4B89A

Mif4g domain of the yeast not1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
230
structure length
230
Chain Sequence
EMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
molecule keywords GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1
total genus 82
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4b89A00
2GGFA 2HM8A 2IOLA 4IULA 3D3MA 4CRWA 2VSOE 4CT4A 2FULA 4C9BB 2IU1A 2IOSA 1N52A 1H2VC 4JHJA 5ANRA 3RK6A 3EIJA 1N54A 1UW4B 4GMLA 4GMJA 4B89A 3EIQC 4B8CB 2ZU6B 1UG3A 1H6KA 3JUIA 3L6AA 2NSZA 4CEMA 4B8AA 4JHKA 1HU3A 4LUNU 2KZTB 2KZTA 2RG8A 3FEXA 1H2TC 2VSXE 2I2OA 1PAQA 1H2UA 2IONA 3FEYA
chains in the Genus database with same CATH superfamily
2IEJA 4N2QA 4L23A 4EBAG 3ZIMA 2FO1E 3ABME 4GTTA 4O60A 1MX4A 1N54A 2VSNA 2L6JA 1EDUA 1A17A 4DI3A 3G2TA 1NP7A 2EQXA 4GTSA 1O5MA 3KAEA 4GTPA 4U63A 1LF8A 3DSVA 4G1TA 1N4QA 5C2YA 5HKPA 5ANRA 5IY5E 5HI7A 1E96B 4B89A 3L08A 3NZSA 3PEUB 3CVYA 4IYPA 3P2BA 1N11A 5D66A 2X6HA 3TG4A 1G3NB 3I5PA 5EIBE 1YA0A 2RFAA 3SO8A 3ENEA 3ZXSA 3NQPA 4GYWA 2OVBA 5ENQD 3L22A 4ABNA 3KSQA 2EILE 2MHKA 3HXCA 4GCNA 4Y6CA 1MHQA 3IV0A 3QC1A 1TYQG 2ETAA 3R7QA 2HYZA 2R03A 4JZYA 4GTOA 2LSUA 4N3BA 1QYMA 4E85A 2P9KG 4CDMA 1XNFA 1BD8A 5FWQA 3DSSA 4GCOA 4K5CA 3MJWA 2XS8A 2XPIA 4DPRA 4GU5A 4GMLA 3TWTA 1EPUA 3D9MA 4DI4A 5J90A 4UWLA 4J7WA 4BTBA 3UKUG 4TXRA 3HG0D 2LXMA 2VGXB 1HH8A 3O48A 2RKKA 3V31A 4EHMA 4TV3A 4XX5A 1ZBPA 2KM4A 1UJKA 3T5XA 3CVLA 3ZEFA 2P9UG 3ASHA 1BPOA 2C0LA 4K5BA 5A23A 4TXPA 4U0UA 4EECA 1JUQA 1H2UA 2XS1A 2GGFA 3EU5A 1KLXA 3BUAA 3DPYA 3AG1E 4GPKA 1DVPA 4APOA 3CHPA 3PE3A 3UT4A 3EIJA 3KD7A 2CHZA 4C0EA 4UWKA 3UT8A 3TWRA 1Z6TA 4UI9C 5AQ7A 3U64A 3WXXA 1SQMA 4CRWA 3U66A 3APDA 2XZDG 4C9BB 3D9PA 3E33A 2WPVA 3RJVA 4PDXA 2ZIRA 3ZGQA 2ZGGA 1FPPA 3HYMB 5AJDA 4BESA 2ZU6B 4LERA 3ESLA 5CEDB 1OWLA 4A55A 2VYIA 3NBNB 4KVOA 3PE4A 3UIPC 1V54E 3JQ1A 4K03A 3LYAA 4L7TA 3UI2A 4HLLA 2ILRA 2Y0BG 4DX7D 2H6HA 1WDYA 4HRNA 2QFCA 3MZLB 4UWGA 2WVIA 3C5RA 3FEXA 5BUZA 3FFLA 1NI1A 1TNUA 3FTXA 4JA9A 3HIZA 4ILGA 4U96D 1YCSB 3CEQA 3FH7A 3ESKA 2QZAA 4FHJA 3LY8A 4AV7A 1NL4A 2DZNA 4B0ZA 4V3IA 3FU0A 1N52A 4JXTA 1FT1A 2OEWA 5HRYA 4N3AA 4U0ZA 2DVWA 1OUVA 2GRNB 5G2NA 3G2SA 4EQFA 4I2WA 3RO2A 2BKKB 4JVSA 2UY1A 2F37A 1U3DA 4J0UA 3DXKG 3C3RA 1NFIE 4XI0A 2V4LA 3RK6A 4G2VA 4ATZD 5EN5D 1TNZA 2A5EA 3MCXA 2ETBA 3CHRA 3FTZA 4OAVB 4WWOA 3HXEA 2V8SE 2L0IA 5JJ6A 5FZQA 2XRZA 3C72A 1OCCE 5FQ4A 4HRLA 3D9HA 2DCPA 2CFZA 3ZPJA 5ARGA 3ZHEB 3ONLA 4N5CA 2YHEA 2PNNA 3Q47B 3E32A 3DPDA 5ITZF 2GRLA 1D9SA 2IOSA 3IBEA 4L2YA 5G04J 4RG9A 4NIKA 1ZB1A 1KZOA 2P9LG 1JWFA 4HQDA 2YINA 4YDWA 2BUGA 4N5QA 3ASFA 3Q15A 3CKBA 3TWWA 2Y1LE 1TN6A 3JQ0A 4F6RD 3FU3A 2KCLA 1DC2A 1Y6IA 4B94A 5D0OD 1HF8A 1IXVA 1WG0A 5JJ7A 1JWGA 2GRRB 3QKYA 4U04A 3SGHA 3CLJA 4AM9A 2H6FA 3FUJA 5KJMA 2MOWA 3SFYA 4ANWA 3HHMA 4KMOA 1INZA 4BWRA 3ABKE 4M3OA 1JPLA 3HDXA 3T9KA 4N39A 1K3ZD 5LP0A 1HS6A 3L54A 3TJPA 3I4RB 3Q75A 3PNTB 3ZYMA 2Y69E 2KZTB 3D9NA 1ZU2A 3DRAA 4XIFA 3ZW3A 2E2EA 2V0PA 3AS8A 2I1KA 4FLBA 5HQ8A 3OXGA 5LOZA 3UKRG 5LCWC 4ANXA 3L6AA 3ZYLA 4EZJA 5E76A 3PZ1A 4XKCA 3EHNA 2MYOA 4ANUA 3PH0C 5FQ6A 5EX3A 2CG2A 1TNYA 2F8XK 2J07A 3KS2A 4AJWA 2EIME 3AG4E 1OY3D 4WNGA 4FHKA 4YNDA 3AJIA 4TRQA 1LD7A 4BEPA 3ZU7B 1N94A 4Q69A 4HOSA 2P9SG 4KZCA 4JPSA 4NACA 2WXHA 2WXOA 4DX5D 2R5SA 4J8YA 3FU5A 3ONKA 4G8LA 4HI9A 4TUUA 4I9CA 2GRQB 5E75A 5KNGA 2DYRE 3ZYQA 4OYSA 3Q5MA 4BT8A 2P2CP 3TL5A 1H0AA 5AQ9A 3B7TA 4UI9K 4F3VA 1UG3A 2FBNA 3OXLA 4EZKA 4I43A 3RAUA 4OVVA 4CCAA 3SD5A 3HVEB 3MV3B 4A3VA 3ASGA 3E34A 3RRUA 5FQ8A 5JA4D 4GB9A 4HORA 1IHGA 3J5QB 3JUEA 3TWXA 2XEHA 3CHOA 1JCSA 4A1SA 3QAQA 3CSTA 3SF4A 4R7LA 1A5EA 3L9TA 4JEUA 4RVBA 5G05C 3O4ZA 5CECB 4NRHB 4WUYA 3FU6A 1TN7A 4IULA 3D3MA 3LXUX 5AAOA 3TWSA 3FWVA 4L1BA 3QWWA 2WXKA 3FUKA 1IHBA 3AS4A 1FVFA 3MYVA 2WXIA 2WXRA 5JJTA 4J6IA 5ANLA 1TR4A 5KNHD 3MA5A 4XEIG 2PZIA 2B0OE 4G26A 2LSVA 2EIKE 1BLXB 3DSWA 5BW8C 4AY5A 4CGVA 4J8DA 4B93B 4BERA 4U8HA 4IRUA 3FUFA 2LAHA 3FTUA 4AP2A 5EKQD 3CSFA 3RSEG 2WXMA 4U95D 1EF1C 3ZKJA 4HI8A 3AG3E 4ACKA 5BXOA 2J08A 2ZISA 2LXLA 1QQEA 1BI7B 1N4SA 2KCKA 4AOFA 4ZFHA 4PUCA 4GZ5A 3UMVA 3UTMA 1HU3A 2R17C 2I2OA 1X5BA 2WXQA 3SY2A 1UOHA 3J5PA 3PRZA 2XZTG 2V5FA 3Q7AA 3FUIA 3NF1A 1DNPA 1LTXA 2E0IA 2JABA 2FI7A 1KPSB 4TXQA 2WMOA 4FP7A 3ISMC 4C48B 3CVWA 4BT9A 2VSOE 3DEOA 3FUMA 4EBAA 3PUJA 4PS3A 5CEAA 4BTAA 2DWZA 2WXFA 3GZSA 3EU9A 5CCLA 1U2VG 2VTBB 1XGWA 2IO2C 3UXGA 4URKA 4I6JA 1HE8A 2X6KA 3BQOA 4XKBA 1TNOA 3Q79A 5CCMA 3ULYA 5A6CA 4I17A 5EYLA 1OCZE 2R2LA 2X38A 3KEAA 2KZTA 2Y4UA 1WAO1 1NA0A 3B7BA 1OWOA 4EZLA 3FULA 3TXMA 5AJLA 1Q2ZA 4GTQA 3PREA 2AXZA 1PC2A 3PZ3A 5AENA 4GZ3A 4JHRA 5D2MC 1YMPA 1U3CA 4FJYA 3GZ2A 5LX8A 4TUMA 4D10C 3FTYA 1YYHA 2CFUA 2KBXA 4BSXA 4CEMA 3Q7FA 4J8FA 4XZ4A 2RG8A 3SQVA 