3UT4A

Structural view of a non pfam singleton and crystal packing analysis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
TSLRDLIPKHKFDNSTIDQLCKLIDNEIEPIIFDLLKWLQDYNWPIAKDILPVVVLHQSIAMPHILTILQGNDIMWKYWVIKLMIPYLIYPNKQLVKSELERLSSLEIINEDIREIVNLSKDYLHFYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Structural view of a non pfam singleton and crystal packing analysis.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16804 DUF5071 Domain of unknown function (DUF5071)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.750 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ut4A00
3UT7A 3UT4A 3UT8A
chains in the Genus database with same CATH superfamily
2A4ZA 3TL5A 1MHQA 4I2WA 3GZSA 5E75A 3JUEA 2FULA 3RO3A 2V5FA 1OCZE 2KC7A 1H19A 5HS0A 3Q49B 2HYZA 4J8YA 4WWPA 4FJZA 2CHWA 2XENA 5EIBE 2LSVA 2WXKA 4UI9J 3AG4E 4HBDA 5LX8A 2BKKB 4PH4B 1L5JA 2E0IA 5B1BE 3C3RA 1E7VA 2CG2A 5T4YA 4ABNA 3CGHA 4GU5A 3AS5A 4LNUD 5CERB 3LDZA 1JCQA 4U8YD 3TXNA 4ACKA 3T8KA 3DSSA 1LTXA 4KXKB 4B8CB 4CRWA 3EHNA 1E8WA 3ASOE 3QWPA 1UOHA 4URKA 3Q7AA 5JHAA 3ASGA 3TWWA 1LD7A 1ZU2A 3TWRA 1H2UA 2IO2C 3SFYA 4L1BA 5AJDA 4C48B 1ZB1A 4E6HA 1BLXB 2NXPA 4U07A 5FZSA 1TNZA 2AVPA 3B7RL 4KZ0A 2PNNA 4OAVB 2PQNA 2QYJA 5BW8C 1MZCA 2WXQA 3ASHA 4JL0A 1KPSB 2GRMA 4BETA 5G2NA 2L6JA 3ABLE 4I6JA 3IKOB 2OEVA 2LNIA 3ML9A 4B0ZA 3CHMA 3U9WA 3EHRA 3PZ1A 3C5RA 3KD7A 5D2MC 4WNEA 5CMYA 1JWFA 1ELKA 4JA9A 4I6EA 3FTSA 4CT4A 4MS6A 3C3OA 4JC8A 4BT8A 5FZRA 4RVBA 1EDUA 4ZHBA 4Y6WA 4HQDA 3B7SA 4HOUA 3AS8A 5KCMA 3TG4A 4WNDA 3MJWA 4G23A 3DBSA 4L2YA 4EBAA 4C9BB 1UN9A 3C98A 4GZ6A 3CIAA 4AP2A 5G04C 1BU9A 3FEXA 3AAAC 1UG3A 4DPRA 4K5AB 2YHEA 4G8LA 2IOSA 3SO8A 3P1UA 1DVPA 4WAFA 1G3NB 4P29A 3K9IA 3EU9A 2V8SE 3RKVA 4IN3B 5DBKA 2NYJA 2BEDA 2WXLA 1QNFA 3ULQA 3N71A 1UN8A 4K5BA 1H6KA 2J09A 3UM2A 1NFIE 3PRZA 4PS3A 1Y8MA 4K0RA 2YINA 3CV0A 1O1RA 1N0QA 2HR2A 1AP7A 3C72A 3IEGA 5FQ8A 4HXIA 5JJ6A 2LAHA 4AJWA 4UQXA 1FVHA 2P2CP 2P9IG 3SBTB 4UWKA 3UIPC 2AXUA 5ARGA 4MRUA 3L82A 2H6IA 3J5QB 4MBGA 3JQ0A 3I4GA 5LFAA 4N3BA 2Y1LE 2IOLA 4O1OA 1X5BA 2C2LA 2F37A 5G05J 4A1GA 2WXRA 1HXIA 3QWVA 3T8MA 3UPVA 2WQHA 4PS7A 4YDEA 1PAQA 2ETCA 3DEOA 3DPDA 4WWNA 4FULA 4BX9A 2BTDA 4KYOB 3ONKA 4HLEA 4ATGA 3DPYA 4UI9C 4E85A 1YYHA 1TNUA 4MLPA 2UWJG 1IYGA 3GYZA 3JXIA 1ELRA 4JHJA 5FQ4A 5KJLA 3MKQA 3UINC 2VSNA 2VGEA 2L6BA 3FUNA 2NC9A 3RAUA 4GZCA 4HVBA 2UY1B 3EUVA 3LEWA 3CHSA 3FTVA 4IRUA 3E34A 3NB2A 4DX7D 1IHBA 2J4BA 4BTAA 3FH7A 3NQPA 5CRVA 1NP7A 3E33A 3EJNA 2OOEA 2Y0BG 2VGXA 4YVQC 3G2UA 3FU6A 4U7EB 3GW4A 5ANRA 3FWVA 4KVOA 1TJCA 3FUIA 3R9AB 2WXHA 2RFMA 2J8SD 3PDNA 5KJKA 4EBAG 3CKCA 5CCLA 3UUXA 3MYVA 4HORA 5CHEE 2OVBA 4FJYA 2WVIA 3PNLB 4U96D 1S63A 5E76A 2XEEA 3KSQA 1H2TC 2XEVA 3T5VA 4ANUA 3E30A 3S7DA 2H6HA 4GTRA 2P58C 3FTWA 2VSXE 2XGMA 3PZ2A 3MGBA 3AG2E 4F6RD 2WXGA 4GYYA 2AXVA 3TJPA 4O1PA 4K5CA 4HOTA 4DUIA 3PEUB 3SBSA 4ILHB 4IULA 2H6FA 3HIZA 4BSXA 3UXGA 2X6FA 4JHKA 5AYWD 1U3CA 3OXLA 4H7XA 4DRXE 2XZTG 4GA2A 4U8HA 2KBXA 3D9NA 1JUQA 2GRPB 3NZSA 3ZFWA 5FWQA 4KZCA 5LOZA 2PM7A 4A1SA 3LCAA 4FP7A 1IHGA 3EIQC 4X8QA 3L17A 2QYUA 1EYHA 4JD2G 3HVEA 1Z3YA 1ZBPA 3CVQA 1N4QA 2F8YA 3T5XA 3NOCD 1EPUA 2R05A 3EU5A 4U63A 3S7FA 5AN8A 5CCMA 2DVWA 1E8XA 1HU3A 2ETAA 3LXUX 4RLYA 4ANXA 4CT0A 3KSLA 3RRMB 3LY8A 1HG5A 3HXDA 1MX4A 2DZOA 3RRUA 3ZKJA 3ZHEA 1K1BA 4QFVA 4ATZD 3NF1A 2XS8A 4F1SA 2VQ2A 3D9JA 1MQSA 5FJYA 1LD8A 3Q75A 1SQMA 4HOSA 3B7TA 3CLJA 4F1PA 3HXBA 4YVOA 4WWOA 1TYQG 3QAQA 4RSYA 1SA5A 3ABME 1DCEA 3O4ZA 3LPZA 2EIJE 4DI4A 2IONA 1O1TA 4U95D 2XPYA 3LY9A 3G2VA 2CFUA 3G2TA 3UTMA 4W9RA 4BERA 1QYMA 4WNGA 2VTBA 2DZNA 3UM3A 4YDYA 4I17A 3CR3A 2YHCA 1JCRA 2IEJA 4ZFHA 3FTYA 1MJ0A 3LS8A 4EQFA 3VLDA 1JWGA 4N3CA 3FUJA 3FUHA 3PZ3A 4XX5A 2IO3C 3V2OA 3JXJA 5AARA 3E32A 4I1MA 1W3BA 1N52A 2XPIA 1DCQA 2PQRA 3CVXA 4GMRA 2JLBA 3DEPA 4J8DA 2B0OE 4XKCA 3HXEA 1E90A 3ULYA 2P9SG 2H6GA 1OUVA 2LO6A 4L7TA 5JA4D 3UM1A 3QWWA 2F0YA 3DSXA 3WG7E 2RKKA 5JJTA 3DRAA 2EINE 4JB8P 5JHBA 3TG5A 4JVSA 1KT1A 5ENTD 4G26A 3B13A 3MV3B 1IXVA 3UKRG 2I6HA 5HKPA 5H7PA 4GCOA 2EILE 2PL2A 3CVWA 1Y6IA 5CEDB 3ENEA 4DX5D 1Z3XA 2XCBA 3ZNGA 4IYPA 3UKUG 1Z6TA 3R7RA 4G11A 3L13A 2I1KA 3FH5A 4U0SA 4DLQA 2GROB 4NACA 3NAWA 4GTSA 5AQAA 3DXKG 2LSUA 3ZYKA 5M72A 2WXPA 4BTBA 2WXMA 3CQCB 5FQ6A 5J08A 3JCKC 2MRIA 2XCCA 3CSTA 3WXXA 3ZXPA 2DBAA 3CVVA 3I4RB 3QDNA 4APOA 2HO1A 3BU8A 5ENRD 3D9KA 3U64A 4N5QA 2QFCA 4UWFA 2PM6A 4B93B 3ZIMA 4F53A 3PNTB 3ZYMA 2VYIA 3TWSA 3IBEA 3CHRA 3PH0C 2IQCA 3V31A 4HI9A 3ZUVB 1HX8A 1OCCE 1VDYA 5ITZF 4TRQA 4B8AA 3DSTA 3AG1E 3TXMA 4XEIG 2J49A 4XZ4A 4CCAA 3MV2B 1YMPA 3KS2A 5T8IA 1S70B 5KWDA 2P9PG 3CKBA 3FUKA 3BEEA 1DNPA 1OCOE 2L9BA 3ZYQA 2GRQB 2I1JA 1OWOA 4QQIA 3FU5A 1V54E 4TXRA 2J4DA 