CDM A;  2KCV A;  5DQW A;  3WXX A;  3J9X 1;  3RYI E;  4NQ0 A;  5EX3 A;  3OBV E;  4Q94 A;  2X9Y A;  3FU5 A;  3D9K A;  3RRW A;  3V5S A;  4FJZ A;  2J08 A;  3F31 A;  2KM4 A;  4UI9 J;  1EPU A;  5EDS A;  3ZFW A;  3QK0 A;  2DWG A;  4D10 C;  3MA9 A;  1U3D A;  3ZYL A;  4EYY R;  4RG6 A;  2J4D A;  4QHO A;  3TGO A;  3K9I A;  2K5B B;  3D0T A;  1NA3 A;  3JYS A;  2PM6 A;  3I0Q A;  4U74 A;  2FI7 A;  3C98 B;  4ATG A;  4MLK A;  2HM8 A;  2D5U A;  3O1J A;  2JPF A;  2Q9Q C;  2VKO A;  1OXZ A;  5JRC A;  3B7S A;  1IQU A;  3MYV A;  5LHH B;  2VSY A;  2WVI A;  4FU3 A;  5JR9 C;  2GGF A;  5LJN A;  3EHM A;  5L3G B;  3EDV A;  2Y3A A;  5G05 J;  2IC9 A;  1KNZ A;  2IOS A;  3BQL A;  4APF A;  2QFC A;  1HE8 A;  3IHR A;  3T8M A;  1YKH B;  1HH8 A;  4JW1 A;  4JHR A;  2MRI A;  4CT0 A;  3P8C D;  2ZU6 B;  3WAJ A;  1BR2 A;  2ES0 A;  4ILU A;  2WXJ A;  2WXG A;  3ZIM A;  3FXD B;  5HI7 A;  3U3W A;  1VDY A;  5JH7 E;  2HPL A;  3FHE A;  2K9A A;  3D9L A;  4HLE A;  3AA6 B;  2EHO C;  4AKI A;  4GYO A;  3A5X A;  4H9N C;  1UJK A;  3CK9 A;  3KDS E;  3CPZ A;  3RH3 A;  2BUG A;  4GAA A;  3EHN A;  3GWH A;  2Y8D A;  2BDE A;  2YU2 A;  3CLJ A;  5T3R A;  2VAS A;  1TEZ A;  3GN5 A;  4XI0 A;  4EZH A;  3G2V A;  3CK8 A;  4AQF A;  5C1D A;  1SZ9 A;  3MKQ B;  4WND A;  2WXM A;  3MJW A;  2MTQ A;  2C5I T;  1H2U A;  1Y6I A;  3FUF A;  3ESL A;  4LUN U;  4APO A;  2NTX A;  3UT8 A;  3CQX C;  1JWF A;  4I17 A;  3LDZ A;  5LOV E;  2WQH A;  4X20 E;  3AB3 B;  3N9N A;  4EB6 E;  4TZ4 C;  3KV4 A;  1IJ6 A;  2N1G A;  4BA9 A;  2XRY A;  5FY1 A;  5L2L A;  4KBQ A;  5KCM A;  3QAQ A;  3CKB A;  3NRY A;  4L9I A;  4I4T E;  4PK6 A;  3L6A A;  1S35 A;  4PH4 B;  3EUH A;  4L23 A;  2PG8 A;  2MYS A;  4YJ2 E;  2VSN A;  3ZN0 B;  1E8Y A;  2JRK A;  5A1L A;  3LKU A;  4U07 A;  4H7X A;  5HXE A;  2CE7 A;  3FTX A;  4ZS2 A;  4FUL A;  4HVB A;  5J90 A;  2IF4 A;  5CCL A;  3AS5 A;  1V9D A;  3AAI A;  4PK4 A;  2LE8 A;  4A56 A;  4XE0 A;  4AI6 A;  4IHJ E;  3CHR A;  4X1I E;  3Q15 A;  3E08 A;  1D0Y A;  4UI9 K;  5DJQ C;  2HH7 A;  2UXN B;  1SQM A;  1X5B A;  5ANR A;  4U72 A;  3ZYK A;  4E85 A;  3HKE E;  4GK5 E;  2Y4U A;  3IHV A;  1AJ3 A;  5CA1 E;  4EIW A;  1MMA A;  1X79 A;  2WQ6 A;  2H7V C;  2OVB A;  2E2E A;  5EK4 A;  3CSF A;  4I50 E;  3P7I A;  4Y6C A;  1MIW