1E8XA 4EPZA 3MKQA 5CRVA 5DIZA 3CHQA 4I2ZA 4JA7A 4LRZA 4GTVA 1HX8A 3B7RL 1OT8A 4HOTA 2DZOA 2IF4A 5T3RA 2L9BA 3SZ7A 3HRAA 2NYJA 4DLQA 5BT1A 4N3CA 3NOGD 2AJAA 5BNWA 3L17A 1V55E 3NOCD 5EYPF 5B1AE 5AIJA 1H19A 3UM1A 3E30A 3ASDA 4QFVA 2NXPA 4U0SA 4JHJA 2VGYA 5FINA 1UW4B 5KBAA 4AY6A 2OOEA 3CVNA 1EYHA 2OEVA 5FTPA 2ONDA 2VGXA 1TN8A 1MJ0A 3CQGB 3ZHEA 5AN8A 2WB2A 3OXFA 3U9WA 3R9MA 3W9FA 4I1MA 4GZCA 2Y3AA 3C98A 1OCOE 3PEVB 3RKVA 1OWPA 4RLYA 3UQ3A 4Q94A 2OCCE 3DSTA 4L9PA 2V5QC 3PUKA 3LVRE 4PS8A 1BI8B 2ETCA 2IY0C 4B8CB 1HFAA 1X81A 3S7BA 4I6GA 5FZSA 4LNBA 1E7UA 1SA4A 2YQ8A 1IQRA 2QY7A 4RQIA 1MX2A 2KATA 2MRIA 4KVMA 4ATGA 4LNUD 3UIOC 4HRMB 2F0YA 4YVQC 2RFMA 4A1GA 2OVFA 2BTDA 3TWQA 2A4ZA 3VLDA 3FH5A 3D9KA 2I1JA 2XCCA 3TWUA 2Q7FA 4WNEA 3IHYA 1HG2A 3TG5A 4BETA 4CDRA 2VQ2A 5FJYA 3UT7A 3CKCA 2X6JA 5KWDA 1NZNA 5G55A 5A7DB 4UUCA 3LVQE 3APFA 4UQZA 1HG5A 2HM8A 5KJKA 4XI9A 4WNFA 3NZUA 2IFUA 4GMRA 3T5VA 2XEEA 3EUVA 2R59A 5CMYA 3NAWA 3G2UA 3ZFWA 4MBGA 3ZVVA 4FJZA 4F53A 2IONA 3IXEA 4DX1A 3CK9A 2H6GA 1Z3XA 3GW4A 3D9OA 1FT2A 4F7AA 5ARFA 3K9IA 3LDZA 2BKGA 3CIAA 3FDHA 4I9EA 2EIJE 1S64A 3WG7E 1E7VA 4MKTA 5LCWJ 2VGEA 3LEWA 3UM0A 3V2XA 3AG2E 5EDSA 3LS8A 2ZGDA 5BPPA 2GRMA 5AQAA 4GA1A 4IN3B 3ZN3A 4L2LA 4X8QA 5AQBA 3D9JA 2IJGX 3BG1B 4FA6A 2PM6A 4GYOA 4BY6A 4LUNU 3QWVA 1VDYA 5ENNA 2XEVA 3QARA 1OCRE 2XGOA 1ELWA 4HS2A 1N4PA 4BX9A 3EHQA 3DXMG 2X3MA 4HOQA 1OXJA 5ENRD 4UWHA 4CT4A 4AVXA 1TJCA 1E90A 4UI9J 5CHEE 2RD0A 3ULQA 3MEKA 3UPVA 2LO6A 4YDEA 4GYYA 1Z5SC 2HE0A 4RSYA 2WM9A 1RW2A 4C0MA 4H7XA 2BEDA 3L82A 4FULA 1LD8A 1H2TC 4WWPA 3F6QA 4RG6A 4AIFA 4G23A 1JCQA 2IU1A 1S63A 1ELKA 4JW1A 3B95A 1H6OA 3ZRHA 4APFA 3ABLE 2GRPB 2FEZA 2Y4TA 4G11A 4JEHA 1QNFA 3Q73A 2P58C 3LKUA 5G04C 5CBNA 5B3SE 3LJ3A 1N0QA 3BEEA 1K1AA 3DSUA 3SHFA 3N71A 1MZCA 3KSLA 4MS6A 4J8EA 1D8EA 4AEZC 3Q49B 5J08A 1DCQA 2DBAA 2YNQA 1OWNA 3CGHA 4FU3A 1WY6A 2X6IA 4K5AB 2NC9A 3B7SA 3GYZA 4W9RA 3V30A 3APCA 3DSXA 3QB2A 3IEGA 4U8YD 1IKND 5ENTD 3SFZA 3AU4A 5JHAA 3FTSA 5EIDA 5KCMA 5BV0A 2WXPA 3EJNA 4P29A 3SFXA 5JMND 1MX6A 2X6FA 3CR3A 3DBSA 3L13A 1GW6A 2P9PG 3HXFA 4CT0A 2LNIA 3G2WA 2WXNA 1HO8A 3URZA 2UY1B 3NB2A 4FLHA 2WQ7A 3RIBA 4K0RA 2J49A 3EDTB 1UJJA 2PQNA 2VJ8A 5H7PA 3UX4A 2L6BA 4WNDA 3CVVA 3DEPA 3PS6A 4JC8A 3LCAA 3TWVA 2P9IG 1OWMA 2A5UA 2C0MA 3QJZA 3VTYA 2XPYA 3CVQA 3Q9NC 4DRXE 2IQCA 5T4YA 4KXKB 2XPZA 4GA2A 4JHKA 2FO7A 2QYJA 4GZ6A 5LFAA 3FUDA 4ZHBA 1WM5A 5EX0A 4YDYA 4HFGA 1HXIA 2CHWA 3VLEA 2B6CA 2CG3A 2QC9A 3ML8A 3GZ1A 4HBDA 1W3BA 3CK8A 4DX6D 1TJFA 1Z3YA 1L5JA 1SA5A 3RO3A 4YVOA 2BF0X 3QK0A 1RZ4A 5FZRA 1SZAA 1PY1A 1AWCB 5KJLA 4KBQA 3VTXA 3FP3A 3FY4A 1UN9A 2JLBA 4YDOA 3W9GA 4GMJA 1KT1A 3JCKC 1H6PA 3CK7A 3FTVA 5CBOA 3CVUA 5HS0A 4B8AA 3TAXA 3E37A 5KJNA 3OTNA 1SW6A 3JXIA 4GTRA 3MKQB 4DLOA 3ASOE 3FHEA 4FADA 3AAAC 5CRUA 4JL0A 4LSZE 5M72A 3S2AA 1TNBA 1JCRA 3OAWA 3ZUVB 3EIQC 4BX8A 3MX3A 1NA3A 3MKRA 4JD2G 3E4BA 1SZ9A 1N95A 2J8SD 4CDNA 4ME2A 5CERB 2V4HC 3CVPA 5JHBA 5G05J 4H7YA 3ULEG 2CHXA 3ZXPA 4O6FA 1BU9A 4OAUC 4HLEA 3EHRA 3D9IA 3MGBA 3MV2B 2GW1A 4DJAA 4UQXA 2C2LA 2VSYA 4QQIA 3HXBA 2I6HA 1K8KG 2EINE 4PS7A 1HZ4A 3ML9A 3AS5A 4HNAD 5ENOD 2HR2A 1O1SA 3PZ2A 2YHCA 4M7CA 4NURA 1QBQA 3S7JA 2KXPC 3JUIA 3PNLB 2H6IA 3U3WA 3T8MA 2XGMA 4ILIA 4Q96A 1FCHA 2F8YA 3KEZA 3IKOB 2AXVA 4HB5A 4NQ0A 2FF4A 5BV1A 1E8WA 3VLFA 2PM7A 4BFRA 1QZ2A 2WXJA 4A3TA 3CHSA 4J8SA 4UWFA 2WQ6A 4GZDA 3I4GA 3U4TA 3L16A 3UUXA 4F1SA 4E6HA 2XHEA 3QOUA 3LY7A 1N9AA 3CQCB 5FT9A 4Z68A 2OV8A 5AYWD 2WXLA 4KZ0A 2VSXE 3CV0A 2VTBA 1PAQA 2XGSA 1S0PA 5B1BE 4MLPA 3R9AB 4ACLA 4G24A 1P5QA 4OVUA 3C3QA 4KYOB 1H2VC 4U8VD 4FC8A 4I6EA 4MRUA 3RRMB 2XRYA 3QWPA 4UQYA 4N2SA 4ANVA 3PZDA 3QDNA 5C1DA 4BSZB 5AARA 4KT6B 3AU5A 3HVEA 3PDNA 2IOLA 2P9NG 3CHMA 3T8KA 2LAIA 3V79K 2FULA 1N0RA 2J9QA 3B7UX 3SBSA 4JB8P 4ILHB 3CVXA 1D8DA 2KCVA 4Y6WA 2KC7A 2QYUA 1MYOA 1UN8A 3Q9UC 4CGWA 3B13A 1IQUA 2XCBA 4F1PA 3BG0B 4O1OA 4DK5A 4CZ2D 2R05A 4LG6A 4LNGA 5EILA 3BU8A 4GTMA 1E8YA 1B89A 4DX2A 4U07A 4O1PA 4HVBA 4XE0A 2JEKA 2XQ0A 1FVHA 2ZXWE 1KZPA 3QNKA 2UWJG 4AXHA 3C3OA 3I3NA 2I9CA 1S70B 3ASNE 1Y8MA 1O1RA 4I1OB 3LY9A 4HOUA 5FIOA 4LCTA 4WAFA 4GA0A 3SBTB 2GROB 1DCEA 3UINC 2AWIA 3D9LA 4HXIA 1KT0A 3RRNB 5T8IA 1E8ZA 2DYSE 3P1UA 5FQ7A 5ENSD 3DWLG 5CMWA 3Q78A 3FH8A 2LUHA 2PL2A 2J4DA 4PH4B 1TEZA 5DBKA 3ZYKA 4LEUA 4WWNA 1O1TA 3S7FA 5D0QD 1AP7A 1MQSA 2AW6A 3HXDA 3UM3A 4G8KA 3S7DA 2XENA 3LPZA 3FEYA 4GPMA 2PQRA 3V2OA 4I1AA 2HO1A 2AXUA 2WMNA 3ZNGA 5BXUA 5ENPD 2WXGA 3EHMA 3FUHA 2DIWA 3G2VA 3LJNA 3Q4AB 4GAAA 2IO3C 4CYMD 2NSZA 4U7EB 3FUNA 3TGOA 3FUEA 3PVLA 3X2QE 1ELRA 2J4BA 2AVPA 3UM2A 1K1BA 2L0TB 4DUIA 3SNXA 1SVXA 3JXJA 3R7RA 3PZ4A 4G25A 2WQHA 3SI5A 3JYSA 2J09A 3FTWA 1N4RA 3IHVA 2M63A 1H6KA 4A63B 1IYGA 2R02A 3RU0A 3TXNA
chains in the Genus database with same CATH topology