2EQXA 3JUIA 3SF4A 3ZXSA 2PZIA 2QC9A 5CEAA 5EILA 3ZN3A 1Q2ZA 5EX3A 2OCCE 3HXFA 1FT2A 5KNHD 2FF4A 3MKRA 3TGOA 4A63B 3IXEA 4DK5A 5HRYA 1TNOA 3L16A 5LCWJ 2V4HC 4A3VA 5A6CA 4CEMA 4OYSA 5BPPA 4RG9A 1X81A 1OT8A 1OCRE 1HS6A 4GZ3A 4G24A 3ESLA 4WUYA 3W9GA 2BKGA 4I1AA 5HQ8A 3QARA 3MKQB 3D9PA 2XQ0A 4N39A 4I43A 3G2WA 3C3QA 3HG0D 3ML8A 1Z5SC 2CHZA 1N4PA 2RG8A 3D9MA 1HH8A 2IU1A 3APDA 3V2XA 2B6CA 2VGXB 2Y69E 3ZYLA 4HS2A 2CG3A 3CVNA 1N11A 2GGFA 3OXGA 3Q73A 4I1OB 4LUNU 2XHEA 5D0OD 1FT1A 3IHYA 4OAUC 1HO8A 2WXOA 5FZQA 4GB9A 3BG0B 2E2EA 3PVLA 3TWTA 4DX6D 1HE8A 2LXLA 2ZGGA 2WMOA 3VTYA 4DJAA 3S7JA 4G2VA 4FHJA 3FH8A 3URZA 2VSYA 2BF0X 2X6KA 1MYOA 3P2BA 5JJ7A 2WXJA 2XZDG 2AXZA 1NL4A 1D8EA 3TWUA 3D9LA 2R03A 3V30A 4DX1A 3MX3A 3ULEG 4HRNA 3FULA 2QZAA 3DSUA 4U0ZA 1S0PA 4LG6A 4BSZB 1N94A 1EF1C 4HRMB 2FO7A 2FEZA 3FU3A 1N54A 2ZU6B 1BD8A 3L54A 4WNFA 2OEWA 3LVQE 3EIJA 3BUAA 4I6GA 4J6IA 4UWGA 2XEHA 4KVMA 2I9CA 1P5QA 4DLOA 1D9SA 4GPMA 4AXHA 4J7WA 4FADA 4FLHA 3ONLA 3RO2A 2DCPA 3UT4A 2WM9A 1PY1A 3HVEB 3PUKA 3HXCA 3ABKE 1N95A 3Q7FA 2V5QC 3HRAA 3VLEA 1TNBA 2V0PA 3AS4A 5A7DB 3QJZA 4JZYA 5EIDA 4L2LA 4TXPA 1BPOA 3MCXA 5KBAA 4J8SA 4GA1A 1H0AA 4G8KA 3SZ7A 1XGWA 3RSEG 3CVPA 5FTPA 2WMNA 5FINA 3UT7A 1FCHA 1SZ9A 5B1AE 4EZJA 4HRLA 4NQ0A 4V3IA 3FTZA 4TXQA 4GAAA 1O1SA 1H6PA 4GPKA 1HG2A 2LAIA 3ZHEB 2WQ6A 1NI1A 4Q96A 3FUDA 5EYPF 5ANLA 3ASDA 1KZOA 1JCSA 4KMOA 4GZ5A 4HNAD 3PUJA 1K1AA 3TWVA 3KAEA 1RZ4A 2KZTA 3ZRHA 4RG6A 3Q5MA 3QNKA 1H6OA 5DIZA 4BX8A 4PS8A 5FIOA 1IKND 2VTBB 3R7QA 3PE4A 5LCWC 1E7UA 2DIWA 3UQ3A 3APCA 2HM8A 1OXJA 2YNQA 3B7BA 4ME2A 5D0QD 3OTNA 3D9OA 3PE3A 4ANVA 3ZPJA 4ANWA 3NZUA 2Y4TA 1KZPA 2R2LA 3SNXA 3D9HA 3MEKA 2ZGDA 3U66A 3UM0A 1U3DA 3B7UX 5AJLA 2J9QA 1RW2A 4GTVA 5C1DA 1TEZA 3FUEA 1HFAA 5BNWA 5AAOA 2WXFA 1OWLA 3DSVA 3L6AA 3FHEA 4F7AA 3EDTB 3FP3A 4GMJA 2AW6A 4PDXA 1OWNA 1MX6A 4M3OA 1WDYA 5C2YA 4GZDA 5KNGA 1S64A 3Q47B 1N0RA 1K3ZD 2VSOE 1INZA 3U4TA 4AY6A 4CDRA 3NBNB 4U04A 1QZ2A 3EHQA 1N4RA 4N2QA 1HZ4A 1KT0A 3L08A 5G55A 1SA4A 3UMVA 3FEYA 3KEAA 4XI9A 3V79K 1OWMA 3PZDA 3R9MA 1N4SA 1WM5A 4UQZA 2XGOA 2L0IA 4R7LA 3L9TA 2L0TB 3HHMA 4CDNA 4AY5A 2ZIRA 2C0MA 2RD0A 2FI7A 1WG0A 4C0EA 4XI0A 5BXOA 4HI8A 2XGSA 3PZ4A 5IY5E 4N3AA 3LJ3A 4KT6B 1WY6A 3SHFA 5BT1A 4UWHA 4O60A 3RK6A 3DXMG 5EN5D 3LKUA 2IJGX 5EKQD 3TWQA 4CGVA 5BV0A 1SZAA 4I2ZA 1E8YA 4JA7A 4FA6A 3UT8A 1FPPA 4GCNA 1FVFA 5B3SE 2XRYA 3CK8A 4OVVA 2KCLA 3CK7A 4LNBA 4L23A 2Y4UA 5AQBA 3Q9NC 3G2SA 3VTXA 4U8VD 4NURA 1ELWA 2EIME 4APFA 1D8DA 1GW6A 4BEPA 2IF4A 2FBNA 4DI3A 1OWPA 2J07A 3CHOA 3I3NA 3L22A 4BFRA 4AOFA 3AU5A 3SQVA 2A5EA 4LERA 5CRUA 1A5EA 4HB5A 3GZ1A 3J5PA 3OXFA 5BV1A 2ONDA 4NRHB 2ETBA 3IHVA 3DWLG 2AJAA 4BT9A 1SVXA 1NA0A 3IV0A 4J0UA 4N2SA 2WXIA 3QOUA 4CGWA 2A5UA 1LF8A 3FDHA 5AQ7A 3FUFA 2R02A 4M7CA 5A23A 3B95A 4TUMA 3F6QA 2LXMA 5EYLA 3HDXA 3JYSA 1KLXA 3FTUA 1UJJA 5EX0A 3D3MA 3RJVA 4G1TA 4CZ2D 1IQRA 2CHXA 3MZLB 3FTXA 5BXUA 2DYRE 3O48A 3BQOA 3U3WA 2QY7A 4Q69A 2R59A 2WPVA 4LRZA 4YDWA 2RFAA 2WB2A 1UW4B 3PREA 1YA0A 1QQEA 2OVFA 4ILIA 2FO1E 1A17A 4BWRA 3GZ2A 2GRRB 4G25A 3W9FA 4OVUA 1QBQA 2P9UG 3EHMA 3OAWA 5ENSD 2V4LA 4AIFA 4HOQA 3RRNB 1E96B 3TWXA 1SW6A 5ENQD 4BESA 3RU0A 1JPLA 3FFLA 3AJIA 4Q94A 3VLFA 5J90A 2KCVA 3HYMB 2BUGA 5CMWA 3Q4AB 2IY0C 3ESKA 3SGHA 3ZVVA 2ZXWE 3SFZA 3Q15A 4O6FA 3ZU7B 5CECB 4AEZC 5ENOD 3ZEFA 1B89A 1U2VG 1AWCB 2AWIA 2KXPC 4C0MA 3SY2A 3DSWA 4J8FA 3LVRE 4BY6A 3FY4A 4UQYA 3NOGD 4LSZE 2P9KG 3QKYA 2UY1A 4GTMA 1PC2A 2WQ7A 2MYOA 4ACLA 4YDOA 2YQ8A 2CFZA 3JQ1A 5AENA 2JABA 4JW1A 4JPSA 4JEHA 4GTOA 3I5PA 5FT9A 1O5MA 5CBNA 3X2QE 3Q9UC 1NZNA 4PUCA 3UX4A 2KATA 2OV8A 4GTTA 1DC2A 2X6HA 1TN6A 2J08A 1BI8B 5ARFA 4EPZA 4XIFA 5EDSA 5D66A 4Z68A 1NA3A 4GYOA 4RQIA 3QK0A 4UUCA 2P9LG 5JMND 2LUHA 3D9IA 5CBOA 3APFA 4I9CA 3CSFA 4J8EA 2GRNB 4AVXA 3ASNE 4Y6CA 4GYWA 1YCSB 4D10C 3Q78A 3T9KA 2X6IA 1TN8A 2GRLA 4EZLA 4XE0A 2M63A 4GMLA 4FHKA 3CVLA 4JXTA 2C0LA 4TV3A 2R17C 4B89A 3CK9A 3PS6A 3CVYA 5KJMA 1E8ZA 3SFXA 1TNYA 2JEKA 4LCTA 4LEUA 2IFUA 4N5CA 1N9AA 4FLBA 2EIKE 1WAO1 5AIJA 3Q79A 4GTQA 4CDMA 4FU3A 3BG1B 4TUUA 5ENPD 4EZKA 4XKBA 2NSZA 4LNGA 1TR4A 5G04J 4B94A 3QB2A 3LJNA 2XRZA 2KCKA 3S7BA 2X3MA 4JEUA 2KM4A 2I2OA 2VJ8A 3FU0A 3SI5A 4KBQA 3S2AA 4UI9K 5BUZA 3ISMC 3PEVB 4EECA 3E37A 2WXNA 2MHKA 2F8XK 2X6JA 5KJNA 2VGYA 2Y3AA 4K03A 3ASFA 3SD5A 4DX2A 4U0UA 5FQ7A 4EHMA 4I9EA 2KZTB 5ENNA 1TN7A 5LP0A 2DYSE 3ZW3A 3CQGB 3ZGQA 3CVUA 4A55A 3AG3E 4HLLA 1H2VC 2Q7FA 3QC1A 1OY3D 1V55E 3LY7A 1HF8A 3MA5A 1XNFA 4H7YA 1IQUA 3CHQA 4UWLA 4NIKA 2HE0A 4YNDA 5HI7A 4CYMD 1UJKA 4FC8A 3RIBA 5T3RA 5AQ9A 2ZISA 2X38A 3CHPA 3UIOC 4GA0A 4L9PA 1MX2A 1TJFA 4F3VA 2P9NG 2XPZA 4JHRA 3FUMA 4ILGA 2DWZA 3LYAA 4AV7A 3UI2A 3TAXA 2XS1A 3CEQA 3AU4A 2GW1A 1K8KG 4MKTA 5G05C 4AM9A 4HFGA 1BI7B 3KEZA 2R5SA 4GTPA 3E4BA 4A3TA 2ILRA 2MOWA
