4B89A

Mif4g domain of the yeast not1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
230
structure length
230
Chain Sequence
EMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
molecule keywords GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1
total genus 82
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4b89A00
1N52A 2FULA 4GMLA 4GMJA 2IOLA 1H2UA 1H2TC 4CEMA 3FEXA 4CT4A 2RG8A 3L6AA 4CRWA 2KZTA 1N54A 4B89A 4JHKA 3EIQC 4IULA 2VSXE 4B8AA 1UG3A 2GGFA 2I2OA 4B8CB 2VSOE 2IU1A 2ZU6B 3FEYA 2IOSA 3D3MA 4JHJA 2HM8A 1H2VC 5ANRA 2IONA 3EIJA 1PAQA 1HU3A 1UW4B 2KZTB 3RK6A 4C9BB 4LUNU 3JUIA 1H6KA 2NSZA
chains in the Genus database with same CATH superfamily
4Q96A 3LVQE 4BWRA 4EZLA 3CVYA 5AENA 5D2MC 3CEQA 5FTPA 3JQ1A 2NYJA 2VSOE 3APCA 3V79K 4N5CA 5JHBA 3AS5A 5KJNA 5FJYA 3SQVA 2EIME 2J8SD 3QNKA 5CBOA 2H6GA 4HOQA 3TL5A 2YQ8A 4JC8A 2F37A 4B93B 5BW8C 2QFCA 4NURA 3NOGD 4OAVB 1MX6A 1V54E 3S7BA 1FPPA 5C1DA 3OXGA 2J08A 2RKKA 2VGEA 5CMWA 4U8HA 4ABNA 2BKKB 2R5SA 4GU5A 2IONA 3CKBA 3T8MA 3ZHEB 4ACKA 2F8YA 4JA9A 1IHGA 3QK0A 4BSZB 2V0PA 4A63B 3Q5MA 3R7RA 3RO3A 4GTVA 4AV7A 3ZPJA 2V4LA 4HRNA 4EZJA 3W9FA 3CQCB 4HS2A 2WXHA 5ENSD 1SW6A 5B1AE 5CEDB 3V31A 5DBKA 2EILE 5KJLA 2WXJA 4KYOB 4I1MA 1GW6A 2A4ZA 1E8XA 4XI0A 3E33A 2WXFA 1MYOA 3UIPC 1KPSB 4MLPA 4I17A 4L1BA 3SHFA 2XHEA 3E32A 4FJZA 5FQ6A 4G25A 3J5QB 3APFA 4YDEA 2FEZA 4N39A 1UJKA 3CHOA 4BY6A 2ZGDA 1H6OA 3T5XA 3UM3A 5FQ7A 4DX5D 3BU8A 4B8CB 4GTPA 4GZCA 3HG0D 1JCQA 3ZKJA 3CVNA 4DPRA 4O6FA 2WXQA 3FTSA 3ZVVA 2ETBA 3LJNA 4HRMB 2WPVA 2CHWA 2IEJA 4U07A 3HVEA 3RO2A 5EX0A 2AXVA 5HKPA 5FZRA 4EQFA 3GZ1A 1BI7B 3P2BA 3K9IA 3PS6A 5EYPF 2FO7A 4GMLA 3UM1A 4EHMA 2Y4TA 3GZSA 3LY8A 4DX2A 3KEZA 2RFAA 4P29A 1BI8B 3ENEA 3ZYQA 3Q47B 3OXFA 3FP3A 5ENRD 2HM8A 1YMPA 3EHNA 3RK6A 4HVBA 4HI8A 2IY0C 2VTBB 2IOLA 3PUKA 3BG0B 4J8EA 4MKTA 1XNFA 4FULA 4JA7A 3FU3A 4H7YA 2XCBA 3ABLE 4C0MA 3ONLA 2L9BA 3IHVA 1ZBPA 3ABME 3GZ2A 5AYWD 4RG6A 1BU9A 3JYSA 4AXHA 2QY7A 4WWNA 3DSVA 1YA0A 4YVOA 2OCCE 3FFLA 3DPDA 1K1AA 3L16A 4Y6WA 1K3ZD 4R7LA 4DX1A 1NL4A 3ASFA 2CG3A 4FP7A 5FIOA 3QWPA 5EYLA 3E34A 5FT9A 1HU3A 1JWGA 1KLXA 4KXKB 3FH5A 3ASHA 3BUAA 2J4DA 2I1KA 2JEKA 1OWMA 4DRXE 2I1JA 3PZ3A 3L54A 5LOZA 5CRVA 4B89A 2WXLA 4UQYA 2EIKE 3D9MA 4J8DA 3Q75A 4O1OA 4WUYA 2KM4A 3R7QA 3C3RA 4HOSA 1TYQG 5BPPA 1W3BA 4CRWA 4UWGA 1E8YA 4CDNA 4E85A 5HQ8A 3CHMA 2ZU6B 3NBNB 3DSXA 5KBAA 1IQRA 2DBAA 3UT7A 4F3VA 1OXJA 4ANXA 3NF1A 1PC2A 3U9WA 1H2TC 3QOUA 3ZUVB 3BEEA 2XZDG 2H6HA 3TAXA 3AU5A 1ELWA 4CZ2D 3PE4A 4JHJA 4FHJA 3FTYA 2VYIA 2X38A 3AG4E 3N71A 1N0RA 4ZHBA 3DBSA 3UT8A 3UX4A 2FBNA 3B7UX 4FA6A 4JZYA 4I1AA 1QZ2A 4EBAG 1K8KG 4LEUA 3SNXA 1QBQA 3TWVA 4UI9J 3MCXA 4OVUA 3AU4A 5EIBE 3O48A 3V2XA 3HXDA 3PZ4A 2XGSA 3URZA 4C48B 3KS2A 1EDUA 4B8AA 3UUXA 3RIBA 2KATA 3PH0C 4WNDA 3PVLA 5E76A 3QDNA 3WXXA 4N3BA 3LCAA 2LXMA 3E37A 4G8LA 3C3QA 3ISMC 5B1BE 3ASOE 2VTBA 5ENOD 4XKBA 4E6HA 4I6GA 4Q69A 3PRZA 4F53A 2GGFA 2XS1A 3C3OA 4JXTA 4RVBA 3HRAA 2WQHA 2LAHA 4JL0A 5B3SE 3EU9A 1LTXA 3C72A 2XCCA 2GRQB 1HO8A 2H6IA 3HVEB 5KJKA 3Q78A 1DVPA 2ZISA 3NQPA 4F1PA 2C0MA 2CFZA 4HFGA 1S63A 5G05J 4LERA 4GTQA 3UKUG 4V3IA 4F1SA 2X6HA 3CLJA 1OWNA 4Z68A 4IN3B 4N2QA 1HH8A 3LXUX 4EZKA 1IYGA 2IOSA 2WMOA 4DUIA 2PM6A 4F6RD 3OAWA 4GCOA 3FDHA 2AW6A 4YVQC 1MQSA 4CEMA 5AN8A 3CGHA 2CHZA 2L0TB 3RKVA 4HORA 2V4HC 5T4YA 4GZ3A 3EHMA 5ANRA 3HXEA 5T3RA 3IXEA 4LRZA 3LVRE 5BXOA 5ENPD 3RAUA 2WXRA 3ZRHA 2P9NG 4UQXA 3EUVA 3HYMB 1FVHA 1HE8A 3EU5A 3FUIA 4GYYA 4DLOA 4BSXA 3TWWA 3LEWA 3VTXA 2CFUA 2IU1A 5ANLA 2IFUA 1NFIE 1S0PA 4A1SA 4GMJA 3PE3A 2VGYA 2Y3AA 2E0IA 1U2VG 2L6JA 2RG8A 4GMRA 3FU5A 2IQCA 2LSUA 2VGXA 1Y6IA 3AJIA 3L13A 2XEEA 1PAQA 2X6FA 3MKQA 1VDYA 5FZSA 3G2TA 3MX3A 4AP2A 3APDA 3SI5A 1KZOA 1SA5A 4EECA 4CGVA 4XIFA 4TUMA 2R03A 4HBDA 4HI9A 4BT9A 3PEUB 4BFRA 4LNUD 5G2NA 3Q9UC 2BTDA 4UWFA 4Q94A 2P9PG 4RLYA 3D9NA 4TUUA 4XZ4A 3ZNGA 5LCWJ 3CSFA 2ZXWE 3X2QE 5EIDA 2BKGA 1EYHA 1WY6A 2MYOA 3AAAC 3DRAA 5HI7A 3G2UA 1SVXA 4HOTA 4BX8A 4OVVA 2P2CP 3KAEA 3LYAA 4UQZA 1AWCB 1BD8A 1K1BA 4GTTA 2CG2A 2Q7FA 4DJAA 2PQRA 4YNDA 1OWPA 1L5JA 4CT0A 5M72A 3TXMA 2AXUA 5G04C 4APFA 3G2WA 3JUIA 4N5QA 1E90A 2XEHA 3GYZA 5DIZA 3FEXA 1WAO1 1MJ0A 4G26A 3S7FA 2LXLA 4QFVA 3FUDA 1U3DA 4BERA 2R05A 3DPYA 1OCRE 4TXRA 1N0QA 4LCTA 3BG1B 1TEZA 2R59A 1IHBA 5AQ9A 3D9OA 1KT0A 2XPIA 3C5RA 2L6BA 3ML8A 3ULEG 1OT8A 1N54A 1WM5A 4G8KA 5KNHD 3FULA 1N4RA 1DCEA 3ASNE 5AQAA 1WG0A 4GCNA 2LUHA 2V5QC 5A23A 3Q7FA 1OCOE 4GZ6A 5AJDA 4M7CA 3MKQB 3EHQA 5FWQA 1B89A 2XPYA 4JHRA 2VSXE 4WWPA 2NC9A 4MS6A 2I2OA 4L23A 3D3MA 2OVFA 2GRMA 4CDMA 5T8IA 1O1TA 5G05C 3DSWA 2WQ6A 3CVLA 4GYOA 4NRHB 4JHKA 4ATZD 3CSTA 2X6JA 1SZAA 3HXFA 1O1RA 2KCKA 2J4BA 1DCQA 1H6KA 1N11A 1SA4A 1O5MA 3Q79A 3ZU7B 4KZCA 4EBAA 3QB2A 4ANUA 5KWDA 3L22A 