4B89A

Mif4g domain of the yeast not1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
230
structure length
230
Chain Sequence
EMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 82
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4b89A00
2FULA 4JHKA 2KZTB 4B8CB 3L6AA 1UG3A 3EIQC 4CEMA 2IOLA 3D3MA 4CRWA 1H6KA 2HM8A 4GMLA 4IULA 2IU1A 4LUNU 2IOSA 1N52A 2RG8A 3RK6A 4C9BB 2NSZA 5ANRA 2VSXE 4CT4A 2I2OA 2VSOE 1PAQA 4B8AA 3JUIA 4GMJA 1N54A 1H2VC 3FEYA 1H2UA 4JHJA 3EIJA 1H2TC 1UW4B 2KZTA 2GGFA 4B89A 3FEXA 2ZU6B 1HU3A 2IONA
chains in the Genus database with same CATH superfamily
3Q73A 4UWGA 2PZIA 1DCEA 2J09A 1E8WA 2LAHA 3FULA 4XKCA 1O1TA 2V5FA 4ACLA 2C2LA 1JCRA 1Z3YA 4H7YA 2B0OE 1EYHA 3ASDA 4LNUD 4HOUA 4RG6A 2GW1A 1NZNA 1SW6A 3FEXA 2WXMA 4ILHB 4DLQA 4QFVA 2FI7A 1FVFA 1XNFA 3NZUA 3L82A 2ZGGA 2FEZA 2BF0X 4CT4A 4HOTA 1O1RA 5B1BE 5ENSD 5B3SE 3HIZA 3DSWA 3EIQC 3CVXA 3DSTA 4TUUA 4GMRA 2NSZA 3NOCD 2R5SA 2QYUA 2CHWA 1OCRE 2QZAA 3CV0A 4I1OB 3TWSA 2XPIA 2WQHA 3GZ2A 3NB2A 4JL0A 2E0IA 1D8DA 3T8MA 4P29A 2HM8A 1OWOA 2AJAA 4HS2A 2DVWA 1TEZA 2IJGX 2RFMA 3VLFA 2MOWA 1JWFA 4AIFA 4BEPA 5FQ8A 3U3WA 5CMYA 2X6KA 4HI9A 1UN8A 4ILIA 1S70B 2VJ8A 3U66A 3B13A 3UUXA 4YDYA 3CSTA 1XGWA 4AM9A 3LY7A 3JQ1A 1KLXA 3R9MA 5A7DB 4DPRA 1IQRA 2CHXA 2J9QA 3AG4E 1B89A 1UJJA 4AOFA 3L17A 1OCOE 1Z6TA 4I1MA 3KEZA 5G05J 4KYOB 2A4ZA 3ZN3A 3AS5A 2J07A 4DRXE 5KJMA 4EBAG 3D9NA 1TN7A 3B7SA 4HORA 5D0OD 5KJNA 4LERA 5KJLA 5H7PA 5KBAA 3E34A 1YMPA 3TGOA 3CHPA 3ZUVB 1DCQA 3PE4A 1N9AA 3UM0A 3ZEFA 2I9CA 3JCKC 4KMOA 5BNWA 3NOGD 1YA0A 1H2UA 1U3DA 3PZ4A 1TNBA 2XPZA 4GPKA 4JPSA 4I6EA 1AP7A 3FUFA 4JA7A 4K03A 3LPZA 5DBKA 3C3QA 4JEHA 5G04C 2C0MA 3QDNA 3IXEA 4GTPA 4MBGA 5KNHD 4J6IA 1OCZE 5JA4D 4N3AA 3E4BA 3OXLA 3JYSA 4NURA 4EZJA 3AG3E 3ASHA 3TWQA 4LNBA 1E7VA 3E30A 1Y6IA 5ENPD 3ZYKA 4GCOA 5D66A 3RRUA 2WXOA 2VSOE 2DYRE 3G2TA 2ETCA 2MHKA 4G26A 3NBNB 3CSFA 1MZCA 4CYMD 1ZU2A 3FU5A 3EHRA 3B95A 3FU6A 3OTNA 2R2LA 2DYSE 3SHFA 5LX8A 2NXPA 1N11A 2VSXE 3ZHEA 5LFAA 1UJKA 1TN6A 5JJ6A 1TNUA 4WAFA 5A23A 3PS6A 3CEQA 3CVVA 4GA1A 5ARFA 3R9AB 3ZYMA 4ZHBA 3CK9A 3CLJA 1A5EA 3HG0D 3ULYA 4R7LA 2VGEA 2YINA 3D9KA 2H6GA 2J49A 4WWPA 3FTUA 4GTMA 4UQXA 2VGYA 3MEKA 3GYZA 2KM4A 2LAIA 4GU5A 3DWLG 2IO2C 3ULQA 5KCMA 2P2CP 3FTWA 5AQAA 3FH8A 4W9RA 3UM1A 3D3MA 1K1BA 5A6CA 1A17A 1V55E 5ANRA 4V3IA 1EF1C 3QWVA 3DRAA 5AN8A 2LO6A 5JHAA 3ZXPA 3QKYA 4L7TA 1H6PA 4JEUA 2VSNA 3R7QA 2KCVA 2F8XK 2P9UG 3P2BA 3QAQA 2R59A 4BTAA 3DXKG 4BY6A 5ENTD 3QOUA 3FU0A 4NIKA 1Y8MA 2BEDA 3ESKA 4GMLA 2XZDG 4YDEA 1ELKA 5EX0A 1HXIA 4Q94A 3UKUG 3AS4A 4G8KA 2WMNA 2XHEA 2J4BA 1WM5A 2XPYA 4ATGA 5HI7A 4PS8A 4PUCA 3LS8A 4DI3A 2UWJG 2I2OA 5FIOA 2XGOA 3D9HA 1VDYA 3I4RB 3MKRA 3OXFA 5FQ4A 3I5PA 4G24A 1PY1A 3D9OA 5BXUA 5EDSA 1BI7B 1SA5A 2BKKB 3FUEA 3FTZA 5ITZF 1E8YA 4JZYA 3U9WA 2GRPB 3KSQA 3UPVA 2R17C 4Y6CA 1ZBPA 3SFXA 4D10C 3L22A 4B94A 3T9KA 4F7AA 2R05A 2WXQA 2KZTA 3C72A 2KCKA 3LDZA 2LXMA 1KT0A 2QFCA 2OVBA 4KBQA 4IULA 5CBOA 3NF1A 3SBTB 1N52A 1BPOA 1N4QA 3SZ7A 4M3OA 4B93B 3SY2A 3PZDA 2VTBA 4N5QA 3MYVA 5G04J 4EZKA 1OUVA 1LD7A 3RU0A 2NYJA 2PL2A 3CVPA 4FULA 3DXMG 5BV1A 2FO7A 4GZ5A 5J08A 3PNLB 3ML8A 5FZQA 2P9KG 3LKUA 3G2WA 4CEMA 3FHEA 2V4HC 3PRZA 5D0QD 2Y1LE 4DX6D 4UI9K 3MV2B 2MRIA 4GTQA 5ARGA 1W3BA 3CGHA 4UWKA 1E8XA 5J90A 3EUVA 4UUCA 1FT1A 3MV3B 3PDNA 3PH0C 4DLOA 5T8IA 4ME2A 5BW8C 4L1BA 1SZAA 5CRUA 3S2AA 4HRLA 4ZFHA 4HQDA 4B0ZA 2VGXA 3C5RA 2P9NG 3D9JA 2I6HA 4EQFA 4J8YA 5C2YA 5JJ7A 2OEWA 3AU5A 3G2VA 2XGMA 3L13A 4ANWA 3ZVVA 3DSXA 3HXBA 2EIJE 1NP7A 2DZOA 3KEAA 3CVLA 5FT9A 3TWXA 4J8FA 2WQ6A 4FHKA 2PM6A 2Y4TA 2PQNA 4UQYA 1Z5SC 1N0QA 3UIPC 3E37A 3N71A 1IHBA 2L6JA 5FWQA 3VLDA 1N94A 3L9TA 3HXFA 1E8ZA 2AWIA 5KNGA 5BXOA 1OWMA 3LXUX 2A5UA 3HVEA 4UI9C 4U8HA 4K5CA 2RFAA 4GTRA 4BX8A 3Q15A 4A1SA 1D9SA 4PS7A 2R03A 4O1PA 2HYZA 2IOLA 3S7DA 4J0UA 2BKGA 2KCLA 4I6GA 1U2VG 1MX2A 2GRNB 5EKQD 2IFUA 4BWRA 1QYMA 3HXCA 5BUZA 2H6IA 1TJFA 3FEYA 4CGWA 3ZHEB 3PE3A 3CHMA 5JHBA 3AU4A 3UM3A 3CHOA 3B7TA 2GRLA 3EHMA 2AXUA 3PNTB 4WNGA 2WXFA 4OAUC 3KD7A 1NL4A 1FPPA 3UTMA 1N0RA 4Z68A 3PZ2A 3QWPA 4RVBA 1ZB1A 1HS6A 5E76A 1TNYA 4FLBA 4XE0A 2GRRB 5BPPA 4EBAA 4BSZB 4JB8P 4LUNU 1ELWA 3LVQE 3PVLA 4HXIA 3IBEA 1D8EA 4TV3A 3IKOB 1QQEA 3VTYA 3L54A 4CCAA 4I6JA 1IYGA 2Y69E 1NA0A 3MZLB 3C98A 3FP3A 2AXZA 1TNZA 1SA4A 2FF4A 2XENA 3C3RA 4APOA 2HO1A 3S7FA 3G2SA 3X2QE 4LCTA 4ANVA 1HO8A 3BQOA 3S7BA 4WNFA 3ZRHA 4EZLA 3Q75A 4TXRA 2PNNA 2KATA 1OWNA 3ASFA 2J08A 5AJLA 4J8EA 2QY7A 1IHGA 1H6OA 4A1GA 3MJWA 3U64A 2ZU6B 3FWVA 4GAAA 1FVHA 2AXVA 1N4PA 4DK5A 4U95D 4GZ3A 3PZ1A 4O1OA 4F53A 1SZ9A 5CEDB 2DZNA 2QYJA 3HXEA 3APCA 1L5JA 5LCWC 3URZA 4LG6A 3WG7E 4KVMA 5AENA 4TRQA 3SNXA 1K3ZD 4CT0A 4G2VA 3FFLA 5CCMA 2BUGA 3DPYA 2J4DA 3UX4A 5JMND 2P9IG 2EIME 2H6HA 