2WM9A

Structure of the complex between dock9 and cdc42.
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
423
structure length
407
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 148
structure length 407
sequence length 423
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wm9A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wm9A01
2WMOA 2YINA 3B13A 2WMNA 2WM9A 3VHLA
chains in the Genus database with same CATH superfamily
4AY6A 3BEEA 2AXVA 2IO2C 3DSWA 3S7FA 4UI9C 3LK42 4GMJA 3UXGA 1ZHCA 3RIUA 2WWUA 3RPUA 5KXJA 4ANJA 2WZIA 3JADA 2XQ0A 3VU7H 2LHRA 3AA6B 3CSFA 2ACXA 4DV7T 3HYMB 3AG2E 4KP3C 2X0LB 4JI4T 2UXNB 5FTPA 1SZAA 4DBRA 3DPDA 4IDPA 3L82A 3JQ1A 4C9BB 5CB4E 3D9IA 1H19A 1S63A 4H63H 3TLVA 3ZYQA 3PEVB 5CFBA 5BNWA 3HHMA 5HKPA 1ZEEA 2EHOD 4IGUA 3T1HT 4EIWA 4FULA 2IF4A 3AU4A 4TNWA 2LXMA 4HTEA 4HFDA 2WXRA 1H6KA 1MMAA 3DBSA 3ZNGA 2V7LA 4KYOB 3QOUA 5EIBE 2X6FA 4CGVA 4M3OA 1IBKT 1T72A 1H0AA 4I50E 4GA1A 2CXFA 1HS6A 1SQMA 3C4WA 3AG1E 2W4XA 3RIFA 4IE0A 3FZFB 2KM4A 2KMFA 4B89A 1LTXA 3Q9UC 2RG8A 2BG9E 3VTYA 4L5GA 3FUDA 1UN9A 3Q79A 1D1BA 4AVXA 4HOTA 2Q9QA 4DLQA 3PUGA 5EYLA 3RLFF 4RVBA 3L54A 2CBJA 1SHZC 3P4WA 5AARA 1E7UA 3ML8A 3U66A 4Q94A 1SZ9A 2NTXA 5AAOA 2I1JA 4GK5E 4A3TA 5KWDA 5JH7E 4IDZA 2MYSA 3L22A 4HWDA 3VKHA 4J0UA 5AQHB 3JXJA 2LAIA 3N71A 5FXVA 5F3JA 3AEEA 4HRMB 4NIQA 3VKGA 2KWIB 2H6GA 2RFAA 1XNRT 1DC2A 2LOSA 3SI5A 2PL2A 3LEWA 2D0TA 3NBXX 5L2LA 1FEWA 2V7KA 4OAVB 3UT8A 5ENSD 1MZCA 5H6RB 2GRMA 4I55E 3DRAA 1W09A 2X9HA 2KZ7B 4FLBA 2X66A 4PUCA 4DBQA 1N4QA 1Z5SC 4FLHA 3FWVA 4EECA 4O60A 1HTJF 3EUHA 4DV0T 1TNUA 2P9PG 4NIKA 4E85A 4WNKA 2XAFB 1T8BA 5LBMA 4V3IA 2BVLA 5FIOA 3HXEA 1LKXA 5HYAA 2FJBA 3KSLA 4DI3A 5C8YE 2BUGA 2CHNA 3CPZA 2IUBA 5AQMB 4CZZB 3RIAA 4BTBA 4O2AE 3U4TA 1HCIA 2NXPA 1BR1A 2KZTA 3UUBA 4ZI2D 2YNQA 2LSKA 1NAFA 3GYZA 3Q5MA 4N3CA 5JTGA 3OJAA 3CX7B 3MZKB 5JQGE 1MNEA 2EIME 3K8PC 2XY8B 1TJFA 4KHPT 1TN8A 2RA1A 5HEGA 4LCTA 4LUNU 3PZ4A 2DI4A 2LEHA 3AVRA 3IV0A 2Y69E 1G8XA 2VK9A 3HVEB 3MYVA 3RSEG 2YN6A 4AKIA 4GOUA 3G2TA 3N9MA 4N2QA 3ULEG 5BUZA 5AJLA 1OY3D 1MIVA 3NRXA 4ZS2A 3C3QA 2IONA 3FXEB 2ZGGA 3OAWA 1NZNA 4L2YA 3Q7FA 3ZJ1A 1KK7A 4P09A 2LKHA 5IHYA 4DUZT 1OWOA 3JQ0A 2UXBT 2J8SD 2M6IA 5IY5E 1NWMX 2JJ9A 3V5SA 4A1GA 3AU5A 3W15B 3KBUA 4MALA 4APOA 4OYJA 3AEDA 2NC9A 1TJCA 2CEAA 4J6IA 4NUVA 3FUMA 3TLTA 3AE5A 3FTYA 5G04J 4DIDB 3IA3A 2XEVA 2XSBA 1NFIE 5HWYA 2AXUA 3OXFA 2PNNA 2WXGA 5HI7A 1W3BA 2B0OE 2ODUA 3ZT6A 4J8YA 4DJAA 4U8HA 4HFBA 2KXPC 2BKNA 2A2FX 5FXXA 4LF4T 5ABFA 5C2TA 2L9QA 1ZB1A 2EILE 2V5DA 4E6HA 3LY9A 4IULA 4U74A 4ILCA 3UT5E 3FH5A 4GA2A 4JHKA 2L6JA 3WG7E 1IQRA 3KAEA 4CDMA 4F8HA 1O1TA 4AJWA 3UU8A 4JI8T 2R6GF 2LAHA 3E08A 3EU9A 3P4PA 2VGEA 2OLTA 4YNDA 5ENTD 3L9TA 5L3BB 3KSQA 5LG3A 4A55A 4KZCA 4G25A 2BKKB 3E22E 3ABME 3EJNA 4FJYA 2IFUA 2DYSE 3HA4A 3RO2A 1I6ZA 3FBLA 3P2BA 4AM9A 4CCAA 3FHEA 2I1KA 2E0IA 3J5QB 1E8YA 2LT3A 4O6FA 3UIPC 5C3JA 3D0TA 1UX5A 2ZM6T 2ZIRA 5FJYA 3BQLA 4ZZCA 1MIYA 1O1RA 5HWXA 3TWTA 3OYXA 2CMRA 1HG5A 3SFEA 4TX5A 3TLWA 3MJWA 2A5UA 1V9DA 3GN5B 4F3VA 2WXLA 2AXZA 3O1JA 4IRUA 5E76A 4C91A 2GRPB 2E9XA 3ASHA 3L8RA 2MYOA 3UTMA 3CIRA 2A5EA 1L0VA 5FINA 5KNHD 5FNVE 3AAAC 1JWGA 3ZFWA 3ZC0A 5AIJA 2WCAA 4CN1A 2V7JA 3LK3B 2F8XK 2ODVA 1HXIA 4DUIA 1WR6A 2BG9C 1P5QA 5AJDA 3MV2B 4LMJA 3S4UA 5HXEA 2B76A 2P9KG 3Q5EA 3OXGA 1IBMT 4GTQA 3Q78A 4I1OB 2C5KT 3FU5A 4OFZA 3CK7A 2IIUA 4ZZBA 3BQOA 3PUXF 4UI9K 2Q9QC 5FQ7A 2H6IA 3AEGA 2BS2A 3QAQA 4DV1T 3B95A 3ZC1A 2WXJA 2XSAA 2EHOB 4Z91A 1Z6TA 1WFDA 4GTVA 4U8VD 4UV8B 4GKJT 1Q2ZA 4LF8T 1AJ3A 2J47A 3EVYA 3ASGA 3HIZA 2DWZA 5KJMA 3OTNA 1PY1A 4C0MA 3PZ2A 4XZCA 4YY3T 4TXPA 5KCMA 2CCQA 2UWJG 2W61A 2H89A 3WAKA 4EV6A 3CV0A 2V6YA 2H7OA 4JYAT 5FL1A 2LSGA 3EHQA 4HFHA 5ARGA 2IJGX 2YU2A 5HRYA 1JNZA 3KV4A 3NBNB 4LSZE 1N34T 1UCUA 3I9WA 2EIJE 4JEUB 4YDWA 3RU0A 5L4HA 3IKOB 2VGXA 4IL4A 3DTOA 1WAO1 3KV5A 2D2SA 3SD5A 4U7IA 2J4BA 1NEKA 4A5XA 1XNFA 1KT0A 3EIQC 5J2UE 3BG1B 4ZI3D 2X6IA 1WR0A 3FDHA 3MKRA 3C50A 4GTTA 4C0EA 1XGWA 1IJ5A 2I0MA 1EYHA 1JCSA 3N5LA 3QOFA 3CHSA 1HNZT 1E7VA 2JQKA 1K1BA 1J5WA 4MHCA 3Q4AB 2JMHA 3EUVA 1N4PA 4NPPA 2XPKA 2M67A 3ABLE 2OEVA 3E4BA 3QNKA 5ABGA 1BI8B 5BXUA 4WBNE 3B7BA 3LCAA 4ME2A 4HRNA 3LK2B 1KNPA 4OYKA 1QSDA 2L3LA 4CT0A 4BJNA 4DV6T 3SFDA 2AW6A 4UVBB 5A7DB 1K8KG 4U0UA 3MJXA 4DR7T 1DVPA 4E7SA 2XPIA 3K3NA 2F8YA 3SS1A 3F31A 4JI7T 3LJNA 1PC2A 3CQXC 4PJJA 3L16A 2K9AA 3ZMUB 4NXMT 1H7CA 3HRAA 3N2KE 1R8IA 3TWQA 1FMVA 3UUXA 3LJ3A 1FJGT 3VLFA 3AE6A 1E8ZA 3NOGD 1E7PA 2MRIA 5EN5D 3APFA 3TWRA 1ZOYA 5JHBA 2VGYA 3HL6A 3TWSA 3Q5XA 1OCZE 5LP0A 2FO1E 4F6RC 2WXNA 5AQNB 4ADZA 5JMND 4I2ZA 2K24A 5ETWA 1H2TC 1QBQA 5CERB 1FT1A 4IDOA 3HXDA 3CR3A 5HCJA 3PDYA 3ZEFB 3M65A 3JUIA 4PAGA 3TG4A 4ANWA 3FZHB 2CHZA 4QX7B 4WW0A 2XZDG 3VRBA 3PURA 5G04C 1OCRE 2JMKA 4TXRA 4EBAG 2AWIA 1IZNB 2XUEA 3UPVA 1HH8A 4ANUA 2P9LG 3P50A 3ASNE 4AXHA 2P2CP 5CMYA 4DVDA 3EHMA 3LXUX 1D0XA 2XS8A 3GZ1A 3ZVVA 4NUUA 5T3RA 5AQLB 5T8IA 4AIFA 3LVRE 1SW6A 3KVBA 4B3TT 2V8SE 3A7MA 3CVPA 5DQWA 4HN9A 4KMCA 4DV2T 3ZT5A 1J1JA 3FFLA 4RSYA 2WU5A 3L13A 3QKYA 3AE1A 4A56A 1MMNA 1I94T 2XAHB 2HE0A 1BLXB 3ANWA 3ASFA 2J4GA 4EYUA 2N2NA 5M72A 2LSUA 4ISTA 2LSYA 5FQ6A 4N3AA 1HNWT 1ZV4X 2ZLYA 4WWOA 1UUSA 1AWCB 2AE9A 4U7YA 4G8LA 2NR4A 4HFCA 1D8EA 4KMOA 2HH7A 3UM0A 1OEDA 4EBAA 5FY7A 3IHVA 2A4ZA 1Y64B 1IBLT 2WVIA 3JC6D 2IY0C 3R9AB 5HEJA 2CE7A 2PJQA 1MQSA 4XBFB 3CEQA 3MX3A 3DWLG 1OEDE 1EF1C 3CKBA 4PDXA 2XZTG 2QYUA 3AS4A 2XM1A 2QC9A 4Z8XA 3NZQA 3HDXA 1DNPA 3PEUB 4U04A 3CHPA 4FADA 4UEMA 3D9PA 2V7MA 5HEUA 3RC3A 1Y8MA 1ZU2A 2QRXA 3FU6A 2A3DA 2KCVA 1XMOT 3V2XA 4O4IE 4HWFA 4IE7A 2KNDA 4I9CA 4J8DA 4JHRA 5JA4D 3VR9A 3EDVA 2R03A 2VURA 4CYMD 2JQHA 1G73A 2P58C 5DIZA 1KPSB 2LSJA 3RC8A 3IF8B 1OWAA 3U3WA 4CI2B 2LLYA 5A23A 5LXTE 4LF7T 2YQ8A 3UT7A 3FEXA 2OOEA 4TV3A 3URZA 4GZ3A 2YEVC 2I9CA 3E33A 4QX8B 2L6BA 4JI1T 1SA0E 3EDUA 5KJKA 1OCCE 3PUWF 4HWHA 4L9IA 4AI6A 3K9IA 2JRKA 3E32A 1M7KA 3QWVA 3N9QA 1WM5A 2WMOA 3KDSE 4LMKA 1K1AA 4N78D 3Q5DA 1KFYA 1GQEA 3ZT7A 2X51A 2V7IA 4A1SA 3QWWA 1US7B 4XI0A 3FY4A 4DR5T 1QNFA 4JA7A 3TAXA 5A6CA 2HR2A 4UXNB 1N4RA 3NWIA 2BKGA 3BK9A 3D9KA 2QYJA 1TR4A 2BBJA 1MHQA 2NOXA 3NVOA 1QLBA 2P9NG 4ILIA 2V8SV 3EU5A 4DR3T 4LRZA 1HNXT 1VDYA 1MX2A 2BS4A 3LJCA 4TXQA 5LFAA 2NSZA 3CK8A 5E75A 5KDMC 2UXDT 3V31A 3ONJA 4K5AB 5FVLA 2RD0A 5IYZE 2GGFA 2J1DG 1YKEB 4UWFA 1M62A 2G0UA 2X9XA 2YDSA 5BR8T 2BG9A 4U31A 4TWFA 3C98A 4TUUA 4KHZF 1J5ET 1VCTA 4ZXLA 3CMLA 2FO7A 3PREA 4O4JE 3I4GA 1YMPA 2HN2A 4OX9T 2XEHA 3H37A 3EI0A 1UOHA 3TL5A 3CVLA 4KX6A 3BQIA 4FHJA 3DJBA 1E1HB 5ARFA 4H9QC 2XQ5A 1UJJA 1HZ4A 3V79K 2K3WA 3D9HA 5AQSB 3LYAA 2P9SG 3ZYMA 5CRUA 1FIOA 4JXTA 4MLKA 2B6CA 1BR4A 2NW8A 5G55A 2XS1A 4COFA 3IBPA 5AFUL 2XPYA 4A63B 1B89A 1UX4A 5LX8A 4K5CA 4DX6D 1WYCA 5J0ZA 3RKGA 4IE6A 4I43B 4DX5D 2OV9A 2DCPA 5GONE 3EAMA 2R05A 1FCHA 2VVSA 3IBEA 2WXHA 4X20E 2WQ7A 4HOSA 3Q75A 1YD8G 3D9JA 3DSUA 4HQDA 2CM0A 4NXNT 1UJKA 3NZSA 4QH1A 3ABKE 1A5EA 3ZSTA 3ZKRA 4MS6A 3OVUA 3CLJA 4TZ4C 1TNZA 2IMLA 4LF6T 4AKRB 5JR9C 4DNDA 3G2SA 3W9GA 2UXCT 1D8DA 1LRZA 1H6PA 4H9PC 4HFGA 2DIWA 4X5TA 4WNGA 4JI3T 3GA8A 2WAUA 2X67A 1DU2A 4HGAA 4JPSA 5F8PA 2W2UA 1E8XA 2I2OA 1D0ZA 2XJ7A 3S2AA 2KC7A 3UMVA 3DSSA 3QJZA 4GCNA 5EILA 2V6XA 4TV9E 4JI0T 1OEDC 2CHXA 5CCLA 4PK4A 4ASKA 1INZA 3FU0A 4I4TE 2WXFA 3UU5A 3RQWA 2HN1A 4H7XA 4OAUC 4WBOA 3ZHEA 4N39A 4DR1T 3KV9A 3CX6B 4BT9A 4QFVA 4BESA 4NQ0A 2CLYC 3V2OA 2FJEA 3H3MA 5ABFB 3PE0A 4LFBT 4B94A 3O4XE 4LNUD 2FEZA 5LMUT 1N52A 2BVMA 4HORA 3ONKA 3VLEA 2NW9A 4DRXE 3Q9DA 4I6EA 2LE8A 4XKCA 2X9YA 1X79A 4B3MT 3JUEA 3FZMB 4NURA 3UUNA 5CEDB 2RFMA 3RGLA 3J9X1 3U3IA 2CG3A 3AE7A 1U5PA 3MKQB 4DPRA 2YINA 3AE3A 3ZMTB 3PE3A 4KT6B 4WZXA 2ZM8A 4PJNA 2ZGDA 2X9WA 1Z0PA 1N36T 1N95A 3AAIA 2IEJA 2PG8A 4ILAA 3NOCD 4PS3A 2DHRA 2ZM2A 3UX4A 4ZHBA 2WDVA 3OPCA 5JDQA 1W0BA 2H6FA 2J4DA 3VTXA 4H9OC 5AQJB 4I1AA 4B3RT 1N9AA 4UQYA 4TWDA 2D5UA 1T7SA 4RG9A 2E9XB 2Y8DA 4ILUA 5BT1A 2BKOA 5JDFA 4X62T 4AQGA 3PDNA 4YTMA 4QKNA 2N9DA 2VJ8A 1WCRA 3IEGA 2HO1A 3TXNA 3UQ7A 4EPZA 1ZBPA 4YSZA 3P1UA 4UWKA 2BBHA 4GIWA 5FQ8A 2HPLA 3C64A 3LBXB 3PVLA 3T9KA 5AQKB 5G05J 2JEKA 2JIWA 2VQET 2F37A 4UWHA 3MV3B 3UT4A 3NQPA 5CGMA 4AQFA 1QUUA 4U63A 3QUJA 4P1NA 4CGWA 3ESLA 2CPTA 3WI3A 3ZCIA 3ZN1B 2WDQA 3JCKC 4RQIA 4YDOA 2WXOA 4KXKB 2R2LA 4URKA 3FXDB 3D9OA 4TV8E 3N2GE 2ZMAA 4HOUA 2F0YA 4UR9A 4GKKT 4IREA 5ABHA 4O4HE 4YVQC 1BR0A 3P7IA 4GYWA 1S70B 1VOMA 3VR8A 3ZXPA 1TNOA 3T5VA 1N94A 4ACLA 3GW4A 4WAFA 3MACA 4GYYA 3ZIMA 3T5XA 1E90A 5ENRD 1MX6A 5JVDE 5ANLA 2CXLA 2Y0BG 4LEUA 3T1YT 1O3XA 4X8QA 4JV5T 4ZOLE 4O1OA 4G2VA 2OCCE 5BV1A 3GWHA 3ETVA 3LSVA 2IU1A 5CA0E 2OV8A 5ADXL 2XRYA 3Q73A 5J90A 2MOWA 2VL0A 4BEPA 3CVNA 5LJMA 3EDTB 5L3DB 2PM6A 4DX1A 3CQCB 2VGXB 4EB6E 4U7EB 2DVWA 2FJAA 4M1PA 3BUAA 2CWOA 4XKBA 1EZ3A 3NAWA 4JBWF 2E8IA 