3HDXA 3PS6A 4JC8A 3LCAA 4L23A 4N2QA 4N39A 5LP0A 1HS6A 3L54A 1OWMA 4EBAG 2A5UA 3TJPA 1H19A 3ZIMA 5AIJA 3ASDA 2C0MA 4QFVA 2NXPA 3I4RB 3QJZA 4JHJA 2VGYA 4U0SA 3VTYA 2XPYA 1N54A 1UW4B 3PNTB 2VSNA 3CVQA 2L6JA 3ZYMA 4AY6A 2OOEA 3CVNA 2IQCA 5T4YA 4KXKB 1EDUA 2XPZA 1EYHA 4GA2A 5FTPA 2ONDA 2VGXA 4JHKA 1A17A 2FO7A 5LFAA 4GZ6A 2KZTB 3FUDA 4DI3A 1WM5A 3CQGB 3G2TA 3D9NA 5EX0A 3ZHEA 1NP7A 2EQXA 2WB2A 1ZU2A 3OXFA 3U9WA 3KAEA 4I1MA 4XIFA 3ZW3A 4U63A 1LF8A 2E2EA 4G1TA 5C2YA 4HFGA 2V0PA 4GZCA 2Y3AA 5ANRA 3C98A 1HXIA 3AS8A 2I1KA 3PEVB 2CHWA 3VLEA 3RKVA 1OWPA 2CG3A 3ML8A 4FLBA 1E96B 3GZ1A 5HI7A 4B89A 1W3BA 3L08A 5HQ8A 3CK8A 3OXGA 3NZSA 3PEUB 1TJFA 5LOZA 5LCWC 3CVYA 4IYPA 4ANXA 3L6AA 1Z3YA 1L5JA 3ZYLA 4EZJA 3P2BA 4YVOA 3RO3A 2BF0X 3QK0A 2X6HA 3TG4A 5FZRA 3I5PA 1SZAA 1PY1A 1YA0A 5KJLA 5E76A 3ENEA 3ZXSA 3UQ3A 4Q94A 3NQPA 4XKCA 4GYWA 2OVBA 4KBQA 3L22A 3VTXA 3FP3A 3FY4A 1UN9A 3EHNA 4ABNA 4ANUA 2JLBA 3PH0C 3PUKA 5FQ6A 5EX3A 4GMJA 2MHKA 3LVRE 2CG2A 4PS8A 4GCNA 1KT1A 3JCKC 4Y6CA 1MHQA 3CK7A 3FTVA 4B8CB 1HFAA 2J07A 3IV0A 3CVUA 3QC1A 3KS2A 3S7BA 4B8AA 4I6GA 5FZSA 4AJWA 3TAXA 1E7UA 5KJNA 3OTNA 3R7QA 2HYZA 4JZYA 2YQ8A 4WNGA 4FHKA 1IQRA 2QY7A 3MKQB 4DLOA 4YNDA 4TRQA 2LSUA 4N3BA 3FHEA 4FADA 4Q69A 4HOSA 4KVMA 2KATA 2MRIA 4ATGA 4JL0A 5M72A 4YVQC 3S2AA 4KZCA 3OAWA 4JPSA 2WXHA 4NACA 4E85A 2WXOA 4A1GA 2R5SA 3EIQC 4CDMA 1XNFA 2OVFA 2BTDA 4BX8A 2A4ZA 3MX3A 3VLDA 3FU5A 1NA3A 3FH5A 3MKRA 3ONKA 5FWQA 3E4BA 1SZ9A 3D9KA 4GCOA 2I1JA 2XCCA 2Q7FA 4WNEA 3MJWA 3IHYA 1HG2A 4CDNA 4ME2A 3TG5A 4TUUA 4CDRA 3CVPA 2VQ2A 2XPIA 4I9CA 5FJYA 5JHBA 5E75A 5G05J 3UT7A 3CKCA 2X6JA 4DPRA 3ZYQA 4OYSA 1NZNA 3Q5MA 4H7YA 4BT8A 4GU5A 3TL5A 4GMLA 5G55A 1H0AA 1EPUA 3D9MA 2CHXA 5A7DB 4O6FA 3B7TA 4DI4A 4UI9K 5J90A 4HLEA 4F3VA 4UWLA 1UG3A 2FBNA 3OXLA 4BTBA 3D9IA 2VGXB 3LVQE 3MGBA 3APFA 2GW1A 1HH8A 3MV2B 4I43A 4UQZA 3O48A 4DJAA 4EZKA 1HG5A 4OVVA 4UQXA 4CCAA 3SD5A 3HVEB 2C2LA 2HM8A 2VSYA 3MV3B 5KJKA 2I6HA 4TV3A 4WNFA 3ASGA 4XI9A 4A3VA 4XX5A 3RRUA 1ZBPA 2KM4A 4PS7A 5FQ8A 3NZUA 1HZ4A 3ML9A 4GB9A 1UJKA 2IFUA 3AS5A 1IHGA 3T5XA 3CVLA 4HORA 3T5VA 2HR2A 3ZEFA 2R59A 3CHOA 5CMYA 3ASHA 2YHCA 1BPOA 2C0LA 4A1SA 4NURA 3S7JA 3QAQA 3G2UA 3JUIA 5A23A 3PNLB 3CSTA 4U0UA 3U3WA 4EECA 3ZFWA 1JUQA 3SF4A 3ZVVA 3T8MA 2XGMA 4ILIA 4Q96A 4FJZA 1FCHA 4F53A 1H2UA 2IONA 2GGFA 3KEZA 1KLXA 3CK9A 4R7LA 3IKOB 2AXVA 1Z3XA 3GW4A 4GPKA 3D9OA 1DVPA 4APOA 3CHPA 4NQ0A 3PE3A 2FF4A 3UT4A 4JEUA 4F7AA 5ARFA 3K9IA 5BV1A 1E8WA 3VLFA 3LDZA 3EIJA 2PM7A 3FDHA 3CIAA 3KD7A 4I9EA 4BFRA 1QZ2A 2CHZA 2WXJA 4RVBA 4A3TA 5G05C 3CHSA 4J8SA 1E7VA 3O4ZA 4MKTA 4UWFA 2WQ6A 4GZDA 4C0EA 4UWKA 3I4GA 3U4TA 5LCWJ 4NRHB 3UT8A 4WUYA 1Z6TA 4UI9C 3LEWA 3U64A 3FU6A 3WXXA 1SQMA 3L16A 4IULA 3D3MA 3LXUX 4CRWA 3U66A 3FWVA 4L1BA 3APDA 3UUXA 4F1SA 5EDSA 3LS8A 3D9PA 3QWWA 4C9BB 4E6HA 2GRMA 2WXKA 2XHEA 3FUKA 5BPPA 3AS4A 1FVFA 3QOUA 3LY7A 2WPVA 3MYVA 4PDXA 2WXIA 3RJVA 2WXRA 4GA1A 4IN3B 5JJTA 3ZN3A 4L2LA 3CQCB 4J6IA 5FT9A 3ZGQA 3D9JA 5AJDA 3HYMB 2IJGX 5ANLA 2OV8A 2ZU6B 3BG1B 4LERA 5AYWD 3MA5A 4FA6A 2PM6A 2WXLA 4GYOA 4KZ0A 3ESLA 4BY6A 1OWLA 4LUNU 4A55A 2VYIA 2VSXE 3CV0A 2VTBA 1PAQA 2XGSA 1S0PA 3QWVA 1VDYA 2PZIA 5ENNA 4G26A 2LSVA 2XEVA 3QARA 4MLPA 3R9AB 5BW8C 4ACLA 4G24A 4AY5A 4CGVA 4J8DA 1P5QA 4KVOA 4OVUA 2XGOA 4KYOB 1H2VC 4FC8A 1ELWA 4I6EA 4MRUA 3RRMB 3PE4A 2XRYA 3QWPA 4HS2A 4UQYA 3JQ1A 4BX9A 4U8HA 4K03A 3LYAA 4L7TA 4IRUA 4ANVA 4N2SA 3PZDA 3FUFA 2LAHA 2X3MA 3FTUA 3QDNA 5C1DA 4AP2A 2ILRA 5EKQD 3CSFA 4HOQA 4KT6B 2QFCA 3MZLB 2WXMA 4UWGA 2WVIA 1EF1C 3AU5A 3FEXA 4UWHA 4AVXA 4CT4A 3FFLA 1TJCA 5BUZA 3HVEA 3PDNA 2IOLA 1E90A 3CHMA 4UI9J 2LAIA 5CHEE 2RD0A 4ACKA 2FULA 3ULQA 3MEKA 2J08A 2LO6A 3UPVA 3FTXA 4GYYA 4JA9A 3HIZA 2J9QA 3B7UX 3SBSA 1QQEA 4ILHB 4RSYA 2WM9A 2KCKA 3CVXA 4AOFA 4ILGA 4PUCA 4C0MA 2KCVA 4GZ5A 4H7XA 4Y6WA 3UMVA 3CEQA 3FH7A 2KC7A 1UN8A 3ESKA 4CGWA 3B13A 4FULA 1HU3A 1IQUA 2R17C 4FHJA 2XCBA 3LY8A 1H2TC 4WWPA 2I2OA 4AV7A 1X5BA 2WXQA 3BG0B 4RG6A 4DK5A 4AIFA 3PRZA 4G23A 4B0ZA 2V5FA 4V3IA 2IU1A 1E8YA 3FU0A 1N52A 4JXTA 3FUIA 3NF1A 1DNPA 1ELKA 1B89A 4N3AA 2E0IA 4JW1A 4U07A 4U0ZA 1OUVA 4HVBA 4XE0A 5G2NA 2JEKA 2FI7A 2XQ0A 3G2SA 4EQFA 4I2WA 1FVHA 3ZRHA 4APFA 2FEZA 2Y4TA 4G11A 3RO2A 4JVSA 2UY1A 2WMOA 4FP7A 4JEHA 1QNFA 3CVWA 1U3DA 4J0UA 3QNKA 4BT9A 2VSOE 2UWJG 2P58C 3LKUA 5G04C 4XI0A 3LJ3A 2V4LA 3RK6A 4AXHA 4G2VA 3FUMA 3I3NA 2I9CA 4EBAA 1Y8MA 3PUJA 4PS3A 3BEEA 3MCXA 4BTAA 4I1OB 3CHRA 3LY9A 2WXFA 3FTZA 3GZSA 4HOUA 3SHFA 5CCLA 3N71A 2VTBB 1XGWA 4LCTA 4WAFA 4URKA 4MS6A 4J8EA 4I6JA 4GA0A 3SBTB 4WWOA 1HE8A 2AWIA 2X6KA 3D9LA 2V8SE 4HXIA 1KT0A 2L0IA 3RRNB 5JJ6A 4AEZC 5FZQA 2XRZA 5T8IA 3Q49B 4XKBA 5J08A 1E8ZA 3P1UA 5FQ4A 5FQ7A 5CCMA 5CMWA 2DBAA 2YNQA 5A6CA 4I17A 1OWNA 3CGHA 3FH8A 2DCPA 4FU3A 1WY6A 2X6IA 2X38A 