1TR4A 1LD8A 3TWSA 3U64A 4Y6CA 4GPKA 3FUNA 3PZ2A 1BPOA 1V55E 4KMOA 1X5BA 4NACA 2VSNA 2KCLA 4FLHA 4AJWA 2WB2A 2KXPC 3KEAA 4J7WA 4UI9C 5EILA 3B13A 4DX7D 1NA0A 4LNBA 3QAQA 4UUCA 2AVPA 4FLBA 2X6KA 5ENQD 4NQ0A 2GRPB 2YNQA 3DSUA 3EHRA 4KVOA 2RFMA 4JB8P 3T9KA 2XRYA 4L9PA 4A55A 2XQ0A 4TXPA 5AJLA 3ULYA 1UN8A 3MGBA 4J0UA 3FUKA 2J49A 5A7DB 3SO8A 5C2YA 2KZTA 5CHEE 4DI3A 4I2WA 3NOCD 4WNEA 1Z3XA 3PDNA 3LY7A 4BT8A 3VLEA 4D10C 2ZIRA 3ZFWA 3T5VA 3ZYMA 2BUGA 4HRLA 1H19A 1ZU2A 3Q7AA 5JMND 3HDXA 3DXMG 4XKCA 4CDRA 4B94A 1E7UA 4JEHA 2XENA 4K5AB 3AS4A 1Z5SC 2KCVA 2P9KG 3CHQA 2XRZA 3PREA 4IRUA 3W9GA 2FI7A 2DWZA 3EIQC 3MV3B 3PNLB 5FINA 5D0OD 2ZGGA 4K5BA 4TV3A 5BV0A 2KZTB 4FADA 1QYMA 2E2EA 3TG4A 1D8EA 3ZIMA 3ONKA 1TNYA 2BEDA 2I6HA 2OEWA 3I3NA 2OV8A 1TN7A 3L6AA 1PY1A 5FQ4A 4GTSA 3FTZA 4AOFA 3SZ7A 2QYJA 3UT4A 2EIJE 3FEYA 2HE0A 3IKOB 3J5PA 3CVXA 3CVUA 2VQ2A 3SBTB 3TJPA 4U0SA 2FULA 4URKA 3DXKG 4APOA 3JXJA 3CK7A 3MV2B 1A5EA 3LY9A 1IXVA 3UXGA 1FT1A 1HX8A 3LJ3A 1OY3D 5BXUA 3TWTA 3SFYA 1E7VA 4WNFA 4WAFA 3WG7E 5J08A 4G24A 4KBQA 3L9TA 2XEVA 2QC9A 3NZSA 2V8SE 3E4BA 3RRMB 4WNGA 4IULA 2PNNA 5FQ8A 3IV0A 4A3VA 5G55A 3CVPA 3LPZA 3MEKA 3UINC 4U95D 3NAWA 4U7EB 4JD2G 1UG3A 3QARA 4L2YA 5HS0A 3DEPA 2CHXA 1Y8MA 2WXMA 4ANVA 4HLEA 4U0ZA 2GW1A 4PS7A 5JHAA 3DWLG 4HLLA 3MZLB 4L7TA 4RSYA 1KZPA 2Y69E 4J6IA 2LO6A 5KNGA 4ANWA 4GA2A 1ZB1A 4AM9A 1TN8A 1E8ZA 3ZXSA 4I9CA 5LP0A 4O1PA 3CK9A 4ILGA 2IJGX 1YYHA 4U96D 1N94A 2RD0A 1KT1A 2L0IA 1XGWA 4I6EA 5H7PA 2UY1B 2WVIA 4UWLA 2UY1A 4N2SA 4J8YA 4JEUA 3DSTA 4A1GA 1U3CA 1JUQA 1TNOA 1RZ4A 1NZNA 4DK5A 3U66A 5KJMA 5BV1A 2QYUA 3DEOA 2R2LA 5ITZF 4K03A 4MBGA 2KBXA 1LF8A 2HYZA 1DNPA 3FTUA 3HXCA 4IYPA 2IF4A 2NXPA 4G1TA 4GB9A 3FTVA 1HG2A 4BX9A 3R9AB 4DX6D 2GRNB 3L08A 4ME2A 4B0ZA 1ELRA 3IBEA 4CT4A 2DIWA 3CQGB 5CMYA 4CYMD 4CGWA 3UQ3A 1HF8A 1JPLA 3ZYLA 2X3MA 3RRUA 1FCHA 1N52A 3CHSA 2P58C 3QJZA 1H6PA 2AXZA 5J90A 4GTOA 3D9PA 3FH8A 3MJWA 4LUNU 3MA5A 3VTYA 4PS3A 3CIAA 3TWQA 3G2VA 1UOHA 3EDTB 3CR3A 4N3AA 4AIFA 2Y1LE 1SQMA 2QZAA 4QQIA 4G23A 2VSYA 1UJJA 1OWLA 2XZTG 3Q49B 3MYVA 4X8QA 1UW4B 3L17A 2MOWA 3B7TA 2B6CA 2DYRE 5CBNA 4FU3A 3DSSA 1ELKA 1P5QA 1N4PA 2DVWA 3I5PA 5EX3A 1HXIA 1TN6A 4U04A 2V5FA 3O4ZA 2PM7A 3CVWA 2LAIA 2R02A 4PS8A 3UI2A 3LS8A 1OUVA 4XE0A 4U8YD 4U0UA 2PQNA 1INZA 4N3CA 1IQUA 3U3WA 3PUJA 3JQ0A 4ATGA 4BETA 4BESA 5CERB 2XS8A 5JJTA 1IKND 1X81A 4HNAD 5BT1A 3AG1E 2IO2C 2NSZA 1TNZA 2P9UG 3TGOA 5CECB 3ASGA 3FU0A 2MHKA 1Z6TA 1OWOA 3B7BA 4PUCA 4FHKA 3TWRA 3U4TA 2WXIA 4C0EA 3CKCA 3LKUA 2MRIA 1QNFA 3QWVA 2OEVA 3CVVA 4LSZE 3AG2E 1HS6A 2YHEA 3FTXA 3SGHA 3BQOA 3MKRA 2I9CA 4YDWA 3UTMA 3SFZA 1FVFA 4M3OA 1MX2A 2J09A 2IO3C 5KCMA 2GROB 5ENNA 3S7DA 2WXOA 3CHRA 5AIJA 4GZDA 2PL2A 3KSLA 5CEAA 3EJNA 3NZUA 4KVMA 3UPVA 3UIOC 1S64A 2GRLA 3GW4A 2AWIA 2VGXB 5A6CA 2UWJG 5ENTD 2HO1A 4UWHA 1N4SA 2KC7A 2F8XK 4HQDA 4K5CA 3HIZA 3NB2A 3D9HA 1HZ4A 3V30A 3IHYA 3LDZA 4YDYA 3TXNA 4ZFHA 3SFXA 3TWXA 2WMNA 4JW1A 3FUEA 1A17A 2DZOA 4JVSA 3ESKA 3SF4A 2Y4UA 5EN5D 2VJ8A 2BF0X 4K0RA 4O60A 5BUZA 5JJ6A 3QWWA 5JA4D 5FZQA 3FUFA 4J8SA 3PEVB 1MZCA 5EDSA 2AJAA 3QKYA 5AQ7A 3CVQA 2GRRB 4AY5A 3RRNB 2EINE 2ILRA 4DI4A 2FO1E 2EQXA 2Y0BG 4HB5A 1HG5A 4GTRA 4BEPA 4FC8A 3C98A 1S70B 3CHPA 5BNWA 2P9IG 3Q73A 1O1SA 5LFAA 4FJYA 5E75A 3JCKC 4AVXA 3EIJA 5ARGA 3S2AA 1NA3A 2JLBA 5HRYA 3ZXPA 2WXGA 4DLQA 3IEGA 4RQIA 2B0OE 3FUHA 2HR2A 3TWUA 3CV0A 1WDYA 3FU6A 3OXLA 3UM0A 3ESLA 1NP7A 1G3NB 5EKQD 4GYWA 3Q4AB 3FH7A 4KZ0A 3UKRG 3FTWA 4I6JA 2OOEA 4TRQA 4AY6A 2DYSE 1N9AA 3ABKE 2FF4A 1TJCA 4MRUA 4WWOA 2YHCA 4I9EA 4YDOA 1N4QA 3B7SA 1H2VC 4XEIG 3PZ1A 3FUJA 5JJ7A 3VLFA 2A5EA 1DC2A 4F7AA 4ACLA 4NIKA 4BTBA 3UM2A 3FUMA 3D9KA 2H6FA 2WXPA 3TG5A 3I4GA 3KSQA 4LNGA 1MHQA 3RJVA 4AEZC 4OYSA 1YCSB 4C9BB 3PNTB 3D9IA 1SZ9A 4UI9K 3ZN3A 3PZDA 3F6QA 3Q9NC 1UN9A 3HHMA 2XPZA 3E30A 3G2SA 3T8KA 4XI9A 3ULQA 2JABA 3D9LA 5IY5E 4ILHB 3SBSA 5LCWC 3UMVA 1Z3YA 1D9SA 4UWKA 3SD5A 3ZYKA 2PZIA 1NI1A 4XX5A 1N95A 3ML9A 4I1OB 2ETAA 3AG3E 1H0AA 3FY4A 3B7RL 4LG6A 2X6IA 3B95A 5CCMA 1D8DA 1TJFA 3FWVA 2P9SG 4J8FA 4GA1A 4I43A 1OCZE 4U63A 3FHEA 1HFAA 3P1UA 1LD7A 3ASDA 3VLDA 2XGOA 2DCPA 4KT6B 2OVBA 1E8WA 5CRUA 4GPMA 3SY2A 1RW2A 3Q15A 4I2ZA 3RU0A 4GAAA 4EPZA 2ETCA 4A3TA 2LSVA 1OCCE 5D66A 2C0LA 5AARA 4U8VD 1FT2A 1H2UA 3OTNA 4HOUA 3AS8A 5D0QD 4HXIA 1BLXB 4W9RA 3I4RB 4ILIA 3QC1A 4TXQA 1TNUA 2R17C 4GTMA 2WXKA 1EPUA 2P9LG 1JCRA 3ZHEA 1MX4A 2F0YA 3JXIA 1AP7A 2YINA 1EF1C 2LNIA 4RG9A 3JUEA 4JPSA 5G04J 5AAOA 4BTAA 2XGMA 4GZ5A 3V2OA 2C2LA 5AQBA 3S7JA 4H7XA 4GA0A 2WQ7A 3R9MA 3CK8A 5CCLA 4PDXA 3RSEG 2DZNA 4G2VA 4PH4B 1QQEA 2A5UA 2J9QA 4OAUC 1JWFA 2WXNA 2J07A 3ZW3A 2M63A 4G11A 5LX8A 3L82A 1Q2ZA 4CCAA 3HXBA 5ARFA 2WM9A 3KD7A 1TNBA 4L2LA 3ZEFA 3D9JA 3ZGQA 1E96B 1JCSA 2ONDA
chains in the Genus database with same CATH topology