5CBNA 3PE4A 3HXFA 3CGHA 3C4ZA 5HEHA 1N0QA 3AJIA 4EZJA 2BZBA 4UQXA 3I9YA 5JREA 4IIJE 4F7AA 2VSYA 4UF0A 2IOLA 3KD7A 2VYIA 1W0AA 5G2NA 4GZCA 1QQEA 4YT0A 4O4LE 1SA4A 4IT4A 5BV0A 2WXIA 2Q9QD 4FJZA 2AXDS 2YHCA 2ACZA 3SFYA 2BKPA 3MA5A 4H9NC 1OWMA 3EHNA 3O1HA 4YFSA 2QVAA 3AECA 3OBVE 2VVNA 4I17A 5LJNA 3DSXA 2C5IT 3ZN0B 1K3ZD 3B5MA 2MBGA 3AA1B 3N9LA 1XZYA 4C48B 2X3MA 4AIUA 2XHEA 4UI9J 3AB3B 2KCLA 2WMNA 3B7TA 4KI0F 2L8KA 3AXJA 4APFA 2I6HA 4BSXA 3ZGQA 3ZCJA 2X6JA 2XGSA 4JEHA 2DZNA 4L9PA 1TYQG 2XQ8A 4O2BE 4AP2A 2WQHA 2UUCT 4C90A 3UUXB 4XEIG 4XIFA 5E0OA 5EX0A 4K0UA 5CA1E 2VKJA 2IOSA 3G06A 3UU4A 3RK6A 2JQ9A 5ITZF 2I59A 2VL8A 1S94A 2EHOA 4TWHA 2C2LA 4CN4A 5FP3A 5BPPA 2GRNB 1FMWA 4DMVA 5HXHA 2E5LT 1ELRA 1NP7A 2XCCA 4UWLA 2UUBT 4YLHA 1OWNA 3SWHA 2LOPA 4GYOA 4BY6A 5B3SE 2YHEA 2VASA 1TNYA 4UUCA 4RG6A 3QWPA 5KJNA 3F2EA 3PH0C 4ERRA 5CMWA 3IEEA 3JAFA 3FUEA 1KNRA 2LRKA 4DV4T 4ZEYA 3RYIE 4G1TA 4JVSA 3SF4A 3EABA 3UKUG 3KINB 4WNDA 5CCMA 3ZJ2A 2VB6A 4YTPA 4V1Av 4MKTA 5AQPB 2V0PA 5JDNA 2CWYA 3MGBA 3NZUA 5A1LA 3CIAA 3UM3A 2BS3A 3HKEE 4CZ2D 3DPYA 4ANVA 3DEPA 3ABVA 2B1EA 2XAJB 3QB5A 1LD8A 1YQ3A 4P0BA 5AQGB 5H7PA 1D1AA 3HXCA 1X9BA 3D3MA 2H3RA 5LB7B 3ZU7B 1SA5A 2WXQA 3W9FA 3ZLIA 2VKHA 5L4EA 3PNLB 2E2AA 2CHWA 3PUYF 2HYZA 4YSYA 4TUMA 3X2QE 3UKRG 2ILRA 4IYPA 4M7CA 5EX3A 2ZXWE 4IE5A 2WS3A 4DO0A 5M4YA 1JCRA 2VTBB 4IDQA 4B0ZA 3JXIA 4F6RD 3UULA 4FP7A 4EGWA 2LHNA 3RHWA 3A5XA 3ETUA 3ZUVB 1SE7A 2GK9A 5CHEE 1OEDB 4PFOA 4AQFC 4HFIA 2CFZA 5KNGA 4GB9A 5FVKA 5FL0A 4U96D 1O5MA 4YHJA 2WM9A 2Q7FA 1LVKA 3RX6A 3FH8A 5JHAA 4AV7A 2H7VC 3R7QA 4LNGA 4HI8A 3ESKA 4MRUA 2R5SA 4UV9B 1HE8A 2BDEA 3UI2A 3HXBA 4F1PA 2VSNA 3AEBA 5JR9A 5B1AE 4HWCA 3B7UX 5LNKA 1UURA 4DX2A 4BJMA 4BX9A 4MFRA 5FXZA 3PUSA 4GTRA 4QXHB 2WDRA 3C5RA 5FQ4A 2YOEA 3B7RL 4HWIB 4DR2T 3A8YC 3DXKG 3L08A 4YJ2E 3PJAJ 4J8FA 4LF9T 3E0ZA 2K5BB 5ENNA 4HLEA 2N1GA 1Z3YA 2C0SA 1TN7A 2UXXB 1UW4B 2IQCA 4K0KT 2DCFA 2LNIA 2E9XD 4HB5A 3ZXSA 1XDOA 2KXPB 5ENOD 2RKKA 3CVYA 3TLUA 4LNBA 4U95D 3C51A 2FJDA 2JPFA 3TWVA 4JI2T 4GK0E 2X6KA 3NKZA 2Y4TA 1FVFA 2BEDA 4JA9A 5EZYE 2M6BA 3UQ4A 2W00A 1UG3A 5AQIB 2CFUA 4IE4A 1LF8A 3AVSA 5JDMA 1N0RA 3CVWA 4XX5A 4GTMA 3SY2A 3Q47B 4G2AA 5IUXA 3UTKA 1PAQA 5AQ9A 5JJTA 1HFAA 4FA6A 2PM7A 2VKDA 4LF5T 3APCA 4DLOA 4K03A 2DZOA 3TLSA 1X81A 4AKGA 2L9BA 3ENEA 2WXPA 4J8SA 2Y3AA 4EYYR 5LP6E 5JDGA 3CX8B 2D9DA 2AVPA 3NB2A 5LMNT 1YYHA 5AQQB 2VSXE 1RZ4A 1T98A 2XZEA 4HLLA 4AY5A 5JRCA 5J08A 2AJAA 5EK3A 1ZP0A 3UFEA 2C0LA 3QNUA 2H88A 1A17A 4BTAA 3LS8A 3PUKA 3T8MA 1TN6A 2EINE 2W63A 5J2TE 3AAAB 4HEAA 3QB2A 4QH5A 2MHKA 3HKBE 5TAOA 2WWVA 2Y1LE 3PZ3A 1IXVA 4WNFA 3UINC 3U78A 5LGTB 3ISMC 4DR6T 1SVXA 2BG9B 3RYCE 4EQFA 1E96B 2W62A 5HXRA 2DLRA 4GAAA 4K5BA 3S7DA 4OK0A 4PFPA 2Y4UA 5AENA 5FZQA 3D9NA 2K48A 2EHOC 1KF6A 2LKGA 1U4QA 4JHJA 4CEMA 1CUNA 4GPMA 4YXDA 3FUKA 3LDZA 4TRQA 1D0YA 2CRBA 1VRBA 2XAQB 2Q9QB 4PNIA 3ZMZB 2CG2A 5EDSA 2PTFA 1IKND 4HOQA 3O9XA 3AE8A 3P4RA 3L09A 1CHUA 4AISA 3SZ7A 2XEEA 4K0RA 5LGNB 2DBAA 2WPVA 4U72A 1NI1A 2PQNA 3ULYA 1MMGA 2C5JA 2UY1A 4GZ6A 5CRVA 1KLXA 1YCSB 3KEZA 3EHRA 4B6XA 3DEOA 3ASOE 3VRAA 1MMDA 2XASB 2XENA 4HRLA 4PH4B 1YA0A 3HKCE 3HKDE 3J7Yq 2WU2A 4DV3T 4ACKA 4UVAB 3JYSA 5AQAA 3SNXA 4X1YE 4QWNB 5JJ7A 4DUYT 4DR4T 3E30A 3TWWA 4UVCB 2HHHT 1AP7A 2OEWA 3BU8A 4GYSA 4CN6A 4ILBA 2C0MA 5CEAA 3PUQA 3N9OA 4J8EA 5HQ8A 2XM2A 4E7ZA 3WXXA 4YVOA 2KWHA 3VLDA 2YDQA 2IW5B 3MZLB 3AS5A 3NZPA 4JZYA 3PU8A 4HBDA 4LFAT 3UM2A 1HX1B 2MOZA 2L0IA 1H2VC 3RH3A 3FP3A 3RKOA 2XQ4A 3M3ZB 1WRDA 3RIBA 2IC6A 2WY2A 1Z3XA 3UUMA 3JCFA 1BU9A 4B8CB 3AA7B 4IHJE 3K3QC 3TKLB 4OHFA 3UIOC 4Q96A 4G26A 2KZTB 1JCQA 2W0GA 2J09A 2LJLA 1BPOA 4AQYT 4KZ0A 3MEKA 3WAJA 3D9LA 3FTXA 4ILGA 4XZ4A 4EEDA 1U2VG 3MXZA 3ZHEB 3OXLA 5AQOB 4PS7A 3U9WA 3PRZA 3ZYLA 3FUJA 1OCOE 3PUVF 4EZHA 2ZM0A 4O8SA 5JDHA 2BTDA 5JDLA 5KBAA 4GMRA 2P9BA 2LO6A 5FT9A 4LERA 3S7JA 1QZ2A 3Q5WA 3RYHE 4FC8A 5FZRA 2RPAA 3F57A 4KBMB 3L17A 1UGOA 1NA3A 2W66A 3RI5A 1N33T 2XGMA 5ENPD 3N9PA 4TNVA 4EOZB 1OT8A 5LCWJ 5AQTB 5DJQC 4X1IE 2P9UG 2ZU6B 4ABNA 2V1DB 4CI1B 3C3RA 2XAGB 2GRLA 4ZI2C 2XQ9A 5DBKA 1IYGA 3I0QA 5D0OD 2CA5A 4Z90A 4I2WA 5CJ5A 4X1KE 2WZHA 4B8AA 4AOFA 2J49A 4L23A 2YDRA 3H3AA 3FZLB 4GA0A 3UU3A 3SFZA 1S35A 2LUHA 1UK5A 3QDNA 4N5CA 2J9QA 2JQQA 3P4SA 1WG0A 1HX8A 3IHYA 4EEBA 2MPKA 4FJOA 3FU3A 4MBGA 4R7LA 5FKYA 4ZFHA 4HVBA 5CBOA 2FF4A 5FYMA 4I43A 4CDNA 5BMVE 4KBQA 2QYWA 5L3FB 3AG4E 3MKDA 1JNRA 5FMNA 4GPKA 3I3NA 1DCEA 2FBNA 2NYJA 4O1PA 2QGSA 4BT8A 2EIKE 3E37A 3RRMB 1L5JA 5L3CB 2YK0A 3QC9A 3CKCA 2WBLA 2X0YA 4H63V 5LHIB 2KT9A 2OA5A 4ZHQE 4YHHT 3LPZA 3FHNA 4A97A 4AXPA 4N5QA 5HS0A 2VSOE 5C1DA 3P8CD 3D9MA 1B7TA 3BG0B 4GU5A 1X5BA 4DV5T 3LDQB 1IJ6A 1V54E 3CQGB 2XGOA 4Z68A 4H9SE 4YSXA 5HXCA 2FUPA 4AEZC 5HEOA 2IHR1 3ASDA 1BI7B 3AAEB 4HFVA 4I6JA 4XAXB 3AG3E 4ANXA 2OVFA 3SRZA 3I4RB 3LY8A 3ONLA 2M63A 4FI5A 2MAWA 4N2SA 5KMGP 1MIWA 2J62A 5D2MC 4OVVA 3ULQA 4LMLA 4H9RC 2V4HC 4JC8A 2XQ3A 2WSSV 3R6NA 2GROB 1JPLA 3RRCA 3UQ3A 1XWMA 3HVEA 4YDYA 4BWRA 3O4ZA 3DSVA 3RIUC 3SOLA 3PU3A 2CHOA 4HKAA 1EDUA 1FT2A 4HXIA 2NWBA 4EHMA 2DWKA 2A72A 3ZKJA 3B13A 1N32T 2LSIA 2H6HA 5AQBA 3L39A 4YJ3E 3FTSA 5EK4A 3AEAA 4JLEA 4P0AA 4LFCT 3DP7A 3OTOT 3EIJA 4NRHB 2V4LA 1YQ4A 2D0UA 4CDRA 3MKQA 3U64A 4PJLA 3CK9A 3S7BA 2LXLA 4UF0B 1WYBA 4DK5A 5FXWA 4F53A 4U2YA 5AQRB 3Q9NC 1MX4A 5LOZA 3B7SA 4EXTA 3RO3A 4X66T 2V6YB 2V5FA 1OWLA 4CXXA 5BW8C 3LFMA 3FTZA 4G24A 4ISSA 4CQIA 4G63A 1WDYA 3HG0D 4GTPA 3L6AA 3J5PA 1U3DA 4XE0A 3GZSA 2GRRB 5LOVE 4L1BA 1E8WA 3G2VA 1NENA 5FY0A 3P4QA 1DCQA 2KLQA 3LY7A 3IXEA 4PJMA 2KINB 5KJLA 4MBQA 3LBXA 3VHLA 2XHEB 5L3GB 2X6HA 4FHKA 5BXOA 4L0RA 3AXJB 4JI6T 1D9SA 5L3EB 1HG2A 4EZ4A 4BETA 4EZLA 5FZSA 3KBTA 2MTQA 1BD8A 3G2WA 4PS8A 1HR0T 4IDNA 4JEHB 3FZKB 2X68A 5LHHB 3ONXA 5F5WA 2UUAT 1O1SA 2VKOA 2QFCA 3RKVA 3DXMG 1YW0A 4ATZD 5ABEA 3RYFE 4WYVA 3BQKA 4ZS3A 3ML9A 3EHZA 4TUYE 2WXKA 3TG5A 2J08A 3FH7A 3Q49B 2XQ7A 4QQIA 4J7WA 3GN5A 1LD7A 4UIGA 2Y48B 3AS8A 1N11A 2FULA 3ZSSA 2IDOB 4DI4A 3R7RA 3TXMA 2VWAA 1YXRA 4U33A 4I0UA 4PK6A 5EYPF 2LSVA 3TWUA 3R9MA 2LM9A 3AE9A 2WQYA 4ZI3C 3PUJA 5LYJE 1SUMB 4X64T 3AE2A 4JI5T 2ES0A 3N9NA 2CBIA 4Q69A 5ANRA 1IAPA 4ILHB 3SGHA 3DSTA 4F1SA 3MK7C 4LG6A 2ETCA 1MNDA 3O1IA 2NW7A 5L47A 3UU6A 4ZI7E 4AKHA 3HR0A 3ZMVB 1KZOA 3TJPA 3QB5K 3GZ2A 5ENQD 1HU3A 4GZDA 3SHFA 4ATGA 2NTYA 4DMWA 4KVOA 2ZISA 3PUAA 3PV0F 3CSTA 2OVBA 3CHMA 2XRZA 2PBIA 4HS2A 1H6OA 2KCKA 3SO8A 2XTLA 3K1SA 1JUQA 5DQVA 3RRUA 4BA9A 3RJVA 4GTSA 4Y6WA 4BFRA 1TNBA 1IHGA 3PZ1A 5LCWC 4MLPA 3CVQA 3RF1A 4J2CA 1N54A 4U3CA 2R17C 2XCBA 5LGUB 1XMQT 1Z8UA 3G2UA 1KT1A 1QYMA 4HE8A 3Q7AA 3OYZA 1V55E 3PTRB 1E2AA 3IHRA 4RLYA 3R84B 2FI7A 4TN7B 2VQ2A 4OVUA 2F4VT 3C72A 4CT4A 3PNTB 4CXWA 4DX7D 1Y6IA 4JEUA 5AQVB 2WXMA 4CXYA 4QXCB 4A3VA 3K3OA 4P29A 2UU9T 2QA7A 2HPJA 1WY6A 2RP4A 2PQRA 5EKQD 3ZYKA 2IAKA 4NACA 3PUZF 5JJ6A 2EQXA 2IC9A 5FWQA 4U0SA 3B57A 5B1BE 4CI3B 3FEYA 4QH4A 3KVAA 3GMIA 1NL4A 2J07A 3KV6A 3NRYA 3N2OA 1OXJA 3AA0B 4YTNA 3FTVA 4QXBB 1OUVA 3HI2A 5HXSA 5HCMA 3LG7A 3APDA 2GW1A 2WQ6A 1MYOA 5JR9B 3SFXA 2WB2A 3CVRA 4AKLA 4U07A 3CHOA 3AE4A 3SBTB 3ZPOA 3T8OA 2ETAA 5LG4A 1HS7A 1D1CA 4I9EA 3ANWB 2P9IG 3CHQA 3RQUA 1IQUA 2E2EA 3ONLC 2ETBA 4GTOA 2CXDA 4Y6CA 3FBZA 1NA0A 2DL1A 4D10C 4L2LA 4UWGA 2YU1A 3UFGA 3QK0A 2HM8A 3KS2A 3O48A 2R02A 5DABA 2V5QC 2VQFT 3MA9A 1UN8A 1WLXA 1FPPA 4U2ZA 3FUIA 3ZMSB 3FUFA 4HNAD 4U8YD 3RRNB 3TWXA 1H2UA 1S0PA 4G23A 3ZW3A 2V5CA 1ZKEA 4UELA 3CKDA 3I1AA 5LHGB 3I5PA 3SQVA 1FVHA 1KZPA 2WB5A 5D66A 2CLYB 5AQFB 2JLBA 3FUHA 4FU3A 3PS6A 5G05C 5LA6E 3FB2A 5HAXA 5FY1A 4WNEA 3OKQA 2LM2A 1HO8A 2DYRE 2FBWA 2PFVA 3LKUA 5AYWD 4GYRA 4WWNA 4EZKA 1EPUA 1ELKA 4JUYA 5KX5E 4U0ZA 2XQAA 2XQYA 2X0HA 4Q25A 2L0TB 1BR2A 4N3BA 3V5UA 1VCSA 2DNXA 4G11A 3JC6C 3ZEFA 4I1MA 3JAEA 1MJ0A 3CHRA 1KEYA 3TGOA 2E9XC 5C2YA 4I6GA 4X65T 4GZ5A 3NF1A 3FTWA 1W9RA 3QC1A 5AN8A 5T4YA 2XPZA 4L7TA 2GRQB 1U3CA 2YKSA 4EAHA 5JRCB 5AQUB 2VTBA 5EK2A 3LVQE 4HI9A 4QHOA 3I0OA 3PJAA 4CRWA 2W67A 2E5VA 3CVVA 5IWAT 4W9RA 2X38A 2QZAA 1TEZA 2IO3C 3Q15A 2WP9A 5AQ7A 2ONDA 3E34A 3PZDA 3ZPJA 2A9UA 3RAUA 4GCOA 2JABA 4PK5A 1IHBA 3V30A 4BSZB 1KNZA 3SBSA 2KATA 2LRLA 4KUMB 4JD2G 5CECB 1YKHB 5H6QB 3QARA 3T8KA 3ZRHA 3FTUA 4PW8A 3CVUA 4WUYA 1RW2A 4KVMA 1GW6A 3F6QA 2KSRA 2BF0X 2XQ6A 3QK6A 1N4SA 2Y6XA 3RRWA 1OWPA 5EIDA 4BX8A 1JWFA 5LCYA 4IN3B 3L3PA 3C4XA 3AEFA 1XDPA 2DWGA 2V26A 4JW1A 1G3NB 4A98A 4UQZA 3CVXA 5J1GA 2Z6EA 2QY7A 4JB8P 1HF8A 3FUNA 2R59A 2KBXA 3KEAA 4JL0A 2PZIA 3FULA 4G8KA 4B93B 3MCXA 4YDEA 5D0QD 3X1DA 2SPCA 3KFWX 4GMLA 2UY1B 4WWPA 1ELWA 3CK6A 3UM1A 4OYSA 3CWZB 3ZN3A 1Y01A 4HFEA 3C3OA 1LVFA 1XNQT 4B3ST 1S64A 4IL9A 4H7YA 1OXZA 5LBQB 3Q2MA 4XI9A 4BAYB 3C98B 2NP9A 4BERA
chains in the Genus database with same CATH topology
