3AS5A

Mama amb-1 p212121
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
183
structure length
183
Chain Sequence
DDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELALVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
total genus 69
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as5A01
3CVLA 2NC9A 3Q49B 3TG4A 3QOUA 3VTXA 3ASHA 5EX3A 4I9EA 3FFLA 2VGXB 2XGMA 3OXGA 4I2ZA 5D0OD 3CVPA 4N5CA 1E96B 3OXLA 5FZSA 4JL0A 4JA7A 4B94A 3QWVA 4BT9A 4AY6A 5A6CA 2GW1A 4NQ0A 1ELWA 3RJVA 3BEEA 1ELRA 1HXIA 3URZA 2UWJG 3QWPA 5A7DB 3EDTB 1KLXA 2BUGA 1QZ2A 3TAXA 4N2QA 3PE4A 4G1TA 4I17A 4U0ZA 1ZU2A 4A1SA 3S7BA 4HORA 3K9IA 2HYZA 5AYWD 5G04J 3ASGA 3O48A 4LEUA 4GZ5A 4J8FA 3SZ7A 4J0UA 3RIBA 1Y8MA 4I9CA 4N2SA 4JA9A 3QDNA 3HYMB 5FZQA 2LSUA 3UUXA 3S7JA 2PZIA 3CEQA 1WM5A 2HR2A 2XGSA 2YHCA 2C2LA 1FCHA 5JJ6A 3AS4A 5FTPA 2IF4A 5BT1A 3PDNA 4J8EA 5M72A 4RG6A 2XPIA 4I2WA 1YA0A 3KS2A 2LSVA 4W9RA 5LCWC 5JJTA 3LY7A 3WXXA 4H7YA 4GYYA 5LCWJ 4GA0A 2KCVA 3GYZA 3OXFA 2J9QA 4XI0A 5ARGA 3CKCA 3S7FA 4J8DA 4G23A 5EKQD 3MKRA 4GYOA 3S7DA 5C1DA 2PL2A 3CVQA 4WNFA 2ONDA 4ME2A 3AS8A 3RU0A 4I1AA 4GZ3A 3ASDA 2FI7A 4YNDA 3GZ1A 3VTYA 4YVOA 1A17A 2LNIA 1NZNA 2Y4TA 4RG9A 5EX0A 3MA5A 3LY9A 5CCLA 3RO2A 2C0MA 4HOQA 1WAO1 4UI9K 4IN3B 3CVNA 2FF4A 3SF4A 3JYSA 4AM9A 5KJKA 4U0UA 2FBNA 2FEZA 3RO3A 5KJLA 4GA1A 2I6HA 5G05C 4NRHB 5G04C 3ZPJA 1HZ4A 3E4BA 2PQNA 1NA3A 2AVPA 3QWWA 5G05J 2XCCA 1IYGA 4H7XA 3Q15A 3R9AB 4ABNA 4GZ6A 4HOUA 5FZRA 4AIFA 1XNFA 4CGVA 3QKYA 5D0QD 4G26A 2VGXA 3CK8A 4WNGA 1ZBPA 2L6JA 2UY1B 5FJYA 3CV0A 3ZHEB 2PQRA 3TG5A 2XEVA 2XGOA 3GW4A 3AS5A 3LPZA 4BTAA 1KT0A 1TJCA 5CHEE 4KBQA 4O6FA 3LY8A 4APOA 1QQEA 3LYAA 1KT1A 2QFCA 2XCBA 5DBKA 1HH8A 3N71A 4WNEA 4WNDA 5HQ8A 2E2EA 4EQFA 2V5FA 4XIFA 3MEKA 5JJ7A 4F3VA 5KJMA 2P58C 4UI9C 2KCKA 3NF1A 1B89A 2VSYA 2WPVA 3MV2B 4N3AA 4BWRA 2Y4UA 4U0SA 3ESKA 2IFUA 3Q47B 4HOTA 4UI9J 3ZGQA 4N39A 3CKBA 4N3CA 2JLBA 2VYIA 4KYOB 2DBAA 2R5SA 3LKUA 4GCNA 4UQZA 2UY1A 