4Q96A 3MGBA 3CVVA 4J0UA 2XCCA 3LVQE 3FUKA 1HS6A 1HO8A 2J49A 5A7DB 3HVEB 4BWRA 4EZLA 3CVYA 5C2YA 2KZTA 2YHEA 3FTXA 5KJKA 3SGHA 5CHEE 1DVPA 4DI3A 3NQPA 5AENA 2C0MA 2CFZA 3MKRA 2I9CA 3CEQA 4HFGA 4I2WA 4WNEA 1Z3XA 3JQ1A 3PDNA 5FTPA 3LY7A 5G05J 3SFZA 4BT8A 2VSOE 3APCA 3VLEA 4D10C 3ZFWA 4LERA 1FVFA 3T5VA 4M3OA 4N5CA 3ZYMA 5JHBA 2BUGA 3AS5A 1H19A 2J09A 5KJNA 1ZU2A 5KCMA 5ENNA 4V3IA 5FJYA 3S7DA 4F1SA 2WXOA 3CHRA 2X6HA 3HDXA 3CLJA 4GZDA 4XKCA 5AIJA 1OWNA 3QNKA 2PL2A 4HOQA 3TL5A 4CDRA 4B94A 2YQ8A 4IN3B 3EJNA 3NZUA 4JC8A 4KVMA 4N2QA 1E7UA 4JEHA 1HH8A 3UPVA 3LXUX 5BW8C 2QFCA 4EZKA 1IYGA 2IOSA 1E96B 2WMOA 3AS4A 2GRLA 4NURA 3GW4A 2KCVA 2PM6A 3OAWA 3S7BA 3CHQA 2XRZA 2AWIA 2VGXB 4GCOA 3FDHA 5A6CA 2AW6A 4YVQC 2UWJG 5C1DA 1MQSA 3PREA 4CEMA 3OXGA 2HO1A 4IRUA 2J08A 3CGHA 4UWHA 2FI7A 2CHZA 2KC7A 5CMWA 2L0TB 3EIQC 3MV3B 3RKVA 3PNLB 4HORA 5T4YA 4U8HA 3HIZA 4GZ3A 5D0OD 4ABNA 1HZ4A 2R5SA 4GU5A 3IHYA 3LDZA 3EHMA 5ANRA 2IONA 4TV3A 5BV0A 2KZTB 5T3RA 3CKBA 2E2EA 4LRZA 4FADA 3LVRE 3TG4A 3TXNA 3ZIMA 3T8MA 3ZHEB 4ACKA 4JA9A 1IHGA 3ONKA 3QK0A 2V0PA 2WXRA 3ZRHA 2I6HA 3I3NA 3Q5MA 2WMNA 3R7RA 2OV8A 3L6AA 4UQXA 4JW1A 3RO3A 3FUEA 1PY1A 3HYMB 1FVHA 1HE8A 5FQ4A 1A17A 3FUIA 4GYYA 3ESKA 4JVSA 3ZPJA 4AV7A 2V4LA 4BSXA 4DLOA 3FTZA 2Y4UA 3SF4A 3LEWA 3SZ7A 4AOFA 4EZJA 2VJ8A 3UT4A 3VTXA 2BF0X 2CFUA 2IU1A 3FEYA 4K0RA 5ANLA 3CQCB 3IKOB 2IFUA 2WXHA 4HS2A 5BUZA 3CVXA 5JJ6A 1S0PA 3CVUA 3QWWA 2VQ2A 3SBTB 3TJPA 4U0SA 2FULA 3FUFA 5FZQA 4A1SA 4GMJA 5DBKA 5KJLA 4J8SA 3PE3A 4URKA 2VGYA 2WXJA 4KYOB 2Y3AA 2E0IA 3PEVB 4I1MA 4APOA 1GW6A 2L6JA 2RG8A 3CK7A 3FU5A 2IQCA 2LSUA 3MV2B 5EDSA 2A4ZA 3LY9A 1E8XA 4XI0A 2VGXA 2WXFA 1Y6IA 3QKYA 3L13A 4MLPA 1HX8A 3CVQA 3LJ3A 4AY5A 4I17A 4L1BA 3RRNB 3SHFA 1PAQA 2XHEA 2X6FA 1E7VA 4FJZA 4WNFA 4WAFA 5FQ6A 4G25A 3MKQA 1VDYA 3APFA 2FEZA 4N39A 5FZSA 1UJKA 2ILRA 3G2TA 5J08A 3CHOA 4DI4A 3MX3A 4AP2A 4BY6A 4G24A 3APDA 3SI5A 2EQXA 4KBQA 3T5XA 2XEVA 3NZSA 1HG5A 2V8SE 3E4BA 4FC8A 5FQ7A 3C98A 3RRMB 4WNGA 4IULA 4EECA 4CGVA 3CHPA 5BNWA 5FQ8A 3IV0A 4A3VA 4B8CB 5LFAA 4FJYA 5E75A 4GZCA 3JCKC 4AVXA 3EIJA 5ARGA 3S2AA 4XIFA 1NA3A 5G55A 2JLBA 3CVNA 4BT9A 3CVPA 4O6FA 4DPRA 3LPZA 2WXGA 4DLQA 3PEUB 3MEKA 4BFRA 2WXQA 3FTSA 3IEGA 3ZVVA 3FUHA 2HR2A 2WPVA 5G2NA 2CHWA 3CV0A 4U07A 3HVEA 3FU6A 2BTDA 3OXLA 1UG3A 3QARA 4Q94A 4UWFA 4L2YA 3D9NA 3RO2A 5EX0A 2CHXA 1Y8MA 2WXMA 3ESLA 2AXVA 4TUUA 1NP7A 4ANVA 4HLEA 4XZ4A 5FZRA 4EQFA 5LCWJ 4U0ZA 3GZ1A 3P2BA 2GW1A 3K9IA 3PS6A 4PS7A 5EKQD 2FO7A 4GYWA 4GMLA 3Q4AB 3FH7A 3CSFA 5JHAA 3MZLB 4KZ0A 2Y4TA 3FTWA 4L7TA 3GZSA 4I6JA 1EYHA 1WY6A 2OOEA 3LY8A 4TRQA 4RSYA 4AY6A 5HI7A 3KEZA 3G2UA 4J6IA 4HOTA 2LO6A 4P29A 2FF4A 3ENEA 1TJCA 4MRUA 4OVVA 4GA2A 3ZYQA 4ANWA 4BX8A 4AM9A 3Q47B 4WWOA 1E8ZA 2YHCA 3ZXSA 4I9EA 3OXFA 3KAEA 3LYAA 3FP3A 4UQZA 3B7SA 2HM8A 1H2VC 4I9CA 5LP0A 3EHNA 3RK6A 4HVBA 3FUJA 3CK9A 4ILGA 3VLFA 2IJGX 5JJ7A 2VTBB 4F7AA 2IOLA 3PUKA 3BG0B 2RD0A 4J8EA 4ACLA 1KT1A 2L0IA 2CG2A 2Q7FA 1XGWA 4BTBA 4I6EA 4DJAA 4MKTA 1XNFA 2PQRA 3FUMA 2UY1B 2WVIA 2WXPA 3D9KA 4YNDA 4UWLA 2UY1A 1OWPA 3TG5A 4N2SA 4FULA 4JEUA 4JA7A 1L5JA 1U3CA 1JUQA 2XCBA 3FU3A 4H7YA 3I4GA 4A1GA 4C0MA 4CT0A 3ONLA 2L9BA 3IHVA 1ZBPA 5M72A 1MHQA 3GZ2A 5AYWD 3RJVA 3TXMA 4RG6A 4OYSA 4AEZC 3JYSA 4AXHA 2AXUA 2QY7A 5G04C 4C9BB 4APFA 4WWNA 1NZNA 3G2WA 3JUIA 3PNTB 4DK5A 3D9IA 1SZ9A 1YA0A 4UI9K 3U66A 3ZN3A 4YVOA 5KJMA 1E90A 3FFLA 3PZDA 1UN9A 5BV1A 3HHMA 3DPDA 3GYZA 2XPZA 3G2SA 5DIZA 3FEXA 3L16A 4K03A 1WAO1 4Y6WA 4G26A 4R7LA 4XI9A 3S7FA 3ULQA 3D9LA 4ILHB 4QFVA 1LF8A 2HYZA 3FUDA 3SBSA 1U3DA 3ASFA 5LCWC 1DNPA 3FTUA 3UMVA 2CG3A 4FP7A 1Z3YA 4UWKA 4IYPA 3SD5A 2IF4A 2NXPA 3ZYKA 3QWPA 4G1TA 4GB9A 2PZIA 3FTVA 1HG2A 4LCTA 3R9AB 3BG1B 4BX9A 2R59A 5FT9A 1HU3A 1JWGA 4XX5A 1KLXA 1TEZA 4KXKB 3L08A 3ML9A 3FH5A 4I1OB 3ASHA 4ME2A 2J4DA 4B0ZA 2I1KA 1H0AA 2JEKA 3D9OA 3FY4A 1OWMA 1KT0A 2I1JA 3B7RL 2X6IA 1ELRA 2XPIA 3IBEA 3L54A 2DIWA 3ML8A 4CT4A 5CCMA 1N54A 5LOZA 1TJFA 1WM5A 3CQGB 5CMYA 3FWVA 4CGWA 4B89A 2WXLA 3FULA 3UQ3A 4UQYA 3D9MA 4J8DA 4J8FA 1HF8A 4GA1A 4I43A 4U63A 3FHEA 1HFAA 4GCNA 4WUYA 1JPLA 3P1UA 3ZYLA 2KM4A 2X3MA 3RRUA 5A23A 3ASDA 1FCHA 4GZ6A 1N52A 3CHSA 3VLDA 2P58C 3R7QA 3QJZA 5AJDA 4HOSA 2XGOA 3MKQB 2DCPA 5BPPA 1W3BA 4KT6B 2OVBA 5FWQA 4CRWA 4UWGA 2AXZA 1B89A 1E8WA 5J90A 2XPYA 4JHRA 1E8YA 2VSXE 4WWPA 2NC9A 4CDNA 4MS6A 3Q15A 4I2ZA 3RU0A 2I2OA 4E85A 5HQ8A 3D9PA 3CHMA 4L23A 2ZU6B 3FH8A 3D3MA 4GAAA 1IQRA 2DBAA 2OVFA 3MJWA 4EPZA 2GRMA 4CDMA 4LUNU 3UT7A 3MA5A 4A3TA 2LSVA 4F3VA 4ANXA 5T8IA 5G05C 3NF1A 2C0LA 3VTYA 2WQ6A 3CVLA 1H2UA 3OTNA 1PC2A 4PS3A 4GYOA 1H2TC 3QOUA 3CIAA 3U9WA 3G2VA 4HOUA 3BEEA 3AS8A 3EDTB 3CR3A 3TAXA 4N3AA 5D0QD 4AIFA 3AU5A 1ELWA 4HXIA 1SQMA 3I4RB 4ILIA 3QC1A 4JHKA 4NRHB 4W9RA 2R17C 3CSTA 4G23A 2WXKA 2VSYA 1EPUA 