2WM9A

Structure of the complex between dock9 and cdc42.
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
423
structure length
407
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 148
structure length 407
sequence length 423
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wm9A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wm9A01
2WM9A 2YINA 3B13A 2WMOA 2WMNA 3VHLA
chains in the Genus database with same CATH superfamily
2MYOA 1MX4A 5AQSB 2VKHA 3DEOA 3KBUA 4K03A 3QC9A 2YOEA 4FADA 4XE0A 3MXZA 3U4TA 1DVPA 2YK0A 3D9JA 4YFSA 4GZCA 1FMWA 2QC9A 1IBMT 3KEAA 4GYOA 2PQRA 1KZPA 1BI8B 3CMLA 5ENRD 4V3IA 5CEDB 2PL2A 3HA4A 3UTKA 4LEUA 5JR9B 4KVMA 4WZXA 2ETCA 5AJDA 4LMLA 5EN5D 2WQ6A 1J5WA 4EPZA 3DXKG 3I0OA 1TEZA 3HI2A 4EAHA 1TYQG 3DP7A 2R5SA 3VLFA 4C9BB 2X6FA 4LFBT 5HCJA 4IDQA 4TV3A 1T72A 3FZFB 1RW2A 3G2UA 2JMHA 2E2AA 4H63V 4UV9B 4D10C 3RKGA 5H7PA 2XS8A 3PZ1A 2L9QA 3FH8A 3NF1A 5L3DB 1V55E 5EIBE 3CSFA 3FXEB 4TNWA 5G04C 3KVAA 4U33A 3EI0A 2CWOA 1OWMA 3IEEA 3QB5K 2D0TA 3AG3E 2JRKA 4JI0T 1WYBA 5CA0E 1SA4A 2X3MA 2K9AA 4O4HE 3CQGB 1MZCA 3DBSA 5JHAA 3CGHA 3TAXA 5JJ7A 1VDYA 3FY4A 4OFZA 4U04A 3GMIA 3ONJA 5ENPD 4KMOA 1OEDC 5AYWD 2DBAA 2X9XA 5C2YA 3OVUA 4OX9T 1MJ0A 5AARA 3ONKA 3LY7A 1LF8A 5HXEA 2BG9C 1L0VA 3KSQA 2XEEA 4L9PA 4FI5A 3ETVA 3Q75A 3DTOA 1PY1A 4BA9A 2CRBA 4GA1A 4LNBA 5LJMA 3RK6A 3FTXA 1S63A 5CHEE 2CPTA 3AU5A 3L08A 2OA5A 4DIDB 4ACLA 4KI0F 4EB6E 5LBMA 3QJZA 5BUZA 5LYJE 4EXTA 2QZAA 3ONXA 3AEGA 2LKHA 4B6XA 3LS8A 4BSZB 1JWFA 3FULA 5FQ4A 1J5ET 2XHEB 2RD0A 5ETWA 3OKQA 3RO2A 2HN2A 3TXNA 4H7XA 1KPSB 3JC6C 4UWHA 4ASKA 4JXTA 3BQOA 3MA5A 4EZLA 4X62T 1N4RA 2X9WA 4CT0A 4JHRA 2XQ5A 3L54A 1HNXT 4ZZCA 4CGVA 2LSYA 1BI7B 3FEYA 1OWAA 4LG6A 1KT0A 3OXGA 2XAHB 5HQ8A 2V7LA 1HE8A 5LNKA 1TNOA 5HXHA 3NWIA 4KHPT 4NXMT 5JTGA 4GPMA 5T3RA 3SFYA 3ZN0B 1OCRE 3AAAC 5D0QD 5L3EB 1N94A 4WNFA 4EIWA 2OOEA 5JMND 5BXOA 1E1HB 2CE7A 4B3MT 2JQHA 2NR4A 3MCXA 4GTPA 4PS7A 4GPKA 3EHZA 4KYOB 5JR9C 1ZP0A 5CFBA 3FEXA 2Q7FA 2XQ3A 4GTTA 5FP3A 4JL0A 2VWAA 2HR2A 3K3OA 5LP6E 1KLXA 5DBKA 3KFWX 2WMOA 2LJLA 1H2VC 2UXDT 4X1YE 3PUWF 4CN4A 2FJEA 4PW8A 1Z8UA 3PUAA 4A56A 3G2SA 5FQ8A 5LGUB 3C3QA 3KD7A 2WZHA 1OXZA 3ZSTA 4JEHB 2ACZA 2XENA 1LD8A 3EU9A 3L6AA 4DR4T 2P9UG 4WUYA 1D1CA 4HFGA 1JNZA 4Z68A 4XAXB 2LAHA 3ZXPA 2EIKE 4AVXA 2X38A 2ZMAA 4JUYA 5G55A 1IQRA 1E7UA 1Z6TA 4QXCB 4FU3A 3CVXA 3H37A 4YHJA 3MYVA 5AQ9A 2FO1E 2EHOC 1KFYA 3NZUA 3PZ2A 2V4LA 3ML9A 5KCMA 3FUFA 1N4SA 3BG0B 3UUXB 1FEWA 3SWHA 3TLUA 3QK0A 3C4ZA 3Q73A 5H6QB 1YMPA 3UIOC 1YYHA 4H9SE 3HXEA 3CK7A 3D9PA 2GRRB 2VQ2A 5DABA 5JR9A 5AIJA 1KEYA 3FU6A 5LGNB 2Y48B 3V79K 5CBOA 4HWCA 3I1AA 3WAJA 4LFCT 3CSTA 4CEMA 4RG9A 4UXNB 1DCQA 4TZ4C 1N34T 4DMVA 2XQ7A 4ZI7E 2UXBT 4AXHA 4YHHT 2BG9B 2LOPA 2R17C 1EDUA 3SNXA 4ABNA 4X65T 4DVDA 3UU3A 3ISMC 4XZCA 4AQFA 3AG1E 2BDEA 1BR4A 3UQ4A 2MYSA 2AXVA 5EYPF 3G06A 4BJMA 4UVAB 3ZEFA 4I43B 4DV7T 1IHBA 4PUCA 2QGSA 5M4YA 4ILBA 2CG3A 1YQ3A 3QC1A 4B94A 1HX1B 3AECA 3EU5A 2WDQA 2K48A 4UV8B 4HI8A 3LJCA 1HU3A 5HXRA 4L1BA 4AKHA 2V7KA 2A4ZA 2GRMA 2ZGDA 4ILHB 4W9RA 4NIQA 2XTLA 3ASGA 1EYHA 2CWYA 4MBGA 3HXFA 3UFEA 2BUGA 1WY6A 4LF6T 4BFRA 1HR0T 1YD8G 3HL6A 4IE4A 2IDOB 2L6JA 4JC8A 3RGLA 4HFVA 3K9IA 1CUNA 4JW1A 3FTWA 4UWFA 3DSUA 3EHRA 4J8FA 5L4EA 2E5LT 5HEHA 2WB2A 3MKQB 4DV4T 4GMRA 5FZSA 3NZQA 3QNUA 2KZ7B 1O1RA 4O4JE 3PVLA 5LMUT 3BK9A 3SZ7A 2VASA 4J8EA 4OK0A 2D5UA 4MLKA 3UUMA 4L9IA 4CXXA 5AQJB 2KZTA 5AQKB 1HNWT 3DSVA 2BKPA 4UR9A 3EAMA 3ZC1A 1EPUA 3VLEA 3N2GE 1T8BA 2UUBT 4NUUA 3MV2B 4ATGA 5CRVA 3ZMZB 2K3WA 4YXDA 4GTSA 4BX9A 5J08A 3NRYA 5FZRA 4ILAA 2FJBA 1YQ4A 4PK6A 2XQ0A 3Q5DA 4WWNA 2IU1A 4KXKB 2WWVA 3K1SA 2HYZA 3EABA 1NL4A 5IY5E 5IUXA 4HOTA 2H3RA 1T7SA 2NC9A 4TWFA 4A55A 1H7CA 3OYZA 4PS3A 4C0MA 1OWLA 3CIAA 4FJZA 1UG3A 3LSVA 4C48B 2L3LA 2KINB 5B1AE 1OY3D 4BWRA 2JQ9A 3HVEB 3W9FA 4QFVA 1H19A 4URKA 1ZOYA 2XRYA 3APFA 4PDXA 3ASNE 2JEKA 3G2TA 3RC8A 1HO8A 3ONLC 1YXRA 5LP0A 4DR2T 5HAXA 3GYZA 4H9PC 3AXJB 1D8DA 3T5XA 3B57A 1IBKT 4BAYB 4XKCA 2JJ9A 3UFGA 2MPKA 4MS6A 5FJYA 5DQVA 4HEAA 2Z6EA 3IBPA 4JHKA 4RQIA 5CCLA 2DZOA 4Q25A 2I9CA 4ME2A 5EDSA 4HVBA 3P4QA 5J2TE 5KNGA 3ZMVB 3E33A 4I6JA 3ZXSA 1G3NB 3NOCD 4BY6A 2CM0A 3T8KA 2XPKA 3Q79A 2WXMA 2V7IA 4HXIA 3O1HA 3EDUA 3B13A 3HR0A 2W62A 4KUMB 2ZU6B 3NZSA 3UU6A 1IAPA 3QK6A 1O1TA 4L5GA 2DIWA 5FWQA 2XS1A 3PEUB 5HS0A 2GRPB 3TG4A 2ZIRA 1G8XA 4AKGA 1TNBA 3HKBE 4AY6A 2WMNA 5G05J 2HE0A 2XZDG 4JA9A 2P9IG 4IIJE 4DI4A 4O4LE 2X67A 3S7JA 1Z3YA 4UQXA 4JI1T 2WBLA 4EZKA 1YA0A 3MZKB 2LUHA 2X9HA 1XDOA 3D3MA 2H89A 2PG8A 4TUUA 2AJAA 3CV0A 3KV5A 2Y0BG 5G04J 2Y4UA 4I2WA 1B89A 4QQIA 2L0IA 2VGXA 5FT9A 4LF8T 2WQHA 5LFAA 2BEDA 1LVKA 5AQBA 3K3NA 1TN7A 3AXJA 1QZ2A 3AVRA 4YJ2E 3AB3B 3Q47B 4HOSA 5JRCA 3FUEA 5TAOA 3QOFA 3Q9UC 3P50A 4DV3T 4B3TT 5A23A 1BLXB 5EILA 1SVXA 2KMFA 4HFCA 3RI5A 4TUMA 2CHNA 2WAUA 4FLBA 2DCFA 5ENOD 2V26A 4NRHB 3OXLA 5AQAA 3QDNA 3CHSA 5ANRA 5CBNA 1R8IA 4Z8XA 4ZI3C 3HKEE 4UI9C 3HKDE 5LCYA 2IFUA 3V30A 2WCAA 1UUSA 3ZN1B 5FYMA 4DX5D 4JI8T 4I50E 3AG2E 2V7JA 4GZDA 4I2ZA 2WQ7A 3DSTA 4PK5A 4PK4A 4AXPA 2KSRA 4U7IA 3ZT5A 3CKDA 3Q7AA 5FQ6A 5F3JA 3SF4A 2H88A 1N0QA 5A1LA 2VSOE 3UKRG 1NAFA 1OXJA 2AXUA 3KSLA 5KXJA 2YDRA 4A97A 2CG2A 2VSXE 1Z5SC 3ZGQA 4KBMB 1TN6A 1D0XA 1UGOA 2KBXA 5FQ7A 4RSYA 2AWIA 1EZ3A 4OYSA 3L82A 3JQ0A 3RRWA 5FIOA 4EBAG 4CZZB 4GCOA 2XSAA 2XJ7A 3FZLB 2BS3A 5AJLA 5ENSD 2X66A 3AEFA 4U72A 4LMKA 2DYSE 2KCKA 3DPYA 3PS6A 1OCZE 3OYXA 2XSBA 4BT8A 5BPPA 3QKYA 1WDYA 3ZMTB 3ZCJA 5BXUA 4J2CA 1ELRA 3C98B 1LD7A 2C0SA 3NBXX 3PUVF 3ZUVB 3J9X1 3VU7H 3RU0A 3GW4A 5EK4A 1E8YA 2V6XA 1ZBPA 2G0UA 4YSYA 3UT8A 3R6NA 4GB9A 4EZ4A 4ATZD 4WBOA 2H7OA 2XASB 5ENQD 1QLBA 2NYJA 3E0ZA 4AKLA 4E85A 3BQIA 1A5EA 2V4HC 3R7QA 4L7TA 3GWHA 2CXFA 4O4IE 4GZ5A 3ZHEA 4QXHB 5L3BB 4RLYA 2XUEA 1TNYA 3I4RB 3L8RA 1BR2A 3GN5B 1FIOA 1RZ4A 2EHOD 4HFIA 4HS2A 4U8YD 3JAFA 2R2LA 5FXVA 2VL0A 1LTXA 3Q9DA 4DJAA 4M3OA 4JEUB 2BG9E 4JBWF 5BT1A 3UUBA 3CR3A 2WXKA 3RIFA 4DK5A 1TJCA 5DJQC 3I3NA 4GYWA 2XGOA 2XY8B 4WYVA 2J62A 4GMLA 4HBDA 4NPPA 2E9XD 3TG5A 4YTPA 4A98A 4CQIA 4UWKA 1O1SA 2B0OE 2NOXA 3ANWB 3TWXA 2LT3A 3UUXA 3ZKRA 3ZC0A 2XAQB 4GK5E 2VGYA 3N2KE 3L22A 3U78A 3ZW3A 5FMNA 4LERA 4O60A 5ENNA 4EYYR 4PJJA 4YY3T 4AQGA 4CI2B 1TNUA 3FUNA 5LB7B 5FXXA 4A3TA 4AM9A 4HWDA 3MA9A 2V1DB 1W0AA 3VTXA 2KM4A 3V2OA 3ZLIA 3RYHE 3OXFA 3ZEFB 1KK7A 1LRZA 2LKGA 3QWWA 2ZM6T 2XEHA 2QYUA 3X1DA 4WBNE 1AJ3A 4G8KA 3CVWA 2FI7A 1AP7A 2CHZA 3BUAA 2OV9A 4X1IE 2B6CA 1T98A 4OYKA 5DQWA 2DZNA 5EK3A 3MGBA 1MX6A 3J5QB 3ZHEB 3FTUA 2DWGA 4Q94A 5CMWA 3AS4A 4UWGA 3PH0C 1S70B 4ZS3A 3RRCA 4APOA 1N95A 4G63A 1FJGT 1S64A 3TWQA 2A5UA 3CHQA 2IMLA 4IN3B 1HG5A 3JXJA 2GRQB 5CB4E 2W61A 4UF0B 4KVOA 4J8YA 1SZ9A 5C2TA 4J8DA 3PUZF 1ELKA 2Y6XA 2BBHA 1MMNA 4DV2T 3HIZA 4HWHA 4DR5T 3NAWA 2MBGA 2CBIA 3B7RL 3Q2MA 4U7EB 3HHMA 3EJNA 4TN7B 4AI6A 3CHOA 1HFAA 3JAEA 3FUMA 3UINC 2E2EA 3QWVA 3TLVA 5FNVE 3NBNB 3ZSSA 5HXCA 2JMKA 4LRZA 3D9LA 4GZ3A 3LY9A 4GA2A 4DX1A 2W2UA 3VTYA 3TGOA 3SFEA 3AEAA 4HLLA 1MMGA 2QFCA 3OBVE 1ZHCA 1D8EA 2OVFA 3T1YT 4PJLA 4P0BA 3L9TA 4L0RA 3PTRB 3MZLB 5LCWC 3AA0B 3LFMA 5FY1A 4CXWA 3LDZA 3RQUA 4IULA 4U2ZA 3F6QA 3U3IA 2UY1B 5L2LA 2BBJA 1H6KA 3AAAB 3S7BA 2UXCT 4BETA 4GYYA 3RYIE 3URZA 1LVFA 1SHZC 3HXBA 3SBTB 5FY7A 4G26A 2WSSV 4LNGA 2PNNA 4QH1A 4IE7A 5KMGP 4DX7D 5AQQB 1JWGA 3RPUA 2WXGA 5E75A 1NENA 2A72A 3ZRHA 3IHRA 2CXLA 2D0UA 3P2BA 3PURA 2PQNA 2CHXA 2V5FA 3LBXB 4ACKA 1Z0PA 4LSZE 3LG7A 4CI1B 5BV1A 5C1DA 5F5WA 2C5IT 3PNLB 3DEPA 2FUPA 2WS3A 4CZ2D 1SZAA 4UELA 5ADXL 5L47A 3NRXA 4I4TE 2XCBA 3X2QE 4KP3C 2D9DA 4CDRA 4DR6T 3IEGA 3OJAA 1N52A 2R02A 3FTSA 3RIUC 3ZFWA 2GRLA 4DLQA 3KDSE 3FH7A 4XZ4A 3ZT6A 4HWFA 5GONE 4J7WA 3PEVB 4A1SA 1K8KG 3E37A 4CGWA 2NWBA 1SQMA 4PH4B 2RPAA 4LUNU 1Q2ZA 1UN9A 4CCAA 2DHRA 3C4XA 4GZ6A 1N9AA 4GTMA 3E32A 2R6GF 1FCHA 4GA0A 5AN8A 4DR7T 4U3CA 1N33T 2A9UA 1MHQA 4U74A 4I55E 2X6KA 2P9LG 3S2AA 3E08A 5AQHB 3ENEA 2ETBA 4F6RC 3UQ7A 3QB2A 2ODUA 5JVDE 2YU1A 3UMVA 2LSVA 2NW8A 2GW1A 4IL9A 4TWHA 1E8XA 1VRBA 2P9KG 4GYSA 1UW4B 2XQ8A 5AQVB 2AW6A 2XEVA 2IW5B 4AKRB 1FPPA 1NA0A 3WXXA 5AQ7A 2WY2A 4ANUA 4HE8A 5C8YE 1IKND 5HI7A 5HEJA 4JD2G 4CDMA 3D9OA 2XPZA 1NZNA 3MEKA 2LHRA 1IQUA 1VOMA 3PE0A 4AIUA 3KEZA 4U0SA 3PUSA 3CWZB 4HGAA 3HXDA 3Q5XA 3PUKA 4PJMA 5EK2A 3FTYA 1ZU2A 4PFOA 3LBXA 3AE3A 2LNIA 3RIUA 1GQEA 3L3PA 2PZIA 3NOGD 4FC8A 1HS6A 4XIFA 5KNHD 3UKUG 2I0MA 1OCOE 2YINA 3ZYMA 1OT8A 5CGMA 1E90A 5JDFA 3C5RA 3PE3A 2GGFA 3ESLA 4G24A 4Y6WA 3AEDA 2JQKA 3ULQA 4DI3A 3PDYA 2DLRA 2WXFA 4AY5A 3C3RA 1E8ZA 2NSZA 4ZS2A 3N9OA 3ZPOA 1V9DA 4WWPA 2VTBA 4QH4A 2V8SE 5L3GB 1WM5A 5FL1A 2HPJA 2XM1A 2CMRA 3CHRA 4F1PA 4Q96A 1DU2A 2Y4TA 3RRMB 2CA5A 4OYJA 2UUAT 2QYJA 2A3DA 2VGEA 3ULEG 2BKOA 1XNQT 3KS2A 2HH7A 3CX6B 3UM3A 1CHUA 3I0QA 3EIQC 3O1IA 4LMJA 5A7DB 4U31A 4AJWA 3LY8A 1E7VA 5LHHB 2QA7A 4KMCA 4IE6A 