2WM9A

Structure of the complex between dock9 and cdc42.
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
423
structure length
407
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 148
structure length 407
sequence length 423
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wm9A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wm9A01
2YINA 2WM9A 3B13A 3VHLA 2WMNA 2WMOA
chains in the Genus database with same CATH superfamily
3FULA 4M1PA 1E7UA 1PY1A 2DYSE 4G1TA 3KV6A 4ZI3C 4PK5A 3ZCIA 2CFUA 4UVBB 4HFDA 1WRDA 3AEAA 2Q7FA 2B1EA 2HN1A 2X38A 5FQ4A 3E34A 1U3CA 4CN4A 4BTAA 3SI5A 5IUXA 4HWCA 4KT6B 4NACA 4JUYA 3HXCA 5CBNA 5LA6E 4G8LA 3D0TA 2WP9A 4EZLA 3P7IA 2NXPA 4YLHA 5KJLA 2W63A 2QC9A 4LFAT 3FU3A 3WG7E 2H6IA 4JI1T 3N71A 3MK7C 4BSXA 3VR9A 4I6EA 4A3TA 2W00A 5KNGA 2CMRA 5IY5E 3ZYMA 5LMUT 4J6IA 3CHSA 4J8EA 1TNBA 4U72A 4L23A 2XGMA 4RVBA 4AKGA 4GTMA 3FZHB 2EINE 3NRXA 2UY1B 1Q2ZA 3QARA 4K0RA 5FL0A 4XX5A 2VKDA 2IO3C 2WQ7A 5L3GB 4NXMT 1D1CA 4Z8XA 2J09A 2YU2A 2ETAA 5CBOA 5BXOA 2WXPA 2ES0A 3I1AA 2Y0BG 1FMWA 3DSTA 5C8YE 4I50E 1N52A 4GMJA 3T8MA 2MAWA 4B94A 5AQ9A 2WDVA 4BETA 1E1HB 3Q2MA 2UUCT 3TXNA 3NBNB 3ZYQA 3A7MA 2FJEA 3CVPA 4I0UA 2VQFT 2MOZA 4ZI2C 4IRUA 2BS2A 5C2TA 2QYJA 4HOTA 3T8OA 1OY3D 2E9XC 2VK9A 2E2EA 4AY5A 2C0LA 1HNWT 2NSZA 3X1DA 2C0MA 3BQIA 4ZXLA 3O4ZA 3LS8A 3QC1A 4L1BA 3FTSA 4DV7T 2B0OE 4O2AE 4RG6A 3KV9A 3T5XA 2BKOA 4CDMA 4DR4T 3DSVA 5JDGA 2KLQA 4OHFA 3ML9A 5JJ6A 3AA7B 2NWBA 1OEDC 2XQYA 1HFAA 3V5UA 4DV5T 2F8XK 1MNDA 2QZAA 3Q78A 2IO2C 3TWRA 3G2WA 3U78A 4X1KE 4AVXA 1VDYA 4U2YA 3DSUA 1U5PA 2KSRA 2ZU6B 2GRMA 2WQ6A 3Q9NC 4CN1A 3O48A 2JABA 3Q4AB 1W0AA 3WI3A 4DBQA 2ZGDA 3UFGA 2CHWA 4HS2A 3G2TA 5LBQB 1OUVA 4GKJT 2XASB 5AQRB 1FPPA 5JVDE 4UIGA 3KSLA 3ZC0A 3D3MA 3P1UA 3R6NA 4LF5T 2NC9A 4MALA 2ZGGA 3ASDA 2J08A 1G8XA 1MIVA 3APDA 3RQUA 1T7SA 5FZRA 3D9HA 2JQQA 3P4SA 5AQAA 4EZ4A 3W9GA 1KEYA 2HO1A 3ASGA 3LEWA 3ZYKA 3DSWA 4EECA 1NP7A 2QRXA 3UU4A 4B8CB 1NA3A 4TUUA 4L7TA 3ZU7B 3ZMZB 2FBWA 3E22E 3RH3A 1TYQG 3OPCA 2IU1A 3S4UA 4B6XA 1QLBA 2XAQB 3AG3E 1SZ9A 4EXTA 2RFAA 2BBJA 3K3NA 4KBQA 4Y6CA 5JJ7A 2WCAA 4L2LA 4WBNE 4DV6T 1BPOA 3ZT7A 3QB5K 4IDNA 3TLWA 3OXLA 1HH8A 2FJAA 1HNZT 3OBVE 2XZDG 4O60A 1OWMA 5HEGA 1NL4A 2JQKA 5JDNA 5ENOD 3PDYA 1FVHA 2V7JA 1XMOT 4MRUA 5LCWJ 2BUGA 5DBKA 1G3NB 4NIKA 1XMQT 2Y4UA 3B7BA 4O4HE 4DUZT 4JHJA 4YTMA 3FU6A 2XUEA 3E37A 2CWOA 4K0KT 3AE9A 3AVSA 3RQWA 4DIDB 4PFOA 4I17A 5KBAA 4DR3T 3VRBA 3JC6C 2KZ7B 4U07A 3KV5A 1E8WA 3Q9UC 4KBMB 3RYCE 3ZPJA 4KP3C 2R59A 3AXJA 3PUZF 2VL8A 2LXLA 5KNHD 3DXMG 3RC8A 3GMIA 5FY0A 4YT0A 5FQ8A 2GRQB 4OFZA 3FTWA 4ISTA 3LBXB 4TXPA 1KF6A 5HXHA 4AXHA 3FEXA 4M3OA 3KFWX 4PNIA 1SA0E 3CSFA 3K3QC 3JC6D 4B3MT 3ZRHA 1JCSA 4YSZA 1LVKA 1LD8A 3Q5DA 1K1AA 5ENPD 3ZKJA 2DNXA 3AEGA 1KT1A 4GK5E 3HL6A 4Z91A 3C4WA 1RW2A 3MJWA 2DYRE 1N4SA 3H3AA 5AQTB 1DU2A 2YNQA 3E33A 4G25A 2NTYA 2C2LA 4N2SA 3MGBA 2D0UA 1I94T 1TN8A 3NWIA 4NURA 4URKA 3B7SA 5AQGB 3PH0C 4H63H 4N5CA 1LKXA 3QNKA 5AYWD 3EHRA 5FJYA 5JDMA 2L8KA 1W9RA 3AAAB 3FHNA 2MBGA 2P2CP 4UQYA 2WXIA 2X6IA 3FTXA 1JWGA 3AS5A 4UV9B 4FJYA 3VLEA 5FZSA 1UURA 2HN2A 3OVUA 1A17A 3CLJA 3MV2B 4I4TE 3GZSA 3JQ1A 1YCSB 3EUHA 1H2UA 3S2AA 4OYSA 3RX6A 2E9XA 3JUIA 2Y48B 4R7LA 4F6RC 4I6GA 3HXFA 4U8VD 1Z3YA 1K8KG 1ZB1A 4UWGA 5AJLA 2BEDA 4P29A 3JCFA 2CHOA 4U96D 3DRAA 1HF8A 3FUDA 4H7YA 5AJDA 4EZHA 2CEAA 2EHOC 4IL9A 4KZCA 4U63A 3P4RA 5LG3A 1WAO1 2XQ6A 4QXCB 3ZN1B 3T9KA 1Z0PA 3L17A 3H37A 2L6BA 3CK9A 2WWVA 2VJ8A 5LHIB 4GIWA 4HOQA 1KFYA 2DI4A 3FUEA 2WXJA 5FQ7A 3AE3A 2BTDA 4AQYT 2BS3A 3CIRA 4DMWA 3RIUA 5FXWA 4FLBA 2AXDS 3UQ4A 2LJLA 3LBXA 1KLXA 5B3SE 4AKHA 2AWIA 3UULA 3EIJA 4JD2G 3BQLA 1UK5A 2KT9A 2Q9QC 3P4PA 3MX3A 3UINC 3PZ2A 4PJMA 4K5BA 4DK5A 2N9DA 2X3MA 3RK6A 4OK0A 2WQHA 3PVLA 4AQGA 3FXDB 1IBKT 1LTXA 4ASKA 4E7ZA 1HZ4A 4CT0A 2BG9C 3SD5A 4JI8T 2RFMA 4HRLA 1ZOYA 3ZEFB 2WSSV 4AXPA 3M3ZB 2WAUA 3PUYF 3TWSA 4ATGA 4CQIA 2QYUA 4DR5T 1LD7A 1XGWA 4U33A 3LJ3A 4KVMA 4ZS3A 1MQSA 2ODVA 4XKBA 3NRYA 5KJKA 2C5IT 2V6YB 2FULA 4PJLA 4HFCA 4JZYA 4OVVA 2CLYB 5CB4E 2XRZA 2MOWA 4JHRA 5ENRD 1HX8A 2C5KT 3KEAA 3FUFA 2X9XA 2LSIA 2WXRA 3HXDA 4F1SA 3FH5A 2W0GA 3ZCJA 5A7DB 4I55E 3TLTA 5DJQC 3CKCA 2CFZA 2R17C 3B57A 4X1IE 2XQ8A 1QZ2A 3DPDA 3FU0A 2XEHA 4G24A 4BX8A 1NWMX 3ZEFA 4LSZE 2W2UA 3UMVA 4PAGA 3TKLB 1FT2A 1Z6TA 4LCTA 2CWYA 3TG4A 3MZLB 5KCMA 3NZSA 2J4DA 4CXYA 3RRUA 3UX4A 4UELA 4DRXE 3PE0A 3I5PA 1J5WA 3LXUX 3OKQA 4L9PA 4PJNA 2LAHA 1SZAA 3NB2A 2GK9A 3HHMA 3RRNB 3MKDA 2X68A 4O4JE 2V4LA 2X9WA 4DX6D 5LJNA 2XM1A 4A63B 5L3BB 1XDPA 2XENA 5JA4D 5LB7B 4ILUA 2J47A 2L0IA 5FT9A 1OEDB 3FFLA 4QQIA 4FU3A 2WY2A 2GW1A 2H6FA 2DVWA 1VCTA 3RJVA 5L2LA 4NRHB 2LXMA 3QNUA 2P9LG 3F6QA 4DR2T 1O1SA 2NP9A 3Q15A 3ABKE 1Y64B 3ONXA 2LO6A 1JCRA 4ZI7E 2I9CA 3QWPA 3ML8A 4LG6A 3P8CD 4HOUA 3PREA 2EILE 4DPRA 4LF8T 4ZFHA 2R2LA 4CRWA 3ANWA 5CJ5A 4H9RC 3ETUA 1GW6A 1EPUA 4HVBA 5FXVA 3P4QA 5FY7A 4BA9A 1N33T 3B7RL 3OAWA 2C0SA 4XZ4A 4YDOA 4DV0T 4A98A 4O4LE 3JUEA 4P1NA 4HI8A 2KCVA 2LLYA 1HNXT 3BQKA 4X66T 2PL2A 2V6YA 3SFZA 1AJ3A 3LDZA 2B76A 2WXQA 2IHR1 1O1TA 1N11A 3CHRA 4OAVB 5CECB 2UXNB 1OCZE 1ELKA 1IZNB 5AQHB 1TN6A 3I0QA 1M7KA 5ABHA 1DVPA 5ABEA 3C3OA 1I6ZA 3FTZA 3C64A 4LNGA 5BUZA 3HR0A 2OOEA 3AE1A 4EIWA 3QDNA 4YY3T 5L47A 5FXZA 4UV8B 4B0ZA 2OLTA 2UXXB 4D10C 3URZA 2YOEA 3RSEG 3D9IA 2LOPA 2X6HA 4QH1A 3LVRE 4TWHA 1NI1A 5F5WA 5AARA 1UJJA 5JHBA 1DCEA 3O4XE 2MRIA 4TWFA 2CBIA 4TNVA 4CI1B 3S7DA 3WAKA 1INZA 5A23A 2CRBA 4IL4A 4PW8A 3AJIA 3J7Yq 3EDVA 4JLEA 2R6GF 5C3JA 4CZ2D 3GA8A 2CBJA 2I6HA 3J5QB 3LK3B 1XZYA 4K5CA 1UCUA 4CN6A 2L9BA 2DHRA 3PU3A 1E7PA 4X65T 3GZ1A 2E8IA 4F3VA 1IJ5A 1S35A 2DZNA 3QWWA 4IDZA 4QXBB 3HVEA 4A55A 4F53A 1VRBA 1HX1B 5EX0A 4GTRA 4TRQA 5CA0E 2FBNA 4F1PA 2L9QA 3B95A 2PG8A 4H9NC 3E4BA 5HS0A 4ZOLE 3VLDA 2L6JA 3ONLA 2EIKE 5ABGA 3N9LA 3RO2A 2MYOA 1JUQA 4QX7B 3DWLG 4GYSA 4TN7B 4A97A 3HXBA 2GROB 5AQ7A 3CVUA 4DUYT 4DR1T 3FHEA 3AEFA 1HXIA 2L3LA 2WVIA 5E75A 5C2YA 5JJTA 4HQDA 2MTQA 2HPJA 4U0UA 5JQGE 3UKUG 4YDWA 5L3CB 2J07A 4HBDA 5CHEE 1MX6A 1OCOE 3ZN0B 2VSXE 5J2UE 4CEMA 3FUIA 4HLLA 5KXJA 4TZ4C 1IJ6A 4N2QA 2X0HA 3T1YT 2XGOA 2LHRA 2E5VA 3AVRA 3IEEA 2XPYA 3C3RA 3KV4A 2LSJA 5ABFB 2R02A 4AIUA 3A5XA 5T8IA 3HKEE 4ERRA 3ZPOA 4EEBA 3PRZA 3FXEB 4GZDA 4I43B 2VSOE 2I2OA 3SZ7A 5EYPF 4IDQA 3JADA 1G73A 1N9AA 3KINB 3LY8A 2IC9A 3FTVA 4EBAG 4WNGA 4JBWF 5EZYE 3EHQA 3CVNA 5CA1E 1UUSA 2AJAA 3NZPA 1ZU2A 2XZEA 3D9MA 2D0TA 3KVAA 3ZT6A 4EPZA 3ZMSB 3DPYA 5CEAA 3FZFB 1YQ4A 4H9QC 5F8PA 3HYMB 3U64A 3Q49B 1OCCE 2UXDT 4BFRA 3EI0A 1YXRA 1WG0A 2VVNA 3MKQB 3QAQA 1E96B 3MXZA 1XWMA 2XM2A 5FIOA 4ZZBA 4LF7T 2P9SG 3UM3A 5AQSB 1IKND 4Q69A 4RQIA 1OWLA 2XGSA 2ZXWE 1S64A 2ZIRA 4HXIA 3C51A 1OT8A 3HA4A 3CX8B 4X8QA 1OCRE 5LJMA 1Z5SC 3CHOA 1TNUA 3KD7A 3FTYA 2LRKA 2Y3AA 3O1IA 4TV3A 2LSVA 3QK0A 3S7FA 1KPSB 3KVBA 4JEHB 2XAGB 3UUXA 2CHNA 1IQUA 4EYUA 2KZTB 3ZXPA 1FMVA 2H6GA 4UWHA 2UXCT 3VKGA 2EIME 3ABLE 1XNRT 2UU9T 3UIOC 3CHPA 1ZEEA 3ABME 3I9WA 3DP7A 4A1SA 1YD8G 3CKDA 2VTBB 3RRCA 4G2AA 4TXRA 4WBOA 4P0AA 2I1KA 4J8FA 3CWZB 3E32A 2BKPA 3LKUA 4I1MA 2BKNA 3EHMA 3V2XA 2ZLYA 3L8RA 1IAPA 2KXPB 3PV0F 3U66A 4KMCA 3U9WA 3QOFA 4RLYA 2MHKA 3HIZA 4G63A 3CVXA 3TLSA 3QWVA 3LK2B 2DWKA 1E2AA 5IHYA 4BESA 3L39A 2FF4A 2PZIA 3CK7A 3Q9DA 3U4TA 2V6XA 5A6CA 2XY8B 4QXHB 2DZOA 3Q47B 3TGOA 4LERA 2X6JA 4KMOA 4WNDA 4JC8A 3ZYLA 1U4QA 4JEUB 2NR4A 4P0BA 2ETCA 3SQVA 5AIJA 3FH8A 3IHVA 2VKJA 3SF4A 4H63V 3I4GA 3ZHEA 2A5EA 4OAUC 2VGXA 2X67A 5AQFB 5BT1A 2LRLA 1N0RA 3AAEB 2ZM0A 5LOZA 3UIPC 3FTUA 3UTKA 1NENA 2V26A 3UT8A 5ENQD 2PQRA 4UQXA 4J8DA 3T5VA 3N2KE 1S70B 2ZMAA 4GYYA 5HEHA 4JI6T 4DX1A 4Q96A 3V79K 1R8IA 3ISMC 1V9DA 2XQ7A 3HKDE 5HAXA 2Y8DA 1O5MA 2A3DA 3AAIA 4ANVA 2H89A 2KINB 3RAUA 2XRYA 2M63A 3UM0A 3NZQA 1MMDA 4IULA 4FP7A 3ZUVB 2IF4A 2FO1E 3MKQA 4JI5T 2LEHA 2DCPA 3CGHA 2R5SA 4DV4T 2UY1A 1HE8A 2V5CA 3CQGB 2VGEA 5LBMA 5L3DB 4PDXA 3R9AB 3CQXC 3RLFF 4YJ3E 4DI4A 4MFRA 4DV3T 3Q73A 2CHZA 4DO0A 5J0ZA 4W9RA 2GRNB 1MMGA 5LFAA 4LMLA 4U8YD 1OWPA 5HXRA 3EHZA 5AQNB 3KEZA 3K1SA 3LSVA 1EYHA 2CE7A 2ACXA 1SVXA 2IFUA 1T98A 3ZJ2A 2YN6A 3PZ3A 3TWQA 2K24A 1EDUA 2IJGX 3BUAA 1Y6IA 1JWFA 2VKOA 2XZTG 4KHZF 2CG3A 1NZNA 3D9NA 4XI0A 3KBTA 3HKCE 3E30A 4Q94A 5BXUA 2V0PA 2BKGA 3ESKA 3N9PA 3ASNE 3UU5A 4DMVA 1N32T 2HYZA 4OYJA 5FKYA 1YKEB 2RPAA 1BR2A 3C4ZA 3AS4A 2IW5B 4E7SA 1X79A 5EKQD 5LOVE 2BF0X 4UI9K 1BI8B 3RYFE 4KYOB 1ZV4X 4NIQA 2XHEA 2LM9A 4LNUD 3QOUA 3ZNGA 2XPIA 2JJ9A 2LM2A 3V31A 2UUBT 4CGWA 4U8HA 4WWNA 3F2EA 2VSYA 4GTOA 1HG2A 1H0AA 3LY7A 4FHKA 5BR8T 4N5QA 1YYHA 5AENA 3MEKA 3FBZA 5AQQB 5AFUL 3IKOB 1CUNA 3TLVA 4PS8A 3LCAA 1CHUA 3LFMA 4IIJE 4GTVA 4BSZB 3RC3A 3ULYA 3B5MA 3RGLA 1SUMB 4HFGA 3HKBE 2KC7A 4AIFA 3MA5A 5DABA 5EILA 5J1GA 1B7TA 1VOMA 3MCXA 4XKCA 2JMKA 2X9HA 1O3XA 2J4GA 2UXBT 4F8HA 4PS3A 4UQZA 4CT4A 3IBEA 4PUCA 4HWIB 5JTGA 4KI0F 