2GROB 4L2LA 2KZTB 2ZISA 2XEVA 3TWUA 1RW2A 3PUJA 2GRMA 1TYQG 1BD8A 3FUMA 4GCNA 1OT8A 2GGFA 4B89A 2LSVA 4KT6B 2KC7A 3LYAA 2LNIA 5EIBE 1HE8A 2CG2A 2VTBB 4U8VD 3GZ1A 2WVIA 1TR4A 4GZDA 3RO2A 1K1AA 1N4SA 3B7UX 4DX5D 4F3VA 5AARA 3Q7AA 4RQIA 4XZ4A 4PH4B 4Q69A 2WMOA 1H6KA 4CGVA 1S64A 3CVQA 1INZA 3CHRA 3V2XA 5G2NA 4E6HA 4LEUA 3TG5A 3SQVA 4ABNA 2L0TB 3V30A 4U7EB 3VLEA 1OXJA 2X6IA 2V0PA 5FZRA 1SQMA 2CFZA 3FUDA 2XGSA 4HFGA 2A5EA 3UKRG 2IOSA 3IEGA 2P9SG 4EPZA 2IQCA 3JXJA 3QB2A 4I1AA 2XCCA 2VGXB 2CG3A 3D9LA 4J7WA 3AG2E 5CERB 3DEPA 4WUYA 3MGBA 5FINA 4I9EA 2XRYA 1S63A 3ZFWA 2OEVA 3FH5A 3Q5MA 4GYOA 3PUKA 1Z3XA 3ZPJA 3D9PA 3FU3A 4YVQC 3ZXSA 4GZCA 5ENQD 4FJYA 3IV0A 4G1TA 3W9FA 2YQ8A 5FJYA 1KZOA 3CVUA 5JJTA 4N5CA 3TWTA 4ILGA 2LXLA 4G25A 3CK8A 4KZ0A 4URKA 1JUQA 2C0LA 1WDYA 3Q79A 4QQIA 1WAO1 3PEVB 2EIKE 4GB9A 4GA0A 3OXGA 3TWVA 4XI9A 3JUEA 3LJ3A 2IONA 4KXKB 4BTBA 3APFA 1DNPA 2WXPA 3E33A 1MYOA 4FJZA 3ZYLA 1K8KG 2RG8A 2Y0BG 4EHMA 3Q7FA 4HB5A 1Q2ZA 3B7BA 3HVEB 3V79K 4FC8A 2EILE 3C3OA 3FDHA 1OCCE 2X6FA 4YDWA 4RSYA 1HU3A 2X6HA 3ONLA 3BUAA 4U04A 3LJNA 1E7UA 3QNKA 5T3RA 5FQ7A 4OAVB 3IHVA 5KJKA 1HZ4A 3WXXA 4AXHA 1N54A 4NACA 4ACKA 5ANLA 1V54E 3AS8A 3JQ0A 4RLYA 3LVRE 4GZ6A 5G05C 2CFUA 2FULA 3RKVA 1WG0A 2IU1A 4N3CA 4O6FA 3SD5A 5M72A 3EHNA 3NZSA 2AW6A 3U4TA 3UI2A 4UWLA 3QC1A 3QWWA 2OCCE 3BU8A 4HVBA 3FY4A 1DC2A 5LCWJ 1LF8A 5CBNA 2V5QC 1HX8A 1UG3A 4AVXA 2UY1A 4PDXA 5AYWD 3RRNB 4F6RD 4U0UA 1YCSB 1P5QA 2J8SD 4Y6WA 1O5MA 2Y3AA 3CK7A 4IRUA 2XEEA 2YHEA 4GTVA 4JVSA 4YNDA 3Q78A 1X5BA 2WXHA 3RIBA 4FHJA 4NRHB 1U3CA 1H19A 2P9LG 4EECA 3FTYA 2H6FA 2WPVA 3RAUA 5E75A 4GTOA 2X38A 3UINC 4AJWA 1YYHA 4TXQA 3EHQA 3FTSA 3CQGB 3MA5A 4HLLA 4HLEA 3FUNA 3HHMA 4NQ0A 4G11A 5ENOD 3ASNE 4AY5A 4ANXA 3UT8A 4AY6A 4HRNA 4AEZC 3UMVA 2V4LA 4U0ZA 3JXIA 2M63A 4C0EA 4OVVA 4L2YA 4MS6A 2XCBA 3I4GA 5ENNA 1EDUA 2DBAA 5CEAA 1LTXA 2WXLA 2ZGDA 1N4RA 1HF8A 4WWNA 4HBDA 3Q49B 3V2OA 2RKKA 3QK0A 3T8KA 3G2UA 2P58C 1X81A 2E2EA 4L23A 5AAOA 3IHYA 3QARA 2L9BA 4RG9A 3L16A 4WWOA 1H2VC 4I17A 4C0MA 4XI0A 3BG0B 4FADA 4TUMA 3GW4A 1RZ4A 3CHSA 1KPSB 1UOHA 2V8SE 5FTPA 1JCQA 3SI5A 4JC8A 4YVOA 5B1AE 4ANUA 3UQ3A 4JW1A 4O60A 4UWHA 2XQ0A 3KS2A 3SF4A 3LY8A 5AQ7A 4N39A 4JHKA 4N2SA 5HKPA 4M7CA 4FLHA 1O1SA 3P1UA 3MKQA 3RK6A 3D9IA 2NC9A 3Q9UC 1NA3A 3F6QA 5CRVA 3ZYQA 4B8AA 2ZXWE 3UT7A 4DX1A 3ABME 3S7JA 1FT2A 3RO3A 3DSVA 2VSYA 3TJPA 3FUKA 2R02A 2ILRA 4K5AB 4BESA 2ZIRA 4DX2A 1HG2A 1S0PA 4BT8A 1KT1A 1KZPA 4HOSA 2OV8A 2YHCA 4N3BA 4A3TA 3ABLE 4BT9A 4U63A 3Q9NC 2OVFA 2WQ7A 4U0SA 2WXJA 2L6BA 4CDNA 3BEEA 2JEKA 2VQ2A 4I9CA 5HS0A 2FBNA 2YNQA 3ZU7B 1QZ2A 5IY5E 3TL5A 3J5QB 5AQ9A 5ENRD 1OY3D 3FTVA 3PEUB 2F0YA 4CDMA 4YDOA 4AV7A 4IYPA 3VTXA 1UN9A 3UXGA 4BFRA 2XS8A 4GA2A 4TXPA 4C9BB 3T5VA 2QC9A 1E90A 3E32A 1WY6A 5T4YA 1ELRA 1PAQA 3KAEA 4HRMB 3W9GA 1UW4B 3HRAA 4GTTA 4XX5A 1QBQA 5LOZA 4I2ZA 3AJIA 2JABA 4LRZA 4Q96A 4GTSA 4U96D 5EYLA 2KXPC 3AG1E 2BTDA 2FO1E 1EPUA 3R7RA 2AVPA 3EIJA 4OYSA 2WXGA 5EIDA 3UIOC 3PREA 2WM9A 3ISMC 4N2QA 4WNEA 2F37A 2JLBA 3SO8A 3MX3A 2LUHA 4DX7D 4LSZE 3TXNA 4GMJA 3FTXA 3CHQA 4FP7A 4HOQA 3CIAA 3TWRA 3CVWA 4DUIA 1MX6A 2ETBA 2X3MA 3EU5A 2ONDA 3I3NA 3CVNA 2CHZA 2HE0A 4U8YD 2MYOA 1G3NB 5C1DA 5EILA 3DPDA 2IEJA 2PQRA 1BU9A 1GW6A 2WXKA 2B6CA 3ULEG 4MRUA 1AWCB 5EN5D 4GPMA 4JD2G 3EDTB 5DIZA 4BSXA 2DIWA 4A3VA 3D9MA 3RJVA 1MQSA 3ZNGA 1BLXB 3HXDA 4BX9A 3GZSA 2PM7A 3DBSA 2UY1B 3J5PA 3KSLA 1H0AA 4UI9J 2P9PG 3Q47B 3SFZA 5HQ8A 5KWDA 3SGHA 4XKBA 3EU9A 3ASOE 4B8CB 3L6AA 4XIFA 3ABKE 3HYMB 4CRWA 1NI1A 1OWLA 3TWWA 3UT4A 2IO3C 4A55A 4AP2A 1TNOA 2LSUA 1TJCA 3FUJA 3ZGQA 5EYPF 1SVXA 1JCSA 3CQCB 3ENEA 2F8YA 2OOEA 4CDRA 5D2MC 4J8SA 4F1PA 3B7RL 2ETAA 3JUIA 1N95A 4X8QA 2DCPA 3ML9A 2GRQB 3CKCA 4IN3B 4MKTA 4XEIG 2IY0C 2IF4A 3L08A 5FZSA 3ZIMA 2EINE 4MLPA 3RRMB 4WNDA 1MJ0A 4C48B 3DEOA 2HR2A 3V31A 1HH8A 3AAAC 2XEHA 3MCXA 3TAXA 4JXTA 2Q7FA 5CHEE 3QJZA 2I1JA 1NFIE 2WXNA 4GYYA 3O4ZA 3CKBA 5AIJA 2WB2A 4APFA 4KZCA 3ZW3A 1E96B 5LP0A 3ESLA 4BETA 3ONKA 2XRZA 2WXRA 2RD0A 1JPLA 3SFYA 4PS3A 5FQ6A 3O48A 5EX3A 2KBXA 1BI8B 4I43A 4J8DA 3K9IA 3NAWA 5CCLA 2I1KA 3DSUA 5AQBA 3RSEG 4E85A 1QNFA 4GYWA 3FUHA 4K0RA 4G23A 3NQPA 1MHQA 4LNGA 3BG1B 4L9PA 5HRYA 2EQXA 1FCHA 4ATZD 5CMWA 3MKQB 4FU3A 3ASGA 3OAWA 5BT1A 1H2TC 5CECB 3TG4A 3UM2A 4H7XA 5AJDA 1MX4A 3DSSA 4F1SA 3CR3A 3APDA 3HDXA 4U07A 4FA6A 4CZ2D 4HI8A 1JWGA 4OVUA 2WXIA 4K5BA 1HG5A 4I2WA 3SBSA 3FUIA 2L0IA 4KVOA 1PC2A 1HFAA 4G8LA 2X6JA 4UQZA 2Y4UA 3CVYA 3LEWA 3Q4AB 4JA9A 3T5XA 5G55A 2XZTG 4HNAD 3FH7A 5BV0A 4DJAA 3PZ3A 1LD8A 2XS1A 1IXVA 4JHRA 4UWFA 3ZKJA 1IKND 1TN8A 4DI4A 4A63B 3LCAA 4BERA 1DVPA 3LY9A 3EJNA 4JHJA 3TXMA 1IQUA 2DWZA 2VYIA 1OWPA
chains in the Genus database with same CATH topology