4DV0T 2EQXA 2OV8A 3Q5WA 3UT4A 4U0ZA 4XKBA 4DR1T 5EIDA 3UI2A 2IJGX 2X9YA 3K8PC 4UIGA 1M7KA 4B89A 1D1BA 4G25A 1WG0A 4GTQA 4JPSA 1LKXA 4GTRA 2NXPA 4WNGA 4GTVA 3MKDA 3PZ4A 4Y6CA 1OCCE 2IOLA 3JXIA 5J2UE 5B3SE 2KXPB 4HTEA 5CJ5A 3AJIA 2DWZA 3EUHA 3Q5MA 5G2NA 3RJVA 2W4XA 3O1JA 4U7YA 4X5TA 1MMAA 2L8KA 2GRNB 5T8IA 4M7CA 4B0ZA 1HH8A 5JHBA 2X0LB 2X68A 3LPZA 4UUCA 3BG1B 1FMVA 4AV7A 5KJMA 5JDGA 3ANWA 1W09A 3SY2A 3AS5A 1PC2A 4JI3T 1BD8A 2XQ4A 4JI4T 2VL8A 5LXTE 2X0HA 4FHKA 2WP9A 4X66T 2E9XB 2X0YA 4X1KE 3MV3B 4O6FA 4UVCB 5AAOA 2FEZA 3Q15A 1SA0E 4H9QC 3VKHA 1VCTA 4N3CA 2P9BA 1OEDB 3IF8B 4G8LA 1HXIA 3UQ3A 2WZIA 4N39A 3ZCIA 3EHNA 2PTFA 4O2AE 5D2MC 3ULYA 3MJWA 2YQ8A 2QY7A 4HRMB 2Q9QB 2LHNA 2CXDA 5KJKA 3IKOB 5J0ZA 2VKOA 4UI9K 2RKKA 1UCUA 3LDQB 2PM7A 4K0RA 4X8QA 3AE5A 3BU8A 5LBQB 4TXQA 3DJBA 3KINB 3SBSA 1BU9A 4MHCA 2EIJE 2VJ8A 2AE9A 3AEEA 1K1AA 1XMOT 4FLHA 2LXMA 3SFXA 2PBIA 3ABKE 1VCSA 4TX5A 2D2SA 3TWRA 5FZQA 3PRZA 1JCQA 1ZB1A 3TWWA 4I6EA 2ETAA 4KZ0A 4KX6A 2JABA 2WDVA 1S0PA 4CN6A 2YHCA 2XQYA 3VRAA 5JQGE 3G2WA 5HEOA 3VR9A 2XAGB 1UK5A 3RRUA 2IUBA 2B76A 4MKTA 5CMYA 4HNAD 5JREA 3K3QC 4JLEA 3IXEA 4EV6A 4IDPA 3AS8A 5D66A 4BTBA 3MK7C 4DNDA 1MIYA 2ZM2A 4YJ3E 2H7VC 1OEDA 4NACA 2IC6A 2LRLA 1TR4A 4EZHA 4O2BE 3Q5EA 3KV9A 5HKPA 5KX5E 4XX5A 2GK9A 5CA1E 5ABFA 3CK9A 1XNRT 3TLTA 1H2UA 2CHOA 3LJ3A 4WAFA 3PZDA 4J0UA 2L6BA 4EEDA 1MNEA 3UM2A 2EHOA 2VYIA 2J47A 4YTNA 4BESA 4N2QA 3AE4A 2VK9A 2K5BB 3UX4A 4ISTA 2XPIA 4IDOA 2XRZA 4I1MA 3AAEB 1WLXA 2IAKA 3L17A 3FXDB 3SO8A 4HLEA 3Q4AB 3CK8A 4EQFA 3I4GA 3UXGA 2DVWA 4J8SA 4AQYT 3UU5A 3PUGA 4QKNA 3SRZA 1WFDA 4O8SA 1UOHA 5CRUA 2WPVA 2RFAA 3ZU7B 4A3VA 3T8MA 4ZI2C 2IIUA 1H0AA 3C64A 2FBNA 5IHYA 1E2AA 3H3MA 2F8YA 5E76A 2P9NG 4NIKA 2X6JA 1IZNB 2IQCA 4NXNT 3FTZA 1SUMB 4LF9T 2YDQA 3V31A 5IWAT 3TKLB 1UJJA 3T8OA 1HZ4A 2X6HA 2J49A 2V5QC 2LSKA 4XEIG 5JH7E 3JCFA 3N71A 4IL4A 4A63B 4BX8A 2ES0A 4G2VA 3QOUA 2H6FA 4FP7A 5EX0A 4UWLA 1IBLT 3RQWA 3LYAA 4JEHA 3VR8A 2C0LA 2BKGA 2R05A 4GKJT 3I9WA 3JADA 4GYRA 5LGTB 3MACA 3D0TA 5BW8C 1Y8MA 3A7MA 1JCSA 4LNUD 3B7SA 2N2NA 4U0UA 2Q9QC 5LX8A 3PDNA 1P5QA 3CHMA 4U95D 3C72A 4QXBB 5JDLA 2ONDA 3PE4A 4P1NA 4LF4T 3IHYA 3ZIMA 4I9EA 3CVLA 2PJQA 1ZKEA 3EUVA 3PUJA 2M67A 3UT5E 3PUYF 4YNDA 1DC2A 4TNVA 1OWNA 3RKVA 3QWPA 3ZKJA 4MRUA 1N0RA 5JDNA 1U4QA 2HPLA 5KDMC 4GIWA 5HCMA 5ABFB 4DX2A 1MNDA 3C98A 1BPOA 2M6BA 4DX6D 5JJ6A 1NA3A 3MKRA 4ANJA 3SFZA 5AENA 1KNZA 3TLSA 2K24A 4KZCA 4BT9A 5LA6E 3CKCA 3VRBA 4ADZA 3P7IA 4HFBA 2RG8A 4CYMD 3JYSA 3PUQA 4H63H 2CEAA 4AIFA 4UI9J 4KBQA 5ARGA 1E96B 4LCTA 2CFZA 4UQYA 1IJ5A 3PJAJ 4IREA 3AE9A 1FT2A 3RH3A 5EKQD 1KNRA 1G73A 4MBQA 3APCA 4I9CA 1UX5A 3F57A 3ZVVA 3GN5A 4A1GA 4LF5T 3ZT7A 3P1UA 3V5SA 2BKNA 3SS1A 2NW7A 2BVMA 4IGUA 1XWMA 3AEBA 3SI5A 2YN6A 3QAQA 1HCIA 5KJNA 4B3RT 2C5JA 4JI6T 3KV4A 1HG2A 4HQDA 4I0UA 5KBAA 3DSSA 1NWMX 1HX8A 1MIWA 1QQEA 1OWOA 5A6CA 3FH5A 3FU0A 2KCVA 3UPVA 4HORA 4JYAT 4AOFA 4K0UA 4DUZT 3RYFE 2LLYA 2VSYA 4E6HA 1U3CA 3F2EA 3CQXC 3N9QA 4HI9A 4EECA 2KATA 3AA1B 2F8XK 5G05C 5BR8T 2WXLA 4OVVA 4OAUC 2KWIB 4H9NC 4IE5A 3E34A 5FVLA 2WXIA 3GZ1A 2I1KA 2FJDA 1FVFA 1TN8A 2A5EA 1O3XA 2BS2A 4EZJA 4GCNA 2NTYA 2AVPA 1QYMA 1HF8A 3PU8A 3N2OA 3TL5A 3UTMA 1NEKA 1BR0A 2LSGA 4R7LA 1GW6A 4JZYA 2NW9A 3ZMUB 4U63A 2EHOB 4YDWA 3AE1A 2R59A 4DUIA 2KZTB 2CFUA 2YHEA 4GTOA 4GK0E 3E22E 4AKIA 5EYLA 4TWDA 1HS7A 3ESKA 5L3FB 2OEVA 3RIBA 4ILCA 1D0YA 3FUDA 3CIRA 3Q7FA 3PJAA 1IJ6A 4K5CA 1N11A 4BTAA 3I9YA 4E7ZA 2ZISA 2WU2A 1SW6A 1QNFA 1Z3XA 3AG4E 3EHQA 2HN1A 2XGSA 5LOVE 4OHFA 3M65A 2LM9A 4L23A 3NKZA 2V6YB 3AA6B 3B7BA 3UU8A 4HRNA 3SQVA 1W9RA 2XPYA 3CVPA 5FVKA 2BS4A 2W66A 3OTOT 5CCMA 1X9BA 4JHJA 5CERB 3WAKA 2WXRA 4YSXA 5IYZE 4TV9E 5L4HA 2FBWA 3CQCB 1K1BA 2J9QA 3TLWA 3FDHA 3C50A 4FJOA 1N4QA 5AQFB 2HO1A 2Y8DA 4FA6A 4H9OC 2OCCE 2GROB 3HXCA 4Z91A 3HRAA 1HNZT 2A2FX 3I5PA 2I1JA 3RLFF 3L09A 4YTMA 3PNTB 1SE7A 4L2YA 3LKUA 2J4GA 5HWXA 4IT4A 2WDRA 3J7Yq 4DBRA 4P29A 2E9XC 3N9NA 2XAJB 4OAVB 4V1Av 3FWVA 3ML8A 4RG6A 2J09A 3RSEG 4WW0A 2P2CP 4DLOA 3TWSA 2CHWA 4JEUA 1X81A 2KXPC 4MFRA 2V7MA 3EHMA 3C3OA 2CBJA 1MIVA 2V8SV 1XMQT 5JJTA 1E7PA 3KBTA 2F0YA 1EF1C 4HWIB 5AQTB 4GMJA 5LCWJ 1JCRA 4NURA 3FFLA 1X5BA 4QX7B 4EHMA 1WCRA 2BTDA 2H6IA 5T4YA 5AQOB 3O4ZA 2VGXB 1A17A 4ZI3D 3HDXA 4TRQA 3UT7A 2IONA 2RP4A 3D9NA 3HKCE 2BZBA 3FBZA 4F3VA 2MOWA 1WRDA 4G2AA 2ZGGA 5JDQA 2CLYC 4DRXE 2JLBA 4PFPA 4U8VD 4BSXA 3LCAA 4PJNA 4CXYA 3ZNGA 3CLJA 2M6IA 4KT6B 3FUIA 4EBAA 5BNWA 1UX4A 1KZOA 4YDYA 3SOLA 2JQQA 3BEEA 3CPZA 3KV6A 3DSXA 5FINA 5ITZF 5LG3A 3ZN3A 2WXHA 2OEWA 5CECB 4IE0A 4ANWA 4K5BA 1FT1A 3FU3A 2V5DA 1N54A 3Q78A 3AE6A 3RYCE 3M3ZB 4WNDA 2RFMA 3FU5A 3U64A 5AQGB 4AQFC 1HTJF 4ZHBA 1IXVA 1NP7A 1XDPA 2KLQA 1J1JA 5HXSA 1E8WA 2IC9A 4M1PA 3ABME 4ZFHA 2EIME 4QH5A 4BJNA 1YCSB 4NUVA 2VSNA 4C91A 3R9AB 4FJYA 3QB5A 3WG7E 4F7AA 2X51A 2QVAA 5HWYA 3DSWA 1SA5A 4GAAA 4DO0A 5FY0A 5LMNT 2FJAA 1OEDE 1QSDA 2B1EA 3EVYA 2DYRE 1K3ZD 4B93B 4FHJA 2QYWA 3RRNB 3F31A 3C51A 3CVRA 5KWDA 3J5PA 5LHIB 3D9MA 3P4PA 2J8SD 3PU3A 2I6HA 2P58C 3CEQA 4RVBA 3S4UA 4CT4A 3V5UA 2FO7A 4IYPA 3FUJA 3B95A 4C0EA 3O48A 1D0ZA 4H9RC 4DUYT 2WWUA 3CVQA 5FKYA 4JV5T 3U66A 3LJNA 2UWJG 2DCPA 1X79A 4YDOA 3OPCA 2WXQA 3JCKC 4ERRA 2R03A 4CDNA 3W15B 2DI4A 2MRIA 5HRYA 2M63A 3E30A 3O4XE 4X64T 2MHKA 3D9HA 4QHOA 3DXMG 2WQYA 2E0IA 4XI9A 4DMWA 1D9SA 1W3BA 5EX3A 2V6YA 2IHR1 4COFA 2IY0C 2JPFA 1Y01A 3T1HT 4WNKA 5LJNA 4FULA 4EGWA 3UU4A 2HM8A 3CVNA 3KVBA 3LVRE 5M72A 1QBQA 3N9PA 1NFIE 2JIWA 1I6ZA 4F6RD 2VVNA 2J07A 4U2YA 3LVQE 4N3BA 2W0GA 5J90A 2FF4A 3R9MA 2NTXA 3DRAA 4N2SA 2N9DA 3AE7A 2ZXWE 4G23A 2UU9T 4C90A 3FBLA 4UQZA 2YNQA 2L0TB 3FTVA 5AQLB 4OVUA 4U07A 4ZI2D 3FZHB 1MQSA 5ABHA 1BR1A 1MYOA 1UN8A 3FUHA 4TV8E 1IHGA 1Y64B 2ILRA 2KT9A 2DL1A 4G1TA 3N9LA 2UXNB 1KF6A 1ZEEA 4ZEYA 3VKGA 4F53A 4DR3T 3ZPJA 2WVIA 1S94A 4K0KT 5JA4D 3MJXA 1D1AA 1WR6A 4EYUA 5KJLA 4Q69A 3WI3A 3ZMSB 4JA7A 3W9GA 2V0PA 4LFAT 1FVHA 5HEGA 1U5PA 2WB5A 3CHPA 1O5MA 5HEUA 5ENTD 2W67A 4HFDA 4ISSA 4WWOA 3KAEA 1S35A 2J08A 3R7RA 3JC6D 5JDMA 3AA7B 2H6HA 5FL0A 1N4PA 2BKKB 1JUQA 4JB8P 2HHHT 4XBFB 4LF7T 5D0OD 2W00A 2IEJA 2J4BA 2YU2A 4DPRA 4BERA 4E7SA 3B7UX 5AFUL 2Q9QA 3A8YC 3L16A 5FXZA 1XNFA 2LE8A 2VKDA 3QNKA 2LRKA 5LG4A 4O1PA 2CCQA 3BQLA 2PM6A 3TWVA 4IDNA 3EDTB 4HOUA 1XZYA 2VQFT 2E5VA 5LOZA 2IF4A 1U2VG 1XGWA 2LSUA 1WR0A 4YT0A 5LHGB 4G11A 4YVQC 2MAWA 3APDA 3P4RA 4IHJE 4HFEA 3ZJ2A 4I43A 1YW0A 1H6OA 2XHEA 5HYAA 3H3AA 1TNZA 4ILIA 3HVEA 3SD5A 2BVLA 3CX7B 3CX8B 4CN1A 3O9XA 2KWHA 2YDSA 1MX2A 2IO2C 2J4DA 5DIZA 1QUUA 4UF0A 5C3JA 3ABLE 3L13A 3CVYA 3RHWA 3IV0A 2QRXA 4EEBA 4P0AA 3DWLG 4ILGA 3RF1A 2KCLA 4JVSA 4CRWA 4HRLA 2KC7A 2WXJA 3FHEA 3NVOA 3FUKA 3DPDA 3EIJA 3P8CD 4PNIA 3GZ2A 4HB5A 3FZKB 3A5XA 3U3WA 3AE2A 4WNEA 3FB2A 3TXMA 4B8CB 2E8IA 3S7DA 2XM2A 1M62A 4AEZC 4NQ0A 2YEVC 4KHZF 5CEAA 1TJFA 2H6GA 3LXUX 1Y6IA 1YKHB 2NP9A 1DNPA 3LK3B 4YDEA 1I94T 4F8HA 4N3AA 2F4VT 3VLDA 3NZPA 4O1OA 4A5XA 4QWNB 4YLHA 4B8AA 4ANXA 2C2LA 1WAO1 3LEWA 3PREA 2UUCT 4DV6T 2EILE 4ANVA 1JNRA 5AQRB 3T9KA 4EOZB 1W0BA 2I2OA 2WXOA 3IBEA 3UM0A 4BEPA 3AU4A 2XAFB 4ZOLE 3JUEA 2IOSA 5AQPB 4I17A 3QARA 4K5AB 2W63A 3PUXF 4TUYE 2LAIA 4HN9A 3ASOE 3B7TA 4GU5A 5JDHA 4I1AA 2C5KT 4B3ST 2OLTA 1DCEA 3D9IA 3CVVA 3EDVA 2MTQA 3BQKA 4HKAA 1ELWA 2LSIA 4PAGA 1OWPA 2Y3AA 4XI0A 2X6IA 3P4WA 1MMDA 2Y69E 5E0OA 3P4SA 5H6RB 5JRCB 2XZEA 3LK42 4I6GA 4N5QA 1UJKA 4DV5T 2ZM8A 2I59A 2AXDS 4QX8B 3FZMB 5AQIB 2LO6A 4TXRA 4IRUA 2VVSA 2J1DG 3HYMB 2C0MA 3CVUA 3RO3A 2DNXA 2LXLA 3ASFA 4H7YA 2PFVA 3IHVA 4APFA 1KNPA 2YKSA 1U3DA 3HG0D 3SFDA 3TWUA 5ARFA 5AQMB 2BG9A 2ZM0A 4IDZA 5L3CB 4P09A 1H6PA 4CI3B 1AWCB 3S7FA 3TWTA 4JI2T 3GZSA 3SHFA 4MALA 4Z90A 4I1OB 2BF0X 3CKBA 5ABEA 3RIAA 3Q49B 3U9WA 4HFHA 3UUNA 1N36T 4F1SA 1US7B 3IA3A 5AQNB 2F37A 2P9PG 1H2TC 2XQ9A 5AQUB 2UXXB 3G2VA 3AAIA 3LK2B 3GA8A 3AVSA 3ONLA 3AE8A 3UM1A 2SPCA 3R84B 3OTNA 3V2XA 2VB6A 3JUIA 3UIPC 2ODVA 2KNDA 2WM9A 3CK6A 4L2LA 4J6IA 3N5LA 4DV1T 2ZLYA 5FTPA 3ABVA 2V5CA 4DBQA 2LSJA 1V54E 3UULA 1OUVA 3JQ1A 2DWKA 2OVBA 3T5VA 3RAUA 2AXZA 3ASHA 1L5JA 5ANLA 3N9MA 2RA1A 4ZXLA 2LOSA 5BMVE 2L9BA 1KT1A 1N32T 3ZJ1A 2MOZA 3RC3A 3C4WA 1ZV4X 3FHNA 2LEHA 4ZZBA 4YVOA 4UVBB 2XZTG 2VKJA 3ZYQA 2VTBB 1IYGA 4PS8A 2Q9QD 4MLPA 1B7TA 3ZYLA 3RX6A 3TJPA 2ACXA 3D9KA 3ZYKA 3NQPA 1PAQA 3ASDA 3FP3A 4HOQA 2VQET 3MX3A 4TXPA 5J1GA 4U8HA 3B5MA 3VHLA 3ETUA 4N5CA 3RKOA 1INZA 4GOUA 4ZHQE 5B1BE 3L39A 2UY1A 2N1GA 5F8PA 1UURA 1WYCA 2LM2A 4JI7T 3OAWA 3PV0F 3SGHA 3Q9NC 5FXWA 2XQ6A 3PZ3A 4AISA 2VURA 3QUJA 2CLYB 2XGMA 4U96D 1JPLA 3E4BA 2P9SG 4YSZA 5ABGA 2FULA 4UEMA 2WXPA 4N78D 4GKKT 2IO3C 2XCCA 2XQAA 2WU5A 1NI1A 2WXNA 1YKEB 3MKQA 5EZYE 2EINE 4X20E 5BV0A 4AP2A 4ILUA 3NB2A 2Y1LE 4JI5T 2E9XA
chains in the Genus database with same CATH topology
