3UT4A

Structural view of a non pfam singleton and crystal packing analysis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
b'TSLRDLIPKHKFDNSTIDQLCKLIDNEIEPIIFDLLKWLQDYNWPIAKDILPVVVLHQSIAMPHILTILQGNDIMWKYWVIKLMIPYLIYPNKQLVKSELERLSSLEIINEDIREIVNLSKDYLHFYY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural view of a non pfam singleton and crystal packing analysis.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Unknown function
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16804 DUF5071 Domain of unknown function (DUF5071)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.750 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ut4A00
3UT7A 3UT4A 3UT8A
chains in the Genus database with same CATH superfamily
1E8ZA 3RSEG 1U2VG 4URKA 4XZ4A 4I17A 3UPVA 4KVOA 4G11A 2YQ8A 3MJWA 4CDRA 3NB2A 3SD5A 4LUNU 3SY2A 1K3ZD 5B3SE 3D9MA 1Y6IA 3V30A 5EN5D 1UJJA 2ONDA 3Q79A 3PDNA 2R03A 5AQAA 5KJNA 4UWKA 1DCEA 4GA2A 2X6IA 4KXKB 3S7JA 3EHRA 4JVSA 1PC2A 2FF4A 3MV2B 4JEUA 1Z3YA 3SNXA 1GW6A 2KCVA 2Q7FA 4BTBA 1Z5SC 1B89A 4WAFA 4RG6A 1TNYA 2RFMA 4KT6B 5FQ4A 1SA5A 3UUXA 4B8AA 2ILRA 2KZTA 2X6FA 3J5PA 4JEHA 3FTUA 3MA5A 3HYMB 1KZOA 3D9KA 3X2QE 4JA7A 3PEUB 4G25A 4HB5A 3TXNA 5A6CA 2EIJE 3NOCD 4ILIA 5EX3A 2IY0C 2DWZA 2BF0X 5CCMA 1UOHA 3TWUA 4HRLA 3TWXA 1N94A 5HS0A 4FJYA 5A23A 2AXZA 2F8XK 4AJWA 4ZFHA 4ABNA 3RIBA 4NQ0A 5ENNA 2DIWA 2XGMA 4GZ6A 2RG8A 3FUIA 4KMOA 4A3TA 3FTZA 4BTAA 5KJLA 3SBSA 4I6EA 3PUKA 2P9SG 4ANWA 1OWOA 4MLPA 3KEZA 3LYAA 4J8YA 1N4QA 3L82A 5CERB 5JHAA 3EU9A 3RU0A 3Q4AB 3ULQA 1ELKA 4UQZA 4B93B 4RVBA 5LX8A 4GYOA 4WWOA 2IF4A 1OT8A 3DEOA 3PZ2A 4DI3A 4AP2A 4AVXA 3GZ1A 4APFA 3C3OA 2WXLA 2WB2A 5EKQD 4JA9A 3U3WA 3LPZA 2HO1A 4LEUA 2HYZA 2J08A 2R2LA 3CR3A 4BT9A 3JYSA 4CDMA 4N2SA 4BX8A 3TAXA 1H0AA 3RO2A 5KJKA 3CV0A 5B1BE 5CEAA 1O5MA 2J09A 4W9RA 4LNGA 2R05A 4F7AA 4F6RD 5KNGA 3E33A 3MV3B 2LO6A 3LY8A 5G05J 1TNBA 4KZCA 5D0QD 2LSUA 3WXXA 3AJIA 3ASOE 3ONLA 4NACA 4EZJA 2CHWA 3FP3A 4FULA 5CECB 4BX9A 4L2LA 3FUJA 1JPLA 3KAEA 3SHFA 3UM1A 4F3VA 5LCWJ 2YHCA 5CBOA 4JC8A 5BXUA 3SBTB 2XRZA 2XEEA 3QKYA 4JHRA 3CHOA 3FU6A 3ML8A 3UT7A 3D9IA 2CFZA 2VSOE 3IHVA 4JD2G 5CEDB 3DSSA 3D9NA 2VGXB 3QWWA 4ANXA 2RD0A 2WXHA 5FZQA 5HKPA 2KBXA 3ZGQA 3APFA 1UN8A 1N9AA 4UI9C 4L23A 4DX5D 3Q5MA 4FLHA 2OEVA 4U07A 1H6KA 2VTBB 3Q49B 5CRUA 4BEPA 2ZU6B 4N2QA 2XPZA 3AU5A 4K03A 5G04J 3HHMA 5D2MC 3GZ2A 4DRXE 3ONKA 4EECA 3UIPC 2F0YA 4I6JA 4PS3A 1FVHA 4XKCA 3ZUVB 4NRHB 3ZKJA 3DBSA 3CEQA 2I2OA 2MHKA 2R59A 5C1DA 1VDYA 3CHSA 4FHJA 3HXCA 3D9HA 5ARFA 3ZPJA 3NOGD 3L22A 5EYPF 1AP7A 3HIZA 4K5AB 2FO7A 4EZKA 2P58C 1HE8A 1U3CA 2WXMA 1KLXA 3BUAA 3FUKA 4A1SA 4Y6WA 2Y3AA 1IYGA 4JZYA 4CGWA 3CVWA 3RRUA 2QYJA 4G8KA 4XI0A 2R17C 2WXJA 5ENQD 2J4BA 5KBAA 5BPPA 5D66A 5BV1A 4O60A 5FTPA 2UWJG 1XNFA 3PH0C 2PZIA 4G1TA 2E0IA 2PL2A 2EIKE 4LSZE 2FULA 3S7DA 3L54A 4DX6D 3BG0B 5LCWC 4A3VA 1YMPA 1JCQA 4DJAA 3PZDA 2IFUA 2C0MA 2GROB 3ESLA 1FCHA 1QQEA 2XCCA 1PY1A 4YVOA 2V5QC 3RAUA 1HO8A 4YVQC 5ENSD 5G2NA 3CK8A 2AXVA 2P9KG 5CHEE 4QFVA 3ABKE 1OWLA 3L17A 3APCA 5EX0A 1IHGA 2PNNA 3FTXA 5FINA 2ETBA 2LAIA 3ZU7B 2XZDG 4GYWA 1E8YA 1P5QA 3SF4A 3LJ3A 3TGOA 4R7LA 2P9PG 3LKUA 5FJYA 4M7CA 3DPYA 4AEZC 2WXPA 3B7SA 3ASGA 3ULYA 4BSZB 2UY1A 2I9CA 4PUCA 4GTRA 3VTXA 4DX1A 1WY6A 2ZGGA 1OWMA 3CHQA 1MYOA 2X6KA 1ZU2A 4ME2A 4GTMA 4I2WA 3TWRA 4AY5A 4U0ZA 1HF8A 3GW4A 1MX2A 4XIFA 4CYMD 2PM7A 2DCPA 2OCCE 4U8YD 4UQYA 5KJMA 5C2YA 3NZUA 2WPVA 3S7BA 5ANRA 2GRMA 3ABME 4ACKA 5KWDA 2MRIA 3AG1E 2P9IG 1HG5A 3LDZA 3V2XA 4GPMA 5ITZF 3NBNB 2GRRB 3RKVA 1N4PA 3FU5A 3GYZA 3CQCB 3AAAC 1HX8A 3FEYA 3GZSA 1WDYA 1OWPA 4GZ3A 2YINA 3FUNA 4BERA 4DPRA 1INZA 2J8SD 2GRQB 3ZHEB 2LXLA 3MCXA 3HG0D 2A5UA 4HLLA 4TXRA 2V4HC 3UI2A 3Q9NC 1NFIE 2XPIA 1ZB1A 2X3MA 1E96B 3I4GA 3URZA 2FI7A 3NZSA 4O6FA 2LSVA 3DXKG 4A55A 1DCQA 3TWTA 4KBQA 3AS5A 2WXFA 5A7DB 3FUFA 3ZVVA 3CVLA 3UT8A 3Q73A 2NSZA 2XS1A 3TG5A 4F53A 4JB8P 3JUIA 1EF1C 4C0EA 4XI9A 3B95A 3TWQA 1SA4A 3BG1B 3QNKA 4U7EB 4A63B 4GTVA 1YYHA 4K5BA 4AY6A 4Q94A 4HI8A 3QARA 3PUJA 1BU9A 3FTSA 1KZPA 2BUGA 4EPZA 4J0UA 3UT4A 3P2BA 3RO3A 3CVPA 1TNZA 2DYRE 4UI9J 5JMND 4K5CA 1D8EA 3U4TA 3D9JA 5KNHD 5G55A 4IYPA 3SZ7A 4OAVB 1E7UA 2XGOA 3MYVA 4OVUA 4N3AA 4Z68A 2V5FA 2ETCA 5EIDA 3D9PA 1FT1A 5AQ9A 4E6HA 1K8KG 1H2UA 3CSTA 4IRUA 2I1KA 2V4LA 2IONA 4HLEA 3L13A 1A5EA 3PS6A 3F6QA 4HOQA 1WM5A 1N4SA 2A5EA 2C0LA 1HZ4A 3AS8A 3QAQA 3QB2A 2VSYA 2KXPC 2EILE 3EDTB 3FUHA 3CQGB 1IXVA 2RFAA 3Q15A 1TNUA 4IN3B 2YHEA 1IKND 1RW2A 2JEKA 4B94A 4DI4A 4CT0A 2OV8A 1IHBA 3FUMA 4YDEA 4MRUA 1JWGA 1HH8A 1SZAA 3WG7E 4E85A 3FHEA 4NIKA 5BW8C 5AQBA 3V2OA 3FEXA 2QFCA 2AW6A 4OVVA 4WNEA 1BLXB 3CVVA 1S63A 4N5QA 1BPOA 5HRYA 2GRNB 3R9AB 3ASNE 1H19A 3TG4A 2YNQA 4XEIG 2PQRA 