4AY6A 3BEEA 2AXVA 3S7FA 4UI9C 3LK42 4GMJA 1ZHCA 2WWUA 3RPUA 4ANJA 2XQ0A 3VU7H 2LHRA 3AA6B 3CSFA 2ACXA 3HYMB 4KP3C 2X0LB 2UXNB 5FTPA 1SZAA 4DBRA 3DPDA 3JQ1A 4C9BB 5CB4E 3D9IA 1H19A 4H63H 3ZYQA 3PEVB 5BNWA 3HHMA 1ZEEA 2EHOD 4IGUA 4EIWA 4FULA 2IF4A 3AU4A 4HTEA 2WXRA 1H6KA 1MMAA 3DBSA 2V7LA 4KYOB 3QOUA 2X6FA 4CGVA 4M3OA 1H0AA 4I50E 4GA1A 2CXFA 1HS6A 1SQMA 3C4WA 4IE0A 2KM4A 2KMFA 4B89A 2RG8A 3VTYA 4L5GA 3FUDA 1UN9A 1D1BA 4AVXA 4HOTA 2Q9QA 4DLQA 3PUGA 4RVBA 3L54A 1SHZC 1E7UA 3ML8A 3U66A 4Q94A 1SZ9A 2NTXA 2I1JA 4GK5E 4A3TA 5JH7E 4IDZA 2MYSA 3L22A 3VKHA 4J0UA 2LAIA 3N71A 5FXVA 5F3JA 3VKGA 2KWIB 2LOSA 3SI5A 2PL2A 3LEWA 2D0TA 3NBXX 5L2LA 1FEWA 2V7KA 3UT8A 5H6RB 2GRMA 4I55E 2X9HA 2KZ7B 4FLBA 2X66A 4PUCA 4DBQA 4FLHA 3FWVA 4EECA 1HTJF 3EUHA 4E85A 4WNKA 2XAFB 5LBMA 4V3IA 2BVLA 1LKXA 5HYAA 4DI3A 5C8YE 2BUGA 3CPZA 4CZZB 4BTBA 4O2AE 3U4TA 1HCIA 2NXPA 1BR1A 2KZTA 4ZI2D 2YNQA 2LSKA 1NAFA 3GYZA 3Q5MA 4N3CA 3OJAA 3CX7B 3MZKB 5JQGE 1MNEA 3K8PC 1TJFA 2RA1A 4LCTA 4LUNU 2DI4A 2LEHA 3AVRA 3IV0A 1G8XA 2VK9A 3HVEB 3MYVA 4AKIA 4GOUA 3G2TA 3N9MA 4N2QA 5BUZA 5AJLA 1MIVA 3NRXA 4ZS2A 2IONA 3FXEB 3OAWA 1NZNA 4L2YA 3ZJ1A 1KK7A 4P09A 5IHYA 1OWOA 3JQ0A 1NWMX 2JJ9A 3V5SA 4A1GA 3AU5A 3W15B 3KBUA 4MALA 4APOA 4OYJA 2NC9A 1TJCA 2CEAA 4J6IA 4NUVA 3FUMA 3FTYA 5G04J 2XEVA 5HWYA 2AXUA 3OXFA 2WXGA 5HI7A 1W3BA 2ODUA 4DJAA 4U8HA 2A2FX 5FXXA 2L9QA 4E6HA 3LY9A 4IULA 4U74A 3UT5E 3FH5A 4GA2A 4JHKA 2L6JA 1IQRA 3KAEA 4CDMA 4AJWA 2LAHA 3E08A 4YNDA 5L3BB 4A55A 4KZCA 4G25A 3E22E 3EJNA 4FJYA 2IFUA 3HA4A 3RO2A 3FBLA 3P2BA 4AM9A 4CCAA 3FHEA 2I1KA 2E0IA 1E8YA 2LT3A 4O6FA 3D0TA 1UX5A 5FJYA 3BQLA 1MIYA 5HWXA 3OYXA 2CMRA 1HG5A 4TX5A 3MJWA 2A5UA 1V9DA 3GN5B 4F3VA 2WXLA 2AXZA 3O1JA 4IRUA 5E76A 4C91A 2E9XA 3ASHA 5FNVE 5AIJA 1JWGA 3ZFWA 3ZC0A 2V7JA 3LK3B 2ODVA 1HXIA 1WR6A 1P5QA 5AJDA 3MV2B 3S4UA 5HXEA 3OXGA 4I1OB 2C5KT 3FU5A 4OFZA 3CK7A 4UI9K 2Q9QC 5FQ7A 3QAQA 3ZC1A 2WXJA 2EHOB 1Z6TA 4UV8B 3ASGA 1AJ3A 3EVYA 3HIZA 5KJMA 3OTNA 1PY1A 4C0MA 4XZCA 5KCMA 2CCQA 2UWJG 2W61A 3WAKA 3CV0A 2H7OA 2LSGA 5ARGA 2IJGX 2YU2A 3KV4A 1UCUA 3I9WA 4JEUB 3RU0A 3IKOB 2VGXA 3DTOA 1WAO1 3KV5A 2D2SA 3SD5A 2J4BA 1XNFA 1KT0A 3EIQC 5J2UE 3BG1B 4ZI3D 2X6IA 3MKRA 3FDHA 3C50A 4C0EA 1XGWA 1IJ5A 1EYHA 3N5LA 3CHSA 1E7VA 4MHCA 3Q4AB 2JMHA 2M67A 3QNKA 3E4BA 4WBNE 3LCAA 4ME2A 3LK2B 4OYKA 1QSDA 2L3LA 4CT0A 4BJNA 2AW6A 4UVBB 5A7DB 4U0UA 3MJXA 1DVPA 4E7SA 2XPIA 3K3NA 3SS1A 3F31A 1PC2A 3CQXC 4PJJA 3L16A 2K9AA 3ZMUB 1H7CA 3N2KE 1FMVA 3UUXA 3LJ3A 3VLFA 1E8ZA 2MRIA 3APFA 5JHBA 2VGYA 3HL6A 3Q5XA 5LP0A 4F6RC 2WXNA 4ADZA 4I2ZA 2K24A 5ETWA 1H2TC 3CR3A 3PDYA 3ZEFB 3M65A 3JUIA 4PAGA 3TG4A 4ANWA 2CHZA 4QX7B 4WW0A 3PURA 5G04C 2JMKA 4EBAG 2AWIA 1IZNB 2XUEA 3UPVA 1HH8A 4ANUA 4AXHA 5CMYA 4DVDA 3EHMA 3LXUX 1D0XA 3GZ1A 3ZVVA 4NUUA 5T3RA 5T8IA 4AIFA 3LVRE 3KVBA 2V8SE 3CVPA 5DQWA 4HN9A 4KMCA 3FFLA 4RSYA 3L13A 3QKYA 4A56A 1MMNA 2XAHB 3ANWA 3ASFA 4EYUA 2N2NA 5M72A 2LSUA 4ISTA 2LSYA 5FQ6A 4N3AA 1ZV4X 2ZLYA 4WWOA 4KMOA 2HH7A 4EBAA 5FY7A 3IHVA 2A4ZA 1Y64B 2WVIA 3JC6D 3R9AB 2CE7A 2PJQA 1MQSA 4XBFB 3CEQA 3MX3A 1EF1C 3CKBA 4PDXA 3AS4A 3PEUB 4Z8XA 3NZQA 3HDXA 1DNPA 4U04A 3CHPA 4FADA 4UEMA 3D9PA 2V7MA 3RC3A 1Y8MA 1ZU2A 3FU6A 2A3DA 2KCVA 4O4IE 4IE7A 2KNDA 4I9CA 4J8DA 4JHRA 3EDVA 1G73A 2P58C 5DIZA 2LSJA 3RC8A 3IF8B 1OWAA 3U3WA 4CI2B 5A23A 5LXTE 2YQ8A 3UT7A 3FEXA 2OOEA 4TV3A 3URZA 4GZ3A 2YEVC 2I9CA 4QX8B 1SA0E 3EDUA 5KJKA 4L9IA 4AI6A 3K9IA 2JRKA 3QWVA 3N9QA 1WM5A 2WMOA 3KDSE 4N78D 2X51A 2V7IA 4A1SA 3QWWA 1US7B 4XI0A 3FY4A 1QNFA 3TAXA 4JA7A 5A6CA 2HR2A 4UXNB 3BK9A 3D9KA 1MHQA 2NOXA 4ILIA 4LRZA 1VDYA 3LJCA 5LFAA 2NSZA 3CK8A 5E75A 5KDMC 2RD0A 5IYZE 2GGFA 2J1DG 1YKEB 4UWFA 2G0UA 2X9XA 3C98A 4TUUA 3CMLA 2FO7A 3PREA 4O4JE 3I4GA 3H37A 3TL5A 3CVLA 3BQIA 4FHJA 3DJBA 1E1HB 5ARFA 4H9QC 1UJJA 1HZ4A 3LYAA 3ZYMA 1FIOA 4JXTA 4MLKA 1BR4A 2NW8A 5G55A 3IBPA 5AFUL 2XPYA 1B89A 1UX4A 5LX8A 1WYCA 4IE6A 4I43B 2DCPA 5GONE 1FCHA 3IBEA 2WXHA 4X20E 2WQ7A 4HOSA 1YD8G 3D9JA 2CM0A 1UJKA 3NZSA 4MS6A 3CLJA 4TZ4C 4AKRB 5JR9C 4DNDA 3G2SA 1LRZA 4H9PC 4HFGA 2DIWA 4WNGA 3GA8A 2WAUA 2X67A 4HGAA 4JPSA 5F8PA 1E8XA 2I2OA 1D0ZA 3S2AA 2KC7A 3UMVA 3QJZA 4GCNA 4TV9E 2CHXA 5CCLA 4PK4A 4ASKA 1INZA 3FU0A 4I4TE 2WXFA 4H7XA 4WBOA 3ZHEA 4N39A 3KV9A 3CX6B 4BT9A 4QFVA 4NQ0A 2CLYC 3PE0A 4B94A 3O4XE 2FEZA 1N52A 2BVMA 4HORA 3ONKA 3VLEA 2NW9A 3Q9DA 4I6EA 2LE8A 4XKCA 2X9YA 1X79A 4NURA 3UUNA 3J9X1 3U3IA 2CG3A 1U5PA 3MKQB 4DPRA 2YINA 3ZMTB 3PE3A 4KT6B 2ZM8A 4PJNA 2X9WA 1Z0PA 3AAIA 2PG8A 4PS3A 2DHRA 2ZM2A 3UX4A 5JDQA 2J4DA 3VTXA 4H9OC 4I1AA 4UQYA 2D5UA 4RG9A 5BT1A 2E9XB 2Y8DA 4ILUA 5JDFA 4AQGA 3PDNA 4QKNA 2N9DA 2VJ8A 3IEGA 2HO1A 3TXNA 4EPZA 1ZBPA 3P1UA 4UWKA 4GIWA 5FQ8A 2HPLA 3C64A 3LBXB 3PVLA 5G05J 2JEKA 4UWHA 3MV3B 3UT4A 3NQPA 4AQFA 1QUUA 4U63A 3QUJA 4CGWA 3ESLA 3WI3A 3ZCIA 3ZN1B 3JCKC 2WXOA 4KXKB 4URKA 3FXDB 3D9OA 4TV8E 3N2GE 2ZMAA 4HOUA 4O4HE 4YVQC 1BR0A 3P7IA 4GYWA 1VOMA 3T5VA 4ACLA 3GW4A 4WAFA 3MACA 4GYYA 3ZIMA 3T5XA 1E90A 5JVDE 5ANLA 2CXLA 4LEUA 1O3XA 4ZOLE 4G2VA 5BV1A 3GWHA 3ETVA 2IU1A 5CA0E 2OV8A 5ADXL 2XRYA 5J90A 2MOWA 3CVNA 5LJMA 3EDTB 5L3DB 2PM6A 3CQCB 2VGXB 4EB6E 4M1PA 2CWOA 4XKBA 1EZ3A 2E8IA 3PE4A 3CGHA 3C4ZA 4EZJA 2BZBA 4UQXA 3I9YA 5JREA 4IIJE 4F7AA 2VSYA 4UF0A 2IOLA 3KD7A 2VYIA 5G2NA 4GZCA 1QQEA 4O4LE 5BV0A 2WXIA 2Q9QD 4FJZA 2YHCA 3MA5A 4H9NC 1OWMA 3EHNA 3O1HA 4YFSA 3OBVE 4I17A 5LJNA 2C5IT 3ZN0B 2MBGA 3AA1B 3N9LA 2X3MA 2XHEA 4UI9J 3AB3B 2KCLA 2WMNA 3B7TA 2L8KA 4APFA 2I6HA 4BSXA 3ZGQA 3ZCJA 2X6JA 2XGSA 4JEHA 4O2BE 4AP2A 2WQHA 4C90A 3UUXB 4XIFA 5E0OA 5EX0A 4K0UA 5CA1E 2VKJA 2IOSA 3RK6A 2I59A 2VL8A 1S94A 2EHOA 2C2LA 5FP3A 5BPPA 1FMWA 4DMVA 5HXHA 2XCCA 1ELRA 1NP7A 4UWLA 1OWNA 4YLHA 3SWHA 2LOPA 4GYOA 4BY6A 2YHEA 2VASA 4RG6A 3QWPA 5KJNA 3F2EA 3PH0C 4ERRA 5CMWA 3IEEA 3FUEA 3RYIE 4G1TA 4JVSA 3SF4A 3KINB 4WNDA 5CCMA 3ZJ2A 2VB6A 4V1Av 4MKTA 2V0PA 5JDNA 2CWYA 3MGBA 3NZUA 5A1LA 3CIAA 3HKEE 4ANVA 2B1EA 2XAJB 4P0BA 1D1AA 3D3MA 2H3RA 2WXQA 3ZLIA 2VKHA 3PNLB 2CHWA 2HYZA 2ILRA 4IYPA 5EX3A 4IE5A 4DO0A 5M4YA 2VTBB 4B0ZA 3UULA 4FP7A 2LHNA 3A5XA 3ETUA 2GK9A 5CHEE 4PFOA 4AQFC 2CFZA 4GB9A 4YHJA 2WM9A 2Q7FA 1LVKA 3RX6A 3FH8A 5JHAA 4AV7A 2H7VC 3R7QA 3ESKA 4MRUA 2R5SA 4UV9B 1HE8A 2BDEA 2VSNA 5JR9A 3B7UX 5LNKA 4BJMA 4BX9A 4MFRA 5FXZA 3PUSA 4QXHB 5FQ4A 3B7RL 3L08A 4YJ2E 4J8FA 3E0ZA 2K5BB 5ENNA 4HLEA 2N1GA 1Z3YA 2C0SA 2UXXB 1UW4B 2IQCA 2DCFA 2LNIA 2E9XD 3ZXSA 2KXPB 3CVYA 3C51A 2JPFA 4GK0E 2X6KA 2Y4TA 1FVFA 4JA9A 5EZYE 1UG3A 2W00A 2CFUA 4IE4A 1LF8A 3AVSA 5JDMA 3CVWA 4XX5A 3Q47B 4G2AA 1PAQA 3UTKA 5JJTA 1HFAA 4FA6A 2PM7A 2VKDA 3APCA 4DLOA 4K03A 4AKGA 2L9BA 3ENEA 2WXPA 4J8SA 2Y3AA 4EYYR 5LP6E 5JDGA 3CX8B 2AVPA 2VSXE 1T98A 4AY5A 5JRCA 5J08A 5EK3A 3UFEA 2C0LA 4BTAA 1A17A 3LS8A 3PUKA 3T8MA 2W63A 5J2TE 3AAAB 4HEAA 3QB2A 2MHKA 3HKBE 5TAOA 4WNFA 3U78A 5LGTB 3RYCE 4EQFA 1E96B 2W62A 5HXRA 2DLRA 4GAAA 3S7DA 4OK0A 4PFPA 2Y4UA 5AENA 5FZQA 3D9NA 2K48A 2EHOC 1U4QA 4JHJA 4CEMA 1CUNA 3FUKA 3LDZA 4TRQA 1D0YA 2XAQB 1VRBA 2Q9QB 4PNIA 3ZMZB 2CG2A 5EDSA 4HOQA 3O9XA 3L09A 3SZ7A 4K0RA 5LGNB 2DBAA 2WPVA 4U72A 2PQNA 1MMGA 2C5JA 2UY1A 4GZ6A 1KLXA 3KEZA 4B6XA 1MMDA 2XASB 4PH4B 1YA0A 3HKCE 3HKDE 3J7Yq 4ACKA 4UVAB 3JYSA 3SNXA 4X1YE 4QWNB 5JJ7A 4UVCB 4GYSA 2C0MA 3PUQA 3N9OA 4J8EA 5HQ8A 4E7ZA 3WXXA 4YVOA 2KWHA 3VLDA 2IW5B 3MZLB 3AS5A 3NZPA 4JZYA 3PU8A 2MOZA 2L0IA 1H2VC 3RH3A 3FP3A 3RKOA 1WRDA 3RIBA 2IC6A 1Z3XA 3UUMA 4B8CB 3AA7B 4IHJE 3K3QC 3TKLB 4OHFA 4Q96A 4G26A 2KZTB 2W0GA 2J09A 2LJLA 1BPOA 4KZ0A 3MEKA 3WAJA 3D9LA 3FTXA 4ILGA 4XZ4A 3ZHEB 3MXZA 3OXLA 4PS7A 3U9WA 3PRZA 3ZYLA 3FUJA 2BTDA 4EZHA 2ZM0A 4O8SA 5JDHA 5JDLA 2P9BA 2LO6A 5FT9A 4LERA 3S7JA 1QZ2A 3Q5WA 3RYHE 4FC8A 5FZRA 3F57A 4KBMB 3L17A 1NA3A 2XGMA 3N9PA 4EOZB 5LCWJ 5DJQC 4X1IE 2ZU6B 4ABNA 2V1DB 4CI1B 2XAGB 2GRLA 4ZI2C 5DBKA 1IYGA 3I0QA 5D0OD 2CA5A 4I2WA 4X1KE 4B8AA 4AOFA 2J49A 4L23A 3H3AA 4GA0A 3SFZA 1S35A 3QDNA 4N5CA 2J9QA 2JQQA 1HX8A 3IHYA 4FJOA 3FU3A 4R7LA 4HVBA 2FF4A 5FYMA 4I43A 4CDNA 5BMVE 4KBQA 5L3FB 3MKDA 5FMNA 4GPKA 3I3NA 2FBNA 2QGSA 4BT8A 3RRMB 1L5JA 5L3CB 2YK0A 3QC9A 3CKCA 2WBLA 4H63V 5LHIB 2KT9A 2OA5A 4ZHQE 3LPZA 3FHNA 4AXPA 2VSOE 5C1DA 3P8CD 3D9MA 1B7TA 3BG0B 4GU5A 1X5BA 1IJ6A 3CQGB 2XGOA 4H9SE 5HXCA 4AEZC 3ASDA 3AAEB 4HFVA 4I6JA 4XAXB 4ANXA 2OVFA 3SRZA 3I4RB 3LY8A 3ONLA 2M63A 4FI5A 4N2SA 5KMGP 1MIWA 4OVVA 3ULQA 4H9RC 4JC8A 2WSSV 3R6NA 1JPLA 3RRCA 3UQ3A 3HVEA 4BWRA 3O4ZA 3SOLA 3PU3A 4HKAA 1EDUA 4HXIA 2NWBA 2DWKA 2A72A 3B13A 2LSIA 4YJ3E 3FTSA 5EK4A 4P0AA 4JLEA 3DP7A 3EIJA 4NRHB 2V4LA 2D0UA 4CDRA 3MKQA 3U64A 4PJLA 3CK9A 3S7BA 4UF0B 1WYBA 4DK5A 5FXWA 4F53A 5LOZA 3B7SA 4EXTA 3RO3A 2V5FA 1OWLA 4CXXA 5BW8C 3LFMA 3FTZA 4G24A 4ISSA 4CQIA 4G63A 3L6AA 4XE0A 1U3DA 3GZSA 5LOVE 4L1BA 1E8WA 3G2VA 5FY0A 2KLQA 3LY7A 4PJMA 2KINB 5KJLA 4MBQA 3LBXA 3VHLA 2XHEB 5L3GB 2X6HA 4FHKA 4L0RA 5L3EB 1HG2A 4EZ4A 4EZLA 5FZSA 3KBTA 2MTQA 3G2WA 4PS8A 