2CFZA 3ZPJA 2KZTA 5ARGA 3ZHEB 2PL2A 3B7SA 2NC9A 2Y4UA 3ONLA 2J4DA 3GYZA 1WAO1 4W9RA 4N5CA 1NA0A 4PH4B 1OWOA 2YHEA 3APCA 1TEZA 3Q47B 3DPDA 4EZLA 2GRLA 5DBKA 3FULA 3TXMA 5AJLA 3ZYKA 2IOSA 3IBEA 4LEUA 4WWNA 4L2YA 3QB2A 3PREA 5G04J 4RG9A 3IEGA 2AXZA 3S7FA 1PC2A 5D0QD 5AENA 1MQSA 2AW6A 4GZ3A 1JWFA 2YINA 4JHRA 2BUGA 3SFZA 3AU4A 1U3CA 3ASFA 5JHAA 3S7DA 3FTSA 4FJYA 3GZ2A 3Q15A 3CKBA 3LPZA 5LX8A 3FEYA 5KCMA 5BV0A 2WXPA 2PQRA 4D10C 3EJNA 4P29A 3FTYA 2HO1A 4I1AA 2AXUA 2WMNA 2X6FA 3JQ0A 3CR3A 3FU3A 2KCLA 2WXGA 3EHMA 3DBSA 3FUHA 2CFUA 2DIWA 3L13A 3G2VA 1Y6IA 4B94A 3Q4AB 1GW6A 4GAAA 5D0OD 4BSXA 2NSZA 4CT0A 4CEMA 2LNIA 3FUNA 1HF8A 3G2WA 4J8FA 2WXNA 3TGOA 1HO8A 4XZ4A 2RG8A 2UY1B 3FUEA 3PVLA 1E8XA 1ELRA 3URZA 2J4BA 4FLHA 2WQ7A 2AVPA 5JJ7A 1JWGA 3RIBA 4K0RA 2J49A 4EPZA 3MKQA 5DIZA 3EDTB 2L0TB 3QKYA 4U04A 3CHQA 4I2ZA 1UJJA 4JA7A 3SGHA 3SNXA 3CLJA 4LRZA 3R7RA 1HX8A 4AM9A 3B7RL 4G25A 4HOTA 2WQHA 2IF4A 3FUJA 2PQNA 2VJ8A 3JYSA 2MOWA 2L9BA 5T3RA 3SI5A 2J09A 3FTWA 3SZ7A 5KJMA 4ANWA 3UX4A 3HHMA 3IHVA 2M63A 4KMOA 4WNDA 4DLQA 1H6KA 1IYGA 5BT1A 4N3CA 3RU0A 3CVVA 1INZA 3TXNA 5BNWA 3L17A 4BWRA 4M3OA 1JPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGF A;  2HM8 A;  2IOL A;  4IUL A;  3D3M A;  4CRW A;  2VSO E;  4CT4 A;  2FUL A;  4C9B B;  2IU1 A;  2IOS A;  1N52 A;  1H2V C;  4JHJ A;  5ANR A;  3RK6 A;  3EIJ A;  1N54 A;  1UW4 B;  4GML A;  4GMJ A;  4B89 A;  3EIQ C;  4B8C B;  2ZU6 B;  1UG3 A;  1H6K A;  3JUI A;  3L6A A;  2NSZ A;  4CEM A;  4B8A A;  4JHK A;  1HU3 A;  4LUN U;  2KZT B;  2KZT A;  2RG8 A;  3FEX A;  1H2T C;  2VSX E;  2I2O A;  1PAQ A;  1H2U A;  2ION A;  3FEY A; 
#chains in the Genus database with same CATH topology
 2IEJ A;  4N2Q A;  4L23 A;  4EBA G;  3ZIM A;  2FO1 E;  3ABM E;  4GTT A;  4O60 A;  1MX4 A;  1N54 A;  2VSN A;  2L6J A;  1EDU A;  1A17 A;  4DI3 A;  3G2T A;  1NP7 A;  2EQX A;  4GTS A;  1O5M A;  3KAE A;  4GTP A;  4U63 A;  1LF8 A;  3DSV A;  4G1T A;  1N4Q A;  5C2Y A;  5HKP A;  5ANR A;  5IY5 E;  5HI7 A;  1E96 B;  4B89 A;  3L08 A;  3NZS A;  3PEU B;  3CVY A;  4IYP A;  3P2B A;  1N11 A;  5D66 A;  2X6H A;  3TG4 A;  1G3N B;  3I5P A;  5EIB E;  1YA0 A;  2RFA A;  3SO8 A;  3ENE A;  3ZXS A;  3NQP A;  4GYW A;  2OVB A;  5ENQ D;  3L22 A;  4ABN A;  3KSQ A;  2EIL E;  2MHK A;  3HXC A;  4GCN A;  4Y6C A;  1MHQ A;  3IV0 A;  3QC1 A;  1TYQ G;  2ETA A;  3R7Q A;  2HYZ A;  2R03 A;  4JZY A;  4GTO A;  2LSU A;  4N3B A;  1QYM A;  4E85 A;  2P9K G;  4CDM A;  1XNF A;  1BD8 A;  5FWQ A;  3DSS A;  4GCO A;  4K5C A;  3MJW A;  2XS8 A;  2XPI A;  4DPR A;  4GU5 A;  4GML A;  3TWT A;  1EPU A;  3D9M A;  4DI4 A;  5J90 A;  4UWL A;  4J7W A;  4BTB A;  3UKU G;  4TXR A;  3HG0 D;  2LXM A;  2VGX B;  1HH8 A;  3O48 A;  2RKK A;  3V31 A;  4EHM A;  4TV3 A;  4XX5 A;  1ZBP A;  2KM4 A;  1UJK A;  3T5X A;  3CVL A;  3ZEF A;  2P9U G;  3ASH A;  1BPO A;  2C0L A;  4K5B A;  5A23 A;  4TXP A;  4U0U A;  4EEC A;  1JUQ A;  1H2U A;  2XS1 A;  2GGF A;  3EU5 A;  1KLX A;  3BUA A;  3DPY A;  3AG1 E;  4GPK A;  1DVP A;  4APO A;  3CHP A;  3PE3 A;  3UT4 A;  3EIJ A;  3KD7 A;  2CHZ A;  4C0E A;  4UWK A;  3UT8 A;  3TWR A;  1Z6T A;  4UI9 C;  5AQ7 A;  3U64 A;  3WXX A;  1SQM A;  4CRW A;  3U66 A;  3APD A;  2XZD G;  4C9B B;  3D9P A;  3E33 A;  2WPV A;  3RJV A;  4PDX A;  2ZIR A;  3ZGQ A;  2ZGG A;  1FPP A;  3HYM B;  5AJD A;  4BES A;  2ZU6 B;  4LER A;  3ESL A;  5CED B;  1OWL A;  4A55 A;  2VYI A;  3NBN B;  4KVO A;  3PE4 A;  3UIP C;  1V54 E;  3JQ1 A;  4K03 A;  3LYA A;  4L7T A;  3UI2 A;  4HLL A;  2ILR A;  2Y0B G;  4DX7 D;  2H6H A;  1WDY A;  4HRN A;  2QFC A;  3MZL B;  4UWG A;  2WVI A;  3C5R A;  3FEX A;  5BUZ A;  3FFL A;  1NI1 A;  1TNU A;  3FTX A;  4JA9 A;  3HIZ A;  4ILG A;  4U96 D;  1YCS B;  3CEQ A;  3FH7 A;  3ESK A;  2QZA A;  4FHJ A;  3LY8 A;  4AV7 A;  1NL4 A;  2DZN A;  4B0Z A;  4V3I A;  3FU0 A;  1N52 A;  4JXT A;  1FT1 A;  2OEW A;  5HRY A;  4N3A A;  4U0Z A;  2DVW A;  1OUV A;  2GRN B;  5G2N A;  3G2S A;  4EQF A;  4I2W A;  3RO2 A;  2BKK B;  4JVS A;  2UY1 A;  2F37 A;  1U3D A;  4J0U A;  3DXK G;  3C3R A;  1NFI E;  4XI0 A;  2V4L A;  3RK6 A;  4G2V A;  4ATZ D;  5EN5 D;  1TNZ A;  2A5E A;  3MCX A;  2ETB A;  3CHR A;  3FTZ A;  4OAV B;  4WWO A;  3HXE A;  2V8S E;  2L0I A;  5JJ6 A;  5FZQ A;  2XRZ A;  3C72 A;  1OCC E;  5FQ4 A;  4HRL A;  3D9H A;  2DCP A;  2CFZ A;  3ZPJ A;  5ARG A;  3ZHE B;  3ONL A;  4N5C A;  2YHE A;  2PNN A;  3Q47 B;  3E32 A;  3DPD A;  5ITZ F;  2GRL A;  1D9S A;  2IOS A;  3IBE A;  4L2Y A;  5G04 J;  4RG9 A;  4NIK A;  1ZB1 A;  1KZO A;  2P9L G;  1JWF A;  4HQD A;  2YIN A;  4YDW A;  2BUG A;  4N5Q A;  3ASF A;  3Q15 A;  3CKB A;  3TWW A;  2Y1L E;  1TN6 A;  3JQ0 A;  4F6R D;  3FU3 A;  2KCL A;  1DC2 A;  1Y6I A;  4B94 A;  5D0O D;  1HF8 A;  1IXV A;  1WG0 A;  5JJ7 A;  1JWG A;  2GRR