4UWGA 2KC7A 3FUEA 2PZIA 3FTZA 2LNIA 2OVFA 3LYAA 2WQ7A 1HE8A 2WXJA 4U0SA 1E8YA 4JZYA 3U9WA 4CDNA 2J09A 2CG2A 1E8WA 2LAHA 3BEEA 2VTBB 2JEKA 3FULA 4XKCA 3UPVA 2R17C 2VQ2A 3GZ1A 4I9CA 2V5FA 4Y6CA 1ZBPA 2WVIA 4D10C 3L22A 2FBNA 2YNQA 4GZDA 3RO2A 4ACLA 1QZ2A 4B94A 3TL5A 2C2LA 4F7AA 2WXQA 1Z3YA 4H7YA 1EYHA 3B7UX 3ASDA 4HOUA 4RG6A 2GW1A 1NZNA 2KZTA 4F3VA 3FTVA 2KCKA 3FEXA 3PEUB 2WXMA 3LDZA 4XZ4A 4CDMA 4ILHB 4PH4B 4AV7A 4DLQA 4Q69A 1KT0A 4QFVA 2WMOA 4IYPA 2QFCA 1H6KA 1FVFA 1XNFA 1UN9A 2FI7A 2OVBA 4KBQA 4IULA 3VTXA 4CGVA 3NZUA 4BFRA 3NF1A 4GA2A 3SBTB 1N52A 1BPOA 4C9BB 3T5VA 1E90A 3SZ7A 2FEZA 4M3OA 1WY6A 2BF0X 5T4YA 4CT4A 1ELRA 3CVQA 1PAQA 3CHRA 3KAEA 4E6HA 5G2NA 1INZA 4LEUA 3TG5A 4ABNA 4HOTA 2L0TB 1UW4B 3VLEA 3HIZA 4XX5A 5LOZA 2X6IA 4I2ZA 3PZDA 3EIQC 2V0PA 4LRZA 2VTBA 5FZRA 3MYVA 3CVXA 5G04J 4EZKA 4Q96A 1SQMA 2CFZA 3FUDA 2XGSA 1OUVA 4HFGA 4TUUA 3RU0A 2IOSA 3IEGA 2NSZA 2BTDA 2PL2A 4EPZA 2R5SA 3CVPA 1EPUA 4FULA 3R7RA 2IQCA 5BV1A 2AVPA 2FO7A 2CHWA 4GZ5A 3EIJA 3QB2A 5J08A 4I1AA 3PNLB 2XCCA 3ML8A 4OYSA 5FZQA 3CV0A 2VGXB 2CG3A 2WXGA 3LKUA 3D9LA 3G2WA 4I1OB 2XPIA 2WQHA 3GZ2A 4WUYA 4CEMA 4JL0A 3PREA 3MGBA 2E0IA 2WM9A 3FHEA 3T8MA 3PRZA 5D0QD 4N2QA 4I9EA 4P29A 2HM8A 1OWOA 2XRYA 4WNEA 4UI9K 3ZFWA 3MV2B 2JLBA 2MRIA 4HS2A 3MX3A 1TEZA 3FH5A 2IJGX 3Q5MA 4GYOA 3VLFA 3PUKA 2MOWA 4GMJA 1JWFA 1W3BA 1Z3XA 3FTXA 5ARGA 3TXNA 3CGHA 4AIFA 3CHQA 4UWKA 1E8XA 3ZPJA 5J90A 3D9PA 3FU3A 4FP7A 4HOQA 3MV3B 3PDNA 4YVQC 5FQ8A 3ZXSA 3U3WA 3CIAA 4GZCA 4FJYA 3IV0A 4G1TA 5CMYA 2YQ8A 5FJYA 3CVWA 2X6KA 3PH0C 3CVUA 5JJTA 4DLOA 5T8IA 1UN8A 4N5CA 4ILIA 4ME2A 2X3MA 2VJ8A 5BW8C 2ONDA 3I3NA 4L1BA 4ILGA 3CVNA 4G25A 2CHZA 3CK8A 4KZ0A 1SZAA 3U66A 4URKA 1JUQA 3B13A 2C0LA 3S2AA 4B0ZA 3UUXA 5C1DA 2VGXA 1WAO1 3CSTA 3DPDA 3PEVB 1XGWA 4AM9A 3LY7A 3JQ1A 4GB9A 3D9JA 4GA0A 3OXGA 1KLXA 2PQRA 4XI9A 3LJ3A 2IONA 4KXKB 5A7DB 4BTBA 4DPRA 2I6HA 3APFA 4EQFA 5C2YA 1DNPA 1IQRA 2CHXA 5JJ7A 2J9QA 2WXPA 1GW6A 3AU5A 3G2VA 4FJZA 2WXKA 3ZYLA 4MRUA 1B89A 2RG8A 2XGMA 1UJJA 3L13A 4AOFA 4ANWA 3ZVVA 3L17A 3EDTB 3HVEB 4FC8A 1Z6TA 4I1MA 5DIZA 1NP7A 3KEZA 3FDHA 2X6FA 5G05J 4BSXA 3CVLA 2DIWA 5FT9A 4A3VA 4KYOB 4RSYA 1HU3A 2X6HA 4J8FA 2WQ6A 2A4ZA 3ONLA 4FHKA 3D9MA 3ZN3A 3RJVA 3AS5A 2PM6A 2Y4TA 4U04A 1MQSA 1E7UA 2J07A 3QNKA 2PQNA 4UQYA 4BX9A 5T3RA 3GZSA 2PM7A 3DBSA 5FQ7A 2UY1B 5KJMA 1H0AA 3IHVA 4UI9J 5KJKA 3Q47B 4EBAG 1HZ4A 3D9NA 3WXXA 3B7SA 3N71A 3SFZA 4HORA 4AXHA 1N54A 4NACA 2L6JA 4ACKA 5HQ8A 5D0OD 5ANLA 5KJNA 5FWQA 3VLDA 3SGHA 4LERA 3AS8A 3JQ0A 5KJLA 4XKBA 3LVRE 4GZ6A 5G05C 2CFUA 1E8ZA 2FULA 3RKVA 3L6AA 4B8CB 4XIFA 3TGOA 2AWIA 3CHPA 3HYMB 4CRWA 3PE4A 1OWLA 2IU1A 3UT4A 4N3CA 4O6FA 3SD5A 3ZEFA 2I9CA 1OWMA 3JCKC 4A55A 3EHNA 3LXUX 3NZSA 2AW6A 2A5UA 4KMOA 3U4TA 3HVEA 4UI9C 4AP2A 5BNWA 4UWLA 3QC1A 3QWWA 4U8HA 1YA0A 2LSUA 4HVBA 3FY4A 1H2UA 1U3DA 4BX8A 1TJCA 3FUJA 3ZGQA 3Q15A 4A1SA 5LCWJ 1LF8A 2XPZA 4GPKA 4PS7A 1HX8A 4JPSA 4I6EA 2HYZA 3FUFA 1UG3A 3CQCB 3ENEA 2IOLA 4AVXA 2OOEA 4JA7A 4K03A 3S7DA 4J0UA 2UY1A 3LPZA 5DBKA 4PDXA 2KCLA 4CDRA 4JEHA 5G04C 4I6GA 2C0MA 5AYWD 3QDNA 5EKQD 3RRNB 2IFUA 4U0UA 4J8SA 4BWRA 1P5QA 4Y6WA 3B7RL 5BUZA 3JUIA 2Y3AA 4J6IA 1TJFA 2DCPA 3FEYA 3ML9A 3CK7A 4CGWA 4IRUA 3CKCA 3ZHEB 4IN3B 4N3AA 3E4BA 3OXLA 4MKTA 2IF4A 3PE3A 3CHMA 3JYSA 5JHBA 3AU4A 4NURA 2YHEA 4EZJA 4JVSA 3CHOA 4YNDA 1X5BA 2GRLA 3B7TA 3ASHA 3L08A 5FZSA 2WXHA 3ZIMA 3RIBA 4FHJA 4MLPA 4NRHB 1E7VA 2AXUA 3EHMA 3PNTB 4WNDA 3RRMB 4WNGA 2WXFA 1Y6IA 3ZYKA 1U3CA 2HR2A 1H19A 4GCOA 1HH8A 3RRUA 3FTYA 4EECA 3KD7A 2WXOA 2VSOE 2WPVA 3MCXA 5E75A 3G2TA 2MHKA 4G26A 3TAXA 4JXTA 3CSFA 2Q7FA 1ZU2A 2X38A 4AJWA 3FU5A 5CHEE 3QJZA 3QWPA 2I1JA 4RVBA 2WXNA 4GYYA 3FTSA 1HS6A 5E76A 3FU6A 3CQGB 4FLBA 3O4ZA 3MA5A 3CKBA 4XE0A 5BPPA 5AIJA 3OTNA 2WB2A 4EBAA 4HLEA 3SHFA 3FUNA 3HHMA 4NQ0A 4APFA 4KZCA 4G11A 3ZW3A 4LUNU 2NXPA 5LX8A 1E96B 5LP0A 1ELWA 3LVQE 4AY5A 3PVLA 4HXIA 4ANXA 3ESLA 3IBEA 2VSXE 3ONKA 3UT8A 2XRZA 4AY6A 3ZHEA 5LFAA 4AEZC 4TV3A 1UJKA 3UMVA 5JJ6A 2WXRA 2V4LA 2RD0A 3IKOB 1JPLA 1QQEA 2M63A 4U0ZA 3VTYA 4C0EA 4WAFA 5A23A 3PS6A 4OVVA 3CEQA 3L54A 4L2YA 4MS6A 4CCAA 2XCBA 3I4GA 4I6JA 1IYGA 5ENNA 3CVVA 1EDUA 4GA1A 1NA0A 5ARFA 3MZLB 3R9AB 3C98A 3FP3A 3ZYMA 3CK9A 4PS3A 2DBAA 5FQ6A 3CLJA 2AXZA 3O48A 5EX3A 4I43A 4J8DA 4R7LA 2YINA 3K9IA 2FF4A 5CCLA 2WXLA 3D9KA 2J49A 4WWPA 4APOA 3FTUA 1HF8A 4UQXA 4WWNA 2VGYA 2HO1A 2I1KA 3S7FA 3G2SA 3MEKA 4E85A 1QNFA 3GYZA 3Q49B 2KM4A 4LCTA 4GYWA 4ANVA 1HO8A 2LAIA 3FUHA 4GU5A 3S7BA 4K0RA 4G23A 4WNFA 3ULQA 5KCMA 3ZRHA 3FTWA 3NQPA 1MHQA 4EZLA 3QK0A 3FH8A 4W9RA 3BG1B 3G2UA 3D3MA 2P58C 2KATA 1OWNA 3ASFA 5A6CA 2E2EA 1A17A 2J08A 5AJLA 4J8EA 2QY7A 2EQXA 1FCHA 1IHGA 4L23A 5ANRA 4A1GA 4V3IA 5CMWA 3IHYA 3MKQB 5M72A 3QARA 4FU3A 2L9BA 4RG9A 3L16A 4WWOA 1EF1C 3ASGA 3QWVA 1H2VC 3OAWA 4I17A 4C0MA 5BT1A 4XI0A 3BG0B 1H2TC 4FADA 