chains in the Genus database with same CATH topology
4GZ3A 2A4ZA 1FVFA 4G24A 3TL5A 2XRYA 3CK8A 4OVVA 2KCLA 3CK7A 4BSXA 4L23A 1MHQA 4I2WA 3GZSA 2X6FA 2Y4UA 3ESLA 5E75A 4WUYA 3G2SA 3VTXA 4I1AA 4NURA 2FULA 3RO3A 1ELWA 4JHKA 5AYWD 5HQ8A 3QARA 3MKQB 2V5FA 1U3CA 3OXLA 4APFA 3D9PA 1GW6A 2XQ0A 4N39A 4H7XA 4I43A 2IF4A 2FBNA 3G2WA 2KC7A 4GA2A 4DI3A 1H19A 1OWPA 2J07A 3CHOA 3I3NA 3Q49B 3L22A 4BFRA 2HYZA 4WWPA 4AOFA 3AU5A 4FJZA 3ML8A 2CHZA 4U8HA 2CHWA 3D9NA 4LERA 1JUQA 2LSVA 2RG8A 2WXKA 3D9MA 1HH8A 2IU1A 3APDA 4UI9J 3NZSA 3ZFWA 5FWQA 3GZ1A 4KZCA 5LOZA 2PM7A 3OXFA 5LX8A 4A1SA 5BV1A 4PH4B 3LCAA 1L5JA 2ONDA 2E0IA 1IHGA 2VGXB 4FP7A 3EIQC 3L17A 1E7VA 1EYHA 2CG2A 4NRHB 3ZYLA 5T4YA 4ABNA 3HVEA 3CGHA 4HS2A 3IHVA 2CG3A 3CVNA 4BT9A 4GU5A 1Z3YA 1NA0A 3AS5A 2GGFA 3OXGA 1ZBPA 3IV0A 4I1OB 3LDZA 3TXNA 4LUNU 2XHEA 4J0UA 5D0OD 4N2SA 3CVQA 4ACKA 2WXIA 3QOUA 4CGWA 3T5XA 1EPUA 4U63A 2A5UA 1LF8A 3FDHA 3S7FA 4KXKB 3IHYA 4B8CB 1HO8A 5CCMA 2WXOA 5FZQA 4GB9A 3FUFA 3BG0B 3EHNA 1E8XA 2E2EA 4CRWA 1E8WA 3PVLA 3QWPA 4URKA 1HE8A 1HU3A 5JHAA 3ASGA 2WMOA 3VTYA 5A23A 4DJAA 3LXUX 3S7JA 1ZU2A 4G2VA 4FHJA 1H2UA 3FH8A 4ANXA 3URZA 4CT0A 2VSYA 2BF0X 4L1BA 5AJDA 3RRMB 3LY8A 2X6KA 4E6HA 1HG5A 2NXPA 3P2BA 4U07A 5FZSA 3RRUA 5JJ7A 2WXJA 3HDXA 3JYSA 2AXZA 1KLXA 2AVPA 3FTUA 4GCNA 3ZHEA 1UJJA 3B7RL 4QFVA 5EX0A 3D3MA 3NF1A 3D9LA 4KZ0A 3RJVA 4F1SA 2VQ2A 2PQNA 1MQSA 3D9JA 4G1TA 5FJYA 3MX3A 1IQRA 2CHXA 1SQMA 4HOSA 3MZLB 3FTXA 3B7TA 3CLJA 3O48A 5BW8C 3FULA 3U3WA 2QY7A 2WXQA 3ASHA 4Q69A 2R59A 4JL0A 2WPVA 4YVOA 4U0ZA 4LRZA 2GRMA 4WWOA 1S0PA 5G2NA 2L6JA 3QAQA 1EF1C 4RSYA 2FO7A 4I6JA 2FEZA 3FU3A 2WB2A 1UW4B 1N54A 3IKOB 3PREA 2LNIA 1YA0A 2ZU6B 1QQEA 2OVFA 3ML9A 4ILIA 3O4ZA 1A17A 3LPZA 3L54A 4BWRA 4DI4A 4WNFA 4B0ZA 3CHMA 3GZ2A 3U9WA 2IONA 4G25A 2XPYA 3LY9A 3G2VA 2CFUA 3KD7A 3G2TA 3LVQE 4OVUA 4W9RA 3EHMA 4WNGA 3EIJA 4GPKA 3OAWA 2VTBA 4WNEA 5CMYA 2V4LA 1JWFA 4I6GA 1ELKA 4J6IA 4AIFA 4I17A 4I6EA 4JA9A 4UWGA 4HOQA 3FTSA 4KVMA 3RRNB 3CR3A 4CT4A 1E96B 2I9CA 2YHCA 1P5QA 4MS6A 4DLOA 3FTYA 4JC8A 3RU0A 3LS8A 4EQFA 4BT8A 1JPLA 3VLDA 3FFLA 5FZRA 4RVBA 1EDUA 1JWGA 4Q94A 4N3CA 3FUJA 3FUHA 4XX5A 4AXHA 4FADA 3VLFA 4Y6WA 5J90A 4FLHA 3ONLA 2KCVA 3B7SA 3RO2A 3HYMB 2BUGA 2DCPA 5CMWA 4I1MA 4HOUA 3AS8A 1W3BA 3UT4A 5KCMA 3TG4A 1N52A 2XPIA 2WM9A 4WNDA 1PY1A 3HVEB 3Q4AB 3MJWA 3PUKA 4G23A 3DBSA 4L2YA 2PQRA 3ESKA 3SGHA 3CVXA 3ZVVA 4EBAA 4C9BB 1UN9A 3C98A 3SFZA 4GZ6A 3CIAA 3Q15A 4AP2A 3VLEA 2JLBA 5G04C 2V0PA 3AS4A 5A7DB 4J8DA 3QJZA 4JZYA 4O6FA 4L2LA 4XKCA 3FEXA 1BPOA 1UG3A 4DPRA 4AEZC 1E90A 2YHEA 3MCXA 2IOSA 3ZEFA 1B89A 4J8SA 4GA1A 1H0AA 1OUVA 2LO6A 4L7TA 3P1UA 1DVPA 3QWWA 2AWIA 4C0MA 3SZ7A 1XGWA 5JJTA 4WAFA 4P29A 4J8FA 3LVRE 3CVPA 5FTPA 4BY6A 3FY4A 5JHBA 4UQYA 3K9IA 2WMNA 2V8SE 3RKVA 3UT7A 1FCHA 1SZ9A 4EZJA 4IN3B 3QKYA 3TG5A 4JVSA 4NQ0A 5DBKA 2UY1A 4V3IA 3FTZA 2WXLA 4GAAA 1KT1A 1QNFA 1HG2A 3ULQA 1PC2A 4G26A 2LAIA 3N71A 3ZHEB 2WQ7A 2WQ6A 1UN8A 3B13A 4Q96A 3FUDA 3MV3B 4ACLA 2I6HA 5ANLA 3ASDA 4GCOA 1H6KA 2YQ8A 2J09A 2PL2A 2CFZA 3JQ1A 3PRZA 3CVWA 1Y6IA 4KMOA 4PS3A 4GZ5A 1Y8MA 5AENA 3ENEA 4JW1A 1Z3XA 4JPSA 3PUJA 4JEHA 2XCBA 4K0RA 2YINA 3CV0A 3I5PA 4IYPA 1HS6A 2HR2A 5FT9A 3KAEA 1Z6TA 1NZNA 2KZTA 3ZRHA 4PUCA 3IEGA 2KATA 3Q5MA 3QNKA 4RG6A 5FQ8A 3UX4A 2OV8A 4HXIA 3R7RA 5JJ6A 2LAHA 4AJWA 4UQXA 5DIZA 4G11A 2X6HA 4BX8A 1FVHA 2J08A 3L13A 5ARFA 4UWKA 4PS8A 3SBTB 4EPZA 2VTBB 3R7QA 2I1KA 3PE4A 3FH5A 4U0SA 4XIFA 4DLQA 5EDSA 1NA3A 4NACA 2AXUA 4GYOA 5ARGA 4MRUA 5LCWC 1E7UA 3QK0A 2DIWA 3UQ3A 2LSUA 3ZYKA 3APCA 2HM8A 3JQ0A 2YNQA 5M72A 4ME2A 3I4GA 2WXPA 4BTBA 5LFAA 3D9IA 4N3BA 5D0QD 3OTNA 2IOLA 3APFA 2WXMA 4I9CA 3CQCB 5FQ6A 5J08A 3D9OA 3CSFA 4J8EA 4AVXA 1X5BA 3JCKC 2C2LA 2MRIA 2XCCA 4GYWA 3PE3A 4Y6CA 4ANVA 5G05J 3ZPJA 4ANWA 4D10C 4A1GA 2X6IA 3NZUA 2Y4TA 3SNXA 2GRLA 3CSTA 3MEKA 4XE0A 3WXXA 4EZLA 3U66A 2WXRA 2M63A 1HXIA 1U3DA 3QWVA 4FHKA 4GMLA 3B7UX 3CVLA 2J9QA 4JXTA 5AJLA 3T8MA 3UPVA 2WQHA 2C0LA 4PS7A 2DBAA 4TV3A 1PAQA 2R17C 4B89A 3DPDA 4WWNA 4FULA 3CVVA 3I4RB 3QDNA 4APOA 3CK9A 2HO1A 5C1DA 1TEZA 3PS6A 3CVYA 4BX9A 5KJMA 3FUEA 1HFAA 5BNWA 2BTDA 3D9KA 3U64A 2WXFA 4KYOB 1OWLA 3ONKA 3L6AA 3FHEA 1E8ZA 2QFCA 4F7AA 4HLEA 2JEKA 3EDTB 4UWFA 4LCTA 4ATGA 2PM6A 3FP3A 4GMJA 4LEUA 4UI9C 4E85A 2IFUA 4N5CA 3ZIMA 2AW6A 4PDXA 1OWNA 4F53A 3PNTB 4FLBA 4MLPA 2UWJG 3ZYMA 1IYGA 4M3OA 5C2YA 3GYZA 2VYIA 1WAO1 1ELRA 5AIJA 4GZDA 4JHJA 3IBEA 5FQ4A 5KJLA 3MKQA 4CDMA 3Q47B 3CHRA 3PH0C 2IQCA 2VSNA 3BG1B 4FU3A 4TUUA 3FUNA 4EZKA 2NC9A 2VSOE 1HX8A 4GZCA 1INZA 4XKBA 2NSZA 4HVBA 2UY1B 3LEWA 4IRUA 3CHSA 3FTVA 3U4TA 5G04J 1VDYA 4B94A 4AY6A 3QB2A 2XRZA 4CDRA 2KCKA 3S7BA 2J4BA 2X3MA 4TRQA 4U04A 4BTAA 4B8AA 