B;  3QKY A;  4U04 A;  3SGH A;  3CLJ A;  4AM9 A;  2H6F A;  3FUJ A;  5KJM A;  2MOW A;  3SFY A;  4ANW A;  3HHM A;  4KMO A;  1INZ A;  4BWR A;  3ABK E;  4M3O A;  1JPL A;  3HDX A;  3T9K A;  4N39 A;  1K3Z D;  5LP0 A;  1HS6 A;  3L54 A;  3TJP A;  3I4R B;  3Q75 A;  3PNT B;  3ZYM A;  2Y69 E;  2KZT B;  3D9N A;  1ZU2 A;  3DRA A;  4XIF A;  3ZW3 A;  2E2E A;  2V0P A;  3AS8 A;  2I1K A;  4FLB A;  5HQ8 A;  3OXG A;  5LOZ A;  3UKR G;  5LCW C;  4ANX A;  3L6A A;  3ZYL A;  4EZJ A;  5E76 A;  3PZ1 A;  4XKC A;  3EHN A;  2MYO A;  4ANU A;  3PH0 C;  5FQ6 A;  5EX3 A;  2CG2 A;  1TNY A;  2F8X K;  2J07 A;  3KS2 A;  4AJW A;  2EIM E;  3AG4 E;  1OY3 D;  4WNG A;  4FHK A;  4YND A;  3AJI A;  4TRQ A;  1LD7 A;  4BEP A;  3ZU7 B;  1N94 A;  4Q69 A;  4HOS A;  2P9S G;  4KZC A;  4JPS A;  4NAC A;  2WXH A;  2WXO A;  4DX5 D;  2R5S A;  4J8Y A;  3FU5 A;  3ONK A;  4G8L A;  4HI9 A;  4TUU A;  4I9C A;  2GRQ B;  5E75 A;  5KNG A;  2DYR E;  3ZYQ A;  4OYS A;  3Q5M A;  4BT8 A;  2P2C P;  3TL5 A;  1H0A A;  5AQ9 A;  3B7T A;  4UI9 K;  4F3V A;  1UG3 A;  2FBN A;  3OXL A;  4EZK A;  4I43 A;  3RAU A;  4OVV A;  4CCA A;  3SD5 A;  3HVE B;  3MV3 B;  4A3V A;  3ASG A;  3E34 A;  3RRU A;  5FQ8 A;  5JA4 D;  4GB9 A;  4HOR A;  1IHG A;  3J5Q B;  3JUE A;  3TWX A;  2XEH A;  3CHO A;  1JCS A;  4A1S A;  3QAQ A;  3CST A;  3SF4 A;  4R7L A;  1A5E A;  3L9T A;  4JEU A;  4RVB A;  5G05 C;  3O4Z A;  5CEC B;  4NRH B;  4WUY A;  3FU6 A;  1TN7 A;  4IUL A;  3D3M A;  3LXU X;  5AAO A;  3TWS A;  3FWV A;  4L1B A;  3QWW A;  2WXK A;  3FUK A;  1IHB A;  3AS4 A;  1FVF A;  3MYV A;  2WXI A;  2WXR A;  5JJT A;  4J6I A;  5ANL A;  1TR4 A;  5KNH D;  3MA5 A;  4XEI G;  2PZI A;  2B0O E;  4G26 A;  2LSV A;  2EIK E;  1BLX B;  3DSW A;  5BW8 C;  4AY5 A;  4CGV A;  4J8D A;  4B93 B;  4BER A;  4U8H A;  4IRU A;  3FUF A;  2LAH A;  3FTU A;  4AP2 A;  5EKQ D;  3CSF A;  3RSE G;  2WXM A;  4U95 D;  1EF1 C;  3ZKJ A;  4HI8 A;  3AG3 E;  4ACK A;  5BXO A;  2J08 A;  2ZIS A;  2LXL A;  1QQE A;  1BI7 B;  1N4S A;  2KCK A;  4AOF A;  4ZFH A;  4PUC A;  4GZ5 A;  3UMV A;  3UTM A;  1HU3 A;  2R17 C;  2I2O A;  1X5B A;  2WXQ A;  3SY2 A;  1UOH A;  3J5P A;  3PRZ A;  2XZT G;  2V5F A;  3Q7A A;  3FUI A;  3NF1 A;  1DNP A;  1LTX A;  2E0I A;  2JAB A;  2FI7 A;  1KPS B;  4TXQ A;  2WMO A;  4FP7 A;  3ISM C;  4C48 B;  3CVW A;  4BT9 A;  2VSO E;  3DEO A;  3FUM A;  4EBA A;  3PUJ A;  4PS3 A;  5CEA A;  4BTA A;  2DWZ A;  2WXF A;  3GZS A;  3EU9 A;  5CCL A;  1U2V G;  2VTB B;  1XGW A;  2IO2 C;  3UXG A;  4URK A;  4I6J A;  1HE8 A;  2X6K A;  3BQO A;  4XKB A;  1TNO A;  3Q79 A;  5CCM A;  3ULY A;  5A6C A;  4I17 A;  5EYL A;  1OCZ E;  2R2L A;  2X38 A;  3KEA A;  2KZT A;  2Y4U A;  1WAO 1;  1NA0 A;  3B7B A;  1OWO A;  4EZL A;  3FUL A;  3TXM A;  5AJL A;  1Q2Z A;  4GTQ A;  3PRE A;  2AXZ A;  1PC2 A;  3PZ3 A;  5AEN A;  4GZ3 A;  4JHR A;  5D2M C;  1YMP A;  1U3C A;  4FJY A;  3GZ2 A;  5LX8 A;  4TUM A;  4D10 C;  3FTY A;  1YYH A;  2CFU A;  2KBX A;  4BSX A;  4CEM A;  3Q7F A;  4J8F A;  4XZ4 A;  2RG8 A;  3SQV A;  1E8X A;  4EPZ A;  3MKQ A;  5CRV A;  5DIZ A;  3CHQ A;  4I2Z A;  4JA7 A;  4LRZ A;  4GTV A;  1HX8 A;  3B7R L;  1OT8 A;  4HOT A;  2DZO A;  2IF4 A;  5T3R A;  2L9B A;  3SZ7 A;  3HRA A;  2NYJ A;  4DLQ A;  5BT1 A;  4N3C A;  3NOG D;  2AJA A;  5BNW A;  3L17 A;  1V55 E;  3NOC D;  5EYP F;  5B1A E;  5AIJ A;  1H19 A;  3UM1 A;  3E30 A;  3ASD A;  4QFV A;  2NXP A;  4U0S A;  4JHJ A;  2VGY A;  5FIN A;  1UW4 B;  5KBA A;  4AY6 A;  2OOE A;  3CVN A;  1EYH A;  2OEV A;  5FTP A;  2OND A;  2VGX A;  1TN8 A;  1MJ0 A;  3CQG B;  3ZHE A;  5AN8 A;  2WB2 A;  3OXF A;  3U9W A;  3R9M A;  3W9F A;  4I1M A;  4GZC A;  2Y3A A;  3C98 A;  1OCO E;  3PEV B;  3RKV A;  1OWP A;  4RLY A;  3UQ3 A;  4Q94 A;  2OCC E;  3DST A;  4L9P A;  2V5Q C;  3PUK A;  3LVR E;  4PS8 A;  1BI8 B;  2ETC A;  2IY0 C;  4B8C B;  1HFA A;  1X81 A;  3S7B A;  4I6G A;  5FZS A;  4LNB A;  1E7U A;  1SA4 A;  2YQ8 A;  1IQR A;  2QY7 A;  4RQI A;  1MX2 A;  2KAT A;  2MRI A;  4KVM A;  4ATG A;  4LNU D;  3UIO C;  4HRM B;  2F0Y A;  4YVQ C;  2RFM A;  4A1G A;  2OVF A;  2BTD A;  3TWQ A;  2A4Z A;  3VLD A;  3FH5 A;  3D9K A;  2I1J A;  2XCC A;  3TWU A;  2Q7F A;  4WNE A;  3IHY A;  1HG2 A;  3TG5 A;  4BET A;  4CDR A;  2VQ2 A;  5FJY A;  3UT7 A;  3CKC A;  2X6J A;  5KWD A;  1NZN A;  5G55 A;  5A7D B;  4UUC A;  3LVQ E;  3APF A;  4UQZ A;  1HG5 A;  2HM8 A;  5KJK A;  4XI9 A;  4WNF A;  3NZU A;  2IFU A;  4GMR A;  3T5V A;  2XEE A;  3EUV A;  2R59 A;  5CMY A;  3NAW A;  3G2U A;  3ZFW A;  4MBG A;  3ZVV A;  4FJZ A;  4F53 A;  2ION A;  3IXE A;  4DX1 A;  3CK9 A;  2H6G A;  1Z3X A;  3GW4 A;  3D9O A;  1FT2 A;  4F7A A;  5ARF A;  3K9I A;  3LDZ A;  2BKG A;  3CIA A;  3FDH A;  4I9E A;  2EIJ E;  1S64 A;  3WG7 E;  1E7V A;  4MKT A;  5LCW J;  2VGE A;  3LEW A;  3UM0 A;  