3GW4A 3TG4A 3MJWA 2LO6A 3U64A 3CHSA 5JHAA 2ZU6B 4H7XA 3FWVA 5AJDA 4F1SA 3QKYA 2V8SE 3CR3A 3APDA 4GAAA 3HDXA 1FVHA 4L7TA 4U07A 2AXVA 5FTPA 3SI5A 4DK5A 4FA6A 4JC8A 4GZ3A 4YVOA 1JWGA 4OVUA 2WXIA 4ANUA 4JEUA 3UQ3A 2VSNA 3R7QA 1HG5A 4F53A 4I2WA 4JW1A 4UWHA 1SZ9A 2KCVA 3SBSA 3FUIA 3P2BA 2XQ0A 2L0IA 3QAQA 2R59A 3KS2A 3APCA 3LY8A 4KVOA 3SF4A 1L5JA 4BTAA 1PC2A 5LCWC 1HFAA 3URZA 4N39A 4BY6A 4JHKA 4KVMA 5AENA 4N2SA 2X6JA 3QOUA 3FU0A 4UQZA 2Y4UA 1Y8MA 3ESKA 4GMLA 4FLHA 3P1UA 4TRQA 3CVYA 3LEWA 3SNXA 3MKQA 4CT0A 3RK6A 4G2VA 3Q4AB 3D9IA 4JA9A 2NC9A 3FFLA 1NA3A 3T5XA 5CCMA 1ELKA 5EX0A 2BUGA 5G55A 3FH7A 3ZYQA 2J4DA 4B8AA 5BV0A 1HXIA 4Q94A 3UT7A 3UX4A 4DJAA 3AS4A 2WMNA 2XHEA 4L2LA 3S7JA 2KZTB 2J4BA 1WM5A 4JHRA 4UWFA 3RO3A 2XPYA 2XEVA 4ATGA 5HI7A 2VSYA 3TJPA 3FUKA 2ILRA 4U63A 4PS8A 4PUCA 3PUJA 2GRMA 3LS8A 4DI3A 4DI4A 1HG2A 2UWJG 1S0PA 3LCAA 4BT8A 1KT1A 2I2OA 1DVPA 4HOSA 2XGOA 3LY9A 3FUMA 1VDYA 2OV8A 3I4RB 3EJNA 3MKRA 3OXFA 4JHJA 5FQ4A 3TXMA 1IQUA 2YHCA 3I5PA 4G24A 1PY1A 4GCNA 4N3BA 4A3TA 3D9OA 2GGFA 4BT9A 2VYIA 5EDSA 4B89A 1OWPA 2LSVA 4KT6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUL A;  4JHK A;  2KZT B;  4B8C B;  3L6A A;  1UG3 A;  3EIQ C;  4CEM A;  2IOL A;  3D3M A;  4CRW A;  1H6K A;  2HM8 A;  4GML A;  4IUL A;  2IU1 A;  4LUN U;  2IOS A;  1N52 A;  2RG8 A;  3RK6 A;  4C9B B;  2NSZ A;  5ANR A;  2VSX E;  4CT4 A;  2I2O A;  2VSO E;  1PAQ A;  4B8A A;  3JUI A;  4GMJ A;  1N54 A;  1H2V C;  3FEY A;  1H2U A;  4JHJ A;  3EIJ A;  1H2T C;  1UW4 B;  2KZT A;  2GGF A;  4B89 A;  3FEX A;  2ZU6 B;  1HU3 A;  2ION A; 
#chains in the Genus database with same CATH topology
 3Q73 A;  4UWG A;  2PZI A;  1DCE A;  2J09 A;  1E8W A;  2LAH A;  3FUL A;  4XKC A;  1O1T A;  2V5F A;  4ACL A;  2C2L A;  1JCR A;  1Z3Y A;  4H7Y A;  2B0O E;  1EYH A;  3ASD A;  4LNU D;  4HOU A;  4RG6 A;  2GW1 A;  1NZN A;  1SW6 A;  3FEX A;  2WXM A;  4ILH B;  4DLQ A;  4QFV A;  2FI7 A;  1FVF A;  1XNF A;  3NZU A;  3L82 A;  2ZGG A;  2FEZ A;  2BF0 X;  4CT4 A;  4HOT A;  1O1R A;  5B1B E;  5ENS D;  5B3S E;  3HIZ A;  3DSW A;  3EIQ C;  3CVX A;  3DST A;  4TUU A;  4GMR A;  2NSZ A;  3NOC D;  2R5S A;  2QYU A;  2CHW A;  1OCR E;  2QZA A;  3CV0 A;  4I1O B;  3TWS A;  2XPI A;  2WQH A;  3GZ2 A;  3NB2 A;  4JL0 A;  2E0I A;  1D8D A;  3T8M A;  4P29 A;  2HM8 A;  1OWO A;  2AJA A;  4HS2 A;  2DVW A;  1TEZ A;  2IJG X;  2RFM A;  3VLF A;  2MOW A;  1JWF A;  4AIF A;  4BEP A;  5FQ8 A;  3U3W A;  5CMY A;  2X6K A;  4HI9 A;  1UN8 A;  4ILI A;  1S70 B;  2VJ8 A;  3U66 A;  3B13 A;  3UUX A;  4YDY A;  3CST A;  1XGW A;  4AM9 A;  3LY7 A;  3JQ1 A;  1KLX A;  3R9M A;  5A7D B;  4DPR A;  1IQR A;  2CHX A;  2J9Q A;  3AG4 E;  1B89 A;  1UJJ A;  4AOF A;  3L17 A;  1OCO E;  1Z6T A;  4I1M A;  3KEZ A;  5G05 J;  4KYO B;  2A4Z A;  3ZN3 A;  3AS5 A;  2J07 A;  4DRX E;  5KJM A;  4EBA G;  3D9N A;  1TN7 A;  3B7S A;  4HOR A;  5D0O D;  5KJN A;  4LER A;  5KJL A;  5H7P A;  5KBA A;  3E34 A;  1YMP A;  3TGO A;  3CHP A;  3ZUV B;  1DCQ A;  3PE4 A;  1N9A A;  3UM0 A;  3ZEF A;  2I9C A;  3JCK C;  4KMO A;  5BNW A;  3NOG D;  1YA0 A;  1H2U A;  1U3D A;  3PZ4 A;  1TNB A;  2XPZ A;  4GPK A;  4JPS A;  4I6E A;  1AP7 A;  3FUF A;  4JA7 A;  4K03 A;  3LPZ A;  5DBK A;  3C3Q A;  4JEH A;  5G04 C;  2C0M A;  3QDN A;  3IXE A;  4GTP A;  4MBG A;  5KNH D;  4J6I A;  1OCZ E;  5JA4 D;  4N3A A;  3E4B A;  3OXL A;  3JYS A;  4NUR A;  4EZJ A;  3AG3 E;  3ASH A;  3TWQ A;  4LNB A;  1E7V A;  3E30 A;  1Y6I A;  5ENP D;  3ZYK A;  4GCO A;  5D66 A;  3RRU A;  2WXO A;  2VSO E;  2DYR E;  3G2T A;  2ETC A;  2MHK A;  4G26 A;  3NBN B;  3CSF A;  1MZC A;  4CYM D;  1ZU2 A;  3FU5 A;  3EHR A;  3B95 A;  3FU6 A;  3OTN A;  2R2L A;  2DYS E;  3SHF A;  5LX8 A;  2NXP A;  1N11 A;  2VSX E;  3ZHE A;  5LFA A;  1UJK A;  1TN6 A;  5JJ6 A;  1TNU A;  4WAF A;  5A23 A;  3PS6 A;  3CEQ A;  3CVV A;  4GA1 A;  5ARF A;  3R9A B;  3ZYM A;  4ZHB A;  3CK9 A;  3CLJ A;  1A5E A;  3HG0 D;  3ULY A;  4R7L A;  2VGE A;  2YIN A;  3D9K A;  2H6G A;  2J49 A;  4WWP A;  3FTU A;  4GTM A;  4UQX A;  2VGY A;  3MEK A;  3GYZ A;  2KM4 A;  2LAI A;  4GU5 A;  3DWL G;  2IO2 C;  3ULQ A;  5KCM A;  2P2C P;  3FTW A;  5AQA A;  3FH8 A;  4W9R A;  3UM1 A;  3D3M A;  1K1B A;  5A6C A;  1A17 A;  1V55 E;  5ANR A;  4V3I A;  1EF1 C;  3QWV A;  3DRA A;  5AN8 A;  2LO6 A;  5JHA A;  3ZXP A;  3QKY A;  4L7T A;  1H6P A;  4JEU A;  2VSN A;  3R7Q A;  2KCV A;  2F8X K;  2P9U G;  3P2B A;  3QAQ A;  2R59 A;  4BTA A;  3DXK G;  4BY6 A;  5ENT D;  3QOU A;  3FU0 A;  4NIK A;  1Y8M A;  2BED A;  3ESK A;  4GML A;  2XZD G;  4YDE A;  1ELK A;  5EX0 A;  1HXI A;  4Q94 A;  3UKU G;  3AS4 A;  4G8K A;  2WMN A;  2XHE A;  2J4B A;  1WM5 A;  2XPY A;  4ATG A;  5HI7 A;  4PS8 A;  4PUC A;  3LS8 A;  4DI3 A;  2UWJ G;  2I2O A;  5FIO A;  2XGO A;  3D9H