1D8DA 5EK4A 3TWTA 2YKSA 3F31A 1D8EA 4IE6A 3BK9A 3C3QA 4ADZA 4DLOA 2XSAA 5JDHA 3U3WA 5KMGP 4TV9E 2E2AA 4E6HA 4AQFA 4MHCA 1WR0A 5AQMB 3ABVA 3TWXA 4CI2B 3L09A 2J1DG 1QUUA 4M7CA 3VKHA 4HN9A 5EIDA 1XNQT 4JHKA 1E8XA 4ANWA 3Q5EA 3RRMB 2V8SV 2KM4A 4L0RA 2E9XB 4X62T 5E0OA 3QK6A 2CG2A 3PUSA 4BT8A 4WNKA 3RF1A 2A5UA 4JI0T 2PFVA 3TLUA 3UFEA 4GZCA 3HXEA 4WNFA 3KS2A 4IDPA 4ANUA 2NW8A 1W0BA 2PTFA 2QVAA 3D9KA 2BDEA 4UWKA 2WXNA 4B8AA 5EIBE 3I9YA 4H9PC 2F37A 2WXLA 2XQ3A 4ZZCA 2RD0A 2DIWA 3L22A 5HQ8A 3EUVA 3P50A 5M4YA 4K0UA 2XHEB 3FWVA 1H7CA 3CK6A 1QQEA 3CVLA 1Y01A 5HCJA 1DNPA 2F4VT 5TAOA 4CXWA 3SFYA 2IEJA 4YSXA 5HYAA 2CHXA 3FUNA 4E85A 3AE4A 3ENEA 2XJ7A 4WWOA 1OXJA 2WU2A 4HRMB 4MBQA 1QSDA 5AQJB 4AP2A 4JW1A 3Q7AA 4O8SA 4EV6A 1IHBA 5T3RA 4AISA 3D9JA 2VWAA 4UXNB 3SY2A 2MPKA 5D0OD 2XQ9A 4EZKA 2XQ5A 3UUBA 2PQNA 1IHGA 4GMLA 2NOXA 5AQIB 2P9BA 2KMFA 5FWQA 2ZM2A 4GPMA 2A9UA 4GU5A 4N78D 2QY7A 3EDTB 4HFVA 1U2VG 1ZBPA 2YK0A 1NFIE 2LT3A 2XCCA 3L82A 5EDSA 1KT0A 4BY6A 1FCHA 3JQ0A 4U7EB 4AKIA 3Q5XA 4UVCB 1MHQA 3AXJB 3QKYA 3PU8A 3SFEA 1IXVA 4PH4B 4DVDA 5D2MC 3UI2A 5LNKA 2A2FX 4Y6WA 1ELRA 3ULEG 2LAIA 1UX4A 2VYIA 3BG0B 1OEDE 4XI9A 3ZIMA 3G2VA 3OXGA 5AQOB 2AVPA 4B93B 2SPCA 3TXMA 5FVKA 3L6AA 2CLYC 3R9MA 5FMNA 5KWDA 4HORA 1YW0A 3PUVF 1YKHB 2WDRA 1QNFA 3GW4A 2KCLA 1W3BA 4DR7T 2OV8A 2Q9QB 3SFXA 3C5RA 4GOUA 2DL1A 2XPZA 1QYMA 3DBSA 3H3MA 1TN7A 2ACZA 2WZIA 4ILBA 5L4EA 3AA1B 2LSUA 3VTXA 4BX9A 3EU9A 3ANWB 2VQ2A 3AEBA 3W15B 2WMOA 2RA1A 1XDOA 2K5BB 3N2GE 2OVFA 2HR2A 3FZKB 3VLFA 5AQUB 4CZZB 1TEZA 5JRCA 3J9X1 5HI7A 3C4XA 5BV1A 4HTEA 4BTBA 2HHHT 4K03A 4U95D 2WMNA 3NVOA 3R7QA 2K48A 4Z68A 4UEMA 1YMPA 2QGSA 2IONA 3PE3A 4L2YA 3TWUA 3TWVA 3DSSA 3OTOT 2X0YA 4HFHA 4BT9A 2E9XD 3OJAA 5HKPA 4COFA 3I3NA 1US7B 2V7IA 5DQVA 4GAAA 4LRZA 3PDNA 5CGMA 2B6CA 3PTRB 3L9TA 4HFEA 1S63A 5DIZA 4J2CA 4EZJA 4GB9A 3APCA 3EU5A 3LY9A 4H9SE 3IHRA 5J90A 4ZI3D 1HG5A 3N9QA 5H7PA 4YJ2E 3ZMUB 2WBLA 2JLBA 4ILGA 4PK4A 4AKRB 2Q9QD 2D9DA 3UKRG 5B1AE 3L3PA 4AKLA 3JAFA 3G2UA 3NAWA 4XE0A 1AP7A 2AW6A 3KAEA 1D1BA 4LMKA 4EGWA 2JEKA 5FNVE 5LX8A 4MLKA 4LFCT 3T8KA 2J49A 5JRCB 1MJ0A 2PNNA 1H19A 1N4QA 2XAFB 3CQCB 3SBSA 1ELWA 5EYLA 2LSGA 3EHNA 1IBMT 1HO8A 4DX2A 1EF1C 4N3BA 4JPSA 4GYOA 2JQHA 2A4ZA 3N5LA 2VSNA 4U2ZA 4OX9T 2H88A 2EIJE 4GYWA 4BERA 3PNTB 1WDYA 1HU3A 3OTNA 4H9OC 3Q7FA 4LNBA 3PUKA 5JDFA 4JA7A 1E8ZA 3AECA 4QH4A 1WCRA 4UR9A 2M6IA 3RIUC 3K9IA 3MZKB 1E8YA 3FU5A 3R84B 4DX5D 3RPUA 4LUNU 5FQ6A 4EB6E 3MA9A 4XIFA 2J62A 3FBLA 5LGTB 1KNRA 3PJAJ 3N2OA 4YDYA 3ZGQA 5GONE 5FL1A 5D0QD 4J8YA 2BBHA 1D1AA 4G11A 3SHFA 3UPVA 2VVSA 3V30A 1SHZC 3LJNA 2XPKA 3RI5A 3CR3A 4TNWA 1H6PA 3ETVA 3JYSA 2Q9QA 1H6KA 4K5AB 1H6OA 3FY4A 2BVMA 3HRAA 4V1Av 3EJNA 2V4HC 3PEVB 1LVFA 4FLHA 4RG9A 2LOSA 5FTPA 4DNDA 3AG2E 4H7XA 5EK3A 3W9FA 4CDRA 4PFPA 4CCAA 4XZCA 5LMNT 3B7TA 4C0EA 1P5QA 4NXNT 4I1AA 4CI3B 4HWFA 1KNPA 1D0ZA 4YVQC 2DCFA 4U04A 1OXZA 1UG3A 4UUCA 4DR6T 3LK42 5JDLA 4LF4T 1FT1A 2P58C 2LSYA 5FZQA 4ABNA 1T72A 3HVEB 2AXVA 1MNEA 2PBIA 2WU5A 5J2TE 5LP6E 3LYAA 3ZJ1A 1TJCA 5CFBA 1X81A 5AQLB 1Z8UA 5LG4A 2WB2A 1X9BA 4N3CA 2W66A 5LXTE 5CEDB 4U7YA 3O1HA 4QWNB 2CA5A 1LRZA 3FZMB 3PUGA 3ONJA 3VTYA 3UQ3A 3DTOA 2LSKA 4I2ZA 1HR0T 1D0YA 2P9KG 4GCOA 1RZ4A 2VQET 2KBXA 4YVOA 5DQWA 3GN5A 4ILAA 2VB6A 2KNDA 4QHOA 3I4RB 4QX8B 3N9OA 3CX7B 3DSXA 5ITZF 3CVRA 1TNYA 3FZLB 4EYYR 3J5PA 4FULA 4A5XA 2J9QA 2X6KA 2X51A 3TJPA 4B3ST 3M65A 4NPPA 3NBXX 2ETBA 4KHPT 3ZLIA 2YDSA 3PEUB 2FJDA 3RIAA 4ANJA 3AS8A 4U0ZA 2NW9A 2LHNA 2KATA 2GRLA 4X5TA 2UWJG 4GKKT 4PK6A 4JI2T 2IY0C 4U0SA 2YINA 1NEKA 4ANXA 4L5GA 5JREA 2AE9A 2WZHA 3OYXA 4C9BB 2BG9E 3NOCD 3CX6B 3S7BA 2WXOA 4IGUA 4HLEA 4FA6A 2CPTA 3IBPA 2XEEA 2A72A 2WS3A 3PE4A 2V1DB 3EVYA 2I59A 5BW8C 3SNXA 2M67A 2KZTA 2CXLA 1O1RA 4IN3B 2YEVC 5JR9C 2E5LT 2BVLA 4TV8E 3D9PA 3NZUA 2WQYA 5E76A 4NUUA 1N34T 4PS7A 3ZMTB 1AWCB 4GTQA 3PURA 2XAHB 3AG4E 1MZCA 5BV0A 4KUMB 4QH5A 1SQMA 1W09A 3AU4A 2HH7A 2H3RA 2KWHA 5CRVA 5BMVE 1IBLT 2LE8A 2IUBA 1HTJF 3AB3B 1N4PA 1IYGA 2F8YA 3JCKC 4YHHT 2G0UA 5LCWC 3ZN3A 3HI2A 2JQ9A 4DBRA 2J8SD 5EK2A 3G06A 4IDOA 4G8KA 4UF0A 4XAXB 1N94A 1OWOA 1MMAA 3FUHA 4MS6A 3PZ1A 2HPLA 3Q5WA 3BG1B 1D0XA 3UQ7A 1OWNA 1JPLA 2YHCA 1K1BA 3AAAC 4JEUA 1SA4A 4ZEYA 1TNOA 3UT5E 5HXSA 3CKBA 5HXCA 4MBGA 4TUMA 3VR8A 2WWUA 2JPFA 2VKHA 3ASHA 2GRRB 4DX7D 1H2VC 1WM5A 2GRPB 3CEQA 3SGHA 4WNEA 4CGVA 1X5BA 2Z6EA 3DEPA 2XS1A 5L4HA 4DV1T 4PJJA 3G2SA 4WUYA 4BJNA 5JDQA 5HEUA 2PM6A 2VURA 3EDUA 5LHHB 5JMND 2W4XA 2OVBA 4BJMA 2VTBA 4AEZC 1MX4A 3QUJA 5LCYA 4UI9C 4DUIA 3K3OA 3IEGA 2CM0A 5LYJE 3HDXA 3CVWA 3RIBA 3V5SA 3ZSSA 3S7JA 4JA9A 2XAJB 4IYPA 2R05A 2OEVA 3AA6B 3B13A 1Y8MA 2WXFA 4ACKA 4UF0B 2Y4TA 2XSBA 4CYMD 4GA2A 4XEIG 5ENNA 4GZ5A 1WLXA 1HS7A 4BAYB 2CXDA 4HKAA 4AQFC 3UUMA 2VASA 3UU3A 4YSYA 4NQ0A 4KZ0A 1E7VA 5L3EB 3QJZA 4AY6A 2VL0A 2IOLA 5CERB 4JI3T 3NF1A 4IT4A 3ULQA 4X20E 2XS8A 3WXXA 2OV9A 5BPPA 4APOA 4JL0A 3LG7A 3DXKG 4HRNA 3ASFA 1S94A 5KDMC 1BI7B 3ZHEB 4HWDA 4UWLA 3MV3B 3BU8A 3TL5A 5CCLA 5G2NA 4IREA 2EHOD 1MIWA 2KWIB 3RYIE 2H6HA 3P2BA 2KXPC 3JXJA 4N39A 4XBFB 2P9IG 3OXFA 5LP0A 2LUHA 4JI4T 1UN8A 1XNFA 2QA7A 2ODUA 4DI3A 1HCIA 1UW4B 4HWHA 1T8BA 3LVQE 1TJFA 3PUJA 5CMWA 5L3FB 1WR6A 3SRZA 5IYZE 3JAEA 2DWZA 2JRKA 4GA0A 4G23A 2WDQA 1J1JA 3AEDA 4I6JA 2XQ4A 2WPVA 4WWPA 5G04C 2FJBA 4GYRA 3IF8B 1NAFA 4LMJA 3TAXA 3ZVVA 3VRAA 4WAFA 4EOZB 5H6QB 2K9AA 4YXDA 4I9EA 5C1DA 3UUXB 3DJBA 4A3VA 4UVAB 2DLRA 3WAJA 4WYVA 3PJAA 5FYMA 1TR4A 3R7RA 2XTLA 2LKGA 4U31A 2RP4A 3PUWF 3VHLA 4C91A 3GYZA 4YTNA 3T1HT 4TWDA 3I0OA 3CIAA 5ARGA 2W67A 5AAOA 4B3TT 5ENSD 4NUVA 2W62A 1S0PA 5AQKB 3AE2A 5LHGB 1KNZA 1LF8A 2Y69E 1JNRA 4ZI2D 3RRWA 4OVUA 1BLXB 5ARFA 2FO7A 3ZSTA 4CXXA 4HE8A 4EEDA 2V8SE 1KK7A 3UM2A 5KJMA 3V2OA 1N36T 1V55E 4JI7T 4HI9A 4MKTA 3GWHA 4KVOA 1SW6A 3QC9A 1DC2A 2JMHA 3D9OA 4ACLA 4HNAD 4JYAT 4X64T 1DCQA 3O1JA 3C72A 2RG8A 3MKRA 3ZFWA 4G26A 4IE4A 3UM1A 4FC8A 3CK8A 4B3RT 3AG1E 3CVVA 4IE5A 1E90A 4CDNA 4RSYA 5G05J 3A8YC 4X1YE 3UUNA 4FHJA 4YTPA 3N9NA 2H7VC 5AQVB 1HS6A 4YNDA 4KX6A 1OEDA 3RYHE 1PC2A 3EABA 1FIOA 4UWFA 1OWAA 5CCMA 1L5JA 4HFBA 2IIUA 5HEOA 4GPKA 4EQFA 3NQPA 5JHAA 3GN5B 5CMYA 2N1GA 2I1JA 3CMLA 1B89A 4P09A 1ZKEA 4A56A 3AEEA 2UUAT 4WZXA 3CVYA 1UJKA 5ANLA 4I1OB 4TXQA 4ISSA 4HGAA 5JR9A 2IC6A 4AV7A 2M6BA 3TWWA 3FP3A 1EZ3A 3SO8A 1KZPA 3BQOA 3C98B 4ILCA 2JIWA 4EAHA 3E0ZA 3KSQA 2P9UG 1MYOA 4IE0A 4Q25A 4AI6A 3IV0A 2OCCE 1BU9A 3PUXF 5LGUB 4JVSA 3AE5A 3OYZA 3ZKRA 3Q75A 4I9CA 3AE7A 1BD8A 4JXTA 4BWRA 3E08A 1WY6A 4N3AA 5G04J 3RKVA 2BS4A 3RU0A 5JH7E 2BG9A 3LDQB 2I0MA 4ILIA 4C0MA 1UOHA 3QB5A 3CV0A 1U3DA 2F0YA 4HOSA 2X66A 2N2NA 3AE6A 2ZM8A 2WXKA 2WXMA 3JXIA 1TNZA 1FEWA 3HG0D 4DJAA 2J4BA 3X2QE 1A5EA 5JR9B 4AOFA 4B89A 5KX5E 1H2TC 1BR4A 1MX2A 3GZ2A 3L08A 5T4YA 3KDSE 3C98A 3ZW3A 3RHWA 4O6FA 1BR1A 5HRYA 4ZHBA 3L54A 3F57A 2FUPA 4TX5A 5KJNA 2Y1LE 3MYVA 2Y6XA 1UX5A 5EX3A 4LEUA 3CHQA 2X9YA 4ILHB 3ONLC 4BEPA 2V7KA 3MACA 2P9PG 2OA5A 2IQCA 2V5QC 5ABFA 5LGNB 3AU5A 3IXEA 4IE7A 5ENTD 2PJQA 2CCQA 2R03A 3N9MA 3LPZA 2IMLA 5CRUA 4ME2A 4I43A 1YQ3A 1UGOA 2GGFA 2WXHA 4YHJA 4ATZD 4DLQA 2DWGA 3UT7A 2BKKB 5HEJA 2KCKA 2IAKA 4FI5A 1JNZA 3CHMA 5AQPB 3NKZA 4GK0E 5J08A 1KZOA 4UI9J 4O1PA 1L0VA 3SBTB 3CPZA 2FEZA 3CSTA 2V5FA 4KXKB 3TG5A 3LJCA 3DEOA 1MMNA 5FINA 3RKGA 3FH7A 4FADA 3UU8A 3AA0B 3O9XA 4Z90A 1M62A 2BZBA 3BEEA 5FY1A 3PUQA 2LNIA 5AQBA 2ONDA 3PZDA 1SE7A 1JCQA 2X6FA 4IHJE 4DV2T 4F7AA 2IDOB 2LKHA 3ZMVB 5ADXL 5HWXA 4GZ6A 4HEAA 4LFBT 2V7MA 2V7LA 3ESLA 3D9LA 3IHYA 4EHMA 3FUMA 3SFDA 4JB8P 3K8PC 2FI7A 2HM8A 2RKKA 4L9IA 2IOSA 2V5DA 3PZ4A 3Q5MA 2HE0A 2W61A 2WXGA 5A1LA 4J7WA 2C5JA 2AXZA 4LF9T 4JEHA 1GQEA 5HCMA 4GCNA 2BG9B 5FVLA 3UXGA 3L16A 2YQ8A 5EN5D 4C48B 2XEVA 4G2VA 3Q79A 3U3IA 5ANRA 3IA3A 4YFSA 1NA0A 4J8SA 2EHOA 1J5ET 3ONKA 3MJXA 3UU6A 4GA1A 2E0IA 4U74A 1N54A 2ZM6T 2DBAA 3L13A 1WYBA 1V54E 4QKNA 2H7OA 1WYCA 4FJZA 1N95A 2ZISA 4HB5A 5ETWA 2AXUA 4FJOA 4O2BE 2XCBA 5G55A 1MIYA 1ZHCA 5G05C 4GTTA 1ZP0A 3PS6A 3SOLA 3NOGD 2YDRA 4I2WA 4GTSA 3FUJA 4GTPA 1UN9A 3QB2A 3ZC1A 2K3WA 1N4RA 3EIQC 3PUAA 2PM7A 5FXXA 4O1OA 2MYSA 4ZS2A 2QYWA 3SS1A 1D9SA 3ZT5A 2X0LB 4F6RD 2QFCA 1YA0A 1FVFA 4YDEA 4ZHQE 2NTXA 4OYKA 2EHOB 3B7UX 5D66A 5B1BE 3FEYA 2WM9A 2CXFA 3UTMA 2VGXB 4APFA 3UT4A 3APFA 4J0UA 1Z3XA 3ASOE 2YU1A 3KBUA 4O4IE 5HWYA 4GMRA 4EBAA 1FJGT 4WW0A 3SWHA 4C90A 4AJWA 2D2SA 4GZ3A 4HFIA 5BNWA 2L0TB 2YDQA 3AE8A 3EAMA 4QFVA 5HXEA 4A1GA 3RKOA 2OEWA 2XQAA 3CVQA 4U3CA 5M72A 2EQXA 3FUKA 4V3IA 2YHEA 3FDHA 3ZXSA 2P9NG 2D5UA 5F3JA 3C50A 1SA5A 1WFDA 3PNLB 5IWAT 4TUYE 3P4WA 4AM9A 2XQ0A 5H6RB 1PAQA 4MLPA 4LF6T 4JV5T 4U7IA 3VU7H 2NW7A 1N0QA 3FB2A 5AN8A 3RO3A 1K3ZD 1QBQA 2VGYA 2WB5A 1VCSA 1IQRA 2NYJA 5FP3A 3RIFA 1BR0A 2ILRA
chains in the Genus database with same CATH topology