4JEHB 2X68A 5LHHB 3ONXA 2VKOA 2QFCA 3RKVA 1YW0A 3RYFE 3BQKA 4ZS3A 3ML9A 4TUYE 2WXKA 3TG5A 2J08A 3FH7A 3Q49B 3GN5A 4UIGA 2Y48B 3AS8A 2FULA 4DI4A 3R7RA 3TXMA 2VWAA 4PK6A 2LSVA 2LM9A 4ZI3C 3PUJA 5LYJE 2ES0A 3N9NA 4Q69A 5ANRA 1IAPA 4ILHB 3SGHA 4F1SA 3MK7C 1MNDA 3O1IA 2NW7A 4ZI7E 4AKHA 3HR0A 3ZMVB 3TJPA 3GZ2A 1HU3A 4GZDA 3SHFA 4ATGA 2NTYA 4DMWA 4KVOA 3PUAA 3CSTA 2OVBA 3CHMA 2XRZA 2PBIA 4HS2A 2KCKA 2XTLA 1JUQA 5DQVA 3RRUA 4BA9A 3RJVA 4Y6WA 4BFRA 1IHGA 5LCWC 4MLPA 3CVQA 4J2CA 1N54A 2R17C 2XCBA 5LGUB 3G2UA 1KT1A 4HE8A 3OYZA 3PTRB 3IHRA 3R84B 2FI7A 4TN7B 2VQ2A 4OVUA 4CT4A 3PNTB 4CXWA 1Y6IA 4JEUA 2WXMA 4CXYA 4QXCB 4A3VA 3K3OA 4P29A 2QA7A 2HPJA 1WY6A 2RP4A 2PQRA 5EKQD 3ZYKA 2IAKA 4NACA 5JJ6A 2EQXA 2IC9A 5FWQA 4U0SA 3B57A 4CI3B 3FEYA 3KVAA 3GMIA 2J07A 3KV6A 3NRYA 3N2OA 3AA0B 3FTVA 4QXBB 1OUVA 3HI2A 5HXSA 3LG7A 3APDA 2GW1A 2WQ6A 5JR9B 2WB2A 3CVRA 4AKLA 4U07A 3CHOA 3SBTB 3ZPOA 3T8OA 5LG4A 1HS7A 1D1CA 4I9EA 3ANWB 3CHQA 1IQUA 2E2EA 2CXDA 4Y6CA 3FBZA 1NA0A 4D10C 4L2LA 4UWGA 2YU1A 3QK0A 2HM8A 3KS2A 3O48A 5DABA 3MA9A 1UN8A 1WLXA 3FUIA 3ZMSB 3FUFA 3RRNB 1H2UA 1S0PA 4G23A 3ZW3A 1ZKEA 4UELA 3CKDA 3I1AA 5LHGB 3I5PA 1FVHA 2CLYB 2JLBA 3FUHA 4FU3A 3PS6A 5G05C 5LA6E 3FB2A 5HAXA 5FY1A 4WNEA 3OKQA 1HO8A 2PFVA 3LKUA 5AYWD 4GYRA 4WWNA 4EZKA 1EPUA 1ELKA 4JUYA 5KX5E 4U0ZA 2XQYA 2L0TB 1BR2A 4N3BA 3V5UA 2DNXA 4G11A 3JC6C 3ZEFA 4I1MA 3CHRA 3TGOA 2E9XC 5C2YA 4I6GA 4GZ5A 3NF1A 3FTWA 3QC1A 5T4YA 2XPZA 4L7TA 1U3CA 4EAHA 5JRCB 2VTBA 5EK2A 3LVQE 4QHOA 3I0OA 4CRWA 3CVVA 4W9RA 2X38A 1TEZA 3Q15A 2ONDA 3PZDA 3ZPJA 4GCOA 4PK5A 1KNZA 3SBSA 2KATA 4KUMB 1YKHB 5H6QB 3QARA 3ZRHA 3FTUA 4PW8A 3CVUA 4WUYA 4KVMA 1GW6A 2BF0X 3QK6A 2Y6XA 3RRWA 1OWPA 4BX8A 1JWFA 5LCYA 4IN3B 3L3PA 3C4XA 2DWGA 2V26A 4JW1A 4UQZA 3CVXA 5J1GA 2Z6EA 2QY7A 1HF8A 3FUNA 2R59A 4JL0A 2PZIA 3FULA 3MCXA 5D0QD 2SPCA 3KFWX 4GMLA 2UY1B 4WWPA 1ELWA 4OYSA 3CWZB 3ZN3A 1LVFA 4H7YA 1OXZA 5LBQB 3Q2MA 4XI9A 4BAYB 3C98B 2NP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  2YIN A;  3B13 A;  2WMN A;  2WM9 A;  3VHL A; 
#chains in the Genus database with same CATH topology
 4AY6 A;  3BEE A;  2AXV A;  2IO2 C;  3DSW A;  3S7F A;  4UI9 C;  3LK4 2;  4GMJ A;  3UXG A;  1ZHC A;  3RIU A;  2WWU A;  3RPU A;  5KXJ A;  4ANJ A;  2WZI A;  3JAD A;  2XQ0 A;  3VU7 H;  2LHR A;  3AA6 B;  3CSF A;  2ACX A;  4DV7 T;  3HYM B;  3AG2 E;  4KP3 C;  2X0L B;  4JI4 T;  2UXN B;  5FTP A;  1SZA A;  4DBR A;  3DPD A;  4IDP A;  3L82 A;  3JQ1 A;  4C9B B;  5CB4 E;  3D9I A;  1H19 A;  1S63 A;  4H63 H;  3TLV A;  3ZYQ A;  3PEV B;  5CFB A;  5BNW A;  3HHM A;  5HKP A;  1ZEE A;  2EHO D;  4IGU A;  3T1H T;  4EIW A;  4FUL A;  2IF4 A;  3AU4 A;  4TNW A;  2LXM A;  4HTE A;  4HFD A;  2WXR A;  1H6K A;  1MMA A;  3DBS A;  3ZNG A;  2V7L A;  4KYO B;  3QOU A;  5EIB E;  2X6F A;  4CGV A;  4M3O A;  1IBK T;  1T72 A;  1H0A A;  4I50 E;  4GA1 A;  2CXF A;  1HS6 A;  1SQM A;  3C4W A;  3AG1 E;  2W4X A;  3RIF A;  4IE0 A;  3FZF B;  2KM4 A;  2KMF A;  4B89 A;  1LTX A;  3Q9U C;  2RG8 A;  2BG9 E;  3VTY A;  4L5G A;  3FUD A;  1UN9 A;  3Q79 A;  1D1B A;  4AVX A;  4HOT A;  2Q9Q A;  4DLQ A;  3PUG A;  5EYL A;  3RLF F;  4RVB A;  3L54 A;  2CBJ A;  1SHZ C;  3P4W A;  5AAR A;  1E7U A;  3ML8 A;  3U66 A;  4Q94 A;  1SZ9 A;  2NTX A;  5AAO A;  2I1J A;  4GK5 E;  4A3T A;  5KWD A;  5JH7 E;  4IDZ A;  2MYS A;  3L22 A;  4HWD A;  3VKH A;  4J0U A;  5AQH B;  3JXJ A;  2LAI A;  3N71 A;  5FXV A;  5F3J A;  3AEE A;  4HRM B;  4NIQ A;  3VKG A;  2KWI B;  2H6G A;  2RFA A;  1XNR T;  1DC2 A;  2LOS A;  3SI5 A;  2PL2 A;  3LEW A;  2D0T A;  3NBX X;  5L2L A;  1FEW A;  2V7K A;  4OAV B;  3UT8 A;  5ENS D;  1MZC A;  5H6R B;  2GRM A;  4I55 E;  3DRA A;  1W09 A;  2X9H A;  2KZ7 B;  4FLB A;  2X66 A;  4PUC A;  4DBQ A;  1N4Q A;  1Z5S C;  4FLH A;  3FWV A;  4EEC A;  4O60 A;  1HTJ F;  3EUH A;  4DV0 T;  1TNU A;  2P9P G;  4NIK A;  4E85 A;  4WNK A;  2XAF B;  1T8B A;  5LBM A;  4V3I A;  2BVL A;  5FIO A;  3HXE A;  1LKX A;  5HYA A;  2FJB A;  3KSL A;  4DI3 A;  5C8Y E;  2BUG A;  2CHN A;  3CPZ A;  2IUB A;  5AQM B;  4CZZ B;  3RIA A;  4BTB A;  4O2A E;  3U4T A;  1HCI A;  2NXP A;  1BR1 A;  2KZT A;  3UUB A;  4ZI2 D;  2YNQ A;  2LSK A;  1NAF A;  3GYZ A;  3Q5M A;  4N3C A;  5JTG A;  3OJA A;  3CX7 B;  3MZK B;  5JQG E;  1MNE A;  2EIM E;  3K8P C;  2XY8 B;  1TJF A;  4KHP T;  1TN8 A;  2RA1 A;  5HEG A;  4LCT A;  4LUN U;  3PZ4 A;  2DI4 A;  2LEH A;  3AVR A;  3IV0 A;  2Y69 E;  1G8X A;  2VK9 A;  3HVE B;  3MYV A;  3RSE G;  2YN6 A;  4AKI A;  4GOU A;  3G2T A;  3N9M A;  4N2Q A;  3ULE G;  5BUZ A;  5AJL A;  1OY3 D;  1MIV A;  3NRX A;  4ZS2 A;  3C3Q A;  2ION A;  3FXE B;  2ZGG A;  3OAW A;  1NZN A;  4L2Y A;  3Q7F A;  3ZJ1 A;  1KK7 A;  4P09 A;  2LKH A;  5IHY A;  4DUZ T;  1OWO A;  3JQ0 A;  2UXB T;  2J8S D;  2M6I A;  5IY5 E;  1NWM X;  2JJ9 A;  3V5S A;  4A1G A;  3AU5 A;  3W15 B;  3KBU A;  4MAL A;  4APO A;  4OYJ A;  3AED A;  2NC9 A;  1TJC A;  2CEA A;  4J6I A;  4NUV A;  3FUM A;  3TLT A;  3AE5 A;  3FTY A;  5G04 J;  4DID B;  3IA3 A;  2XEV A;  2XSB A;  1NFI E;  5HWY A;  2AXU A;  3OXF A;  2PNN A;  2WXG A;  5HI7 A;  1W3B A;  2B0O E;  2ODU A;  3ZT6 A;  4J8Y A;  4DJA A;  4U8H A;  4HFB A;  2KXP C;  2BKN A;  2A2F X;  5FXX A;  4LF4 T;  5ABF A;  5C2T A;  2L9Q A;  1ZB1 A;  2EIL E;  2V5D A;  4E6H A;  3LY9 A;  4IUL A;  4U74 A;  4ILC A;  3UT5 E;  3FH5 A;  4GA2 A;  4JHK A;  2L6J A;  3WG7 E;  1IQR A;  3KAE A;  4CDM A;  4F8H A;  1O1T A;  4AJW A;  3UU8 A;  4JI8 T;  2R6G F;  2LAH A;  3E08 A;  3EU9 A;  3P4P A;  2VGE A;  2OLT A;  4YND A;  5ENT D;  3L9T A;  5L3B B;  3KSQ A;  5LG3 A;  4A55 A;  4KZC A;  4G25 A;  2BKK B;  3E22 E;  3ABM E;  3EJN A;  4FJY A;  2IFU A;  2DYS E;  3HA4 A;  3RO2 A;  1I6Z A;  3FBL A;  3P2B A;  4AM9 A;  4CCA A;  3FHE A;  2I1K A;  2E0I A;  3J5Q B;  1E8Y A;  2LT3 A;  4O6F A;  3UIP C;  5C3J A;  3D0T A;  1UX5 A;  2ZM6 T;  2ZIR A;  5FJY A;  3BQL A;  4ZZC A;  1MIY A;  1O1R A;  5HWX A;  3TWT A;  3OYX A;  2CMR A;  1HG5 A;  3SFE A;  4TX5 A;  3TLW A;  3MJW A;  2A5U A;  1V9D A;  3GN5 B;  4F3V A;  2WXL A;  2AXZ A;  3O1J A;  4IRU A;  5E76 A;  4C91 A;  2GRP B;  2E9X A;  3ASH A;  3L8R A;  2MYO A;  3UTM A;  3CIR A;  2A5E A;  1L0V A;  5FIN A;  5KNH D;  5FNV E;  3AAA C;  1JWG A;  3ZFW A;  3ZC0 A;  5AIJ A;  2WCA A;  4CN1 A;  2V7J A;  3LK3 B;  2F8X K;  2ODV A;  1HXI A;  4DUI A;  1WR6 A;  2BG9 C;  1P5Q A;  5AJD A;  3MV2 B;  4LMJ A;  3S4U A;  5HXE A;  2B76 A;  2P9K G;  3Q5E A;  3OXG A;  1IBM T;  4GTQ A;  3Q78 A;  4I1O B;  2C5K T;  3FU5 A;  4OFZ A;  3CK7 A;  2IIU A;  4ZZB A;  3BQO A;  3PUX F;  4UI9 K;  2Q9Q C;  5FQ7 A;  2H6I A;  3AEG A;  2BS2 A;  3QAQ A;  4DV1 T;  3B95 A;  3ZC1 A;  2WXJ A;  2XSA A;  2EHO B;  4Z91 A;  1Z6T A;  1WFD A;  4GTV A;  4U8V D;  4UV8 B;  4GKJ T;  1Q2Z A;  4LF8 T;  1AJ3 A;  2J47 A;  3EVY A;  3ASG A;  3HIZ A;  2DWZ A;  5KJM A;  3OTN A;  1PY1 A;  4C0M A;  3PZ2 A;  4XZC A;  4YY3 T;  4TXP A;  5KCM A;  2CCQ A;  2UWJ G;  2W61 A;  2H89 A;  3WAK A;  4EV6 A;  3CV0 A;  2V6Y A;  2H7O A;  4JYA T;  5FL1 A;  2LSG A;  3EHQ A;  4HFH A;  5ARG A;  2IJG X;  2YU2 A;  5HRY A;  1JNZ A;  3KV4 A;  3NBN B;  4LSZ E;  1N34 T;  1UCU A;  3I9W A;  2EIJ E;  4JEU B;  4YDW A;  3RU0 A;  5L4H A;  3IKO B;  2VGX A;  4IL4 A;  3DTO A;  1WAO 1;  3KV5 A;  2D2S A;  3SD5 A;  4U7I A;  2J4B A;  1NEK A;  4A5X A;  1XNF A;  1KT0 A;  3EIQ C;  5J2U E;  3BG1 B;  4ZI3 D;  2X6I A;  1WR0 A;  3FDH A;  3MKR A;  3C50 A;  4GTT A;  4C0E A;  1XGW A;  1IJ5 A;  2I0M A;  1EYH A;  1JCS A;  3N5L A;  3QOF A;  3CHS A;  1HNZ T;  1E7V A;  2JQK A;  1K1B A;  1J5W A;  4MHC A;  3Q4A B;  2JMH A;  3EUV A;  1N4P A;  4NPP A;  2XPK A;  2M67 A;  3ABL E;  2OEV A;  3E4B A;  3QNK A;  5ABG A;  1BI8 B;  5BXU A;  4WBN E;  3B7B A;  3LCA A;  4ME2 A;  4HRN A;  3LK2 B;  1KNP A;  4OYK A;  1QSD A;  2L3L A;  4CT0 A;  4BJN A;  4DV6 T;  3SFD A;  2AW6 A;  4UVB B;  5A7D B;  1K8K G;  4U0U A;  3MJX A;  4DR7 T;  1DVP A;  4E7S A;  2XPI A;  3K3N A;  2F8Y A;  3SS1 A;  3F31 A;  4JI7 T;  3LJN A;  1PC2 A;  3CQX C;  4PJJ A;  3L16 A;  2K9A A;  3ZMU B;  4NXM T;  1H7C A;  3HRA A;  3N2K E;  1R8I A;  3TWQ A;  1FMV A;  3UUX A;  3LJ3 A;  1FJG T;  3VLF A;  3AE6 A;  1E8Z A;  3NOG D;  1E7P A;  2MRI A;  5EN5 D;  3APF A;  3TWR A;  1ZOY A;  5JHB A;  2VGY A;  3HL6 A;  3TWS A;  3Q5X A;  1OCZ E;  5LP0 A;  2FO1 E;  4F6R C;  2WXN A;  5AQN B;  4ADZ A;  5JMN D;  4I2Z A;  2K24 A;  5ETW A;  1H2T C;  1QBQ A;  5CER B;  1FT1 A;  4IDO A;  3HXD A;  3CR3 A;  5HCJ A;  3PDY A;  3ZEF B;  3M65 A;  3JUI A;  4PAG A;  3TG4 A;  4ANW A;  3FZH B;  2CHZ A;  4QX7 B;  4WW0 A;  2XZD G;  3VRB A;  3PUR A;  5G04 C;  1OCR E;  2JMK A;  4TXR A;  4EBA G;  2AWI A;  1IZN B;  2XUE A;  3UPV A;  1HH8 A;  4ANU A;  2P9L G;  3P50 A;  3ASN E;  4AXH A;  2P2C P;  5CMY A;  4DVD A;  3EHM A;  3LXU X;  1D0X