4JEUA 1QZ2A 2KM4A 2I2OA 2VJ8A 3FU0A 3FH7A 3NQPA 3SI5A 1NP7A 4KBQA 3S2AA 4UI9K 3EJNA 5BUZA 2OOEA 3PEVB 3TXMA 4EECA 4N2QA 1HZ4A 2VGXA 2WXNA 2MHKA 2J49A 4XZ4A 4CCAA 3MV2B 1KT0A 3KS2A 3L08A 4YVQC 2X6JA 5G55A 5KJNA 2VGYA 2Y3AA 4K03A 3ASFA 3SD5A 3UMVA 3G2UA 5T8IA 3FU6A 3FEYA 3GW4A 5ANRA 3FWVA 4XI9A 3CKBA 3FUKA 4KVOA 1OWMA 3PZDA 3BEEA 1DNPA 1TJCA 2L9BA 4U0UA 5FQ7A 3ZYQA 3FUIA 2I1JA 3R9AB 1OWOA 4I9EA 2WXHA 2KZTB 5ENNA 3FU5A 5LP0A 1WM5A 3ZW3A 3CQGB 2J4DA 3PDNA 2XGOA 2L0IA 4UQZA 2EQXA 3ZGQA 4A55A 5KJKA 4EBAG 3CVUA 4R7LA 2L0TB 1H2VC 2Q7FA 3QC1A 3CKCA 3LY7A 1HF8A 5CCLA 3UUXA 3JUIA 1XNFA 3MA5A 3HHMA 3MYVA 4H7YA 4CDNA 4HORA 3SF4A 3ZXSA 1IQUA 2PZIA 3CHQA 4AY5A 5CHEE 4UWLA 2OVBA 4FJYA 2WVIA 2C0MA 3PNLB 3ZN3A 2RD0A 2FI7A 4YNDA 5HI7A 5E76A 4C0EA 4XI0A 1UJKA 5EX3A 1H2TC 4FC8A 2XEVA 3RIBA 3T5VA 5T3RA 4ANUA 2X38A 3S7DA 2XGSA 3CHPA 2P58C 4N3AA 3FTWA 2VSXE 2XGMA 3LJ3A 2FF4A 4GA0A 4KT6B 3MKRA 3TGOA 1TJFA 1WY6A 4F3VA 3SHFA 5BT1A 4UWHA 2XPZA 3MGBA 4DK5A 3RK6A 4JHRA 3FUMA 3LKUA 2WXGA 2IJGX 2AXVA 4GYYA 4ILGA 5EKQD 3TJPA 3LYAA 4AV7A 3L16A 4CGVA 5LCWJ 3TAXA 3CEQA 3AU4A 4A3VA 1SZAA 5BV0A 2GW1A 5A6CA 4MKTA 5G05C 4AM9A 4CEMA 4OYSA 4HOTA 5BPPA 4HFGA 4I2ZA 1E8YA 3KEZA 4JA7A 4FA6A 4RG9A 3UT8A 2R5SA 3PEUB 3SBSA 4ILHB 4IULA 3HIZA 3E4BA 4A3TA 2ILRA 2MOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT7 A;  3UT4 A;  3UT8 A; 
#chains in the Genus database with same CATH topology
 2A4Z A;  3TL5 A;  1MHQ A;  4I2W A;  3GZS A;  5E75 A;  3JUE A;  2FUL A;  3RO3 A;  2V5F A;  1OCZ E;  2KC7 A;  1H19 A;  5HS0 A;  3Q49 B;  2HYZ A;  4J8Y A;  4WWP A;  4FJZ A;  2CHW A;  2XEN A;  5EIB E;  2LSV A;  2WXK A;  4UI9 J;  3AG4 E;  4HBD A;  5LX8 A;  2BKK B;  4PH4 B;  1L5J A;  2E0I A;  5B1B E;  3C3R A;  1E7V A;  2CG2 A;  5T4Y A;  4ABN A;  3CGH A;  4GU5 A;  3AS5 A;  4LNU D;  5CER B;  3LDZ A;  1JCQ A;  4U8Y D;  3TXN A;  4ACK A;  3T8K A;  3DSS A;  1LTX A;  4KXK B;  4B8C B;  4CRW A;  3EHN A;  1E8W A;  3ASO E;  3QWP A;  1UOH A;  4URK A;  3Q7A A;  5JHA A;  3ASG A;  3TWW A;  1LD7 A;  1ZU2 A;  3TWR A;  1H2U A;  2IO2 C;  3SFY A;  4L1B A;  5AJD A;  4C48 B;  1ZB1 A;  4E6H A;  1BLX B;  2NXP A;  4U07 A;  5FZS A;  1TNZ A;  2AVP A;  3B7R L;  4KZ0 A;  2PNN A;  4OAV B;  2PQN A;  2QYJ A;  5BW8 C;  1MZC A;  2WXQ A;  3ASH A;  4JL0 A;  1KPS B;  2GRM A;  4BET A;  5G2N A;  2L6J A;  3ABL E;  4I6J A;  3IKO B;  2OEV A;  2LNI A;  3ML9 A;  4B0Z A;  3CHM A;  3U9W A;  3EHR A;  3PZ1 A;  3C5R A;  3KD7 A;  5D2M C;  4WNE A;  5CMY A;  1JWF A;  1ELK A;  4JA9 A;  4I6E A;  3FTS A;  4CT4 A;  4MS6 A;  3C3O A;  4JC8 A;  4BT8 A;  5FZR A;  4RVB A;  1EDU A;  4ZHB A;  4Y6W A;  4HQD A;  3B7S A;  4HOU A;  3AS8 A;  5KCM A;  3TG4 A;  4WND A;  3MJW A;  4G23 A;  3DBS A;  4L2Y A;  4EBA A;  4C9B B;  1UN9 A;  3C98 A;  4GZ6 A;  3CIA A;  4AP2 A;  5G04 C;  1BU9 A;  3FEX A;  3AAA C;  1UG3 A;  4DPR A;  4K5A B;  2YHE A;  4G8L A;  2IOS A;  3SO8 A;  3P1U A;  1DVP A;  4WAF A;  1G3N B;  4P29 A;  3K9I A;  3EU9 A;  2V8S E;  3RKV A;  4IN3 B;  5DBK A;  2NYJ A;  2BED A;  2WXL A;  1QNF A;  3ULQ A;  3N71 A;  1UN8 A;  4K5B A;  1H6K A;  2J09 A;  3UM2 A;  1NFI E;  3PRZ A;  4PS3 A;  1Y8M A;  4K0R A;  2YIN A;  3CV0 A;  1O1R A;  1N0Q A;  2HR2 A;  1AP7 A;  3C72 A;  3IEG A;  5FQ8 A;  4HXI A;  5JJ6 A;  2LAH A;  4AJW A;  4UQX A;  1FVH A;  2P2C P;  2P9I G;  3SBT B;  4UWK A;  3UIP C;  2AXU A;  5ARG A;  4MRU A;  3L82 A;  2H6I A;  3J5Q B;  4MBG A;  3JQ0 A;  3I4G A;  5LFA A;  4N3B A;  2Y1L E;  2IOL A;  4O1O A;  1X5B A;  2C2L A;  2F37 A;  5G05 J;  4A1G A;  2WXR A;  1HXI A;  3QWV A;  3T8M A;  3UPV A;  2WQH A;  4PS7 A;  4YDE A;  1PAQ A;  2ETC A;  3DEO A;  3DPD A;  4WWN A;  4FUL A;  4BX9 A;  2BTD A;  4KYO B;  3ONK A;  4HLE A;  4ATG A;  3DPY A;  4UI9 C;  4E85 A;  1YYH A;  1TNU A;  4MLP A;  2UWJ G;  1IYG A;  3GYZ A;  3JXI A;  1ELR A;  4JHJ A;  5FQ4 A;  5KJL A;  3MKQ A;  3UIN C;  2VSN A;  2VGE A;  2L6B A;  3FUN A;  2NC9 A;  3RAU A;  4GZC A;  4HVB A;  2UY1 B;  3EUV A;  3LEW A;  3CHS A;  3FTV A;  4IRU A;  3E34 A;  3NB2 A;  4DX7 D;  1IHB A;  2J4B A;  4BTA A;  3FH7 A;  3NQP A;  5CRV A;  1NP7 A;  3E33 A;  3EJN A;  2OOE A;  2Y0B G;  2VGX A;  4YVQ C;  3G2U A;  3FU6 A;  4U7E B;  3GW4 A;  5ANR A;  3FWV A;  4KVO A;  1TJC A;  3FUI A;  3R9A B;  2WXH A;  2RFM A;  2J8S D;  3PDN A;  5KJK A;  4EBA G;  3CKC A;  5CCL A;  3UUX A;  3MYV A;  4HOR A;  5CHE E;  2OVB A;  4FJY A;  2WVI A;  3PNL B;  4U96 D;  1S63 A;  5E76 A;  2XEE A;  3KSQ A;  1H2T C;  2XEV A;  3T5V A;  4ANU A;  3E30 A;  3S7D A;  2H6H A;  4GTR A;  2P58 C;  3FTW A;  2VSX E;  2XGM A;  3PZ2 A;  3MGB A;  3AG2 E;  4F6R D;  2WXG A;  4GYY A;  2AXV A;  3TJP A;  4O1P A;  4K5C A;  4HOT A;  4DUI A;  3PEU B;  3SBS