4UQYA 3FP3A 2VSNA 3ZHEA 1P5QA 5FT9A 3FWVA 1NA0A 4GYWA 2HO1A 3KD7A 4UQXA 1OUVA 3GZ2A 3RKVA 4AY5A 4G24A 1W3BA 3UPVA 4G25A 4WUYA 2OOEA 4XI9A 1IHGA 4Y6WA 2KC7A 3CK9A 3PE3A 4JHRA 3IEGA 4BTBA 2C0LA 5BW8C 2Q7FA 4U04A 3Q4AB 3UQ3A 3U3WA 5CCMA 3TGOA 2KCLA 2WQHA 5DIZA 2FO7A 4GA2A 2VGYA 3ZFWA 2MHKA 2VQ2A 2KATA 3CK7A 4CGWA 4U07A 3LCAA 5KJNA 4GCOA 3U4TA 4YVQC 3KAEA 3MV3B 4N3BA 3ASFA 3ULQA 5HI7A 4Y6CA 5BNWA 3ZN3A 1PC2A 5ARFA 4G2VA 2YQ8A 4GPKA 4BT8A 3Q5MA 4KXKB 4CDRA 4HOSA
chains in the Genus database with same CATH superfamily
3CVLA 4A1GA 5AAOA 4GZCA 2BEDA 4O1OA 3Q49B 4JVSA 1IXVA 3BUAA 3PS6A 3B7RL 3ASHA 4I9EA 2PM6A 3FFLA 2VGXB 2XGMA 4MBGA 2IO2C 3OXGA 5D0OD 4I6JA 1H6PA 1E8ZA 3E30A 4Q96A 4B94A 1N9AA 2DZNA 3TXNA 4BT9A 3HXEA 3TWSA 3EHRA 4F1SA 3PREA 1X81A 2QY7A 3BG1B 1ELRA 1O1SA 1N0QA 2EINE 2UWJG 2WXRA 3ZKJA 4A3VA 3FU5A 5CECB 3APFA 5C2YA 4LUNU 3TAXA 3OTNA 4N2QA 4Q69A 5ENQD 4DX1A 2R03A 3C3QA 2RKKA 3RRMB 3CHSA 5ENTD 4HRLA 3K9IA 5CMYA 4NURA 3ASGA 3O48A 3NOGD 4LEUA 2KXPC 3LVRE 3TWUA 3TJPA 3FHEA 3FH7A 3TWRA 4ZFHA 3CVWA 1BI7B 3RIBA 3CVVA 4I9CA 3UTMA 5ENOD 1UW4B 5KCMA 4JC8A 4HQDA 2QYUA 2OV8A 2ZIRA 1GW6A 2YHCA 3EJNA 2X6JA 3AS4A 3B95A 4D10C 4GMLA 4EECA 3PZDA 3PDNA 2J49A 2GROB 4RG6A 3V31A 2GRQB 3RRNB 3V30A 2DYSE 4FA6A 5LCWC 5JJTA 3MCXA 3WXXA 4R7LA 3TWVA 4GA0A 2KCVA 1FPPA 3GYZA 5ARGA 4AVXA 4G23A 3MKQB 2WB2A 4GYOA 3S7DA 3SGHA 3MJWA 3ABKE 2PL2A 1N4QA 5G2NA 2BTDA 4ME2A 3AS8A 3RU0A 2XRZA 3EUVA 4E6HA 2YHEA 4ZHBA 1N0RA 4ATZD 2ZGDA 3HHMA 2FI7A 2OVBA 3ZEFA 3RSEG 3L6AA 5FQ6A 4HB5A 4RSYA 3QARA 3VTYA 4YVOA 4KT6B 3T8KA 5EYPF 2YINA 5EX0A 5JMND 5CCLA 1OWOA 3LY9A 4YDYA 1YYHA 3RO2A 4XKBA 3L08A 3GZSA 4DI3A 4AM9A 2LAHA 3UX4A 3KEAA 2B6CA 5AN8A 2FO1E 4U0UA 4YDWA 3RO3A 4CDMA 2QZAA 1TNOA 3R7QA 4NRHB 3ULEG 5AARA 5EDSA 3AG3E 1PY1A 3Q7FA 3APDA 2R02A 1IYGA 3R9AB 2RG8A 4U7EB 2GRNB 4TXRA 4GZ6A 3Q7AA 4B8CB 4CGVA 3CK8A 2IU1A 3CGHA 2UY1B 3MKQA 4K5CA 2PNNA 1N54A 5FJYA 5LFAA 1S0PA 3D9JA 2XEVA 4MS6A 4MRUA 3HDXA 