A;  1VDY A;  3I4R B;  3MKR A;  3OXF A;  5FQ4 A;  3I5P A;  4G24 A;  1PY1 A;  3D9O A;  5BXU A;  5EDS A;  1BI7 B;  1SA5 A;  2BKK B;  3FUE A;  3FTZ A;  5ITZ F;  1E8Y A;  4JZY A;  3U9W A;  2GRP B;  3KSQ A;  3UPV A;  2R17 C;  4Y6C A;  1ZBP A;  3SFX A;  4D10 C;  3L22 A;  4B94 A;  3T9K A;  4F7A A;  2R05 A;  2WXQ A;  2KZT A;  3C72 A;  2KCK A;  3LDZ A;  2LXM A;  1KT0 A;  2QFC A;  2OVB A;  4KBQ A;  4IUL A;  5CBO A;  3NF1 A;  3SBT B;  1N52 A;  1BPO A;  1N4Q A;  3SZ7 A;  4M3O A;  4B93 B;  3SY2 A;  3PZD A;  2VTB A;  4N5Q A;  3MYV A;  5G04 J;  4EZK A;  1OUV A;  1LD7 A;  3RU0 A;  2NYJ A;  2PL2 A;  3CVP A;  4FUL A;  3DXM G;  5BV1 A;  2FO7 A;  4GZ5 A;  5J08 A;  3PNL B;  3ML8 A;  5FZQ A;  2P9K G;  3LKU A;  3G2W A;  4CEM A;  3FHE A;  2V4H C;  3PRZ A;  5D0Q D;  2Y1L E;  4DX6 D;  4UI9 K;  3MV2 B;  2MRI A;  4GTQ A;  5ARG A;  1W3B A;  3CGH A;  4UWK A;  1E8X A;  5J90 A;  3EUV A;  4UUC A;  1FT1 A;  3MV3 B;  3PDN A;  3PH0 C;  4DLO A;  5T8I A;  4ME2 A;  5BW8 C;  4L1B A;  1SZA A;  5CRU A;  3S2A A;  4HRL A;  4ZFH A;  4HQD A;  4B0Z A;  2VGX A;  3C5R A;  2P9N G;  3D9J A;  2I6H A;  4EQF A;  4J8Y A;  5C2Y A;  5JJ7 A;  2OEW A;  3AU5 A;  3G2V A;  2XGM A;  3L13 A;  4ANW A;  3ZVV A;  3DSX A;  3HXB A;  2EIJ E;  1NP7 A;  2DZO A;  3KEA A;  3CVL A;  5FT9 A;  3TWX A;  4J8F A;  2WQ6 A;  4FHK A;  2PM6 A;  2Y4T A;  2PQN A;  4UQY A;  1Z5S C;  1N0Q A;  3UIP C;  3E37 A;  3N71 A;  1IHB A;  2L6J A;  5FWQ A;  3VLD A;  1N94 A;  3L9T A;  3HXF A;  1E8Z A;  2AWI A;  5KNG A;  5BXO A;  1OWM A;  3LXU X;  2A5U A;  3HVE A;  4UI9 C;  4U8H A;  4K5C A;  2RFA A;  4GTR A;  4BX8 A;  3Q15 A;  4A1S A;  1D9S A;  4PS7 A;  2R03 A;  4O1P A;  2HYZ A;  2IOL A;  3S7D A;  4J0U A;  2BKG A;  2KCL A;  4I6G A;  1U2V G;  1MX2 A;  2GRN B;  5EKQ D;  2IFU A;  4BWR A;  1QYM A;  3HXC A;  5BUZ A;  2H6I A;  1TJF A;  3FEY A;  4CGW A;  3ZHE B;  3PE3 A;  3CHM A;  5JHB A;  3AU4 A;  3UM3 A;  3CHO A;  3B7T A;  2GRL A;  3EHM A;  2AXU A;  3PNT B;  4WNG A;  2WXF A;  4OAU C;  3KD7 A;  1NL4 A;  1FPP A;  3UTM A;  1N0R A;  4Z68 A;  3PZ2 A;  3QWP A;  4RVB A;  1ZB1 A;  1HS6 A;  5E76 A;  1TNY A;  4FLB A;  4XE0 A;  2GRR B;  5BPP A;  4EBA A;  4BSZ B;  4JB8 P;  4LUN U;  1ELW A;  3LVQ E;  3PVL A;  4HXI A;  3IBE A;  1D8E A;  4TV3 A;  3IKO B;  1QQE A;  3VTY A;  3L54 A;  4CCA A;  4I6J A;  1IYG A;  2Y69 E;  1NA0 A;  3MZL B;  3C98 A;  3FP3 A;  2AXZ A;  1TNZ A;  1SA4 A;  2FF4 A;  2XEN A;  3C3R A;  4APO A;  2HO1 A;  3S7F A;  3G2S A;  3X2Q E;  4LCT A;  4ANV A;  1HO8 A;  3BQO A;  3S7B A;  4WNF A;  3ZRH A;  4EZL A;  3Q75 A;  4TXR A;  2PNN A;  2KAT A;  1OWN A;  3ASF A;  2J08 A;  5AJL A;  4J8E A;  2QY7 A;  1IHG A;  1H6O A;  4A1G A;  3MJW A;  3U64 A;  2ZU6 B;  3FWV A;  4GAA A;  1FVH A;  2AXV A;  1N4P A;  4DK5 A;  4U95 D;  4GZ3 A;  3PZ1 A;  4O1O A;  4F53 A;  1SZ9 A;  5CED B;  2DZN A;  2QYJ A;  3HXE A;  3APC A;  1L5J A;  5LCW C;  3URZ A;  4LG6 A;  3WG7 E;  4KVM A;  5AEN A;  4TRQ A;  3SNX A;  1K3Z D;  4CT0 A;  4G2V A;  3FFL A;  5CCM A;  2BUG A;  3DPY A;  2J4D A;  3UX4 A;  5JMN D;  2P9I G;  2EIM E;  2H6H A;  2GRO B;  4L2L A;  2KZT B;  2ZIS A;  2XEV A;  3TWU A;  1RW2 A;  3PUJ A;  2GRM A;  1TYQ G;  1BD8 A;  3FUM A;  4GCN A;  1OT8 A;  2GGF A;  4B89 A;  2LSV A;  4KT6 B;  2KC7 A;  3LYA A;  2LNI A;  5EIB E;  1HE8 A;  2CG2 A;  2VTB B;  4U8V D;  3GZ1 A;  2WVI A;  1TR4 A;  4GZD A;  3RO2 A;  1K1A A;  1N4S A;  3B7U X;  4DX5 D;  4F3V A;  5AAR A;  3Q7A A;  4RQI A;  4XZ4 A;  4PH4 B;  4Q69 A;  2WMO A;  1H6K A;  4CGV A;  1S64 A;  3CVQ A;  1INZ A;  3CHR A;  3V2X A;  5G2N A;  4E6H A;  4LEU A;  3TG5 A;  3SQV A;  4ABN A;  2L0T B;  3V30 A;  4U7E B;  3VLE A;  1OXJ A;  2X6I A;  2V0P A;  5FZR A;  1SQM A;  2CFZ A;  3FUD A;  2XGS A;  4HFG A;  2A5E A;  3UKR G;  2IOS A;  3IEG A;  2P9S G;  4EPZ A;  2IQC A;  3JXJ A;  3QB2 A;  4I1A A;  2XCC A;  2VGX B;  2CG3 A;  3D9L A;  4J7W A;  3AG2 E;  5CER B;  3DEP A;  4WUY A;  3MGB A;  5FIN A;  4I9E A;  2XRY A;  1S63 A;  3ZFW A;  2OEV A;  3FH5 A;  3Q5M A;  4GYO A;  3PUK A;  1Z3X A;  3ZPJ A;  3D9P A;  3FU3 A;  4YVQ C;  3ZXS A;  4GZC A;  5ENQ D;  4FJY A;  3IV0 A;  4G1T A;  3W9F A;  2YQ8 A;  5FJY A;  1KZO A;  3CVU A;  5JJT A;  4N5C A;  3TWT A;  4ILG A;  2LXL A;  4G25 A;  3CK8 A;  4KZ0 A;  4URK A;  1JUQ A;  2C0L A;  1WDY A;  3Q79 A;  4QQI A;  1WAO 1;  3PEV B;  2EIK E;  4GB9 A;  4GA0 A;  3OXG A;  3TWV A;  4XI9 A;  3JUE A;  3LJ3 A;  2ION A;  4KXK B;  4BTB A;  3APF A;  1DNP A;  2WXP A;  3E33 A;  1MYO A;  4FJZ A;  3ZYL A;  1K8K G;  2RG8 A;  2Y0B G;  4EHM A;  3Q7F A;  4HB5 A;  1Q2Z A;  3B7B A;  3HVE B;  3V79 K;  4FC8 A;  2EIL E;  3C3O A;  3FDH A;  1OCC E;  2X6F A;  4YDW A;  4RSY A;  1HU3 A;  2X6H A;  3ONL A;  3BUA A;  4U04 A;  3LJN A;  1E7U A;  3QNK A;  5T3R