2VKHA 4K03A 3KBUA 3QC9A 4FADA 4XE0A 3MXZA 3U4TA 1DVPA 2YK0A 3D9JA 4YFSA 4GZCA 1FMWA 4GYOA 2PQRA 3CMLA 4V3IA 2PL2A 3HA4A 3UTKA 4LEUA 5JR9B 4KVMA 5AJDA 2WQ6A 4EPZA 3I0OA 1TEZA 3HI2A 4EAHA 3DP7A 2R5SA 3VLFA 4C9BB 2X6FA 4TV3A 3G2UA 2JMHA 4H63V 4UV9B 4D10C 2L9QA 3FH8A 3NF1A 5L3DB 3CSFA 3FXEB 5G04C 3KVAA 2CWOA 1OWMA 3IEEA 2D0TA 2JRKA 1WYBA 5CA0E 2X3MA 2K9AA 4O4HE 3CQGB 3DBSA 5JHAA 3CGHA 3TAXA 5JJ7A 1VDYA 3FY4A 4OFZA 4U04A 3GMIA 4KMOA 5AYWD 2DBAA 2X9XA 5C2YA 3ONKA 3LY7A 1LF8A 5HXEA 4FI5A 3ETVA 3DTOA 1PY1A 4BA9A 4GA1A 3RK6A 5LJMA 3FTXA 5CHEE 3AU5A 3L08A 2OA5A 4ACLA 4EB6E 5LBMA 3QJZA 5BUZA 5LYJE 4EXTA 3ONXA 4B6XA 3LS8A 1JWFA 3FULA 5FQ4A 2XHEB 2RD0A 5ETWA 3OKQA 3RO2A 3TXNA 4H7XA 3JC6C 4UWHA 4ASKA 4JXTA 3MA5A 4EZLA 2X9WA 4CT0A 4JHRA 3L54A 4CGVA 2LSYA 3FEYA 1OWAA 1KT0A 3OXGA 2XAHB 5HQ8A 2V7LA 1HE8A 5LNKA 5HXHA 5T3RA 3ZN0B 5D0QD 5L3EB 4WNFA 4EIWA 2OOEA 1E1HB 2CE7A 3MCXA 4PS7A 4GPKA 4KYOB 5JR9C 3FEXA 2Q7FA 5FP3A 4JL0A 2VWAA 2HR2A 3K3OA 5LP6E 1KLXA 5DBKA 3KFWX 2WMOA 2LJLA 1H2VC 4X1YE 4PW8A 4A56A 3PUAA 3G2SA 5FQ8A 5LGUB 3KD7A 1OXZA 4JEHB 3L6AA 4WUYA 1D1CA 4HFGA 4XAXB 2LAHA 4AVXA 2X38A 2ZMAA 4JUYA 5G55A 1IQRA 1E7UA 1Z6TA 4QXCB 4FU3A 3CVXA 3H37A 4YHJA 3MYVA 2EHOC 3NZUA 2V4LA 3ML9A 5KCMA 3FUFA 3BG0B 3UUXB 1FEWA 3SWHA 3QK0A 3C4ZA 5H6QB 4H9SE 3CK7A 3D9PA 2VQ2A 5DABA 5JR9A 5AIJA 3FU6A 5LGNB 2Y48B 3I1AA 3WAJA 3CSTA 4CEMA 4RG9A 4UXNB 4TZ4C 4DMVA 4ZI7E 4AXHA 2LOPA 2R17C 1EDUA 3SNXA 4ABNA 4DVDA 4XZCA 4AQFA 2BDEA 1BR4A 2MYSA 2AXVA 4BJMA 4UVAB 3ZEFA 4I43B 4PUCA 2QGSA 5M4YA 2CG3A 4B94A 3QC1A 2K48A 4UV8B 3LJCA 1HU3A 5HXRA 4AKHA 2V7KA 2A4ZA 2GRMA 4ILHB 4W9RA 2XTLA 3ASGA 1EYHA 2CWYA 3UFEA 2BUGA 1WY6A 4BFRA 1YD8G 3HL6A 4IE4A 2L6JA 4JC8A 4HFVA 3K9IA 1CUNA 4JW1A 3FTWA 4UWFA 4J8FA 2WB2A 3MKQB 5FZSA 3NZQA 2KZ7B 4O4JE 3PVLA 3BK9A 3SZ7A 2VASA 4J8EA 4OK0A 2D5UA 4MLKA 3UUMA 4L9IA 4CXXA 2KZTA 3ZC1A 1EPUA 3VLEA 3N2GE 4NUUA 3MV2B 4ATGA 3ZMZB 4BX9A 5J08A 3NRYA 5FZRA 4PK6A 2XQ0A 4WWNA 2IU1A 4KXKB 2HYZA 4HOTA 2H3RA 2NC9A 4A55A 1H7CA 3OYZA 4PS3A 4C0MA 1OWLA 3CIAA 4FJZA 1UG3A 2L3LA 2KINB 4BWRA 3HVEB 4QFVA 1H19A 4URKA 2XRYA 3APFA 4PDXA 2JEKA 3G2TA 3RC8A 1HO8A 5LP0A 3GYZA 5HAXA 4H9PC 3T5XA 3B57A 4BAYB 4XKCA 2JJ9A 4MS6A 5FJYA 5DQVA 4HEAA 2Z6EA 3IBPA 4JHKA 5CCLA 2I9CA 5EDSA 4ME2A 4HVBA 5J2TE 3ZMVB 4I6JA 3ZXSA 4BY6A 2CM0A 2WXMA 2V7IA 4HXIA 3O1HA 3EDUA 3B13A 3HR0A 2W62A 4KUMB 2ZU6B 3NZSA 1IAPA 3QK6A 2DIWA 4L5GA 5FWQA 3PEUB 3TG4A 1G8XA 4AKGA 3HKBE 4AY6A 2WMNA 5G05J 4JA9A 4IIJE 4DI4A 4O4LE 2X67A 3S7JA 1Z3YA 4UQXA 2WBLA 4EZKA 1YA0A 3MZKB 2X9HA 3D3MA 2PG8A 4TUUA 3CV0A 3KV5A 5G04J 2Y4UA 4I2WA 1B89A 2L0IA 2VGXA 5FT9A 2WQHA 5LFAA 1LVKA 3K3NA 1QZ2A 3AVRA 4YJ2E 3AB3B 3Q47B 4HOSA 5JRCA 3FUEA 5TAOA 5A23A 2KMFA 2WAUA 4FLBA 2DCFA 2V26A 4NRHB 3OXLA 3QDNA 3CHSA 5ANRA 4Z8XA 4ZI3C 3HKEE 4UI9C 3HKDE 5LCYA 2IFUA 3ZN1B 5FYMA 4I50E 4GZDA 2V7JA 4I2ZA 2WQ7A 4PK5A 4PK4A 4AXPA 3CKDA 5FQ6A 5F3JA 3SF4A 5A1LA 2VSOE 1NAFA 2AXUA 2VSXE 2CG2A 3ZGQA 4KBMB 1D0XA 5FQ7A 4RSYA 2AWIA 1EZ3A 4OYSA 3JQ0A 3RRWA 4EBAG 4CZZB 4GCOA 5AJLA 2X66A 4U72A 2KCKA 3PS6A 3OYXA 4BT8A 5BPPA 3QKYA 3ZMTB 3ZCJA 4J2CA 1ELRA 3C98B 2C0SA 3NBXX 3J9X1 3VU7H 3RU0A 3GW4A 5EK4A 1E8YA 1ZBPA 2G0UA 3UT8A 3R6NA 4GB9A 4EZ4A 4WBOA 2H7OA 2XASB 3E0ZA 4AKLA 4E85A 3BQIA 3R7QA 4L7TA 3GWHA 2CXFA 4O4IE 4GZ5A 3ZHEA 4QXHB 5L3BB 2XUEA 3I4RB 1BR2A 3GN5B 1FIOA 2EHOD 4HS2A 5FXVA 3Q9DA 4DJAA 4M3OA 4JEUB 5BT1A 3CR3A 2WXKA 4DK5A 1TJCA 5DJQC 3I3NA 4GYWA 2XGOA 4GMLA 2E9XD 3TG5A 4CQIA 4UWKA 2NOXA 3ANWB 3UUXA 2LT3A 3ZC0A 2XAQB 4GK5E 2VGYA 3N2KE 3L22A 3U78A 3ZW3A 5FMNA 4LERA 5ENNA 4EYYR 4PJJA 4AQGA 4CI2B 3FUNA 5FXXA 4A3TA 4AM9A 3MA9A 2V1DB 3VTXA 2KM4A 3ZLIA 3RYHE 3OXFA 3ZEFB 1KK7A 1LRZA 3QWWA 4WBNE 1AJ3A 3CVWA 2FI7A 2CHZA 4X1IE 1T98A 4OYKA 5DQWA 5EK3A 3MGBA 3ZHEB 3FTUA 2DWGA 4Q94A 5CMWA 3AS4A 4UWGA 3PH0C 4ZS3A 3RRCA 4APOA 4G63A 2A5UA 3CHQA 4IN3B 1HG5A 5CB4E 2W61A 4UF0B 4KVOA 1SZ9A 4J8DA 1ELKA 2Y6XA 1MMNA 3HIZA 2MBGA 3B7RL 3Q2MA 3HHMA 3EJNA 4TN7B 4AI6A 3CHOA 1HFAA 3FUMA 2E2EA 3QWVA 5FNVE 5HXCA 2JMKA 4LRZA 3D9LA 4GZ3A 3LY9A 4GA2A 3VTYA 3TGOA 1MMGA 2QFCA 3OBVE 1ZHCA 2OVFA 4PJLA 4P0BA 4L0RA 3PTRB 3MZLB 5LCWC 3AA0B 3LFMA 5FY1A 4CXWA 3LDZA 4IULA 3U3IA 2UY1B 5L2LA 1H6KA 3AAAB 3S7BA 4GYYA 3RYIE 3URZA 1LVFA 1SHZC 3SBTB 5FY7A 4G26A 2WSSV 4IE7A 5KMGP 1JWGA 3RPUA 2WXGA 5E75A 2A72A 3ZRHA 3IHRA 2CXLA 2D0UA 3P2BA 3PURA 2PQNA 2CHXA 2V5FA 3LBXB 4ACKA 1Z0PA 3LG7A 4CI1B 5BV1A 5C1DA 2C5IT 3PNLB 1SZAA 4UELA 5ADXL 3NRXA 4I4TE 2XCBA 4KP3C 4CDRA 3IEGA 3OJAA 1N52A 3FTSA 3ZFWA 2GRLA 4DLQA 3KDSE 3FH7A 4XZ4A 5GONE 3PEVB 4A1SA 4CGWA 2NWBA 1SQMA 4PH4B 4LUNU 1UN9A 4CCAA 2DHRA 3C4XA 4GZ6A 1FCHA 4GA0A 1MHQA 4U74A 4I55E 2X6KA 3S2AA 3E08A 3ENEA 4F6RC 3QB2A 2ODUA 5JVDE 2YU1A 3UMVA 2LSVA 2NW8A 2GW1A 1E8XA 1VRBA 4GYSA 1UW4B 2XEVA 2AW6A 2IW5B 4AKRB 3WXXA 1NA0A 4ANUA 4HE8A 5C8YE 5HI7A 4CDMA 3D9OA 2XPZA 1NZNA 3MEKA 2LHRA 1IQUA 1VOMA 3PE0A 3KEZA 4U0SA 3PUSA 3CWZB 4HGAA 3Q5XA 3PUKA 4PJMA 5EK2A 3FTYA 1ZU2A 4PFOA 3LBXA 2LNIA 4FC8A 3L3PA 2PZIA 4XIFA 1HS6A 2YINA 3ZYMA 1E90A 5JDFA 3PE3A 2GGFA 3ESLA 4G24A 4Y6WA 3ULQA 4DI3A 3PDYA 2DLRA 2WXFA 4AY5A 1E8ZA 2NSZA 4ZS2A 3N9OA 3ZPOA 1V9DA 4WWPA 2VTBA 2V8SE 5L3GB 1WM5A 2HPJA 2CMRA 3CHRA 4Q96A 2Y4TA 3RRMB 2CA5A 4OYJA 2A3DA 3KS2A 2HH7A 3CX6B 3I0QA 3EIQC 3O1IA 5A7DB 4AJWA 3LY8A 1E7VA 5LHHB 2QA7A 4KMCA 4IE6A 2EQXA 2OV8A 3Q5WA 3UT4A 4U0ZA 4XKBA 2IJGX 2X9YA 3K8PC 4UIGA 4B89A 1D1BA 4G25A 4JPSA 1LKXA 2NXPA 4WNGA 3MKDA 4Y6CA 2IOLA 5J2UE 2KXPB 4HTEA 3EUHA 3Q5MA 5G2NA 3RJVA 3O1JA 5T8IA 1MMAA 2L8KA 4B0ZA 1HH8A 5JHBA 2X0LB 2X68A 3LPZA 3BG1B 1FMVA 4AV7A 5KJMA 5JDGA 3ANWA 3AS5A 1PC2A 2VL8A 5LXTE 4FHKA 2E9XB 4X1KE 3MV3B 4O6FA 4UVCB 2FEZA 3Q15A 1SA0E 4H9QC 3VKHA 4N3CA 2P9BA 3IF8B 1HXIA 3UQ3A 4N39A 3ZCIA 3EHNA 4O2AE 3MJWA 2YQ8A 2QY7A 2Q9QB 2LHNA 2CXDA 5KJKA 3IKOB 4UI9K 2VKOA 1UCUA 2PM7A 4K0RA 5LBQB 3DJBA 3KINB 3SBSA 4MHCA 2VJ8A 4FLHA 2PBIA 4TX5A 2D2SA 5FZQA 3PRZA 4I6EA 4KZ0A 1S0PA 2YHCA 2XQYA 5JQGE 3G2WA 2XAGB 3RRUA 4MKTA 5CMYA 5JREA 3K3QC 4JLEA 3AS8A 4BTBA 3MK7C 4DNDA 1MIYA 2ZM2A 4YJ3E 2H7VC 4NACA 2IC6A 4EZHA 4O2BE 3KV9A 5KX5E 4XX5A 2GK9A 5CA1E 3CK9A 1H2UA 3LJ3A 4WAFA 3PZDA 4J0UA 1MNEA 2EHOA 2VYIA 4N2QA 2VK9A 2K5BB 3UX4A 4ISTA 2XPIA 2XRZA 4I1MA 3AAEB 1WLXA 2IAKA 3L17A 3FXDB 4HLEA 3Q4AB 3CK8A 4EQFA 3I4GA 4J8SA 3PUGA 4QKNA 3SRZA 4O8SA 2WPVA 4A3VA 3T8MA 4ZI2C 1H0AA 3C64A 2FBNA 5IHYA 5E76A 2X6JA 1IZNB 2IQCA 3FTZA 1UJJA 3TKLB 2X6HA 3T8OA 1HZ4A 2J49A 2LSKA 5JH7E 3N71A 4BX8A 2ES0A 4G2VA 3QOUA 4FP7A 5EX0A 4UWLA 3LYAA 4JEHA 2C0LA 3I9WA 4GYRA 5LGTB 3MACA 3D0TA 5BW8C 1Y8MA 3B7SA 2N2NA 4U0UA 2Q9QC 5LX8A 3PDNA 1P5QA 3CHMA 4QXBB 5JDLA 2ONDA 3PE4A 3IHYA 3ZIMA 4I9EA 3CVLA 2PJQA 1ZKEA 3PUJA 2M67A 3UT5E 4YNDA 1OWNA 3RKVA 3QWPA 4MRUA 5JDNA 1U4QA 2HPLA 5KDMC 4GIWA 1MNDA 3C98A 1BPOA 5JJ6A 1NA3A 3MKRA 4ANJA 3SFZA 5AENA 1KNZA 2K24A 4KZCA 4BT9A 5LA6E 3CKCA 4ADZA 3P7IA 2RG8A 3JYSA 3PUQA 4H63H 2CEAA 4AIFA 4UI9J 4KBQA 5ARGA 1E96B 4LCTA 2CFZA 4UQYA 1IJ5A 3RH3A 5EKQD 1G73A 4MBQA 4I9CA 3APCA 1UX5A 3F57A 3ZVVA 3GN5A 4A1GA 3P1UA 3V5SA 3SS1A 2NW7A 2BVMA 4IGUA 3SI5A 3QAQA 1HCIA 5KJNA 2C5JA 3KV4A 1HG2A 1NWMX 1HX8A 1MIWA 1QQEA 1OWOA 5A6CA 3FH5A 3FU0A 2KCVA 3UPVA 4HORA 4AOFA 4K0UA 3RYFE 2VSYA 4E6HA 1U3CA 3F2EA 3CQXC 3N9QA 4EECA 2KATA 3AA1B 5G05C 2WXLA 4OVVA 2KWIB 4H9NC 4IE5A 3GZ1A 2WXIA 2I1KA 1FVFA 1O3XA 4EZJA 4GCNA 2NTYA 2AVPA 1HF8A 3PU8A 3N2OA 3TL5A 1BR0A 2LSGA 4R7LA 1GW6A 4JZYA 2NW9A 3ZMUB 4U63A 2EHOB 2R59A 2KZTB 2CFUA 2YHEA 4GK0E 3E22E 4AKIA 1HS7A 3ESKA 5L3FB 3RIBA 1D0YA 3FUDA 1IJ6A 4BTAA 3I9YA 4E7ZA 1Z3XA 1QNFA 2XGSA 5LOVE 4OHFA 3M65A 2LM9A 4L23A 3AA6B 2XPYA 3CVPA 5CCMA 4JHJA 3WAKA 2WXRA 5IYZE 4TV9E 3CQCB 2J9QA 3FDHA 3C50A 4FJOA 2HO1A 2Y8DA 4FA6A 4H9OC 2A2FX 3I5PA 2I1JA 3L09A 3PNTB 4L2YA 3LKUA 5HWXA 3J7Yq 4DBRA 4P29A 2E9XC 3N9NA 2XAJB 4V1Av 3FWVA 3ML8A 4RG6A 2J09A 4WW0A 4DLOA 2CHWA 4JEUA 4MFRA 2V7MA 3EHMA 1MIVA 5JJTA 3KBTA 1EF1C 4GMJA 5LCWJ 4NURA 3FFLA 1X5BA 4QX7B 2BTDA 5T4YA 3O4ZA 2VGXB 1A17A 4ZI3D 3HDXA 4TRQA 3UT7A 2IONA 2RP4A 3D9NA 3HKCE 2BZBA 3FBZA 4F3VA 2MOWA 1WRDA 4G2AA 5JDQA 2CLYC 2JLBA 4PFPA 4BSXA 3LCAA 4PJNA 4CXYA 3CLJA 4KT6B 3FUIA 4EBAA 5BNWA 1UX4A 3SOLA 2JQQA 3BEEA 3CPZA 3KV6A 3ZN3A 2WXHA 4IE0A 4ANWA 3FU3A 1N54A 3RYCE 4WNDA 3FU5A 3U64A 4AQFC 1HTJF 1NP7A 2KLQA 5HXSA 1E8WA 2IC9A 4M1PA 4BJNA 4NUVA 2VSNA 4C91A 3R9AB 4FJYA 4F7AA 2X51A 5HWYA 4GAAA 4DO0A 5FY0A 1QSDA 2B1EA 3EVYA 4FHJA 3RRNB 3F31A 3C51A 3CVRA 5LHIB 3D9MA 3PU3A 2I6HA 2P58C 3CEQA 4RVBA 3S4UA 4CT4A 4IYPA 3V5UA 2FO7A 3FUJA 4C0EA 3O48A 1D0ZA 4H9RC 2WWUA 3CVQA 3U66A 2UWJG 2DCPA 1X79A 2WXQA 3JCKC 4ERRA 4CDNA 3W15B 2DI4A 2MRIA 2M63A 3O4XE 2MHKA 4QHOA 2E0IA 4XI9A 4DMWA 1W3BA 5EX3A 2JPFA 4WNKA 5LJNA 4FULA 2HM8A 3CVNA 3KVBA 3LVRE 5M72A 3N9PA 2J07A 3LVQE 4N3BA 2W0GA 5J90A 2FF4A 2NTXA 4N2SA 2N9DA 4G23A 4C90A 3FBLA 4UQZA 2YNQA 2L0TB 3FTVA 4OVUA 4U07A 4ZI2D 1MQSA 1BR1A 1UN8A 3FUHA 4TV8E 