3Q47B 1E90A 2E2EA 2WM9A 4ATGA 1MJ0A 4F1PA 4DX7D 3ESKA 4UWLA 4N39A 5FQ6A 3IXEA 4U96D 3QWPA 4GCOA 3CHPA 2V0PA 5DIZA 5ENOD 4JPSA 1SVXA 1LF8A 2JLBA 4I1MA 3EHNA 3P1UA 1ELWA 2VJ8A 3QDNA 4GMLA 3OXLA 3DSXA 5HQ8A 1DC2A 1FPPA 3LVQE 3FTWA 2HR2A 4C0MA 3PEVB 4I1OB 5AAOA 4TXQA 3FH7A 4AOFA 5LFAA 4CZ2D 4YDYA 4X8QA 3E32A 4KVMA 3MX3A 3CHRA 4GTSA 3ULEG 3MKQB 3AG4E 2VSNA 5JJ6A 3R7QA 2AXUA 3T5XA 2ZGDA 4HBDA 1IQRA 4YDOA 5FQ7A 3TJPA 2MOWA 3BQOA 4MKTA 4FP7A 1N95A 1NA0A 3PRZA 4MBGA 2EQXA 1L5JA 1JCSA 1TYQG 1HU3A 4UWHA 2X6JA 3D9OA 3IBEA 2LNIA 3CK9A 5JJTA 2CFUA 1TJFA 4XX5A 4KZ0A 1V54E 1OUVA 2XS8A 2OVFA 4I43A 1Z6TA 3HVEA 3LXUX 3T9KA 4WNDA 3RRMB 1TN6A 2I6HA 4OAUC 5ENRD 2H6HA 4LG6A 3QK0A 5HI7A 3R9MA 4APOA 4ANVA 3PVLA 3ABLE 1E8XA 3J5QB 1U3DA 2UY1B 3AG3E 3FULA 4CDNA 3EIQC 3Q78A 2Y0BG 3FUDA 1UG3A 3DSUA 5EILA 3V31A 4WNFA 4GTPA 1K1AA 3E4BA 4UWFA 2KATA 3AG2E 4U0UA 1O1TA 5JJ7A 3OXFA 1H6OA 2BKGA 1S0PA 2WXOA 5AJLA 3CK7A 2XRYA 3FFLA 4DLQA 5AN8A 1MQSA 4FA6A 2ZXWE 4LNBA 2C2LA 3UXGA 4L9PA 1OXJA 2GGFA 3CVXA 4EZLA 3U9WA 1H6PA 3PNTB 2L6BA 3Q7FA 5EYLA 1ZBPA 4WWPA 2B0OE 3LS8A 3APDA 3SFYA 2RKKA 2R5SA 3ZFWA 1NI1A 2AWIA 4PDXA 1XGWA 2MYOA 2P9UG 2WXRA 1E7VA 4HOTA 4BFRA 3FUEA 5EIBE 3PREA 1NL4A 3ENEA 1JUQA 4L1BA 2IO3C 2L0TB 3FTVA 4WNGA 4DUIA 3LVRE 4HXIA 3D9LA 1QZ2A 3EUVA 4HFGA 4RLYA 1DVPA 3ML9A 4J8DA 2L6JA 1PAQA 3DRAA 1LD8A 2B6CA 1TJCA 1JWFA 4GA1A 4U04A 2XGSA 3BU8A 2AJAA 5AENA 4HORA 2KZTB 4GZ5A 3C72A 4KYOB 3MKRA 2DVWA 3HXEA 3RK6A 1N4RA 3S7FA 2H6GA 2Y4UA 5JHBA 4ACLA 1TN8A 1AWCB 3ASDA 3LCAA 4O1OA 2F37A 3KEAA 1G3NB 4N5CA 3JQ1A 2V8SE 3JQ0A 3UINC 3HRAA 2WQHA 1NP7A 3Q7AA 2WMNA 3E30A 1N11A 4GTTA 4G2VA 3CVUA 1SZ9A 3UM0A 2EIME 2ETAA 1OY3D 1EDUA 2PQNA 3BEEA 4CGVA 3AU4A 2XEVA 3QC1A 2LUHA 4IULA 4I2ZA 4H7YA 3JXIA 5ANLA 4J6IA 4FHKA 3DSWA 4K0RA 1TNOA 5BXOA 1N54A 1Q2ZA 5J90A 2J07A 3L6AA 3VLFA 4GTOA 1BD8A 2DZNA 2WXGA 4GCNA 4GTQA 3EIJA 3KSQA 3JXJA 3DSVA 4JL0A 3C98A 4YDWA 5AARA 1HFAA 2WXQA 3MGBA 4U8VD 3ZYQA 2L9BA 4AXHA 2VSXE 3UM2A 3ZEFA 1RZ4A 3CVQA 4GAAA 4PS7A 2IJGX 3JCKC 3PZ1A 5BV0A 3NF1A 2CHXA 3ZN3A 1O1RA 3R7RA 2WQ6A 4B8CB 2P9LG 4L7TA 4AM9A 4L2YA 2IQCA 5BT1A 1D8DA 3ZXPA 2WXNA 4C9BB 3IHYA 3CVNA 4J7WA 4TXPA 4HOSA 2IU1A 3PNLB 1SQMA 4G24A 3HDXA 1IQUA 3FWVA 3UTMA 3SQVA 3ZIMA 1YCSB 2AVPA 2HE0A 4FC8A 1QNFA 1UW4B 2Y4TA 3L9TA 3ASHA 3EHMA 3T8KA 2F8YA 4GMJA 4HOUA 4UUCA 4M3OA 1FT2A 5T4YA 3UKRG 3UMVA 3IEGA 3LJNA 4TV3A 3S2AA 4JHKA 3CLJA 1DNPA 4XE0A 2DYSE 3OAWA 3SGHA 1EPUA 3VTYA 3C3QA 4EBAG 3PZ4A 2IOSA 5FWQA 4B0ZA 3QOUA 3CHMA 3QJZA 2ZISA 3G2TA 2NYJA 2J49A 3EU5A 4BT8A 1H2TC 4EQFA 2ZIRA 4CRWA 4LNUD 1N0QA 1FVFA 3T8MA 3FU3A 3NAWA 4FLBA 3K9IA 5AJDA 3N71A 3I4RB 4Q69A 4JXTA 2M63A 4U95D 3SO8A 4GB9A 3KS2A 3U64A 4GYYA 4FADA 5ARGA 2WQ7A 2X6HA 4PH4B 3Q9UC 4N3BA 3RRNB 3UIOC 3ZHEA 3FTYA 3MEKA 1X81A 3LY9A 3IKOB 4CEMA 4HNAD 3UKUG 3DPDA 2J9QA 3FY4A 1YA0A 5FZSA 2GRLA 4NURA 4G26A 4EBAA 5FQ8A 5T3RA 4AV7A 3DEPA 3KSLA 2OOEA 1KT1A 4RG9A 2HM8A 3B13A 4HRNA 3CKBA 5M72A 3HVEB 4J8EA 4XKBA 3NQPA 4P29A 4LCTA 1H2VC 5T8IA 3EJNA 3QWVA 1WAO1 2XHEA 5AYWD 3ZYLA 3PE3A 1NA3A 4V3IA 5AIJA 4BWRA 3ISMC 5AQ7A 1MX6A 2BTDA 2Y69E 4GA0A 1S70B 2CG3A 1W3BA 1A17A 3HXFA 2XPYA 4QQIA 2DZOA 2JABA 2Y1LE 2IEJA 4ILGA 4ILHB 2WXKA 3L16A 3UQ3A 3E34A 5EDSA 2XQ0A 3G2VA 4I9CA 3SFXA 5E76A 2XCBA 5DBKA 4GMRA 4DK5A 1HXIA 3TWWA 3KD7A 4OYSA 3G2WA 2I1JA 5LP0A 4H7XA 3VLDA 4I1AA 2VGYA 3DSTA 1MZCA 2GRPB 2H6IA 4J8FA 3CIAA 2VYIA 3UX4A 5LOZA 4BSXA 2GW1A 1KPSB 4TRQA 2FO1E 3W9FA 5BUZA 2VQ2A 5FIOA 3DWLG 5KCMA 1V55E 2L0IA 3B7BA 3O48A 1X5BA 3ZW3A 1TEZA 3B7UX 3UM3A 3ASFA 4DX2A 4WWNA 2FBNA 2DBAA 3U66A 3W9GA 3D3MA 1BI8B 2KM4A 4LERA 2P2CP 2P9NG 3TWVA 4GPKA 3G2SA 3RJVA 4CCAA 1QBQA 5CBNA 1E8WA 3IV0A 3ZYKA 2QYUA 4EHMA 4U0SA 4DLOA 3I5PA 1TR4A 1O1SA 3HXBA 5ENPD 5CRVA 4A1GA 5J08A 1LTXA 5ENTD 1JCRA 4UI9K 1LD7A 2EINE 5FZRA 2NC9A 4U8HA 3ZNGA 1UN9A 4LRZA 2QC9A 1SW6A 4ANUA 3FDHA 2NXPA 1S64A 2KC7A 4Y6CA 2A4ZA 5B1AE 1OCRE 4G8LA 5D0OD 3CSFA 4C48B 4TUMA 3VLEA 3FH8A 5E75A 4BESA 1OCCE 2J4DA 4WUYA 1BI7B 1KT0A 4UWGA 1EYHA 5IY5E 2IOLA 4JW1A 2XEHA 2H6FA 3FU0A 1K1BA 4UQXA 3HXDA 1NZNA 3ZYMA 4HI9A 2OVBA 4GU5A 3SFZA 3MZLB 1D9SA 1N52A 3E37A 3I3NA 5G05C 4YNDA 1Y8MA 2VGXA 2VGEA 2CG2A 4BY6A 4AIFA 3O4ZA 3OTNA 5H7PA 1HG2A 2XENA 1OCOE 3MKQA 3JUEA 3ZRHA 4RSYA 4B89A 5CMWA 2CHZA 2KCLA 4GZDA 1N0RA 1QYMA 4U63A 2BEDA 4BETA 3ZXSA 1WG0A 4I9EA 4G23A 3FH5A 2PM6A 2VTBA 4HRMB 3EHQA 3DXMG 3CVYA 3TL5A 3V79K 2WVIA 3OXGA 4F1SA 2WXIA 3CKCA 3TXMA 3B7TA 3L08A 2XZTG 3C3RA 4HVBA 1OCZE 2FEZA 4ATZD 5CCLA 1ELRA 2LAHA 4CT4A 3C5RA 2QY7A 3LEWA 2BKKB 3Q75A 3T5VA 2LXMA 1MHQA 2QZAA 4HS2A 5BNWA 4D10C 2R02A 4GZCA 2KCKA 3CGHA 1OWNA 3SI5A 5JA4D 4I6GA 2WMOA 4FJZA 3TWSA 2X38A 1HS6A 4FU3A 3B7RL 3LY7A 4J8SA 3PZ3A 2OEWA 3G2UA 4PS8A 5G04C 4MS6A 4Q96A 1UJKA 2IO2C 4TUUA 1Z3XA 1TN7A 4HQDA 4JHJA 3PE4A 3AS4A 5CMYA 4N3CA 4ZHBA 4RQIA 1MX4A 5FT9A 4O1PA