3V2X A;  3AG2 E;  5EDS A;  3LS8 A;  2ZGD A;  5BPP A;  2GRM A;  5AQA A;  4GA1 A;  4IN3 B;  3ZN3 A;  4L2L A;  4X8Q A;  5AQB A;  3D9J A;  2IJG X;  3BG1 B;  4FA6 A;  2PM6 A;  4GYO A;  4BY6 A;  4LUN U;  3QWV A;  1VDY A;  5ENN A;  2XEV A;  3QAR A;  1OCR E;  2XGO A;  1ELW A;  4HS2 A;  1N4P A;  4BX9 A;  3EHQ A;  3DXM G;  2X3M A;  4HOQ A;  1OXJ A;  5ENR D;  4UWH A;  4CT4 A;  4AVX A;  1TJC A;  1E90 A;  4UI9 J;  5CHE E;  2RD0 A;  3ULQ A;  3MEK A;  3UPV A;  2LO6 A;  4YDE A;  4GYY A;  1Z5S C;  2HE0 A;  4RSY A;  2WM9 A;  1RW2 A;  4C0M A;  4H7X A;  2BED A;  3L82 A;  4FUL A;  1LD8 A;  1H2T C;  4WWP A;  3F6Q A;  4RG6 A;  4AIF A;  4G23 A;  1JCQ A;  2IU1 A;  1S63 A;  1ELK A;  4JW1 A;  3B95 A;  1H6O A;  3ZRH A;  4APF A;  3ABL E;  2GRP B;  2FEZ A;  2Y4T A;  4G11 A;  4JEH A;  1QNF A;  3Q73 A;  2P58 C;  3LKU A;  5G04 C;  5CBN A;  5B3S E;  3LJ3 A;  1N0Q A;  3BEE A;  1K1A A;  3DSU A;  3SHF A;  3N71 A;  1MZC A;  3KSL A;  4MS6 A;  4J8E A;  1D8E A;  4AEZ C;  3Q49 B;  5J08 A;  1DCQ A;  2DBA A;  2YNQ A;  1OWN A;  3CGH A;  4FU3 A;  1WY6 A;  2X6I A;  4K5A B;  2NC9 A;  3B7S A;  3GYZ A;  4W9R A;  3V30 A;  3APC A;  3DSX A;  3QB2 A;  3IEG A;  4U8Y D;  1IKN D;  5ENT D;  3SFZ A;  3AU4 A;  5JHA A;  3FTS A;  5EID A;  5KCM A;  5BV0 A;  2WXP A;  3EJN A;  4P29 A;  3SFX A;  5JMN D;  1MX6 A;  2X6F A;  3CR3 A;  3DBS A;  3L13 A;  1GW6 A;  2P9P G;  3HXF A;  4CT0 A;  2LNI A;  3G2W A;  2WXN A;  1HO8 A;  3URZ A;  2UY1 B;  3NB2 A;  4FLH A;  2WQ7 A;  3RIB A;  4K0R A;  2J49 A;  3EDT B;  1UJJ A;  2PQN A;  2VJ8 A;  5H7P A;  3UX4 A;  2L6B A;  4WND A;  3CVV A;  3DEP A;  3PS6 A;  4JC8 A;  3LCA A;  3TWV A;  2P9I G;  1OWM A;  2A5U A;  2C0M A;  3QJZ A;  3VTY A;  2XPY A;  3CVQ A;  3Q9N C;  4DRX E;  2IQC A;  5T4Y A;  4KXK B;  2XPZ A;  4GA2 A;  4JHK A;  2FO7 A;  2QYJ A;  4GZ6 A;  5LFA A;  3FUD A;  4ZHB A;  1WM5 A;  5EX0 A;  4YDY A;  4HFG A;  1HXI A;  2CHW A;  3VLE A;  2B6C A;  2CG3 A;  2QC9 A;  3ML8 A;  3GZ1 A;  4HBD A;  1W3B A;  3CK8 A;  4DX6 D;  1TJF A;  1Z3Y A;  1L5J A;  1SA5 A;  3RO3 A;  4YVO A;  2BF0 X;  3QK0 A;  1RZ4 A;  5FZR A;  1SZA A;  1PY1 A;  1AWC B;  5KJL A;  4KBQ A;  3VTX A;  3FP3 A;  3FY4 A;  1UN9 A;  2JLB A;  4YDO A;  3W9G A;  4GMJ A;  1KT1 A;  3JCK C;  1H6P A;  3CK7 A;  3FTV A;  5CBO A;  3CVU A;  5HS0 A;  4B8A A;  3TAX A;  3E37 A;  5KJN A;  3OTN A;  1SW6 A;  3JXI A;  4GTR A;  3MKQ B;  4DLO A;  3ASO E;  3FHE A;  4FAD A;  3AAA C;  5CRU A;  4JL0 A;  4LSZ E;  5M72 A;  3S2A A;  1TNB A;  1JCR A;  3OAW A;  3ZUV B;  3EIQ C;  4BX8 A;  3MX3 A;  1NA3 A;  3MKR A;  4JD2 G;  3E4B A;  1SZ9 A;  1N95 A;  2J8S D;  4CDN A;  4ME2 A;  5CER B;  2V4H C;  3CVP A;  5JHB A;  5G05 J;  4H7Y A;  3ULE G;  2CHX A;  3ZXP A;  4O6F A;  1BU9 A;  4OAU C;  4HLE A;  3EHR A;  3D9I A;  3MGB A;  3MV2 B;  2GW1 A;  4DJA A;  4UQX A;  2C2L A;  2VSY A;  4QQI A;  3HXB A;  2I6H A;  1K8K G;  2EIN E;  4PS7 A;  1HZ4 A;  3ML9 A;  3AS5 A;  4HNA D;  5ENO D;  2HR2 A;  1O1S A;  3PZ2 A;  2YHC A;  4M7C A;  4NUR A;  1QBQ A;  3S7J A;  2KXP C;  3JUI A;  3PNL B;  2H6I A;  3U3W A;  3T8M A;  2XGM A;  4ILI A;  4Q96 A;  1FCH A;  2F8Y A;  3KEZ A;  3IKO B;  2AXV A;  4HB5 A;  4NQ0 A;  2FF4 A;  5BV1 A;  1E8W A;  3VLF A;  2PM7 A;  4BFR A;  1QZ2 A;  2WXJ A;  4A3T A;  3CHS A;  4J8S A;  4UWF A;  2WQ6 A;  4GZD A;  3I4G A;  3U4T A;  3L16 A;  3UUX A;  4F1S A;  4E6H A;  2XHE A;  3QOU A;  3LY7 A;  1N9A A;  3CQC B;  5FT9 A;  4Z68 A;  2OV8 A;  5AYW D;  2WXL A;  4KZ0 A;  2VSX E;  3CV0 A;  2VTB A;  1PAQ A;  2XGS A;  1S0P A;  5B1B E;  4MLP A;  3R9A B;  4ACL A;  4G24 A;  1P5Q A;  4OVU A;  3C3Q A;  4KYO B;  1H2V C;  4U8V D;  4FC8 A;  4I6E A;  4MRU A;  3RRM B;  2XRY A;  3QWP A;  4UQY A;  4N2S A;  4ANV A;  3PZD A;  3QDN A;  5C1D A;  4BSZ B;  5AAR A;  4KT6 B;  3AU5 A;  3HVE A;  3PDN A;  2IOL A;  2P9N G;  3CHM A;  3T8K A;  2LAI A;  3V79 K;  2FUL A;  1N0R A;  2J9Q A;  3B7U X;  3SBS A;  4JB8 P;  4ILH B;  3CVX A;  1D8D A;  2KCV A;  4Y6W A;  2KC7 A;  2QYU A;  1MYO A;  1UN8 A;  3Q9U C;  4CGW A;  3B13 A;  1IQU A;  2XCB A;  4F1P A;  3BG0 B;  4O1O A;  4DK5 A;  4CZ2 D;  2R05 A;  4LG6 A;  4LNG A;  5EIL A;  3BU8 A;  4GTM A;  1E8Y A;  1B89 A;  4DX2 A;  4U07 A;  4O1P A;  4HVB A;  4XE0 A;  2JEK A;  2XQ0 A;  1FVH A;  2ZXW E;  1KZP A;  3QNK A;  2UWJ G;  4AXH A;  3C3O A;  3I3N A;  2I9C A;  1S70 B;  3ASN E;  1Y8M A;  1O1R A;  4I1O B;  3LY9 A;  4HOU A;  5FIO A;  4LCT A;  4WAF A;  4GA0 A;  3SBT B;  2GRO B;  1DCE A;  3UIN C;  2AWI A;  3D9L A;  4HXI A;  1KT0 A;  3RRN B;  5T8I A;  1E8Z A;  2DYS E;  3P1U A;  5FQ7 A;  5ENS D;  3DWL G;  5CMW A;  3Q78 A;  3FH8 A;  2LUH A;  2PL2 A;  2J4D A;  4PH4 B;  1TEZ A;  5DBK A;  3ZYK A;  4LEU A;  4WWN A;  1O1T A;  3S7F A;  5D0Q D;  1AP7 A;  1MQS A;  2AW6 A;  3HXD A;  3UM3 A;  4G8K A;  3S7D A;  2XEN A;  3LPZ A;  3FEY A;  4GPM A;  2PQR A;  3V2O A;  4I1A A;  2HO1 A;  2AXU A;  2WMN A;  3ZNG A;  5BXU A;  5ENP D;  2WXG A;  3EHM A;  3FUH A;  2DIW A;  3G2V A;  3LJN A;  3Q4A B;  4GAA A;  2IO3 C;  4CYM D;  2NSZ A;  4U7E B;  3FUN A;  3TGO A;  3FUE A;  3PVL A;  3X2Q E;  1ELR A;  2J4B A;  2AVP A;  3UM2 A;  1K1B A;  2L0T B;  4DUI A;  3SNX A;  1SVX A;  3JXJ A;  3R7R A;  3PZ4 A;  4G25 A;  2WQH A;  3SI5 A;  3JYS A;  2J09 A;  3FTW A;  1N4R A;  3IHV A;  2M63 A;  1H6K A;  4A63 B;  1IYG A;  2R02 A;  3RU0 A;  3TXN A; 