1IHGA 1Y64B 2ILRA 2KT9A 4G1TA 3N9LA 2UXNB 1ZEEA 3VKGA 4F53A 3ZPJA 2WVIA 1S94A 3MJXA 1D1AA 1WR6A 4EYUA 5KJLA 4Q69A 3WI3A 3ZMSB 4JA7A 2V0PA 1FVHA 1U5PA 3CHPA 4ISSA 4WWOA 3KAEA 1S35A 2J08A 3R7RA 3JC6D 5JDMA 3AA7B 1JUQA 4XBFB 5D0OD 2W00A 2J4BA 2YU2A 4DPRA 4E7SA 3B7UX 5AFUL 2Q9QA 3L16A 5FXZA 1XNFA 2LE8A 2VKDA 3QNKA 5LG4A 2CCQA 3BQLA 2PM6A 3EDTB 4HOUA 5LOZA 2IF4A 1XGWA 2LSUA 5LHGB 4G11A 4YVQC 3APDA 4IHJE 3ZJ2A 4I43A 1YW0A 2XHEA 5HYAA 3H3AA 4ILIA 3HVEA 3SD5A 2BVLA 3CX7B 3CX8B 3O9XA 2KWHA 5DIZA 2J4DA 1QUUA 4UF0A 3L13A 3CVYA 3IV0A 4P0AA 4ILGA 2KCLA 4JVSA 4CRWA 2KC7A 2WXJA 3FHEA 3FUKA 3DPDA 3EIJA 3P8CD 4PNIA 3GZ2A 3A5XA 3U3WA 4WNEA 3FB2A 3TXMA 4B8CB 2E8IA 3S7DA 4AEZC 4NQ0A 2YEVC 1TJFA 3LXUX 1Y6IA 1YKHB 2NP9A 3LK3B 1DNPA 4N3AA 3VLDA 3NZPA 4QWNB 4YLHA 4B8AA 4ANXA 2C2LA 1WAO1 3LEWA 3PREA 4ANVA 4EOZB 2I2OA 2WXOA 3IBEA 3AU4A 2XAFB 4ZOLE 2IOSA 4I17A 3QARA 2W63A 4TUYE 2LAIA 4HN9A 3B7TA 4GU5A 5JDHA 4I1AA 2C5KT 3D9IA 3CVVA 3EDVA 2MTQA 3BQKA 4HKAA 1ELWA 2LSIA 4PAGA 1OWPA 2Y3AA 4XI0A 2X6IA 1MMDA 5E0OA 5H6RB 5JRCB 3LK42 4I6GA 1UJKA 2ZM8A 2I59A 4QX8B 2LO6A 4IRUA 2J1DG 3HYMB 2C0MA 3CVUA 3RO3A 2DNXA 3ASFA 4H7YA 2PFVA 3IHVA 4APFA 1U3DA 5ARFA 2ZM0A 4IDZA 5L3CB 4P09A 4CI3B 3S7FA 3SHFA 3GZSA 4MALA 4I1OB 2BF0X 3CKBA 3Q49B 3U9WA 3UUNA 4F1SA 1US7B 1H2TC 2UXXB 3G2VA 3AAIA 3LK2B 3GA8A 3AVSA 3ONLA 2SPCA 3R84B 3OTNA 2VB6A 3JUIA 2ODVA 2KNDA 2WM9A 4L2LA 4J6IA 3N5LA 2ZLYA 5FTPA 4DBQA 2LSJA 3UULA 1OUVA 3JQ1A 2DWKA 2OVBA 3T5VA 2AXZA 3ASHA 1L5JA 5ANLA 3N9MA 2RA1A 5BMVE 2LOSA 2L9BA 1KT1A 3ZJ1A 2MOZA 3RC3A 3C4WA 1ZV4X 3FHNA 2LEHA 4YVOA 4UVBB 2VKJA 3ZYQA 2VTBB 1IYGA 4PS8A 2Q9QD 4MLPA 1B7TA 3ZYLA 3RX6A 3TJPA 2ACXA 3D9KA 3ZYKA 3NQPA 1PAQA 3ASDA 3FP3A 4HOQA 3MX3A 5J1GA 4U8HA 3VHLA 3ETUA 4N5CA 3RKOA 1INZA 4GOUA 4ZHQE 2UY1A 2N1GA 5F8PA 1WYCA 3OAWA 3SGHA 5FXWA 3QUJA 2CLYB 2XGMA 1JPLA 3E4BA 2WXPA 2FULA 4UEMA 4N78D 2XCCA 2WXNA 1YKEB 3MKQA 5EZYE 4X20E 5BV0A 4AP2A 4ILUA 4L1BA 2E9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WM9 A;  2YIN A;  3B13 A;  2WMO A;  2WMN A;  3VHL A; 
#chains in the Genus database with same CATH topology
 2MYO A;  1MX4 A;  5AQS B;  2VKH A;  3DEO A;  3KBU A;  4K03 A;  3QC9 A;  2YOE A;  4FAD A;  4XE0 A;  3MXZ A;  3U4T A;  1DVP A;  2YK0 A;  3D9J A;  4YFS A;  4GZC A;  1FMW A;  2QC9 A;  1IBM T;  3KEA A;  4GYO A;  2PQR A;  1KZP A;  1BI8 B;  3CML A;  5ENR D;  4V3I A;  5CED B;  2PL2 A;  3HA4 A;  3UTK A;  4LEU A;  5JR9 B;  4KVM A;  4WZX A;  2ETC A;  5AJD A;  4LML A;  5EN5 D;  2WQ6 A;  1J5W A;  4EPZ A;  3DXK G;  3I0O A;  1TEZ A;  3HI2 A;  4EAH A;  1TYQ G;  3DP7 A;  2R5S A;  3VLF A;  4C9B B;  2X6F A;  4LFB T;  5HCJ A;  4IDQ A;  4TV3 A;  1T72 A;  3FZF B;  1RW2 A;  3G2U A;  2JMH A;  2E2A A;  4H63 V;  4UV9 B;  4D10 C;  3RKG A;  5H7P A;  2XS8 A;  3PZ1 A;  2L9Q A;  3FH8 A;  3NF1 A;  5L3D B;  1V55 E;  5EIB E;  3CSF A;  3FXE B;  4TNW A;  5G04 C;  3KVA A;  4U33 A;  3EI0 A;  2CWO A;  1OWM A;  3IEE A;  3QB5 K;  2D0T A;  3AG3 E;  2JRK A;  4JI0 T;  1WYB A;  5CA0 E;  1SA4 A;  2X3M A;  2K9A A;  4O4H E;  3CQG B;  1MZC A;  3DBS A;  5JHA A;  3CGH A;  3TAX A;  5JJ7 A;  1VDY A;  3FY4 A;  4OFZ A;  4U04 A;  3GMI A;  3ONJ A;  5ENP D;  4KMO A;  1OED C;  5AYW D;  2DBA A;  2X9X A;  5C2Y A;  3OVU A;  4OX9 T;  1MJ0 A;  5AAR A;  3ONK A;  3LY7 A;  1LF8 A;  5HXE A;  2BG9 C;  1L0V A;  3KSQ A;  2XEE A;  4L9P A;  4FI5 A;  3ETV A;  3Q75 A;  3DTO A;  1PY1 A;  4BA9 A;  2CRB A;  4GA1 A;  4LNB A;  5LJM A;  3RK6 A;  3FTX A;  1S63 A;  5CHE E;  2CPT A;  3AU5 A;  3L08 A;  2OA5 A;  4DID B;  4ACL A;  4KI0 F;  4EB6 E;  5LBM A;  3QJZ A;  5BUZ A;  5LYJ E;  4EXT A;  2QZA A;  3ONX A;  3AEG A;  2LKH A;  4B6X A;  3LS8 A;  4BSZ B;  1JWF A;  3FUL A;  5FQ4 A;  1J5E T;  2XHE B;  2RD0 A;  5ETW A;  3OKQ A;  3RO2 A;  2HN2 A;  3TXN A;  4H7X A;  1KPS B;  3JC6 C;  4UWH A;  4ASK A;  4JXT A;  3BQO A;  3MA5 A;  4EZL A;  4X62 T;  1N4R A;  2X9W A;  4CT0 A;  4JHR A;  2XQ5 A;  3L54 A;  1HNX T;  4ZZC A;  4CGV A;  2LSY A;  1BI7 B;  3FEY A;  1OWA A;  4LG6 A;  1KT0 A;  3OXG A;  2XAH B;  5HQ8 A;  2V7L A;  1HE8 A;  5LNK A;  1TNO A;  5HXH A;  3NWI A;  4KHP T;  4NXM T;  5JTG A;  4GPM A;  5T3R A;  3SFY A;  3ZN0 B;  1OCR E;  3AAA C;  5D0Q D;  5L3E B;  1N94 A;  4WNF A;  4EIW A;  2OOE A;  5JMN D;  5BXO A;  1E1H B;  2CE7 A;  4B3M T;  2JQH A;  2NR4 A;  3MCX A;  4GTP A;  4PS7 A;  4GPK A;  3EHZ A;  4KYO B;  5JR9 C;  1ZP0 A;  5CFB A;  3FEX A;  2Q7F A;  2XQ3 A;  4GTT A;  5FP3 A;  4JL0 A;  2VWA A;  2HR2 A;  3K3O A;  5LP6 E;  1KLX A;  5DBK A;  3KFW X;  2WMO A;  2LJL A;  1H2V C;  2UXD T;  4X1Y E;  3PUW F;  4CN4 A;  2FJE A;  4PW8 A;  1Z8U A;  3PUA A;  4A56 A;  3G2S A;  5FQ8 A;  5LGU B;  3C3Q A;  3KD7 A;  2WZH A;  1OXZ A;  3ZST A;  4JEH B;  2ACZ A;  2XEN A;  1LD8 A;  3EU9 A;  3L6A A;  4DR4 T;  2P9U G;  4WUY A;  1D1C A;  4HFG A;  1JNZ A;  4Z68 A;  4XAX B;  2LAH A;  3ZXP A;  2EIK E;  4AVX A;  2X38 A;  2ZMA A;  4JUY A;  5G55 A;  1IQR A;  1E7U A;  1Z6T A;  4QXC B;  4FU3 A;  3CVX A;  3H37 A;  4YHJ A;  3MYV A;  5AQ9 A;  2FO1 E;  2EHO C;  1KFY A;  3NZU A;  3PZ2 A;  2V4L A;  3ML9 A;  5KCM A;  3FUF A;  1N4S A;  3BG0 B;  3UUX B;  1FEW A;  3SWH A;  3TLU A;  3QK0 A;  3C4Z A;  3Q73 A;  5H6Q B;  1YMP A;  3UIO C;  1YYH A;  4H9S E;  3HXE A;  3CK7 A;  3D9P A;  2GRR B;  2VQ2 A;  5DAB A;  5JR9 A;  5AIJ A;  1KEY A;  3FU6 A;  5LGN B;  2Y48 B;  3V79 K;  5CBO A;  4HWC A;  3I1A A;  3WAJ A;  4LFC T;  3CST A;  4CEM A;  4RG9 A;  4UXN B;  1DCQ A;  4TZ4 C;  1N34 T;  4DMV A;  2XQ7 A;  4ZI7 E;  2UXB T;  4AXH A;  4YHH T;  2BG9 B;  2LOP A;  2R17 C;  1EDU A;  3SNX A;  4ABN A;  4X65 T;  4DVD A;  3UU3 A;  3ISM C;  4XZC A;  4AQF A;  3AG1 E;  2BDE A;  1BR4 A;  3UQ4 A;  2MYS A;  2AXV A;  5EYP F;  3G06 A;  4BJM A;  4UVA B;  3ZEF A;  4I43 B;  4DV7 T;  1IHB A;  4PUC A;  2QGS A;  5M4Y A;  4ILB A;  2CG3 A;  1YQ3 A;  3QC1 A;  4B94 A;  1HX1 B;  3AEC A;  3EU5 A;  2WDQ A;  2K48 A;  4UV8 B;  4HI8 A;  3LJC A;  1HU3 A;  5HXR A;  4L1B A;  4AKH A;  2V7K A;  2A4Z A;  2GRM A;  2ZGD A;  4ILH B;  4W9R A;  4NIQ A;  2XTL A;  3ASG A;  1EYH A;  2CWY A;  4MBG A;  3HXF A;  3UFE A;  2BUG A;  1WY6 A;  4LF6 T;  4BFR A;  1HR0 T;  1YD8 G;  3HL6 A;  4IE4 A;  2IDO B;  2L6J A;  4JC8 A;  3RGL A;  4HFV A;  3K9I A;  1CUN A;  4JW1 A;  3FTW A;  4UWF A;  3DSU A;  3EHR A;  4J8F A;  5L4E A;  2E5L T;  5HEH A;  2WB2 A;  3MKQ B;  4DV4 T;  4GMR A;  5FZS A;  3NZQ A;  3QNU A;  2KZ7 B;  1O1R A;  4O4J E;  3PVL A;  5LMU T;  3BK9 A;  3SZ7 A;  2VAS A;  4J8E A;  4OK0 A;  2D5U A;  4MLK A;  3UUM A;  4L9I A;  4CXX A;  5AQJ B;  2KZT A;  5AQK B;  1HNW T;  3DSV A;  2BKP A;  4UR9 A;  3EAM A;  3ZC1 A;  1EPU A;  3VLE A;  3N2G E;  1T8B A;  2UUB T;  4NUU A;  3MV2 B;  4ATG A;  5CRV A;  3ZMZ B;  2K3W A;  4YXD A;  4GTS A;  4BX9 A;  5J08 A;  3NRY A;  5FZR A;  4ILA A;  2FJB A;  1YQ4 A;  4PK6 A;  2XQ0 A;  3Q5D A;  4WWN A;  2IU1 A;  4KXK B;  2WWV A;  3K1S A;  2HYZ A;  3EAB A;  1NL4 A;  5IY5 E;  5IUX A;  4HOT A;  2H3R A;  1T7S A;  2NC9 A;  4TWF A;  4A55 A;  1H7C A;  3OYZ A;  4PS3 A;  4C0M A;  1OWL A;  3CIA A;  4FJZ A;  1UG3 A;  3LSV A;  4C48 B;  2L3L A;  2KIN B;  5B1A E;  1OY3 D;  4BWR A;  2JQ9 A;  3HVE B;  3W9F A;  4QFV A;  1H19 A;  4URK A;  1ZOY A;  2XRY A;  3APF A;  4PDX A;  3ASN E;  2JEK A;  3G2T A;  3RC8 A;  1HO8 A;  3ONL C;  1YXR A;  5LP0 A;  4DR2 T;  5HAX A;  3GYZ A;  4H9P C;  3AXJ B;  1D8D A;  3T5X A;  3B57 A;  1IBK T;  4BAY B;  4XKC A;  2JJ9 A;  3UFG A;  2MPK A;  4MS6 A;  5FJY A;  5DQV A;  4HEA A;  2Z6E A;  3IBP A;  4JHK A;  4RQI A;  5CCL A;  2DZO A;  4Q25 A;  2I9C A;  4ME2 A;  5EDS A;  4HVB A;  3P4Q A;  5J2T E;  5KNG A;  3ZMV B;  3E33 A;  4I6J A;  3ZXS A;  1G3N B;  3NOC D;  4BY6 A;  2CM0 A;  3T8K A;  2XPK A;  3Q79 A;  2WXM A;  2V7I A;  4HXI A;  3O1H A;  3EDU A;  3B13 A;  3HR0 A;  2W62 A;  4KUM B;  2ZU6 B;  3NZS A;  3UU6 A;  1IAP A;  3QK6 A;  1O1T A;  4L5G A;  2DIW A;  5FWQ A;  2XS1 A;  3PEU B;  5HS0 A;  2GRP B;  3TG4 A;  2ZIR A;  1G8X A;  4AKG A;  1TNB A;  3HKB E;  4AY6 A;  2WMN A;  5G05 J;  2HE0 A;  2XZD G;  4JA9 A;  2P9I G;  4IIJ E;  4DI4 A;  4O4L E;  2X67 A;  3S7J A;  1Z3Y A;  4UQX A;  4JI1 T;  2WBL A;  4EZK A;  1YA0 A;  3MZK B;  2LUH A;  2X9H A;  1XDO A;  3D3M A;  2H89 A;  2PG8 A;  4TUU A;  2AJA A;  3CV0 A;  3KV5 A;  2Y0B G;  5G04 J;  2Y4U A;  4I2W A;  1B89 A;  4QQI A;  2L0I A;  2VGX A;  5FT9 A;  4LF8 T;  2WQH A;  5LFA A;  2BED A;  1LVK A;  5AQB A;  3K3N A;  1TN7 A;  3AXJ A;  1QZ2 A;  3AVR A;  4YJ2 E;  3AB3 B;  3Q47 B;  4HOS A;  5JRC A;  3FUE A;  5TAO A;  3QOF A;  3Q9U C;  3P50 A;  4DV3 T;  4B3T T;  5A23 A;  1BLX B;  5EIL A;  1SVX A;  2KMF A;  4HFC A;  3RI5 A;  4TUM A;  2CHN A;  2WAU A;  4FLB A;  2DCF A;  5ENO D;  2V26 A;  4NRH B;  3OXL A;  5AQA A;  3QDN A;  3CHS A;  5ANR A;  5CBN A;  