A;  5FQ7 A;  4OAV B;  3IHV A;  5KJK A;  1HZ4 A;  3WXX A;  4AXH A;  1N54 A;  4NAC A;  4ACK A;  5ANL A;  1V54 E;  3AS8 A;  3JQ0 A;  4RLY A;  3LVR E;  4GZ6 A;  5G05 C;  2CFU A;  2FUL A;  3RKV A;  1WG0 A;  2IU1 A;  4N3C A;  4O6F A;  3SD5 A;  5M72 A;  3EHN A;  3NZS A;  2AW6 A;  3U4T A;  3UI2 A;  4UWL A;  3QC1 A;  3QWW A;  2OCC E;  3BU8 A;  4HVB A;  3FY4 A;  1DC2 A;  5LCW J;  1LF8 A;  5CBN A;  2V5Q C;  1HX8 A;  1UG3 A;  4AVX A;  2UY1 A;  4PDX A;  5AYW D;  3RRN B;  4F6R D;  4U0U A;  1YCS B;  1P5Q A;  2J8S D;  4Y6W A;  1O5M A;  2Y3A A;  3CK7 A;  4IRU A;  2XEE A;  2YHE A;  4GTV A;  4JVS A;  4YND A;  3Q78 A;  1X5B A;  2WXH A;  3RIB A;  4FHJ A;  4NRH B;  1U3C A;  1H19 A;  2P9L G;  4EEC A;  3FTY A;  2H6F A;  2WPV A;  3RAU A;  5E75 A;  4GTO A;  2X38 A;  3UIN C;  4AJW A;  1YYH A;  4TXQ A;  3EHQ A;  3FTS A;  3CQG B;  3MA5 A;  4HLL A;  4HLE A;  3FUN A;  3HHM A;  4NQ0 A;  4G11 A;  5ENO D;  3ASN E;  4AY5 A;  4ANX A;  3UT8 A;  4AY6 A;  4HRN A;  4AEZ C;  3UMV A;  2V4L A;  4U0Z A;  3JXI A;  2M63 A;  4C0E A;  4OVV A;  4L2Y A;  4MS6 A;  2XCB A;  3I4G A;  5ENN A;  1EDU A;  2DBA A;  5CEA A;  1LTX A;  2WXL A;  2ZGD A;  1N4R A;  1HF8 A;  4WWN A;  4HBD A;  3Q49 B;  3V2O A;  2RKK A;  3QK0 A;  3T8K A;  3G2U A;  2P58 C;  1X81 A;  2E2E A;  4L23 A;  5AAO A;  3IHY A;  3QAR A;  2L9B A;  4RG9 A;  3L16 A;  4WWO A;  1H2V C;  4I17 A;  4C0M A;  4XI0 A;  3BG0 B;  4FAD A;  4TUM A;  3GW4 A;  1RZ4 A;  3CHS A;  1KPS B;  1UOH A;  2V8S E;  5FTP A;  1JCQ A;  3SI5 A;  4JC8 A;  4YVO A;  5B1A E;  4ANU A;  3UQ3 A;  4JW1 A;  4O60 A;  4UWH A;  2XQ0 A;  3KS2 A;  3SF4 A;  3LY8 A;  5AQ7 A;  4N39 A;  4JHK A;  4N2S A;  5HKP A;  4M7C A;  4FLH A;  1O1S A;  3P1U A;  3MKQ A;  3RK6 A;  3D9I A;  2NC9 A;  3Q9U C;  1NA3 A;  3F6Q A;  5CRV A;  3ZYQ A;  4B8A A;  2ZXW E;  3UT7 A;  4DX1 A;  3ABM E;  3S7J A;  1FT2 A;  3RO3 A;  3DSV A;  2VSY A;  3TJP A;  3FUK A;  2R02 A;  2ILR A;  4K5A B;  4BES A;  2ZIR A;  4DX2 A;  1HG2 A;  1S0P A;  4BT8 A;  1KT1 A;  1KZP A;  4HOS A;  2OV8 A;  2YHC A;  4N3B A;  4A3T A;  3ABL E;  4BT9 A;  4U63 A;  3Q9N C;  2OVF A;  2WQ7 A;  4U0S A;  2WXJ A;  2L6B A;  4CDN A;  3BEE A;  2JEK A;  2VQ2 A;  4I9C A;  5HS0 A;  2FBN A;  2YNQ A;  3ZU7 B;  1QZ2 A;  5IY5 E;  3TL5 A;  3J5Q B;  5AQ9 A;  5ENR D;  1OY3 D;  3FTV A;  3PEU B;  2F0Y A;  4CDM A;  4YDO A;  4AV7 A;  4IYP A;  3VTX A;  1UN9 A;  3UXG A;  4BFR A;  2XS8 A;  4GA2 A;  4TXP A;  4C9B B;  3T5V A;  2QC9 A;  1E90 A;  3E32 A;  1WY6 A;  5T4Y A;  1ELR A;  1PAQ A;  3KAE A;  4HRM B;  3W9G A;  1UW4 B;  3HRA A;  4GTT A;  4XX5 A;  1QBQ A;  5LOZ A;  4I2Z A;  3AJI A;  2JAB A;  4LRZ A;  4Q96 A;  4GTS A;  4U96 D;  5EYL A;  2KXP C;  3AG1 E;  2BTD A;  2FO1 E;  1EPU A;  3R7R A;  2AVP A;  3EIJ A;  4OYS A;  2WXG A;  5EID A;  3UIO C;  3PRE A;  2WM9 A;  3ISM C;  4N2Q A;  4WNE A;  2F37 A;  2JLB A;  3SO8 A;  3MX3 A;  2LUH A;  4DX7 D;  4LSZ E;  3TXN A;  4GMJ A;  3FTX A;  3CHQ A;  4FP7 A;  4HOQ A;  3CIA A;  3TWR A;  3CVW A;  4DUI A;  1MX6 A;  2ETB A;  2X3M A;  3EU5 A;  2OND A;  3I3N A;  3CVN A;  2CHZ A;  2HE0 A;  4U8Y D;  2MYO A;  1G3N B;  5C1D A;  5EIL A;  3DPD A;  2IEJ A;  2PQR A;  1BU9 A;  1GW6 A;  2WXK A;  2B6C A;  3ULE G;  4MRU A;  1AWC B;  5EN5 D;  4GPM A;  4JD2 G;  3EDT B;  5DIZ A;  4BSX A;  2DIW A;  4A3V A;  3D9M A;  3RJV A;  1MQS A;  3ZNG A;  1BLX B;  3HXD A;  4BX9 A;  3GZS A;  2PM7 A;  3DBS A;  2UY1 B;  3J5P A;  3KSL A;  1H0A A;  4UI9 J;  2P9P G;  3Q47 B;  3SFZ A;  5HQ8 A;  5KWD A;  3SGH A;  4XKB A;  3EU9 A;  3ASO E;  4B8C B;  3L6A A;  4XIF A;  3ABK E;  3HYM B;  4CRW A;  1NI1 A;  1OWL A;  3TWW A;  3UT4 A;  2IO3 C;  4A55 A;  4AP2 A;  1TNO A;  2LSU A;  1TJC A;  3FUJ A;  3ZGQ A;  5EYP F;  1SVX A;  1JCS A;  3CQC B;  3ENE A;  2F8Y A;  2OOE A;  4CDR A;  5D2M C;  4J8S A;  4F1P A;  3B7R L;  2ETA A;  3JUI A;  1N95 A;  4X8Q A;  2DCP A;  3ML9 A;  2GRQ B;  3CKC A;  4IN3 B;  4MKT A;  4XEI G;  2IY0 C;  2IF4 A;  3L08 A;  5FZS A;  3ZIM A;  2EIN E;  4MLP A;  3RRM B;  4WND A;  1MJ0 A;  4C48 B;  3DEO A;  2HR2 A;  3V31 A;  1HH8 A;  3AAA C;  2XEH A;  3MCX A;  3TAX A;  4JXT A;  2Q7F A;  5CHE E;  3QJZ A;  2I1J A;  1NFI E;  2WXN A;  4GYY A;  3O4Z A;  3CKB A;  5AIJ A;  2WB2 A;  4APF A;  4KZC A;  3ZW3 A;  1E96 B;  5LP0 A;  3ESL A;  4BET A;  3ONK A;  2XRZ A;  2WXR A;  2RD0 A;  1JPL A;  3SFY A;  4PS3 A;  5FQ6 A;  3O48 A;  5EX3 A;  2KBX A;  1BI8 B;  4I43 A;  4J8D A;  3K9I A;  3NAW A;  5CCL A;  2I1K A;  3DSU A;  5AQB A;  3RSE G;  4E85 A;  1QNF A;  4GYW A;  3FUH A;  4K0R A;  4G23 A;  3NQP A;  1MHQ A;  4LNG A;  3BG1 B;  4L9P A;  5HRY A;  2EQX A;  1FCH A;  4ATZ D;  5CMW A;  3MKQ B;  4FU3 A;  3ASG A;  3OAW A;  5BT1 A;  1H2T C;  5CEC B;  3TG4 A;  3UM2 A;  4H7X A;  5AJD A;  1MX4 A;  3DSS A;  4F1S A;  3CR3 A;  3APD A;  3HDX A;  4U07 A;  4FA6 A;  4CZ2 D;  4HI8 A;  1JWG A;  4OVU A;  2WXI A;  4K5B A;  1HG5 A;  4I2W A;  3SBS A;  3FUI A;  2L0I A;  4KVO A;  1PC2 A;  1HFA A;  4G8L A;  2X6J A;  4UQZ A;  2Y4U A;  3CVY A;  3LEW A;  3Q4A B;  4JA9 A;  3T5X A;  5G55 A;  2XZT G;  4HNA D;  3FH7 A;  5BV0 A;  4DJA A;  3PZ3 A;  1LD8 A;  2XS1 A;  1IXV A;  4JHR A;  4UWF A;  3ZKJ A;  1IKN D;  1TN8 A;  4DI4 A;  4A63 B;  3LCA A;  4BER A;  1DVP A;  3LY9 A;  3EJN A;  4JHJ A;  3TXM A;  1IQU A;  2DWZ A;  2VYI A;  1OWP A; 