chains in the Genus database with same CATH topology
3LVQE 5BPPA 1E8ZA 3FTWA 2HR2A 3QJZA 4C0MA 4XZ4A 4URKA 3G2TA 5BV1A 2J49A 3PEVB 5FTPA 4I1OB 4BT8A 4I17A 2UWJG 4KVOA 3UPVA 1H2TC 3FH7A 2YQ8A 1XNFA 3PH0C 2PZIA 4G11A 4CRWA 4G1TA 4EQFA 3MJWA 1FVFA 3T8MA 4CDRA 4AOFA 5LFAA 2E0IA 3FU3A 2PL2A 4FLBA 3K9IA 3SD5A 5AJDA 4LUNU 3N71A 3I4RB 4Q69A 4KVMA 3D9MA 1Y6IA 3MX3A 3CHRA 2M63A 4JXTA 3MKQB 2VSNA 5JJ6A 2FULA 4GB9A 1UJJA 2ONDA 2AXUA 3KS2A 3L54A 3R7QA 3S7DA 3BG0B 4GYYA 3U64A 3T5XA 4FADA 5LCWC 4A3VA 3PDNA 5ARGA 1IQRA 2WQ7A 5FQ7A 3TJPA 2MOWA 5KJNA 2X6HA 4PH4B 4DJAA 4UWKA 3PZDA 2C0MA 2IFUA 3ESLA 4FP7A 4GA2A 4MKTA 4N3BA 1FCHA 1QQEA 2X6IA 1PY1A 1NA0A 2XCCA 3RRNB 4YVOA 4KXKB 3PRZA 3ZHEA 3FTYA 3MEKA 3S7JA 1HO8A 4YVQC 2EQXA 3LY9A 1L5JA 4JVSA 3IKOB 5G2NA 4CEMA 3CK8A 2AXVA 1HU3A 1PC2A 2FF4A 2J9QA 3DPDA 1YA0A 3FY4A 2X6JA 3MV2B 4JEUA 4UWHA 5CHEE 1Z3YA 3D9OA 4QFVA 5FZSA 3SNXA 1OWLA 2GRLA 1GW6A 2KCVA 2LNIA 3CK9A 2Q7FA 3IBEA 3APCA 3L17A 1IHGA 4G26A 4NURA 5EX0A 4BTBA 4EBAA 5JJTA 3FTXA 2CFUA 1B89A 1TJFA 4XX5A 4KZ0A 4WAFA 5FQ8A 5T3RA 2LAIA 4RG6A 4AV7A 4KT6B 1OUVA 2OOEA 1KT1A 2OVFA 4I43A 5FQ4A 4RG9A 4GYWA 1E8YA 1P5QA 1Z6TA 3SF4A 3LJ3A 3TGOA 2HM8A 3HVEA 4R7LA 3UUXA 3LKUA 4B8AA 3B13A 3CKBA 2ILRA 2KZTA 3LXUX 5M72A 3HVEB 5FJYA 2X6FA 4JEHA 4J8EA 4AEZC 4WNDA 4XKBA 3RRMB 3FTUA 3NQPA 2I6HA 2WXPA 3MA5A 3B7SA 3HYMB 3ASGA 4LCTA 4P29A 1H2VC 3QK0A 5HI7A 4APOA 5T8IA 4ANVA 3D9KA 3EJNA 1WAO1 2XHEA 3QWVA 4JA7A 5AYWD 3PVLA 5FT9A 3PE3A 3ZYLA 1NA3A 3PEUB 4V3IA 4G25A 5AIJA 4BWRA 2UY1A 3TXNA 5A6CA 1E8XA 2BTDA 4GA0A 2I9CA 1U3DA 2UY1B 4PUCA 3FULA 3VTXA 4CDNA 2CG3A 4ILIA 3EIQC 5EX3A 1W3BA 1A17A 2XPYA 1WY6A 3CHQA 1OWMA 2BF0X 3FUDA 2X6KA 1UG3A 5CCMA 4WNFA 4ILGA 1ZU2A 4ME2A 4ILHB 2WXKA 4FJYA 3L16A 5A23A 4I2WA 3UQ3A 2AXZA 3E4BA 4UWFA 2KATA 2XQ0A 4AY5A 3G2VA 4AJWA 4U0ZA 5EDSA 1HF8A 3GW4A 4I9CA 4U0UA 5E76A 5JJ7A 3OXFA 4XIFA 4ABNA 2XCBA 5DBKA 4NQ0A 3RIBA 5ENNA 4DK5A 2DIWA 1HXIA 1S0PA 2XGMA 2PM7A 2WXOA 2DCPA 5AJLA 4GZ6A 4UQYA 2RG8A 3KD7A 5KJMA 3CK7A 4OYSA 5C2YA 3G2WA 2I1JA 2WPVA 3FUIA 3NZUA 2XRYA 3FFLA 4KMOA 5LP0A 3S7BA 5ANRA 4A3TA 2GRMA 3FTZA 4ACKA 4BTAA 3SBSA 4DLQA 5KJLA 2MRIA 1MQSA 4H7XA 4FA6A 4I6EA 3PUKA 2C2LA 4ANWA 1OWOA 1HG5A 3VLDA 2GGFA 4MLPA 3KEZA 3LDZA 3CVXA 4I1AA 2VGYA 4EZLA 3U9WA 3LYAA 4J8FA 3CIAA 3RKVA 3PNTB 5JHAA 2VYIA 3UX4A 5LOZA 3FU5A 4BSXA 3GYZA 2GW1A 3CQCB 3RU0A 3Q4AB 3ULQA 1ELKA 4TRQA 4UQZA 1ZBPA 4WWPA 1HX8A 3LS8A 4RVBA 3APDA 3FEYA 3GZSA 5BUZA 5LX8A 2VQ2A 4GYOA 2R5SA 4WWOA 2AWIA 4PDXA 3ZFWA 5KCMA 1XGWA 2L0IA 2IF4A 1OWPA 3O48A 4GZ3A 2WXRA 1E7VA 2YINA 4HOTA 1X5BA 3FUNA 3ZW3A 4DI3A 4AP2A 1TEZA 3B7UX 3ASFA 4DPRA 4BFRA 1INZA 4WWNA 4AVXA 3ZHEB 3GZ1A 3FUEA 4APFA 2FBNA 3MCXA 2A5UA 2WXLA 2WB2A 2DBAA 3PREA 3U66A 5EKQD 3D3MA 3ENEA 4JA9A 2KM4A 4LERA 3U3WA 3LPZA 2HO1A 1JUQA 4L1BA 4LEUA 2L0TB 2XPIA 2X3MA 1E96B 3I4GA 3URZA 3FTVA 2FI7A 3NZSA 4WNGA 4O6FA 2HYZA 2LSVA 3LVRE 3G2SA 3RJVA 4GPKA 4HXIA 3D9LA 1QZ2A 4CCAA 2J08A 4HFGA 1DVPA 3ML9A 4J8DA 2L6JA 1E8WA 3IV0A 3ZYKA 1PAQA 4A55A 4U0SA 3CR3A 4BT9A 4DLOA 3I5PA 1TJCA 1JWFA 4GA1A 4U04A 4KBQA 3JYSA 3AS5A 4CDMA 2XGSA 2WXFA 5A7DB 5AENA 3FUFA 3ZVVA 4HORA 3CVLA 3UT8A 2KZTB 4BX8A 3TAXA 4GZ5A 1H0AA 2NSZA 4A1GA 5J08A 4N2SA 4KYOB 3MKRA 3RO2A 3TG5A 4F53A 4UI9K 5KJKA 3CV0A 3JUIA 3RK6A 5FZRA 1EF1C 3S7FA 2J09A 2NC9A 4C0EA 4U8HA 4XI9A 4W9RA 2Y4UA 5JHBA 4ACLA 1UN9A 4LRZA 3BG1B 3ASDA 3QNKA 3LCAA 4F7AA 4ANUA 4AY6A 3FDHA 4N5CA 4Q94A 3MV3B 2LO6A 3JQ1A 2V8SE 3JQ0A 2NXPA 3LY8A 2KC7A 3QARA 5G05J 4KZCA 3PUJA 2WQHA 1NP7A 4Y6CA 2WMNA 5D0QD 2LSUA 3FTSA 2A4ZA 3WXXA 4G2VA 2BUGA 4EPZA 1SZ9A 3CVUA 4J0UA 5D0OD 3UT4A 3ONLA 3P2BA 3RO3A 4NACA 3CVPA 1EDUA 4EZJA 3CSFA 2PQNA 2CHWA 3FP3A 4FULA 3BEEA 4CGVA 3AU4A 2XEVA 3VLEA 4BX9A 3FH8A 4L2LA 3FUJA 1JPLA 3QC1A 3KAEA 4UI9J 5E75A 4IULA 3SHFA 3U4TA 4I2ZA 4H7YA 3D9JA 2J4DA 4WUYA 4F3VA 5LCWJ 1KT0A 4UWGA 2YHCA 4JC8A 5G55A 1EYHA 3SBTB 4IYPA 5ANLA 2XRZA 2IOLA 4JW1A 3SZ7A 4J6IA 1E7UA 2XGOA 3FU0A 3MYVA 4FHKA 4K0RA 4UQXA 4OVUA 4N3AA 1NZNA 3ZYMA 2OVBA 4GU5A 2V5FA 3QKYA 1N54A 4JHRA 3SFZA 3D9PA 3MZLB 5J90A 1N52A 3CHOA 2J07A 3FU6A 3L6AA 3ML8A 3I3NA 3UT7A 3D9IA 3VLFA 5G05C 4YNDA 2CFZA 1Y8MA 2VGXA 2VSOE 3IHVA 2CG2A 4BY6A 1H2UA 4E6HA 4AIFA 3CSTA 4IRUA 3D9NA 3O4ZA 2I1KA 2VGXB 3QWWA 2V4LA 4ANXA 2WXGA 2RD0A 2IONA 2WXHA 4GCNA 3L13A 4HLEA 5FZQA 3OTNA 3PS6A 4HOQA 1WM5A 3EIJA 1HG2A 3MKQA 3ZRHA 4RSYA 2C0LA 1HZ4A 3ZGQA 4B89A 3AS8A 3QAQA 4JL0A 3APFA 3C98A 5CMWA 2CHZA 1UN8A 2VSYA 3QB2A 2KCLA 1HFAA 4GZDA 4UI9C 2WXQA 4L23A 4U63A 3EDTB 3MGBA 3Q5MA 3FUHA 3CQGB 3ZXSA 3ZYQA 2L9BA 3Q15A 4AXHA 4IN3B 2VSXE 2YHEA 4I9EA 4G23A 3FH5A 2JEKA 4FLHA 4U07A 