1R8I A;  4Z8X A;  4ZI3 C;  3HKE E;  4UI9 C;  3HKD E;  5LCY A;  2IFU A;  3V30 A;  2WCA A;  1UUS A;  3ZN1 B;  5FYM A;  4DX5 D;  4JI8 T;  4I50 E;  3AG2 E;  2V7J A;  4GZD A;  4I2Z A;  2WQ7 A;  3DST A;  4PK5 A;  4PK4 A;  4AXP A;  2KSR A;  4U7I A;  3ZT5 A;  3CKD A;  3Q7A A;  5FQ6 A;  5F3J A;  3SF4 A;  2H88 A;  1N0Q A;  5A1L A;  2VSO E;  3UKR G;  1NAF A;  1OXJ A;  2AXU A;  3KSL A;  5KXJ A;  2YDR A;  4A97 A;  2CG2 A;  2VSX E;  1Z5S C;  3ZGQ A;  4KBM B;  1TN6 A;  1D0X A;  1UGO A;  2KBX A;  5FQ7 A;  4RSY A;  2AWI A;  1EZ3 A;  4OYS A;  3L82 A;  3JQ0 A;  3RRW A;  5FIO A;  4EBA G;  4CZZ B;  4GCO A;  2XSA A;  2XJ7 A;  3FZL B;  2BS3 A;  5AJL A;  5ENS D;  2X66 A;  3AEF A;  4U72 A;  4LMK A;  2DYS E;  2KCK A;  3DPY A;  3PS6 A;  1OCZ E;  3OYX A;  2XSB A;  4BT8 A;  5BPP A;  3QKY A;  1WDY A;  3ZMT B;  3ZCJ A;  5BXU A;  4J2C A;  1ELR A;  3C98 B;  1LD7 A;  2C0S A;  3NBX X;  3PUV F;  3ZUV B;  3J9X 1;  3VU7 H;  3RU0 A;  3GW4 A;  5EK4 A;  1E8Y A;  2V6X A;  1ZBP A;  2G0U A;  4YSY A;  3UT8 A;  3R6N A;  4GB9 A;  4EZ4 A;  4ATZ D;  4WBO A;  2H7O A;  2XAS B;  5ENQ D;  1QLB A;  2NYJ A;  3E0Z A;  4AKL A;  4E85 A;  3BQI A;  1A5E A;  2V4H C;  3R7Q A;  4L7T A;  3GWH A;  2CXF A;  4O4I E;  4GZ5 A;  3ZHE A;  4QXH B;  5L3B B;  4RLY A;  2XUE A;  1TNY A;  3I4R B;  3L8R A;  1BR2 A;  3GN5 B;  1FIO A;  1RZ4 A;  2EHO D;  4HFI A;  4HS2 A;  4U8Y D;  3JAF A;  2R2L A;  5FXV A;  2VL0 A;  1LTX A;  3Q9D A;  4DJA A;  4M3O A;  4JEU B;  2BG9 E;  4JBW F;  5BT1 A;  3UUB A;  3CR3 A;  2WXK A;  3RIF A;  4DK5 A;  1TJC A;  5DJQ C;  3I3N A;  4GYW A;  2XGO A;  2XY8 B;  4WYV A;  2J62 A;  4GML A;  4HBD A;  4NPP A;  2E9X D;  3TG5 A;  4YTP A;  4A98 A;  4CQI A;  4UWK A;  1O1S A;  2B0O E;  2NOX A;  3ANW B;  3TWX A;  2LT3 A;  3UUX A;  3ZKR A;  3ZC0 A;  2XAQ B;  4GK5 E;  2VGY A;  3N2K E;  3L22 A;  3U78 A;  3ZW3 A;  5FMN A;  4LER A;  4O60 A;  5ENN A;  4EYY R;  4PJJ A;  4YY3 T;  4AQG A;  4CI2 B;  1TNU A;  3FUN A;  5LB7 B;  5FXX A;  4A3T A;  4AM9 A;  4HWD A;  3MA9 A;  2V1D B;  1W0A A;  3VTX A;  2KM4 A;  3V2O A;  3ZLI A;  3RYH E;  3OXF A;  3ZEF B;  1KK7 A;  1LRZ A;  2LKG A;  3QWW A;  2ZM6 T;  2XEH A;  2QYU A;  3X1D A;  4WBN E;  1AJ3 A;  4G8K A;  3CVW A;  2FI7 A;  1AP7 A;  2CHZ A;  3BUA A;  2OV9 A;  4X1I E;  2B6C A;  1T98 A;  4OYK A;  5DQW A;  2DZN A;  5EK3 A;  3MGB A;  1MX6 A;  3J5Q B;  3ZHE B;  3FTU A;  2DWG A;  4Q94 A;  5CMW A;  3AS4 A;  4UWG A;  3PH0 C;  1S70 B;  4ZS3 A;  3RRC A;  4APO A;  1N95 A;  4G63 A;  1FJG T;  1S64 A;  3TWQ A;  2A5U A;  3CHQ A;  2IML A;  4IN3 B;  1HG5 A;  3JXJ A;  2GRQ B;  5CB4 E;  2W61 A;  4UF0 B;  4KVO A;  4J8Y A;  1SZ9 A;  5C2T A;  4J8D A;  3PUZ F;  1ELK A;  2Y6X A;  2BBH A;  1MMN A;  4DV2 T;  3HIZ A;  4HWH A;  4DR5 T;  3NAW A;  2MBG A;  2CBI A;  3B7R L;  3Q2M A;  4U7E B;  3HHM A;  3EJN A;  4TN7 B;  4AI6 A;  3CHO A;  1HFA A;  3JAE A;  3FUM A;  3UIN C;  2E2E A;  3QWV A;  3TLV A;  5FNV E;  3NBN B;  3ZSS A;  5HXC A;  2JMK A;  4LRZ A;  3D9L A;  4GZ3 A;  3LY9 A;  4GA2 A;  4DX1 A;  2W2U A;  3VTY A;  3TGO A;  3SFE A;  3AEA A;  4HLL A;  1MMG A;  2QFC A;  3OBV E;  1ZHC A;  1D8E A;  2OVF A;  3T1Y T;  4PJL A;  4P0B A;  3L9T A;  4L0R A;  3PTR B;  3MZL B;  5LCW C;  3AA0 B;  3LFM A;  5FY1 A;  4CXW A;  3LDZ A;  3RQU A;  4IUL A;  4U2Z A;  3F6Q A;  3U3I A;  2UY1 B;  5L2L A;  2BBJ A;  1H6K A;  3AAA B;  3S7B A;  2UXC T;  4BET A;  4GYY A;  3RYI E;  3URZ A;  1LVF A;  1SHZ C;  3HXB A;  3SBT B;  5FY7 A;  4G26 A;  2WSS V;  4LNG A;  2PNN A;  4QH1 A;  4IE7 A;  5KMG P;  4DX7 D;  5AQQ B;  1JWG A;  3RPU A;  2WXG A;  5E75 A;  1NEN A;  2A72 A;  3ZRH A;  3IHR A;  2CXL A;  2D0U A;  3P2B A;  3PUR A;  2PQN A;  2CHX A;  2V5F A;  3LBX B;  4ACK A;  1Z0P A;  4LSZ E;  3LG7 A;  4CI1 B;  5BV1 A;  5C1D A;  5F5W A;  2C5I T;  3PNL B;  3DEP A;  2FUP A;  2WS3 A;  4CZ2 D;  1SZA A;  4UEL A;  5ADX L;  5L47 A;  3NRX A;  4I4T E;  2XCB A;  3X2Q E;  4KP3 C;  2D9D A;  4CDR A;  4DR6 T;  3IEG A;  3OJA A;  1N52 A;  2R02 A;  3FTS A;  3RIU C;  3ZFW A;  2GRL A;  4DLQ A;  3KDS E;  3FH7 A;  4XZ4 A;  3ZT6 A;  4HWF A;  5GON E;  4J7W A;  3PEV B;  4A1S A;  1K8K G;  3E37 A;  4CGW A;  2NWB A;  1SQM A;  4PH4 B;  2RPA A;  4LUN U;  1Q2Z A;  1UN9 A;  4CCA A;  2DHR A;  3C4X A;  4GZ6 A;  1N9A A;  4GTM A;  3E32 A;  2R6G F;  1FCH A;  4GA0 A;  5AN8 A;  4DR7 T;  4U3C A;  1N33 T;  2A9U A;  1MHQ A;  4U74 A;  4I55 E;  2X6K A;  2P9L G;  3S2A A;  3E08 A;  5AQH B;  3ENE A;  2ETB A;  4F6R C;  3UQ7 A;  3QB2 A;  2ODU A;  5JVD E;  2YU1 A;  3UMV A;  2LSV A;  2NW8 A;  2GW1 A;  4IL9 A;  4TWH A;  1E8X A;  1VRB A;  2P9K G;  4GYS A;  1UW4 B;  2XQ8 A;  5AQV B;  2AW6 A;  2XEV A;  2IW5 B;  4AKR B;  1FPP A;  1NA0 A;  3WXX A;  5AQ7 A;  2WY2 A;  4ANU A;  4HE8 A;  5C8Y E;  1IKN D;  5HI7 A;  5HEJ A;  4JD2 G;  4CDM A;  3D9O A;  2XPZ A;  1NZN A;  3MEK A;  2LHR A;  1IQU A;  1VOM A;  3PE0 A;  4AIU A;  3KEZ A;  4U0S A;  3PUS A;  3CWZ B;  4HGA A;  3HXD A;  3Q5X A;  3PUK A;  4PJM A;  5EK2 A;  3FTY A;  1ZU2 A;  4PFO A;  3LBX A;  3AE3 A;  2LNI A;  3RIU A;  1GQE A;  3L3P A;  2PZI A;  3NOG D;  4FC8 A;  1HS6 A;  4XIF A;  5KNH D;  3UKU G;  2I0M A;  1OCO E;  2YIN A;  3ZYM A;  1OT8 A;  5CGM A;  1E90 A;  5JDF A;  3C5R A;  3PE3 A;  2GGF A;  3ESL A;  4G24 A;  4Y6W A;  3AED A;  2JQK A;  3ULQ A;  4DI3 A;  3PDY A;  2DLR A;  2WXF A;  4AY5 A;  3C3R A;  1E8Z A;  2NSZ A;  4ZS2 A;  3N9O A;  3ZPO A;  1V9D A;  4WWP A;  2VTB A;  4QH4 A;  2V8S E;  5L3G B;  1WM5 A;  5FL1 A;  2HPJ A;  2XM1 A;  2CMR A;  3CHR A;  4F1P A;  4Q96 A;  1DU2 A;  2Y4T A;  3RRM B;  2CA5 A;  4OYJ A;  2UUA T;  2QYJ A;  2A3D A;  2VGE A;  3ULE G;  2BKO A;  1XNQ T;  3KS2 A;  2HH7 A;  3CX6 B;  3UM3 A;  1CHU A;  3I0Q A;  3EIQ C;  3O1I A;  4LMJ A;  5A7D B;  4U31 A;  4AJW A;  3LY8 A;  1E7V A;  5LHH B;  2QA7 A;  4KMC A;  4IE6 A;  4DV0 T;  2EQX A;  2OV8 A;  3Q5W A;  3UT4 A;  4U0Z A;  4XKB A;  4DR1 T;  5EID A;  3UI2 A;  2IJG X;  2X9Y A;  3K8P C;  4UIG A;  1M7K A;  4B89 A;  1D1B A;  4G25 A;  1WG0 A;  4GTQ A;  4JPS A;  1LKX A;  4GTR A;  2NXP A;  4WNG A;  4GTV A;  3MKD A;  3PZ4 A;  4Y6C A;  1OCC E;  2IOL A;  3JXI A;  5J2U E;  5B3S E;  2KXP B;  4HTE A;  5CJ5 A;  3AJI A;  2DWZ A;  3EUH A;  3Q5M A;  5G2N A;  3RJV A;  2W4X A;  3O1J A;  4U7Y A;  4X5T A;  1MMA A;  2L8K A;  2GRN B;  5T8I A;  4M7C A;  4B0Z A;  1HH8 A;  5JHB A;  2X0L B;  2X68 A;  3LPZ A;  4UUC A;  3BG1 B;  1FMV A;  4AV7 A;  5KJM A;  5JDG A;  3ANW A;  1W09 A;  3SY2 A;  3AS5 A;  1PC2 A;  4JI3 T;  1BD8 A;  2XQ4 A;  4JI4 T;  2VL8 A;  5LXT E;  2X0H A;  4FHK A;  2WP9 A;  4X66 T;  2E9X B;  2X0Y A;  4X1K E;  3MV3 B;  4O6F A;  4UVC B;  5AAO A;  2FEZ A;  3Q15 A;  1SA0 E;  4H9Q C;  3VKH A;  1VCT A;  4N3C A;  2P9B A;  1OED B;  3IF8 B;  4G8L A;  1HXI A;  3UQ3 A;  2WZI A;  4N39 A;  3ZCI A;  3EHN A;  2PTF A;  4O2A E;  5D2M C;  3ULY A;  3MJW A;  2YQ8 A;  2QY7 A;  4HRM B;  2Q9Q B;  2LHN A;  2CXD A;  5KJK A;  3IKO B;  5J0Z A;  2VKO A;  4UI9 K;  2RKK A;  1UCU A;  3LDQ B;  2PM7 A;  4K0R A;  4X8Q A;  3AE5 A;  3BU8 A;  5LBQ B;  4TXQ A;  3DJB A;  3KIN B;  3SBS A;  1BU9 A;  4MHC A;  2EIJ E;  2VJ8 A;  2AE9 A;  3AEE A;  1K1A A;  1XMO T;  4FLH A;  2LXM A;  3SFX A;  2PBI A;  3ABK E;  1VCS A;  4TX5 A;  2D2S A;  3TWR A;  5FZQ A;  3PRZ A;  1JCQ A;  1ZB1 A;  3TWW A;  4I6E A;  2ETA A;  4KZ0 A;  4KX6 A;  2JAB A;  2WDV A;  1S0P A;  4CN6 A;  2YHC A;  2XQY A;  3VRA A;  5JQG E;  3G2W A;  5HEO A;  3VR9 A;  2XAG B;  1UK5 A;  3RRU A;  2IUB A;  2B76 A;  4MKT A;  5CMY A;  4HNA D;  5JRE A;  3K3Q C;  4JLE A;  3IXE A;  4EV6 A;  4IDP A;  3AS8 A;  5D66 A;  4BTB A;  3MK7 C;  4DND A;  1MIY A;  2ZM2 A;  4YJ3 E;  2H7V C;  1OED A;  4NAC A;  2IC6 A;  2LRL A;  1TR4 A;  4EZH A;  4O2B E;  3Q5E A;  3KV9 A;  5HKP A;  5KX5 E;  4XX5 A;  2GK9 A;  5CA1 E;  5ABF A;  3CK9 A;  1XNR T;  3TLT A;  1H2U A;  2CHO A;  3LJ3 A;  4WAF A;  3PZD A;  4J0U A;  2L6B A;  4EED A;  1MNE A;  3UM2 A;  2EHO A;  2VYI A;  2J47 A;  4YTN A;  4BES A;  4N2Q A;  3AE4 A;  2VK9 A;  2K5B B;  3UX4 A;  4IST A;  2XPI A;  4IDO A;  2XRZ A;  4I1M A;  3AAE B;  1WLX A;  2IAK A;  3L17 A;  3FXD B;  3SO8 A;  4HLE A;  3Q4A B;  3CK8 A;  4EQF A;  3I4G A;  3UXG A;  2DVW A;  4J8S A;  4AQY T;  3UU5 A;  3PUG A;  4QKN A;  3SRZ A;  1WFD A;  4O8S A;  1UOH A;  5CRU A;  2WPV A;  2RFA A;  3ZU7 B;  4A3V A;  3T8M A;  4ZI2 C;  2IIU A;  1H0A A;  3C64 A;  2FBN A;  5IHY A;  1E2A A;  3H3M A;  2F8Y A;  5E76 A;  2P9N G;  4NIK A;  2X6J A;  1IZN B;  2IQC A;  4NXN T;  3FTZ A;  1SUM B;  4LF9 T;  2YDQ A;  3V31 A;  5IWA T;  3TKL B;  1UJJ A;  3T8O A;  1HZ4 A;  2X6H A;  2J49 A;  2V5Q C;  2LSK A;  4XEI G;  5JH7 E;  3JCF A;  3N71 A;  4IL4 A;  4A63 B;  4BX8 A;  2ES0 A;  4G2V A;  3QOU A;  2H6F A;  4FP7 A;  5EX0 A;  4UWL A;  1IBL T;  3RQW A;  3LYA A;  4JEH A;  3VR8 A;  2C0L