A;  1VRB A;  5ANL A;  1UX5 A;  4P0A A;  1U4Q A;  3PVL A;  3U66 A;  3CHQ A;  5G04 C;  3K8P C;  3ZW3 A;  4BT8 A;  3R6N A;  2K48 A;  3CVV A;  3FU0 A;  2X6I A;  3DBS A;  4F6R C;  1H0A A;  5FQ6 A;  3D9I A;  3JUI A;  4P09 A;  1ZHC A;  5JR9 B;  2L9B A;  4WWO A;  3B7U X;  2BF0 X;  2XUE A;  2YK0 A;  5HQ8 A;  5F8P A;  4AY6 A;  3CX6 B;  3B57 A;  4YVQ C;  2NP9 A;  4HXI A;  3PUQ A;  1YKE B;  4AKG A;  3L16 A;  3I0O A;  4ANV A;  1LRZ A;  3S2A A;  4HOS A;  5ETW A;  3PRE A;  3CVN A;  1H2T C;  3G2T A;  4LCT A;  4PNI A;  2PZI A;  4CEM A;  4IN3 B;  2AVP A;  3ZYM A;  4YND A;  3PUK A;  4I2W A;  2ODU A;  3FUK A;  3LCA A;  4AIF A;  4O4H E;  3N9M A;  3ONX A;  2LSI A;  2CFU A;  4ZI7 E;  4CXX A;  3TXN A;  2V8S E;  2QY7 A;  2VGX B;  4G63 A;  5FQ8 A;  2LAH A;  5DQV A;  4B6X A;  5KDM C;  4FP7 A;  4I43 A;  1WY6 A;  3RYF E;  3U9W A;  2XCC A;  4JHK A;  1YA0 A;  3MA5 A;  3HR0 A;  2C0M A;  3I9Y A;  3SOL A;  1MIY A;  3Q2M A;  4J8S A;  3FXE B;  3V5U A;  4GZ5 A;  3AVR A;  1IHG A;  4BJM A;  4GCO A;  4MRU A;  3KV5 A;  3UUL A;  3T8O A;  4TX5 A;  2W00 A;  1HS7 A;  4U0S A;  1HG5 A;  1W3B A;  4OVV A;  2WQ7 A;  3P1U A;  4KXK B;  4L7T A;  2OVF A;  3J7Y q;  4ERR A;  1UW4 B;  2P9B A;  1MNE A;  4BSX A;  3I5P A;  4A1S A;  4LEU A;  3VHL A;  3VU7 H;  4HOQ A;  4ANX A;  2X51 A;  2Q9Q B;  2WMN A;  4EYU A;  1HFA A;  2ZLY A;  4XZ4 A;  3BQI A;  2ILR A;  5L3B B;  4EZ4 A;  5LP6 E;  4QXC B;  4ILG A;  4XKC A;  3T5V A;  1CUN A;  2E8I A;  3LBX B;  4IE7 A;  3OTN A;  1WAO 1;  3QK6 A;  4N2S A;  2FBN A;  5L3D B;  1INZ A;  4E6H A;  5EX0 A;  3ASG A;  2PJQ A;  3I4G A;  3CX7 B;  3ZJ1 A;  3MCX A;  5A6C A;  3GYZ A;  2UXX B;  4IE0 A;  4GOU A;  4QFV A;  4HTE A;  3TAX A;  1QUU A;  3PU3 A;  5IYZ E;  1JWG A;  3N9Q A;  4GYY A;  3QKY A;  1EZ3 A;  4DI4 A;  1Z6T A;  5FXV A;  1WRD A;  4KMO A;  4XBF B;  3FFL A;  2YEV C;  2GRL A;  4DK5 A;  2CA5 A;  4TUY E;  4G11 A;  1EF1 C;  2VKD A;  3KBU A;  4QWN B;  3UT5 E;  3SZ7 A;  5FXX A;  5LG4 A;  2E9X D;  4I9C A;  4IST A;  1G73 A;  1ELR A;  4UF0 B;  2VTB A;  1WYC A;  4DJA A;  3RJV A;  2W63 A;  5G2N A;  1UX4 A;  5J1G A;  4KMC A;  3KS2 A;  3CK7 A;  3H3A A;  2KXP B;  3EIQ C;  4ACL A;  3HKC E;  2OND A;  1MMG A;  4PJM A;  2CXF A;  4J8D A;  4PJN A;  4WNE A;  4FI5 A;  1NA0 A;  