1UJJA 3PE4A 1OWLA 2X6JA 3ZHEA 3Q49B 3MYVA 1SZAA 4JHJA 2KCKA 1UW4B 4FHJA 2J4BA 3FTYA 1H6KA 3L17A 2MOWA 2VYIA 2X38A 3B7TA 3N71A 4FU3A 2YINA 3DBSA 4KZCA 3UT8A 4EBAA 3UX4A 1EF1C 1ELKA 2LNIA 2FBNA 3QB2A 4RG9A 4ANUA 1P5QA 3B7UX 4JPSA 4FA6A 5G04J 4BTAA 3I5PA 2XGMA 3L22A 4I1AA 4JZYA 1HXIA 5EX3A 1QZ2A 4EBAG 4U04A 4GZ5A 2V5FA 3O4ZA 3U64A 2PM7A 3CVWA 2LAIA 2C2LA 4Y6CA 4PS8A 4LEUA 3S7JA 3LS8A 3SNXA 1OUVA 4H7XA 4GPKA 4GA0A 4UI9J 4XE0A 2WQ7A 3MCXA 3FUNA 4OVUA 1BPOA 3AU4A 3CK8A 4U0UA 2PQNA 1INZA 3O48A 4N3CA 5CCLA 1IQUA 4PDXA 3U3WA 3PUJA 4G2VA 2XGSA 4KMOA 4PH4B 1QQEA 2A5UA 2J9QA 3JQ0A 3URZA 1X5BA 4ATGA 3KS2A 1EDUA 4NACA 4B8AA 3UUXA 2VSNA 3RIBA 2KCLA 4FLHA 4AJWA 2WB2A 2KATA 4UI9C 1JWFA 2WXNA 2J07A 3PH0C 5JJTA 3ZW3A 4WNDA 3B13A 3PVLA 2M63A 5E76A 5BT1A 3QDNA 1NA0A 4G11A 3WXXA 5LX8A 3QAQA 4CCAA 4N3BA 2AVPA 4FLBA 2NSZA 2X6KA 3LCAA 5ARFA 3TGOA 3ASGA 2WM9A 3KD7A 4NQ0A 3FU0A 2YNQA 2MHKA 2VTBA 1Z6TA 4XKBA 1OWOA 4E6HA 4I6GA 4L2LA 4Q69A 3PRZA 4F53A 4PUCA 4FHKA 4KVOA 3U4TA 2WXIA 4C0EA 3ZEFA 2GGFA 3CKCA 4JXTA 3D9JA 2XRYA 4RVBA 3ZGQA 4A55A 2WQHA 2XQ0A 3LKUA 2LAHA 2MRIA 4JL0A 5AJLA 1QNFA 1UN8A 3QWVA 2ONDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N52 A;  2FUL A;  4GML A;  4GMJ A;  2IOL A;  1H2U A;  1H2T C;  4CEM A;  3FEX A;  4CT4 A;  2RG8 A;  3L6A A;  4CRW A;  2KZT A;  1N54 A;  4B89 A;  4JHK A;  3EIQ C;  4IUL A;  2VSX E;  4B8A A;  1UG3 A;  2GGF A;  2I2O A;  4B8C B;  2VSO E;  2IU1 A;  2ZU6 B;  3FEY A;  2IOS A;  3D3M A;  4JHJ A;  2HM8 A;  1H2V C;  5ANR A;  2ION A;  3EIJ A;  1PAQ A;  1HU3 A;  1UW4 B;  2KZT B;  3RK6 A;  4C9B B;  4LUN U;  3JUI A;  1H6K A;  2NSZ A; 
#chains in the Genus database with same CATH topology
 4Q96 A;  3LVQ E;  4BWR A;  4EZL A;  3CVY A;  5AEN A;  5D2M C;  3CEQ A;  5FTP A;  3JQ1 A;  2NYJ A;  2VSO E;  3APC A;  3V79 K;  4N5C A;  5JHB A;  3AS5 A;  5KJN A;  5FJY A;  3SQV A;  2EIM E;  2J8S D;  3QNK A;  5CBO A;  2H6G A;  4HOQ A;  3TL5 A;  2YQ8 A;  4JC8 A;  2F37 A;  4B93 B;  5BW8 C;  2QFC A;  4NUR A;  3NOG D;  4OAV B;  1MX6 A;  1V54 E;  3S7B A;  1FPP A;  5C1D A;  3OXG A;  2J08 A;  2RKK A;  2VGE A;  5CMW A;  4U8H A;  4ABN A;  2BKK B;  2R5S A;  4GU5 A;  2ION A;  3CKB A;  3T8M A;  3ZHE B;  4ACK A;  2F8Y A;  4JA9 A;  1IHG A;  3QK0 A;  4BSZ B;  2V0P A;  4A63 B;  3Q5M A;  3R7R A;  3RO3 A;  4GTV A;  4AV7 A;  3ZPJ A;  2V4L A;  4HRN A;  4EZJ A;  3W9F A;  3CQC B;  4HS2 A;  2WXH A;  5ENS D;  1SW6 A;  5B1A E;  5CED B;  3V31 A;  5DBK A;  2EIL E;  5KJL A;  2WXJ A;  4KYO B;  4I1M A;  1GW6 A;  2A4Z A;  1E8X A;  4XI0 A;  3E33 A;  2WXF A;  1MYO A;  3UIP C;  1KPS B;  4MLP A;  4I17 A;  4L1B A;  3SHF A;  2XHE A;  3E32 A;  4FJZ A;  5FQ6 A;  4G25 A;  3J5Q B;  3APF A;  4YDE A;  2FEZ A;  4N39 A;  1UJK A;  3CHO A;  4BY6 A;  2ZGD A;  1H6O A;  3T5X A;  3UM3 A;  5FQ7 A;  4DX5 D;  3BU8 A;  4B8C B;  4GTP A;  4GZC A;  3HG0 D;  1JCQ A;  3ZKJ A;  3CVN A;  4DPR A;  4O6F A;  2WXQ A;  3FTS A;  3ZVV A;  2ETB A;  3LJN A;  4HRM B;  2WPV A;  2CHW A;  2IEJ A;  4U07 A;  3HVE A;  3RO2 A;  5EX0 A;  2AXV A;  5HKP A;  5FZR A;  4EQF A;  3GZ1 A;  1BI7 B;  3P2B A;  3K9I A;  3PS6 A;  5EYP F;  2FO7 A;  4GML A;  3UM1 A;  4EHM A;  2Y4T A;  3GZS A;  3LY8 A;  4DX2 A;  3KEZ A;  2RFA A;  4P29 A;  1BI8 B;  3ENE A;  3ZYQ A;  3Q47 B;  3OXF A;  3FP3 A;  5ENR D;  2HM8 A;  1YMP A;  3EHN A;  3RK6 A;  4HVB A;  4HI8 A;  2IY0 C;  2VTB B;  2IOL A;  3PUK A;  3BG0 B;  4J8E A;  4MKT A;  1XNF A;  4FUL A;  4JA7 A;  3FU3 A;  4H7Y A;  2XCB A;  3ABL E;  4C0M A;  3ONL A;  2L9B A;  3IHV A;  1ZBP A;  3ABM E;  3GZ2 A;  5AYW D;  4RG6 A;  1BU9 A;  3JYS A;  4AXH A;  2QY7 A;  4WWN A;  3DSV A;  1YA0 A;  4YVO A;  2OCC E;  3FFL A;  3DPD A;  1K1A A;  3L16 A;  4Y6W A;  1K3Z D;  4R7L A;  4DX1 A;  1NL4 A;  3ASF A;  2CG3 A;  4FP7 A;  5FIO A;  3QWP A;  5EYL A;  3E34 A;  5FT9 A;  1HU3 A;  1JWG A;  1KLX A;  4KXK B;  3FH5 A;  3ASH A;  3BUA A;  2J4D A;  2I1K A;  2JEK A;  1OWM A;  4DRX E;  2I1J A;  3PZ3 A;  3L54 A;  5LOZ A;  5CRV A;  4B89 A;  2WXL A;  4UQY A;  2EIK E;  3D9M A;  4J8D A;  3Q75 A;  4O1O A;  4WUY A;  2KM4 A;  3R7Q A;  3C3R A;  4HOS A;  1TYQ G;  5BPP A;  1W3B A;  4CRW A;  4UWG A;  1E8Y A;  4CDN A;  4E85 A;  5HQ8 A;  3CHM A;  2ZU6 B;  3NBN B;  3DSX A;  5KBA A;  1IQR A;  2DBA A;  3UT7 A;  4F3V A;  1OXJ A;  4ANX A;  3NF1 A;  1PC2 A;  3U9W A;  1H2T C;  3QOU A;  3ZUV B;  3BEE A;  2XZD G;  2H6H A;  3TAX A;  3AU5 A;  1ELW A;  4CZ2 D;  3PE4 A;  4JHJ A;  4FHJ A;  3FTY A;  2VYI A;  2X38 A;  3AG4 E;  3N71 A;  1N0R A;  4ZHB A;  3DBS A;  3UT8 A;  3UX4 A;  2FBN A;  3B7U X;  4FA6 A;  4JZY A;  4I1A A;  1QZ2 A;  4EBA G;  1K8K G;  4LEU A;  3SNX A;  1QBQ A;  3TWV A;  4UI9 J;  3MCX A;  4OVU A;  3AU4 A;  5EIB E;  3O48 A;  3V2X A;  3HXD A;  3PZ4 A;  2XGS A;  3URZ A;  4C48 B;  3KS2 A;  1EDU A;  4B8A A;  3UUX A;  3RIB A;  2KAT A;  3PH0 C;  4WND A;  3PVL A;  5E76 A;  3QDN A;  3WXX A;  4N3B A;  3LCA A;  2LXM A;  3E37 A;  4G8L A;  3C3Q A;  3ISM C;  5B1B E;  3ASO E;  2VTB A;  5ENO D;  4XKB A;  4E6H A;  4I6G A;  4Q69 A;  3PRZ A;  4F53 A;  2GGF A;  2XS1 A;  3C3O A;  4JXT A;  4RVB A;  3HRA A;  2WQH A;  2LAH A;  4JL0 A;  5B3S E;  3EU9 A;  1LTX A;  3C72 A;  2XCC A;  2GRQ B;  1HO8 A;  2H6I A;  3HVE B;  5KJK A;  3Q78 A;  1DVP A;  2ZIS A;  3NQP A;  4F1P A;  2C0M A;  2CFZ A;  4HFG A;  1S63 A;  5G05 J;  4LER A;  4GTQ A;  3UKU G;  4V3I A;  4F1S A;  2X6H A;  3CLJ A;  1OWN A;  4Z68 A;  4IN3 B;  4N2Q A;  1HH8 A;  3LXU X;  4EZK A;  1IYG A;  2IOS A;  2WMO A;  4DUI A;  2PM6 A;  4F6R D;  3OAW A;  4GCO A;  3FDH A;  2AW6 A;  4YVQ C;  1MQS A;  4CEM A;  5AN8 A;  3CGH A;  2CHZ A;  2L0T B;  3RKV A;  4HOR A;  2V4H C;  5T4Y A;  4GZ3 A;  3EHM A;  5ANR A;  3HXE A;  5T3R A;  3IXE A;  4LRZ A;  3LVR E;  5BXO A;  5ENP D;  3RAU A;  2WXR A;  3ZRH A;  2P9N G;  4UQX A;  3EUV A;  3HYM B;  1FVH A;  1HE8 A;  3EU5 A;  3FUI A;  4GYY A;  4DLO A;  4BSX A;  3TWW A;  3LEW A;  3VTX A;  2CFU A;  2IU1 A;  5ANL A;  2IFU A;  1NFI E;  1S0P A;  4A1S A;  4GMJ A;  3PE3 A;  2VGY A;  2Y3A A;  2E0I A;  1U2V G;  2L6J A;  2RG8 A;  4GMR A;  3FU5 A;  2IQC A;  2LSU A;  2VGX A;  1Y6I A;  3AJI A;  3L13 A;  2XEE A;  1PAQ A;  2X6F A;  3MKQ A;  1VDY A;  5FZS A;  3G2T A;  3MX3 A;  4AP2 A;  3APD A;  3SI5 A;  1KZO A;  1SA5 A;  4EEC A;  4CGV A;  4XIF A;  4TUM A;  2R03 A;  4HBD A;  4HI9 A;  4BT9 A;  3PEU B;  4BFR A;  4LNU D;  5G2N A;  3Q9U C;  2BTD A;  4UWF A;  4Q94 A;  2P9P G;  4RLY A;  3D9N A;  4TUU A;  4XZ4 A;  3ZNG A;  5LCW J;  3CSF A;  2ZXW E;  3X2Q E;  5EID A;  2BKG A;  1EYH A;  1WY6 A;  2MYO A;  3AAA C;  3DRA A;  5HI7 A;  3G2U A;  1SVX A;  4HOT A;  4BX8 A;  4OVV A;  2P2C P;  3KAE A;  3LYA A;  4UQZ A;  1AWC B;  1BD8 A;  1K1B A;  4GTT A;  2CG2 A;  2Q7F A;  4DJA A;  2PQR A;  4YND A;  1OWP A;  1L5J A;  4CT0 A;  5M72 A;  3TXM A;  2AXU A;  5G04 C;  4APF A;  3G2W A;  3JUI A;  4N5Q A;  1E90 A;  2XEH A;  3GYZ A;  5DIZ A;  3FEX A;  1WAO 1;  1MJ0 A;  4G26 A;  3S7F A;  2LXL A;  4QFV A;  3FUD A;  1U3D A;  4BER A;  2R05 A;  3DPY A;  1OCR E;  4TXR A;  1N0Q A;  4LCT A;  3BG1 B;  1TEZ A;  2R59 A;  1IHB A;  5AQ9 A;  3D9O A;  1KT0 A;  2XPI A;  3C5R A;  2L6B A;  3ML8 A;  3ULE G;  1OT8 A;  1N54 A;  1WM5 A;  4G8K A;  5KNH D;  3FUL A;  1N4R A;  1DCE A;  3ASN E;  5AQA A;  1WG0 A;  4GCN A;  2LUH A;  2V5Q C;  5A23 A;  3Q7F A;  1OCO E;  4GZ6 A;  5AJD A;  4M7C A;  3MKQ B;  3EHQ A;  5FWQ A;  1B89 A;  2XPY A;  4JHR A;  2VSX E;  4WWP A;  2NC9 A;  4MS6 A;  2I2O A;  4L23 A;  3D3M A;  2OVF A;  2GRM A;  4CDM A;  5T8I A;  1O1T A;  5G05 C;  3DSW A;  2WQ6 A;  3CVL A;  4GYO A;  4NRH B;  4JHK A;  4ATZ D;  3CST A;  2X6J A;  1SZA A;  3HXF A;  1O1R A;  2KCK A;  2J4B A;  1DCQ A;  1H6K A;  1N11 A;  1SA4 A;  1O5M A;  3Q79 A;  3ZU7 B;  4KZC A;  4EBA A;  3QB2 A;  4ANU A;  5KWD A;  3L22 A;  1TR4 A;  1LD8 A;  3TWS A;  3U64 A;  4Y6C A;  4GPK A;  3FUN A;  3PZ2 A;  1BPO A;  1V55 E;  4KMO A;  1X5B A;  4NAC A;  2VSN A;  2KCL A;  4FLH A;  4AJW A;  2WB2 A;  2KXP C;  3KEA A;  4J7W A;  4UI9 C;  5EIL A;  3B13 A;  4DX7 D;  1NA0 A;  4LNB A;  3QAQ A;  4UUC A;  2AVP A;  4FLB A;  2X6K A;  5ENQ D;  4NQ0 A;  2GRP B;  2YNQ A;  3DSU A;  3EHR A;  4KVO A;  2RFM A;  4JB8 P;  3T9K A;  2XRY A;  4L9P A;  4A55 A;  2XQ0 A;  4TXP A;  5AJL A;  3ULY A;  1UN8 A;  3MGB A;  4J0U A;  3FUK A;  2J49 A;  5A7D B;  3SO8 A;  5C2Y A;  2KZT A;  5CHE E;  4DI3 A;  4I2W A;  3NOC D;  4WNE A;  1Z3X A;  3PDN A;  3LY7 A;  4BT8 A;  3VLE A;  4D10 C;  2ZIR A;  3ZFW A;  3T5V A;  3ZYM A;  2BUG A;  4HRL A;  1H19 A;  1ZU2 A;  3Q7A A;  5JMN D;  3HDX A;  3DXM G;  4XKC A;  4CDR A;  4B94 A;  1E7U A;  4JEH A;  2XEN A;  4K5A B;  3AS4 A;  1Z5S C;  2KCV A;  2P9K G;  3CHQ A;  2XRZ A;  3PRE A;  4IRU A;  3W9G A;  2FI7 A;  2DWZ A;  3EIQ C;  3MV3 B;  3PNL B;  5FIN A;  5D0O D;  2ZGG A;  4K5B A;  4TV3 A;  5BV0 A;  2KZT B;  4FAD A;  1QYM A;  2E2E A;  3TG4 A;  1D8E A;  3ZIM A;  3ONK A;  1TNY A;  2BED A;  2I6H A;  2OEW A;  3I3N A;  2OV8 A;  1TN7 A;  3L6A A;  1PY1 A;  5FQ4 A;  4GTS A;  3FTZ A;  4AOF A;  3SZ7 A;  2QYJ A;  3UT4 A;  2EIJ E;  3FEY A;  2HE0 A;  3IKO B;  3J5P A;  3CVX A;  3CVU A;  2VQ2 A;  3SBT B;  3TJP A;  4U0S A;  2FUL A;  4URK A;  3DXK G;  4APO A;  3JXJ A;  3CK7 A;  3MV2 B;  1A5E A;  3LY9 A;  1IXV A;  3UXG A;  1FT1 A;  1HX8 A;  3LJ3 A;  1OY3 D;  5BXU A;  3TWT A;  3SFY A;  1E7V A;  4WNF A;  4WAF A;  3WG7 E;  5J08 A;  4G24 A;  4KBQ A;  3L9T A;  2XEV A;  2QC9 A;  3NZS A;  2V8S E;  3E4B A;  3RRM B;  4WNG A;  4IUL A;  2PNN A;  5FQ8 A;  3IV0 A;  4A3V A;  5G55 A;  3CVP A;  3LPZ A;  3MEK A;  