3ZEFA 2PM6A 4B94A 4DI4A 3CVQA 4CT0A 2VTBA 1H6KA 2OV8A 4GAAA 3CVYA 2VTBB 4PS7A 2IJGX 3JCKC 3FUMA 3Q49B 3TL5A 5BV0A 2WVIA 2ZU6B 3OXGA 4MRUA 4F1SA 2WXIA 2CHXA 3NF1A 1JWGA 3CKCA 3ZN3A 3TXMA 1HH8A 4N2QA 3B7TA 3L08A 3R7RA 1SZAA 2XPZA 2WQ6A 4HVBA 3AU5A 4B8CB 4E85A 3FHEA 2FEZA 5BW8C 5CCLA 4K03A 5G04J 3HHMA 3FEXA 4L7TA 1ELRA 2QFCA 4AM9A 3GZ2A 2AW6A 4OVVA 2LAHA 4L2YA 3ONKA 4CT4A 4EECA 4WNEA 2IQCA 5BT1A 3CVVA 1BPOA 2QY7A 2WXNA 3LEWA 4C9BB 3T5VA 3IHYA 3CVNA 3R9AB 4I6JA 4PS3A 1H19A 3TG4A 2YNQA 4HOSA 1MHQA 1FVHA 4XKCA 2PQRA 2IU1A 1E90A 3Q47B 2E2EA 4HS2A 5BNWA 4D10C 3PNLB 2WM9A 4NRHB 1SQMA 3DBSA 2KCKA 4GZCA 3CEQA 3CGHA 2I2OA 4G24A 1OWNA 2MHKA 4ATGA 2R59A 5C1DA 3SI5A 1VDYA 3CHSA 3HDXA 1IQUA 3FWVA 4I6GA 4FHJA 3ZIMA 2WMOA 3ESKA 4UWLA 4FJZA 5ARFA 2AVPA 2X38A 4FC8A 4N39A 5FQ6A 1QNFA 3ZPJA 1HS6A 4FU3A 3QWPA 1UW4B 4GCOA 2Y4TA 3ASHA 3B7RL 3EHMA 3CHPA 3LY7A 2V0PA 4GMJA 4J8SA 3L22A 5DIZA 3G2UA 4JPSA 4HOUA 4M3OA 4PS8A 5G04C 4MS6A 5T4YA 1LF8A 4Q96A 3HIZA 3UMVA 2JLBA 4I1MA 3EHNA 3IEGA 2FO7A 4EZKA 1UJKA 4TV3A 2P58C 1HE8A 4TUUA 1Z3XA 3P1UA 1ELWA 1U3CA 2WXMA 3S2AA 4JHJA 2VJ8A 4JHKA 1KLXA 3CLJA 1DNPA 3AS4A 3PE4A 3QDNA 4XE0A 5CMYA 4N3CA 3FUKA 4GMLA 4A1SA 4Y6WA 2Y3AA 3OAWA 3OXLA 3SGHA 1EPUA 1IYGA 3VTYA 4JZYA 4CGWA 3CVWA 3RRUA 4EBAG 4XI0A 5FWQA 2IOSA 4B0ZA 5HQ8A 3QOUA 2R17C 2WXJA 3CHMA 2J4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT7 A;  3UT4 A;  3UT8 A; 
#chains in the Genus database with same CATH topology
 1E8Z A;  3RSE G;  1U2V G;  4URK A;  4XZ4 A;  4I17 A;  3UPV A;  4KVO A;  4G11 A;  2YQ8 A;  3MJW A;  4CDR A;  3NB2 A;  3SD5 A;  4LUN U;  3SY2 A;  1K3Z D;  5B3S E;  3D9M A;  1Y6I A;  3V30 A;  5EN5 D;  1UJJ A;  2OND A;  3Q79 A;  3PDN A;  2R03 A;  5AQA A;  5KJN A;  4UWK A;  1DCE A;  4GA2 A;  2X6I A;  4KXK B;  3S7J A;  3EHR A;  4JVS A;  1PC2 A;  2FF4 A;  3MV2 B;  4JEU A;  1Z3Y A;  3SNX A;  1GW6 A;  2KCV A;  2Q7F A;  4BTB A;  1Z5S C;  1B89 A;  4WAF A;  4RG6 A;  1TNY A;  2RFM A;  4KT6 B;  5FQ4 A;  1SA5 A;  3UUX A;  4B8A A;  2ILR A;  2KZT A;  2X6F A;  3J5P A;  4JEH A;  3FTU A;  3MA5 A;  3HYM B;  1KZO A;  3D9K A;  3X2Q E;  4JA7 A;  3PEU B;  4G25 A;  4HB5 A;  3TXN A;  5A6C A;  2EIJ E;  3NOC D;  4ILI A;  5EX3 A;  2IY0 C;  2DWZ A;  2BF0 X;  5CCM A;  1UOH A;  3TWU A;  4HRL A;  3TWX A;  1N94 A;  5HS0 A;  4FJY A;  5A23 A;  2AXZ A;  2F8X K;  4AJW A;  4ZFH A;  4ABN A;  3RIB A;  4NQ0 A;  5ENN A;  2DIW A;  2XGM A;  4GZ6 A;  2RG8 A;  3FUI A;  4KMO A;  4A3T A;  3FTZ A;  4BTA A;  5KJL A;  3SBS A;  4I6E A;  3PUK A;  2P9S G;  4ANW A;  1OWO A;  4MLP A;  3KEZ A;  3LYA A;  4J8Y A;  1N4Q A;  3L82 A;  5CER B;  5JHA A;  3EU9 A;  3RU0 A;  3Q4A B;  3ULQ A;  1ELK A;  4UQZ A;  4B93 B;  4RVB A;  5LX8 A;  4GYO A;  4WWO A;  2IF4 A;  1OT8 A;  3DEO A;  3PZ2 A;  4DI3 A;  4AP2 A;  4AVX A;  3GZ1 A;  4APF A;  3C3O A;  2WXL A;  2WB2 A;  5EKQ D;  4JA9 A;  3U3W A;  3LPZ A;  2HO1 A;  4LEU A;  2HYZ A;  2J08 A;  2R2L A;  3CR3 A;  4BT9 A;  3JYS A;  4CDM A;  4N2S A;  4BX8 A;  3TAX A;  1H0A A;  3RO2 A;  5KJK A;  3CV0 A;  5B1B E;  5CEA A;  1O5M A;  2J09 A;  4W9R A;  4LNG A;  2R05 A;  4F7A A;  4F6R D;  5KNG A;  3E33 A;  3MV3 B;  2LO6 A;  3LY8 A;  5G05 J;  1TNB A;  4KZC A;  5D0Q D;  2LSU A;  3WXX A;  3AJI A;  3ASO E;  3ONL A;  4NAC A;  4EZJ A;  2CHW A;  3FP3 A;  4FUL A;  5CEC B;  4BX9 A;  4L2L A;  3FUJ A;  1JPL A;  3KAE A;  3SHF A;  3UM1 A;  4F3V A;  5LCW J;  2YHC A;  5CBO A;  4JC8 A;  5BXU A;  3SBT B;  2XRZ A;  2XEE A;  3QKY A;  4JHR A;  3CHO A;  3FU6 A;  3ML8 A;  3UT7 A;  3D9I A;  2CFZ A;  2VSO E;  3IHV A;  4JD2 G;  5CED B;  3DSS A;  3D9N A;  2VGX B;  3QWW A;  4ANX A;  2RD0 A;  2WXH A;  5FZQ A;  5HKP A;  2KBX A;  3ZGQ A;  3APF A;  1UN8 A;  1N9A A;  4UI9 C;  4L23 A;  4DX5 D;  3Q5M A;  4FLH A;  2OEV A;  4U07 A;  1H6K A;  2VTB B;  3Q49 B;  5CRU A;  4BEP A;  2ZU6 B;  4N2Q A;  2XPZ A;  3AU5 A;  4K03 A;  5G04 J;  3HHM A;  5D2M C;  3GZ2 A;  4DRX E;  3ONK A;  4EEC A;  3UIP C;  2F0Y A;  4I6J A;  4PS3 A;  1FVH A;  4XKC A;  3ZUV B;  4NRH B;  3ZKJ A;  3DBS A;  3CEQ A;  2I2O A;  2MHK A;  2R59 A;  5C1D A;  1VDY A;  3CHS A;  4FHJ A;  3HXC A;  3D9H A;  5ARF A;  3ZPJ A;  3NOG D;  3L22 A;  5EYP F;  1AP7 A;  3HIZ A;  4K5A B;  2FO7 A;  4EZK A;  2P58 C;  1HE8 A;  1U3C A;  2WXM A;  1KLX A;  3BUA A;  3FUK A;  4A1S A;  4Y6W A;  2Y3A A;  1IYG A;  4JZY A;  4CGW A;  3CVW A;  3RRU A;  2QYJ A;  4G8K A;  4XI0 A;  2R17 C;  2WXJ A;  5ENQ D;  2J4B A;  5KBA A;  5BPP A;  5D66 A;  5BV1 A;  4O60 A;  5FTP A;  2UWJ G;  1XNF A;  3PH0 C;  2PZI A;  4G1T A;  2E0I A;  2PL2 A;  2EIK E;  4LSZ E;  2FUL A;  3S7D A;  3L54 A;  4DX6 D;  3BG0 B;  5LCW C;  4A3V A;  1YMP A;  1JCQ A;  4DJA A;  3PZD A;  2IFU A;  2C0M A;  2GRO B;  