A;  4ILH B;  4IUL A;  2H6F A;  3HIZ A;  4BSX A;  3UXG A;  2X6F A;  4JHK A;  5AYW D;  1U3C A;  3OXL A;  4H7X A;  4DRX E;  2XZT G;  4GA2 A;  4U8H A;  2KBX A;  3D9N A;  1JUQ A;  2GRP B;  3NZS A;  3ZFW A;  5FWQ A;  4KZC A;  5LOZ A;  2PM7 A;  4A1S A;  3LCA A;  4FP7 A;  1IHG A;  3EIQ C;  4X8Q A;  3L17 A;  2QYU A;  1EYH A;  4JD2 G;  3HVE A;  1Z3Y A;  1ZBP A;  3CVQ A;  1N4Q A;  2F8Y A;  3T5X A;  3NOC D;  1EPU A;  2R05 A;  3EU5 A;  4U63 A;  3S7F A;  5AN8 A;  5CCM A;  2DVW A;  1E8X A;  1HU3 A;  2ETA A;  3LXU X;  4RLY A;  4ANX A;  4CT0 A;  3KSL A;  3RRM B;  3LY8 A;  1HG5 A;  3HXD A;  1MX4 A;  2DZO A;  3RRU A;  3ZKJ A;  3ZHE A;  1K1B A;  4QFV A;  4ATZ D;  3NF1 A;  2XS8 A;  4F1S A;  2VQ2 A;  3D9J A;  1MQS A;  5FJY A;  1LD8 A;  3Q75 A;  1SQM A;  4HOS A;  3B7T A;  3CLJ A;  4F1P A;  3HXB A;  4YVO A;  4WWO A;  1TYQ G;  3QAQ A;  4RSY A;  1SA5 A;  3ABM E;  1DCE A;  3O4Z A;  3LPZ A;  2EIJ E;  4DI4 A;  2ION A;  1O1T A;  4U95 D;  2XPY A;  3LY9 A;  3G2V A;  2CFU A;  3G2T A;  3UTM A;  4W9R A;  4BER A;  1QYM A;  4WNG A;  2VTB A;  2DZN A;  3UM3 A;  4YDY A;  4I17 A;  3CR3 A;  2YHC A;  1JCR A;  2IEJ A;  4ZFH A;  3FTY A;  1MJ0 A;  3LS8 A;  4EQF A;  3VLD A;  1JWG A;  4N3C A;  3FUJ A;  3FUH A;  3PZ3 A;  4XX5 A;  2IO3 C;  3V2O A;  3JXJ A;  5AAR A;  3E32 A;  4I1M A;  1W3B A;  1N52 A;  2XPI A;  1DCQ A;  2PQR A;  3CVX A;  4GMR A;  2JLB A;  3DEP A;  4J8D A;  2B0O E;  4XKC A;  3HXE A;  1E90 A;  3ULY A;  2P9S G;  2H6G A;  1OUV A;  2LO6 A;  4L7T A;  5JA4 D;  3UM1 A;  3QWW A;  2F0Y A;  3DSX A;  3WG7 E;  2RKK A;  5JJT A;  3DRA A;  2EIN E;  4JB8 P;  5JHB A;  3TG5 A;  4JVS A;  1KT1 A;  5ENT D;  4G26 A;  3B13 A;  3MV3 B;  1IXV A;  3UKR G;  2I6H A;  5HKP A;  5H7P A;  4GCO A;  2EIL E;  2PL2 A;  3CVW A;  1Y6I A;  5CED B;  3ENE A;  4DX5 D;  1Z3X A;  2XCB A;  3ZNG A;  4IYP A;  3UKU G;  1Z6T A;  3R7R A;  4G11 A;  3L13 A;  2I1K A;  3FH5 A;  4U0S A;  4DLQ A;  2GRO B;  4NAC A;  3NAW A;  4GTS A;  5AQA A;  3DXK G;  2LSU A;  3ZYK A;  5M72 A;  2WXP A;  4BTB A;  2WXM A;  3CQC B;  5FQ6 A;  5J08 A;  3JCK C;  2MRI A;  2XCC A;  3CST A;  3WXX A;  3ZXP A;  2DBA A;  3CVV A;  3I4R B;  3QDN A;  4APO A;  2HO1 A;  3BU8 A;  5ENR D;  3D9K A;  3U64 A;  4N5Q A;  2QFC A;  4UWF A;  2PM6 A;  4B93 B;  3ZIM A;  4F53 A;  3PNT B;  3ZYM A;  2VYI A;  3TWS A;  3IBE A;  3CHR A;  3PH0 C;  2IQC A;  3V31 A;  4HI9 A;  3ZUV B;  1HX8 A;  1OCC E;  1VDY A;  5ITZ F;  4TRQ A;  4B8A A;  3DST A;  3AG1 E;  3TXM A;  4XEI G;  2J49 A;  4XZ4 A;  4CCA A;  3MV2 B;  1YMP A;  3KS2 A;  5T8I A;  1S70 B;  5KWD A;  2P9P G;  3CKB A;  3FUK A;  3BEE A;  1DNP A;  1OCO E;  2L9B A;  3ZYQ A;  2GRQ B;  2I1J A;  1OWO A;  4QQI A;  3FU5 A;  1V54 E;  4TXR A;  2J4D A;  2EQX A;  3JUI A;  3SF4 A;  3ZXS A;  2PZI A;  2QC9 A;  5CEA A;  5EIL A;  3ZN3 A;  1Q2Z A;  5EX3 A;  2OCC E;  3HXF A;  1FT2 A;  5KNH D;  2FF4 A;  3MKR A;  3TGO A;  4A63 B;  3IXE A;  4DK5 A;  5HRY A;  1TNO A;  3L16 A;  5LCW J;  2V4H C;  4A3V A;  5A6C A;  4CEM A;  4OYS A;  5BPP A;  4RG9 A;  1X81 A;  1OT8 A;  1OCR E;  1HS6 A;  4GZ3 A;  4G24 A;  3ESL A;  4WUY A;  3W9G A;  2BKG A;  4I1A A;  5HQ8 A;  3QAR A;  3MKQ B;  3D9P A;  2XQ0 A;  4N39 A;  4I43 A;  3G2W A;  3C3Q A;  3HG0 D;  3ML8 A;  1Z5S C;  2CHZ A;  1N4P A;  2RG8 A;  3D9M A;  1HH8 A;  2IU1 A;  3APD A;  3V2X A;  2B6C A;  2VGX B;  2Y69 E;  3ZYL A;  4HS2 A;  2CG3 A;  3CVN A;  1N11 A;  2GGF A;  3OXG A;  3Q73 A;  4I1O B;  4LUN U;  2XHE A;  5D0O D;  1FT1 A;  3IHY A;  4OAU C;  1HO8 A;  2WXO A;  5FZQ A;  4GB9 A;  3BG0 B;  2E2E A;  3PVL A;  3TWT A;  4DX6 D;  1HE8 A;  2LXL A;  2ZGG A;  2WMO A;  3VTY A;  4DJA A;  3S7J A;  4G2V A;  4FHJ A;  3FH8 A;  3URZ A;  2VSY A;  2BF0 X;  2X6K A;  1MYO A;  3P2B A;  5JJ7 A;  2WXJ A;  2XZD G;  2AXZ A;  1NL4 A;  1D8E A;  3TWU A;  3D9L A;  2R03 A;  3V30 A;  4DX1 A;  3MX3 A;  3ULE G;  4HRN A;  3FUL A;  2QZA A;  3DSU A;  4U0Z A;  1S0P A;  4LG6 A;  4BSZ B;  1N94 A;  1EF1 C;  4HRM B;  2FO7 A;  2FEZ A;  3FU3 A;  1N54 A;  2ZU6 B;  1BD8 A;  3L54 A;  4WNF A;  2OEW A;  3LVQ E;  3EIJ A;  3BUA A;  4I6G A;  4J6I A;  4UWG A;  2XEH A;  4KVM A;  2I9C A;  1P5Q A;  4DLO A;  1D9S A;  4GPM A;  4AXH A;  4J7W A;  4FAD A;  4FLH A;  3ONL A;  3RO2 A;  2DCP A;  3UT4 A;  2WM9 A;  1PY1 A;  3HVE B;  3PUK A;  3HXC A;  3ABK E;  1N95 A;  3Q7F A;  2V5Q C;  3HRA A;  3VLE A;  1TNB A;  2V0P A;  3AS4 A;  5A7D B;  3QJZ A;  4JZY A;  5EID A;  4L2L A;  4TXP A;  1BPO A;  3MCX A;  5KBA A;  4J8S A;  4GA1 A;  1H0A A;  4G8K A;  3SZ7 A;  1XGW A;  3RSE G;  3CVP A;  5FTP A;  2WMN A;  5FIN A;  3UT7 A;  1FCH A;  1SZ9 A;  5B1A E;  4EZJ A;  4HRL A;  4NQ0 A;  4V3I A;  3FTZ A;  4TXQ A;  4GAA A;  1O1S A;  1H6P A;  4GPK A;  1HG2 A;  2LAI