3FULA 4M1PA 1E7UA 1PY1A 4G1TA 3KV6A 4ZI3C 4PK5A 3ZCIA 2CFUA 4UVBB 1WRDA 2Q7FA 2B1EA 2X38A 5FQ4A 1U3CA 4BTAA 3SI5A 4KT6B 4NACA 4JUYA 5LA6E 3D0TA 4EZLA 3P7IA 2NXPA 4YLHA 5KJLA 2W63A 3FU3A 3N71A 3MK7C 4BSXA 4I6EA 4A3TA 2W00A 2CMRA 3ZYMA 4J6IA 3CHSA 4J8EA 4U72A 4L23A 2XGMA 4RVBA 4AKGA 3NRXA 2UY1B 3QARA 4K0RA 4XX5A 2VKDA 2WQ7A 5L3GB 2J09A 1D1CA 4Z8XA 2YU2A 2WXPA 2ES0A 3I1AA 1FMWA 5C8YE 4I50E 1N52A 4GMJA 3T8MA 4B94A 1E1HB 3Q2MA 3TXNA 3ZYQA 3CVPA 2MOZA 4ZI2C 4IRUA 4HOTA 3T8OA 2E9XC 2VK9A 2E2EA 4AY5A 2C0LA 2NSZA 2C0MA 3BQIA 3O4ZA 3LS8A 3QC1A 4L1BA 3FTSA 4O2AE 4RG6A 3KV9A 3T5XA 4CDMA 3ML9A 2KLQA 5JDGA 4OHFA 5JJ6A 3AA7B 2NWBA 2XQYA 1HFAA 3V5UA 1MNDA 3G2WA 3U78A 4X1KE 4AVXA 1VDYA 1U5PA 2ZU6B 2GRMA 2WQ6A 3O48A 3Q4AB 3WI3A 4DBQA 2CHWA 4HS2A 3G2TA 5LBQB 1OUVA 2XASB 5JVDE 4UIGA 3ZC0A 3D3MA 3P1UA 3R6NA 2NC9A 4MALA 3ASDA 2J08A 1G8XA 1MIVA 3APDA 5FZRA 2JQQA 4EZ4A 2HO1A 3ASGA 3LEWA 3ZYKA 4EECA 1NP7A 4B8CB 1NA3A 4TUUA 4L7TA 3ZMZB 3E22E 3RH3A 2IU1A 3S4UA 4B6XA 2XAQB 1SZ9A 4EXTA 3K3NA 4KBQA 4Y6CA 5JJ7A 4L2LA 4WBNE 1BPOA 3OXLA 1HH8A 3OBVE 1OWMA 5JDNA 3PDYA 1FVHA 2V7JA 4MRUA 5LCWJ 2BUGA 5DBKA 2Y4UA 4O4HE 4JHJA 3FU6A 2XUEA 2CWOA 3AVSA 4I17A 4PFOA 3JC6C 2KZ7B 4U07A 3KV5A 1E8WA 4KBMB 3RYCE 3ZPJA 4KP3C 2R59A 2VL8A 3RC8A 3GMIA 5FY0A 5FQ8A 4OFZA 3FTWA 4ISTA 3LBXB 5HXHA 4AXHA 3FEXA 4M3OA 3KFWX 4PNIA 1SA0E 3CSFA 3K3QC 3JC6D 3ZRHA 1LVKA 2DNXA 1KT1A 4GK5E 3HL6A 3C4WA 3MJWA 3H3AA 4G25A 2YNQA 2NTYA 2C2LA 4N2SA 3MGBA 2D0UA 4NURA 4URKA 3B7SA 3PH0C 4H63H 4N5CA 1LKXA 3QNKA 5AYWD 5FJYA 5JDMA 2L8KA 3AAAB 3FHNA 2MBGA 4UQYA 2WXIA 2X6IA 3FTXA 1JWGA 3AS5A 4UV9B 4FJYA 3VLEA 5FZSA 1A17A 3CLJA 3MV2B 4I4TE 3GZSA 3JQ1A 3EUHA 1H2UA 3S2AA 4OYSA 3RX6A 2E9XA 3JUIA 2Y48B 4R7LA 4F6RC 4I6GA 1Z3YA 4UWGA 5AJLA 4P29A 3FUDA 1HF8A 4H7YA 5AJDA 2CEAA 2EHOC 4EZHA 4KZCA 4U63A 1WAO1 4QXCB 3ZN1B 1Z0PA 3L17A 3H37A 3CK9A 2VJ8A 5LHIB 4GIWA 4HOQA 2DI4A 3FUEA 2WXJA 5FQ7A 2BTDA 4DMWA 5FXWA 4FLBA 2LJLA 3LBXA 1KLXA 4AKHA 2AWIA 3UULA 3EIJA 3BQLA 2KT9A 2Q9QC 3MX3A 4PJMA 4DK5A 2N9DA 2X3MA 3RK6A 4OK0A 2WQHA 3PVLA 4AQGA 3FXDB 4ASKA 4E7ZA 1HZ4A 4CT0A 3SD5A 3ZEFB 2WSSV 4AXPA 2WAUA 4ATGA 4CQIA 1XGWA 3LJ3A 4KVMA 4ZS3A 1MQSA 2ODVA 4XKBA 3NRYA 5KJKA 2C5IT 2FULA 4PJLA 4JZYA 4OVVA 2CLYB 5CB4E 2XRZA 2MOWA 4JHRA 1HX8A 2C5KT 3FUFA 2WXRA 2X9XA 2LSIA 4F1SA 3FH5A 2W0GA 3ZCJA 5A7DB 4I55E 5DJQC 3CKCA 2CFZA 2R17C 3B57A 4X1IE 1QZ2A 3DPDA 3FU0A 4G24A 4BX8A 1NWMX 3ZEFA 3UMVA 4PAGA 3TKLB 1Z6TA 4LCTA 2CWYA 3TG4A 3MZLB 5KCMA 3NZSA 2J4DA 4CXYA 3RRUA 3UX4A 4UELA 3PE0A 3I5PA 3LXUX 3OKQA 4PJNA 2LAHA 1SZAA 2GK9A 3HHMA 3RRNB 3MKDA 2X68A 4O4JE 2V4LA 2X9WA 5LJNA 5L3BB 4ILUA 2L0IA 5FT9A 3FFLA 4FU3A 2GW1A 3RJVA 5L2LA 4NRHB 3Q15A 2NP9A 1Y64B 3ONXA 2LO6A 4ZI7E 2I9CA 3QWPA 3ML8A 3P8CD 4HOUA 3PREA 4DPRA 4CRWA 3ANWA 4H9RC 3ETUA 1GW6A 1EPUA 4HVBA 5FXVA 5FY7A 4BA9A 3B7RL 3OAWA 2C0SA 4XZ4A 4O4LE 2KCVA 3BQKA 2PL2A 3SFZA 1AJ3A 3LDZA 2WXQA 3CHRA 2UXNB 1ELKA 1IZNB 3I0QA 1DVPA 3FTZA 5BUZA 3C64A 3HR0A 2OOEA 4EIWA 3QDNA 5FXZA 4UV8B 4B0ZA 2UXXB 4D10C 3URZA 3D9IA 2LOPA 2X6HA 3LVRE 1UJJA 5JHBA 3O4XE 2MRIA 4CI1B 3S7DA 3WAKA 1INZA 5A23A 4PW8A 4JLEA 3EDVA 3J7Yq 3GA8A 2I6HA 3LK3B 1UCUA 2L9BA 2DHRA 3PU3A 3GZ1A 2E8IA 4F3VA 1IJ5A 1S35A 3QWWA 4IDZA 4QXBB 3HVEA 4A55A 4F53A 1VRBA 5EX0A 4TRQA 5CA0E 2FBNA 2L9QA 2PG8A 4H9NC 3E4BA 4ZOLE 3VLDA 2L6JA 3ONLA 3N9LA 3RO2A 1JUQA 4QX7B 4GYSA 4TN7B 3CVUA 3FHEA 1HXIA 2L3LA 2WVIA 5E75A 5C2YA 5JJTA 2MTQA 2HPJA 4U0UA 5JQGE 5L3CB 2J07A 5CHEE 3ZN0B 2VSXE 5J2UE 4CEMA 3FUIA 4TZ4C 1IJ6A 4N2QA 2XGOA 2LHRA 3AVRA 3IEEA 2XPYA 3KV4A 2LSJA 5T8IA 3A5XA 3HKEE 4ERRA 3ZPOA 3PRZA 3FXEB 4GZDA 4I43B 2VSOE 2I2OA 3SZ7A 1G73A 3KINB 3LY8A 2IC9A 3FTVA 4EBAG 4WNGA 5EZYE 3CVNA 5CA1E 3NZPA 1ZU2A 3D9MA 2D0TA 3KVAA 4EPZA 3ZMSB 4H9QC 5F8PA 3HYMB 3U64A 3Q49B 4BFRA 3MKQB 3QAQA 1E96B 3MXZA 4Q69A 1OWLA 2XGSA 4HXIA 3C51A 3HA4A 3CX8B 5LJMA 3CHOA 3KD7A 3FTYA 2Y3AA 3O1IA 4TV3A 2LSVA 3QK0A 3S7FA 3KVBA 4JEHB 2XAGB 3UUXA 1IQUA 4EYUA 2KZTB 1FMVA 4UWHA 3VKGA 3CHPA 1ZEEA 3I9WA 3DP7A 4A1SA 1YD8G 3CKDA 2VTBB 3RRCA 4G2AA 4WBOA 4P0AA 2I1KA 4J8FA 3CWZB 3LKUA 4I1MA 3EHMA 2ZLYA 1IAPA 2KXPB 3U66A 4KMCA 3U9WA 2MHKA 3HIZA 4G63A 3CVXA 3QWVA 3LK2B 2DWKA 5IHYA 2FF4A 2PZIA 3CK7A 3Q9DA 3U4TA 5A6CA 4QXHB 3TGOA 3Q47B 4LERA 2X6JA 4KMOA 4WNDA 4JC8A 3ZYLA 1U4QA 4JEUB 4P0BA 5AIJA 3FH8A 3IHVA 2VKJA 3SF4A 4H63V 3I4GA 3ZHEA 2VGXA 2X67A 5BT1A 3AAEB 2ZM0A 5LOZA 3FTUA 3UTKA 2V26A 3UT8A 2PQRA 4UQXA 4J8DA 3T5VA 3N2KE 2ZMAA 4GYYA 4Q96A 1V9DA 3HKDE 5HAXA 2Y8DA 2A3DA 3AAIA 4ANVA 2KINB 2XRYA 2M63A 3NZQA 4IULA 1MMDA 4FP7A 2IF4A 3MKQA 2LEHA 2DCPA 3CGHA 2R5SA 2UY1A 1HE8A 3CQGB 5LBMA 5L3DB 4PDXA 3R9AB 3CQXC 4YJ3E 4DI4A 4MFRA 2CHZA 4DO0A 4W9RA 1MMGA 5LFAA 1OWPA 5HXRA 3KEZA 1EYHA 2CE7A 2ACXA 2IFUA 1T98A 3ZJ2A 2K24A 1EDUA 2IJGX 1Y6IA 1JWFA 2VKOA 2CG3A 3D9NA 1NZNA 4XI0A 3KBTA 3HKCE 4Q94A 2V0PA 3ESKA 3N9PA 4DMVA 2HYZA 4OYJA 1YKEB 1BR2A 3AS4A 3C4ZA 2IW5B 4E7SA 1X79A 5EKQD 5LOVE 2BF0X 4UI9K 3RYFE 4KYOB 1ZV4X 2XHEA 2LM9A 3QOUA 2XPIA 2JJ9A 4CGWA 4U8HA 4WWNA 3F2EA 2VSYA 1HG2A 1H0AA 3LY7A 4FHKA 5AENA 3MEKA 3FBZA 5AFUL 3IKOB 1CUNA 4PS8A 3LCAA 3LFMA 4IIJE 3RC3A 4HFGA 3HKBE 2KC7A 4AIFA 3MA5A 5DABA 5J1GA 1B7TA 1VOMA 3MCXA 4XKCA 2JMKA 2X9HA 1O3XA 4UQZA 4PS3A 4CT4A 3IBEA 4PUCA 5EK4A 3F31A 4IE6A 3BK9A 4ADZA 4DLOA 5JDHA 3U3WA 5KMGP 4TV9E 4E6HA 4AQFA 4MHCA 4CI2B 3L09A 2J1DG 1QUUA 3VKHA 4HN9A 4JHKA 1E8XA 4ANWA 3RRMB 2KM4A 4L0RA 2E9XB 5E0OA 3QK6A 2CG2A 3PUSA 4BT8A 4WNKA 2A5UA 2PFVA 3UFEA 4GZCA 4WNFA 3KS2A 4ANUA 2NW8A 3D9KA 2BDEA 4UWKA 2WXNA 4B8AA 3I9YA 4H9PC 2WXLA 2RD0A 2DIWA 3L22A 5HQ8A 5M4YA 4K0UA 2XHEB 3FWVA 1H7CA 1QQEA 3CVLA 1DNPA 5TAOA 4CXWA 5HYAA 2CHXA 3FUNA 4E85A 3ENEA 4WWOA 4MBQA 1QSDA 4AP2A 4JW1A 4O8SA 5T3RA 3D9JA 2VWAA 4UXNB 5D0OD 4EZKA 2PQNA 1IHGA 4GMLA 2NOXA 2P9BA 2KMFA 5FWQA 2ZM2A 4GU5A 4N78D 2QY7A 3EDTB 4HFVA 1ZBPA 2YK0A 2XCCA 2LT3A 5EDSA 1KT0A 4BY6A 1FCHA 3JQ0A 4AKIA 3Q5XA 4UVCB 1MHQA 3QKYA 3PU8A 4PH4B 4DVDA 5LNKA 2A2FX 4Y6WA 1ELRA 2LAIA 1UX4A 2VYIA 3BG0B 4XI9A 3ZIMA 3G2VA 3OXGA 2AVPA 2SPCA 3TXMA 3L6AA 2CLYC 5FMNA 4HORA 1YW0A 1YKHB 1QNFA 3GW4A 2KCLA 1W3BA 2OV8A 2Q9QB 4GOUA 2XPZA 3DBSA 2LSUA 3AA1B 3VTXA 4BX9A 3ANWB 2VQ2A 3W15B 2WMOA 2RA1A 3N2GE 2K5BB 2OVFA 2HR2A 3VLFA 4CZZB 1TEZA 5JRCA 3J9X1 5HI7A 3C4XA 5BV1A 4HTEA 4BTBA 4K03A 2WMNA 3R7QA 2K48A 4UEMA 2QGSA 2IONA 3PE3A 4L2YA 4BT9A 2E9XD 3OJAA 3I3NA 4GAAA 1US7B 2V7IA 5DQVA 4LRZA 3PDNA 3PTRB 5DIZA 4J2CA 4EZJA 4GB9A 3APCA 3LY9A 4H9SE 3IHRA 5J90A 4ZI3D 1HG5A 3N9QA 4YJ2E 3ZMUB 2WBLA 2JLBA 4ILGA 4PK4A 4AKRB 2Q9QD 3L3PA 4AKLA 3G2UA 4XE0A 2AW6A 3KAEA 1D1BA 2JEKA 5FNVE 5LX8A 4MLKA 2J49A 5JRCB 1H19A 2XAFB 3CQCB 3SBSA 1ELWA 2LSGA 3EHNA 1HO8A 1EF1C 4N3BA 4JPSA 4GYOA 2A4ZA 3N5LA 2VSNA 4GYWA 3PNTB 1HU3A 3OTNA 4H9OC 3PUKA 5JDFA 4JA7A 1E8ZA 3K9IA 3MZKB 1E8YA 3FU5A 3R84B 3RPUA 4LUNU 5FQ6A 4EB6E 3MA9A 4XIFA 3FBLA 5LGTB 3ZGQA 3N2OA 5GONE 5D0QD 1D1AA 4G11A 3SHFA 3UPVA 1SHZC 3CR3A 3ETVA 3JYSA 2Q9QA 1H6KA 3FY4A 2BVMA 4V1Av 3EJNA 3PEVB 1LVFA 4FLHA 4RG9A 2LOSA 5FTPA 4DNDA 4H7XA 5EK3A 4CDRA 4PFPA 4CCAA 4XZCA 3B7TA 4C0EA 1P5QA 4I1AA 4CI3B 1D0ZA 4YVQC 2DCFA 4U04A 1OXZA 1UG3A 3LK42 5JDLA 2P58C 4ABNA 2LSYA 5FZQA 3HVEB 2AXVA 1MNEA 3LYAA 2PBIA 5J2TE 5LP6E 3ZJ1A 1TJCA 5LG4A 2WB2A 4N3CA 5LXTE 3O1HA 4QWNB 2CA5A 1LRZA 3PUGA 3VTYA 3UQ3A 3DTOA 2LSKA 4I2ZA 1D0YA 4GCOA 4YVOA 5DQWA 3GN5A 2VB6A 3I4RB 2KNDA 4QHOA 4QX8B 3N9OA 3CX7B 3CVRA 4FULA 4EYYR 3TJPA 2X6KA 2J9QA 2X51A 3M65A 3NBXX 3ZLIA 3PEUB 4ANJA 3AS8A 4U0ZA 2NW9A 2LHNA 2KATA 2GRLA 2UWJG 4PK6A 4U0SA 2YINA 4ANXA 4L5GA 5JREA 3OYXA 4C9BB 3CX6B 3S7BA 2WXOA 4IGUA 4HLEA 4FA6A 3IBPA 2A72A 3PE4A 2V1DB 3EVYA 2I59A 5BW8C 3SNXA 2M67A 2KZTA 2CXLA 4IN3B 2YEVC 5JR9C 2BVLA 4TV8E 3NZUA 3D9PA 5E76A 4NUUA 4PS7A 3ZMTB 3PURA 2XAHB 5BV0A 4KUMB 1SQMA 3AU4A 2HH7A 2H3RA 2KWHA 5BMVE 2LE8A 1HTJF 3AB3B 1IYGA 3JCKC 2G0UA 5LCWC 3ZN3A 3HI2A 4DBRA 5EK2A 4UF0A 4XAXB 1OWOA 1MMAA 3FUHA 4MS6A 2HPLA 3Q5WA 3BG1B 1D0XA 1OWNA 2YHCA 1JPLA 4JEUA 3UT5E 5HXSA 3CKBA 5HXCA 2WWUA 2JPFA 2VKHA 3ASHA 1H2VC 1WM5A 3CEQA 3SGHA 4WNEA 4CGVA 1X5BA 2Z6EA 4PJJA 3G2SA 4WUYA 4BJNA 5JDQA 2PM6A 3EDUA 5LHHB 2OVBA 4BJMA 2VTBA 4AEZC 3QUJA 5LCYA 4UI9C 3K3OA 3IEGA 2CM0A 5LYJE 3HDXA 3CVWA 3RIBA 3V5SA 3S7JA 4JA9A 2XAJB 4IYPA 3AA6B 3B13A 1Y8MA 2WXFA 4ACKA 4UF0B 2Y4TA 4GA2A 5ENNA 4GZ5A 1WLXA 1HS7A 4BAYB 2CXDA 4HKAA 4AQFC 3UUMA 2VASA 4NQ0A 4KZ0A 1E7VA 5L3EB 3QJZA 4AY6A 2IOLA 3NF1A 3ULQA 4X20E 3WXXA 5BPPA 4APOA 4JL0A 3LG7A 3ASFA 1S94A 5KDMC 3ZHEB 4UWLA 3MV3B 5CCLA 3TL5A 5G2NA 2EHOD 1MIWA 2KWIB 3RYIE 3P2BA 4N39A 4XBFB 3OXFA 5LP0A 1UN8A 1XNFA 2QA7A 2ODUA 4DI3A 1HCIA 1UW4B 3LVQE 1TJFA 3PUJA 5CMWA 5L3FB 1WR6A 3SRZA 5IYZE 2JRKA 4GA0A 4G23A 4I6JA 2WPVA 4WWPA 5G04C 4GYRA 3IF8B 1NAFA 3TAXA 3ZVVA 4WAFA 4EOZB 5H6QB 2K9AA 5C1DA 4I9EA 3UUXB 3DJBA 4A3VA 4UVAB 2DLRA 3WAJA 5FYMA 3R7RA 2XTLA 2RP4A 3VHLA 4C91A 3GYZA 3I0OA 3CIAA 5ARGA 4NUVA 2W62A 1S0PA 5LHGB 