3ESL A;  1FCH A;  1QQE A;  2XCC A;  1PY1 A;  4YVO A;  2V5Q C;  3RAU A;  1HO8 A;  4YVQ C;  5ENS D;  5G2N A;  3CK8 A;  2AXV A;  2P9K G;  5CHE E;  4QFV A;  3ABK E;  1OWL A;  3L17 A;  3APC A;  5EX0 A;  1IHG A;  2PNN A;  3FTX A;  5FIN A;  2ETB A;  2LAI A;  3ZU7 B;  2XZD G;  4GYW A;  1E8Y A;  1P5Q A;  3SF4 A;  3LJ3 A;  3TGO A;  4R7L A;  2P9P G;  3LKU A;  5FJY A;  4M7C A;  3DPY A;  4AEZ C;  2WXP A;  3B7S A;  3ASG A;  3ULY A;  4BSZ B;  2UY1 A;  2I9C A;  4PUC A;  4GTR A;  3VTX A;  4DX1 A;  1WY6 A;  2ZGG A;  1OWM A;  3CHQ A;  1MYO A;  2X6K A;  1ZU2 A;  4ME2 A;  4GTM A;  4I2W A;  3TWR A;  4AY5 A;  4U0Z A;  1HF8 A;  3GW4 A;  1MX2 A;  4XIF A;  4CYM D;  2PM7 A;  2DCP A;  2OCC E;  4U8Y D;  4UQY A;  5KJM A;  5C2Y A;  3NZU A;  2WPV A;  3S7B A;  5ANR A;  2GRM A;  3ABM E;  4ACK A;  5KWD A;  2MRI A;  3AG1 E;  2P9I G;  1HG5 A;  3LDZ A;  3V2X A;  4GPM A;  5ITZ F;  3NBN B;  2GRR B;  3RKV A;  1N4P A;  3FU5 A;  3GYZ A;  3CQC B;  3AAA C;  1HX8 A;  3FEY A;  3GZS A;  1WDY A;  1OWP A;  4GZ3 A;  2YIN A;  3FUN A;  4BER A;  4DPR A;  1INZ A;  2J8S D;  2GRQ B;  3ZHE B;  2LXL A;  3MCX A;  3HG0 D;  2A5U A;  4HLL A;  4TXR A;  2V4H C;  3UI2 A;  3Q9N C;  1NFI E;  2XPI A;  1ZB1 A;  2X3M A;  1E96 B;  3I4G A;  3URZ A;  2FI7 A;  3NZS A;  4O6F A;  2LSV A;  3DXK G;  4A55 A;  1DCQ A;  3TWT A;  4KBQ A;  3AS5 A;  2WXF A;  5A7D B;  3FUF A;  3ZVV A;  3CVL A;  3UT8 A;  3Q73 A;  2NSZ A;  2XS1 A;  3TG5 A;  4F53 A;  4JB8 P;  3JUI A;  1EF1 C;  4C0E A;  4XI9 A;  3B95 A;  3TWQ A;  1SA4 A;  3BG1 B;  3QNK A;  4U7E B;  4A63 B;  4GTV A;  1YYH A;  4K5B A;  4AY6 A;  4Q94 A;  4HI8 A;  3QAR A;  3PUJ A;  1BU9 A;  3FTS A;  1KZP A;  2BUG A;  4EPZ A;  4J0U A;  3UT4 A;  3P2B A;  3RO3 A;  3CVP A;  1TNZ A;  2DYR E;  4UI9 J;  5JMN D;  4K5C A;  1D8E A;  3U4T A;  3D9J A;  5KNH D;  5G55 A;  4IYP A;  3SZ7 A;  4OAV B;  1E7U A;  2XGO A;  3MYV A;  4OVU A;  4N3A A;  4Z68 A;  2V5F A;  2ETC A;  5EID A;  3D9P A;  1FT1 A;  5AQ9 A;  4E6H A;  1K8K G;  1H2U A;  3CST A;  4IRU A;  2I1K A;  2V4L A;  2ION A;  4HLE A;  3L13 A;  1A5E A;  3PS6 A;  3F6Q A;  4HOQ A;  1WM5 A;  1N4S A;  2A5E A;  2C0L A;  1HZ4 A;  3AS8 A;  3QAQ A;  3QB2 A;  2VSY A;  2KXP C;  2EIL E;  3EDT B;  3FUH A;  3CQG B;  1IXV A;  2RFA A;  3Q15 A;  1TNU A;  4IN3 B;  2YHE A;  1IKN D;  1RW2 A;  2JEK A;  4B94 A;  4DI4 A;  4CT0 A;  2OV8 A;  1IHB A;  3FUM A;  4YDE A;  4MRU A;  1JWG A;  1HH8 A;  1SZA A;  3WG7 E;  4E85 A;  3FHE A;  4NIK A;  5BW8 C;  5AQB A;  3V2O A;  3FEX A;  2QFC A;  2AW6 A;  4OVV A;  4WNE A;  1BLX B;  3CVV A;  1S63 A;  4N5Q A;  1BPO A;  5HRY A;  2GRN B;  3R9A B;  3ASN E;  1H19 A;  3TG4 A;  2YNQ A;  4XEI G;  2PQR A;  3Q47 B;  1E90 A;  2E2E A;  2WM9 A;  4ATG A;  1MJ0 A;  4F1P A;  4DX7 D;  3ESK A;  4UWL A;  4N39 A;  5FQ6 A;  3IXE A;  4U96 D;  3QWP A;  4GCO A;  3CHP A;  2V0P A;  5DIZ A;  5ENO D;  4JPS A;  1SVX A;  1LF8 A;  2JLB A;  4I1M A;  3EHN A;  3P1U A;  1ELW A;  2VJ8 A;  3QDN A;  4GML A;  3OXL A;  3DSX A;  5HQ8 A;  1DC2 A;  1FPP A;  3LVQ E;  3FTW A;  2HR2 A;  4C0M A;  3PEV B;  4I1O B;  5AAO A;  4TXQ A;  3FH7 A;  4AOF A;  5LFA A;  4CZ2 D;  4YDY A;  4X8Q A;  3E32 A;  4KVM A;  3MX3 A;  3CHR A;  4GTS A;  3ULE G;  3MKQ B;  3AG4 E;  2VSN A;  5JJ6 A;  3R7Q A;  2AXU A;  3T5X A;  2ZGD A;  4HBD A;  1IQR A;  4YDO A;  5FQ7 A;  3TJP A;  2MOW A;  3BQO A;  4MKT A;  4FP7 A;  1N95 A;  1NA0 A;  3PRZ A;  4MBG A;  2EQX A;  1L5J A;  1JCS A;  1TYQ G;  1HU3 A;  4UWH A;  2X6J A;  3D9O A;  3IBE A;  2LNI A;  3CK9 A;  5JJT A;  2CFU A;  1TJF A;  4XX5 A;  4KZ0 A;  1V54 E;  1OUV A;  2XS8 A;  2OVF A;  4I43 A;  1Z6T A;  3HVE A;  3LXU X;  3T9K A;  4WND A;  3RRM B;  1TN6 A;  2I6H A;  4OAU C;  5ENR D;  2H6H A;  4LG6 A;  3QK0 A;  5HI7 A;  3R9M A;  4APO A;  4ANV A;  3PVL A;  3ABL E;  1E8X A;  3J5Q B;  1U3D A;  2UY1 B;  3AG3 E;  3FUL A;  4CDN A;  3EIQ C;  3Q78 A;  2Y0B G;  3FUD A;  1UG3 A;  3DSU A;  5EIL A;  3V31 A;  4WNF A;  4GTP A;  1K1A A;  3E4B A;  4UWF A;  2KAT A;  3AG2 E;  4U0U A;  1O1T A;  5JJ7 A;  3OXF A;  1H6O A;  2BKG A;  1S0P A;  2WXO A;  5AJL A;  3CK7 A;  2XRY A;  3FFL A;  4DLQ A;  5AN8 A;  1MQS A;  4FA6 A;  2ZXW E;  4LNB A;  2C2L A;  3UXG A;  4L9P A;  1OXJ A;  2GGF A;  3CVX A;  4EZL A;  3U9W A;  1H6P A;  3PNT B;  2L6B A;  3Q7F A;  5EYL A;  1ZBP A;  4WWP A;  2B0O E;  3LS8 A;  3APD A;  3SFY A;  2RKK A;  2R5S A;  3ZFW A;  1NI1 A;  2AWI A;  4PDX A;  1XGW A;  2MYO A;  2P9U G;  2WXR A;  1E7V A;  4HOT A;  4BFR A;  3FUE A;  5EIB E;  3PRE A;  1NL4 A;  3ENE A;  1JUQ A;  4L1B A;  2IO3 C;  2L0T B;  3FTV A;  4WNG A;  4DUI A;  3LVR E;  4HXI A;  3D9L A;  1QZ2 A;  3EUV A;  4HFG A;  4RLY A;  1DVP A;  3ML9 A;  4J8D A;  2L6J A;  1PAQ A;  3DRA A;  1LD8 A;  2B6C