A;  3ZHE B;  2WQ6 A;  1NI1 A;  4Q96 A;  3FUD A;  5EYP F;  5ANL A;  3ASD A;  1KZO A;  1JCS A;  4KMO A;  4GZ5 A;  4HNA D;  3PUJ A;  1K1A A;  3TWV A;  3KAE A;  1RZ4 A;  2KZT A;  3ZRH A;  4RG6 A;  3Q5M A;  3QNK A;  1H6O A;  5DIZ A;  4BX8 A;  4PS8 A;  5FIO A;  1IKN D;  2VTB B;  3R7Q A;  3PE4 A;  5LCW C;  1E7U A;  2DIW A;  3UQ3 A;  3APC A;  2HM8 A;  1OXJ A;  2YNQ A;  3B7B A;  4ME2 A;  5D0Q D;  3OTN A;  3D9O A;  3PE3 A;  4ANV A;  3ZPJ A;  4ANW A;  3NZU A;  2Y4T A;  1KZP A;  2R2L A;  3SNX A;  3D9H A;  3MEK A;  2ZGD A;  3U66 A;  3UM0 A;  1U3D A;  3B7U X;  5AJL A;  2J9Q A;  1RW2 A;  4GTV A;  5C1D A;  1TEZ A;  3FUE A;  1HFA A;  5BNW A;  5AAO A;  2WXF A;  1OWL A;  3DSV A;  3L6A A;  3FHE A;  4F7A A;  3EDT B;  3FP3 A;  4GMJ A;  2AW6 A;  4PDX A;  1OWN A;  1MX6 A;  4M3O A;  1WDY A;  5C2Y A;  4GZD A;  5KNG A;  1S64 A;  3Q47 B;  1N0R A;  1K3Z D;  2VSO E;  1INZ A;  3U4T A;  4AY6 A;  4CDR A;  3NBN B;  4U04 A;  1QZ2 A;  3EHQ A;  1N4R A;  4N2Q A;  1HZ4 A;  1KT0 A;  3L08 A;  5G55 A;  1SA4 A;  3UMV A;  3FEY A;  3KEA A;  4XI9 A;  3V79 K;  1OWM A;  3PZD A;  3R9M A;  1N4S A;  1WM5 A;  4UQZ A;  2XGO A;  2L0I A;  4R7L A;  3L9T A;  2L0T B;  3HHM A;  4CDN A;  4AY5 A;  2ZIR A;  2C0M A;  2RD0 A;  2FI7 A;  1WG0 A;  4C0E A;  4XI0 A;  5BXO A;  4HI8 A;  2XGS A;  3PZ4 A;  5IY5 E;  4N3A A;  3LJ3 A;  4KT6 B;  1WY6 A;  3SHF A;  5BT1 A;  4UWH A;  4O60 A;  3RK6 A;  3DXM G;  5EN5 D;  3LKU A;  2IJG X;  5EKQ D;  3TWQ A;  4CGV A;  5BV0 A;  1SZA A;  4I2Z A;  1E8Y A;  4JA7 A;  4FA6 A;  3UT8 A;  1FPP A;  4GCN A;  1FVF A;  5B3S E;  2XRY A;  3CK8 A;  4OVV A;  2KCL A;  3CK7 A;  4LNB A;  4L23 A;  2Y4U A;  5AQB A;  3Q9N C;  3G2S A;  3VTX A;  4U8V D;  4NUR A;  1ELW A;  2EIM E;  4APF A;  1D8D A;  1GW6 A;  4BEP A;  2IF4 A;  2FBN A;  4DI3 A;  1OWP A;  2J07 A;  3CHO A;  3I3N A;  3L22 A;  4BFR A;  4AOF A;  3AU5 A;  3SQV A;  2A5E A;  4LER A;  5CRU A;  1A5E A;  4HB5 A;  3GZ1 A;  3J5P A;  3OXF A;  5BV1 A;  2OND A;  4NRH B;  2ETB A;  3IHV A;  3DWL G;  2AJA A;  4BT9 A;  1SVX A;  1NA0 A;  3IV0 A;  4J0U A;  4N2S A;  2WXI A;  3QOU A;  4CGW A;  2A5U A;  1LF8 A;  3FDH A;  5AQ7 A;  3FUF A;  2R02 A;  4M7C A;  5A23 A;  3B95 A;  4TUM A;  3F6Q A;  2LXM A;  5EYL A;  3HDX A;  3JYS A;  1KLX A;  3FTU A;  1UJJ A;  5EX0 A;  3D3M A;  3RJV A;  4G1T A;  4CZ2 D;  1IQR A;  2CHX A;  3MZL B;  3FTX A;  5BXU A;  2DYR E;  3O48 A;  3BQO A;  3U3W A;  2QY7 A;  4Q69 A;  2R59 A;  2WPV A;  4LRZ A;  4YDW A;  2RFA A;  2WB2 A;  1UW4 B;  3PRE A;  1YA0 A;  1QQE A;  2OVF A;  4ILI A;  2FO1 E;  1A17 A;  4BWR A;  3GZ2 A;  2GRR B;  4G25 A;  3W9F A;  4OVU A;  1QBQ A;  2P9U G;  3EHM A;  3OAW A;  5ENS D;  2V4L A;  4AIF A;  4HOQ A;  3RRN B;  1E96 B;  3TWX A;  1SW6 A;  5ENQ D;  4BES A;  3RU0 A;  1JPL A;  3FFL A;  3AJI A;  4Q94 A;  3VLF A;  5J90 A;  2KCV A;  3HYM B;  2BUG A;  5CMW A;  3Q4A B;  2IY0 C;  3ESK A;  3SGH A;  3ZVV A;  2ZXW E;  3SFZ A;  3Q15 A;  4O6F A;  3ZU7 B;  5CEC B;  4AEZ C;  5ENO D;  3ZEF A;  1B89 A;  1U2V G;  1AWC B;  2AWI A;  2KXP C;  4C0M A;  3SY2 A;  3DSW A;  4J8F A;  3LVR E;  4BY6 A;  3FY4 A;  4UQY A;  3NOG D;  4LSZ E;  2P9K G;  3QKY A;  2UY1 A;  4GTM A;  1PC2 A;  2WQ7 A;  2MYO A;  4ACL A;  4YDO A;  2YQ8 A;  2CFZ A;  3JQ1 A;  5AEN A;  2JAB A;  4JW1 A;  4JPS A;  4JEH A;  4GTO A;  3I5P A;  5FT9 A;  1O5M A;  5CBN A;  3X2Q E;  3Q9U C;  1NZN A;  4PUC A;  3UX4 A;  2KAT A;  2OV8 A;  4GTT A;  1DC2 A;  2X6H A;  1TN6 A;  2J08 A;  1BI8 B;  5ARF A;  4EPZ A;  4XIF A;  5EDS A;  5D66 A;  4Z68 A;  1NA3 A;  4GYO A;  4RQI A;  3QK0 A;  4UUC A;  2P9L G;  5JMN D;  2LUH A;  3D9I A;  5CBO A;  3APF A;  4I9C A;  3CSF A;  4J8E A;  2GRN B;  4AVX A;  3ASN E;  4Y6C A;  4GYW A;  1YCS B;  4D10 C;  3Q78 A;  3T9K A;  2X6I A;  1TN8 A;  2GRL A;  4EZL A;  4XE0 A;  2M63 A;  4GML A;  4FHK A;  3CVL A;  4JXT A;  2C0L A;  4TV3 A;  2R17 C;  4B89 A;  3CK9 A;  3PS6 A;  3CVY A;  5KJM A;  1E8Z A;  3SFX A;  1TNY A;  2JEK A;  4LCT A;  4LEU A;  2IFU A;  4N5C A;  1N9A A;  4FLB A;  2EIK E;  1WAO 1;  5AIJ A;  3Q79 A;  4GTQ A;  4CDM A;  4FU3 A;  3BG1 B;  4TUU A;  5ENP D;  4EZK A;  4XKB A;  2NSZ A;  4LNG A;  1TR4 A;  5G04 J;  4B94 A;  3QB2 A;  3LJN A;  2XRZ A;  2KCK A;  3S7B A;  2X3M A;  4JEU A;  2KM4 A;  2I2O A;  2VJ8 A;  3FU0 A;  3SI5 A;  4KBQ A;  3S2A A;  4UI9 K;  5BUZ A;  3ISM C;  3PEV B;  4EEC A;  3E37 A;  2WXN A;  2MHK A;  2F8X K;  2X6J A;  5KJN A;  2VGY A;  2Y3A A;  4K03 A;  3ASF A;  3SD5 A;  4DX2 A;  4U0U A;  5FQ7 A;  4EHM A;  4I9E A;  2KZT B;  5ENN A;  1TN7 A;  5LP0 A;  2DYS E;  3ZW3 A;  3CQG B;  3ZGQ A;  3CVU A;  4A55 A;  3AG3 E;  4HLL A;  1H2V C;  2Q7F A;  3QC1 A;  1OY3 D;  1V55 E;  3LY7 A;  1HF8 A;  3MA5 A;  1XNF A;  4H7Y A;  1IQU A;  3CHQ A;  4UWL A;  4NIK A;  2HE0 A;  4YND A;  5HI7 A;  4CYM D;  1UJK A;  4FC8 A;  3RIB A;  5T3R A;  5AQ9 A;  2ZIS A;  2X38 A;  3CHP A;  3UIO C;  4GA0 A;  4L9P A;  1MX2 A;  1TJF A;  4F3V A;  2P9N G;  2XPZ A;  4JHR A;  3FUM A;  4ILG A;  2DWZ A;  3LYA A;  4AV7 A;  3UI2 A;  3TAX A;  2XS1 A;  3CEQ A;  3AU4 A;  2GW1 A;  1K8K G;  4MKT A;  5G05 C;  4AM9 A;  4HFG A;  1BI7 B;  3KEZ A;  2R5S A;  4GTP A;  3E4B A;  4A3T A;  2ILR A;  2MOW A; 