3B13 A;  4RSY A;  3ANW B;  5AJL A;  3NZU A;  2Y48 B;  2XAF B;  4C0E A;  4UF0 A;  2VTB B;  4H9R C;  4ME2 A;  4FLH A;  1E7U A;  4G26 A;  2ION A;  2RD0 A;  3PDN A;  2V0P A;  1FVF A;  3LVR E;  5FTP A;  5FY7 A;  1OUV A;  4WUY A;  4GZ6 A;  5ENN A;  2VJ8 A;  4DI3 A;  2LOS A;  2L6J A;  3ZN1 B;  4UVB B;  3C50 A;  4A3V A;  1HO8 A;  4C0M A;  4CQI A;  3KD7 A;  3NZS A;  2XHE A;  4K0R A;  1BR1 A;  4N5C A;  2L8K A;  4GYS A;  4I55 E;  2V5F A;  4KUM B;  5ADX L;  1UN9 A;  2AWI A;  3K3Q C;  4G23 A;  3PE0 A;  1D1C A;  2OA5 A;  2H7O A;  3LJ3 A;  4PW8 A;  2X9X A;  1UJJ A;  2N9D A;  2I2O A;  2J49 A;  5LA6 E;  2X66 A;  3PH0 C;  3KIN B;  4EZK A;  3TG5 A;  3ASH A;  2GW1 A;  3D9J A;  4BX8 A;  4N3A A;  3CR3 A;  4ZI3 C;  3ZC0 A;  3AU4 A;  5BW8 C;  3CVP A;  3MV2 B;  1YW0 A;  2XAQ B;  4F3V A;  3ZLI A;  3FH8 A;  3JCK C;  4FHK A;  1A17 A;  4B89 A;  4KP3 C;  2KZ7 B;  1Z3X A;  2VYI A;  2XGM A;  5AYW D;  3CX8 B;  2YHE A;  4NRH B;  1QZ2 A;  1O3X A;  4G24 A;  3ETV A;  2D0U A;  2XQY A;  3RIB A;  3TL5 A;  1PC2 A;  1ELK A;  2KLQ A;  4IGU A;  4V3I A;  4JEH A;  1E96 B;  1SZA A;  3S4U A;  3RRM B;  3ONK A;  2MOW A;  1L5J A;  5EK2 A;  3JQ0 A;  4UQY A;  4O2A E;  4UIG A;  2A72 A;  1MHQ A;  3ZC1 A;  3TXM A;  2V7K A;  1H19 A;  1XGW A;  4J0U A;  1IQR A;  3MAC A;  4N78 D;  4DBQ A;  3QC9 A;  4EBA A;  5CMW A;  4O8S A;  3UPV A;  4CDR A;  4DVD A;  5BPP A;  4CT4 A;  1MMN A;  5DAB A;  2YHC A;  5J2T E;  1BPO A;  5G05 C;  1U5P A;  5LGT B;  3FUD A;  3LXU X;  1HX8 A;  3ZGQ A;  3ZJ2 A;  2Q9Q D;  4B8A A;  3DP7 A;  4UI9 C;  2NSZ A;  3GN5 B;  3BEE A;  4KT6 B;  4PDX A;  3KFW X;  5IHY A;  3GZS A;  4B94 A;  2CCQ A;  3NZP A;  2IFU A;  3N71 A;  3VTY A;  2V7L A;  3N2G E;  1WYB A;  2VSX E;  3LY9 A;  3FUH A;  5LYJ E;  4LRZ A;  3FUL A;  2ACX A;  1IAP A;  2CG3 A;  4P29 A;  2CLY C;  3DJB A;  4ILI A;  5BV1 A;  1OWP A;  4MFR A;  4UWG A;  3M65 A;  1E7V A;  4C9B B;  5ARG A;  2ODV A;  3QDN A;  5LFA A;  3L08 A;  1WM5 A;  1HF8 A;  5LJM A;  4X1Y E;  4ASK A;  4HS2 A;  4L2L A;  4MLP A;  4HEA A;  5JRE A;  1UCU A;  4JC8 A;  5FYM A;  1FVH A;  4PS7 A;  4GYR A;  4HOR A;  5LHI B;  4O4L E;  1HZ4 A;  5FMN A;  4R7L A;  2KWH A;  2OV8 A;  4BJN A;  3VKG A;  5HWX A;  2JMH A;  1Y8M A;  4FLB A;  4ZHQ E;  2MBG A;  4ANJ A;  3CHM A;  