A;  2BKG A;  2R05 A;  4GKJ T;  3I9W A;  3JAD A;  4GYR A;  5LGT B;  3MAC A;  3D0T A;  5BW8 C;  1Y8M A;  3A7M A;  1JCS A;  4LNU D;  3B7S A;  2N2N A;  4U0U A;  2Q9Q C;  5LX8 A;  3PDN A;  1P5Q A;  3CHM A;  4U95 D;  3C72 A;  4QXB B;  5JDL A;  2OND A;  3PE4 A;  4P1N A;  4LF4 T;  3IHY A;  3ZIM A;  4I9E A;  3CVL A;  2PJQ A;  1ZKE A;  3EUV A;  3PUJ A;  2M67 A;  3UT5 E;  3PUY F;  4YND A;  1DC2 A;  4TNV A;  1OWN A;  3RKV A;  3QWP A;  3ZKJ A;  4MRU A;  1N0R A;  5JDN A;  1U4Q A;  2HPL A;  5KDM C;  4GIW A;  5HCM A;  5ABF B;  4DX2 A;  1MND A;  3C98 A;  1BPO A;  2M6B A;  4DX6 D;  5JJ6 A;  1NA3 A;  3MKR A;  4ANJ A;  3SFZ A;  5AEN A;  1KNZ A;  3TLS A;  2K24 A;  4KZC A;  4BT9 A;  5LA6 E;  3CKC A;  3VRB A;  4ADZ A;  3P7I A;  4HFB A;  2RG8 A;  4CYM D;  3JYS A;  3PUQ A;  4H63 H;  2CEA A;  4AIF A;  4UI9 J;  4KBQ A;  5ARG A;  1E96 B;  4LCT A;  2CFZ A;  4UQY A;  1IJ5 A;  3PJA J;  4IRE A;  3AE9 A;  1FT2 A;  3RH3 A;  5EKQ D;  1KNR A;  1G73 A;  4MBQ A;  3APC A;  4I9C A;  1UX5 A;  3F57 A;  3ZVV A;  3GN5 A;  4A1G A;  4LF5 T;  3ZT7 A;  3P1U A;  3V5S A;  2BKN A;  3SS1 A;  2NW7 A;  2BVM A;  4IGU A;  1XWM A;  3AEB A;  3SI5 A;  2YN6 A;  3QAQ A;  1HCI A;  5KJN A;  4B3R T;  2C5J A;  4JI6 T;  3KV4 A;  1HG2 A;  4HQD A;  4I0U A;  5KBA A;  3DSS A;  1NWM X;  1HX8 A;  1MIW A;  1QQE A;  1OWO A;  5A6C A;  3FH5 A;  3FU0 A;  2KCV A;  3UPV A;  4HOR A;  4JYA T;  4AOF A;  4K0U A;  4DUZ T;  3RYF E;  2LLY A;  2VSY A;  4E6H A;  1U3C A;  3F2E A;  3CQX C;  3N9Q A;  4HI9 A;  4EEC A;  2KAT A;  3AA1 B;  2F8X K;  5G05 C;  5BR8 T;  2WXL A;  4OVV A;  4OAU C;  2KWI B;  4H9N C;  4IE5 A;  3E34 A;  5FVL A;  2WXI A;  3GZ1 A;  2I1K A;  2FJD A;  1FVF A;  1TN8 A;  2A5E A;  1O3X A;  2BS2 A;  4EZJ A;  4GCN A;  2NTY A;  2AVP A;  1QYM A;  1HF8 A;  3PU8 A;  3N2O A;  3TL5 A;  3UTM A;  1NEK A;  1BR0 A;  2LSG A;  4R7L A;  1GW6 A;  4JZY A;  2NW9 A;  3ZMU B;  4U63 A;  2EHO B;  4YDW A;  3AE1 A;  2R59 A;  4DUI A;  2KZT B;  2CFU A;  2YHE A;  4GTO A;  4GK0 E;  3E22 E;  4AKI A;  5EYL A;  4TWD A;  1HS7 A;  3ESK A;  5L3F B;  2OEV A;  3RIB A;  4ILC A;  1D0Y A;  3FUD A;  3CIR A;  3Q7F A;  3PJA A;  1IJ6 A;  4K5C A;  1N11 A;  4BTA A;  3I9Y A;  4E7Z A;  2ZIS A;  2WU2 A;  1SW6 A;  1QNF A;  1Z3X A;  3AG4 E;  3EHQ A;  2HN1 A;  2XGS A;  5LOV E;  4OHF A;  3M65 A;  2LM9 A;  4L23 A;  3NKZ A;  2V6Y B;  3AA6 B;  3B7B A;  3UU8 A;  4HRN A;  3SQV A;  1W9R A;  2XPY A;  3CVP A;  5FVK A;  2BS4 A;  2W66 A;  3OTO T;  5CCM A;  1X9B A;  4JHJ A;  5CER B;  3WAK A;  2WXR A;  4YSX A;  5IYZ E;  4TV9 E;  5L4H A;  2FBW A;  3CQC B;  1K1B A;  2J9Q A;  3TLW A;  3FDH A;  3C50 A;  4FJO A;  1N4Q A;  5AQF B;  2HO1 A;  2Y8D A;  4FA6 A;  4H9O C;  2OCC E;  2GRO B;  3HXC A;  4Z91 A;  3HRA A;  1HNZ T;  2A2F X;  3I5P A;  2I1J A;  3RLF F;  3L09 A;  4YTM A;  3PNT B;  1SE7 A;  4L2Y A;  3LKU A;  2J4G A;  5HWX A;  4IT4 A;  2WDR A;  3J7Y q;  4DBR A;  4P29 A;  2E9X C;  3N9N A;  2XAJ B;  4OAV B;  4V1A v;  3FWV A;  3ML8 A;  4RG6 A;  2J09 A;  3RSE G;  4WW0 A;  2P2C P;  4DLO A;  3TWS A;  2CHW A;  4JEU A;  1X81 A;  2KXP C;  4MFR A;  2V7M A;  3EHM A;  3C3O A;  2CBJ A;  1MIV A;  2V8S V;  1XMQ T;  5JJT A;  1E7P A;  3KBT A;  2F0Y A;  1EF1 C;  4HWI B;  5AQT B;  4GMJ A;  5LCW J;  1JCR A;  4NUR A;  3FFL A;  1X5B A;  4QX7 B;  4EHM A;  1WCR A;  2BTD A;  2H6I A;  5T4Y A;  5AQO B;  3O4Z A;  2VGX B;  1A17 A;  4ZI3 D;  3HDX A;  4TRQ A;  3UT7 A;  2ION A;  2RP4 A;  3D9N A;  3HKC E;  2BZB A;  3FBZ A;  4F3V A;  2MOW A;  1WRD A;  4G2A A;  2ZGG A;  5JDQ A;  2CLY C;  4DRX E;  2JLB A;  4PFP A;  4U8V D;  4BSX A;  3LCA A;  4PJN A;  4CXY A;  3ZNG A;  3CLJ A;  2M6I A;  4KT6 B;  3FUI A;  4EBA A;  5BNW A;  1UX4 A;  1KZO A;  4YDY A;  3SOL A;  2JQQ A;  3BEE A;  3CPZ A;  3KV6 A;  3DSX A;  5FIN A;  5ITZ F;  5LG3 A;  3ZN3 A;  2WXH A;  2OEW A;  5CEC B;  4IE0 A;  4ANW A;  4K5B A;  1FT1 A;  3FU3 A;  2V5D A;  1N54 A;  3Q78 A;  3AE6 A;  3RYC E;  3M3Z B;  4WND A;  2RFM A;  3FU5 A;  3U64 A;  5AQG B;  4AQF C;  1HTJ F;  4ZHB A;  1IXV A;  1NP7 A;  1XDP A;  2KLQ A;  1J1J A;  5HXS A;  1E8W A;  2IC9 A;  4M1P A;  3ABM E;  4ZFH A;  2EIM E;  4QH5 A;  4BJN A;  1YCS B;  4NUV A;  2VSN A;  4C91 A;  3R9A B;  4FJY A;  3QB5 A;  3WG7 E;  4F7A A;  2X51 A;  2QVA A;  5HWY A;  3DSW A;  1SA5 A;  4GAA A;  4DO0 A;  5FY0 A;  5LMN T;  2FJA A;  1OED E;  1QSD A;  2B1E A;  3EVY A;  2DYR E;  1K3Z D;  4B93 B;  4FHJ A;  2QYW A;  3RRN B;  3F31 A;  3C51 A;  3CVR A;  5KWD A;  3J5P A;  5LHI B;  3D9M A;  3P4P A;  2J8S D;  3PU3 A;  2I6H A;  2P58 C;  3CEQ A;  4RVB A;  3S4U A;  4CT4 A;  3V5U A;  2FO7 A;  4IYP A;  3FUJ A;  3B95 A;  4C0E A;  3O48 A;  1D0Z A;  4H9R C;  4DUY T;  2WWU A;  3CVQ A;  5FKY A;  4JV5 T;  3U66 A;  3LJN A;  2UWJ G;  2DCP A;  1X79 A;  4YDO A;  3OPC A;  2WXQ A;  3JCK C;  4ERR A;  2R03 A;  4CDN A;  3W15 B;  2DI4 A;  2MRI A;  5HRY A;  2M63 A;  3E30 A;  3O4X E;  4X64 T;  2MHK A;  3D9H A;  4QHO A;  3DXM G;  2WQY A;  2E0I A;  4XI9 A;  4DMW A;  1D9S A;  1W3B A;  5EX3 A;  2V6Y A;  2IHR 1;  4COF A;  2IY0 C;  2JPF A;  1Y01 A;  3T1H T;  4WNK A;  5LJN A;  4FUL A;  4EGW A;  3UU4 A;  2HM8 A;  3CVN A;  3KVB A;  3LVR E;  5M72 A;  1QBQ A;  3N9P A;  1NFI E;  2JIW A;  1I6Z A;  4F6R D;  2VVN A;  2J07 A;  4U2Y A;  3LVQ E;  4N3B A;  2W0G A;  5J90 A;  2FF4 A;  3R9M A;  2NTX A;  3DRA A;  4N2S A;  2N9D A;  3AE7 A;  2ZXW E;  4G23 A;  2UU9 T;  4C90 A;  3FBL A;  4UQZ A;  2YNQ A;  2L0T B;  3FTV A;  5AQL B;  4OVU A;  4U07 A;  4ZI2 D;  3FZH B;  1MQS A;  5ABH A;  1BR1 A;  1MYO A;  1UN8 A;  3FUH A;  4TV8 E;  1IHG A;  1Y64 B;  2ILR A;  2KT9 A;  2DL1 A;  4G1T A;  3N9L A;  2UXN B;  1KF6 A;  1ZEE A;  4ZEY A;  3VKG A;  4F53 A;  4DR3 T;  3ZPJ A;  2WVI A;  1S94 A;  4K0K T;  5JA4 D;  3MJX A;  1D1A A;  1WR6 A;  4EYU A;  5KJL A;  4Q69 A;  3WI3 A;  3ZMS B;  4JA7 A;  3W9G A;  2V0P A;  4LFA T;  1FVH A;  5HEG A;  1U5P A;  2WB5 A;  3CHP A;  1O5M A;  5HEU A;  5ENT D;  2W67 A;  4HFD A;  4ISS A;  4WWO A;  3KAE A;  1S35 A;  2J08 A;  3R7R A;  3JC6 D;  5JDM A;  3AA7 B;  2H6H A;  5FL0 A;  1N4P A;  2BKK B;  1JUQ A;  4JB8 P;  2HHH T;  4XBF B;  4LF7 T;  5D0O D;  2W00 A;  2IEJ A;  2J4B A;  2YU2 A;  4DPR A;  4BER A;  4E7S A;  3B7U X;  5AFU L;  2Q9Q A;  3A8Y C;  3L16 A;  5FXZ A;  1XNF A;  2LE8 A;  2VKD A;  3QNK A;  2LRK A;  5LG4 A;  4O1P A;  2CCQ A;  3BQL A;  2PM6 A;  3TWV A;  4IDN A;  3EDT B;  4HOU A;  1XZY A;  2VQF T;  2E5V A;  5LOZ A;  2IF4 A;  1U2V G;  1XGW A;  2LSU A;  1WR0 A;  4YT0 A;  5LHG B;  4G11 A;  4YVQ C;  2MAW A;  3APD A;  3P4R A;  4IHJ E;  4HFE A;  3ZJ2 A;  4I43 A;  1YW0 A;  1H6O A;  2XHE A;  5HYA A;  3H3A A;  1TNZ A;  4ILI A;  3HVE A;  3SD5 A;  2BVL A;  3CX7 B;  3CX8 B;  4CN1 A;  3O9X A;  2KWH A;  2YDS A;  1MX2 A;  2IO2 C;  2J4D A;  5DIZ A;  1QUU A;  4UF0 A;  5C3J A;  3ABL E;  3L13 A;  3CVY A;  3RHW A;  3IV0 A;  2QRX A;  4EEB A;  4P0A A;  3DWL G;  4ILG A;  3RF1 A;  2KCL A;  4JVS A;  4CRW A;  4HRL A;  2KC7 A;  2WXJ A;  3FHE A;  3NVO A;  3FUK A;  3DPD A;  3EIJ A;  3P8C D;  4PNI A;  3GZ2 A;  4HB5 A;  3FZK B;  3A5X A;  3U3W A;  3AE2 A;  4WNE A;  3FB2 A;  3TXM A;  4B8C B;  2E8I A;  3S7D A;  2XM2 A;  1M62 A;  4AEZ C;  4NQ0 A;  2YEV C;  4KHZ F;  5CEA A;  1TJF A;  2H6G A;  3LXU X;  1Y6I A;  1YKH B;  2NP9 A;  1DNP A;  3LK3 B;  4YDE A;  1I94 T;  4F8H A;  4N3A A;  2F4V T;  3VLD A;  3NZP A;  4O1O A;  4A5X A;  4QWN B;  4YLH A;  4B8A A;  4ANX A;  2C2L A;  1WAO 1;  3LEW A;  3PRE A;  2UUC T;  4DV6 T;  2EIL E;  4ANV A;  1JNR A;  5AQR B;  3T9K A;  4EOZ B;  1W0B A;  2I2O A;  2WXO A;  3IBE A;  3UM0 A;  4BEP A;  3AU4 A;  2XAF B;  4ZOL E;  3JUE A;  2IOS A;  5AQP B;  4I17 A;  3QAR A;  4K5A B;  2W63 A;  3PUX F;  4TUY E;  2LAI A;  4HN9 A;  3ASO E;  3B7T A;  4GU5 A;  5JDH A;  4I1A A;  2C5K T;  4B3S T;  2OLT A;  1DCE A;  3D9I A;  3CVV A;  3EDV A;  2MTQ A;  3BQK A;  4HKA A;  1ELW A;  2LSI A;  4PAG A;  1OWP A;  2Y3A A;  4XI0 A;  2X6I A;  3P4W A;  1MMD A;  2Y69 E;  5E0O A;  3P4S A;  5H6R B;  5JRC B;  2XZE A;  3LK4 2;  4I6G A;  4N5Q A;  1UJK A;  4DV5 T;  2ZM8 A;  2I59 A;  2AXD S;  4QX8 B;  3FZM B;  5AQI B;  2LO6 A;  4TXR A;  4IRU A;  2VVS A;  2J1D G;  3HYM B;  2C0M A;  3CVU A;  3RO3 A;  2DNX A;  2LXL A;  3ASF A;  4H7Y A;  2PFV A;  3IHV A;  4APF A;  1KNP A;  2YKS A;  1U3D A;  3HG0 D;  3SFD A;  3TWU A;  5ARF A;  5AQM B;  2BG9 A;  2ZM0 A;  4IDZ A;  5L3C B;  4P09 A;  1H6P A;  4CI3 B;  1AWC B;  3S7F A;  3TWT A;  4JI2 T;  3GZS A;  3SHF A;  4MAL A;  4Z90 A;  4I1O B;  2BF0 X;  3CKB A;  5ABE A;  3RIA A;  3Q49 B;  3U9W A;  4HFH A;  3UUN A;  1N36 T;  4F1S A;  1US7 B;  3IA3 A;  5AQN B;  2F37 A;  2P9P G;  1H2T C;  2XQ9 A;  5AQU B;  2UXX B;  3G2V A;  3AAI A;  3LK2 B;  3GA8 A;  3AVS A;  3ONL A;  3AE8 A;  3UM1 A;  2SPC A;  3R84 B;  3OTN A;  3V2X A;  2VB6 A;  3JUI A;  3UIP C;  2ODV A;  2KND A;  2WM9 A;  3CK6 A;  4L2L A;  4J6I A;  3N5L A;  4DV1 T;  2ZLY A;  5FTP A;  3ABV A;  2V5C A;  4DBQ A;  2LSJ A;  1V54 E;  3UUL A;  1OUV A;  3JQ1 A;  2DWK A;  2OVB A;  3T5V A;  3RAU A;  2AXZ A;  3ASH A;  1L5J A;  5ANL A;  3N9M A;  2RA1 A;  4ZXL A;  2LOS A;  5BMV E;  2L9B A;  1KT1 A;  1N32 T;  3ZJ1 A;  2MOZ A;  3RC3 A;  3C4W A;  1ZV4 X;  3FHN A;  2LEH A;  4ZZB A;  4YVO A;  4UVB B;  2XZT G;  2VKJ A;  3ZYQ A;  2VTB B;  1IYG A;  4PS8 A;  2Q9Q D;  4MLP A;  1B7T A;  3ZYL A;  3RX6 A;  3TJP A;  2ACX A;  3D9K A;  3ZYK A;  3NQP A;  1PAQ A;  3ASD A;  3FP3 A;  4HOQ A;  2VQE T;  3MX3 A;  4TXP A;  5J1G A;  4U8H A;  3B5M A;  3VHL A;  3ETU A;  4N5C A;  3RKO A;  1INZ A;  4GOU A;  4ZHQ E;  5B1B E;  3L39 A;  2UY1 A;  2N1G A;  5F8P A;  1UUR A;  1WYC A;  2LM2 A;  4JI7 T;  3OAW A;  3PV0 F;  3SGH A;  3Q9N C;  5FXW A;  2XQ6 A;  3PZ3 A;  4AIS A;  2VUR A;  3QUJ A;  2CLY B;  2XGM A;  4U96 D;  1JPL A;  3E4B A;  2P9S G;  4YSZ A;  5ABG A;  2FUL A;  4UEM A;  2WXP A;  4N78 D;  4GKK T;  2IO3 C;  2XCC A;  2XQA A;  2WU5 A;  1NI1 A;  2WXN A;  1YKE B;  3MKQ A;  5EZY E;  2EIN E;  4X20 E;  5BV0 A;  4AP2 A;  4ILU A;  3NB2 A;  2Y1L E;  4JI5 T;  2E9X A; 