A;  2XS8 A;  3GZ1 A;  3ZVV A;  4NUU A;  5T3R A;  5AQL B;  5T8I A;  4AIF A;  3LVR E;  1SW6 A;  3KVB A;  4B3T T;  2V8S E;  3A7M A;  3CVP A;  5DQW A;  4HN9 A;  4KMC A;  4DV2 T;  3ZT5 A;  1J1J A;  3FFL A;  4RSY A;  2WU5 A;  3L13 A;  3QKY A;  3AE1 A;  4A56 A;  1MMN A;  1I94 T;  2XAH B;  2HE0 A;  1BLX B;  3ANW A;  3ASF A;  2J4G A;  4EYU A;  2N2N A;  5M72 A;  2LSU A;  4IST A;  2LSY A;  5FQ6 A;  4N3A A;  1HNW T;  1ZV4 X;  2ZLY A;  4WWO A;  1UUS A;  1AWC B;  2AE9 A;  4U7Y A;  4G8L A;  2NR4 A;  4HFC A;  1D8E A;  4KMO A;  2HH7 A;  3UM0 A;  1OED A;  4EBA A;  5FY7 A;  3IHV A;  2A4Z A;  1Y64 B;  1IBL T;  2WVI A;  3JC6 D;  2IY0 C;  3R9A B;  5HEJ A;  2CE7 A;  2PJQ A;  1MQS A;  4XBF B;  3CEQ A;  3MX3 A;  3DWL G;  1OED E;  1EF1 C;  3CKB A;  4PDX A;  2XZT G;  2QYU A;  3AS4 A;  2XM1 A;  2QC9 A;  4Z8X A;  3NZQ A;  3HDX A;  1DNP A;  3PEU B;  4U04 A;  3CHP A;  4FAD A;  4UEM A;  3D9P A;  2V7M A;  5HEU A;  3RC3 A;  1Y8M A;  1ZU2 A;  2QRX A;  3FU6 A;  2A3D A;  2KCV A;  1XMO T;  3V2X A;  4O4I E;  4HWF A;  4IE7 A;  2KND A;  4I9C A;  4J8D A;  4JHR A;  5JA4 D;  3VR9 A;  3EDV A;  2R03 A;  2VUR A;  4CYM D;  2JQH A;  1G73 A;  2P58 C;  5DIZ A;  1KPS B;  2LSJ A;  3RC8 A;  3IF8 B;  1OWA A;  3U3W A;  4CI2 B;  2LLY A;  5A23 A;  5LXT E;  4LF7 T;  2YQ8 A;  3UT7 A;  3FEX A;  2OOE A;  4TV3 A;  3URZ A;  4GZ3 A;  2YEV C;  2I9C A;  3E33 A;  4QX8 B;  2L6B A;  4JI1 T;  1SA0 E;  3EDU A;  5KJK A;  1OCC E;  3PUW F;  4HWH A;  4L9I A;  4AI6 A;  3K9I A;  2JRK A;  3E32 A;  1M7K A;  3QWV A;  3N9Q A;  1WM5 A;  2WMO A;  3KDS E;  4LMK A;  1K1A A;  4N78 D;  3Q5D A;  1KFY A;  1GQE A;  3ZT7 A;  2X51 A;  2V7I A;  4A1S A;  3QWW A;  1US7 B;  4XI0 A;  3FY4 A;  4DR5 T;  1QNF A;  4JA7 A;  3TAX A;  5A6C A;  2HR2 A;  4UXN B;  1N4R A;  3NWI A;  2BKG A;  3BK9 A;  3D9K A;  2QYJ A;  1TR4 A;  2BBJ A;  1MHQ A;  2NOX A;  3NVO A;  1QLB A;  2P9N G;  4ILI A;  2V8S V;  3EU5 A;  4DR3 T;  4LRZ A;  1HNX T;  1VDY A;  1MX2 A;  2BS4 A;  3LJC A;  4TXQ A;  5LFA A;  2NSZ A;  3CK8 A;  5E75 A;  5KDM C;  2UXD T;  3V31 A;  3ONJ A;  4K5A B;  5FVL A;  2RD0 A;  5IYZ E;  2GGF A;  2J1D G;  1YKE B;  4UWF A;  1M62 A;  2G0U A;  2X9X A;  2YDS A;  5BR8 T;  2BG9 A;  4U31 A;  4TWF A;  3C98 A;  4TUU A;  4KHZ F;  1J5E T;  1VCT A;  4ZXL A;  3CML A;  2FO7 A;  3PRE A;  4O4J E;  3I4G A;  1YMP A;  2HN2 A;  4OX9 T;  2XEH A;  3H37 A;  3EI0 A;  1UOH A;  3TL5 A;  3CVL A;  4KX6 A;  3BQI A;  4FHJ A;  3DJB A;  1E1H B;  5ARF A;  4H9Q C;  2XQ5 A;  1UJJ A;  1HZ4 A;  3V79 K;  2K3W A;  3D9H A;  5AQS B;  3LYA A;  2P9S G;  3ZYM A;  5CRU A;  1FIO A;  4JXT A;  4MLK A;  2B6C A;  1BR4 A;  2NW8 A;  5G55 A;  2XS1 A;  4COF A;  3IBP A;  5AFU L;  2XPY A;  4A63 B;  1B89 A;  1UX4 A;  5LX8 A;  4K5C A;  4DX6 D;  1WYC A;  5J0Z A;  3RKG A;  4IE6 A;  4I43 B;  4DX5 D;  2OV9 A;  2DCP A;  5GON E;  3EAM A;  2R05 A;  1FCH A;  2VVS A;  3IBE A;  2WXH A;  4X20 E;  2WQ7 A;  4HOS A;  3Q75 A;  1YD8 G;  3D9J A;  3DSU A;  4HQD A;  2CM0 A;  4NXN T;  1UJK A;  3NZS A;  4QH1 A;  3ABK E;  1A5E A;  3ZST A;  3ZKR A;  4MS6 A;  3OVU A;  3CLJ A;  4TZ4 C;  1TNZ A;  2IML A;  4LF6 T;  4AKR B;  5JR9 C;  4DND A;  3G2S A;  3W9G A;  2UXC T;  1D8D A;  1LRZ A;  1H6P A;  4H9P C;  4HFG A;  2DIW A;  4X5T A;  4WNG A;  4JI3 T;  3GA8 A;  2WAU A;  2X67 A;  1DU2 A;  4HGA A;  4JPS A;  5F8P A;  2W2U A;  1E8X A;  2I2O A;  1D0Z A;  2XJ7 A;  3S2A A;  2KC7 A;  3UMV A;  3DSS A;  3QJZ A;  4GCN A;  5EIL A;  2V6X A;  4TV9 E;  4JI0 T;  1OED C;  2CHX A;  5CCL A;  4PK4 A;  4ASK A;  1INZ A;  3FU0 A;  4I4T E;  2WXF A;  3UU5 A;  3RQW A;  2HN1 A;  4H7X A;  4OAU C;  4WBO A;  3ZHE A;  4N39 A;  4DR1 T;  3KV9 A;  3CX6 B;  4BT9 A;  4QFV A;  4BES A;  4NQ0 A;  2CLY C;  3V2O A;  2FJE A;  3H3M A;  5ABF B;  3PE0 A;  4LFB T;  4B94 A;  3O4X E;  4LNU D;  2FEZ A;  5LMU T;  1N52 A;  2BVM A;  4HOR A;  3ONK A;  3VLE A;  2NW9 A;  4DRX E;  3Q9D A;  4I6E A;  2LE8 A;  4XKC A;  2X9Y A;  1X79 A;  4B3M T;  3JUE A;  3FZM B;  4NUR A;  3UUN A;  5CED B;  2RFM A;  3RGL A;  3J9X 1;  3U3I A;  2CG3 A;  3AE7 A;  1U5P A;  3MKQ B;  4DPR A;  2YIN A;  3AE3 A;  3ZMT B;  3PE3 A;  4KT6 B;  4WZX A;  2ZM8 A;  4PJN A;  2ZGD A;  2X9W A;  1Z0P A;  1N36 T;  1N95 A;  3AAI A;  2IEJ A;  2PG8 A;  4ILA A;  3NOC D;  4PS3 A;  2DHR A;  2ZM2 A;  3UX4 A;  4ZHB A;  2WDV A;  3OPC A;  5JDQ A;  1W0B A;  2H6F A;  2J4D A;  3VTX A;  4H9O C;  5AQJ B;  4I1A A;  4B3R T;  1N9A A;  4UQY A;  4TWD A;  2D5U A;  1T7S A;  4RG9 A;  2E9X B;  2Y8D A;  4ILU A;  5BT1 A;  2BKO A;  5JDF A;  4X62 T;  4AQG A;  3PDN A;  4YTM A;  4QKN A;  2N9D A;  2VJ8 A;  1WCR A;  3IEG A;  2HO1 A;  3TXN A;  3UQ7 A;  4EPZ A;  1ZBP A;  4YSZ A;  3P1U A;  4UWK A;  2BBH A;  4GIW A;  5FQ8 A;  2HPL A;  3C64 A;  3LBX B;  3PVL A;  3T9K A;  5AQK B;  5G05 J;  2JEK A;  2JIW A;  2VQE T;  2F37 A;  4UWH A;  3MV3 B;  3UT4 A;  3NQP A;  5CGM A;  4AQF A;  1QUU A;  4U63 A;  3QUJ A;  4P1N A;  4CGW A;  3ESL A;  2CPT A;  3WI3 A;  3ZCI A;  3ZN1 B;  2WDQ A;  3JCK C;  4RQI A;  4YDO A;  2WXO A;  4KXK B;  2R2L A;  4URK A;  3FXD B;  3D9O A;  4TV8 E;  3N2G E;  2ZMA A;  4HOU A;  2F0Y A;  4UR9 A;  4GKK T;  4IRE A;  5ABH A;  4O4H E;  4YVQ C;  1BR0 A;  3P7I A;  4GYW A;  1S70 B;  1VOM A;  3VR8 A;  3ZXP A;  1TNO A;  3T5V A;  1N94 A;  4ACL A;  3GW4 A;  4WAF A;  3MAC A;  4GYY A;  3ZIM A;  3T5X A;  1E90 A;  5ENR D;  1MX6 A;  5JVD E;  5ANL A;  2CXL A;  2Y0B G;  4LEU A;  3T1Y T;  1O3X A;  4X8Q A;  4JV5 T;  4ZOL E;  4O1O A;  4G2V A;  2OCC E;  5BV1 A;  3GWH A;  3ETV A;  3LSV A;  2IU1 A;  5CA0 E;  2OV8 A;  5ADX L;  2XRY A;  3Q73 A;  5J90 A;  2MOW A;  2VL0 A;  4BEP A;  3CVN A;  5LJM A;  3EDT B;  5L3D B;  2PM6 A;  4DX1 A;  3CQC B;  2VGX B;  4EB6 E;  4U7E B;  2DVW A;  2FJA A;  4M1P A;  3BUA A;  2CWO A;  4XKB A;  1EZ3 A;  3NAW A;  4JBW F;  2E8I A;  5CBN A;  3PE4 A;  3HXF A;  3CGH A;  3C4Z A;  5HEH A;  1N0Q A;  3AJI A;  4EZJ A;  2BZB A;  4UQX A;  3I9Y A;  5JRE A;  4IIJ E;  4F7A A;  2VSY A;  4UF0 A;  2IOL A;  3KD7 A;  2VYI A;  1W0A A;  5G2N A;  4GZC A;  1QQE A;  4YT0 A;  4O4L E;  1SA4 A;  4IT4 A;  5BV0 A;  2WXI A;  2Q9Q D;  4FJZ A;  2AXD S;  2YHC A;  2ACZ A;  3SFY A;  2BKP A;  3MA5 A;  4H9N C;  1OWM A;  3EHN A;  3O1H A;  4YFS A;  2QVA A;  3AEC A;  3OBV E;  2VVN A;  4I17 A;  5LJN A;  3DSX A;  2C5I T;  3ZN0 B;  1K3Z D;  3B5M A;  2MBG A;  3AA1 B;  3N9L A;  1XZY A;  4C48 B;  2X3M A;  4AIU A;  2XHE A;  4UI9 J;  3AB3 B;  2KCL A;  2WMN A;  3B7T A;  4KI0 F;  2L8K A;  3AXJ A;  4APF A;  2I6H A;  4BSX A;  3ZGQ A;  3ZCJ A;  2X6J A;  2XGS A;  4JEH A;  2DZN A;  4L9P A;  1TYQ G;  2XQ8 A;  4O2B E;  4AP2 A;  2WQH A;  2UUC T;  4C90 A;  3UUX B;  4XEI G;  4XIF A;  5E0O A;  5EX0 A;  4K0U A;  5CA1 E;  2VKJ A;  2IOS A;  3G06 A;  3UU4 A;  3RK6 A;  2JQ9 A;  5ITZ F;  2I59 A;  2VL8 A;  1S94 A;  2EHO A;  4TWH A;  2C2L A;  4CN4 A;  5FP3 A;  5BPP A;  2GRN B;  1FMW A;  4DMV A;  5HXH A;  2E5L T;  1ELR A;  1NP7 A;  2XCC A;  4UWL A;  2UUB T;  4YLH A;  1OWN A;  3SWH A;  2LOP A;  4GYO A;  4BY6 A;  5B3S E;  2YHE A;  2VAS A;  1TNY A;  4UUC A;  4RG6 A;  3QWP A;  5KJN A;  3F2E A;  3PH0 C;  4ERR A;  5CMW A;  3IEE A;  3JAF A;  3FUE A;  1KNR A;  2LRK A;  4DV4 T;  4ZEY A;  3RYI E;  4G1T A;  4JVS A;  3SF4 A;  3EAB A;  3UKU G;  3KIN B;  4WND A;  5CCM A;  3ZJ2 A;  2VB6 A;  4YTP A;  4V1A v;  4MKT A;  5AQP B;  2V0P A;  5JDN A;  2CWY A;  3MGB A;  3NZU A;  5A1L A;  3CIA A;  3UM3 A;  2BS3 A;  3HKE E;  4CZ2 D;  3DPY A;  4ANV A;  3DEP A;  3ABV A;  2B1E A;  2XAJ B;  3QB5 A;  1LD8 A;  1YQ3 A;  4P0B A;  5AQG B;  5H7P A;  1D1A A;  3HXC A;  1X9B A;  3D3M A;  2H3R A;  5LB7 B;  3ZU7 B;  1SA5 A;  2WXQ A;  3W9F A;  3ZLI A;  2VKH A;  5L4E A;  3PNL B;  2E2A A;  2CHW A;  3PUY F;  2HYZ A;  4YSY A;  4TUM A;  3X2Q E;  3UKR G;  2ILR A;  4IYP A;  4M7C A;  5EX3 A;  2ZXW E;  4IE5 A;  2WS3 A;  4DO0 A;  5M4Y A;  1JCR A;  2VTB B;  4IDQ A;  4B0Z A;  3JXI A;  4F6R D;  3UUL A;  4FP7 A;  4EGW A;  2LHN A;  3RHW A;  3A5X A;  3ETU A;  3ZUV B;  1SE7 A;  2GK9 A;  5CHE E;  1OED B;  4PFO A;  4AQF C;  4HFI A;  2CFZ A;  5KNG A;  4GB9 A;  5FVK A;  5FL0 A;  4U96 D;  1O5M A;  4YHJ A;  2WM9 A;  2Q7F A;  1LVK A;  3RX6 A;  3FH8 A;  5JHA A;  4AV7 A;  2H7V C;  3R7Q A;  4LNG A;  4HI8 A;  3ESK A;  4MRU A;  2R5S A;  4UV9 B;  1HE8 A;  2BDE A;  3UI2 A;  3HXB A;  4F1P A;  2VSN A;  3AEB A;  5JR9 A;  5B1A E;  4HWC A;  3B7U X;  5LNK A;  1UUR A;  4DX2 A;  4BJM A;  4BX9 A;  4MFR A;  5FXZ A;  3PUS A;  4GTR A;  4QXH B;  2WDR A;  3C5R A;  5FQ4 A;  2YOE A;  3B7R L;  4HWI B;  4DR2 T;  3A8Y C;  3DXK G;  3L08 A;  4YJ2 E;  3PJA J;  4J8F A;  4LF9 T;  3E0Z A;  2K5B B;  5ENN A;  4HLE A;  2N1G A;  1Z3Y A;  2C0S A;  1TN7 A;  2UXX B;  1UW4 B;  2IQC A;  4K0K T;  2DCF A;  2LNI A;  2E9X D;  4HB5 A;  3ZXS A;  1XDO A;  2KXP B;  5ENO D;  