3UIN C;  4U95 D;  3NAW A;  4U7E B;  4JD2 G;  1UG3 A;  3QAR A;  4L2Y A;  5HS0 A;  3DEP A;  2CHX A;  1Y8M A;  2WXM A;  4ANV A;  4HLE A;  4U0Z A;  2GW1 A;  4PS7 A;  5JHA A;  3DWL G;  4HLL A;  3MZL B;  4L7T A;  4RSY A;  1KZP A;  2Y69 E;  4J6I A;  2LO6 A;  5KNG A;  4ANW A;  4GA2 A;  1ZB1 A;  4AM9 A;  1TN8 A;  1E8Z A;  3ZXS A;  4I9C A;  5LP0 A;  4O1P A;  3CK9 A;  4ILG A;  2IJG X;  1YYH A;  4U96 D;  1N94 A;  2RD0 A;  1KT1 A;  2L0I A;  1XGW A;  4I6E A;  5H7P A;  2UY1 B;  2WVI A;  4UWL A;  2UY1 A;  4N2S A;  4J8Y A;  4JEU A;  3DST A;  4A1G A;  1U3C A;  1JUQ A;  1TNO A;  1RZ4 A;  1NZN A;  4DK5 A;  3U66 A;  5KJM A;  5BV1 A;  2QYU A;  3DEO A;  2R2L A;  5ITZ F;  4K03 A;  4MBG A;  2KBX A;  1LF8 A;  2HYZ A;  1DNP A;  3FTU A;  3HXC A;  4IYP A;  2IF4 A;  2NXP A;  4G1T A;  4GB9 A;  3FTV A;  1HG2 A;  4BX9 A;  3R9A B;  4DX6 D;  2GRN B;  3L08 A;  4ME2 A;  4B0Z A;  1ELR A;  3IBE A;  4CT4 A;  2DIW A;  3CQG B;  5CMY A;  4CYM D;  4CGW A;  3UQ3 A;  1HF8 A;  1JPL A;  3ZYL A;  2X3M A;  3RRU A;  1FCH A;  1N52 A;  3CHS A;  2P58 C;  3QJZ A;  1H6P A;  2AXZ A;  5J90 A;  4GTO A;  3D9P A;  3FH8 A;  3MJW A;  4LUN U;  3MA5 A;  3VTY A;  4PS3 A;  3CIA A;  3TWQ A;  3G2V A;  1UOH A;  3EDT B;  3CR3 A;  4N3A A;  4AIF A;  2Y1L E;  1SQM A;  2QZA A;  4QQI A;  4G23 A;  2VSY A;  1UJJ A;  1OWL A;  2XZT G;  3Q49 B;  3MYV A;  4X8Q A;  1UW4 B;  3L17 A;  2MOW A;  3B7T A;  2B6C A;  2DYR E;  5CBN A;  4FU3 A;  3DSS A;  1ELK A;  1P5Q A;  1N4P A;  2DVW A;  3I5P A;  5EX3 A;  1HXI A;  1TN6 A;  4U04 A;  2V5F A;  3O4Z A;  2PM7 A;  3CVW A;  2LAI A;  2R02 A;  4PS8 A;  3UI2 A;  3LS8 A;  1OUV A;  4XE0 A;  4U8Y D;  4U0U A;  2PQN A;  1INZ A;  4N3C A;  1IQU A;  3U3W A;  3PUJ A;  3JQ0 A;  4ATG A;  4BET A;  4BES A;  5CER B;  2XS8 A;  5JJT A;  1IKN D;  1X81 A;  4HNA D;  5BT1 A;  3AG1 E;  2IO2 C;  2NSZ A;  1TNZ A;  2P9U G;  3TGO A;  5CEC B;  3ASG A;  3FU0 A;  2MHK A;  1Z6T A;  1OWO A;  3B7B A;  4PUC A;  4FHK A;  3TWR A;  3U4T A;  2WXI A;  4C0E A;  3CKC A;  3LKU A;  2MRI A;  1QNF A;  3QWV A;  2OEV A;  3CVV A;  4LSZ E;  3AG2 E;  1HS6 A;  2YHE A;  3FTX A;  3SGH A;  3BQO A;  3MKR A;  2I9C A;  4YDW A;  3UTM A;  3SFZ A;  1FVF A;  4M3O A;  1MX2 A;  2J09 A;  2IO3 C;  5KCM A;  2GRO B;  5ENN A;  3S7D A;  2WXO A;  3CHR A;  5AIJ A;  4GZD A;  2PL2 A;  3KSL A;  5CEA A;  3EJN A;  3NZU A;  4KVM A;  3UPV A;  3UIO C;  1S64 A;  2GRL A;  3GW4 A;  2AWI A;  2VGX B;  5A6C A;  2UWJ G;  5ENT D;  2HO1 A;  4UWH A;  1N4S A;  2KC7 A;  2F8X K;  4HQD A;  4K5C A;  3HIZ A;  3NB2 A;  3D9H A;  1HZ4 A;  3V30 A;  3IHY A;  3LDZ A;  4YDY A;  3TXN A;  4ZFH A;  3SFX A;  3TWX A;  2WMN A;  4JW1 A;  3FUE A;  1A17 A;  2DZO A;  4JVS A;  3ESK A;  3SF4 A;  2Y4U A;  5EN5 D;  2VJ8 A;  2BF0 X;  4K0R A;  4O60 A;  5BUZ A;  5JJ6 A;  3QWW A;  5JA4 D;  5FZQ A;  3FUF A;  4J8S A;  3PEV B;  1MZC A;  5EDS A;  2AJA A;  3QKY A;  5AQ7 A;  3CVQ A;  2GRR B;  4AY5 A;  3RRN B;  2EIN E;  2ILR A;  4DI4 A;  2FO1 E;  2EQX A;  2Y0B G;  4HB5 A;  1HG5 A;  4GTR A;  4BEP A;  4FC8 A;  3C98 A;  1S70 B;  3CHP A;  5BNW A;  2P9I G;  3Q73 A;  1O1S A;  5LFA A;  4FJY A;  5E75 A;  3JCK C;  4AVX A;  3EIJ A;  5ARG A;  3S2A A;  1NA3 A;  2JLB A;  5HRY A;  3ZXP A;  2WXG A;  4DLQ A;  3IEG A;  4RQI A;  2B0O E;  3FUH A;  2HR2 A;  3TWU A;  3CV0 A;  1WDY A;  3FU6 A;  3OXL A;  3UM0 A;  3ESL A;  1NP7 A;  1G3N B;  5EKQ D;  4GYW A;  3Q4A B;  3FH7 A;  4KZ0 A;  3UKR G;  3FTW A;  4I6J A;  2OOE A;  4TRQ A;  4AY6 A;  2DYS E;  1N9A A;  3ABK E;  2FF4 A;  1TJC A;  4MRU A;  4WWO A;  2YHC A;  4I9E A;  4YDO A;  1N4Q A;  3B7S A;  1H2V C;  4XEI G;  3PZ1 A;  3FUJ A;  5JJ7 A;  3VLF A;  2A5E A;  1DC2 A;  4F7A A;  4ACL A;  4NIK A;  4BTB A;  3UM2 A;  3FUM A;  3D9K A;  2H6F A;  2WXP A;  3TG5 A;  3I4G A;  3KSQ A;  4LNG A;  1MHQ A;  3RJV A;  4AEZ C;  4OYS A;  1YCS B;  4C9B B;  3PNT B;  3D9I A;  1SZ9 A;  4UI9 K;  3ZN3 A;  3PZD A;  3F6Q A;  3Q9N C;  1UN9 A;  3HHM A;  2XPZ A;  3E30 A;  3G2S A;  3T8K A;  4XI9 A;  3ULQ A;  2JAB A;  3D9L A;  5IY5 E;  4ILH B;  3SBS A;  5LCW C;  3UMV A;  1Z3Y A;  1D9S A;  4UWK A;  3SD5 A;  3ZYK A;  2PZI A;  1NI1 A;  4XX5 A;  1N95 A;  3ML9 A;  4I1O B;  2ETA A;  3AG3 E;  1H0A A;  3FY4 A;  3B7R L;  4LG6 A;  2X6I A;  3B95 A;  5CCM A;  1D8D A;  1TJF A;  3FWV A;  2P9S G;  4J8F A;  4GA1 A;  4I43 A;  1OCZ E;  4U63 A;  3FHE A;  1HFA A;  3P1U A;  1LD7 A;  3ASD A;  3VLD A;  2XGO A;  2DCP A;  4KT6 B;  2OVB A;  1E8W A;  5CRU A;  4GPM A;  3SY2 A;  1RW2 A;  3Q15 A;  4I2Z A;  3RU0 A;  4GAA A;  4EPZ A;  2ETC A;  4A3T A;  2LSV A;  1OCC E;  5D66 A;  2C0L A;  5AAR A;  4U8V D;  1FT2 A;  1H2U A;  3OTN A;  4HOU A;  3AS8 A;  5D0Q D;  4HXI A;  1BLX B;  4W9R A;  3I4R B;  4ILI A;  3QC1 A;  4TXQ A;  1TNU A;  2R17 C;  4GTM A;  2WXK A;  1EPU A;  2P9L G;  1JCR A;  3ZHE A;  1MX4 A;  2F0Y A;  3JXI A;  1AP7 A;  2YIN A;  1EF1 C;  2LNI A;  4RG9 A;  3JUE A;  4JPS A;  5G04 J;  5AAO A;  4BTA A;  2XGM A;  4GZ5 A;  3V2O A;  2C2L A;  5AQB A;  3S7J A;  4H7X A;  4GA0 A;  2WQ7 A;  3R9M A;  3CK8 A;  5CCL A;  4PDX A;  3RSE G;  2DZN A;  4G2V A;  4PH4 B;  1QQE A;  2A5U A;  2J9Q A;  4OAU C;  1JWF A;  2WXN A;  2J07 A;  3ZW3 A;  2M63 A;  4G11 A;  5LX8 A;  3L82 A;  1Q2Z A;  4CCA A;  3HXB A;  5ARF A;  2WM9 A;  3KD7 A;  1TNB A;  4L2L A;  3ZEF A;  3D9J A;  3ZGQ A;  1E96 B;  1JCS A;  2OND A; 