1KNZA 1LF8A 4ZI2D 3RRWA 4OVUA 5ARFA 2FO7A 4CXXA 4HE8A 2V8SE 1KK7A 5KJMA 4MKTA 3GWHA 4KVOA 3QC9A 2JMHA 3D9OA 4ACLA 3O1JA 2RG8A 3MKRA 3ZFWA 4G26A 4IE4A 4FC8A 3CK8A 3CVVA 4IE5A 1E90A 4CDNA 4RSYA 5G05J 4X1YE 3UUNA 4FHJA 3N9NA 2H7VC 1HS6A 4YNDA 3RYHE 1PC2A 1FIOA 4UWFA 1OWAA 5CCMA 1L5JA 4GPKA 4EQFA 3NQPA 5JHAA 3GN5B 5CMYA 2N1GA 2I1JA 3CMLA 1B89A 4P09A 1ZKEA 4A56A 3CVYA 1UJKA 5ANLA 4I1OB 4ISSA 4HGAA 5JR9A 2IC6A 4AV7A 3FP3A 1EZ3A 3C98B 4EAHA 3E0ZA 4IE0A 3IV0A 4AI6A 5LGUB 4JVSA 3OYZA 4I9CA 4JXTA 4BWRA 3E08A 1WY6A 4N3AA 5G04J 3RKVA 3RU0A 5JH7E 4ILIA 4C0MA 3CV0A 1U3DA 4HOSA 2X66A 2N2NA 2ZM8A 2WXKA 2WXMA 1FEWA 4DJAA 2J4BA 5JR9B 4AOFA 4B89A 5KX5E 1H2TC 1BR4A 3GZ2A 3L08A 5T4YA 3ZW3A 3KDSE 3C98A 4O6FA 1BR1A 3L54A 3F57A 4TX5A 5KJNA 3MYVA 2Y6XA 1UX5A 5EX3A 4LEUA 3CHQA 2X9YA 4ILHB 2V7KA 3MACA 3AU5A 2OA5A 2IQCA 5LGNB 4IE7A 2PJQA 2CCQA 3N9MA 3LPZA 4ME2A 4I43A 2GGFA 2WXHA 4YHJA 4DLQA 2DWGA 3UT7A 2KCKA 2IAKA 4FI5A 3CHMA 4GK0E 5J08A 4UI9J 3SBTB 3CPZA 2FEZA 3CSTA 2V5FA 4KXKB 3TG5A 3LJCA 1MMNA 3FH7A 4FADA 3AA0B 3O9XA 2BZBA 3BEEA 5FY1A 3PUQA 2LNIA 2ONDA 3PZDA 2X6FA 4IHJE 4F7AA 3ZMVB 5ADXL 5HWXA 4GZ6A 4HEAA 2V7MA 2V7LA 3ESLA 3D9LA 3IHYA 3FUMA 3K8PC 2FI7A 2HM8A 4L9IA 2IOSA 3Q5MA 2W61A 2WXGA 5A1LA 2C5JA 2AXZA 4JEHA 4GCNA 3L16A 2YQ8A 2XEVA 4G2VA 3U3IA 5ANRA 4YFSA 1NA0A 4J8SA 2EHOA 3ONKA 4GA1A 3MJXA 2E0IA 4U74A 1N54A 2DBAA 3L13A 1WYBA 4QKNA 2H7OA 1WYCA 4FJZA 5ETWA 2AXUA 4FJOA 4O2BE 2XCBA 5G55A 1MIYA 1ZHCA 5G05C 3PS6A 3SOLA 4I2WA 3FUJA 1UN9A 3QB2A 3ZC1A 3EIQC 3PUAA 2PM7A 5FXXA 2MYSA 4ZS2A 3SS1A 2X0LB 2QFCA 1YA0A 1FVFA 4ZHQE 2NTXA 4OYKA 2EHOB 3B7UX 3FEYA 2WM9A 2CXFA 2VGXB 4APFA 3UT4A 3APFA 4J0UA 1Z3XA 2YU1A 3KBUA 4O4IE 5HWYA 4EBAA 4WW0A 3SWHA 4C90A 4AJWA 2D2SA 4GZ3A 5BNWA 2L0TB 4QFVA 5HXEA 4A1GA 3RKOA 3CVQA 5M72A 2EQXA 3FUKA 4V3IA 2YHEA 3FDHA 3ZXSA 2D5UA 5F3JA 3C50A 3PNLB 4TUYE 4AM9A 2XQ0A 5H6RB 1PAQA 4MLPA 3VU7H 2NW7A 3RO3A 3FB2A 2VGYA 1IQRA 5FP3A 1BR0A 2ILRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIN A;  2WM9 A;  3B13 A;  3VHL A;  2WMN A;  2WMO A; 
#chains in the Genus database with same CATH topology
 3FUL A;  4M1P A;  1E7U A;  1PY1 A;  2DYS E;  4G1T A;  3KV6 A;  4ZI3 C;  4PK5 A;  3ZCI A;  2CFU A;  4UVB B;  4HFD A;  1WRD A;  3AEA A;  2Q7F A;  2B1E A;  2HN1 A;  2X38 A;  5FQ4 A;  3E34 A;  1U3C A;  4CN4 A;  4BTA A;  3SI5 A;  5IUX A;  4HWC A;  4KT6 B;  4NAC A;  4JUY A;  3HXC A;  5CBN A;  5LA6 E;  4G8L A;  3D0T A;  2WP9 A;  4EZL A;  3P7I A;  2NXP A;  4YLH A;  5KJL A;  2W63 A;  2QC9 A;  4LFA T;  3FU3 A;  3WG7 E;  2H6I A;  4JI1 T;  3N71 A;  3MK7 C;  4BSX A;  3VR9 A;  4I6E A;  4A3T A;  2W00 A;  5KNG A;  2CMR A;  5IY5 E;  3ZYM A;  5LMU T;  4J6I A;  3CHS A;  4J8E A;  1TNB A;  4U72 A;  4L23 A;  2XGM A;  4RVB A;  4AKG A;  4GTM A;  3FZH B;  2EIN E;  3NRX A;  2UY1 B;  1Q2Z A;  3QAR A;  4K0R A;  5FL0 A;  4XX5 A;  2VKD A;  2IO3 C;  2WQ7 A;  5L3G B;  4NXM T;  1D1C A;  4Z8X A;  2J09 A;  2YU2 A;  2ETA A;  5CBO A;  5BXO A;  2WXP A;  2ES0 A;  3I1A A;  2Y0B G;  1FMW A;  3DST A;  5C8Y E;  4I50 E;  1N52 A;  4GMJ A;  3T8M A;  2MAW A;  4B94 A;  5AQ9 A;  2WDV A;  4BET A;  1E1H B;  3Q2M A;  2UUC T;  3TXN A;  3NBN B;  3ZYQ A;  3A7M A;  2FJE A;  3CVP A;  4I0U A;  2VQF T;  2MOZ A;  4ZI2 C;  4IRU A;  2BS2 A;  5C2T A;  2QYJ A;  4HOT A;  3T8O A;  1OY3 D;  2E9X C;  2VK9 A;  2E2E A;  4AY5 A;  2C0L A;  1HNW T;  2NSZ A;  3X1D A;  2C0M A;  3BQI A;  4ZXL A;  3O4Z A;  3LS8 A;  3QC1 A;  4L1B A;  3FTS A;  4DV7 T;  2B0O E;  4O2A E;  4RG6 A;  3KV9 A;  3T5X A;  2BKO A;  4CDM A;  4DR4 T;  3DSV A;  5JDG A;  2KLQ A;  4OHF A;  3ML9 A;  5JJ6 A;  3AA7 B;  2NWB A;  1OED C;  2XQY A;  1HFA A;  3V5U A;  4DV5 T;  2F8X K;  1MND A;  2QZA A;  3Q78 A;  2IO2 C;  3TWR A;  3G2W A;  3U78 A;  4X1K E;  4AVX A;  1VDY A;  4U2Y A;  3DSU A;  1U5P A;  2KSR A;  2ZU6 B;  2GRM A;  2WQ6 A;  3Q9N C;  4CN1 A;  3O48 A;  2JAB A;  3Q4A B;  1W0A A;  3WI3 A;  4DBQ A;  2ZGD A;  3UFG A;  2CHW A;  4HS2 A;  3G2T A;  5LBQ B;  1OUV A;  4GKJ T;  2XAS B;  5AQR B;  1FPP A;  5JVD E;  4UIG A;  3KSL A;  3ZC0 A;  3D3M A;  3P1U A;  3R6N A;  4LF5 T;  2NC9 A;  4MAL A;  2ZGG A;  3ASD A;  2J08 A;  1G8X A;  1MIV A;  3APD A;  3RQU A;  1T7S A;  5FZR A;  3D9H A;  2JQQ A;  3P4S A;  5AQA A;  4EZ4 A;  3W9G A;  1KEY A;  2HO1 A;  3ASG A;  3LEW A;  3ZYK A;  3DSW A;  4EEC A;  1NP7 A;  2QRX A;  3UU4 A;  4B8C B;  1NA3 A;  4TUU A;  4L7T A;  3ZU7 B;  3ZMZ B;  2FBW A;  3E22 E;  3RH3 A;  1TYQ G;  3OPC A;  2IU1 A;  3S4U A;  4B6X A;  1QLB A;  2XAQ B;  3AG3 E;  1SZ9 A;  4EXT A;  2RFA A;  2BBJ A;  3K3N A;  4KBQ A;  4Y6C A;  5JJ7 A;  2WCA A;  4L2L A;  4WBN E;  4DV6 T;  1BPO A;  3ZT7 A;  3QB5 K;  4IDN A;  3TLW A;  3OXL A;  1HH8 A;  2FJA A;  1HNZ T;  3OBV E;  2XZD G;  4O60 A;  1OWM A;  5HEG A;  1NL4 A;  2JQK A;  5JDN A;  5ENO D;  3PDY A;  1FVH A;  2V7J A;  1XMO T;  4MRU A;  5LCW J;  2BUG A;  5DBK A;  1G3N B;  4NIK A;  1XMQ T;  2Y4U A;  3B7B A;  4O4H E;  4DUZ T;  4JHJ A;  4YTM A;  3FU6 A;  2XUE A;  3E37 A;  2CWO A;  4K0K T;  3AE9 A;  3AVS A;  3RQW A;  4DID B;  4PFO A;  4I17 A;  5KBA A;  4DR3 T;  3VRB A;  3JC6 C;  2KZ7 B;  4U07 A;  3KV5 A;  1E8W A;  3Q9U C;  4KBM B;  3RYC E;  3ZPJ A;  4KP3 C;  2R59 A;  3AXJ A;  3PUZ F;  2VL8 A;  2LXL A;  5KNH D;  3DXM G;  3RC8 A;  3GMI A;  5FY0 A;  4YT0 A;  5FQ8 A;  2GRQ B;  4OFZ A;  3FTW A;  4IST A;  3LBX B;  4TXP A;  1KF6 A;  5HXH A;  4AXH A;  3FEX A;  4M3O A;  3KFW X;  4PNI A;  1SA0 E;  3CSF A;  3K3Q C;  3JC6 D;  4B3M T;  3ZRH A;  1JCS A;  4YSZ A;  1LVK A;  1LD8 A;  3Q5D A;  1K1A A;  5ENP D;  3ZKJ A;  2DNX A;  3AEG A;  1KT1 A;  4GK5 E;  3HL6 A;  4Z91 A;  3C4W A;  1RW2 A;  3MJW A;  2DYR E;  1N4S A;  3H3A A;  5AQT B;  1DU2 A;  2YNQ A;  3E33 A;  4G25 A;  2NTY A;  2C2L A;  4N2S A;  3MGB A;  2D0U A;  1I94 T;  1TN8 A;  3NWI A;  4NUR A;  4URK A;  3B7S A;  5AQG B;  3PH0 C;  4H63 H;  4N5C A;  1LKX A;  3QNK A;  5AYW D;  3EHR A;  5FJY A;  5JDM A;  2L8K A;  1W9R A;  3AAA B;  3FHN A;  2MBG A;  2P2C P;  4UQY A;  2WXI A;  2X6I A;  3FTX A;  1JWG A;  3AS5 A;  4UV9 B;  4FJY A;  3VLE A;  5FZS A;  1UUR A;  2HN2 A;  3OVU A;  1A17 A;  3CLJ A;  3MV2 B;  4I4T E;  3GZS A;  3JQ1 A;  1YCS B;  3EUH A;  1H2U A;  3S2A A;  4OYS A;  3RX6 A;  2E9X A;  3JUI A;  2Y48 B;  4R7L A;  4F6R C;  4I6G A;  3HXF A;  4U8V D;  1Z3Y A;  1K8K G;  1ZB1 A;  4UWG A;  5AJL A;  2BED A;  4P29 A;  3JCF A;  2CHO A;  4U96 D;  3DRA A;  1HF8 A;  3FUD A;  4H7Y A;  5AJD A;  4EZH A;  2CEA A;  2EHO C;  4IL9 A;  4KZC A;  4U63 A;  3P4R A;  5LG3 A;  1WAO 1;  2XQ6 A;  4QXC B;  3ZN1 B;  3T9K A;  1Z0P A;  3L17 A;  3H37 A;  2L6B A;  3CK9 A;  2WWV A;  2VJ8 A;  5LHI B;  4GIW A;  4HOQ A;  1KFY A;  2DI4 A;  3FUE A;  2WXJ A;  5FQ7 A;  3AE3 A;  2BTD A;  4AQY T;  2BS3 A;  3CIR A;  4DMW A;  3RIU A;  5FXW A;  4FLB A;  2AXD S;  3UQ4 A;  2LJL A;  3LBX A;  1KLX A;  5B3S E;  4AKH A;  2AWI A;  3UUL A;  3EIJ A;  4JD2 G;  3BQL A;  1UK5 A;  2KT9 A;  2Q9Q C;  3P4P A;  3MX3 A;  3UIN C;  3PZ2 A;  4PJM A;  4K5B A;  4DK5 A;  2N9D A;  2X3M A;  3RK6 A;  4OK0 A;  2WQH A;  3PVL A;  4AQG A;  3FXD B;  1IBK T;  1LTX A;  4ASK A;  4E7Z A;  1HZ4 A;  4CT0 A;  2BG9 C;  3SD5 A;  4JI8 T;  2RFM A;  4HRL A;  1ZOY A;  3ZEF B;  2WSS V;  4AXP A;  3M3Z B;  2WAU A;  3PUY F;  3TWS A;  4ATG A;  4CQI A;  2QYU A;  4DR5 T;  1LD7 A;  1XGW A;  4U33 A;  3LJ3 A;  4KVM A;  4ZS3 A;  1MQS A;  2ODV A;  4XKB A;  3NRY A;  5KJK A;  2C5I T;  2V6Y B;  2FUL A;  4PJL A;  4HFC A;  4JZY A;  4OVV A;  2CLY B;  5CB4 E;  2XRZ A;  2MOW A;  4JHR A;  5ENR D;  1HX8 A;  2C5K T;  3KEA A;  3FUF A;  2X9X A;  2LSI A;  2WXR A;  3HXD A;  4F1S A;  3FH5 A;  2W0G A;  3ZCJ A;  5A7D B;  4I55 E;  3TLT A;  5DJQ C;  3CKC A;  2CFZ A;  2R17 C;  3B57 A;  4X1I E;  2XQ8 A;  1QZ2 A;  3DPD A;  3FU0 A;  2XEH A;  4G24 A;  4BX8 A;  1NWM X;  3ZEF A;  4LSZ E;  2W2U A;  3UMV A;  4PAG A;  3TKL B;  1FT2 A;  1Z6T A;  4LCT A;  2CWY A;  3TG4 A;  3MZL B;  5KCM A;  3NZS A;  2J4D A;  4CXY A;  3RRU A;  3UX4 A;  4UEL A;  4DRX E;  3PE0 A;  3I5P A;  1J5W A;  3LXU X;  3OKQ A;  4L9P A;  4PJN A;  2LAH A;  1SZA A;  3NB2 A;  2GK9 A;  3HHM A;  3RRN B;  3MKD A;  2X68 A;  4O4J E;  2V4L A;  2X9W A;  4DX6 D;  5LJN A;  2XM1 A;  4A63 B;  5L3B B;  1XDP A;  2XEN A;  5JA4 D;  5LB7 B;  4ILU A;  2J47 A;  2L0I A;  5FT9 A;  1OED B;  3FFL A;  4QQI A;  4FU3 A;  2WY2 A;  2GW1 A;  2H6F A;  2DVW A;  1VCT A;  3RJV A;  5L2L A;  4NRH B;  2LXM A;  3QNU A;  2P9L G;  3F6Q A;  4DR2 T;  1O1S A;  2NP9 A;  3Q15 A;  3ABK E;  1Y64 B;  3ONX A;  2LO6 A;  1JCR A;  4ZI7 E;  2I9C A;  3QWP A;  3ML8 A;  4LG6 A;  3P8C D;  4HOU A;  3PRE A;  2EIL E;  4DPR A;  4LF8 T;  4ZFH A;  2R2L A;  4CRW A;  3ANW A;  5CJ5 A;  4H9R C;  3ETU A;  1GW6 A;  1EPU A;  4HVB A;  5FXV A;  3P4Q A;  5FY7 A;  4BA9 A;  1N33 T;  3B7R L;  3OAW A;  2C0S A;  4XZ4 A;  4YDO A;  4DV0 T;  4A98 A;  4O4L E;  3JUE A;  4P1N A;  4HI8 A;  2KCV A;  2LLY A;  1HNX T;  3BQK A;  4X66 T;  2PL2 A;  2V6Y A;  3SFZ A;  1AJ3 A;  3LDZ A;  2B76 A;  2WXQ A;  2IHR 1;  1O1T A;  1N11 A;  3CHR A;  4OAV B;  5CEC B;  2UXN B;  1OCZ E;  1ELK A;  1IZN B;  5AQH B;  1TN6 A;  3I0Q A;  1M7K A;  5ABH A;  1DVP A;  5ABE A;  3C3O A;  1I6Z A;  3FTZ A;  3C64 A;  4LNG A;  5BUZ A;  3HR0 A;  2OOE A;  3AE1 A;  4EIW A;  3QDN A;  4YY3 T;  5L47 A;  5FXZ A;  4UV8 B;  4B0Z A;  2OLT A;  2UXX B;  4D10 C;  3URZ A;  2YOE A;  3RSE G;  3D9I A;  2LOP A;  2X6H A;  4QH1 A;  3LVR E;  4TWH A;  1NI1 A;  5F5W A;  5AAR A;  1UJJ A;  5JHB A;  1DCE A;  3O4X E;  2MRI A;  4TWF A;  2CBI A;  4TNV A;  4CI1 B;  3S7D A;  3WAK A;  1INZ A;  5A23 A;  2CRB A;  4IL4 A;  4PW8 A;  3AJI A;  3J7Y q;  3EDV A;  4JLE A;  2R6G F;  5C3J A;  4CZ2 D;  3GA8 A;  2CBJ A;  2I6H A;  3J5Q B;  3LK3 B;  1XZY A;  4K5C A;  1UCU A;  4CN6 A;  2L9B A;  2DHR A;  3PU3 A;  1E7P A;  4X65 T;  3GZ1 A;  2E8I A;  4F3V A;  1IJ5 A;  1S35 A;  2DZN A;  3QWW A;  4IDZ A;  4QXB B;  3HVE A;  4A55 A;  4F53 A;  1VRB A;  1HX1 B;  5EX0 A;  4GTR A;  4TRQ A;  5CA0 E;  2FBN A;  4F1P A;  2L9Q A;  3B95 A;  2PG8 A;  4H9N C;  3E4B A;  5HS0 A;  4ZOL E;  3VLD A;  2L6J A;  3ONL A;  2EIK E;  5ABG A;  3N9L A;  3RO2 A;  2MYO A;  1JUQ A;  4QX7 B;  3DWL G;  4GYS A;  4TN7 B;  4A97 A;  3HXB A;  2GRO B;  5AQ7 A;  3CVU A;  4DUY T;  4DR1 T;  3FHE A;  3AEF A;  1HXI A;  2L3L A;  2WVI A;  5E75 A;  5C2Y A;  5JJT A;  4HQD A;  2MTQ A;  2HPJ A;  4U0U A;  5JQG E;  3UKU G;  4YDW A;  5L3C B;  2J07 A;  4HBD A;  5CHE E;  1MX6 A;  1OCO E;  3ZN0 B;  2VSX E;  5J2U E;  4CEM A;  3FUI A;  4HLL A;  5KXJ A;  4TZ4 C;  1IJ6 A;  4N2Q A;  2X0H A;  3T1Y T;  2XGO A;  2LHR A;  2E5V A;  3AVR A;  3IEE A;  2XPY A;  3C3R A;  3KV4 A;  2LSJ A;  5ABF B;  2R02 A;  4AIU A;  3A5X A;  5T8I A;  3HKE E;  4ERR A;  3ZPO A;  4EEB A;  3PRZ A;  3FXE B;  4GZD A;  4I43 B;  2VSO E;  2I2O A;  3SZ7 A;  5EYP F;  4IDQ A;  3JAD A;  1G73 A;  1N9A A;  3KIN B;  3LY8 A;  2IC9 A;  3FTV A;  4EBA G;  4WNG A;  4JBW F;  5EZY E;  3EHQ A;  3CVN A;  5CA1 E;  1UUS A;  2AJA A;  3NZP A;  1ZU2 A;  2XZE A;  3D9M A;  2D0T A;  3KVA A;  3ZT6 A;  4EPZ A;  3ZMS B;  3DPY A;  5CEA A;  3FZF B;  1YQ4 A;  4H9Q C;  5F8P A;  3HYM B;  3U64 A;  3Q49 B;  1OCC E;  2UXD T;  4BFR A;  3EI0 A;  1YXR A;  1WG0 A;  2VVN A;  3MKQ B;  3QAQ A;  1E96 B;  3MXZ A;  1XWM A;  2XM2 A;  5FIO A;  4ZZB A;  4LF7 T;  2P9S G;  3UM3 A;  5AQS B;  1IKN D;  4Q69 A;  4RQI A;  1OWL A;  2XGS A;  2ZXW E;  1S64 A;  2ZIR A;  4HXI A;  3C51 A;  1OT8 A;  3HA4 A;  3CX8 B;  4X8Q A;  1OCR E;  5LJM A;  1Z5S C;  3CHO A;  1TNU A;  3KD7 A;  3FTY A;  2LRK A;  2Y3A A;  3O1I A;  4TV3 A;  2LSV A;  3QK0 A;  3S7F A;  1KPS B;  3KVB A;  4JEH B;  2XAG B;  3UUX A;  2CHN A;  1IQU A;  4EYU A;  2KZT B;  3ZXP A;  1FMV A;  2H6G A;  4UWH A;  2UXC T;  3VKG A;  2EIM E;  3ABL E;  1XNR T;  2UU9 T;  3UIO C;  3CHP A;  1ZEE A;  3ABM E;  3I9W A;  3DP7 A;  4A1S A;  1YD8 G;  3CKD A;  2VTB B;  3RRC A;  4G2A A;  4TXR A;  4WBO A;  4P0A A;  2I1K A;  4J8F A;  3CWZ B;  3E32 A;  2BKP A;  3LKU A;  4I1M A;  2BKN A;  3EHM A;  3V2X A;  2ZLY A;  3L8R A;  1IAP A;  2KXP B;  3PV0 F;  3U66 A;  4KMC A;  3U9W A;  3QOF A;  4RLY A;  2MHK A;  3HIZ A;  4G63 A;  3CVX A;  3TLS A;  3QWV A;  3LK2 B;  2DWK A;  1E2A A;  5IHY A;  4BES A;  3L39 A;  2FF4 A;  2PZI A;  3CK7 A;  3Q9D A;  3U4T A;  2V6X A;  5A6C A;  2XY8 B;  4QXH B;  2DZO A;  3Q47 B;  3TGO A;  4LER A;  2X6J A;  4KMO A;  4WND A;  4JC8 A;  3ZYL A;  1U4Q A;  4JEU B;  2NR4 A;  4P0B A;  2ETC A;  3SQV A;  5AIJ A;  3FH8 A;  3IHV A;  2VKJ A;  3SF4 A;  4H63 V;  3I4G A;  3ZHE A;  2A5E A;  4OAU C;  2VGX A;  2X67 A;  5AQF B;  5BT1 A;  2LRL A;  1N0R A;  3AAE B;  2ZM0 A;  5LOZ A;  3UIP C;  3FTU A;  3UTK A;  1NEN A;  2V26 A;  3UT8 A;  5ENQ D;  2PQR A;  4UQX A;  4J8D A;  3T5V A;  3N2K E;  1S70 B;  2ZMA A;  4GYY A;  5HEH A;  4JI6 T;  4DX1 A;  4Q96 A;  3V79 K;  1R8I A;  3ISM C;  1V9D A;  2XQ7 A;  3HKD E;  5HAX A;  2Y8D A;  1O5M A;  2A3D A;  3AAI A;  4ANV A;  2H89 A;  2KIN B;  3RAU A;  2XRY A;  2M63 A;  3UM0 A;  3NZQ A;  1MMD A;  4IUL A;  4FP7 A;  3ZUV B;  2IF4 A;  2FO1 E;  3MKQ A;  4JI5 T;  2LEH A;  2DCP A;  3CGH A;  2R5S A;  4DV4 T;  2UY1 A;  1HE8 A;  2V5C A;  3CQG B;  2VGE A;  5LBM A;  5L3D B;  4PDX A;  3R9A B;  3CQX C;  3RLF F;  4YJ3 E;  4DI4 A;  4MFR A;  4DV3 T;  3Q73 A;  2CHZ A;  4DO0 A;  5J0Z A;  4W9R A;  2GRN B;  1MMG A;  5LFA A;  4LML A;  4U8Y D;  1OWP A;  5HXR A;  3EHZ A;  5AQN B;  3KEZ A;  3K1S A;  3LSV A;  1EYH A;  2CE7 A;  2ACX A;  1SVX A;  2IFU A;  1T98 A;  3ZJ2 A;  2YN6 A;  3PZ3 A;  3TWQ A;  2K24 A;  1EDU A;  2IJG X;  3BUA A;  1Y6I A;  1JWF A;  2VKO A;  2XZT G;  4KHZ F;  2CG3 A;  1NZN A;  3D9N A;  4XI0 A;  3KBT A;  3HKC E;  3E30 A;  4Q94 A;  5BXU A;  2V0P A;  2BKG A;  3ESK A;  3N9P A;  3ASN E;  3UU5 A;  4DMV A;  1N32 T;  2HYZ A;  4OYJ A;  5FKY A;  1YKE B;  2RPA A;  1BR2 A;  3C4Z A;  3AS4 A;  2IW5 B;  4E7S A;  1X79 A;  5EKQ D;  5LOV E;  2BF0 X;  4UI9 K;  1BI8 B;  3RYF E;  4KYO B;  1ZV4 X;  4NIQ A;  2XHE A;  2LM9 A;  4LNU D;  3QOU A;  3ZNG A;  2XPI A;  2JJ9 A;  2LM2 A;  3V31 A;  2UUB T;  4CGW A;  4U8H A;  4WWN A;  3F2E A;  2VSY A;  4GTO A;  1HG2 A;  1H0A A;  3LY7 A;  4FHK A;  5BR8 T;  4N5Q A;  1YYH A;  5AEN A;  3MEK A;  3FBZ A;  5AQQ B;  5AFU L;  3IKO B;  1CUN A;  3TLV A;  4PS8 A;  3LCA A;  1CHU A;  3LFM A;  4IIJ E;  4GTV A;  4BSZ B;  3RC3 A;  3ULY A;  3B5M A;  3RGL A;  1SUM B;  4HFG A;  3HKB E;  2KC7 A;  4AIF A;  3MA5 A;  5DAB A;  5EIL A;  5J1G A;  1B7T A;  1VOM A;  3MCX A;  4XKC A;  2JMK A;  2X9H A;  1O3X A;  2J4G A;  2UXB T;  4F8H A;  4PS3 A;  4UQZ A;  4CT4 A;  3IBE A;  4PUC A;  4HWI B;  5JTG A;  4KI0 F;  1D8D A;  5EK4 A;  3TWT A;  2YKS A;  3F31 A;  1D8E A;  4IE6 A;  3BK9 A;  3C3Q A;  4ADZ A;  4DLO A;  2XSA A;  5JDH A;  3U3W A;  5KMG P;  4TV9 E;  2E2A A;  4E6H A;  4AQF A;  4MHC A;  1WR0 A;  5AQM B;  3ABV A;  3TWX A;  4CI2 B;  3L09 A;  2J1D G;  1QUU A;  4M7C A;  3VKH A;  4HN9 A;  5EID A;  1XNQ T;  4JHK A;  1E8X A;  4ANW A;  3Q5E A;  3RRM B;  2V8S V;  2KM4 A;  4L0R A;  2E9X B;  4X62 T;  5E0O A;  3QK6 A;  2CG2 A;  3PUS A;  4BT8 A;  4WNK A;  3RF1 A;  2A5U A;  4JI0 T;  2PFV A;  3TLU A;  3UFE A;  4GZC A;  3HXE A;  4WNF A;  3KS2 A;  4IDP A;  4ANU A;  2NW8 A;  1W0B A;  2PTF A;  2QVA A;  3D9K A;  2BDE A;  4UWK A;  2WXN A;  4B8A A;  5EIB E;  3I9Y A;  4H9P C;  2F37 A;  2WXL A;  2XQ3 A;  4ZZC A;  2RD0 A;  2DIW A;  3L22 A;  5HQ8 A;  3EUV A;  3P50 A;  5M4Y A;  4K0U A;  2XHE B;  3FWV A;  1H7C A;  3CK6 A;  1QQE A;  3CVL A;  1Y01 A;  5HCJ A;  1DNP A;  2F4V T;  5TAO A;  4CXW A;  3SFY A;  2IEJ A;  4YSX A;  5HYA A;  2CHX A;  3FUN A;  4E85 A;  3AE4 A;  3ENE A;  2XJ7 A;  4WWO A;  1OXJ A;  2WU2 A;  4HRM B;  4MBQ A;  1QSD A;  5AQJ B;  4AP2 A;  4JW1 A;  3Q7A A;  4O8S A;  4EV6 A;  1IHB A;  5T3R A;  4AIS A;  3D9J A;  2VWA A;  4UXN B;  3SY2 A;  2MPK A;  5D0O D;  2XQ9 A;  4EZK A;  2XQ5 A;  3UUB A;  2PQN A;  1IHG A;  4GML A;  2NOX A;  5AQI B;  2P9B A;  2KMF A;  5FWQ A;  2ZM2 A;  4GPM A;  2A9U A;  4GU5 A;  4N78 D;  2QY7 A;  3EDT B;  4HFV A;  1U2V G;  1ZBP A;  2YK0 A;  1NFI E;  2LT3 A;  2XCC A;  3L82 A;  5EDS A;  1KT0 A;  4BY6 A;  1FCH A;  3JQ0 A;  4U7E B;  4AKI A;  3Q5X A;  4UVC B;  1MHQ A;  3AXJ B;  3QKY A;  3PU8 A;  3SFE A;  1IXV A;  4PH4 B;  4DVD A;  5D2M C;  3UI2 A;  5LNK A;  2A2F X;  4Y6W A;  1ELR A;  3ULE G;  2LAI A;  1UX4 A;  2VYI A;  3BG0 B;  1OED E;  4XI9 A;  3ZIM A;  3G2V A;  3OXG A;  5AQO B;  2AVP A;  4B93 B;  2SPC A;  3TXM A;  5FVK A;  3L6A A;  2CLY C;  3R9M A;  5FMN A;  5KWD A;  4HOR A;  1YW0 A;  3PUV F;  1YKH B;  2WDR A;  1QNF A;  3GW4 A;  2KCL A;  1W3B A;  4DR7 T;  2OV8 A;  2Q9Q B;  3SFX A;  3C5R A;  4GOU A;  2DL1 A;  2XPZ A;  1QYM A;  3DBS A;  3H3M A;  1TN7 A;  2ACZ A;  2WZI A;  4ILB A;  5L4E A;  3AA1 B;  2LSU A;  3VTX A;  4BX9 A;  3EU9 A;  3ANW B;  2VQ2 A;  3AEB A;  3W15 B;  2WMO A;  2RA1 A;  1XDO A;  2K5B B;  3N2G E;  2OVF A;  2HR2 A;  3FZK B;  3VLF A;  5AQU B;  4CZZ B;  1TEZ A;  5JRC A;  3J9X 1;  5HI7 A;  3C4X A;  5BV1 A;  4HTE A;  4BTB A;  2HHH T;  4K03 A;  4U95 D;  2WMN A;  3NVO A;  3R7Q A;  2K48 A;  4Z68 A;  4UEM A;  1YMP A;  2QGS A;  2ION A;  3PE3 A;  4L2Y A;  3TWU A;  3TWV A;  3DSS A;  3OTO T;  2X0Y A;  4HFH A;  4BT9 A;  2E9X D;  3OJA A;  5HKP A;  4COF A;  3I3N A;  1US7 B;  2V7I A;  5DQV A;  4GAA A;  4LRZ A;  3PDN A;  5CGM A;  2B6C A;  3PTR B;  3L9T A;  4HFE A;  1S63 A;  5DIZ A;  4J2C A;  4EZJ A;  4GB9 A;  3APC A;  3EU5 A;  3LY9 A;  4H9S E;  3IHR A;  5J90 A;  4ZI3 D;  1HG5 A;  3N9Q A;  5H7P A;  4YJ2 E;  3ZMU B;  2WBL A;  2JLB A;  4ILG A;  4PK4 A;  4AKR B;  2Q9Q D;  2D9D