#chains in the Genus database with same CATH homology
 4GZ3 A;  2A4Z A;  1FVF A;  4G24 A;  3TL5 A;  2XRY A;  3CK8 A;  4OVV A;  2KCL A;  3CK7 A;  4BSX A;  4L23 A;  1MHQ A;  4I2W A;  3GZS A;  2X6F A;  2Y4U A;  3ESL A;  5E75 A;  4WUY A;  3G2S A;  3VTX A;  4I1A A;  4NUR A;  2FUL A;  3RO3 A;  1ELW A;  4JHK A;  5AYW D;  5HQ8 A;  3QAR A;  3MKQ B;  2V5F A;  1U3C A;  3OXL A;  4APF A;  3D9P A;  1GW6 A;  2XQ0 A;  4N39 A;  4H7X A;  4I43 A;  2IF4 A;  2FBN A;  3G2W A;  2KC7 A;  4GA2 A;  4DI3 A;  1H19 A;  1OWP A;  2J07 A;  3CHO A;  3I3N A;  3Q49 B;  3L22 A;  4BFR A;  2HYZ A;  4WWP A;  4AOF A;  3AU5 A;  4FJZ A;  3ML8 A;  2CHZ A;  4U8H A;  2CHW A;  3D9N A;  4LER A;  1JUQ A;  2LSV A;  2RG8 A;  2WXK A;  3D9M A;  1HH8 A;  2IU1 A;  3APD A;  4UI9 J;  3NZS A;  3ZFW A;  5FWQ A;  3GZ1 A;  4KZC A;  5LOZ A;  2PM7 A;  3OXF A;  5LX8 A;  4A1S A;  5BV1 A;  4PH4 B;  3LCA A;  1L5J A;  2OND A;  2E0I A;  1IHG A;  2VGX B;  4FP7 A;  3EIQ C;  3L17 A;  1E7V A;  1EYH A;  2CG2 A;  4NRH B;  3ZYL A;  5T4Y A;  4ABN A;  3HVE A;  3CGH A;  4HS2 A;  3IHV A;  2CG3 A;  3CVN A;  4BT9 A;  4GU5 A;  1Z3Y A;  1NA0 A;  3AS5 A;  2GGF A;  3OXG A;  1ZBP A;  3IV0 A;  4I1O B;  3LDZ A;  3TXN A;  4LUN U;  2XHE A;  4J0U A;  5D0O D;  4N2S A;  3CVQ A;  4ACK A;  2WXI A;  3QOU A;  4CGW A;  3T5X A;  1EPU A;  4U63 A;  2A5U A;  1LF8 A;  3FDH A;  3S7F A;  4KXK B;  3IHY A;  4B8C B;  1HO8 A;  5CCM A;  2WXO A;  5FZQ A;  4GB9 A;  3FUF A;  3BG0 B;  3EHN A;  1E8X A;  2E2E A;  4CRW A;  1E8W A;  3PVL A;  3QWP A;  4URK A;  1HE8 A;  1HU3 A;  5JHA A;  3ASG A;  2WMO A;  3VTY A;  5A23 A;  4DJA A;  3LXU X;  3S7J A;  1ZU2 A;  4G2V A;  4FHJ A;  1H2U A;  3FH8 A;  4ANX A;  3URZ A;  4CT0 A;  2VSY A;  2BF0 X;  4L1B A;  5AJD A;  3RRM B;  3LY8 A;  2X6K A;  4E6H A;  1HG5 A;  2NXP A;  3P2B A;  4U07 A;  5FZS A;  3RRU A;  5JJ7 A;  2WXJ A;  3HDX A;  3JYS A;  2AXZ A;  1KLX A;  2AVP A;  3FTU A;  4GCN A;  3ZHE A;  1UJJ A;  3B7R L;  4QFV A;  5EX0 A;  3D3M A;  3NF1 A;  3D9L A;  4KZ0 A;  3RJV A;  4F1S A;  2VQ2 A;  2PQN A;  1MQS A;  3D9J A;  4G1T A;  5FJY A;  3MX3 A;  1IQR A;  2CHX A;  1SQM A;  4HOS A;  3MZL B;  3FTX A;  3B7T A;  3CLJ A;  3O48 A;  5BW8 C;  3FUL A;  3U3W A;  2QY7 A;  2WXQ A;  3ASH A;  4Q69 A;  2R59 A;  4JL0 A;  2WPV A;  4YVO A;  4U0Z A;  4LRZ A;  2GRM A;  4WWO A;  1S0P A;  5G2N A;  2L6J A;  3QAQ A;  1EF1 C;  4RSY A;  2FO7 A;  4I6J A;  2FEZ A;  3FU3 A;  2WB2 A;  1UW4 B;  1N54 A;  3IKO B;  3PRE A;  2LNI A;  1YA0 A;  2ZU6 B;  1QQE A;  2OVF A;  3ML9 A;  4ILI A;  3O4Z A;  1A17 A;  3LPZ A;  3L54 A;  4BWR A;  4DI4 A;  4WNF A;  4B0Z A;  3CHM A;  3GZ2 A;  3U9W A;  2ION A;  4G25 A;  2XPY A;  3LY9 A;  3G2V A;  2CFU A;  3KD7 A;  3G2T A;  3LVQ E;  4OVU A;  4W9R A;  3EHM A;  4WNG A;  3EIJ A;  4GPK A;  3OAW A;  2VTB A;  4WNE A;  5CMY A;  2V4L A;  1JWF A;  4I6G A;  1ELK A;  4J6I A;  4AIF A;  4I17 A;  4I6E A;  4JA9 A;  4UWG A;  4HOQ A;  3FTS A;  4KVM A;  3RRN B;  3CR3 A;  4CT4 A;  1E96 B;  2I9C A;  2YHC A;  1P5Q A;  4MS6 A;  4DLO A;  3FTY A;  4JC8 A;  3RU0 A;  3LS8 A;  4EQF A;  4BT8 A;  1JPL A;  3VLD A;  3FFL A;  5FZR A;  4RVB A;  1EDU A;  1JWG A;  4Q94 A;  4N3C A;  3FUJ A;  3FUH A;  4XX5 A;  4AXH A;  4FAD A;  3VLF A;  4Y6W A;  5J90 A;  4FLH A;  3ONL A;  2KCV A;  3B7S A;  3RO2 A;  3HYM B;  2BUG A;  2DCP A;  5CMW A;  4I1M A;  4HOU A;  3AS8 A;  1W3B A;  3UT4 A;  5KCM A;  3TG4 A;  1N52 A;  2XPI A;  2WM9 A;  4WND A;  1PY1 A;  3HVE B;  3Q4A B;  3MJW A;  3PUK A;  4G23 A;  3DBS A;  4L2Y A;  2PQR A;  3ESK A;  3SGH A;  3CVX A;  3ZVV A;  4EBA A;  4C9B B;  1UN9 A;  3C98 A;  3SFZ A;  4GZ6 A;  3CIA A;  3Q15 A;  4AP2 A;  3VLE A;  2JLB A;  5G04 C;  2V0P A;  3AS4 A;  5A7D B;  4J8D A;  3QJZ A;  4JZY A;  4O6F A;  4L2L A;  4XKC A;  3FEX A;  1BPO A;  1UG3 A;  4DPR A;  4AEZ C;  1E90 A;  2YHE A;  3MCX A;  2IOS A;  3ZEF A;  1B89 A;  4J8S A;  4GA1 A;  1H0A A;  1OUV A;  2LO6 A;  4L7T A;  3P1U A;  1DVP A;  3QWW A;  2AWI A;  4C0M A;  3SZ7 A;  1XGW A;  5JJT A;  4WAF A;  4P29 A;  4J8F A;  3LVR E;  3CVP A;  5FTP A;  4BY6 A;  3FY4 A;  5JHB A;  4UQY A;  3K9I A;  2WMN A;  2V8S E;  3RKV A;  3UT7 A;  1FCH A;  1SZ9 A;  4EZJ A;  4IN3 B;  3QKY A;  3TG5 A;  4JVS A;  4NQ0 A;  5DBK A;  2UY1 A;  4V3I A;  3FTZ A;  