A;  1TJC A;  1JWF A;  4GA1 A;  4U04 A;  2XGS A;  3BU8 A;  2AJA A;  5AEN A;  4HOR A;  2KZT B;  4GZ5 A;  3C72 A;  4KYO B;  3MKR A;  2DVW A;  3HXE A;  3RK6 A;  1N4R A;  3S7F A;  2H6G A;  2Y4U A;  5JHB A;  4ACL A;  1TN8 A;  1AWC B;  3ASD A;  3LCA A;  4O1O A;  2F37 A;  3KEA A;  1G3N B;  4N5C A;  3JQ1 A;  2V8S E;  3JQ0 A;  3UIN C;  3HRA A;  2WQH A;  1NP7 A;  3Q7A A;  2WMN A;  3E30 A;  1N11 A;  4GTT A;  4G2V A;  3CVU A;  1SZ9 A;  3UM0 A;  2EIM E;  2ETA A;  1OY3 D;  1EDU A;  2PQN A;  3BEE A;  4CGV A;  3AU4 A;  2XEV A;  3QC1 A;  2LUH A;  4IUL A;  4I2Z A;  4H7Y A;  3JXI A;  5ANL A;  4J6I A;  4FHK A;  3DSW A;  4K0R A;  1TNO A;  5BXO A;  1N54 A;  1Q2Z A;  5J90 A;  2J07 A;  3L6A A;  3VLF A;  4GTO A;  1BD8 A;  2DZN A;  2WXG A;  4GCN A;  4GTQ A;  3EIJ A;  3KSQ A;  3JXJ A;  3DSV A;  4JL0 A;  3C98 A;  4YDW A;  5AAR A;  1HFA A;  2WXQ A;  3MGB A;  4U8V D;  3ZYQ A;  2L9B A;  4AXH A;  2VSX E;  3UM2 A;  3ZEF A;  1RZ4 A;  3CVQ A;  4GAA A;  4PS7 A;  2IJG X;  3JCK C;  3PZ1 A;  5BV0 A;  3NF1 A;  2CHX A;  3ZN3 A;  1O1R A;  3R7R A;  2WQ6 A;  4B8C B;  2P9L G;  4L7T A;  4AM9 A;  4L2Y A;  2IQC A;  5BT1 A;  1D8D A;  3ZXP A;  2WXN A;  4C9B B;  3IHY A;  3CVN A;  4J7W A;  4TXP A;  4HOS A;  2IU1 A;  3PNL B;  1SQM A;  4G24 A;  3HDX A;  1IQU A;  3FWV A;  3UTM A;  3SQV A;  3ZIM A;  1YCS B;  2AVP A;  2HE0 A;  4FC8 A;  1QNF A;  1UW4 B;  2Y4T A;  3L9T A;  3ASH A;  3EHM A;  3T8K A;  2F8Y A;  4GMJ A;  4HOU A;  4UUC A;  4M3O A;  1FT2 A;  5T4Y A;  3UKR G;  3UMV A;  3IEG A;  3LJN A;  4TV3 A;  3S2A A;  4JHK A;  3CLJ A;  1DNP A;  4XE0 A;  2DYS E;  3OAW A;  3SGH A;  1EPU A;  3VTY A;  3C3Q A;  4EBA G;  3PZ4 A;  2IOS A;  5FWQ A;  4B0Z A;  3QOU A;  3CHM A;  3QJZ A;  2ZIS A;  3G2T A;  2NYJ A;  2J49 A;  3EU5 A;  4BT8 A;  1H2T C;  4EQF A;  2ZIR A;  4CRW A;  4LNU D;  1N0Q A;  1FVF A;  3T8M A;  3FU3 A;  3NAW A;  4FLB A;  3K9I A;  5AJD A;  3N71 A;  3I4R B;  4Q69 A;  4JXT A;  2M63 A;  4U95 D;  3SO8 A;  4GB9 A;  3KS2 A;  3U64 A;  4GYY A;  4FAD A;  5ARG A;  2WQ7 A;  2X6H A;  4PH4 B;  3Q9U C;  4N3B A;  3RRN B;  3UIO C;  3ZHE A;  3FTY A;  3MEK A;  1X81 A;  3LY9 A;  3IKO B;  4CEM A;  4HNA D;  3UKU G;  3DPD A;  2J9Q A;  3FY4 A;  1YA0 A;  5FZS A;  2GRL A;  4NUR A;  4G26 A;  4EBA A;  5FQ8 A;  5T3R A;  4AV7 A;  3DEP A;  3KSL A;  2OOE A;  1KT1 A;  4RG9 A;  2HM8 A;  3B13 A;  4HRN A;  3CKB A;  5M72 A;  3HVE B;  4J8E A;  4XKB A;  3NQP A;  4P29 A;  4LCT A;  1H2V C;  5T8I A;  3EJN A;  3QWV A;  1WAO 1;  2XHE A;  5AYW D;  3ZYL A;  3PE3 A;  1NA3 A;  4V3I A;  5AIJ A;  4BWR A;  3ISM C;  5AQ7 A;  1MX6 A;  2BTD A;  2Y69 E;  4GA0 A;  1S70 B;  2CG3 A;  1W3B A;  1A17 A;  3HXF A;  2XPY A;  4QQI A;  2DZO A;  2JAB A;  2Y1L E;  2IEJ A;  4ILG A;  4ILH B;  2WXK A;  3L16 A;  3UQ3 A;  3E34 A;  5EDS A;  2XQ0 A;  3G2V A;  4I9C A;  3SFX A;  5E76 A;  2XCB A;  5DBK A;  4GMR A;  4DK5 A;  1HXI A;  3TWW A;  3KD7 A;  4OYS A;  3G2W A;  2I1J A;  5LP0 A;  4H7X A;  3VLD A;  4I1A A;  2VGY A;  3DST A;  1MZC A;  2GRP B;  2H6I A;  4J8F A;  3CIA A;  2VYI A;  3UX4 A;  5LOZ A;  4BSX A;  2GW1 A;  1KPS B;  4TRQ A;  2FO1 E;  3W9F A;  5BUZ A;  2VQ2 A;  5FIO A;  3DWL G;  5KCM A;  1V55 E;  2L0I A;  3B7B A;  3O48 A;  1X5B A;  3ZW3 A;  1TEZ A;  3B7U X;  3UM3 A;  3ASF A;  4DX2 A;  4WWN A;  2FBN A;  2DBA A;  3U66 A;  3W9G A;  3D3M A;  1BI8 B;  2KM4 A;  4LER A;  2P2C P;  2P9N G;  3TWV A;  4GPK A;  3G2S A;  3RJV A;  4CCA A;  1QBQ A;  5CBN A;  1E8W A;  3IV0 A;  3ZYK A;  2QYU A;  4EHM A;  4U0S A;  4DLO A;  3I5P A;  1TR4 A;  1O1S A;  3HXB A;  5ENP D;  5CRV A;  4A1G A;  5J08 A;  1LTX A;  5ENT D;  1JCR A;  4UI9 K;  1LD7 A;  2EIN E;  5FZR A;  2NC9 A;  4U8H A;  3ZNG A;  1UN9 A;  4LRZ A;  2QC9 A;  1SW6 A;  4ANU A;  3FDH A;  2NXP A;  1S64 A;  2KC7 A;  4Y6C A;  2A4Z A;  5B1A E;  1OCR E;  4G8L A;  5D0O D;  3CSF A;  4C48 B;  4TUM A;  3VLE A;  3FH8 A;  5E75 A;  4BES A;  1OCC E;  2J4D A;  4WUY A;  1BI7 B;  1KT0 A;  4UWG A;  1EYH A;  5IY5 E;  2IOL A;  4JW1 A;  2XEH A;  2H6F A;  3FU0 A;  1K1B A;  4UQX A;  3HXD A;  1NZN A;  3ZYM A;  4HI9 A;  2OVB A;  4GU5 A;  3SFZ A;  3MZL B;  1D9S A;  1N52 A;  3E37 A;  3I3N A;  5G05 C;  4YND A;  1Y8M A;  2VGX A;  2VGE A;  2CG2 A;  4BY6 A;  4AIF A;  3O4Z A;  3OTN A;  5H7P A;  1HG2 A;  2XEN A;  1OCO E;  3MKQ A;  3JUE A;  3ZRH A;  4RSY A;  4B89 A;  5CMW A;  2CHZ A;  2KCL A;  4GZD A;  1N0R A;  1QYM A;  4U63 A;  2BED A;  4BET A;  3ZXS A;  1WG0 A;  4I9E A;  4G23 A;  3FH5 A;  2PM6 A;  2VTB A;  4HRM B;  3EHQ A;  3DXM G;  3CVY A;  3TL5 A;  3V79 K;  2WVI A;  3OXG A;  4F1S A;  2WXI A;  3CKC A;  3TXM A;  3B7T A;  3L08 A;  2XZT G;  3C3R A;  4HVB A;  1OCZ E;  2FEZ A;  4ATZ D;  5CCL A;  1ELR A;  2LAH A;  4CT4 A;  3C5R A;  2QY7 A;  3LEW A;  2BKK B;  3Q75 A;  3T5V A;  2LXM A;  1MHQ A;  2QZA A;  4HS2 A;  5BNW A;  4D10 C;  2R02 A;  4GZC A;  2KCK A;  3CGH A;  1OWN A;  3SI5 A;  5JA4 D;  4I6G A;  2WMO A;  4FJZ A;  3TWS A;  2X38 A;  1HS6 A;  4FU3 A;  3B7R L;  3LY7 A;  4J8S A;  3PZ3 A;  2OEW A;  3G2U A;  4PS8 A;  5G04 C;  4MS6 A;  4Q96 A;  1UJK A;  2IO2 C;  4TUU A;  1Z3X A;  1TN7 A;  4HQD A;  4JHJ A;  3PE4 A;  3AS4 A;  5CMY A;  4N3C A;  4ZHB A;  4RQI A;  1MX4 A;  5FT9 A;  4O1P A; 