2RKK A;  3CVY A;  3TLU A;  4LNB A;  4U95 D;  3C51 A;  2FJD A;  2JPF A;  3TWV A;  4JI2 T;  4GK0 E;  2X6K A;  3NKZ A;  2Y4T A;  1FVF A;  2BED A;  4JA9 A;  5EZY E;  2M6B A;  3UQ4 A;  2W00 A;  1UG3 A;  5AQI B;  2CFU A;  4IE4 A;  1LF8 A;  3AVS A;  5JDM A;  1N0R A;  3CVW A;  4XX5 A;  4GTM A;  3SY2 A;  3Q47 B;  4G2A A;  5IUX A;  3UTK A;  1PAQ A;  5AQ9 A;  5JJT A;  1HFA A;  4FA6 A;  2PM7 A;  2VKD A;  4LF5 T;  3APC A;  4DLO A;  4K03 A;  2DZO A;  3TLS A;  1X81 A;  4AKG A;  2L9B A;  3ENE A;  2WXP A;  4J8S A;  2Y3A A;  4EYY R;  5LP6 E;  5JDG A;  3CX8 B;  2D9D A;  2AVP A;  3NB2 A;  5LMN T;  1YYH A;  5AQQ B;  2VSX E;  1RZ4 A;  1T98 A;  2XZE A;  4HLL A;  4AY5 A;  5JRC A;  5J08 A;  2AJA A;  5EK3 A;  1ZP0 A;  3UFE A;  2C0L A;  3QNU A;  2H88 A;  1A17 A;  4BTA A;  3LS8 A;  3PUK A;  3T8M A;  1TN6 A;  2EIN E;  2W63 A;  5J2T E;  3AAA B;  4HEA A;  3QB2 A;  4QH5 A;  2MHK A;  3HKB E;  5TAO A;  2WWV A;  2Y1L E;  3PZ3 A;  1IXV A;  4WNF A;  3UIN C;  3U78 A;  5LGT B;  3ISM C;  4DR6 T;  1SVX A;  2BG9 B;  3RYC E;  4EQF A;  1E96 B;  2W62 A;  5HXR A;  2DLR A;  4GAA A;  4K5B A;  3S7D A;  4OK0 A;  4PFP A;  2Y4U A;  5AEN A;  5FZQ A;  3D9N A;  2K48 A;  2EHO C;  1KF6 A;  2LKG A;  1U4Q A;  4JHJ A;  4CEM A;  1CUN A;  4GPM A;  4YXD A;  3FUK A;  3LDZ A;  4TRQ A;  1D0Y A;  2CRB A;  1VRB A;  2XAQ B;  2Q9Q B;  4PNI A;  3ZMZ B;  2CG2 A;  5EDS A;  2PTF A;  1IKN D;  4HOQ A;  3O9X A;  3AE8 A;  3P4R A;  3L09 A;  1CHU A;  4AIS A;  3SZ7 A;  2XEE A;  4K0R A;  5LGN B;  2DBA A;  2WPV A;  4U72 A;  1NI1 A;  2PQN A;  3ULY A;  1MMG A;  2C5J A;  2UY1 A;  4GZ6 A;  5CRV A;  1KLX A;  1YCS B;  3KEZ A;  3EHR A;  4B6X A;  3DEO A;  3ASO E;  3VRA A;  1MMD A;  2XAS B;  2XEN A;  4HRL A;  4PH4 B;  1YA0 A;  3HKC E;  3HKD E;  3J7Y q;  2WU2 A;  4DV3 T;  4ACK A;  4UVA B;  3JYS A;  5AQA A;  3SNX A;  4X1Y E;  4QWN B;  5JJ7 A;  4DUY T;  4DR4 T;  3E30 A;  3TWW A;  4UVC B;  2HHH T;  1AP7 A;  2OEW A;  3BU8 A;  4GYS A;  4CN6 A;  4ILB A;  2C0M A;  5CEA A;  3PUQ A;  3N9O A;  4J8E A;  5HQ8 A;  2XM2 A;  4E7Z A;  3WXX A;  4YVO A;  2KWH A;  3VLD A;  2YDQ A;  2IW5 B;  3MZL B;  3AS5 A;  3NZP A;  4JZY A;  3PU8 A;  4HBD A;  4LFA T;  3UM2 A;  1HX1 B;  2MOZ A;  2L0I A;  1H2V C;  3RH3 A;  3FP3 A;  3RKO A;  2XQ4 A;  3M3Z B;  1WRD A;  3RIB A;  2IC6 A;  2WY2 A;  1Z3X A;  3UUM A;  3JCF A;  1BU9 A;  4B8C B;  3AA7 B;  4IHJ E;  3K3Q C;  3TKL B;  4OHF A;  3UIO C;  4Q96 A;  4G26 A;  2KZT B;  1JCQ A;  2W0G A;  2J09 A;  2LJL A;  1BPO A;  4AQY T;  4KZ0 A;  3MEK A;  3WAJ A;  3D9L A;  3FTX A;  4ILG A;  4XZ4 A;  4EED A;  1U2V G;  3MXZ A;  3ZHE B;  3OXL A;  5AQO B;  4PS7 A;  3U9W A;  3PRZ A;  3ZYL A;  3FUJ A;  1OCO E;  3PUV F;  4EZH A;  2ZM0 A;  4O8S A;  5JDH A;  2BTD A;  5JDL A;  5KBA A;  4GMR A;  2P9B A;  2LO6 A;  5FT9 A;  4LER A;  3S7J A;  1QZ2 A;  3Q5W A;  3RYH E;  4FC8 A;  5FZR A;  2RPA A;  3F57 A;  4KBM B;  3L17 A;  1UGO A;  1NA3 A;  2W66 A;  3RI5 A;  1N33 T;  2XGM A;  5ENP D;  3N9P A;  4TNV A;  4EOZ B;  1OT8 A;  5LCW J;  5AQT B;  5DJQ C;  4X1I E;  2P9U G;  2ZU6 B;  4ABN A;  2V1D B;  4CI1 B;  3C3R A;  2XAG B;  2GRL A;  4ZI2 C;  2XQ9 A;  5DBK A;  1IYG A;  3I0Q A;  5D0O D;  2CA5 A;  4Z90 A;  4I2W A;  5CJ5 A;  4X1K E;  2WZH A;  4B8A A;  4AOF A;  2J49 A;  4L23 A;  2YDR A;  3H3A A;  3FZL B;  4GA0 A;  3UU3 A;  3SFZ A;  1S35 A;  2LUH A;  1UK5 A;  3QDN A;  4N5C A;  2J9Q A;  2JQQ A;  3P4S A;  1WG0 A;  1HX8 A;  3IHY A;  4EEB A;  2MPK A;  4FJO A;  3FU3 A;  4MBG A;  4R7L A;  5FKY A;  4ZFH A;  4HVB A;  5CBO A;  2FF4 A;  5FYM A;  4I43 A;  4CDN A;  5BMV E;  4KBQ A;  2QYW A;  5L3F B;  3AG4 E;  3MKD A;  1JNR A;  5FMN A;  4GPK A;  3I3N A;  1DCE A;  2FBN A;  2NYJ A;  4O1P A;  2QGS A;  4BT8 A;  2EIK E;  3E37 A;  3RRM B;  1L5J A;  5L3C B;  2YK0 A;  3QC9 A;  3CKC A;  2WBL A;  2X0Y A;  4H63 V;  5LHI B;  2KT9 A;  2OA5 A;  4ZHQ E;  4YHH T;  3LPZ A;  3FHN A;  4A97 A;  4AXP A;  4N5Q A;  5HS0 A;  2VSO E;  5C1D A;  3P8C D;  3D9M A;  1B7T A;  3BG0 B;  4GU5 A;  1X5B A;  4DV5 T;  3LDQ B;  1IJ6 A;  1V54 E;  3CQG B;  2XGO A;  4Z68 A;  4H9S E;  4YSX A;  5HXC A;  2FUP A;  4AEZ C;  5HEO A;  2IHR 1;  3ASD A;  1BI7 B;  3AAE B;  4HFV A;  4I6J A;  4XAX B;  3AG3 E;  4ANX A;  2OVF A;  3SRZ A;  3I4R B;  3LY8 A;  3ONL A;  2M63 A;  4FI5 A;  2MAW A;  4N2S A;  5KMG P;  1MIW A;  2J62 A;  5D2M C;  4OVV A;  3ULQ A;  4LML A;  4H9R C;  2V4H C;  4JC8 A;  2XQ3 A;  2WSS V;  3R6N A;  2GRO B;  1JPL A;  3RRC A;  3UQ3 A;  1XWM A;  3HVE A;  4YDY A;  4BWR A;  3O4Z A;  3DSV A;  3RIU C;  3SOL A;  3PU3 A;  2CHO A;  4HKA A;  1EDU A;  1FT2 A;  4HXI A;  2NWB A;  4EHM A;  2DWK A;  2A72 A;  3ZKJ A;  3B13 A;  1N32 T;  2LSI A;  2H6H A;  5AQB A;  3L39 A;  4YJ3 E;  3FTS A;  5EK4 A;  3AEA A;  4JLE A;  4P0A A;  4LFC T;  3DP7 A;  3OTO T;  3EIJ A;  4NRH B;  2V4L A;  1YQ4 A;  2D0U A;  4CDR A;  3MKQ A;  3U64 A;  4PJL A;  3CK9 A;  3S7B A;  2LXL A;  4UF0 B;  1WYB A;  4DK5 A;  5FXW A;  4F53 A;  4U2Y A;  5AQR B;  3Q9N C;  1MX4 A;  5LOZ A;  3B7S A;  4EXT A;  3RO3 A;  4X66 T;  2V6Y B;  2V5F A;  1OWL A;  4CXX A;  5BW8 C;  3LFM A;  3FTZ A;  4G24 A;  4ISS A;  4CQI A;  4G63 A;  1WDY A;  3HG0 D;  4GTP A;  3L6A A;  3J5P A;  1U3D A;  4XE0 A;  3GZS A;  2GRR B;  5LOV E;  4L1B A;  1E8W A;  3G2V A;  1NEN A;  5FY0 A;  3P4Q A;  1DCQ A;  2KLQ A;  3LY7 A;  3IXE A;  4PJM A;  2KIN B;  5KJL A;  4MBQ A;  3LBX A;  3VHL A;  2XHE B;  5L3G B;  2X6H A;  4FHK A;  5BXO A;  4L0R A;  3AXJ B;  4JI6 T;  1D9S A;  5L3E B;  1HG2 A;  4EZ4 A;  4BET A;  4EZL A;  5FZS A;  3KBT A;  2MTQ A;  1BD8 A;  3G2W A;  4PS8 A;  1HR0 T;  4IDN A;  4JEH B;  3FZK B;  2X68 A;  5LHH B;  3ONX A;  5F5W A;  2UUA T;  1O1S A;  2VKO A;  2QFC A;  3RKV A;  3DXM G;  1YW0 A;  4ATZ D;  5ABE A;  3RYF E;  4WYV A;  3BQK A;  4ZS3 A;  3ML9 A;  3EHZ A;  4TUY E;  2WXK A;  3TG5 A;  2J08 A;  3FH7 A;  3Q49 B;  2XQ7 A;  4QQI A;  4J7W A;  3GN5 A;  1LD7 A;  4UIG A;  2Y48 B;  3AS8 A;  1N11 A;  2FUL A;  3ZSS A;  2IDO B;  4DI4 A;  3R7R A;  3TXM A;  2VWA A;  1YXR A;  4U33 A;  4I0U A;  4PK6 A;  5EYP F;  2LSV A;  3TWU A;  3R9M A;  2LM9 A;  3AE9 A;  2WQY A;  4ZI3 C;  3PUJ A;  5LYJ E;  1SUM B;  4X64 T;  3AE2 A;  4JI5 T;  2ES0 A;  3N9N A;  2CBI A;  4Q69 A;  5ANR A;  1IAP A;  4ILH B;  3SGH A;  3DST A;  4F1S A;  3MK7 C;  4LG6 A;  2ETC A;  1MND A;  3O1I A;  2NW7 A;  5L47 A;  3UU6 A;  4ZI7 E;  4AKH A;  3HR0 A;  3ZMV B;  1KZO A;  3TJP A;  3QB5 K;  3GZ2 A;  5ENQ D;  1HU3 A;  4GZD A;  3SHF A;  4ATG A;  2NTY A;  4DMW A;  4KVO A;  2ZIS A;  3PUA A;  3PV0 F;  3CST A;  2OVB A;  3CHM A;  2XRZ A;  2PBI A;  4HS2 A;  1H6O A;  2KCK A;  3SO8 A;  2XTL A;  3K1S A;  1JUQ A;  5DQV A;  3RRU A;  4BA9 A;  3RJV A;  4GTS A;  4Y6W A;  4BFR A;  1TNB A;  1IHG A;  3PZ1 A;  5LCW C;  4MLP A;  3CVQ A;  3RF1 A;  4J2C A;  1N54 A;  4U3C A;  2R17 C;  2XCB A;  5LGU B;  1XMQ T;  1Z8U A;  3G2U A;  1KT1 A;  1QYM A;  4HE8 A;  3Q7A A;  3OYZ A;  1V55 E;  3PTR B;  1E2A A;  3IHR A;  4RLY A;  3R84 B;  2FI7 A;  4TN7 B;  2VQ2 A;  4OVU A;  2F4V T;  3C72 A;  4CT4 A;  3PNT B;  4CXW A;  4DX7 D;  1Y6I A;  4JEU A;  5AQV B;  2WXM A;  4CXY A;  4QXC B;  4A3V A;  3K3O A;  4P29 A;  2UU9 T;  2QA7 A;  2HPJ A;  1WY6 A;  2RP4 A;  2PQR A;  5EKQ D;  3ZYK A;  2IAK A;  4NAC A;  3PUZ F;  5JJ6 A;  2EQX A;  2IC9 A;  5FWQ A;  4U0S A;  3B57 A;  5B1B E;  4CI3 B;  3FEY A;  4QH4 A;  3KVA A;  3GMI A;  1NL4 A;  2J07 A;  3KV6 A;  3NRY A;  3N2O A;  1OXJ A;  3AA0 B;  4YTN A;  3FTV A;  4QXB B;  1OUV A;  3HI2 A;  5HXS A;  5HCM A;  3LG7 A;  3APD A;  2GW1 A;  2WQ6 A;  1MYO A;  5JR9 B;  3SFX A;  2WB2 A;  3CVR A;  4AKL A;  4U07 A;  3CHO A;  3AE4 A;  3SBT B;  3ZPO A;  3T8O A;  2ETA A;  5LG4 A;  1HS7 A;  1D1C A;  4I9E A;  3ANW B;  2P9I G;  3CHQ A;  3RQU A;  1IQU A;  2E2E A;  3ONL C;  2ETB A;  4GTO A;  2CXD A;  4Y6C A;  3FBZ A;  1NA0 A;  2DL1 A;  4D10 C;  4L2L A;  4UWG A;  2YU1 A;  3UFG A;  3QK0 A;  2HM8 A;  3KS2 A;  3O48 A;  2R02 A;  5DAB A;  2V5Q C;  2VQF T;  3MA9 A;  1UN8 A;  1WLX A;  1FPP A;  4U2Z A;  3FUI A;  3ZMS B;  3FUF A;  4HNA D;  4U8Y D;  3RRN B;  3TWX A;  1H2U A;  1S0P A;  4G23 A;  3ZW3 A;  2V5C A;  1ZKE A;  4UEL A;  3CKD A;  3I1A A;  5LHG B;  3I5P A;  3SQV A;  1FVH A;  1KZP A;  2WB5 A;  5D66 A;  2CLY B;  5AQF B;  2JLB A;  3FUH A;  4FU3 A;  3PS6 A;  5G05 C;  5LA6 E;  3FB2 A;  5HAX A;  5FY1 A;  4WNE A;  3OKQ A;  2LM2 A;  1HO8 A;  2DYR E;  2FBW A;  2PFV A;  3LKU A;  5AYW D;  4GYR A;  4WWN A;  4EZK A;  1EPU A;  1ELK A;  4JUY A;  5KX5 E;  4U0Z A;  2XQA A;  2XQY A;  2X0H A;  4Q25 A;  2L0T B;  1BR2 A;  4N3B A;  3V5U A;  1VCS A;  2DNX A;  4G11 A;  3JC6 C;  3ZEF A;  4I1M A;  3JAE A;  1MJ0 A;  3CHR A;  1KEY A;  3TGO A;  2E9X C;  5C2Y A;  4I6G A;  4X65 T;  4GZ5 A;  3NF1 A;  3FTW A;  1W9R A;  3QC1 A;  5AN8 A;  5T4Y A;  2XPZ A;  4L7T A;  2GRQ B;  1U3C A;  2YKS A;  4EAH A;  5JRC B;  5AQU B;  2VTB A;  5EK2 A;  3LVQ E;  4HI9 A;  4QHO A;  3I0O A;  3PJA A;  4CRW A;  2W67 A;  2E5V A;  3CVV A;  5IWA T;  4W9R A;  2X38 A;  2QZA A;  1TEZ A;  2IO3 C;  3Q15 A;  2WP9 A;  5AQ7 A;  2OND A;  3E34 A;  3PZD A;  3ZPJ A;  2A9U A;  3RAU A;  4GCO A;  2JAB A;  4PK5 A;  1IHB A;  3V30 A;  4BSZ B;  1KNZ A;  3SBS A;  2KAT A;  2LRL A;  4KUM B;  4JD2 G;  5CEC B;  1YKH B;  5H6Q B;  3QAR A;  3T8K A;  3ZRH A;  3FTU A;  4PW8 A;  3CVU A;  4WUY A;  1RW2 A;  4KVM A;  1GW6 A;  3F6Q A;  2KSR A;  2BF0 X;  2XQ6 A;  3QK6 A;  1N4S A;  2Y6X A;  3RRW A;  1OWP A;  5EID A;  4BX8 A;  1JWF A;  5LCY A;  4IN3 B;  3L3P A;  3C4X A;  3AEF A;  1XDP A;  2DWG A;  2V26 A;  4JW1 A;  1G3N B;  4A98 A;  4UQZ A;  3CVX A;  5J1G A;  2Z6E A;  2QY7 A;  4JB8 P;  1HF8 A;  3FUN A;  2R59 A;  2KBX A;  3KEA A;  4JL0 A;  2PZI A;  3FUL A;  4G8K A;  4B93 B;  3MCX A;  4YDE A;  5D0Q D;  3X1D A;  2SPC A;  3KFW X;  4GML A;  2UY1 B;  4WWP A;  1ELW A;  3CK6 A;  3UM1 A;  4OYS A;  3CWZ B;  3ZN3 A;  1Y01 A;  4HFE A;  3C3O A;  1LVF A;  1XNQ T;  4B3S T;  1S64 A;  4IL9 A;  4H7Y A;  1OXZ A;  5LBQ B;  3Q2M A;  4XI9 A;  4BAY B;  3C98 B;  2NP9 A;  4BER A; 