#chains in the Genus database with same CATH homology
 3HDX A;  3PS6 A;  4JC8 A;  3LCA A;  4L23 A;  4N2Q A;  4N39 A;  5LP0 A;  1HS6 A;  3L54 A;  1OWM A;  4EBA G;  2A5U A;  3TJP A;  1H19 A;  3ZIM A;  5AIJ A;  3ASD A;  2C0M A;  4QFV A;  2NXP A;  3I4R B;  3QJZ A;  4JHJ A;  2VGY A;  4U0S A;  3VTY A;  2XPY A;  1N54 A;  1UW4 B;  3PNT B;  2VSN A;  3CVQ A;  2L6J A;  3ZYM A;  4AY6 A;  2OOE A;  3CVN A;  2IQC A;  5T4Y A;  4KXK B;  1EDU A;  2XPZ A;  1EYH A;  4GA2 A;  5FTP A;  2OND A;  2VGX A;  4JHK A;  1A17 A;  2FO7 A;  5LFA A;  4GZ6 A;  2KZT B;  3FUD A;  4DI3 A;  1WM5 A;  3CQG B;  3G2T A;  3D9N A;  5EX0 A;  3ZHE A;  1NP7 A;  2EQX A;  2WB2 A;  1ZU2 A;  3OXF A;  3U9W A;  3KAE A;  4I1M A;  4XIF A;  3ZW3 A;  4U63 A;  1LF8 A;  2E2E A;  4G1T A;  5C2Y A;  4HFG A;  2V0P A;  4GZC A;  2Y3A A;  5ANR A;  3C98 A;  1HXI A;  3AS8 A;  2I1K A;  3PEV B;  2CHW A;  3VLE A;  3RKV A;  1OWP A;  2CG3 A;  3ML8 A;  4FLB A;  1E96 B;  3GZ1 A;  5HI7 A;  4B89 A;  1W3B A;  3L08 A;  5HQ8 A;  3CK8 A;  3OXG A;  3NZS A;  3PEU B;  1TJF A;  5LOZ A;  5LCW C;  3CVY A;  4IYP A;  4ANX A;  3L6A A;  1Z3Y A;  1L5J A;  3ZYL A;  4EZJ A;  3P2B A;  4YVO A;  3RO3 A;  2BF0 X;  3QK0 A;  2X6H A;  3TG4 A;  5FZR A;  3I5P A;  1SZA A;  1PY1 A;  1YA0 A;  5KJL A;  5E76 A;  3ENE A;  3ZXS A;  3UQ3 A;  4Q94 A;  3NQP A;  4XKC A;  4GYW A;  2OVB A;  4KBQ A;  3L22 A;  3VTX A;  3FP3 A;  3FY4 A;  1UN9 A;  3EHN A;  4ABN A;  4ANU A;  2JLB A;  3PH0 C;  3PUK A;  5FQ6 A;  5EX3 A;  4GMJ A;  2MHK A;  3LVR E;  2CG2 A;  4PS8 A;  4GCN A;  1KT1 A;  3JCK C;  4Y6C A;  1MHQ A;  3CK7 A;  3FTV A;  4B8C B;  1HFA A;  2J07 A;  3IV0 A;  3CVU A;  3QC1 A;  3KS2 A;  3S7B A;  4B8A A;  4I6G A;  5FZS A;  4AJW A;  3TAX A;  1E7U A;  5KJN A;  3OTN A;  3R7Q A;  2HYZ A;  4JZY A;  2YQ8 A;  4WNG A;  4FHK A;  1IQR A;  2QY7 A;  3MKQ B;  4DLO A;  4YND A;  4TRQ A;  2LSU A;  4N3B A;  3FHE A;  4FAD A;  4Q69 A;  4HOS A;  4KVM A;  2KAT A;  2MRI A;  4ATG A;  4JL0 A;  5M72 A;  4YVQ C;  3S2A A;  4KZC A;  3OAW A;  4JPS A;  2WXH A;  4NAC A;  4E85 A;  2WXO A;  4A1G A;  2R5S A;  3EIQ C;  4CDM A;  1XNF A;  2OVF A;  2BTD A;  4BX8 A;  2A4Z A;  3MX3 A;  3VLD A;  3FU5 A;  1NA3 A;  3FH5 A;  3MKR A;  3ONK A;  5FWQ A;  3E4B A;  1SZ9 A;  3D9K A;  4GCO A;  2I1J A;  2XCC A;  2Q7F A;  4WNE A;  3MJW A;  3IHY A;  1HG2 A;  4CDN A;  4ME2 A;  3TG5 A;  4TUU A;  4CDR A;  3CVP A;  2VQ2 A;  2XPI A;  4I9C A;  5FJY A;  5JHB A;  5E75 A;  5G05 J;  3UT7 A;  3CKC A;  2X6J A;  4DPR A;  3ZYQ A;  4OYS A;  1NZN A;  3Q5M A;  4H7Y A;  4BT8 A;  4GU5 A;  3TL5 A;  4GML A;  5G55 A;  1H0A A;  1EPU A;  3D9M A;  2CHX A;  5A7D B;  4O6F A;  3B7T A;  4DI4 A;  4UI9 K;  5J90 A;  4HLE A;  4F3V A;  4UWL A;  1UG3 A;  2FBN A;  3OXL A;  4BTB A;  3D9I A;  2VGX B;  3LVQ E;  3MGB A;  3APF A;  2GW1 A;  1HH8 A;  3MV2 B;  4I43 A;  4UQZ A;  3O48 A;  4DJA A;  4EZK A;  1HG5 A;  4OVV A;  4UQX A;  4CCA A;  3SD5 A;  3HVE B;  2C2L A;  2HM8 A;  2VSY A;  3MV3 B;  5KJK A;  2I6H A;  4TV3 A;  4WNF A;  3ASG A;  4XI9 A;  4A3V A;  4XX5 A;  3RRU A;  1ZBP A;  2KM4 A;  4PS7 A;  5FQ8 A;  3NZU A;  1HZ4 A;  3ML9 A;  4GB9 A;  1UJK A;  2IFU A;  3AS5 A;  1IHG A;  3T5X A;  3CVL A;  4HOR A;  3T5V A;  2HR2 A;  3ZEF A;  2R59 A;  3CHO A;  5CMY A;  3ASH A;  2YHC A;  1BPO A;  2C0L A;  4A1S A;  4NUR A;  3S7J A;  3QAQ A;  3G2U A;  3JUI A;  5A23 A;  3PNL B;  3CST A;  4U0U A;  3U3W A;  4EEC A;  3ZFW A;  1JUQ A;  3SF4 A;  3ZVV A;  3T8M A;  2XGM A;  4ILI A;  4Q96 A;  4FJZ A;  1FCH A;  4F53 A;  1H2U A;  2ION A;  2GGF A;  3KEZ A;  1KLX A;  3CK9 A;  4R7L A;  3IKO B;  2AXV A;  1Z3X A;  3GW4 A;  4GPK A;  3D9O A;  1DVP A;  4APO A;  3CHP A;  4NQ0 A;  3PE3 A;  2FF4 A;  3UT4 A;  4JEU A;  4F7A A;  5ARF A;  3K9I A;  5BV1 A;  1E8W A;  3VLF A;  3LDZ A;  3EIJ A;  2PM7 A;  3FDH A;  3CIA A;  3KD7 A;  4I9E A;  4BFR A;  1QZ2 A;  2CHZ A;  2WXJ A;  4RVB A;  4A3T A;  5G05 C;  3CHS A;  4J8S A;  1E7V A;  3O4Z A;  4MKT A;  4UWF A;  2WQ6 A;  4GZD A;  4C0E A;  4UWK A;  3I4G A;  3U4T A;  5LCW J;  4NRH B;  3UT8 A;  4WUY A;  1Z6T A;  4UI9 C;  3LEW A;  3U64 A;  3FU6 A;  3WXX A;  1SQM A;  3L16 A;  4IUL A;  3D3M A;  3LXU X;  4CRW A;  3U66 A;  3FWV A;  4L1B A;  3APD