#chains in the Genus database with same CATH homology
 4UWG A;  2KC7 A;  3FUE A;  2PZI A;  3FTZ A;  2LNI A;  2OVF A;  3LYA A;  2WQ7 A;  1HE8 A;  2WXJ A;  4U0S A;  1E8Y A;  4JZY A;  3U9W A;  4CDN A;  2J09 A;  2CG2 A;  1E8W A;  2LAH A;  3BEE A;  2VTB B;  2JEK A;  3FUL A;  4XKC A;  3UPV A;  2R17 C;  2VQ2 A;  3GZ1 A;  4I9C A;  2V5F A;  4Y6C A;  1ZBP A;  2WVI A;  4D10 C;  3L22 A;  2FBN A;  2YNQ A;  4GZD A;  3RO2 A;  4ACL A;  1QZ2 A;  4B94 A;  3TL5 A;  2C2L A;  4F7A A;  2WXQ A;  1Z3Y A;  4H7Y A;  1EYH A;  3B7U X;  3ASD A;  4HOU A;  4RG6 A;  2GW1 A;  1NZN A;  2KZT A;  4F3V A;  3FTV A;  2KCK A;  3FEX A;  3PEU B;  2WXM A;  3LDZ A;  4XZ4 A;  4CDM A;  4ILH B;  4PH4 B;  4AV7 A;  4DLQ A;  4Q69 A;  1KT0 A;  4QFV A;  2WMO A;  4IYP A;  2QFC A;  1H6K A;  1FVF A;  1XNF A;  1UN9 A;  2FI7 A;  2OVB A;  4KBQ A;  4IUL A;  3VTX A;  4CGV A;  3NZU A;  4BFR A;  3NF1 A;  4GA2 A;  3SBT B;  1N52 A;  1BPO A;  4C9B B;  3T5V A;  1E90 A;  3SZ7 A;  2FEZ A;  4M3O A;  1WY6 A;  2BF0 X;  5T4Y A;  4CT4 A;  1ELR A;  3CVQ A;  1PAQ A;  3CHR A;  3KAE A;  4E6H A;  5G2N A;  1INZ A;  4LEU A;  3TG5 A;  4ABN A;  4HOT A;  2L0T B;  1UW4 B;  3VLE A;  3HIZ A;  4XX5 A;  5LOZ A;  2X6I A;  4I2Z A;  3PZD A;  3EIQ C;  2V0P A;  4LRZ A;  2VTB A;  5FZR A;  3MYV A;  3CVX A;  5G04 J;  4EZK A;  4Q96 A;  1SQM A;  2CFZ A;  3FUD A;  2XGS A;  1OUV A;  4HFG A;  4TUU A;  3RU0 A;  2IOS A;  3IEG A;  2NSZ A;  2BTD A;  2PL2 A;  4EPZ A;  2R5S A;  3CVP A;  1EPU A;  4FUL A;  3R7R A;  2IQC A;  5BV1 A;  2AVP A;  2FO7 A;  2CHW A;  4GZ5 A;  3EIJ A;  3QB2 A;  5J08 A;  4I1A A;  3PNL B;  2XCC A;  3ML8 A;  4OYS A;  5FZQ A;  3CV0 A;  2VGX B;  2CG3 A;  2WXG A;  3LKU A;  3D9L A;  3G2W A;  4I1O B;  2XPI A;  2WQH A;  3GZ2 A;  4WUY A;  4CEM A;  4JL0 A;  3PRE A;  3MGB A;  2E0I A;  2WM9 A;  3FHE A;  3T8M A;  3PRZ A;  5D0Q D;  4N2Q A;  4I9E A;  4P29 A;  2HM8 A;  1OWO A;  2XRY A;  4WNE A;  4UI9 K;  3ZFW A;  3MV2 B;  2JLB A;  2MRI A;  4HS2 A;  3MX3 A;  1TEZ A;  3FH5 A;  2IJG X;  3Q5M A;  4GYO A;  3VLF A;  3PUK A;  2MOW A;  4GMJ A;  1JWF A;  1W3B A;  1Z3X A;  3FTX A;  5ARG A;  3TXN A;  3CGH A;  4AIF A;  3CHQ A;  4UWK A;  1E8X A;  3ZPJ A;  5J90 A;  3D9P A;  3FU3 A;  4FP7 A;  4HOQ A;  3MV3 B;  3PDN A;  4YVQ C;  5FQ8 A;  3ZXS A;  3U3W A;  3CIA A;  4GZC A;  4FJY A;  3IV0 A;  4G1T A;  5CMY A;  2YQ8 A;  5FJY A;  3CVW A;  2X6K A;  3PH0 C;  3CVU A;  5JJT A;  4DLO A;  5T8I A;  1UN8 A;  4N5C A;  4ILI A;  4ME2 A;  2X3M A;  2VJ8 A;  5BW8 C;  2OND A;  3I3N A;  4L1B A;  4ILG A;  3CVN A;  4G25 A;  2CHZ A;  3CK8 A;  4KZ0 A;  1SZA A;  3U66 A;  4URK A;  1JUQ A;  3B13 A;  2C0L A;  3S2A A;  4B0Z A;  3UUX A;  5C1D A;  2VGX A;  1WAO 1;  3CST A;  3DPD A;  3PEV B;  1XGW A;  4AM9 A;  3LY7 A;  3JQ1 A;  4GB9 A;  3D9J A;  4GA0 A;  3OXG A;  1KLX A;  2PQR A;  4XI9 A;  3LJ3 A;  2ION A;  4KXK B;  5A7D B;  4BTB A;  4DPR A;  2I6H A;  3APF A;  4EQF A;  5C2Y A;  1DNP A;  1IQR A;  2CHX A;  5JJ7 A;  2J9Q A;  2WXP A;  1GW6 A;  3AU5 A;  3G2V A;  4FJZ A;  2WXK A;  3ZYL A;  4MRU A;  1B89 A;  2RG8 A;  2XGM A;  1UJJ A;  3L13 A;  4AOF A;  4ANW A;  3ZVV A;  3L17 A;  3EDT B;  3HVE B;  4FC8 A;  1Z6T A;  4I1M A;  5DIZ A;  1NP7 A;  3KEZ A;  3FDH A;  2X6F A;  5G05 J;  4BSX A;  3CVL A;  2DIW A;  5FT9 A;  4A3V A;  4KYO B;  4RSY A;  1HU3 A;  2X6H A;  4J8F A;  2WQ6 A;  2A4Z A;  3ONL A;  4FHK A;  3D9M A;  3ZN3 A;  3RJV A;  3AS5 A;  2PM6 A;  2Y4T A;  4U04 A;  1MQS A;  1E7U A;  2J07 A;  3QNK A;  2PQN A;  4UQY A;  4BX9 A;  5T3R A;  3GZS A;  2PM7 A;  3DBS A;  5FQ7 A;  2UY1 B;  5KJM A;  1H0A A;  3IHV A;  4UI9 J;  5KJK A;  3Q47 B;  4EBA G;  1HZ4 A;  3D9N A;  3WXX A;  3B7S A;  3N71 A;  3SFZ A;  4HOR A;  4AXH A;  1N54 A;  4NAC A;  2L6J A;  4ACK A;  5HQ8 A;  5D0O D;  5ANL A;  5KJN A;  5FWQ A;  3VLD A;  3SGH A;  4LER A;  3AS8 A;  3JQ0 A;  5KJL A;  4XKB A;  3LVR E;  4GZ6 A;  5G05 C;  2CFU A;  1E8Z A;  2FUL A;  3RKV A;  3L6A A;  4B8C B;  4XIF A;  3TGO A;  2AWI A;  3CHP A;  3HYM B;  4CRW A;  3PE4 A;  1OWL A;  2IU1 A;  3UT4 A;  4N3C A;  4O6F A;  3SD5 A;  3ZEF A;  2I9C A;  1OWM A;  3JCK C;  4A55 A;  3EHN A;  3LXU X;  3NZS A;  2AW6 A;  2A5U A;  4KMO A;  3U4T A;  3HVE A;  4UI9 C;  4AP2 A;  5BNW