A;  3UKR G;  5B1A E;  3L3P A;  4AKL A;  3JAF A;  3G2U A;  3NAW A;  4XE0 A;  1AP7 A;  2AW6 A;  3KAE A;  1D1B A;  4LMK A;  4EGW A;  2JEK A;  5FNV E;  5LX8 A;  4MLK A;  4LFC T;  3T8K A;  2J49 A;  5JRC B;  1MJ0 A;  2PNN A;  1H19 A;  1N4Q A;  2XAF B;  3CQC B;  3SBS A;  1ELW A;  5EYL A;  2LSG A;  3EHN A;  1IBM T;  1HO8 A;  4DX2 A;  1EF1 C;  4N3B A;  4JPS A;  4GYO A;  2JQH A;  2A4Z A;  3N5L A;  2VSN A;  4U2Z A;  4OX9 T;  2H88 A;  2EIJ E;  4GYW A;  4BER A;  3PNT B;  1WDY A;  1HU3 A;  3OTN A;  4H9O C;  3Q7F A;  4LNB A;  3PUK A;  5JDF A;  4JA7 A;  1E8Z A;  3AEC A;  4QH4 A;  1WCR A;  4UR9 A;  2M6I A;  3RIU C;  3K9I A;  3MZK B;  1E8Y A;  3FU5 A;  3R84 B;  4DX5 D;  3RPU A;  4LUN U;  5FQ6 A;  4EB6 E;  3MA9 A;  4XIF A;  2J62 A;  3FBL A;  5LGT B;  1KNR A;  3PJA J;  3N2O A;  4YDY A;  3ZGQ A;  5GON E;  5FL1 A;  5D0Q D;  4J8Y A;  2BBH A;  1D1A A;  4G11 A;  3SHF A;  3UPV A;  2VVS A;  3V30 A;  1SHZ C;  3LJN A;  2XPK A;  3RI5 A;  3CR3 A;  4TNW A;  1H6P A;  3ETV A;  3JYS A;  2Q9Q A;  1H6K A;  4K5A B;  1H6O A;  3FY4 A;  2BVM A;  3HRA A;  4V1A v;  3EJN A;  2V4H C;  3PEV B;  1LVF A;  4FLH A;  4RG9 A;  2LOS A;  5FTP A;  4DND A;  3AG2 E;  4H7X A;  5EK3 A;  3W9F A;  4CDR A;  4PFP A;  4CCA A;  4XZC A;  5LMN T;  3B7T A;  4C0E A;  1P5Q A;  4NXN T;  4I1A A;  4CI3 B;  4HWF A;  1KNP A;  1D0Z A;  4YVQ C;  2DCF A;  4U04 A;  1OXZ A;  1UG3 A;  4UUC A;  4DR6 T;  3LK4 2;  5JDL A;  4LF4 T;  1FT1 A;  2P58 C;  2LSY A;  5FZQ A;  4ABN A;  1T72 A;  3HVE B;  2AXV A;  1MNE A;  2PBI A;  2WU5 A;  5J2T E;  5LP6 E;  3LYA A;  3ZJ1 A;  1TJC A;  5CFB A;  1X81 A;  5AQL B;  1Z8U A;  5LG4 A;  2WB2 A;  1X9B A;  4N3C A;  2W66 A;  5LXT E;  5CED B;  4U7Y A;  3O1H A;  4QWN B;  2CA5 A;  1LRZ A;  3FZM B;  3PUG A;  3ONJ A;  3VTY A;  3UQ3 A;  3DTO A;  2LSK A;  4I2Z A;  1HR0 T;  1D0Y A;  2P9K G;  4GCO A;  1RZ4 A;  2VQE T;  2KBX A;  4YVO A;  5DQW A;  3GN5 A;  4ILA A;  2VB6 A;  2KND A;  4QHO A;  3I4R B;  4QX8 B;  3N9O A;  3CX7 B;  3DSX A;  5ITZ F;  3CVR A;  1TNY A;  3FZL B;  4EYY R;  3J5P A;  4FUL A;  4A5X A;  2J9Q A;  2X6K A;  2X51 A;  3TJP A;  4B3S T;  3M65 A;  4NPP A;  3NBX X;  2ETB A;  4KHP T;  3ZLI A;  2YDS A;  3PEU B;  2FJD A;  3RIA A;  4ANJ A;  3AS8 A;  4U0Z A;  2NW9 A;  2LHN A;  2KAT A;  2GRL A;  4X5T A;  2UWJ G;  4GKK T;  4PK6 A;  4JI2 T;  2IY0 C;  4U0S A;  2YIN A;  1NEK A;  4ANX A;  4L5G A;  5JRE A;  2AE9 A;  2WZH A;  3OYX A;  4C9B B;  2BG9 E;  3NOC D;  3CX6 B;  3S7B A;  2WXO A;  4IGU A;  4HLE A;  4FA6 A;  2CPT A;  3IBP A;  2XEE A;  2A72 A;  2WS3 A;  3PE4 A;  2V1D B;  3EVY A;  2I59 A;  5BW8 C;  3SNX A;  2M67 A;  2KZT A;  2CXL A;  1O1R A;  4IN3 B;  2YEV C;  5JR9 C;  2E5L T;  2BVL A;  4TV8 E;  3D9P A;  3NZU A;  2WQY A;  5E76 A;  4NUU A;  1N34 T;  4PS7 A;  3ZMT B;  1AWC B;  4GTQ A;  3PUR A;  2XAH B;  3AG4 E;  1MZC A;  5BV0 A;  4KUM B;  4QH5 A;  1SQM A;  1W09 A;  3AU4 A;  2HH7 A;  2H3R A;  2KWH A;  5CRV A;  5BMV E;  1IBL T;  2LE8 A;  2IUB A;  1HTJ F;  3AB3 B;  1N4P A;  1IYG A;  2F8Y A;  3JCK C;  4YHH T;  2G0U A;  5LCW C;  3ZN3 A;  3HI2 A;  2JQ9 A;  4DBR A;  2J8S D;  5EK2 A;  3G06 A;  4IDO A;  4G8K A;  4UF0 A;  4XAX B;  1N94 A;  1OWO A;  1MMA A;  3FUH A;  4MS6 A;  3PZ1 A;  2HPL A;  3Q5W A;  3BG1 B;  1D0X A;  3UQ7 A;  1OWN A;  1JPL A;  2YHC A;  1K1B A;  3AAA C;  4JEU A;  1SA4 A;  4ZEY A;  1TNO A;  3UT5 E;  5HXS A;  3CKB A;  5HXC A;  4MBG A;  4TUM A;  3VR8 A;  2WWU A;  2JPF A;  2VKH A;  3ASH A;  2GRR B;  4DX7 D;  1H2V C;  1WM5 A;  2GRP B;  3CEQ A;  3SGH A;  4WNE A;  4CGV A;  1X5B A;  2Z6E A;  3DEP A;  2XS1 A;  5L4H A;  4DV1 T;  4PJJ A;  3G2S A;  4WUY A;  4BJN A;  5JDQ A;  5HEU A;  2PM6 A;  2VUR A;  3EDU A;  5LHH B;  5JMN D;  2W4X A;  2OVB A;  4BJM A;  2VTB A;  4AEZ C;  1MX4 A;  3QUJ A;  5LCY A;  4UI9 C;  4DUI A;  3K3O A;  3IEG A;  2CM0 A;  5LYJ E;  3HDX A;  3CVW A;  3RIB A;  3V5S A;  3ZSS A;  3S7J A;  4JA9 A;  2XAJ B;  4IYP A;  2R05 A;  2OEV A;  3AA6 B;  3B13 A;  1Y8M A;  2WXF A;  4ACK A;  4UF0 B;  2Y4T A;  2XSB A;  4CYM D;  4GA2 A;  4XEI G;  5ENN A;  4GZ5 A;  1WLX A;  1HS7 A;  4BAY B;  2CXD A;  4HKA A;  4AQF C;  3UUM A;  2VAS A;  3UU3 A;  4YSY A;  4NQ0 A;  4KZ0 A;  1E7V A;  5L3E B;  3QJZ A;  4AY6 A;  2VL0 A;  2IOL A;  5CER B;  4JI3 T;  3NF1 A;  4IT4 A;  3ULQ A;  4X20 E;  2XS8 A;  3WXX A;  2OV9 A;  5BPP A;  4APO A;  4JL0 A;  3LG7 A;  3DXK G;  4HRN A;  3ASF A;  1S94 A;  5KDM C;  1BI7 B;  3ZHE B;  4HWD A;  4UWL A;  3MV3 B;  3BU8 A;  3TL5 A;  5CCL A;  5G2N A;  4IRE A;  2EHO D;  1MIW A;  2KWI B;  3RYI E;  2H6H A;  3P2B A;  2KXP C;  3JXJ A;  4N39 A;  4XBF B;  2P9I G;  3OXF A;  5LP0 A;  2LUH A;  4JI4 T;  1UN8 A;  1XNF A;  2QA7 A;  2ODU A;  4DI3 A;  1HCI A;  1UW4 B;  4HWH A;  1T8B A;  3LVQ E;  1TJF A;  3PUJ A;  5CMW A;  5L3F B;  1WR6 A;  3SRZ A;  5IYZ E;  3JAE A;  2DWZ A;  2JRK A;  4GA0 A;  4G23 A;  2WDQ A;  1J1J A;  3AED A;  4I6J A;  2XQ4 A;  2WPV A;  4WWP A;  5G04 C;  2FJB A;  4GYR A;  3IF8 B;  1NAF A;  4LMJ A;  3TAX A;  3ZVV A;  3VRA A;  4WAF A;  4EOZ B;  5H6Q B;  2K9A A;  4YXD A;  4I9E A;  5C1D A;  3UUX B;  3DJB A;  4A3V A;  4UVA B;  2DLR A;  3WAJ A;  4WYV A;  3PJA A;  5FYM A;  1TR4 A;  3R7R A;  2XTL A;  2LKG A;  4U31 A;  2RP4 A;  3PUW F;  3VHL A;  4C91 A;  3GYZ A;  4YTN A;  3T1H T;  4TWD A;  3I0O A;  3CIA A;  5ARG A;  2W67 A;  5AAO A;  4B3T T;  5ENS D;  4NUV A;  2W62 A;  1S0P A;  5AQK B;  3AE2 A;  5LHG B;  1KNZ A;  1LF8 A;  2Y69 E;  1JNR A;  4ZI2 D;  3RRW A;  4OVU A;  1BLX B;  5ARF A;  2FO7 A;  3ZST A;  4CXX A;  4HE8 A;  4EED A;  2V8S E;  1KK7 A;  3UM2 A;  5KJM A;  3V2O A;  1N36 T;  1V55 E;  4JI7 T;  4HI9 A;  4MKT A;  3GWH A;  4KVO A;  1SW6 A;  3QC9 A;  1DC2 A;  2JMH A;  3D9O A;  4ACL A;  4HNA D;  4JYA T;  4X64 T;  1DCQ A;  3O1J A;  3C72 A;  2RG8 A;  3MKR A;  3ZFW A;  4G26 A;  4IE4 A;  3UM1 A;  4FC8 A;  3CK8 A;  4B3R T;  3AG1 E;  3CVV A;  4IE5 A;  1E90 A;  4CDN A;  4RSY A;  5G05 J;  3A8Y C;  4X1Y E;  3UUN A;  4FHJ A;  4YTP A;  3N9N A;  2H7V C;  5AQV B;  1HS6 A;  4YND A;  4KX6 A;  1OED A;  3RYH E;  1PC2 A;  3EAB A;  1FIO A;  4UWF A;  1OWA A;  5CCM A;  1L5J A;  4HFB A;  2IIU A;  5HEO A;  4GPK A;  4EQF A;  3NQP A;  5JHA A;  3GN5 B;  5CMY A;  2N1G A;  2I1J A;  3CML A;  1B89 A;  4P09 A;  1ZKE A;  4A56 A;  3AEE A;  2UUA T;  4WZX A;  3CVY A;  1UJK A;  5ANL A;  4I1O B;  4TXQ A;  4ISS A;  4HGA A;  5JR9 A;  2IC6 A;  4AV7 A;  2M6B A;  3TWW A;  3FP3 A;  1EZ3 A;  3SO8 A;  1KZP A;  3BQO A;  3C98 B;  4ILC A;  2JIW A;  4EAH A;  3E0Z A;  3KSQ A;  2P9U G;  1MYO A;  4IE0 A;  4Q25 A;  4AI6 A;  3IV0 A;  2OCC E;  1BU9 A;  3PUX F;  5LGU B;  4JVS A;  3AE5 A;  3OYZ A;  3ZKR A;  3Q75 A;  4I9C A;  3AE7 A;  1BD8 A;  4JXT A;  4BWR A;  3E08 A;  1WY6 A;  4N3A A;  5G04 J;  3RKV A;  2BS4 A;  3RU0 A;  5JH7 E;  2BG9 A;  3LDQ B;  2I0M A;  4ILI A;  4C0M A;  1UOH A;  3QB5 A;  3CV0 A;  1U3D A;  2F0Y A;  4HOS A;  2X66 A;  2N2N A;  3AE6 A;  2ZM8 A;  2WXK A;  2WXM A;  3JXI A;  1TNZ A;  1FEW A;  3HG0 D;  4DJA A;  2J4B A;  3X2Q E;  1A5E A;  5JR9 B;  4AOF A;  4B89 A;  5KX5 E;  1H2T C;  1BR4 A;  1MX2 A;  3GZ2 A;  3L08 A;  5T4Y A;  3KDS E;  3C98 A;  3ZW3 A;  3RHW A;  4O6F A;  1BR1 A;  5HRY A;  4ZHB A;  3L54 A;  3F57 A;  2FUP A;  4TX5 A;  5KJN A;  2Y1L E;  3MYV A;  2Y6X A;  1UX5 A;  5EX3 A;  4LEU A;  3CHQ A;  2X9Y A;  4ILH B;  3ONL C;  4BEP A;  2V7K A;  3MAC A;  2P9P G;  2OA5 A;  2IQC A;  2V5Q C;  5ABF A;  5LGN B;  3AU5 A;  3IXE A;  4IE7 A;  5ENT D;  2PJQ A;  2CCQ A;  2R03 A;  3N9M A;  3LPZ A;  2IML A;  5CRU A;  4ME2 A;  4I43 A;  1YQ3 A;  1UGO A;  2GGF A;  2WXH A;  4YHJ A;  4ATZ D;  4DLQ A;  2DWG A;  3UT7 A;  2BKK B;  5HEJ A;  2KCK A;  2IAK A;  4FI5 A;  1JNZ A;  3CHM A;  5AQP B;  3NKZ A;  4GK0 E;  5J08 A;  1KZO A;  4UI9 J;  4O1P A;  1L0V A;  3SBT B;  3CPZ A;  2FEZ A;  3CST A;  2V5F A;  4KXK B;  3TG5 A;  3LJC A;  3DEO A;  1MMN A;  5FIN A;  3RKG A;  3FH7 A;  4FAD A;  3UU8 A;  3AA0 B;  3O9X A;  4Z90 A;  1M62 A;  2BZB A;  3BEE A;  5FY1 A;  3PUQ A;  2LNI A;  5AQB A;  2OND A;  3PZD A;  1SE7 A;  1JCQ A;  2X6F A;  4IHJ E;  4DV2 T;  4F7A A;  2IDO B;  2LKH A;  3ZMV B;  5ADX L;  5HWX A;  4GZ6 A;  4HEA A;  4LFB T;  2V7M A;  2V7L A;  3ESL A;  3D9L A;  3IHY A;  4EHM A;  3FUM A;  3SFD A;  4JB8 P;  3K8P C;  2FI7 A;  2HM8 A;  2RKK A;  4L9I A;  2IOS A;  2V5D A;  3PZ4 A;  3Q5M A;  2HE0 A;  2W61 A;  2WXG A;  5A1L A;  4J7W A;  2C5J A;  2AXZ A;  4LF9 T;  4JEH A;  1GQE A;  5HCM A;  4GCN A;  2BG9 B;  5FVL A;  3UXG A;  3L16 A;  2YQ8 A;  5EN5 D;  4C48 B;  2XEV A;  4G2V A;  3Q79 A;  3U3I A;  5ANR A;  3IA3 A;  4YFS A;  1NA0 A;  4J8S A;  2EHO A;  1J5E T;  3ONK A;  3MJX A;  3UU6 A;  4GA1 A;  2E0I A;  4U74 A;  1N54 A;  2ZM6 T;  2DBA A;  3L13 A;  1WYB A;  1V54 E;  4QKN A;  2H7O A;  1WYC A;  4FJZ A;  1N95 A;  2ZIS A;  4HB5 A;  5ETW A;  2AXU A;  4FJO A;  4O2B E;  2XCB A;  5G55 A;  1MIY A;  1ZHC A;  5G05 C;  4GTT A;  1ZP0 A;  3PS6 A;  3SOL A;  3NOG D;  2YDR A;  4I2W A;  4GTS A;  3FUJ A;  4GTP A;  1UN9 A;  3QB2 A;  3ZC1 A;  2K3W A;  1N4R A;  3EIQ C;  3PUA A;  2PM7 A;  5FXX A;  4O1O A;  2MYS A;  4ZS2 A;  2QYW A;  3SS1 A;  1D9S A;  3ZT5 A;  2X0L B;  4F6R D;  2QFC A;  1YA0 A;  1FVF A;  4YDE A;  4ZHQ E;  2NTX A;  4OYK A;  2EHO B;  3B7U X;  5D66 A;  5B1B E;  3FEY A;  2WM9 A;  2CXF A;  3UTM A;  2VGX B;  4APF A;  3UT4 A;  3APF A;  4J0U A;  1Z3X A;  3ASO E;  2YU1 A;  3KBU A;  4O4I E;  5HWY A;  4GMR A;  4EBA A;  1FJG T;  4WW0 A;  3SWH A;  4C90 A;  4AJW A;  2D2S A;  4GZ3 A;  4HFI A;  5BNW A;  2L0T B;  2YDQ A;  3AE8 A;  3EAM A;  4QFV A;  5HXE A;  4A1G A;  3RKO A;  2OEW A;  2XQA A;  3CVQ A;  4U3C A;  5M72 A;  2EQX A;  3FUK A;  4V3I A;  2YHE A;  3FDH A;  3ZXS A;  2P9N G;  2D5U A;  5F3J A;  3C50 A;  1SA5 A;  1WFD A;  3PNL B;  5IWA T;  4TUY E;  3P4W A;  4AM9 A;  2XQ0 A;  5H6R B;  1PAQ A;  4MLP A;  4LF6 T;  4JV5 T;  4U7I A;  3VU7 H;  2NW7 A;  1N0Q A;  3FB2 A;  5AN8 A;  3RO3 A;  1K3Z D;  1QBQ A;  2VGY A;  2WB5 A;  1VCS A;  1IQR A;  2NYJ A;  5FP3 A;  3RIF A;  1BR0 A;  2ILR A; 