#chains in the Genus database with same CATH homology
 4AY6 A;  3BEE A;  2AXV A;  3S7F A;  4UI9 C;  3LK4 2;  4GMJ A;  1ZHC A;  2WWU A;  3RPU A;  4ANJ A;  2XQ0 A;  3VU7 H;  2LHR A;  3AA6 B;  3CSF A;  2ACX A;  3HYM B;  4KP3 C;  2X0L B;  2UXN B;  5FTP A;  1SZA A;  4DBR A;  3DPD A;  3JQ1 A;  4C9B B;  5CB4 E;  3D9I A;  1H19 A;  4H63 H;  3ZYQ A;  3PEV B;  5BNW A;  3HHM A;  1ZEE A;  2EHO D;  4IGU A;  4EIW A;  4FUL A;  2IF4 A;  3AU4 A;  4HTE A;  2WXR A;  1H6K A;  1MMA A;  3DBS A;  2V7L A;  4KYO B;  3QOU A;  2X6F A;  4CGV A;  4M3O A;  1H0A A;  4I50 E;  4GA1 A;  2CXF A;  1HS6 A;  1SQM A;  3C4W A;  4IE0 A;  2KM4 A;  2KMF A;  4B89 A;  2RG8 A;  3VTY A;  4L5G A;  3FUD A;  1UN9 A;  1D1B A;  4AVX A;  4HOT A;  2Q9Q A;  4DLQ A;  3PUG A;  4RVB A;  3L54 A;  1SHZ C;  1E7U A;  3ML8 A;  3U66 A;  4Q94 A;  1SZ9 A;  2NTX A;  2I1J A;  4GK5 E;  4A3T A;  5JH7 E;  4IDZ A;  2MYS A;  3L22 A;  3VKH A;  4J0U A;  2LAI A;  3N71 A;  5FXV A;  5F3J A;  3VKG A;  2KWI B;  2LOS A;  3SI5 A;  2PL2 A;  3LEW A;  2D0T A;  3NBX X;  5L2L A;  1FEW A;  2V7K A;  3UT8 A;  5H6R B;  2GRM A;  4I55 E;  2X9H A;  2KZ7 B;  4FLB A;  2X66 A;  4PUC A;  4DBQ A;  4FLH A;  3FWV A;  4EEC A;  1HTJ F;  3EUH A;  4E85 A;  4WNK A;  2XAF B;  5LBM A;  4V3I A;  2BVL A;  1LKX A;  5HYA A;  4DI3 A;  5C8Y E;  2BUG A;  3CPZ A;  4CZZ B;  4BTB A;  4O2A E;  3U4T A;  1HCI A;  2NXP A;  1BR1 A;  2KZT A;  4ZI2 D;  2YNQ A;  2LSK A;  1NAF A;  3GYZ A;  3Q5M A;  4N3C A;  3OJA A;  3CX7 B;  3MZK B;  5JQG E;  1MNE A;  3K8P C;  1TJF A;  2RA1 A;  4LCT A;  4LUN U;  2DI4 A;  2LEH A;  3AVR A;  3IV0 A;  1G8X A;  2VK9 A;  3HVE B;  3MYV A;  4AKI A;  4GOU A;  3G2T A;  3N9M A;  4N2Q A;  5BUZ A;  5AJL A;  1MIV A;  3NRX A;  4ZS2 A;  2ION A;  3FXE B;  3OAW A;  1NZN A;  4L2Y A;  3ZJ1 A;  1KK7 A;  4P09 A;  5IHY A;  1OWO A;  3JQ0 A;  1NWM X;  2JJ9 A;  3V5S A;  4A1G A;  3AU5 A;  3W15 B;  3KBU A;  4MAL A;  4APO A;  4OYJ A;  2NC9 A;  1TJC A;  2CEA A;  4J6I A;  4NUV A;  3FUM A;  3FTY A;  5G04 J;  2XEV A;  5HWY A;  2AXU A;  3OXF A;  2WXG A;  5HI7 A;  1W3B A;  2ODU A;  4DJA A;  4U8H A;  2A2F X;  5FXX A;  2L9Q A;  4E6H A;  3LY9 A;  4IUL A;  4U74 A;  3UT5 E;  3FH5 A;  4GA2 A;  4JHK A;  2L6J A;  1IQR A;  3KAE A;  4CDM A;  4AJW A;  2LAH A;  3E08 A;  4YND A;  5L3B B;  4A55 A;  4KZC A;  4G25 A;  3E22 E;  3EJN A;  4FJY A;  2IFU A;  3HA4 A;  3RO2 A;  3FBL A;  3P2B A;  4AM9 A;  4CCA A;  3FHE A;  2I1K A;  2E0I A;  1E8Y A;  2LT3 A;  4O6F A;  3D0T A;  1UX5 A;  5FJY A;  3BQL A;  1MIY A;  5HWX A;  3OYX A;  2CMR A;  1HG5 A;  4TX5 A;  3MJW A;  2A5U A;  1V9D A;  3GN5 B;  4F3V A;  2WXL A;  2AXZ A;  3O1J A;  4IRU A;  5E76 A;  4C91 A;  2E9X A;  3ASH A;  5FNV E;  5AIJ A;  1JWG A;  3ZFW A;  3ZC0 A;  2V7J A;  3LK3 B;  2ODV A;  1HXI A;  1WR6 A;  1P5Q A;  5AJD A;  3MV2 B;  3S4U A;  5HXE A;  3OXG A;  4I1O B;  2C5K T;  3FU5 A;  4OFZ A;  3CK7 A;  4UI9 K;  2Q9Q C;  5FQ7 A;  3QAQ A;  3ZC1 A;  2WXJ A;  2EHO B;  1Z6T A;  4UV8 B;  3ASG A;  1AJ3 A;  3EVY A;  3HIZ A;  5KJM A;  3OTN A;  1PY1 A;  4C0M A;  4XZC A;  5KCM A;  2CCQ A;  2UWJ G;  2W61 A;  3WAK A;  3CV0 A;  2H7O A;  2LSG A;  5ARG A;  2IJG X;  2YU2 A;  3KV4 A;  1UCU A;  3I9W A;  4JEU B;  3RU0 A;  3IKO B;  2VGX A;  3DTO A;  1WAO 1;  3KV5 A;  2D2S A;  3SD5 A;  2J4B A;  1XNF A;  1KT0 A;  3EIQ C;  5J2U E;  3BG1 B;  4ZI3 D;  2X6I A;  3MKR A;  3FDH A;  3C50 A;  4C0E A;  1XGW A;  1IJ5 A;  1EYH A;  3N5L A;  3CHS A;  1E7V A;  4MHC A;  3Q4A B;  2JMH A;  2M67 A;  3QNK A;  3E4B A;  4WBN E;  3LCA A;  4ME2 A;  3LK2 B;  4OYK A;  1QSD A;  2L3L A;  4CT0 A;  4BJN A;  2AW6 A;  4UVB B;  5A7D B;  4U0U A;  3MJX A;  1DVP A;  4E7S A;  2XPI A;  3K3N A;  3SS1 A;  3F31 A;  1PC2 A;  3CQX C;  4PJJ A;  3L16 A;  2K9A A;  3ZMU B;  1H7C A;  3N2K E;  1FMV A;  3UUX A;  3LJ3 A;  3VLF A;  1E8Z A;  2MRI A;  3APF A;  5JHB A;  2VGY A;  3HL6 A;  3Q5X A;  5LP0 A;  4F6R C;  2WXN A;  4ADZ A;  4I2Z A;  2K24 A;  5ETW A;  1H2T C;  3CR3 A;  3PDY A;  3ZEF B;  3M65 A;  3JUI A;  4PAG A;  3TG4 A;  4ANW A;  2CHZ A;  4QX7 B;  4WW0 A;  3PUR A;  5G04 C;  2JMK A;  4EBA G;  2AWI A;  1IZN B;  2XUE A;  3UPV A;  1HH8 A;  4ANU A;  4AXH A;  5CMY A;  4DVD A;  3EHM A;  3LXU X;  1D0X A;  3GZ1 A;  3ZVV A;  4NUU A;  5T3R A;  5T8I A;  4AIF A;  3LVR E;  3KVB A;  2V8S E;  3CVP A;  5DQW A;  4HN9 A;  4KMC A;  3FFL A;  4RSY A;  3L13 A;  3QKY A;  4A56 A;  1MMN A;  2XAH B;  3ANW A;  3ASF A;  4EYU A;  2N2N A;  5M72 A;  2LSU A;  4IST A;  2LSY A;  5FQ6 A;  4N3A A;  1ZV4 X;  2ZLY A;  4WWO A;  4KMO A;  2HH7 A;  4EBA A;  5FY7 A;  3IHV A;  2A4Z A;  1Y64 B;  2WVI A;  3JC6 D;  3R9A B;  2CE7 A;  2PJQ A;  1MQS A;  4XBF B;  3CEQ A;  3MX3 A;  1EF1 C;  3CKB A;  4PDX A;  3AS4 A;  3PEU B;  4Z8X A;  3NZQ A;  3HDX A;  1DNP A;  4U04 A;  3CHP A;  4FAD A;  4UEM A;  3D9P A;  2V7M A;  3RC3 A;  1Y8M A;  1ZU2 A;  3FU6 A;  2A3D A;  2KCV A;  4O4I E;  4IE7 A;  2KND A;  4I9C A;  4J8D A;  4JHR A;  3EDV A;  1G73 A;  2P58 C;  5DIZ A;  2LSJ A;  3RC8 A;  3IF8 B;  1OWA A;  3U3W A;  4CI2 B;  5A23 A;  5LXT E;  2YQ8 A;  3UT7 A;  3FEX A;  2OOE A;  4TV3 A;  3URZ A;  4GZ3 A;  2YEV C;  2I9C A;  4QX8 B;  1SA0 E;  3EDU A;  5KJK A;  4L9I A;  4AI6 A;  3K9I A;  2JRK A;  3QWV A;  3N9Q A;  1WM5 A;  2WMO A;  3KDS E;  4N78 D;  2X51 A;  2V7I A;  4A1S A;  3QWW A;  1US7 B;  4XI0 A;  3FY4 A;  1QNF A;  3TAX A;  4JA7 A;  5A6C A;  2HR2 A;  4UXN B;  3BK9 A;  3D9K A;  1MHQ A;  2NOX A;  4ILI A;  4LRZ A;  1VDY A;  3LJC A;  5LFA A;  2NSZ A;  3CK8 A;  5E75 A;  5KDM C;  2RD0 A;  5IYZ E;  2GGF A;  2J1D G;  1YKE B;  4UWF A;  2G0U A;  2X9X A;  3C98 A;  4TUU A;  3CML A;  2FO7 A;  3PRE A;  4O4J E;  3I4G A;  3H37 A;  3TL5 A;  3CVL A;  3BQI A;  4FHJ A;  3DJB A;  1E1H B;  5ARF A;  4H9Q C;  1UJJ A;  1HZ4 A;  3LYA A;  3ZYM A;  1FIO A;  4JXT A;  4MLK A;  1BR4 A;  2NW8 A;  5G55 A;  3IBP A;  5AFU L;  2XPY A;  1B89 A;  1UX4 A;  5LX8 A;  1WYC A;  4IE6 A;  4I43 B;  2DCP A;  5GON E;  1FCH A;  3IBE A;  2WXH A;  4X20 E;  2WQ7 A;  4HOS A;  1YD8 G;  3D9J A;  2CM0 A;  1UJK A;  3NZS A;  4MS6 A;  3CLJ A;  4TZ4 C;  4AKR B;  5JR9 C;  4DND A;  3G2S A;  1LRZ A;  4H9P C;  4HFG A;  2DIW A;  4WNG A;  3GA8 A;  2WAU A;  2X67 A;  4HGA A;  4JPS A;  5F8P A;  1E8X A;  2I2O A;  1D0Z A;  3S2A A;  2KC7 A;  3UMV A;  3QJZ A;  4GCN A;  4TV9 E;  2CHX A;  5CCL A;  4PK4 A;  4ASK A;  1INZ A;  3FU0 A;  4I4T E;  2WXF A;  4H7X A;  4WBO A;  3ZHE A;  4N39 A;  3KV9 A;  3CX6 B;  4BT9 A;  4QFV A;  4NQ0 A;  2CLY C;  3PE0 A;  4B94 A;  3O4X E;  2FEZ A;  1N52 A;  2BVM A;  4HOR A;  3ONK A;  3VLE A;  2NW9 A;  3Q9D A;  4I6E A;  2LE8 A;  4XKC A;  2X9Y A;  1X79 A;  4NUR A;  3UUN A;  3J9X 1;  3U3I A;  2CG3 A;  1U5P A;  3MKQ B;  4DPR A;  2YIN A;  3ZMT B;  3PE3 A;  4KT6 B;  2ZM8 A;  4PJN A;  2X9W A;  1Z0P A;  3AAI A;  2PG8 A;  4PS3 A;  2DHR A;  2ZM2 A;  3UX4 A;  5JDQ A;  2J4D A;  3VTX A;  4H9O C;  4I1A A;  4UQY A;  2D5U A;  4RG9 A;  5BT1 A;  2E9X B;  2Y8D A;  4ILU A;  5JDF A;  4AQG A;  3PDN A;  4QKN A;  2N9D A;  2VJ8 A;  3IEG A;  2HO1 A;  3TXN A;  4EPZ A;  1ZBP A;  3P1U A;  4UWK A;  4GIW A;  5FQ8 A;  2HPL A;  3C64 A;  3LBX B;  3PVL A;  5G05 J;  2JEK A;  4UWH A;  3MV3 B;  3UT4 A;  3NQP A;  4AQF A;  1QUU A;  4U63 A;  3QUJ A;  4CGW A;  3ESL A;  3WI3 A;  3ZCI A;  3ZN1 B;  3JCK C;  2WXO A;  4KXK B;  4URK A;  3FXD B;  3D9O A;  4TV8 E;  3N2G E;  2ZMA A;  4HOU A;  4O4H E;  4YVQ C;  1BR0 A;  3P7I A;  4GYW A;  1VOM A;  3T5V A;  4ACL A;  3GW4 A;  4WAF A;  3MAC A;  4GYY A;  3ZIM A;  3T5X A;  1E90 A;  5JVD E;  5ANL A;  2CXL A;  4LEU A;  1O3X