2WXL A;  4GAA A;  1KT1 A;  1QNF A;  1HG2 A;  3ULQ A;  1PC2 A;  4G26 A;  2LAI A;  3N71 A;  3ZHE B;  2WQ7 A;  2WQ6 A;  1UN8 A;  3B13 A;  4Q96 A;  3FUD A;  3MV3 B;  4ACL A;  2I6H A;  5ANL A;  3ASD A;  4GCO A;  1H6K A;  2YQ8 A;  2J09 A;  2PL2 A;  2CFZ A;  3JQ1 A;  3PRZ A;  3CVW A;  1Y6I A;  4KMO A;  4PS3 A;  4GZ5 A;  1Y8M A;  5AEN A;  3ENE A;  4JW1 A;  1Z3X A;  4JPS A;  3PUJ A;  4JEH A;  2XCB A;  4K0R A;  2YIN A;  3CV0 A;  3I5P A;  4IYP A;  1HS6 A;  2HR2 A;  5FT9 A;  3KAE A;  1Z6T A;  1NZN A;  2KZT A;  3ZRH A;  4PUC A;  3IEG A;  2KAT A;  3Q5M A;  3QNK A;  4RG6 A;  5FQ8 A;  3UX4 A;  2OV8 A;  4HXI A;  3R7R A;  5JJ6 A;  2LAH A;  4AJW A;  4UQX A;  5DIZ A;  4G11 A;  2X6H A;  4BX8 A;  1FVH A;  2J08 A;  3L13 A;  5ARF A;  4UWK A;  4PS8 A;  3SBT B;  4EPZ A;  2VTB B;  3R7Q A;  2I1K A;  3PE4 A;  3FH5 A;  4U0S A;  4XIF A;  4DLQ A;  5EDS A;  1NA3 A;  4NAC A;  2AXU A;  4GYO A;  5ARG A;  4MRU A;  5LCW C;  1E7U A;  3QK0 A;  2DIW A;  3UQ3 A;  2LSU A;  3ZYK A;  3APC A;  2HM8 A;  3JQ0 A;  2YNQ A;  5M72 A;  4ME2 A;  3I4G A;  2WXP A;  4BTB A;  5LFA A;  3D9I A;  4N3B A;  5D0Q D;  3OTN A;  2IOL A;  3APF A;  2WXM A;  4I9C A;  3CQC B;  5FQ6 A;  5J08 A;  3D9O A;  3CSF A;  4J8E A;  4AVX A;  1X5B A;  3JCK C;  2C2L A;  2MRI A;  2XCC A;  4GYW A;  3PE3 A;  4Y6C A;  4ANV A;  5G05 J;  3ZPJ A;  4ANW A;  4D10 C;  4A1G A;  2X6I A;  3NZU A;  2Y4T A;  3SNX A;  2GRL A;  3CST A;  3MEK A;  4XE0 A;  3WXX A;  4EZL A;  3U66 A;  2WXR A;  2M63 A;  1HXI A;  1U3D A;  3QWV A;  4FHK A;  4GML A;  3B7U X;  3CVL A;  2J9Q A;  4JXT A;  5AJL A;  3T8M A;  3UPV A;  2WQH A;  2C0L A;  4PS7 A;  2DBA A;  4TV3 A;  1PAQ A;  2R17 C;  4B89 A;  3DPD A;  4WWN A;  4FUL A;  3CVV A;  3I4R B;  3QDN A;  4APO A;  3CK9 A;  2HO1 A;  5C1D A;  1TEZ A;  3PS6 A;  3CVY A;  4BX9 A;  5KJM A;  3FUE A;  1HFA A;  5BNW A;  2BTD A;  3D9K A;  3U64 A;  2WXF A;  4KYO B;  1OWL A;  3ONK A;  3L6A A;  3FHE A;  1E8Z A;  2QFC A;  4F7A A;  4HLE A;  2JEK A;  3EDT B;  4UWF A;  4LCT A;  4ATG A;  2PM6 A;  3FP3 A;  4GMJ A;  4LEU A;  4UI9 C;  4E85 A;  2IFU A;  4N5C A;  3ZIM A;  2AW6 A;  4PDX A;  1OWN A;  4F53 A;  3PNT B;  4FLB A;  4MLP A;  2UWJ G;  3ZYM A;  1IYG A;  4M3O A;  5C2Y A;  3GYZ A;  2VYI A;  1WAO 1;  1ELR A;  5AIJ A;  4GZD A;  4JHJ A;  3IBE A;  5FQ4 A;  5KJL A;  3MKQ A;  4CDM A;  3Q47 B;  3CHR A;  3PH0 C;  2IQC A;  2VSN A;  3BG1 B;  4FU3 A;  4TUU A;  3FUN A;  4EZK A;  2NC9 A;  2VSO E;  1HX8 A;  4GZC A;  1INZ A;  4XKB A;  2NSZ A;  4HVB A;  2UY1 B;  3LEW A;  4IRU A;  3CHS A;  3FTV A;  3U4T A;  5G04 J;  1VDY A;  4B94 A;  4AY6 A;  3QB2 A;  2XRZ A;  4CDR A;  2KCK A;  3S7B A;  2J4B A;  2X3M A;  4TRQ A;  4U04 A;  4BTA A;  4B8A A;  4JEU A;  1QZ2 A;  2KM4 A;  2I2O A;  2VJ8 A;  3FU0 A;  3FH7 A;  3NQP A;  3SI5 A;  1NP7 A;  4KBQ A;  3S2A A;  4UI9 K;  3EJN A;  5BUZ A;  2OOE A;  3PEV B;  3TXM A;  4EEC A;  4N2Q A;  1HZ4 A;  2VGX A;  2WXN A;  2MHK A;  2J49 A;  4XZ4 A;  4CCA A;  3MV2 B;  1KT0 A;  3KS2 A;  3L08 A;  4YVQ C;  2X6J A;  5G55 A;  5KJN A;  2VGY A;  2Y3A A;  4K03 A;  3ASF A;  3SD5 A;  3UMV A;  3G2U A;  5T8I A;  3FU6 A;  3FEY A;  3GW4 A;  5ANR A;  3FWV A;  4XI9 A;  3CKB A;  3FUK A;  4KVO A;  1OWM A;  3PZD A;  3BEE A;  1DNP A;  1TJC A;  2L9B A;  4U0U A;  5FQ7 A;  3ZYQ A;  3FUI A;  2I1J A;  3R9A B;  1OWO A;  4I9E A;  2WXH A;  2KZT B;  5ENN A;  3FU5 A;  5LP0 A;  1WM5 A;  3ZW3 A;  3CQG B;  2J4D A;  3PDN A;  2XGO A;  2L0I A;  4UQZ A;  2EQX A;  3ZGQ A;  4A55 A;  5KJK A;  4EBA G;  3CVU A;  4R7L A;  2L0T B;  1H2V C;  2Q7F A;  3QC1 A;  3CKC A;  3LY7 A;  1HF8 A;  5CCL A;  3UUX A;  3JUI A;  1XNF A;  3MA5 A;  3HHM A;  3MYV A;  4H7Y A;  4CDN A;  4HOR A;  3SF4 A;  3ZXS A;  1IQU A;  2PZI A;  3CHQ A;  4AY5 A;  5CHE E;  4UWL A;  2OVB A;  4FJY A;  2WVI A;  2C0M A;  3PNL B;  3ZN3 A;  2RD0 A;  2FI7 A;  4YND A;  5HI7 A;  5E76 A;  4C0E A;  4XI0 A;  1UJK A;  5EX3 A;  1H2T C;  4FC8 A;  2XEV A;  3RIB A;  3T5V A;  5T3R A;  4ANU A;  2X38 A;  3S7D A;  2XGS A;  3CHP A;  2P58 C;  4N3A A;  3FTW A;  2VSX E;  2XGM A;  3LJ3 A;  2FF4 A;  4GA0 A;  4KT6 B;  3MKR A;  3TGO A;  1TJF A;  1WY6 A;  4F3V A;  3SHF A;  5BT1 A;  4UWH A;  2XPZ A;  3MGB A;  4DK5 A;  3RK6 A;  4JHR A;  3FUM A;  3LKU A;  2WXG A;  2IJG X;  2AXV A;  4GYY A;  4ILG A;  5EKQ D;  3TJP A;  3LYA A;  4AV7 A;  3L16 A;  4CGV A;  5LCW J;  3TAX A;  3CEQ A;  3AU4 A;  4A3V A;  1SZA A;  5BV0 A;  2GW1 A;  5A6C A;  4MKT A;  5G05 C;  4AM9 A;  4CEM A;  4OYS A;  4HOT A;  5BPP A;  4HFG A;  4I2Z A;  1E8Y A;  3KEZ A;  4JA7 A;  4FA6 A;  4RG9 A;  3UT8 A;  2R5S A;  3PEU B;  3SBS A;  4ILH B;  4IUL A;  3HIZ A;  3E4B A;  4A3T A;  2ILR A;  2MOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...