A;  4UWL A;  3QC1 A;  3QWW A;  4U8H A;  1YA0 A;  2LSU A;  4HVB A;  3FY4 A;  1H2U A;  1U3D A;  4BX8 A;  1TJC A;  3FUJ A;  3ZGQ A;  3Q15 A;  4A1S A;  5LCW J;  1LF8 A;  2XPZ A;  4GPK A;  4PS7 A;  1HX8 A;  4JPS A;  4I6E A;  2HYZ A;  3FUF A;  1UG3 A;  3CQC B;  3ENE A;  2IOL A;  4AVX A;  2OOE A;  4JA7 A;  4K03 A;  3S7D A;  4J0U A;  2UY1 A;  3LPZ A;  5DBK A;  4PDX A;  2KCL A;  4CDR A;  4JEH A;  5G04 C;  4I6G A;  2C0M A;  5AYW D;  3QDN A;  5EKQ D;  3RRN B;  2IFU A;  4U0U A;  4J8S A;  4BWR A;  1P5Q A;  4Y6W A;  3B7R L;  5BUZ A;  3JUI A;  2Y3A A;  4J6I A;  1TJF A;  2DCP A;  3FEY A;  3ML9 A;  3CK7 A;  4CGW A;  4IRU A;  3CKC A;  3ZHE B;  4IN3 B;  4N3A A;  3E4B A;  3OXL A;  4MKT A;  2IF4 A;  3PE3 A;  3CHM A;  3JYS A;  5JHB A;  3AU4 A;  4NUR A;  2YHE A;  4EZJ A;  4JVS A;  3CHO A;  4YND A;  1X5B A;  2GRL A;  3B7T A;  3ASH A;  3L08 A;  5FZS A;  2WXH A;  3ZIM A;  3RIB A;  4FHJ A;  4MLP A;  4NRH B;  1E7V A;  2AXU A;  3EHM A;  3PNT B;  4WND A;  3RRM B;  4WNG A;  2WXF A;  1Y6I A;  3ZYK A;  1U3C A;  2HR2 A;  1H19 A;  4GCO A;  1HH8 A;  3RRU A;  3FTY A;  4EEC A;  3KD7 A;  2WXO A;  2VSO E;  2WPV A;  3MCX A;  5E75 A;  3G2T A;  2MHK A;  4G26 A;  3TAX A;  4JXT A;  3CSF A;  2Q7F A;  1ZU2 A;  2X38 A;  4AJW A;  3FU5 A;  5CHE E;  3QJZ A;  3QWP A;  2I1J A;  4RVB A;  2WXN A;  4GYY A;  3FTS A;  1HS6 A;  5E76 A;  3FU6 A;  3CQG B;  4FLB A;  3O4Z A;  3MA5 A;  3CKB A;  4XE0 A;  5BPP A;  5AIJ A;  3OTN A;  2WB2 A;  4EBA A;  4HLE A;  3SHF A;  3FUN A;  3HHM A;  4NQ0 A;  4APF A;  4KZC A;  4G11 A;  3ZW3 A;  4LUN U;  2NXP A;  5LX8 A;  1E96 B;  5LP0 A;  1ELW A;  3LVQ E;  4AY5 A;  3PVL A;  4HXI A;  4ANX A;  3ESL A;  3IBE A;  2VSX E;  3ONK A;  3UT8 A;  2XRZ A;  4AY6 A;  3ZHE A;  5LFA A;  4AEZ C;  4TV3 A;  1UJK A;  3UMV A;  5JJ6 A;  2WXR A;  2V4L A;  2RD0 A;  3IKO B;  1JPL A;  1QQE A;  2M63 A;  4U0Z A;  3VTY A;  4C0E A;  4WAF A;  5A23 A;  3PS6 A;  4OVV A;  3CEQ A;  3L54 A;  4L2Y A;  4MS6 A;  4CCA A;  2XCB A;  3I4G A;  4I6J A;  1IYG A;  5ENN A;  3CVV A;  1EDU A;  4GA1 A;  1NA0 A;  5ARF A;  3MZL B;  3R9A B;  3C98 A;  3FP3 A;  3ZYM A;  3CK9 A;  4PS3 A;  2DBA A;  5FQ6 A;  3CLJ A;  2AXZ A;  3O48 A;  5EX3 A;  4I43 A;  4J8D A;  4R7L A;  2YIN A;  3K9I A;  2FF4 A;  5CCL A;  2WXL A;  3D9K A;  2J49 A;  4WWP A;  4APO A;  3FTU A;  1HF8 A;  4UQX A;  4WWN A;  2VGY A;  2HO1 A;  2I1K A;  3S7F A;  3G2S A;  3MEK A;  4E85 A;  1QNF A;  3GYZ A;  3Q49 B;  2KM4 A;  4LCT A;  4GYW A;  4ANV A;  1HO8 A;  2LAI A;  3FUH A;  4GU5 A;  3S7B A;  4K0R A;  4G23 A;  4WNF A;  3ULQ A;  5KCM A;  3ZRH A;  3FTW A;  3NQP A;  1MHQ A;  4EZL A;  3QK0 A;  3FH8 A;  4W9R A;  3BG1 B;  3G2U A;  3D3M A;  2P58 C;  2KAT A;  1OWN A;  3ASF A;  5A6C A;  2E2E A;  1A17 A;  2J08 A;  5AJL A;  4J8E A;  2QY7 A;  2EQX A;  1FCH A;  1IHG A;  4L23 A;  5ANR A;  4A1G A;  4V3I A;  5CMW A;  3IHY A;  3MKQ B;  5M72 A;  3QAR A;  4FU3 A;  2L9B A;  4RG9 A;  3L16 A;  4WWO A;  1EF1 C;  3ASG A;  3QWV A;  1H2V C;  3OAW A;  4I17 A;  4C0M A;  5BT1 A;  4XI0 A;  3BG0 B;  1H2T C;  4FAD A;  3GW4 A;  3TG4 A;  3MJW A;  2LO6 A;  3U64 A;  3CHS A;  5JHA A;  2ZU6 B;  4H7X A;  3FWV A;  5AJD A;  4F1S A;  3QKY A;  2V8S E;  3CR3 A;  3APD A;  4GAA A;  3HDX A;  1FVH A;  4L7T A;  4U07 A;  2AXV A;  5FTP A;  3SI5 A;  4DK5 A;  4FA6 A;  4JC8 A;  4GZ3 A;  4YVO A;  1JWG A;  4OVU A;  2WXI A;  4ANU A;  4JEU A;  3UQ3 A;  2VSN A;  3R7Q A;  1HG5 A;  4F53 A;  4I2W A;  4JW1 A;  4UWH A;  1SZ9 A;  2KCV A;  3SBS A;  3FUI A;  3P2B A;  2XQ0 A;  2L0I A;  3QAQ A;  2R59 A;  3KS2 A;  3APC A;  3LY8 A;  4KVO A;  3SF4 A;  1L5J A;  4BTA A;  1PC2 A;  5LCW C;  1HFA A;  3URZ A;  4N39 A;  4BY6 A;  4JHK A;  4KVM A;  5AEN A;  4N2S A;  2X6J A;  3QOU A;  3FU0 A;  4UQZ A;  2Y4U A;  1Y8M A;  3ESK A;  4GML A;  4FLH A;  3P1U A;  4TRQ A;  3CVY A;  3LEW A;  3SNX A;  3MKQ A;  4CT0 A;  3RK6 A;  4G2V A;  3Q4A B;  3D9I A;  4JA9 A;  2NC9 A;  3FFL A;  1NA3 A;  3T5X A;  5CCM A;  1ELK A;  5EX0 A;  2BUG A;  5G55 A;  3FH7 A;  3ZYQ A;  2J4D A;  4B8A A;  5BV0 A;  1HXI A;  4Q94 A;  3UT7 A;  3UX4 A;  4DJA A;  3AS4 A;  2WMN A;  2XHE A;  4L2L A;  3S7J A;  2KZT B;  2J4B A;  1WM5 A;  4JHR A;  4UWF A;  3RO3 A;  2XPY A;  2XEV A;  4ATG A;  5HI7 A;  2VSY A;  3TJP A;  3FUK A;  2ILR A;  4U63 A;  4PS8 A;  4PUC A;  3PUJ A;  2GRM A;  3LS8 A;  4DI3 A;  4DI4 A;  1HG2 A;  2UWJ G;  1S0P A;  3LCA A;  4BT8 A;  1KT1 A;  2I2O A;  1DVP A;  4HOS A;  2XGO A;  3LY9 A;  3FUM A;  1VDY A;  2OV8 A;  3I4R B;  3EJN A;  3MKR A;  3OXF A;  4JHJ A;  5FQ4 A;  3TXM A;  1IQU A;  2YHC A;  3I5P A;  4G24 A;  1PY1 A;  4GCN A;  4N3B A;  4A3T A;  3D9O A;  2GGF A;  4BT9 A;  2VYI A;  5EDS A;  4B89 A;  1OWP A;  2LSV A;  4KT6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...