A;  4ZOL E;  4G2V A;  5BV1 A;  3GWH A;  3ETV A;  2IU1 A;  5CA0 E;  2OV8 A;  5ADX L;  2XRY A;  5J90 A;  2MOW A;  3CVN A;  5LJM A;  3EDT B;  5L3D B;  2PM6 A;  3CQC B;  2VGX B;  4EB6 E;  4M1P A;  2CWO A;  4XKB A;  1EZ3 A;  2E8I A;  3PE4 A;  3CGH A;  3C4Z A;  4EZJ A;  2BZB A;  4UQX A;  3I9Y A;  5JRE A;  4IIJ E;  4F7A A;  2VSY A;  4UF0 A;  2IOL A;  3KD7 A;  2VYI A;  5G2N A;  4GZC A;  1QQE A;  4O4L E;  5BV0 A;  2WXI A;  2Q9Q D;  4FJZ A;  2YHC A;  3MA5 A;  4H9N C;  1OWM A;  3EHN A;  3O1H A;  4YFS A;  3OBV E;  4I17 A;  5LJN A;  2C5I T;  3ZN0 B;  2MBG A;  3AA1 B;  3N9L A;  2X3M A;  2XHE A;  4UI9 J;  3AB3 B;  2KCL A;  2WMN A;  3B7T A;  2L8K A;  4APF A;  2I6H A;  4BSX A;  3ZGQ A;  3ZCJ A;  2X6J A;  2XGS A;  4JEH A;  4O2B E;  4AP2 A;  2WQH A;  4C90 A;  3UUX B;  4XIF A;  5E0O A;  5EX0 A;  4K0U A;  5CA1 E;  2VKJ A;  2IOS A;  3RK6 A;  2I59 A;  2VL8 A;  1S94 A;  2EHO A;  2C2L A;  5FP3 A;  5BPP A;  1FMW A;  4DMV A;  5HXH A;  2XCC A;  1ELR A;  1NP7 A;  4UWL A;  1OWN A;  4YLH A;  3SWH A;  2LOP A;  4GYO A;  4BY6 A;  2YHE A;  2VAS A;  4RG6 A;  3QWP A;  5KJN A;  3F2E A;  3PH0 C;  4ERR A;  5CMW A;  3IEE A;  3FUE A;  3RYI E;  4G1T A;  4JVS A;  3SF4 A;  3KIN B;  4WND A;  5CCM A;  3ZJ2 A;  2VB6 A;  4V1A v;  4MKT A;  2V0P A;  5JDN A;  2CWY A;  3MGB A;  3NZU A;  5A1L A;  3CIA A;  3HKE E;  4ANV A;  2B1E A;  2XAJ B;  4P0B A;  1D1A A;  3D3M A;  2H3R A;  2WXQ A;  3ZLI A;  2VKH A;  3PNL B;  2CHW A;  2HYZ A;  2ILR A;  4IYP A;  5EX3 A;  4IE5 A;  4DO0 A;  5M4Y A;  2VTB B;  4B0Z A;  3UUL A;  4FP7 A;  2LHN A;  3A5X A;  3ETU A;  2GK9 A;  5CHE E;  4PFO A;  4AQF C;  2CFZ A;  4GB9 A;  4YHJ A;  2WM9 A;  2Q7F A;  1LVK A;  3RX6 A;  3FH8 A;  5JHA A;  4AV7 A;  2H7V C;  3R7Q A;  3ESK A;  4MRU A;  2R5S A;  4UV9 B;  1HE8 A;  2BDE A;  2VSN A;  5JR9 A;  3B7U X;  5LNK A;  4BJM A;  4BX9 A;  4MFR A;  5FXZ A;  3PUS A;  4QXH B;  5FQ4 A;  3B7R L;  3L08 A;  4YJ2 E;  4J8F A;  3E0Z A;  2K5B B;  5ENN A;  4HLE A;  2N1G A;  1Z3Y A;  2C0S A;  2UXX B;  1UW4 B;  2IQC A;  2DCF A;  2LNI A;  2E9X D;  3ZXS A;  2KXP B;  3CVY A;  3C51 A;  2JPF A;  4GK0 E;  2X6K A;  2Y4T A;  1FVF A;  4JA9 A;  5EZY E;  1UG3 A;  2W00 A;  2CFU A;  4IE4 A;  1LF8 A;  3AVS A;  5JDM A;  3CVW A;  4XX5 A;  3Q47 B;  4G2A A;  1PAQ A;  3UTK A;  5JJT A;  1HFA A;  4FA6 A;  2PM7 A;  2VKD A;  3APC A;  4DLO A;  4K03 A;  4AKG A;  2L9B A;  3ENE A;  2WXP A;  4J8S A;  2Y3A A;  4EYY R;  5LP6 E;  5JDG A;  3CX8 B;  2AVP A;  2VSX E;  1T98 A;  4AY5 A;  5JRC A;  5J08 A;  5EK3 A;  3UFE A;  2C0L A;  4BTA A;  1A17 A;  3LS8 A;  3PUK A;  3T8M A;  2W63 A;  5J2T E;  3AAA B;  4HEA A;  3QB2 A;  2MHK A;  3HKB E;  5TAO A;  4WNF A;  3U78 A;  5LGT B;  3RYC E;  4EQF A;  1E96 B;  2W62 A;  5HXR A;  2DLR A;  4GAA A;  3S7D A;  4OK0 A;  4PFP A;  2Y4U A;  5AEN A;  5FZQ A;  3D9N A;  2K48 A;  2EHO C;  1U4Q A;  4JHJ A;  4CEM A;  1CUN A;  3FUK A;  3LDZ A;  4TRQ A;  1D0Y A;  2XAQ B;  1VRB A;  2Q9Q B;  4PNI A;  3ZMZ B;  2CG2 A;  5EDS A;  4HOQ A;  3O9X A;  3L09 A;  3SZ7 A;  4K0R A;  5LGN B;  2DBA A;  2WPV A;  4U72 A;  2PQN A;  1MMG A;  2C5J A;  2UY1 A;  4GZ6 A;  1KLX A;  3KEZ A;  4B6X A;  1MMD A;  2XAS B;  4PH4 B;  1YA0 A;  3HKC E;  3HKD E;  3J7Y q;  4ACK A;  4UVA B;  3JYS A;  3SNX A;  4X1Y E;  4QWN B;  5JJ7 A;  4UVC B;  4GYS A;  2C0M A;  3PUQ A;  3N9O A;  4J8E A;  5HQ8 A;  4E7Z A;  3WXX A;  4YVO A;  2KWH A;  3VLD A;  2IW5 B;  3MZL B;  3AS5 A;  3NZP A;  4JZY A;  3PU8 A;  2MOZ A;  2L0I A;  1H2V C;  3RH3 A;  3FP3 A;  3RKO A;  1WRD A;  3RIB A;  2IC6 A;  1Z3X A;  3UUM A;  4B8C B;  3AA7 B;  4IHJ E;  3K3Q C;  3TKL B;  4OHF A;  4Q96 A;  4G26 A;  2KZT B;  2W0G A;  2J09 A;  2LJL A;  1BPO A;  4KZ0 A;  3MEK A;  3WAJ A;  3D9L A;  3FTX A;  4ILG A;  4XZ4 A;  3ZHE B;  3MXZ A;  3OXL A;  4PS7 A;  3U9W A;  3PRZ A;  3ZYL A;  3FUJ A;  2BTD A;  4EZH A;  2ZM0 A;  4O8S A;  5JDH A;  5JDL A;  2P9B A;  2LO6 A;  5FT9 A;  4LER A;  3S7J A;  1QZ2 A;  3Q5W A;  3RYH E;  4FC8 A;  5FZR A;  3F57 A;  4KBM B;  3L17 A;  1NA3 A;  2XGM A;  3N9P A;  4EOZ B;  5LCW J;  5DJQ C;  4X1I E;  2ZU6 B;  4ABN A;  2V1D B;  4CI1 B;  2XAG B;  2GRL A;  4ZI2 C;  5DBK A;  1IYG A;  3I0Q A;  5D0O D;  2CA5 A;  4I2W A;  4X1K E;  4B8A A;  4AOF A;  2J49 A;  4L23 A;  3H3A A;  4GA0 A;  3SFZ A;  1S35 A;  3QDN A;  4N5C A;  2J9Q A;  2JQQ A;  1HX8 A;  3IHY A;  4FJO A;  3FU3 A;  4R7L A;  4HVB A;  2FF4 A;  5FYM A;  4I43 A;  4CDN A;  5BMV E;  4KBQ A;  5L3F B;  3MKD A;  5FMN A;  4GPK A;  3I3N A;  2FBN A;  2QGS A;  4BT8 A;  3RRM B;  1L5J A;  5L3C B;  2YK0 A;  3QC9 A;  3CKC A;  2WBL A;  4H63 V;  5LHI B;  2KT9 A;  2OA5 A;  4ZHQ E;  3LPZ A;  3FHN A;  4AXP A;  2VSO E;  5C1D A;  3P8C D;  3D9M A;  1B7T A;  3BG0 B;  4GU5 A;  1X5B A;  1IJ6 A;  3CQG B;  2XGO A;  4H9S E;  5HXC A;  4AEZ C;  3ASD A;  3AAE B;  4HFV A;  4I6J A;  4XAX B;  4ANX A;  2OVF A;  3SRZ A;  3I4R B;  3LY8 A;  3ONL A;  2M63 A;  4FI5 A;  4N2S A;  5KMG P;  1MIW A;  4OVV A;  3ULQ A;  4H9R C;  4JC8 A;  2WSS V;  3R6N A;  1JPL A;  3RRC A;  3UQ3 A;  3HVE A;  4BWR A;  3O4Z A;  3SOL A;  3PU3 A;  4HKA A;  1EDU A;  4HXI A;  2NWB A;  2DWK A;  2A72 A;  3B13 A;  2LSI A;  4YJ3 E;  3FTS A;  5EK4 A;  4P0A A;  4JLE A;  3DP7 A;  3EIJ A;  4NRH B;  2V4L A;  2D0U A;  4CDR A;  3MKQ A;  3U64 A;  4PJL A;  3CK9 A;  3S7B A;  4UF0 B;  1WYB A;  4DK5 A;  5FXW A;  4F53 A;  5LOZ A;  3B7S A;  4EXT A;  3RO3 A;  2V5F A;  1OWL A;  4CXX A;  5BW8 C;  3LFM A;  3FTZ A;  4G24 A;  4ISS A;  4CQI A;  4G63 A;  3L6A A;  4XE0 A;  1U3D A;  3GZS A;  5LOV E;  4L1B A;  1E8W A;  3G2V A;  5FY0 A;  2KLQ A;  3LY7 A;  4PJM A;  2KIN B;  5KJL A;  4MBQ A;  3LBX A;  3VHL A;  2XHE B;  5L3G B;  2X6H A;  4FHK A;  4L0R A;  5L3E B;  1HG2 A;  4EZ4 A;  4EZL A;  5FZS A;  3KBT A;  2MTQ A;  3G2W A;  4PS8 A;  4JEH B;  2X68 A;  5LHH B;  3ONX A;  2VKO A;  2QFC A;  3RKV A;  1YW0 A;  3RYF E;  3BQK A;  4ZS3 A;  3ML9 A;  4TUY E;  2WXK A;  3TG5 A;  2J08 A;  3FH7 A;  3Q49 B;  3GN5 A;  4UIG A;  2Y48 B;  3AS8 A;  2FUL A;  4DI4 A;  3R7R A;  3TXM A;  2VWA A;  4PK6 A;  2LSV A;  2LM9 A;  4ZI3 C;  3PUJ A;  5LYJ E;  2ES0 A;  3N9N A;  4Q69 A;  5ANR A;  1IAP A;  4ILH B;  3SGH A;  4F1S A;  3MK7 C;  1MND A;  3O1I A;  2NW7 A;  4ZI7 E;  4AKH A;  3HR0 A;  3ZMV B;  3TJP A;  3GZ2 A;  1HU3 A;  4GZD A;  3SHF A;  4ATG A;  2NTY A;  4DMW A;  4KVO A;  3PUA A;  3CST A;  2OVB A;  3CHM A;  2XRZ A;  2PBI A;  4HS2 A;  2KCK A;  2XTL A;  1JUQ A;  5DQV A;  3RRU A;  4BA9 A;  3RJV A;  4Y6W A;  4BFR A;  1IHG A;  5LCW C;  4MLP A;  3CVQ A;  4J2C A;  1N54 A;  2R17 C;  2XCB A;  5LGU B;  3G2U A;  1KT1 A;  4HE8 A;  3OYZ A;  3PTR B;  3IHR A;  3R84 B;  2FI7 A;  4TN7 B;  2VQ2 A;  4OVU A;  4CT4 A;  3PNT B;  4CXW A;  1Y6I A;  4JEU A;  2WXM A;  4CXY A;  4QXC B;  4A3V A;  3K3O A;  4P29 A;  2QA7 A;  2HPJ A;  1WY6 A;  2RP4 A;  2PQR A;  5EKQ D;  3ZYK A;  2IAK A;  4NAC A;  5JJ6 A;  2EQX A;  2IC9 A;  5FWQ A;  4U0S A;  3B57 A;  4CI3 B;  3FEY A;  3KVA A;  3GMI A;  2J07 A;  3KV6 A;  3NRY A;  3N2O A;  3AA0 B;  3FTV A;  4QXB B;  1OUV A;  3HI2 A;  5HXS A;  3LG7 A;  3APD A;  2GW1 A;  2WQ6 A;  5JR9 B;  2WB2 A;  3CVR A;  4AKL A;  4U07 A;  3CHO A;  3SBT B;  3ZPO A;  3T8O A;  5LG4 A;  1HS7 A;  1D1C A;  4I9E A;  3ANW B;  3CHQ A;  1IQU A;  2E2E A;  2CXD A;  4Y6C A;  3FBZ A;  1NA0 A;  4D10 C;  4L2L A;  4UWG A;  2YU1 A;  3QK0 A;  2HM8 A;  3KS2 A;  3O48 A;  5DAB A;  3MA9 A;  1UN8 A;  1WLX A;  3FUI A;  3ZMS B;  3FUF A;  3RRN B;  1H2U A;  1S0P A;  4G23 A;  3ZW3 A;  1ZKE A;  4UEL A;  3CKD A;  3I1A A;  5LHG B;  3I5P A;  1FVH A;  2CLY B;  2JLB A;  3FUH A;  4FU3 A;  3PS6 A;  5G05 C;  5LA6 E;  3FB2 A;  5HAX A;  5FY1 A;  4WNE A;  3OKQ A;  1HO8 A;  2PFV A;  3LKU A;  5AYW D;  4GYR A;  4WWN A;  4EZK A;  1EPU A;  1ELK A;  4JUY A;  5KX5 E;  4U0Z A;  2XQY A;  2L0T B;  1BR2 A;  4N3B A;  3V5U A;  2DNX A;  4G11 A;  3JC6 C;  3ZEF A;  4I1M A;  3CHR A;  3TGO A;  2E9X C;  5C2Y A;  4I6G A;  4GZ5 A;  3NF1 A;  3FTW A;  3QC1 A;  5T4Y A;  2XPZ A;  4L7T A;  1U3C A;  4EAH A;  5JRC B;  2VTB A;  5EK2 A;  3LVQ E;  4QHO A;  3I0O A;  4CRW A;  3CVV A;  4W9R A;  2X38 A;  1TEZ A;  3Q15 A;  2OND A;  3PZD A;  3ZPJ A;  4GCO A;  4PK5 A;  1KNZ A;  3SBS A;  2KAT A;  4KUM B;  1YKH B;  5H6Q B;  3QAR A;  3ZRH A;  3FTU A;  4PW8 A;  3CVU A;  4WUY A;  4KVM A;  1GW6 A;  2BF0 X;  3QK6 A;  2Y6X A;  3RRW A;  1OWP A;  4BX8 A;  1JWF A;  5LCY A;  4IN3 B;  3L3P A;  3C4X A;  2DWG A;  2V26 A;  4JW1 A;  4UQZ A;  3CVX A;  5J1G A;  2Z6E A;  2QY7 A;  1HF8 A;  3FUN A;  2R59 A;  4JL0 A;  2PZI A;  3FUL A;  3MCX A;  5D0Q D;  2SPC A;  3KFW X;  4GML A;  2UY1 B;  4WWP A;  1ELW A;  4OYS A;  3CWZ B;  3ZN3 A;  1LVF A;  4H7Y A;  1OXZ A;  5LBQ B;  3Q2M A;  4XI9 A;  4BAY B;  3C98 B;  2NP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...