#chains in the Genus database with same CATH homology
 3LVQ E;  5BPP A;  1E8Z A;  3FTW A;  2HR2 A;  3QJZ A;  4C0M A;  4XZ4 A;  4URK A;  3G2T A;  5BV1 A;  2J49 A;  3PEV B;  5FTP A;  4I1O B;  4BT8 A;  4I17 A;  2UWJ G;  4KVO A;  3UPV A;  1H2T C;  3FH7 A;  2YQ8 A;  1XNF A;  3PH0 C;  2PZI A;  4G11 A;  4CRW A;  4G1T A;  4EQF A;  3MJW A;  1FVF A;  3T8M A;  4CDR A;  4AOF A;  5LFA A;  2E0I A;  3FU3 A;  2PL2 A;  4FLB A;  3K9I A;  3SD5 A;  5AJD A;  4LUN U;  3N71 A;  3I4R B;  4Q69 A;  4KVM A;  3D9M A;  1Y6I A;  3MX3 A;  3CHR A;  2M63 A;  4JXT A;  3MKQ B;  2VSN A;  5JJ6 A;  2FUL A;  4GB9 A;  1UJJ A;  2OND A;  2AXU A;  3KS2 A;  3L54 A;  3R7Q A;  3S7D A;  3BG0 B;  4GYY A;  3U64 A;  3T5X A;  4FAD A;  5LCW C;  4A3V A;  3PDN A;  5ARG A;  1IQR A;  2WQ7 A;  5FQ7 A;  3TJP A;  2MOW A;  5KJN A;  2X6H A;  4PH4 B;  4DJA A;  4UWK A;  3PZD A;  2C0M A;  2IFU A;  3ESL A;  4FP7 A;  4GA2 A;  4MKT A;  4N3B A;  1FCH A;  1QQE A;  2X6I A;  1PY1 A;  1NA0 A;  2XCC A;  3RRN B;  4YVO A;  4KXK B;  3PRZ A;  3ZHE A;  3FTY A;  3MEK A;  3S7J A;  1HO8 A;  4YVQ C;  2EQX A;  3LY9 A;  1L5J A;  4JVS A;  3IKO B;  5G2N A;  4CEM A;  3CK8 A;  2AXV A;  1HU3 A;  1PC2 A;  2FF4 A;  2J9Q A;  3DPD A;  1YA0 A;  3FY4 A;  2X6J A;  3MV2 B;  4JEU A;  4UWH A;  5CHE E;  1Z3Y A;  3D9O A;  4QFV A;  5FZS A;  3SNX A;  1OWL A;  2GRL A;  1GW6 A;  2KCV A;  2LNI A;  3CK9 A;  2Q7F A;  3IBE A;  3APC A;  3L17 A;  1IHG A;  4G26 A;  4NUR A;  5EX0 A;  4BTB A;  4EBA A;  5JJT A;  3FTX A;  2CFU A;  1B89 A;  1TJF A;  4XX5 A;  4KZ0 A;  4WAF A;  5FQ8 A;  5T3R A;  2LAI A;  4RG6 A;  4AV7 A;  4KT6 B;  1OUV A;  2OOE A;  1KT1 A;  2OVF A;  4I43 A;  5FQ4 A;  4RG9 A;  4GYW A;  1E8Y A;  1P5Q A;  1Z6T A;  3SF4 A;  3LJ3 A;  3TGO A;  2HM8 A;  3HVE A;  4R7L A;  3UUX A;  3LKU A;  4B8A A;  3B13 A;  3CKB A;  2ILR A;  2KZT A;  3LXU X;  5M72 A;  3HVE B;  5FJY A;  2X6F A;  4JEH A;  4J8E A;  4AEZ C;  4WND A;  4XKB A;  3RRM B;  3FTU A;  3NQP A;  2I6H A;  2WXP A;  3MA5 A;  3B7S A;  3HYM B;  3ASG A;  4LCT A;  4P29 A;  1H2V C;  3QK0 A;  5HI7 A;  4APO A;  5T8I A;  4ANV A;  3D9K A;  3EJN A;  1WAO 1;  2XHE A;  3QWV A;  4JA7 A;  5AYW D;  3PVL A;  5FT9 A;  3PE3 A;  3ZYL A;  1NA3 A;  3PEU B;  4V3I A;  4G25 A;  5AIJ A;  4BWR A;  2UY1 A;  3TXN A;  5A6C A;  1E8X A;  2BTD A;  4GA0 A;  2I9C A;  1U3D A;  2UY1 B;  4PUC A;  3FUL A;  3VTX A;  4CDN A;  2CG3 A;  4ILI A;  3EIQ C;  5EX3 A;  1W3B A;  1A17 A;  2XPY A;  1WY6 A;  3CHQ A;  1OWM A;  2BF0 X;  3FUD A;  2X6K A;  1UG3 A;  5CCM A;  4WNF A;  4ILG A;  1ZU2 A;  4ME2 A;  4ILH B;  2WXK A;  4FJY A;  3L16 A;  5A23 A;  4I2W A;  3UQ3 A;  2AXZ A;  3E4B A;  4UWF A;  2KAT A;  2XQ0 A;  4AY5 A;  3G2V A;  4AJW A;  4U0Z A;  5EDS A;  1HF8 A;  3GW4 A;  4I9C A;  4U0U A;  5E76 A;  5JJ7 A;  3OXF A;  4XIF A;  4ABN A;  2XCB A;  5DBK A;  4NQ0 A;  3RIB A;  5ENN A;  4DK5 A;  2DIW A;  1HXI A;  1S0P A;  2XGM A;  2PM7 A;  2WXO A;  2DCP A;  5AJL A;  4GZ6 A;  4UQY A;  2RG8 A;  3KD7 A;  5KJM A;  3CK7 A;  4OYS A;  5C2Y A;  3G2W A;  2I1J A;  2WPV A;  3FUI A;  3NZU A;  2XRY A;  3FFL A;  4KMO A;  5LP0 A;  3S7B A;  5ANR A;  4A3T A;  2GRM A;  3FTZ A;  4ACK A;  4BTA A;  3SBS A;  4DLQ A;  5KJL A;  2MRI A;  1MQS A;  4H7X A;  4FA6 A;  4I6E A;  3PUK A;  2C2L A;  4ANW A;  1OWO A;  1HG5 A;  3VLD A;  2GGF A;  4MLP A;  3KEZ A;  3LDZ A;  3CVX A;  4I1A A;  2VGY A;  4EZL A;  3U9W A;  3LYA A;  4J8F A;  3CIA A;  3RKV A;  3PNT B;  5JHA A;  2VYI A;  3UX4 A;  5LOZ A;  3FU5 A;  4BSX A;  3GYZ A;  2GW1 A;  3CQC B;  3RU0 A;  3Q4A B;  3ULQ A;  1ELK A;  4TRQ A;  4UQZ A;  1ZBP A;  4WWP A;  1HX8 A;  3LS8 A;  4RVB A;  3APD A;  3FEY A;  3GZS A;  5BUZ A;  5LX8 A;  2VQ2 A;  4GYO A;  2R5S A;  4WWO A;  2AWI A;  4PDX A;  3ZFW A;  5KCM A;  1XGW A;  2L0I A;  2IF4 A;  1OWP A;  3O48 A;  4GZ3 A;  2WXR A;  1E7V A;  2YIN A;  4HOT A;  1X5B A;  3FUN A;  3ZW3 A;  4DI3 A;  4AP2 A;  1TEZ A;  3B7U X;  3ASF A;  4DPR A;  4BFR A;  1INZ A;  4WWN A;  4AVX A;  3ZHE B;  3GZ1 A;  3FUE A;  4APF A;  2FBN A;  3MCX A;  2A5U A;  2WXL A;  2WB2 A;  2DBA A;  3PRE A;  3U66 A;  5EKQ D;  3D3M A;  3ENE A;  4JA9 A;  2KM4 A;  4LER A;  3U3W A;  3LPZ A;  2HO1 A;  1JUQ A;  4L1B A;  4LEU A;  2L0T B;  2XPI A;  2X3M A;  1E96 B;  3I4G A;  