#chains in the Genus database with same CATH homology
 2VKH A;  4K03 A;  3KBU A;  3QC9 A;  4FAD A;  4XE0 A;  3MXZ A;  3U4T A;  1DVP A;  2YK0 A;  3D9J A;  4YFS A;  4GZC A;  1FMW A;  4GYO A;  2PQR A;  3CML A;  4V3I A;  2PL2 A;  3HA4 A;  3UTK A;  4LEU A;  5JR9 B;  4KVM A;  5AJD A;  2WQ6 A;  4EPZ A;  3I0O A;  1TEZ A;  3HI2 A;  4EAH A;  3DP7 A;  2R5S A;  3VLF A;  4C9B B;  2X6F A;  4TV3 A;  3G2U A;  2JMH A;  4H63 V;  4UV9 B;  4D10 C;  2L9Q A;  3FH8 A;  3NF1 A;  5L3D B;  3CSF A;  3FXE B;  5G04 C;  3KVA A;  2CWO A;  1OWM A;  3IEE A;  2D0T A;  2JRK A;  1WYB A;  5CA0 E;  2X3M A;  2K9A A;  4O4H E;  3CQG B;  3DBS A;  5JHA A;  3CGH A;  3TAX A;  5JJ7 A;  1VDY A;  3FY4 A;  4OFZ A;  4U04 A;  3GMI A;  4KMO A;  5AYW D;  2DBA A;  2X9X A;  5C2Y A;  3ONK A;  3LY7 A;  1LF8 A;  5HXE A;  4FI5 A;  3ETV A;  3DTO A;  1PY1 A;  4BA9 A;  4GA1 A;  3RK6 A;  5LJM A;  3FTX A;  5CHE E;  3AU5 A;  3L08 A;  2OA5 A;  4ACL A;  4EB6 E;  5LBM A;  3QJZ A;  5BUZ A;  5LYJ E;  4EXT A;  3ONX A;  4B6X A;  3LS8 A;  1JWF A;  3FUL A;  5FQ4 A;  2XHE B;  2RD0 A;  5ETW A;  3OKQ A;  3RO2 A;  3TXN A;  4H7X A;  3JC6 C;  4UWH A;  4ASK A;  4JXT A;  3MA5 A;  4EZL A;  2X9W A;  4CT0 A;  4JHR A;  3L54 A;  4CGV A;  2LSY A;  3FEY A;  1OWA A;  1KT0 A;  3OXG A;  2XAH B;  5HQ8 A;  2V7L A;  1HE8 A;  5LNK A;  5HXH A;  5T3R A;  3ZN0 B;  5D0Q D;  5L3E B;  4WNF A;  4EIW A;  2OOE A;  1E1H B;  2CE7 A;  3MCX A;  4PS7 A;  4GPK A;  4KYO B;  5JR9 C;  3FEX A;  2Q7F A;  5FP3 A;  4JL0 A;  2VWA A;  2HR2 A;  3K3O A;  5LP6 E;  1KLX A;  5DBK A;  3KFW X;  2WMO A;  2LJL A;  1H2V C;  4X1Y E;  4PW8 A;  4A56 A;  3PUA A;  3G2S A;  5FQ8 A;  5LGU B;  3KD7 A;  1OXZ A;  4JEH B;  3L6A A;  4WUY A;  1D1C A;  4HFG A;  4XAX B;  2LAH A;  4AVX A;  2X38 A;  2ZMA A;  4JUY A;  5G55 A;  1IQR A;  1E7U A;  1Z6T A;  4QXC B;  4FU3 A;  3CVX A;  3H37 A;  4YHJ A;  3MYV A;  2EHO C;  3NZU A;  2V4L A;  3ML9 A;  5KCM A;  3FUF A;  3BG0 B;  3UUX B;  1FEW A;  3SWH A;  3QK0 A;  3C4Z A;  5H6Q B;  4H9S E;  3CK7 A;  3D9P A;  2VQ2 A;  5DAB A;  5JR9 A;  5AIJ A;  3FU6 A;  5LGN B;  2Y48 B;  3I1A A;  3WAJ A;  3CST A;  4CEM A;  4RG9 A;  4UXN B;  4TZ4 C;  4DMV A;  4ZI7 E;  4AXH A;  2LOP A;  2R17 C;  1EDU A;  3SNX A;  4ABN A;  4DVD A;  4XZC A;  4AQF A;  2BDE A;  1BR4 A;  2MYS A;  2AXV A;  4BJM A;  4UVA B;  3ZEF A;  4I43 B;  4PUC A;  2QGS A;  5M4Y A;  2CG3 A;  4B94 A;  3QC1 A;  2K48 A;  4UV8 B;  3LJC A;  1HU3 A;  5HXR A;  4AKH A;  2V7K A;  2A4Z A;  2GRM A;  4ILH B;  4W9R A;  2XTL A;  3ASG A;  1EYH A;  2CWY A;  3UFE A;  2BUG A;  1WY6 A;  4BFR A;  1YD8 G;  3HL6 A;  4IE4 A;  2L6J A;  4JC8 A;  4HFV A;  3K9I A;  1CUN A;  4JW1 A;  3FTW A;  4UWF A;  4J8F A;  2WB2 A;  3MKQ B;  5FZS A;  3NZQ A;  2KZ7 B;  4O4J E;  3PVL A;  3BK9 A;  3SZ7 A;  2VAS A;  4J8E A;  4OK0 A;  2D5U A;  4MLK A;  3UUM A;  4L9I A;  4CXX A;  2KZT A;  3ZC1 A;  1EPU A;  3VLE A;  3N2G E;  4NUU A;  3MV2 B;  4ATG A;  3ZMZ B;  4BX9 A;  5J08 A;  3NRY A;  5FZR A;  4PK6 A;  2XQ0 A;  4WWN A;  2IU1 A;  4KXK B;  2HYZ A;  4HOT A;  2H3R A;  2NC9 A;  4A55 A;  1H7C A;  3OYZ A;  4PS3 A;  4C0M A;  1OWL A;  3CIA A;  4FJZ A;  1UG3 A;  2L3L A;  2KIN B;  4BWR A;  3HVE B;  4QFV A;  1H19 A;  4URK A;  2XRY A;  3APF A;  4PDX A;  2JEK A;  3G2T A;  3RC8 A;  1HO8 A;  5LP0 A;  3GYZ A;  5HAX A;  4H9P C;  3T5X A;  3B57 A;  4BAY B;  4XKC A;  2JJ9 A;  4MS6 A;  5FJY A;  5DQV A;  4HEA A;  2Z6E A;  3IBP A;  4JHK A;  5CCL A;  2I9C A;  5EDS A;  4ME2 A;  4HVB A;  5J2T E;  3ZMV B;  4I6J A;  3ZXS A;  4BY6 A;  2CM0 A;  2WXM A;  2V7I A;  4HXI A;  3O1H A;  3EDU A;  3B13 A;  3HR0 A;  2W62 A;  4KUM B;  2ZU6 B;  3NZS A;  1IAP A;  3QK6 A;  2DIW A;  4L5G A;  5FWQ A;  3PEU B;  3TG4 A;  1G8X A;  4AKG A;  3HKB E;  4AY6 A;  2WMN A;  5G05 J;  4JA9 A;  4IIJ E;  4DI4 A;  4O4L E;  2X67 A;  3S7J A;  1Z3Y A;  4UQX A;  2WBL A;  4EZK A;  1YA0 A;  3MZK B;  2X9H A;  3D3M A;  2PG8 A;  4TUU A;  3CV0 A;  3KV5 A;  5G04 J;  2Y4U A;  4I2W A;  1B89 A;  2L0I A;  2VGX A;  5FT9 A;  2WQH A;  5LFA A;  1LVK A;  3K3N A;  1QZ2 A;  3AVR A;  4YJ2 E;  3AB3 B;  3Q47 B;  4HOS A;  5JRC A;  3FUE A;  5TAO A;  5A23 A;  2KMF A;  2WAU A;  4FLB A;  2DCF A;  2V26 A;  4NRH B;  3OXL A;  3QDN A;  3CHS A;  5ANR A;  4Z8X A;  4ZI3 C;  3HKE E;  4UI9 C;  3HKD E;  5LCY A;  2IFU A;  3ZN1 B;  5FYM A;  4I50 E;  4GZD A;  2V7J A;  4I2Z A;  2WQ7 A;  4PK5 A;  4PK4 A;  4AXP A;  3CKD A;  5FQ6 A;  5F3J A;  3SF4 A;  5A1L A;  2VSO E;  1NAF A;  2AXU A;  2VSX E;  2CG2 A;  3ZGQ A;  4KBM B;  1D0X A;  5FQ7 A;  4RSY A;  2AWI A;  1EZ3 A;  4OYS A;  3JQ0 A;  3RRW A;  4EBA G;  4CZZ B;  4GCO A;  5AJL A;  2X66 A;  4U72 A;  2KCK A;  3PS6 A;  3OYX A;  4BT8 A;  5BPP A;  3QKY A;  3ZMT B;  3ZCJ A;  4J2C A;  1ELR A;  3C98 B;  2C0S A;  3NBX X;  3J9X 1;  3VU7 H;  3RU0 A;  3GW4 A;  5EK4 A;  1E8Y A;  1ZBP A;  2G0U A;  3UT8 A;  3R6N A;  4GB9 A;  4EZ4 A;  4WBO A;  2H7O A;  2XAS B;  3E0Z A;  4AKL A;  4E85 A;  3BQI A;  3R7Q A;  4L7T A;  3GWH A;  2CXF A;  4O4I E;  4GZ5 A;  3ZHE A;  4QXH B;  5L3B B;  2XUE A;  3I4R B;  1BR2 A;  3GN5 B;  1FIO A;  2EHO D;  4HS2 A;  5FXV A;  3Q9D A;  4DJA A;  4M3O A;  4JEU B;  5BT1 A;  3CR3 A;  2WXK A;  4DK5 A;  1TJC A;  5DJQ C;  3I3N A;  4GYW A;  2XGO A;  4GML A;  2E9X D;  3TG5 A;  4CQI A;  4UWK A;  2NOX A;  3ANW B;  3UUX A;  2LT3 A;  3ZC0 A;  2XAQ B;  4GK5 E;  2VGY A;  3N2K E;  3L22 A;  3U78 A;  3ZW3 A;  5FMN A;  4LER A;  5ENN A;  4EYY R;  4PJJ A;  4AQG A;  4CI2 B;  3FUN A;  5FXX A;  4A3T A;  4AM9 A;  3MA9 A;  2V1D B;  3VTX A;  2KM4 A;  3ZLI A;  3RYH E;  3OXF A;  3ZEF B;  1KK7 A;  1LRZ A;  3QWW A;  4WBN E;  1AJ3 A;  3CVW A;  2FI7 A;  2CHZ A;  4X1I E;  1T98 A;  4OYK A;  5DQW A;  5EK3 A;  3MGB A;  3ZHE B;  3FTU A;  2DWG A;  4Q94 A;  5CMW A;  3AS4 A;  4UWG A;  3PH0 C;  4ZS3 A;  3RRC A;  4APO A;  4G63 A;  2A5U A;  3CHQ A;  4IN3 B;  1HG5 A;  5CB4 E;  2W61 A;  4UF0 B;  4KVO A;  1SZ9 A;  4J8D A;  1ELK A;  2Y6X A;  1MMN A;  3HIZ A;  2MBG A;  3B7R L;  3Q2M A;  3HHM A;  3EJN A;  4TN7 B;  4AI6 A;  3CHO A;  1HFA A;  3FUM A;  2E2E A;  3QWV A;  5FNV E;  5HXC A;  2JMK A;  4LRZ A;  3D9L A;  4GZ3 A;  3LY9 A;  4GA2 A;  3VTY A;  3TGO A;  1MMG A;  2QFC A;  3OBV E;  1ZHC A;  2OVF A;  4PJL A;  4P0B A;  4L0R A;  3PTR B;  3MZL B;  5LCW C;  3AA0 B;  3LFM A;  5FY1 A;  4CXW A;  3LDZ A;  4IUL A;  3U3I A;  2UY1 B;  5L2L A;  1H6K A;  3AAA B;  3S7B A;  4GYY A;  3RYI E;  3URZ A;  1LVF A;  1SHZ C;  3SBT B;  5FY7 A;  4G26 A;  2WSS V;  4IE7 A;  5KMG P;  1JWG A;  3RPU A;  2WXG A;  5E75 A;  2A72 A;  3ZRH A;  3IHR A;  2CXL A;  2D0U A;  3P2B A;  3PUR A;  2PQN A;  2CHX A;  2V5F A;  3LBX B;  4ACK A;  1Z0P A;  3LG7 A;  4CI1 B;  5BV1 A;  5C1D A;  2C5I T;  3PNL B;  1SZA A;  4UEL A;  5ADX L;  3NRX A;  4I4T E;  2XCB A;  4KP3 C;  4CDR A;  3IEG A;  3OJA A;  1N52 A;  3FTS A;  3ZFW A;  2GRL A;  4DLQ A;  3KDS E;  3FH7 A;  4XZ4 A;  5GON E;  3PEV B;  4A1S A;  4CGW A;  2NWB A;  1SQM A;  4PH4 B;  4LUN U;  1UN9 A;  4CCA A;  2DHR A;  3C4X A;  4GZ6 A;  1FCH A;  4GA0 A;  1MHQ A;  4U74 A;  4I55 E;  2X6K A;  3S2A A;  3E08 A;  3ENE A;  4F6R C;  3QB2 A;  2ODU A;  5JVD E;  2YU1 A;  3UMV A;  2LSV A;  2NW8 A;  2GW1 A;  1E8X A;  1VRB A;  4GYS A;  1UW4 B;  2XEV A;  2AW6 A;  2IW5 B;  4AKR B;  3WXX A;  1NA0 A;  4ANU A;  4HE8 A;  5C8Y E;  5HI7 A;  4CDM A;  3D9O A;  2XPZ A;  1NZN A;  3MEK A;  2LHR A;  1IQU A;  1VOM A;  3PE0 A;  3KEZ A;  4U0S A;  3PUS A;  3CWZ B;  4HGA A;  3Q5X A;  3PUK A;  4PJM A;  5EK2 A;  3FTY A;  1ZU2 A;  4PFO A;  3LBX A;  2LNI A;  4FC8 A;  3L3P A;  2PZI A;  