#chains in the Genus database with same CATH homology
 3FUL A;  4M1P A;  1E7U A;  1PY1 A;  4G1T A;  3KV6 A;  4ZI3 C;  4PK5 A;  3ZCI A;  2CFU A;  4UVB B;  1WRD A;  2Q7F A;  2B1E A;  2X38 A;  5FQ4 A;  1U3C A;  4BTA A;  3SI5 A;  4KT6 B;  4NAC A;  4JUY A;  5LA6 E;  3D0T A;  4EZL A;  3P7I A;  2NXP A;  4YLH A;  5KJL A;  2W63 A;  3FU3 A;  3N71 A;  3MK7 C;  4BSX A;  4I6E A;  4A3T A;  2W00 A;  2CMR A;  3ZYM A;  4J6I A;  3CHS A;  4J8E A;  4U72 A;  4L23 A;  2XGM A;  4RVB A;  4AKG A;  3NRX A;  2UY1 B;  3QAR A;  4K0R A;  4XX5 A;  2VKD A;  2WQ7 A;  5L3G B;  2J09 A;  1D1C A;  4Z8X A;  2YU2 A;  2WXP A;  2ES0 A;  3I1A A;  1FMW A;  5C8Y E;  4I50 E;  1N52 A;  4GMJ A;  3T8M A;  4B94 A;  1E1H B;  3Q2M A;  3TXN A;  3ZYQ A;  3CVP A;  2MOZ A;  4ZI2 C;  4IRU A;  4HOT A;  3T8O A;  2E9X C;  2VK9 A;  2E2E A;  4AY5 A;  2C0L A;  2NSZ A;  2C0M A;  3BQI A;  3O4Z A;  3LS8 A;  3QC1 A;  4L1B A;  3FTS A;  4O2A E;  4RG6 A;  3KV9 A;  3T5X A;  4CDM A;  3ML9 A;  2KLQ A;  5JDG A;  4OHF A;  5JJ6 A;  3AA7 B;  2NWB A;  2XQY A;  1HFA A;  3V5U A;  1MND A;  3G2W A;  3U78 A;  4X1K E;  4AVX A;  1VDY A;  1U5P A;  2ZU6 B;  2GRM A;  2WQ6 A;  3O48 A;  3Q4A B;  3WI3 A;  4DBQ A;  2CHW A;  4HS2 A;  3G2T A;  5LBQ B;  1OUV A;  2XAS B;  5JVD E;  4UIG A;  3ZC0 A;  3D3M A;  3P1U A;  3R6N A;  2NC9 A;  4MAL A;  3ASD A;  2J08 A;  1G8X A;  1MIV A;  3APD A;  5FZR A;  2JQQ A;  4EZ4 A;  2HO1 A;  3ASG A;  3LEW A;  3ZYK A;  4EEC A;  1NP7 A;  4B8C B;  1NA3 A;  4TUU A;  4L7T A;  3ZMZ B;  3E22 E;  3RH3 A;  2IU1 A;  3S4U A;  4B6X A;  2XAQ B;  1SZ9 A;  4EXT A;  3K3N A;  4KBQ A;  4Y6C A;  5JJ7 A;  4L2L A;  4WBN E;  1BPO A;  3OXL A;  1HH8 A;  3OBV E;  1OWM A;  5JDN A;  3PDY A;  1FVH A;  2V7J A;  4MRU A;  5LCW J;  2BUG A;  5DBK A;  2Y4U A;  4O4H E;  4JHJ A;  3FU6 A;  2XUE A;  2CWO A;  3AVS A;  4I17 A;  4PFO A;  3JC6 C;  2KZ7 B;  4U07 A;  3KV5 A;  1E8W A;  4KBM B;  3RYC E;  3ZPJ A;  4KP3 C;  2R59 A;  2VL8 A;  3RC8 A;  3GMI A;  5FY0 A;  5FQ8 A;  4OFZ A;  3FTW A;  4IST A;  3LBX B;  5HXH A;  4AXH A;  3FEX A;  4M3O A;  3KFW X;  4PNI A;  1SA0 E;  3CSF A;  3K3Q C;  3JC6 D;  3ZRH A;  1LVK A;  2DNX A;  1KT1 A;  4GK5 E;  3HL6 A;  3C4W A;  3MJW A;  3H3A A;  4G25 A;  2YNQ A;  2NTY A;  2C2L A;  4N2S A;  3MGB A;  2D0U A;  4NUR A;  4URK A;  3B7S A;  3PH0 C;  4H63 H;  4N5C A;  1LKX A;  3QNK A;  5AYW D;  5FJY A;  5JDM A;  2L8K A;  3AAA B;  3FHN A;  2MBG A;  4UQY A;  2WXI A;  2X6I A;  3FTX A;  1JWG A;  3AS5 A;  4UV9 B;  4FJY A;  3VLE A;  5FZS A;  1A17 A;  3CLJ A;  3MV2 B;  4I4T E;  3GZS A;  3JQ1 A;  3EUH A;  1H2U A;  3S2A A;  4OYS A;  3RX6 A;  2E9X A;  3JUI A;  2Y48 B;  4R7L A;  4F6R C;  4I6G A;  1Z3Y A;  4UWG A;  5AJL A;  4P29 A;  3FUD A;  1HF8 A;  4H7Y A;  5AJD A;  2CEA A;  2EHO C;  4EZH A;  4KZC A;  4U63 A;  1WAO 1;  4QXC B;  3ZN1 B;  1Z0P A;  3L17 A;  3H37 A;  3CK9 A;  2VJ8 A;  5LHI B;  4GIW A;  4HOQ A;  2DI4 A;  3FUE A;  2WXJ A;  5FQ7 A;  2BTD A;  4DMW A;  5FXW A;  4FLB A;  2LJL A;  3LBX A;  1KLX A;  4AKH A;  2AWI A;  3UUL A;  3EIJ A;  3BQL A;  2KT9 A;  2Q9Q C;  3MX3 A;  4PJM A;  4DK5 A;  2N9D A;  2X3M A;  3RK6 A;  4OK0 A;  2WQH A;  3PVL A;  4AQG A;  3FXD B;  4ASK A;  4E7Z A;  1HZ4 A;  4CT0 A;  3SD5 A;  3ZEF B;  2WSS V;  4AXP A;  2WAU A;  4ATG A;  4CQI A;  1XGW A;  3LJ3 A;  4KVM A;  4ZS3 A;  1MQS A;  2ODV A;  4XKB A;  3NRY A;  5KJK A;  2C5I T;  2FUL A;  4PJL A;  4JZY A;  4OVV A;  2CLY B;  5CB4 E;  2XRZ A;  2MOW A;  4JHR A;  1HX8 A;  2C5K T;  3FUF A;  2WXR A;  2X9X A;  2LSI A;  4F1S A;  3FH5 A;  2W0G A;  3ZCJ A;  5A7D B;  4I55 E;  5DJQ C;  3CKC A;  2CFZ A;  2R17 C;  3B57 A;  4X1I E;  1QZ2 A;  3DPD A;  3FU0 A;  4G24 A;  4BX8 A;  1NWM X;  3ZEF A;  3UMV A;  4PAG A;  3TKL B;  1Z6T A;  4LCT A;  2CWY A;  3TG4 A;  3MZL B;  5KCM A;  3NZS A;  2J4D A;  4CXY A;  3RRU A;  3UX4 A;  4UEL A;  3PE0 A;  3I5P A;  3LXU X;  3OKQ A;  4PJN A;  2LAH A;  1SZA A;  2GK9 A;  3HHM A;  3RRN B;  3MKD A;  2X68 A;  4O4J E;  2V4L A;  2X9W A;  5LJN A;  5L3B B;  4ILU A;  2L0I A;  5FT9 A;  3FFL A;  4FU3 A;  2GW1 A;  3RJV A;  5L2L A;  4NRH B;  3Q15 A;  2NP9 A;  1Y64 B;  3ONX A;  2LO6 A;  4ZI7 E;  2I9C A;  3QWP A;  3ML8 A;  3P8C D;  4HOU A;  3PRE A;  4DPR A;  4CRW A;  3ANW A;  4H9R C;  3ETU A;  1GW6 A;  1EPU A;  4HVB A;  5FXV A;  5FY7 A;  4BA9 A;  3B7R L;  3OAW A;  2C0S A;  4XZ4 A;  4O4L E;  2KCV A;  3BQK A;  2PL2 A;  3SFZ A;  1AJ3 A;  3LDZ A;  2WXQ A;  3CHR A;  2UXN B;  1ELK A;  1IZN B;  3I0Q A;  1DVP A;  3FTZ A;  5BUZ A;  3C64 A;  3HR0 A;  2OOE A;  4EIW A;  3QDN A;  5FXZ A;  4UV8 B;  4B0Z A;  2UXX B;  4D10 C;  3URZ A;  3D9I A;  2LOP A;  2X6H A;  3LVR E;  1UJJ A;  5JHB A;  3O4X E;  2MRI A;  4CI1 B;  3S7D A;  3WAK A;  1INZ A;  5A23 A;  4PW8 A;  4JLE A;  3EDV A;  3J7Y q;  3GA8 A;  2I6H A;  3LK3 B;  1UCU A;  2L9B A;  2DHR A;  3PU3 A;  3GZ1 A;  2E8I A;  4F3V A;  1IJ5 A;  1S35 A;  3QWW A;  4IDZ A;  4QXB B;  3HVE A;  4A55 A;  4F53 A;  1VRB A;  5EX0 A;  4TRQ A;  5CA0 E;  2FBN A;  2L9Q A;  2PG8 A;  4H9N C;  3E4B A;  4ZOL E;  3VLD A;  2L6J A;  3ONL A;  3N9L A;  3RO2 A;  1JUQ A;  4QX7 B;  4GYS A;  4TN7 B;  3CVU A;  3FHE A;  1HXI A;  2L3L A;  2WVI A;  5E75 A;  5C2Y A;  5JJT A;  2MTQ A;  2HPJ A;  4U0U A;  5JQG E;  5L3C B;  2J07 A;  5CHE E;  3ZN0 B;  2VSX E;  5J2U E;  4CEM A;  3FUI A;  4TZ4 C;  1IJ6 A;  4N2Q A;  2XGO A;  2LHR A;  3AVR A;  3IEE A;  2XPY A;  3KV4 A;  2LSJ A;  5T8I A;  3A5X A;  3HKE E;  4ERR A;  3ZPO A;  3PRZ A;  3FXE B;  4GZD A;  4I43 B;  2VSO E;  2I2O A;  3SZ7 A;  1G73 A;  3KIN B;  3LY8 A;  2IC9 A;  3FTV A;  4EBA G;  4WNG A;  5EZY E;  3CVN A;  5CA1 E;  3NZP A;  1ZU2 A;  3D9M A;  2D0T A;  3KVA A;  4EPZ A;  3ZMS B;  4H9Q C;  5F8P A;  3HYM B;  3U64 A;  3Q49 B;  4BFR A;  3MKQ B;  3QAQ A;  1E96 B;  3MXZ A;  4Q69 A;  1OWL A;  2XGS A;  4HXI A;  3C51 A;  3HA4 A;  3CX8 B;  5LJM A;  3CHO A;  3KD7 A;  3FTY A;  2Y3A A;  3O1I A;  4TV3 A;  2LSV A;  3QK0 A;  3S7F A;  3KVB A;  4JEH B;  2XAG B;  3UUX A;  1IQU A;  4EYU A;  2KZT B;  1FMV A;  4UWH A;  3VKG A;  3CHP A;  1ZEE A;  3I9W A;  3DP7 A;  4A1S A;  1YD8 G;  3CKD A;  2VTB B;  3RRC A;  4G2A A;  4WBO A;  4P0A A;  2I1K A;  4J8F A;  3CWZ B;  3LKU A;  4I1M A;  3EHM A;  2ZLY A;  1IAP A;  2KXP B;  3U66 A;  4KMC A;  3U9W A;  2MHK A;  3HIZ A;  4G63 A;  3CVX A;  3QWV A;  3LK2 B;  2DWK A;  5IHY A;  2FF4 A;  2PZI A;  3CK7 A;  3Q9D A;  3U4T A;  5A6C A;  4QXH B;  3TGO A;  3Q47 B;  4LER A;  2X6J A;  4KMO A;  4WND A;  4JC8 A;  3ZYL A;  1U4Q A;  4JEU B;  4P0B A;  5AIJ A;  3FH8 A;  3IHV A;  2VKJ A;  3SF4 A;  4H63 V;  3I4G A;  3ZHE A;  2VGX A;  2X67 A;  5BT1 A;  3AAE B;  2ZM0 A;  5LOZ A;  3FTU A;  3UTK A;  2V26 A;  3UT8 A;  2PQR A;  4UQX A;  4J8D A;  3T5V A;  3N2K E;  2ZMA A;  4GYY A;  4Q96 A;  1V9D A;  3HKD E;  5HAX A;  2Y8D A;  2A3D A;  3AAI A;  4ANV A;  2KIN B;  2XRY A;  2M63 A;  3NZQ A;  4IUL A;  1MMD A;  4FP7 A;  2IF4 A;  3MKQ A;  2LEH A;  2DCP A;  3CGH A;  2R5S A;  2UY1 A;  1HE8 A;  3CQG B;  5LBM A;  5L3D B;  4PDX A;  3R9A B;  3CQX C;  4YJ3 E;  4DI4 A;  4MFR A;  2CHZ A;  4DO0 A;  4W9R A;  1MMG A;  5LFA A;  1OWP A;  5HXR A;  3KEZ A;  1EYH A;  2CE7 A;  2ACX A;  2IFU A;  1T98 A;  3ZJ2 A;  2K24 A;  1EDU A;  2IJG X;  1Y6I A;  1JWF A;  2VKO A;  2CG3 A;  3D9N A;  1NZN A;  4XI0 A;  3KBT A;  3HKC E;  4Q94 A;  2V0P A;  3ESK A;  3N9P A;  4DMV A;  2HYZ A;  4OYJ A;  1YKE B;  1BR2 A;  3AS4 A;  3C4Z A;  2IW5 B;  4E7S A;  1X79 A;  5EKQ D;  5LOV E;  2BF0 X;  4UI9 K;  3RYF E;  4KYO B;  1ZV4 X;  2XHE A;  2LM9 A;  3QOU A;  2XPI A;  2JJ9 A;  4CGW A;  4U8H