A;  3UUX A;  4F1S A;  5EDS A;  3LS8 A;  3D9P A;  3QWW A;  4C9B B;  4E6H A;  2GRM A;  2WXK A;  2XHE A;  3FUK A;  5BPP A;  3AS4 A;  1FVF A;  3QOU A;  3LY7 A;  2WPV A;  3MYV A;  4PDX A;  2WXI A;  3RJV A;  2WXR A;  4GA1 A;  4IN3 B;  5JJT A;  3ZN3 A;  4L2L A;  3CQC B;  4J6I A;  5FT9 A;  3ZGQ A;  3D9J A;  5AJD A;  3HYM B;  2IJG X;  5ANL A;  2OV8 A;  2ZU6 B;  3BG1 B;  4LER A;  5AYW D;  3MA5 A;  4FA6 A;  2PM6 A;  2WXL A;  4GYO A;  4KZ0 A;  3ESL A;  4BY6 A;  1OWL A;  4LUN U;  4A55 A;  2VYI A;  2VSX E;  3CV0 A;  2VTB A;  1PAQ A;  2XGS A;  1S0P A;  3QWV A;  1VDY A;  2PZI A;  5ENN A;  4G26 A;  2LSV A;  2XEV A;  3QAR A;  4MLP A;  3R9A B;  5BW8 C;  4ACL A;  4G24 A;  4AY5 A;  4CGV A;  4J8D A;  1P5Q A;  4KVO A;  4OVU A;  2XGO A;  4KYO B;  1H2V C;  4FC8 A;  1ELW A;  4I6E A;  4MRU A;  3RRM B;  3PE4 A;  2XRY A;  3QWP A;  4HS2 A;  4UQY A;  3JQ1 A;  4BX9 A;  4U8H A;  4K03 A;  3LYA A;  4L7T A;  4IRU A;  4ANV A;  4N2S A;  3PZD A;  3FUF A;  2LAH A;  2X3M A;  3FTU A;  3QDN A;  5C1D A;  4AP2 A;  2ILR A;  5EKQ D;  3CSF A;  4HOQ A;  4KT6 B;  2QFC A;  3MZL B;  2WXM A;  4UWG A;  2WVI A;  1EF1 C;  3AU5 A;  3FEX A;  4UWH A;  4AVX A;  4CT4 A;  3FFL A;  1TJC A;  5BUZ A;  3HVE A;  3PDN A;  2IOL A;  1E90 A;  3CHM A;  4UI9 J;  2LAI A;  5CHE E;  2RD0 A;  4ACK A;  2FUL A;  3ULQ A;  3MEK A;  2J08 A;  2LO6 A;  3UPV A;  3FTX A;  4GYY A;  4JA9 A;  3HIZ A;  2J9Q A;  3B7U X;  3SBS A;  1QQE A;  4ILH B;  4RSY A;  2WM9 A;  2KCK A;  3CVX A;  4AOF A;  4ILG A;  4PUC A;  4C0M A;  2KCV A;  4GZ5 A;  4H7X A;  4Y6W A;  3UMV A;  3CEQ A;  3FH7 A;  2KC7 A;  1UN8 A;  3ESK A;  4CGW A;  3B13 A;  4FUL A;  1HU3 A;  1IQU A;  2R17 C;  4FHJ A;  2XCB A;  3LY8 A;  1H2T C;  4WWP A;  2I2O A;  4AV7 A;  1X5B A;  2WXQ A;  3BG0 B;  4RG6 A;  4DK5 A;  4AIF A;  3PRZ A;  4G23 A;  4B0Z A;  2V5F A;  4V3I A;  2IU1 A;  1E8Y A;  3FU0 A;  1N52 A;  4JXT A;  3FUI A;  3NF1 A;  1DNP A;  1ELK A;  1B89 A;  4N3A A;  2E0I A;  4JW1 A;  4U07 A;  4U0Z A;  1OUV A;  4HVB A;  4XE0 A;  5G2N A;  2JEK A;  2FI7 A;  2XQ0 A;  3G2S A;  4EQF A;  4I2W A;  1FVH A;  3ZRH A;  4APF A;  2FEZ A;  2Y4T A;  4G11 A;  3RO2 A;  4JVS A;  2UY1 A;  2WMO A;  4FP7 A;  4JEH A;  1QNF A;  3CVW A;  1U3D A;  4J0U A;  3QNK A;  4BT9 A;  2VSO E;  2UWJ G;  2P58 C;  3LKU A;  5G04 C;  4XI0 A;  3LJ3 A;  2V4L A;  3RK6 A;  4AXH A;  4G2V A;  3FUM A;  3I3N A;  2I9C A;  4EBA A;  1Y8M A;  3PUJ A;  4PS3 A;  3BEE A;  3MCX A;  4BTA A;  4I1O B;  3CHR A;  3LY9 A;  2WXF A;  3FTZ A;  3GZS A;  4HOU A;  3SHF A;  5CCL A;  3N71 A;  2VTB B;  1XGW A;  4LCT A;  4WAF A;  4URK A;  4MS6 A;  4J8E A;  4I6J A;  4GA0 A;  3SBT B;  4WWO A;  1HE8 A;  2AWI A;  2X6K A;  3D9L A;  2V8S E;  4HXI A;  1KT0 A;  2L0I A;  3RRN B;  5JJ6 A;  4AEZ C;  5FZQ A;  2XRZ A;  5T8I A;  3Q49 B;  4XKB A;  5J08 A;  1E8Z A;  3P1U A;  5FQ4 A;  5FQ7 A;  5CCM A;  5CMW A;  2DBA A;  2YNQ A;  5A6C A;  4I17 A;  1OWN A;  3CGH A;  3FH8 A;  2DCP A;  4FU3 A;  1WY6 A;  2X6I A;  2X38 A;  2CFZ A;  3ZPJ A;  2KZT A;  5ARG A;  3ZHE B;  2PL2 A;  3B7S A;  2NC9 A;  2Y4U A;  3ONL A;  2J4D A;  3GYZ A;  1WAO 1;  4W9R A;  4N5C A;  1NA0 A;  4PH4 B;  1OWO A;  2YHE A;  3APC A;  1TEZ A;  3Q47 B;  3DPD A;  4EZL A;  2GRL A;  5DBK A;  3FUL A;  3TXM A;  5AJL A;  3ZYK A;  2IOS A;  3IBE A;  4LEU A;  4WWN A;  4L2Y A;  3QB2 A;  3PRE A;  5G04 J;  4RG9 A;  3IEG A;  2AXZ A;  3S7F A;  1PC2 A;  5D0Q D;  5AEN A;  1MQS A;  2AW6 A;  4GZ3 A;  1JWF A;  2YIN A;  4JHR A;  2BUG A;  3SFZ A;  3AU4 A;  1U3C A;  3ASF A;  5JHA A;  3S7D A;  3FTS A;  4FJY A;  3GZ2 A;  3Q15 A;  3CKB A;  3LPZ A;  5LX8 A;  3FEY A;  5KCM A;  5BV0 A;  2WXP A;  2PQR A;  4D10 C;  3EJN A;  4P29 A;  3FTY A;  2HO1 A;  4I1A A;  2AXU A;  2WMN A;  2X6F A;  3JQ0 A;  3CR3 A;  3FU3 A;  2KCL A;  2WXG A;  3EHM A;  3DBS A;  3FUH A;  2CFU A;  2DIW A;  3L13 A;  3G2V A;  1Y6I A;  4B94 A;  3Q4A B;  1GW6 A;  4GAA A;  5D0O D;  4BSX A;  2NSZ A;  4CT0 A;  4CEM A;  2LNI A;  3FUN A;  1HF8 A;  3G2W A;  4J8F A;  2WXN A;  3TGO A;  1HO8 A;  4XZ4 A;  2RG8 A;  2UY1 B;  3FUE A;  3PVL A;  1E8X A;  1ELR A;  3URZ A;  2J4B A;  4FLH A;  2WQ7 A;  2AVP A;  5JJ7 A;  1JWG A;  3RIB A;  4K0R A;  2J49 A;  4EPZ A;  3MKQ A;  5DIZ A;  3EDT B;  2L0T B;  3QKY A;  4U04 A;  3CHQ A;  4I2Z A;  1UJJ A;  4JA7 A;  3SGH A;  3SNX A;  3CLJ A;  4LRZ A;  3R7R A;  1HX8 A;  4AM9 A;  3B7R L;  4G25 A;  4HOT A;  2WQH A;  2IF4 A;  3FUJ A;  2PQN A;  2VJ8 A;  3JYS A;  2MOW A;  2L9B A;  5T3R A;  3SI5 A;  2J09 A;  3FTW A;  3SZ7 A;  5KJM A;  4ANW A;  3UX4 A;  3HHM A;  3IHV A;  2M63 A;  4KMO A;  4WND A;  4DLQ A;  1H6K A;  1IYG A;  5BT1 A;  4N3C A;  3RU0 A;  3CVV A;  1INZ A;  3TXN A;  5BNW A;  3L17 A;  4BWR A;  4M3O A;  1JPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...