3HKB E;  4C90 A;  3IBE A;  1H7C A;  2NW7 A;  3AAE B;  3FBL A;  2CLY B;  2XPZ A;  3PZD A;  4KVM A;  3O48 A;  4N3B A;  4H9O C;  3VLE A;  4Y6W A;  3KVA A;  3OJA A;  2LSY A;  5LCW C;  5G04 J;  5L3E B;  4OYJ A;  2X0L B;  2V7J A;  4G1T A;  5LHG B;  3PEU B;  1FIO A;  4AKH A;  1HU3 A;  1E8W A;  2EHO D;  3QC1 A;  4AM9 A;  1N54 A;  4AP2 A;  5HXR A;  3PUJ A;  3U78 A;  2NWB A;  5LCY A;  2N2N A;  4GZC A;  4M1P A;  5JHA A;  2WXO A;  5JJ6 A;  3RO2 A;  5TAO A;  5G55 A;  4FA6 A;  4AQF C;  2PBI A;  3FUN A;  5FY0 A;  2A5U A;  2WXL A;  5DBK A;  3TJP A;  4A1G A;  3BG1 B;  3LS8 A;  4NUU A;  2JJ9 A;  5FP3 A;  4CXW A;  4BWR A;  3CWZ B;  2X6H A;  4JHJ A;  3LPZ A;  1S0P A;  2VWA A;  3T5X A;  4UQX A;  3CHO A;  3Q47 B;  4MBQ A;  1MIV A;  1HG2 A;  5KX5 E;  3OXL A;  3AU5 A;  2WPV A;  2WM9 A;  3FUI A;  3UUM A;  3PUA A;  3HI2 A;  3MJX A;  2CHX A;  4AKL A;  4GB9 A;  5LNK A;  3SNX A;  3HKD E;  4DMW A;  3CHS A;  2WXH A;  1MND A;  4RG9 A;  3ZHE B;  3MX3 A;  4UWH A;  3APD A;  3O4Z A;  2RA1 A;  4UWF A;  5H6Q B;  2J1D G;  3HHM A;  1HTJ F;  5M72 A;  4JA9 A;  3QB2 A;  2BTD A;  2X6F A;  3B7R L;  3ULQ A;  3RRC A;  2KIN B;  3R84 B;  2JEK A;  3PNL B;  4KZ0 A;  5KJL A;  5KMG P;  4Q69 A;  3HYM B;  2UY1 A;  2WBL A;  2QGS A;  3CVX A;  2CHW A;  2YNQ A;  4WWN A;  2X38 A;  3WI3 A;  1E90 A;  3U4T A;  3FEX A;  4EXT A;  4G2V A;  5E76 A;  4ZI2 C;  4OK0 A;  2XAS B;  4L1B A;  3UMV A;  3ENE A;  5M4Y A;  5J08 A;  3FTU A;  5BUZ A;  1SA0 E;  4L5G A;  1QNF A;  3EJN A;  5FQ7 A;  1FCH A;  1D1B A;  1TJF A;  1WLX A;  4TV9 E;  5AEN A;  3SGH A;  4GYW A;  2M67 A;  3HL6 A;  2DBA A;  4YFS A;  4UEM A;  4OYK A;  3LK3 B;  3PTR B;  5E0O A;  3D9P A;  4M3O A;  4CDN A;  2W62 A;  4I6G A;  2NW8 A;  3LY7 A;  3C4X A;  2EHO B;  3IV0 A;  3NF1 A;  4KYO B;  2I59 A;  4OHF A;  4CI2 B;  3HVE B;  4P0B A;  4ISS A;  4WAF A;  1FEW A;  4GU5 A;  5KJM A;  5AJD A;  3VKH A;  4AQG A;  1HS6 A;  3C51 A;  3KAE A;  3SI5 A;  2LHR A;  5LOZ A;  3GW4 A;  4GCN A;  2XAJ B;  4YHJ A;  2JQQ A;  3CVR A;  4UV9 B;  4AVX A;  4OFZ A;  4I1A A;  5BNW A;  4WW0 A;  3C4Z A;  3ASF A;  4J2C A;  3RRN B;  5T4Y A;  5C8Y E;  3AS4 A;  2DNX A;  3RYH E;  4U8H A;  4WBO A;  3CST A;  1ZU2 A;  4AXH A;  4PS8 A;  5A23 A;  3QUJ A;  4DND A;  2Z6E A;  4ZOL E;  5T8I