3URZ A;  3FTV A;  2FI7 A;  3NZS A;  4WNG A;  4O6F A;  2HYZ A;  2LSV A;  3LVR E;  3G2S A;  3RJV A;  4GPK A;  4HXI A;  3D9L A;  1QZ2 A;  4CCA A;  2J08 A;  4HFG A;  1DVP A;  3ML9 A;  4J8D A;  2L6J A;  1E8W A;  3IV0 A;  3ZYK A;  1PAQ A;  4A55 A;  4U0S A;  3CR3 A;  4BT9 A;  4DLO A;  3I5P A;  1TJC A;  1JWF A;  4GA1 A;  4U04 A;  4KBQ A;  3JYS A;  3AS5 A;  4CDM A;  2XGS A;  2WXF A;  5A7D B;  5AEN A;  3FUF A;  3ZVV A;  4HOR A;  3CVL A;  3UT8 A;  2KZT B;  4BX8 A;  3TAX A;  4GZ5 A;  1H0A A;  2NSZ A;  4A1G A;  5J08 A;  4N2S A;  4KYO B;  3MKR A;  3RO2 A;  3TG5 A;  4F53 A;  4UI9 K;  5KJK A;  3CV0 A;  3JUI A;  3RK6 A;  5FZR A;  1EF1 C;  3S7F A;  2J09 A;  2NC9 A;  4C0E A;  4U8H A;  4XI9 A;  4W9R A;  2Y4U A;  5JHB A;  4ACL A;  1UN9 A;  4LRZ A;  3BG1 B;  3ASD A;  3QNK A;  3LCA A;  4F7A A;  4ANU A;  4AY6 A;  3FDH A;  4N5C A;  4Q94 A;  3MV3 B;  2LO6 A;  3JQ1 A;  2V8S E;  3JQ0 A;  2NXP A;  3LY8 A;  2KC7 A;  3QAR A;  5G05 J;  4KZC A;  3PUJ A;  2WQH A;  1NP7 A;  4Y6C A;  2WMN A;  5D0Q D;  2LSU A;  3FTS A;  2A4Z A;  3WXX A;  4G2V A;  2BUG A;  4EPZ A;  1SZ9 A;  3CVU A;  4J0U A;  5D0O D;  3UT4 A;  3ONL A;  3P2B A;  3RO3 A;  4NAC A;  3CVP A;  1EDU A;  4EZJ A;  3CSF A;  2PQN A;  2CHW A;  3FP3 A;  4FUL A;  3BEE A;  4CGV A;  3AU4 A;  2XEV A;  3VLE A;  4BX9 A;  3FH8 A;  4L2L A;  3FUJ A;  1JPL A;  3QC1 A;  3KAE A;  4UI9 J;  5E75 A;  4IUL A;  3SHF A;  3U4T A;  4I2Z A;  4H7Y A;  3D9J A;  2J4D A;  4WUY A;  4F3V A;  5LCW J;  1KT0 A;  4UWG A;  2YHC A;  4JC8 A;  5G55 A;  1EYH A;  3SBT B;  4IYP A;  5ANL A;  2XRZ A;  2IOL A;  4JW1 A;  3SZ7 A;  4J6I A;  1E7U A;  2XGO A;  3FU0 A;  3MYV A;  4FHK A;  4K0R A;  4UQX A;  4OVU A;  4N3A A;  1NZN A;  3ZYM A;  2OVB A;  4GU5 A;  2V5F A;  3QKY A;  1N54 A;  4JHR A;  3SFZ A;  3D9P A;  3MZL B;  5J90 A;  1N52 A;  3CHO A;  2J07 A;  3FU6 A;  3L6A A;  3ML8 A;  3I3N A;  3UT7 A;  3D9I A;  3VLF A;  5G05 C;  4YND A;  2CFZ A;  1Y8M A;  2VGX A;  2VSO E;  3IHV A;  2CG2 A;  4BY6 A;  1H2U A;  4E6H A;  4AIF A;  3CST A;  4IRU A;  3D9N A;  3O4Z A;  2I1K A;  2VGX B;  3QWW A;  2V4L A;  4ANX A;  2WXG A;  2RD0 A;  2ION A;  2WXH A;  4GCN A;  3L13 A;  4HLE A;  5FZQ A;  3OTN A;  3PS6 A;  4HOQ A;  1WM5 A;  3EIJ A;  1HG2 A;  3MKQ A;  3ZRH A;  4RSY A;  2C0L A;  1HZ4 A;  3ZGQ A;  4B89 A;  3AS8 A;  3QAQ A;  4JL0 A;  3APF A;  3C98 A;  5CMW A;  2CHZ A;  1UN8 A;  2VSY A;  3QB2 A;  2KCL A;  1HFA A;  4GZD A;  4UI9 C;  2WXQ A;  4L23 A;  4U63 A;  3EDT B;  3MGB A;  3Q5M A;  3FUH A;  3CQG B;  3ZXS A;  3ZYQ A;  2L9B A;  3Q15 A;  4AXH A;  4IN3 B;  2VSX E;  2YHE A;  4I9E A;  4G23 A;  3FH5 A;  2JEK A;  4FLH A;  4U07 A;  3ZEF A;  2PM6 A;  4B94 A;  4DI4 A;  3CVQ A;  4CT0 A;  2VTB A;  1H6K A;  2OV8 A;  4GAA A;  3CVY A;  2VTB B;  4PS7 A;  2IJG X;  3JCK C;  3FUM A;  3Q49 B;  3TL5 A;  5BV0 A;  2WVI A;  2ZU6 B;  3OXG A;  4MRU A;  4F1S A;  2WXI A;  2CHX A;  3NF1 A;  1JWG A;  3CKC A;  3ZN3 A;  3TXM A;  1HH8 A;  4N2Q A;  3B7T A;  3L08 A;  3R7R A;  1SZA A;  2XPZ A;  2WQ6 A;  4HVB A;  3AU5 A;  4B8C B;  4E85 A;  3FHE A;  2FEZ A;  5BW8 C;  5CCL A;  4K03 A;  5G04 J;  3HHM A;  3FEX A;  4L7T A;  1ELR A;  2QFC A;  4AM9 A;  3GZ2 A;  2AW6 A;  4OVV A;  2LAH A;  4L2Y A;  3ONK A;  4CT4 A;  4EEC A;  4WNE A;  2IQC A;  5BT1 A;  3CVV A;  1BPO A;  2QY7 A;  2WXN A;  3LEW A;  4C9B B;  3T5V A;  3IHY A;  3CVN A;  3R9A B;  4I6J A;  4PS3 A;  1H19 A;  3TG4 A;  2YNQ A;  4HOS A;  1MHQ A;  1FVH A;  4XKC A;  2PQR A;  2IU1 A;  1E90 A;  3Q47 B;  2E2E A;  4HS2 A;  5BNW A;  4D10 C;  3PNL B;  2WM9 A;  4NRH B;  1SQM A;  3DBS A;  2KCK A;  4GZC A;  3CEQ A;  3CGH A;  2I2O A;  4G24 A;  1OWN A;  2MHK A;  4ATG A;  2R59 A;  5C1D A;  3SI5 A;  1VDY A;  3CHS A;  3HDX A;  1IQU A;  3FWV A;  4I6G A;  4FHJ A;  3ZIM A;  2WMO A;  3ESK A;  4UWL A;  4FJZ A;  5ARF A;  2AVP A;  2X38 A;  4FC8 A;  4N39 A;  5FQ6 A;  1QNF A;  3ZPJ A;  1HS6 A;  4FU3 A;  3QWP A;  1UW4 B;  4GCO A;  2Y4T A;  3ASH A;  3B7R L;  3EHM A;  3CHP A;  3LY7 A;  2V0P A;  4GMJ A;  4J8S A;  3L22 A;  5DIZ A;  3G2U A;  4JPS A;  4HOU A;  4M3O A;  4PS8 A;  5G04 C;  4MS6 A;  5T4Y A;  1LF8 A;  4Q96 A;  3HIZ A;  3UMV A;  2JLB A;  4I1M A;  3EHN A;  3IEG A;  2FO7 A;  4EZK A;  1UJK A;  4TV3 A;  2P58 C;  1HE8 A;  4TUU A;  1Z3X A;  3P1U A;  1ELW A;  1U3C A;  2WXM A;  3S2A A;  4JHJ A;  2VJ8 A;  4JHK A;  1KLX A;  3CLJ A;  1DNP A;  3AS4 A;  3PE4 A;  3QDN A;  4XE0 A;  5CMY A;  4N3C A;  3FUK A;  4GML A;  4A1S A;  4Y6W A;  2Y3A A;  3OAW A;  3OXL A;  3SGH A;  1EPU A;  1IYG A;  3VTY A;  4JZY A;  4CGW A;  3CVW A;  3RRU A;  4EBA G;  4XI0 A;  5FWQ A;  2IOS A;  4B0Z A;  5HQ8 A;  3QOU A;  2R17 C;  2WXJ A;  3CHM A;  2J4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...