A;  4WWN A;  3F2E A;  2VSY A;  1HG2 A;  1H0A A;  3LY7 A;  4FHK A;  5AEN A;  3MEK A;  3FBZ A;  5AFU L;  3IKO B;  1CUN A;  4PS8 A;  3LCA A;  3LFM A;  4IIJ E;  3RC3 A;  4HFG A;  3HKB E;  2KC7 A;  4AIF A;  3MA5 A;  5DAB A;  5J1G A;  1B7T A;  1VOM A;  3MCX A;  4XKC A;  2JMK A;  2X9H A;  1O3X A;  4UQZ A;  4PS3 A;  4CT4 A;  3IBE A;  4PUC A;  5EK4 A;  3F31 A;  4IE6 A;  3BK9 A;  4ADZ A;  4DLO A;  5JDH A;  3U3W A;  5KMG P;  4TV9 E;  4E6H A;  4AQF A;  4MHC A;  4CI2 B;  3L09 A;  2J1D G;  1QUU A;  3VKH A;  4HN9 A;  4JHK A;  1E8X A;  4ANW A;  3RRM B;  2KM4 A;  4L0R A;  2E9X B;  5E0O A;  3QK6 A;  2CG2 A;  3PUS A;  4BT8 A;  4WNK A;  2A5U A;  2PFV A;  3UFE A;  4GZC A;  4WNF A;  3KS2 A;  4ANU A;  2NW8 A;  3D9K A;  2BDE A;  4UWK A;  2WXN A;  4B8A A;  3I9Y A;  4H9P C;  2WXL A;  2RD0 A;  2DIW A;  3L22 A;  5HQ8 A;  5M4Y A;  4K0U A;  2XHE B;  3FWV A;  1H7C A;  1QQE A;  3CVL A;  1DNP A;  5TAO A;  4CXW A;  5HYA A;  2CHX A;  3FUN A;  4E85 A;  3ENE A;  4WWO A;  4MBQ A;  1QSD A;  4AP2 A;  4JW1 A;  4O8S A;  5T3R A;  3D9J A;  2VWA A;  4UXN B;  5D0O D;  4EZK A;  2PQN A;  1IHG A;  4GML A;  2NOX A;  2P9B A;  2KMF A;  5FWQ A;  2ZM2 A;  4GU5 A;  4N78 D;  2QY7 A;  3EDT B;  4HFV A;  1ZBP A;  2YK0 A;  2XCC A;  2LT3 A;  5EDS A;  1KT0 A;  4BY6 A;  1FCH A;  3JQ0 A;  4AKI A;  3Q5X A;  4UVC B;  1MHQ A;  3QKY A;  3PU8 A;  4PH4 B;  4DVD A;  5LNK A;  2A2F X;  4Y6W A;  1ELR A;  2LAI A;  1UX4 A;  2VYI A;  3BG0 B;  4XI9 A;  3ZIM A;  3G2V A;  3OXG A;  2AVP A;  2SPC A;  3TXM A;  3L6A A;  2CLY C;  5FMN A;  4HOR A;  1YW0 A;  1YKH B;  1QNF A;  3GW4 A;  2KCL A;  1W3B A;  2OV8 A;  2Q9Q B;  4GOU A;  2XPZ A;  3DBS A;  2LSU A;  3AA1 B;  3VTX A;  4BX9 A;  3ANW B;  2VQ2 A;  3W15 B;  2WMO A;  2RA1 A;  3N2G E;  2K5B B;  2OVF A;  2HR2 A;  3VLF A;  4CZZ B;  1TEZ A;  5JRC A;  3J9X 1;  5HI7 A;  3C4X A;  5BV1 A;  4HTE A;  4BTB A;  4K03 A;  2WMN A;  3R7Q A;  2K48 A;  4UEM A;  2QGS A;  2ION A;  3PE3 A;  4L2Y A;  4BT9 A;  2E9X D;  3OJA A;  3I3N A;  4GAA A;  1US7 B;  2V7I A;  5DQV A;  4LRZ A;  3PDN A;  3PTR B;  5DIZ A;  4J2C A;  4EZJ A;  4GB9 A;  3APC A;  3LY9 A;  4H9S E;  3IHR A;  5J90 A;  4ZI3 D;  1HG5 A;  3N9Q A;  4YJ2 E;  3ZMU B;  2WBL A;  2JLB A;  4ILG A;  4PK4 A;  4AKR B;  2Q9Q D;  3L3P A;  4AKL A;  3G2U A;  4XE0 A;  2AW6 A;  3KAE A;  1D1B A;  2JEK A;  5FNV E;  5LX8 A;  4MLK A;  2J49 A;  5JRC B;  1H19 A;  2XAF B;  3CQC B;  3SBS A;  1ELW A;  2LSG A;  3EHN A;  1HO8 A;  1EF1 C;  4N3B A;  4JPS A;  4GYO A;  2A4Z A;  3N5L A;  2VSN A;  4GYW A;  3PNT B;  1HU3 A;  3OTN A;  4H9O C;  3PUK A;  5JDF A;  4JA7 A;  1E8Z A;  3K9I A;  3MZK B;  1E8Y A;  3FU5 A;  3R84 B;  3RPU A;  4LUN U;  5FQ6 A;  4EB6 E;  3MA9 A;  4XIF A;  3FBL A;  5LGT B;  3ZGQ A;  3N2O A;  5GON E;  5D0Q D;  1D1A A;  4G11 A;  3SHF A;  3UPV A;  1SHZ C;  3CR3 A;  3ETV A;  3JYS A;  2Q9Q A;  1H6K A;  3FY4 A;  2BVM A;  4V1A v;  3EJN A;  3PEV B;  1LVF A;  4FLH A;  4RG9 A;  2LOS A;  5FTP A;  4DND A;  4H7X A;  5EK3 A;  4CDR A;  4PFP A;  4CCA A;  4XZC A;  3B7T A;  4C0E A;  1P5Q A;  4I1A A;  4CI3 B;  1D0Z A;  4YVQ C;  2DCF A;  4U04 A;  1OXZ A;  1UG3 A;  3LK4 2;  5JDL A;  2P58 C;  4ABN A;  2LSY A;  5FZQ A;  3HVE B;  2AXV A;  1MNE A;  3LYA A;  2PBI A;  5J2T E;  5LP6 E;  3ZJ1 A;  1TJC A;  5LG4 A;  2WB2 A;  4N3C A;  5LXT E;  3O1H A;  4QWN B;  2CA5 A;  1LRZ A;  3PUG A;  3VTY A;  3UQ3 A;  3DTO A;  2LSK A;  4I2Z A;  1D0Y A;  4GCO A;  4YVO A;  5DQW A;  3GN5 A;  2VB6 A;  3I4R B;  2KND A;  4QHO A;  4QX8 B;  3N9O A;  3CX7 B;  3CVR A;  4FUL A;  4EYY R;  3TJP A;  2X6K A;  2J9Q A;  2X51 A;  3M65 A;  3NBX X;  3ZLI A;  3PEU B;  4ANJ A;  3AS8 A;  4U0Z A;  2NW9 A;  2LHN A;  2KAT A;  2GRL A;  2UWJ G;  4PK6 A;  4U0S A;  2YIN A;  4ANX A;  4L5G A;  5JRE A;  3OYX A;  4C9B B;  3CX6 B;  3S7B A;  2WXO A;  4IGU A;  4HLE A;  4FA6 A;  3IBP A;  2A72 A;  3PE4 A;  2V1D B;  3EVY A;  2I59 A;  5BW8 C;  3SNX A;  2M67 A;  2KZT A;  2CXL A;  4IN3 B;  2YEV C;  5JR9 C;  2BVL A;  4TV8 E;  3NZU A;  3D9P A;  5E76 A;  4NUU A;  4PS7 A;  3ZMT B;  3PUR A;  2XAH B;  5BV0 A;  4KUM B;  1SQM A;  3AU4 A;  2HH7 A;  2H3R A;  2KWH A;  5BMV E;  2LE8 A;  1HTJ F;  3AB3 B;  1IYG A;  3JCK C;  2G0U A;  5LCW C;  3ZN3 A;  3HI2 A;  4DBR A;  5EK2 A;  4UF0 A;  4XAX B;  1OWO A;  1MMA A;  3FUH A;  4MS6 A;  2HPL A;  3Q5W A;  3BG1 B;  1D0X A;  1OWN A;  2YHC A;  1JPL A;  4JEU A;  3UT5 E;  5HXS A;  3CKB A;  5HXC A;  2WWU A;  2JPF A;  2VKH A;  3ASH A;  1H2V C;  1WM5 A;  3CEQ A;  3SGH A;  4WNE A;  4CGV A;  1X5B A;  2Z6E A;  4PJJ A;  3G2S A;  4WUY A;  4BJN A;  5JDQ A;  2PM6 A;  3EDU A;  5LHH B;  2OVB A;  4BJM A;  2VTB A;  4AEZ C;  3QUJ A;  5LCY A;  4UI9 C;  3K3O A;  3IEG A;  2CM0 A;  5LYJ E;  3HDX A;  3CVW A;  3RIB A;  3V5S A;  3S7J A;  4JA9 A;  2XAJ B;  4IYP A;  3AA6 B;  3B13 A;  1Y8M A;  2WXF A;  4ACK A;  4UF0 B;  2Y4T A;  4GA2 A;  5ENN A;  4GZ5 A;  1WLX A;  1HS7 A;  4BAY B;  2CXD A;  4HKA A;  4AQF C;  3UUM A;  2VAS A;  4NQ0 A;  4KZ0 A;  1E7V A;  5L3E B;  3QJZ A;  4AY6 A;  2IOL A;  3NF1 A;  3ULQ A;  4X20 E;  3WXX A;  5BPP A;  4APO A;  4JL0 A;  3LG7 A;  3ASF A;  1S94 A;  5KDM C;  3ZHE B;  4UWL A;  3MV3 B;  5CCL A;  3TL5 A;  5G2N A;  2EHO D;  1MIW A;  2KWI B;  3RYI E;  3P2B A;  4N39 A;  4XBF B;  3OXF A;  5LP0 A;  1UN8 A;  1XNF A;  2QA7 A;  2ODU A;  4DI3 A;  1HCI A;  1UW4 B;  3LVQ E;  1TJF A;  3PUJ A;  5CMW A;  5L3F B;  1WR6 A;  3SRZ A;  5IYZ E;  2JRK A;  4GA0 A;  4G23 A;  4I6J A;  2WPV A;  4WWP A;  5G04 C;  4GYR A;  3IF8 B;  1NAF A;  3TAX A;  3ZVV A;  4WAF A;  4EOZ B;  5H6Q B;  2K9A A;  5C1D A;  4I9E A;  3UUX B;  3DJB A;  4A3V A;  4UVA B;  2DLR A;  3WAJ A;  5FYM A;  3R7R A;  2XTL A;  2RP4 A;  3VHL A;  4C91 A;  3GYZ A;  3I0O A;  3CIA A;  5ARG A;  4NUV A;  2W62 A;  1S0P A;  5LHG B;  1KNZ A;  1LF8 A;  4ZI2 D;  3RRW A;  4OVU A;  5ARF A;  2FO7 A;  4CXX A;  4HE8 A;  2V8S E;  1KK7 A;  5KJM A;  4MKT A;  3GWH A;  4KVO A;  3QC9 A;  2JMH A;  3D9O A;  4ACL A;  3O1J A;  2RG8 A;  3MKR A;  3ZFW A;  4G26 A;  4IE4 A;  4FC8 A;  3CK8 A;  3CVV A;  4IE5 A;  1E90 A;  4CDN A;  4RSY A;  5G05 J;  4X1Y E;  3UUN A;  4FHJ A;  3N9N A;  2H7V C;  1HS6 A;  4YND A;  3RYH E;  1PC2 A;  1FIO A;  4UWF A;  1OWA A;  5CCM A;  1L5J A;  4GPK A;  4EQF A;  3NQP A;  5JHA A;  3GN5 B;  5CMY A;  2N1G A;  2I1J A;  3CML A;  1B89 A;  4P09 A;  1ZKE A;  4A56 A;  3CVY A;  1UJK A;  5ANL A;  4I1O B;  4ISS A;  4HGA A;  5JR9 A;  2IC6 A;  4AV7 A;  3FP3 A;  1EZ3 A;  3C98 B;  4EAH A;  3E0Z A;  4IE0 A;  3IV0 A;  4AI6 A;  5LGU B;  4JVS A;  3OYZ A;  4I9C A;  4JXT A;  4BWR A;  3E08 A;  1WY6 A;  4N3A A;  5G04 J;  3RKV A;  3RU0 A;  5JH7 E;  4ILI A;  4C0M A;  3CV0 A;  1U3D A;  4HOS A;  2X66 A;  2N2N A;  2ZM8 A;  2WXK A;  2WXM A;  1FEW A;  4DJA A;  2J4B A;  5JR9 B;  4AOF A;  4B89 A;  5KX5 E;  1H2T C;  1BR4 A;  3GZ2 A;  3L08 A;  5T4Y A;  3ZW3 A;  3KDS E;  3C98 A;  4O6F A;  1BR1 A;  3L54 A;  3F57 A;  4TX5 A;  5KJN A;  3MYV A;  2Y6X A;  1UX5 A;  5EX3 A;  4LEU A;  3CHQ A;  2X9Y A;  4ILH B;  2V7K A;  3MAC A;  3AU5 A;  2OA5 A;  2IQC A;  5LGN B;  4IE7 A;  2PJQ A;  2CCQ A;  3N9M A;  3LPZ A;  4ME2 A;  4I43 A;  2GGF A;  2WXH A;  4YHJ A;  4DLQ A;  2DWG A;  3UT7 A;  2KCK A;  2IAK A;  4FI5 A;  3CHM A;  4GK0 E;  5J08 A;  4UI9 J;  3SBT B;  3CPZ A;  2FEZ A;  3CST A;  2V5F A;  4KXK B;  3TG5 A;  3LJC A;  1MMN A;  3FH7 A;  4FAD A;  3AA0 B;  3O9X A;  2BZB A;  3BEE A;  5FY1 A;  3PUQ A;  2LNI A;  2OND A;  3PZD A;  2X6F A;  4IHJ E;  4F7A A;  3ZMV B;  5ADX L;  5HWX A;  4GZ6 A;  4HEA A;  2V7M A;  2V7L A;  3ESL A;  3D9L A;  3IHY A;  3FUM A;  3K8P C;  2FI7 A;  2HM8 A;  4L9I A;  2IOS A;  3Q5M A;  2W61 A;  2WXG A;  5A1L A;  2C5J A;  2AXZ A;  4JEH A;  4GCN A;  3L16 A;  2YQ8 A;  2XEV A;  4G2V A;  3U3I A;  5ANR A;  4YFS A;  1NA0 A;  4J8S A;  2EHO A;  3ONK A;  4GA1 A;  3MJX A;  2E0I A;  4U74 A;  1N54 A;  2DBA A;  3L13 A;  1WYB A;  4QKN A;  2H7O A;  1WYC A;  4FJZ A;  5ETW A;  2AXU A;  4FJO A;  4O2B E;  2XCB A;  5G55 A;  1MIY A;  1ZHC A;  5G05 C;  3PS6 A;  3SOL A;  4I2W A;  3FUJ A;  1UN9 A;  3QB2 A;  3ZC1 A;  3EIQ C;  3PUA A;  2PM7 A;  5FXX A;  2MYS A;  4ZS2 A;  3SS1 A;  2X0L B;  2QFC A;  1YA0 A;  1FVF A;  4ZHQ E;  2NTX A;  4OYK A;  2EHO B;  3B7U X;  3FEY A;  2WM9 A;  2CXF A;  2VGX B;  4APF A;  3UT4 A;  3APF A;  4J0U A;  1Z3X A;  2YU1 A;  3KBU A;  4O4I E;  5HWY A;  4EBA A;  4WW0 A;  3SWH A;  4C90 A;  4AJW A;  2D2S A;  4GZ3 A;  5BNW A;  2L0T B;  4QFV A;  5HXE A;  4A1G A;  3RKO A;  3CVQ A;  5M72 A;  2EQX A;  3FUK A;  4V3I A;  2YHE A;  3FDH A;  3ZXS A;  2D5U A;  5F3J A;  3C50 A;  3PNL B;  4TUY E;  4AM9 A;  2XQ0 A;  5H6R B;  1PAQ A;  4MLP A;  3VU7 H;  2NW7 A;  3RO3 A;  3FB2 A;  2VGY A;  1IQR A;  5FP3 A;  1BR0 A;  2ILR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...