#chains in the Genus database with same CATH homology
 4Q96 A;  3MGB A;  3CVV A;  4J0U A;  2XCC A;  3LVQ E;  3FUK A;  1HS6 A;  1HO8 A;  2J49 A;  5A7D B;  3HVE B;  4BWR A;  4EZL A;  3CVY A;  5C2Y A;  2KZT A;  2YHE A;  3FTX A;  5KJK A;  3SGH A;  5CHE E;  1DVP A;  4DI3 A;  3NQP A;  5AEN A;  2C0M A;  2CFZ A;  3MKR A;  2I9C A;  3CEQ A;  4HFG A;  4I2W A;  4WNE A;  1Z3X A;  3JQ1 A;  3PDN A;  5FTP A;  3LY7 A;  5G05 J;  3SFZ A;  4BT8 A;  2VSO E;  3APC A;  3VLE A;  4D10 C;  3ZFW A;  4LER A;  1FVF A;  3T5V A;  4M3O A;  4N5C A;  3ZYM A;  5JHB A;  2BUG A;  3AS5 A;  1H19 A;  2J09 A;  5KJN A;  1ZU2 A;  5KCM A;  5ENN A;  4V3I A;  5FJY A;  3S7D A;  4F1S A;  2WXO A;  3CHR A;  2X6H A;  3HDX A;  3CLJ A;  4GZD A;  4XKC A;  5AIJ A;  1OWN A;  3QNK A;  2PL2 A;  4HOQ A;  3TL5 A;  4CDR A;  4B94 A;  2YQ8 A;  4IN3 B;  3EJN A;  3NZU A;  4JC8 A;  4KVM A;  4N2Q A;  1E7U A;  4JEH A;  1HH8 A;  3UPV A;  3LXU X;  5BW8 C;  2QFC A;  4EZK A;  1IYG A;  2IOS A;  1E96 B;  2WMO A;  3AS4 A;  2GRL A;  4NUR A;  3GW4 A;  2KCV A;  2PM6 A;  3OAW A;  3S7B A;  3CHQ A;  2XRZ A;  2AWI A;  2VGX B;  4GCO A;  3FDH A;  5A6C A;  2AW6 A;  4YVQ C;  2UWJ G;  5C1D A;  1MQS A;  3PRE A;  4CEM A;  3OXG A;  2HO1 A;  4IRU A;  2J08 A;  3CGH A;  4UWH A;  2FI7 A;  2CHZ A;  2KC7 A;  5CMW A;  2L0T B;  3EIQ C;  3MV3 B;  3RKV A;  3PNL B;  4HOR A;  5T4Y A;  4U8H A;  3HIZ A;  4GZ3 A;  5D0O D;  4ABN A;  1HZ4 A;  2R5S A;  4GU5 A;  3IHY A;  3LDZ A;  3EHM A;  5ANR A;  2ION A;  4TV3 A;  5BV0 A;  2KZT B;  5T3R A;  3CKB A;  2E2E A;  4LRZ A;  4FAD A;  3LVR E;  3TG4 A;  3TXN A;  3ZIM A;  3T8M A;  3ZHE B;  4ACK A;  4JA9 A;  1IHG A;  3ONK A;  3QK0 A;  2V0P A;  2WXR A;  3ZRH A;  2I6H A;  3I3N A;  3Q5M A;  2WMN A;  3R7R A;  2OV8 A;  3L6A A;  4UQX A;  4JW1 A;  3RO3 A;  3FUE A;  1PY1 A;  3HYM B;  1FVH A;  1HE8 A;  5FQ4 A;  1A17 A;  3FUI A;  4GYY A;  3ESK A;  4JVS A;  3ZPJ A;  4AV7 A;  2V4L A;  4BSX A;  4DLO A;  3FTZ A;  2Y4U A;  3SF4 A;  3LEW A;  3SZ7 A;  4AOF A;  4EZJ A;  2VJ8 A;  3UT4 A;  3VTX A;  2BF0 X;  2CFU A;  2IU1 A;  3FEY A;  4K0R A;  5ANL A;  3CQC B;  3IKO B;  2IFU A;  2WXH A;  4HS2 A;  5BUZ A;  3CVX A;  5JJ6 A;  1S0P A;  3CVU A;  3QWW A;  2VQ2 A;  3SBT B;  3TJP A;  4U0S A;  2FUL A;  3FUF A;  5FZQ A;  4A1S A;  4GMJ A;  5DBK A;  5KJL A;  4J8S A;  3PE3 A;  4URK A;  2VGY A;  2WXJ A;  4KYO B;  2Y3A A;  2E0I A;  3PEV B;  4I1M A;  4APO A;  1GW6 A;  2L6J A;  2RG8 A;  3CK7 A;  3FU5 A;  2IQC A;  2LSU A;  3MV2 B;  5EDS A;  2A4Z A;  3LY9 A;  1E8X A;  4XI0 A;  2VGX A;  2WXF A;  1Y6I A;  3QKY A;  3L13 A;  4MLP A;  1HX8 A;  3CVQ A;  3LJ3 A;  4AY5 A;  4I17 A;  4L1B A;  3RRN B;  3SHF A;  1PAQ A;  2XHE A;  2X6F A;  1E7V A;  4FJZ A;  4WNF A;  4WAF A;  5FQ6 A;  4G25 A;  3MKQ A;  1VDY A;  3APF A;  2FEZ A;  4N39 A;  5FZS A;  1UJK A;  2ILR A;  3G2T A;  5J08 A;  3CHO A;  4DI4 A;  3MX3 A;  4AP2 A;  4BY6 A;  4G24 A;  3APD A;  3SI5 A;  2EQX A;  4KBQ A;  3T5X A;  2XEV A;  3NZS A;  1HG5 A;  2V8S E;  3E4B A;  4FC8 A;  5FQ7 A;  3C98 A;  3RRM B;  4WNG A;  4IUL A;  4EEC A;  4CGV A;  3CHP A;  5BNW A;  5FQ8 A;  3IV0 A;  4A3V A;  4B8C B;  5LFA A;  4FJY A;  5E75 A;  4GZC A;  3JCK C;  4AVX A;  3EIJ A;  5ARG A;  3S2A A;  4XIF A;  1NA3 A;  5G55 A;  2JLB A;  3CVN A;  4BT9 A;  3CVP A;  4O6F A;  4DPR A;  3LPZ A;  2WXG A;  4DLQ A;  3PEU B;  3MEK A;  4BFR A;  2WXQ A;  3FTS A;  3IEG A;  3ZVV A;  3FUH A;  2HR2 A;  2WPV A;  5G2N A;  2CHW A;  3CV0 A;  4U07 A;  3HVE A;  3FU6 A;  2BTD A;  3OXL A;  1UG3 A;  3QAR A;  4Q94 A;  4UWF A;  4L2Y A;  3D9N A;  3RO2 A;  5EX0 A;  2CHX A;  1Y8M A;  2WXM A;  3ESL A;  2AXV A;  4TUU A;  1NP7 A;  4ANV A;  4HLE A;  4XZ4 A;  5FZR A;  4EQF A;  5LCW J;  4U0Z A;  3GZ1 A;  3P2B A;  2GW1 A;  3K9I A;  3PS6 A;  4PS7 A;  5EKQ D;  2FO7 A;  4GYW A;  4GML A;  3Q4A B;  3FH7 A;  3CSF A;  5JHA A;  3MZL B;  4KZ0 A;  2Y4T A;  3FTW A;  4L7T A;  3GZS A;  4I6J A;  1EYH A;  1WY6 A;  2OOE A;  3LY8 A;  4TRQ A;  4RSY A;  4AY6 A;  5HI7 A;  3KEZ A;  3G2U A;  4J6I A;  4HOT A;  2LO6 A;  4P29 A;  2FF4 A;  3ENE A;  1TJC A;  4MRU A;  4OVV A;  4GA2 A;  3ZYQ A;  4ANW A;  4BX8 A;  4AM9 A;  3Q47 B;  4WWO A;  1E8Z A;  2YHC A;  3ZXS A;  4I9E A;  3OXF