4XIF A;  1HS6 A;  2YIN A;  3ZYM A;  1E90 A;  5JDF A;  3PE3 A;  2GGF A;  3ESL A;  4G24 A;  4Y6W A;  3ULQ A;  4DI3 A;  3PDY A;  2DLR A;  2WXF A;  4AY5 A;  1E8Z A;  2NSZ A;  4ZS2 A;  3N9O A;  3ZPO A;  1V9D A;  4WWP A;  2VTB A;  2V8S E;  5L3G B;  1WM5 A;  2HPJ A;  2CMR A;  3CHR A;  4Q96 A;  2Y4T A;  3RRM B;  2CA5 A;  4OYJ A;  2A3D A;  3KS2 A;  2HH7 A;  3CX6 B;  3I0Q A;  3EIQ C;  3O1I A;  5A7D B;  4AJW A;  3LY8 A;  1E7V A;  5LHH B;  2QA7 A;  4KMC A;  4IE6 A;  2EQX A;  2OV8 A;  3Q5W A;  3UT4 A;  4U0Z A;  4XKB A;  2IJG X;  2X9Y A;  3K8P C;  4UIG A;  4B89 A;  1D1B A;  4G25 A;  4JPS A;  1LKX A;  2NXP A;  4WNG A;  3MKD A;  4Y6C A;  2IOL A;  5J2U E;  2KXP B;  4HTE A;  3EUH A;  3Q5M A;  5G2N A;  3RJV A;  3O1J A;  5T8I A;  1MMA A;  2L8K A;  4B0Z A;  1HH8 A;  5JHB A;  2X0L B;  2X68 A;  3LPZ A;  3BG1 B;  1FMV A;  4AV7 A;  5KJM A;  5JDG A;  3ANW A;  3AS5 A;  1PC2 A;  2VL8 A;  5LXT E;  4FHK A;  2E9X B;  4X1K E;  3MV3 B;  4O6F A;  4UVC B;  2FEZ A;  3Q15 A;  1SA0 E;  4H9Q C;  3VKH A;  4N3C A;  2P9B A;  3IF8 B;  1HXI A;  3UQ3 A;  4N39 A;  3ZCI A;  3EHN A;  4O2A E;  3MJW A;  2YQ8 A;  2QY7 A;  2Q9Q B;  2LHN A;  2CXD A;  5KJK A;  3IKO B;  4UI9 K;  2VKO A;  1UCU A;  2PM7 A;  4K0R A;  5LBQ B;  3DJB A;  3KIN B;  3SBS A;  4MHC A;  2VJ8 A;  4FLH A;  2PBI A;  4TX5 A;  2D2S A;  5FZQ A;  3PRZ A;  4I6E A;  4KZ0 A;  1S0P A;  2YHC A;  2XQY A;  5JQG E;  3G2W A;  2XAG B;  3RRU A;  4MKT A;  5CMY A;  5JRE A;  3K3Q C;  4JLE A;  3AS8 A;  4BTB A;  3MK7 C;  4DND A;  1MIY A;  2ZM2 A;  4YJ3 E;  2H7V C;  4NAC A;  2IC6 A;  4EZH A;  4O2B E;  3KV9 A;  5KX5 E;  4XX5 A;  2GK9 A;  5CA1 E;  3CK9 A;  1H2U A;  3LJ3 A;  4WAF A;  3PZD A;  4J0U A;  1MNE A;  2EHO A;  2VYI A;  4N2Q A;  2VK9 A;  2K5B B;  3UX4 A;  4IST A;  2XPI A;  2XRZ A;  4I1M A;  3AAE B;  1WLX A;  2IAK A;  3L17 A;  3FXD B;  4HLE A;  3Q4A B;  3CK8 A;  4EQF A;  3I4G A;  4J8S A;  3PUG A;  4QKN A;  3SRZ A;  4O8S A;  2WPV A;  4A3V A;  3T8M A;  4ZI2 C;  1H0A A;  3C64 A;  2FBN A;  5IHY A;  5E76 A;  2X6J A;  1IZN B;  2IQC A;  3FTZ A;  1UJJ A;  3TKL B;  2X6H A;  3T8O A;  1HZ4 A;  2J49 A;  2LSK A;  5JH7 E;  3N71 A;  4BX8 A;  2ES0 A;  4G2V A;  3QOU A;  4FP7 A;  5EX0 A;  4UWL A;  3LYA A;  4JEH A;  2C0L A;  3I9W A;  4GYR A;  5LGT B;  3MAC A;  3D0T A;  5BW8 C;  1Y8M A;  3B7S A;  2N2N A;  4U0U A;  2Q9Q C;  5LX8 A;  3PDN A;  1P5Q A;  3CHM A;  4QXB B;  5JDL A;  2OND A;  3PE4 A;  3IHY A;  3ZIM A;  4I9E A;  3CVL A;  2PJQ A;  1ZKE A;  3PUJ A;  2M67 A;  3UT5 E;  4YND A;  1OWN A;  3RKV A;  3QWP A;  4MRU A;  5JDN A;  1U4Q A;  2HPL A;  5KDM C;  4GIW A;  1MND A;  3C98 A;  1BPO A;  5JJ6 A;  1NA3 A;  3MKR A;  4ANJ A;  3SFZ A;  5AEN A;  1KNZ A;  2K24 A;  4KZC A;  4BT9 A;  5LA6 E;  3CKC A;  4ADZ A;  3P7I A;  2RG8 A;  3JYS A;  3PUQ A;  4H63 H;  2CEA A;  4AIF A;  4UI9 J;  4KBQ A;  5ARG A;  1E96 B;  4LCT A;  2CFZ A;  4UQY A;  1IJ5 A;  3RH3 A;  5EKQ D;  1G73 A;  4MBQ A;  4I9C A;  3APC A;  1UX5 A;  3F57 A;  3ZVV A;  3GN5 A;  4A1G A;  3P1U A;  3V5S A;  3SS1 A;  2NW7 A;  2BVM A;  4IGU A;  3SI5 A;  3QAQ A;  1HCI A;  5KJN A;  2C5J A;  3KV4 A;  1HG2 A;  1NWM X;  1HX8 A;  1MIW A;  1QQE A;  1OWO A;  5A6C A;  3FH5 A;  3FU0 A;  2KCV A;  3UPV A;  4HOR A;  4AOF A;  4K0U A;  3RYF E;  2VSY A;  4E6H A;  1U3C A;  3F2E A;  3CQX C;  3N9Q A;  4EEC A;  2KAT A;  3AA1 B;  5G05 C;  2WXL A;  4OVV A;  2KWI B;  4H9N C;  4IE5 A;  3GZ1 A;  2WXI A;  2I1K A;  1FVF A;  1O3X A;  4EZJ A;  4GCN A;  2NTY A;  2AVP A;  1HF8 A;  3PU8 A;  3N2O A;  3TL5 A;  1BR0 A;  2LSG A;  4R7L A;  1GW6 A;  4JZY A;  2NW9 A;  3ZMU B;  4U63 A;  2EHO B;  2R59 A;  2KZT B;  2CFU A;  2YHE A;  4GK0 E;  3E22 E;  4AKI A;  1HS7 A;  3ESK A;  5L3F B;  3RIB A;  1D0Y A;  3FUD A;  1IJ6 A;  4BTA A;  3I9Y A;  4E7Z A;  1Z3X A;  1QNF A;  2XGS A;  5LOV E;  4OHF A;  3M65 A;  2LM9 A;  4L23 A;  3AA6 B;  2XPY A;  3CVP A;  5CCM A;  4JHJ A;  3WAK A;  2WXR A;  5IYZ E;  4TV9 E;  3CQC B;  2J9Q A;  3FDH A;  3C50 A;  4FJO A;  2HO1 A;  2Y8D A;  4FA6 A;  4H9O C;  2A2F X;  3I5P A;  2I1J A;  3L09 A;  3PNT B;  4L2Y A;  3LKU A;  5HWX A;  3J7Y q;  4DBR A;  4P29 A;  2E9X C;  3N9N A;  2XAJ B;  4V1A v;  3FWV A;  3ML8 A;  4RG6 A;  2J09 A;  4WW0 A;  4DLO A;  2CHW A;  4JEU A;  4MFR A;  2V7M A;  3EHM A;  1MIV A;  5JJT A;  3KBT A;  1EF1 C;  4GMJ A;  5LCW J;  4NUR A;  3FFL A;  1X5B A;  4QX7 B;  2BTD A;  5T4Y A;  3O4Z A;  2VGX B;  1A17 A;  4ZI3 D;  3HDX A;  4TRQ A;  3UT7 A;  2ION A;  2RP4 A;  3D9N A;  3HKC E;  2BZB A;  3FBZ A;  4F3V A;  2MOW A;  1WRD A;  4G2A A;  5JDQ A;  2CLY C;  2JLB A;  4PFP A;  4BSX A;  3LCA A;  4PJN A;  4CXY A;  3CLJ A;  4KT6 B;  3FUI A;  4EBA A;  5BNW A;  1UX4 A;  3SOL A;  2JQQ A;  3BEE A;  3CPZ A;  3KV6 A;  3ZN3 A;  2WXH A;  4IE0 A;  4ANW A;  3FU3 A;  1N54 A;  3RYC E;  4WND A;  3FU5 A;  3U64 A;  4AQF C;  1HTJ F;  1NP7 A;  2KLQ A;  5HXS A;  1E8W A;  2IC9 A;  4M1P A;  4BJN A;  4NUV A;  2VSN A;  4C91 A;  3R9A B;  4FJY A;  4F7A A;  2X51 A;  5HWY A;  4GAA A;  4DO0 A;  5FY0 A;  1QSD A;  2B1E A;  3EVY A;  4FHJ A;  3RRN B;  3F31 A;  3C51 A;  3CVR A;  5LHI B;  3D9M A;  3PU3 A;  2I6H A;  2P58 C;  3CEQ A;  4RVB A;  3S4U A;  4CT4 A;  4IYP A;  3V5U A;  2FO7 A;  3FUJ A;  4C0E A;  3O48 A;  1D0Z A;  4H9R C;  2WWU A;  3CVQ A;  3U66 A;  2UWJ G;  2DCP A;  1X79 A;  2WXQ A;  3JCK C;  4ERR A;  4CDN A;  3W15 B;  2DI4 A;  2MRI A;  2M63 A;  3O4X E;  2MHK A;  4QHO A;  2E0I A;  4XI9 A;  4DMW A;  1W3B A;  5EX3 A;  2JPF A;  4WNK A;  5LJN A;  4FUL A;  2HM8 A;  3CVN A;  3KVB A;  3LVR E;  5M72 A;  3N9P A;  2J07 A;  3LVQ E;  4N3B A;  2W0G A;  5J90 A;  2FF4 A;  2NTX A;  4N2S A;  2N9D A;  4G23 A;  4C90 A;  3FBL A;  4UQZ A;  2YNQ A;  2L0T B;  3FTV A;  4OVU A;  4U07 A;  4ZI2 D;  1MQS A;  1BR1 A;  1UN8 A;  3FUH A;  4TV8 E;  1IHG A;  1Y64 B;  2ILR A;  2KT9 A;  4G1T A;  3N9L A;  2UXN B;  1ZEE A;  3VKG A;  4F53 A;  3ZPJ A;  2WVI A;  1S94 A;  3MJX A;  1D1A A;  1WR6 A;  4EYU A;  5KJL A;  4Q69 A;  3WI3 A;  3ZMS B;  4JA7 A;  2V0P A;  1FVH A;  1U5P A;  3CHP A;  4ISS A;  4WWO A;  3KAE A;  1S35 A;  2J08 A;  3R7R A;  3JC6 D;  5JDM A;  3AA7 B;  1JUQ A;  4XBF B;  5D0O D;  2W00 A;  2J4B A;  2YU2 A;  4DPR A;  4E7S A;  3B7U X;  5AFU L;  2Q9Q A;  3L16 A;  5FXZ A;  1XNF A;  2LE8 A;  2VKD A;  3QNK A;  5LG4 A;  2CCQ A;  3BQL A;  2PM6 A;  3EDT B;  4HOU A;  5LOZ A;  2IF4 A;  1XGW A;  2LSU A;  5LHG B;  4G11 A;  4YVQ C;  3APD A;  4IHJ E;  3ZJ2 A;  4I43 A;  1YW0 A;  2XHE A;  5HYA A;  3H3A A;  4ILI A;  3HVE A;  3SD5 A;  2BVL A;  3CX7 B;  3CX8 B;  3O9X A;  2KWH A;  5DIZ A;  2J4D A;  1QUU A;  4UF0 A;  3L13 A;  3CVY A;  3IV0 A;  4P0A A;  4ILG A;  2KCL A;  4JVS A;  4CRW A;  2KC7 A;  2WXJ A;  3FHE A;  3FUK A;  3DPD A;  3EIJ A;  3P8C D;  4PNI A;  3GZ2 A;  3A5X A;  3U3W A;  4WNE A;  3FB2 A;  3TXM A;  4B8C B;  2E8I A;  3S7D A;  4AEZ C;  4NQ0 A;  2YEV C;  1TJF A;  3LXU X;  1Y6I A;  1YKH B;  2NP9 A;  3LK3 B;  1DNP A;  4N3A A;  3VLD A;  3NZP A;  4QWN B;  4YLH A;  4B8A A;  4ANX A;  2C2L A;  1WAO 1;  3LEW A;  3PRE A;  4ANV A;  4EOZ B;  2I2O A;  2WXO A;  3IBE A;  3AU4 A;  2XAF B;  4ZOL E;  2IOS A;  4I17 A;  3QAR A;  2W63 A;  4TUY E;  2LAI A;  4HN9 A;  3B7T A;  4GU5 A;  5JDH A;  4I1A A;  2C5K T;  3D9I A;  3CVV A;  3EDV A;  2MTQ A;  3BQK A;  4HKA A;  1ELW A;  2LSI A;  4PAG A;  1OWP A;  2Y3A A;  4XI0 A;  2X6I A;  1MMD A;  5E0O A;  5H6R B;  5JRC B;  3LK4 2;  4I6G A;  1UJK A;  2ZM8 A;  2I59 A;  4QX8 B;  2LO6 A;  4IRU A;  2J1D G;  3HYM B;  2C0M A;  3CVU A;  3RO3 A;  2DNX A;  3ASF A;  4H7Y A;  2PFV A;  3IHV A;  4APF A;  1U3D A;  5ARF A;  2ZM0 A;  4IDZ A;  5L3C B;  4P09 A;  4CI3 B;  3S7F A;  3SHF A;  3GZS A;  4MAL A;  4I1O B;  2BF0 X;  3CKB A;  3Q49 B;  3U9W A;  3UUN A;  4F1S A;  1US7 B;  1H2T C;  2UXX B;  3G2V A;  3AAI A;  3LK2 B;  3GA8 A;  3AVS A;  3ONL A;  2SPC A;  3R84 B;  3OTN A;  2VB6 A;  3JUI A;  2ODV A;  2KND A;  2WM9 A;  4L2L A;  4J6I A;  3N5L A;  2ZLY A;  5FTP A;  4DBQ A;  2LSJ A;  3UUL A;  1OUV A;  3JQ1 A;  2DWK A;  2OVB A;  3T5V A;  2AXZ A;  3ASH A;  1L5J A;  5ANL A;  3N9M A;  2RA1 A;  5BMV E;  2LOS A;  2L9B A;  1KT1 A;  3ZJ1 A;  2MOZ A;  3RC3 A;  3C4W A;  1ZV4 X;  3FHN A;  2LEH A;  4YVO A;  4UVB B;  2VKJ A;  3ZYQ A;  2VTB B;  1IYG A;  4PS8 A;  2Q9Q D;  4MLP A;  1B7T A;  3ZYL A;  3RX6 A;  3TJP A;  2ACX A;  3D9K A;  3ZYK A;  3NQP A;  1PAQ A;  3ASD A;  3FP3 A;  4HOQ A;  3MX3 A;  5J1G A;  4U8H A;  3VHL A;  3ETU A;  4N5C A;  3RKO A;  1INZ A;  4GOU A;  4ZHQ E;  2UY1 A;  2N1G A;  5F8P A;  1WYC A;  3OAW A;  3SGH A;  5FXW A;  3QUJ A;  2CLY B;  2XGM A;  1JPL A;  3E4B A;  2WXP A;  2FUL A;  4UEM A;  4N78 D;  2XCC A;  2WXN A;  1YKE B;  3MKQ A;  5EZY E;  4X20 E;  5BV0 A;  4AP2 A;  4ILU A;  4L1B A;  2E9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...