A;  4GMJ A;  1OWA A;  1Z0P A;  3FUM A;  2D0T A;  3UFE A;  5JDL A;  3LK2 B;  3RC3 A;  2KCL A;  3S7B A;  3ZVV A;  3ML8 A;  2IQC A;  4H9Q C;  2Y4T A;  2CG2 A;  4OVU A;  4EQF A;  3I1A A;  5DIZ A;  5L3F B;  2R59 A;  4JLE A;  5BT1 A;  4UXN B;  3MZL B;  3O1H A;  4RVB A;  4NUV A;  3VLF A;  3FTZ A;  1T98 A;  3D9O A;  3FDH A;  3ZCI A;  3L09 A;  4N2Q A;  1QQE A;  3RK6 A;  3FP3 A;  2VL8 A;  2MHK A;  3NBX X;  5JDM A;  3ONL A;  3RC8 A;  2RP4 A;  1EDU A;  4WBN E;  5JDH A;  4AV7 A;  3G2S A;  3MEK A;  4DBR A;  3RKV A;  4KBM B;  4H9P C;  3ZMT B;  3RPU A;  4JUY A;  3Q49 B;  1FMV A;  2J4B A;  2XAH B;  4IIJ E;  5JRC B;  2QA7 A;  3S7F A;  5JVD E;  3O9X A;  4KVO A;  2AXZ A;  1LKX A;  3BK9 A;  3Q5M A;  4HE8 A;  1N52 A;  3KV9 A;  3SF4 A;  2J07 A;  5EKQ D;  2WXK A;  4TUU A;  4V1A v;  3UX4 A;  1WR6 A;  2X9H A;  4GIW A;  3PDY A;  5GON E;  3ZCJ A;  2PFV A;  3FUJ A;  3ZHE A;  3LFM A;  4MAL A;  4I1M A;  5HXC A;  2DHR A;  4BY6 A;  4TV8 E;  3G2W A;  4UQZ A;  3GZ1 A;  3S7D A;  4NAC A;  4GZD A;  2LO6 A;  2KZT A;  2DCF A;  3LEW A;  3JC6 C;  3FU3 A;  3CVY A;  5CB4 E;  3VTX A;  1SHZ C;  4FJY A;  4QX7 B;  2WXF A;  2HR2 A;  4N3C A;  1NP7 A;  4JPS A;  3QWP A;  3UUN A;  2X6K A;  2FO7 A;  3UT4 A;  5A7D B;  4B8C B;  2UY1 B;  4YVO A;  1OWM A;  2I1K A;  4IDZ A;  3PUS A;  1MMD A;  1TJC A;  3N9P A;  4F1S A;  1XNF A;  2RG8 A;  3TKL B;  1PY1 A;  3R7Q A;  3CEQ A;  4EPZ A;  3QWV A;  2D2S A;  1IJ5 A;  3U64 A;  3EDU A;  4GA1 A;  3MGB A;  4TN7 B;  4MKT A;  5KJK A;  1BR0 A;  3ZPJ A;  4CXY A;  3ZEF B;  5ARF A;  4PJJ A;  3RU0 A;  4AJW A;  3Q4A B;  3IHY A;  1D0Z A;  3CHP A;  2L0I A;  3KVB A;  5FZQ A;  2LT3 A;  3CKD A;  1NWM X;  3APF A;  5FWQ A;  2IC6 A;  3PNT B;  5LGN B;  3E0Z A;  3FTV A;  2FF4 A;  2PQN A;  3ANW A;  2V7M A;  4GML A;  2L3L A;  3PUG A;  4UV8 B;  5JDG A;  2JMK A;  5JR9 A;  5FZS A;  4U0Z A;  3AA7 B;  4AXP A;  4PS3 A;  4WNK A;  2VKJ A;  5FT9 A;  4BTA A;  3OYZ A;  3RX6 A;  4GA2 A;  2C5K T;  2J9Q A;  3PE3 A;  5EK3 A;  3AA0 B;  2XPY A;  3FWV A;  4G2A A;  1ZEE A;  4HOU A;  2NXP A;  3DPD A;  4IE5 A;  4PJL A;  3FH7 A;  5LXT E;  5HWY A;  4GA0 A;  3SS1 A;  3HVE A;  2CWO A;  1FMW A;  4TV3 A;  1D0X A;  3C98 A;  4I9E A;  3CVQ A;  4JVS A;  3CML A;  3FTS A;  2C0S A;  4BT9 A;  3ZRH A;  