A;  3KAE A;  3LYA A;  3FP3 A;  4UQZ A;  3B7S A;  2HM8 A;  1H2V C;  4I9C A;  5LP0 A;  3EHN A;  3RK6 A;  4HVB A;  3FUJ A;  3CK9 A;  4ILG A;  3VLF A;  2IJG X;  5JJ7 A;  2VTB B;  4F7A A;  2IOL A;  3PUK A;  3BG0 B;  2RD0 A;  4J8E A;  4ACL A;  1KT1 A;  2L0I A;  2CG2 A;  2Q7F A;  1XGW A;  4BTB A;  4I6E A;  4DJA A;  4MKT A;  1XNF A;  2PQR A;  3FUM A;  2UY1 B;  2WVI A;  2WXP A;  3D9K A;  4YND A;  4UWL A;  2UY1 A;  1OWP A;  3TG5 A;  4N2S A;  4FUL A;  4JEU A;  4JA7 A;  1L5J A;  1U3C A;  1JUQ A;  2XCB A;  3FU3 A;  4H7Y A;  3I4G A;  4A1G A;  4C0M A;  4CT0 A;  3ONL A;  2L9B A;  3IHV A;  1ZBP A;  5M72 A;  1MHQ A;  3GZ2 A;  5AYW D;  3RJV A;  3TXM A;  4RG6 A;  4OYS A;  4AEZ C;  3JYS A;  4AXH A;  2AXU A;  2QY7 A;  5G04 C;  4C9B B;  4APF A;  4WWN A;  1NZN A;  3G2W A;  3JUI A;  3PNT B;  4DK5 A;  3D9I A;  1SZ9 A;  1YA0 A;  4UI9 K;  3U66 A;  3ZN3 A;  4YVO A;  5KJM A;  1E90 A;  3FFL A;  3PZD A;  1UN9 A;  5BV1 A;  3HHM A;  3DPD A;  3GYZ A;  2XPZ A;  3G2S A;  5DIZ A;  3FEX A;  3L16 A;  4K03 A;  1WAO 1;  4Y6W A;  4G26 A;  4R7L A;  4XI9 A;  3S7F A;  3ULQ A;  3D9L A;  4ILH B;  4QFV A;  1LF8 A;  2HYZ A;  3FUD A;  3SBS A;  1U3D A;  3ASF A;  5LCW C;  1DNP A;  3FTU A;  3UMV A;  2CG3 A;  4FP7 A;  1Z3Y A;  4UWK A;  4IYP A;  3SD5 A;  2IF4 A;  2NXP A;  3ZYK A;  3QWP A;  4G1T A;  4GB9 A;  2PZI A;  3FTV A;  1HG2 A;  4LCT A;  3R9A B;  3BG1 B;  4BX9 A;  2R59 A;  5FT9 A;  1HU3 A;  1JWG A;  4XX5 A;  1KLX A;  1TEZ A;  4KXK B;  3L08 A;  3ML9 A;  3FH5 A;  4I1O B;  3ASH A;  4ME2 A;  2J4D A;  4B0Z A;  2I1K A;  1H0A A;  2JEK A;  3D9O A;  3FY4 A;  1OWM A;  1KT0 A;  2I1J A;  3B7R L;  2X6I A;  1ELR A;  2XPI A;  3IBE A;  3L54 A;  2DIW A;  3ML8 A;  4CT4 A;  5CCM A;  1N54 A;  5LOZ A;  1TJF A;  1WM5 A;  3CQG B;  5CMY A;  3FWV A;  4CGW A;  4B89 A;  2WXL A;  3FUL A;  3UQ3 A;  4UQY A;  3D9M A;  4J8D A;  4J8F A;  1HF8 A;  4GA1 A;  4I43 A;  4U63 A;  3FHE A;  1HFA A;  4GCN A;  4WUY A;  1JPL A;  3P1U A;  3ZYL A;  2KM4 A;  2X3M A;  3RRU A;  5A23 A;  3ASD A;  1FCH A;  4GZ6 A;  1N52 A;  3CHS A;  3VLD A;  2P58 C;  3R7Q A;  3QJZ A;  5AJD A;  4HOS A;  2XGO A;  3MKQ B;  2DCP A;  5BPP A;  1W3B A;  4KT6 B;  2OVB A;  5FWQ A;  4CRW A;  4UWG A;  2AXZ A;  1B89 A;  1E8W A;  5J90 A;  2XPY A;  4JHR A;  1E8Y A;  2VSX E;  4WWP A;  2NC9 A;  4CDN A;  4MS6 A;  3Q15 A;  4I2Z A;  3RU0 A;  2I2O A;  4E85 A;  5HQ8 A;  3D9P A;  3CHM A;  4L23 A;  2ZU6 B;  3FH8 A;  3D3M A;  4GAA A;  1IQR A;  2DBA A;  2OVF A;  3MJW A;  4EPZ A;  2GRM A;  4CDM A;  4LUN U;  3UT7 A;  3MA5 A;  4A3T A;  2LSV A;  4F3V A;  4ANX A;  5T8I A;  5G05 C;  3NF1 A;  2C0L A;  3VTY A;  2WQ6 A;  3CVL A;  1H2U A;  3OTN A;  1PC2 A;  4PS3 A;  4GYO A;  1H2T C;  3QOU A;  3CIA A;  3U9W A;  3G2V A;  4HOU A;  3BEE A;  3AS8 A;  3EDT B;  3CR3 A;  3TAX A;  4N3A A;  5D0Q D;  4AIF A;  3AU5 A;  1ELW A;  4HXI A;  1SQM A;  3I4R B;  4ILI A;  3QC1 A;  4JHK A;  4NRH B;  4W9R A;  2R17 C;  3CST A;  4G23 A;  2WXK A;  2VSY A;  1EPU A;  1UJJ A;  3PE4 A;  1OWL A;  2X6J A;  3ZHE A;  3Q49 B;  3MYV A;  1SZA A;  4JHJ A;  2KCK A;  1UW4 B;  4FHJ A;  2J4B A;  3FTY A;  1H6K A;  3L17 A;  2MOW A;  2VYI A;  2X38 A;  3B7T A;  3N71 A;  4FU3 A;  2YIN A;  3DBS A;  4KZC A;  3UT8 A;  4EBA A;  3UX4 A;  1EF1 C;  1ELK A;  2LNI A;  2FBN A;  3QB2 A;  4RG9 A;  4ANU A;  1P5Q A;  3B7U X;  4JPS A;  4FA6 A;  5G04 J;  4BTA A;  3I5P A;  2XGM A;  3L22 A;  4I1A A;  4JZY A;  1HXI A;  5EX3 A;  1QZ2 A;  4EBA G;  4U04 A;  4GZ5 A;  2V5F A;  3O4Z A;  3U64 A;  2PM7 A;  3CVW A;  2LAI A;  2C2L A;  4Y6C A;  4PS8 A;  4LEU A;  3S7J A;  3LS8 A;  3SNX A;  1OUV A;  4H7X A;  4GPK A;  4GA0 A;  4UI9 J;  4XE0 A;  2WQ7 A;  3MCX A;  3FUN A;  4OVU A;  1BPO A;  3AU4 A;  3CK8 A;  4U0U A;  2PQN A;  1INZ A;  3O48 A;  4N3C A;  5CCL A;  1IQU A;  4PDX A;  3U3W A;  3PUJ A;  4G2V A;  2XGS A;  4KMO A;  4PH4 B;  1QQE A;  2A5U A;  2J9Q A;  3JQ0 A;  3URZ A;  1X5B A;  4ATG A;  3KS2 A;  1EDU A;  4NAC A;  4B8A A;  3UUX A;  2VSN A;  3RIB A;  2KCL A;  4FLH A;  4AJW A;  2WB2 A;  2KAT A;  4UI9 C;  1JWF A;  2WXN A;  2J07 A;  3PH0 C;  5JJT A;  3ZW3 A;  4WND A;  3B13 A;  3PVL A;  2M63 A;  5E76 A;  5BT1 A;  3QDN A;  1NA0 A;  4G11 A;  3WXX A;  5LX8 A;  3QAQ A;  4CCA A;  4N3B A;  2AVP A;  4FLB A;  2NSZ A;  2X6K A;  3LCA A;  5ARF A;  3TGO A;  3ASG A;  2WM9 A;  3KD7 A;  4NQ0 A;  3FU0 A;  2YNQ A;  2MHK A;  2VTB A;  1Z6T A;  4XKB A;  1OWO A;  4E6H A;  4I6G A;  4L2L A;  4Q69 A;  3PRZ A;  4F53 A;  4PUC A;  4FHK A;  4KVO A;  3U4T A;  2WXI A;  4C0E A;  3ZEF A;  2GGF A;  3CKC A;  4JXT A;  3D9J A;  2XRY A;  4RVB A;  3ZGQ A;  4A55 A;  2WQH A;  2XQ0 A;  3LKU A;  2LAH A;  2MRI A;  4JL0 A;  5AJL A;  1QNF A;  1UN8 A;  3QWV A;  2OND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...