2BVM A;  3LJC A;  5HAX A;  4A3T A;  5D0O D;  3FHN A;  3N9O A;  3NRX A;  2GRM A;  1DNP A;  3ZXS A;  3U3I A;  2DI4 A;  3JC6 D;  3D9N A;  5JJT A;  4HFG A;  3PE4 A;  2DCP A;  4W9R A;  4FC8 A;  1UN8 A;  2K24 A;  4H9S E;  1QSD A;  3MKD A;  3O1I A;  2IJG X;  3SD5 A;  4GZ3 A;  2JLB A;  4JEU A;  3CQG B;  2IOL A;  2R5S A;  2CEA A;  1H6K A;  2WSS V;  5J2U E;  2LAI A;  3GZ2 A;  2ZM8 A;  5CA0 E;  3K3N A;  4I6J A;  2BZB A;  5JHB A;  3FU6 A;  5CMY A;  4HOT A;  5EZY E;  2R17 C;  3HIZ A;  3UUX A;  2ZM0 A;  4ZS3 A;  3N2O A;  4JEU B;  2LSG A;  2Q7F A;  3IF8 B;  1P5Q A;  3AAA B;  3ZMS B;  2HYZ A;  1U3C A;  2WXR A;  4ACK A;  5FQ4 A;  3TG4 A;  1HXI A;  4LER A;  4KZC A;  1D1A A;  3ZMV B;  3URZ A;  2PQR A;  4U0U A;  3CQC B;  3QAR A;  4CGW A;  3KBT A;  4Z8X A;  4PFP A;  3I4R B;  4H7Y A;  3ZMZ B;  2KC7 A;  3KEZ A;  5HYA A;  3QOU A;  4IE4 A;  2A4Z A;  3IBP A;  4JXT A;  1NZN A;  2IW5 B;  4O4J E;  3F57 A;  4QXH B;  5CCM A;  2XGS A;  2LM9 A;  4DLO A;  2PM7 A;  2LOP A;  3ML9 A;  3FTW A;  3N5L A;  2WAU A;  3E4B A;  4XKB A;  2C0L A;  3FY4 A;  2J09 A;  2V7I A;  4N39 A;  3AS8 A;  3O4X E;  4EOZ B;  2LSU A;  4XI9 A;  3EIJ A;  3ESK A;  2CMR A;  4PAG A;  2E9X C;  1GW6 A;  3QJZ A;  2AXU A;  3IKO B;  3MZK B;  2KND A;  4WWP A;  4UEL A;  2W0G A;  1KLX A;  3CIA A;  3SFZ A;  1JUQ A;  3K3O A;  4BFR A;  4F53 A;  5HXS A;  5LBQ B;  4J8E A;  3R7R A;  4PUC A;  3RRU A;  5FJY A;  4JEH B;  4UVA B;  3FUE A;  2P58 C;  2C5J A;  3C4W A;  2X9W A;  2YIN A;  4J8F A;  2V26 A;  5JJ7 A;  3F2E A;  4AY5 A;  1KT1 A;  3FH5 A;  5L3C B;  4GK0 E;  5FXW A;  2LNI A;  1UG3 A;  3ZN3 A;  2UWJ G;  3FB2 A;  2XGO A;  4O2B E;  3WAK A;  2M63 A;  2KT9 A;  2KCK A;  4HKA A;  3N2K E;  3PS6 A;  4I43 B;  3B7T A;  4ILH B;  4FJO A;  3CKC A;  1LF8 A;  1Y64 B;  1BR4 A;  2CFZ A;  4ZI2 D;  4C91 A;  3LY8 A;  3MKR A;  5KJN A;  4H63 V;  4HFV A;  3RO3 A;  3HA4 A;  3I9W A;  3UTK A;  3FTY A;  5HXH A;  4EBA G;  2WXN A;  4QX8 B;  2V1D B;  3OXG A;  4G25 A;  3SRZ A;  4UWK A;  2I1J A;  4CI3 B;  5C2Y A;  2X3M A;  2AXV A;  3Q5W A;  2WXQ A;  4IRU A;  2WXI A;  4ANW A;  2LHN A;  3OXF A;  3MKQ A;  3ZEF A;  3HDX A;  1Z3Y A;  2VK9 A;  2VSO E;  3L13 A;  5H6R B;  1NAF A;  2BVL A;  4CGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...