2XQ0A 2ETCA 3LPZA 5B1AE 3IV0A 1KT0A 5CHEE 1IQRA 5E76A 3DSVA 1VDYA 2P2CP 4HRMB 3UKRG 1QQEA 4HS2A 3LYAA 3DSSA 4L2YA 1HH8A 2E2EA 3D3MA 4GTVA 2DCPA 1OWMA 3MEKA 4O1PA 4V3IA 5CMWA 2ETBA 4LNGA 2F8XK 3ZYMA 4DX2A 4HFGA 2WXNA 4GAAA 4L7TA 2DYRE 4UI9C 3MV2B 2IFUA 1UJJA 3ZGQA 2XZDG 5HS0A 1OT8A 4APFA 1U2VG 3P2BA 1BD8A 3SY2A 2OEVA 2EIME 2UY1A 3FP3A 3B13A 3DRAA 1P5QA 4ANVA 4TUMA 5FT9A 5CRUA 2HO1A 2MRIA 4LNUD 3KD7A 4EPZA 3GZ2A 4LRZA 2V5QC 3CHMA 2ILRA 3C98A 5BUZA 3SQVA 4WUYA 2V8SE 4XI9A 1OY3D 2EIJE 3JCKC 3D9LA 3EHMA 3IEGA 3PNLB 2Q7FA 2F37A 2VSXE 1TNUA 3Q4AB 3UQ3A 4ILHB 3U3WA 3ENEA 2KCLA 2WQHA 4AP2A 4C0EA 2JABA 3ZFWA 4EZJA 1HS6A 1AP7A 2MHKA 4B93B 1SZ9A 5LOZA 3UI2A 3BU8A 1DNPA 5LP0A 3I3NA 5JHBA 3U4TA 3CVXA 4LSZE 5AIJA 2MYOA 4RLYA 4GTOA 3TWTA 5BNWA 3ZN3A 5CBOA 2YQ8A 3LDZA 1LTXA 4CDRA 1KPSB 2NC9A 3UKUG 4KZCA 1HG2A 3NAWA 3TG4A 1QNFA 4F1PA 3QOUA 3VTXA 5AQBA 5EX3A 1H2TC 2DZOA 1SQMA 3UT4A 3V79K 1SA5A 5BPPA 2AXUA 2RFMA 3G2SA 1MZCA 1E96B 2V4LA 5ANRA 3NOCD 4JL0A 3L16A 4JA7A 4XEIG 3MYVA 3I5PA 4FLBA 4BERA 4AY6A 4NQ0A 1ELWA 3ML9A 3RJVA 2CFUA 2OEWA 2X6FA 2WXKA 4M3OA 3FH8A 3QWPA 3D9HA 1OCRE 5A7DB 3ZXPA 1JCSA 1N95A 1KLXA 3U64A 1QZ2A 3PEVB 4TXPA 3UT8A 3CHOA 2DWZA 2GRMA 4LERA 4PUCA 1NL4A 1ZU2A 3U9WA 3P1UA 4A1SA 3J5QB 3CIAA 3S7BA 4P29A 3AU5A 1E7UA 3CHQA 5CRVA 2J08A 4TXQA 4UWHA 4N2SA 3QDNA 3HYMB 4FULA 1Z3YA 2EILE 3UUXA 3S7JA 1H6OA 4I1MA 4A3TA 3NB2A 2HR2A 2CG2A 3FTYA 4EBAA 3FU3A 1TR4A 4JXTA 3T5VA 3UIPC 2IF4A 2XEEA 5D2MC 1DC2A 4WWNA 1YMPA 1HFAA 4U95D 5M72A 2XPIA 2L0IA 1KZPA 2AXZA 2H6GA 1HX8A 3EIJA 3UMVA 1BI8B 1IQUA 3IHYA 1V54E 4LNBA 1TJFA 1SVXA 4JB8P 3UM1A 3SFZA 4XI0A 4I1OB 2LXLA 5FQ4A 2AXVA 2A5EA 3SHFA 3MGBA 3L54A 3B7BA 4FJYA 4GZDA 5KNHD 3CR3A 3ASDA 1U3CA 4DLQA 3C3OA 1NZNA 2IY0C 4L9PA 3G2VA 3JXIA 2WXOA 1WAO1 3ASOE 2ZXWE 3NZSA 3OAWA 1Y6IA 2FBNA 4KMOA 5KJLA 3PZ1A 4GA1A 2AW6A 5G04C 2Y1LE 2KZTA 2EQXA 2VTBB 2XCCA 4H7XA 3LXUX 2OCCE 4HVBA 1HO8A 5FZRA 4G8KA 3QKYA 1K1AA 2LUHA 1HE8A 4LG6A 4GB9A 5D0QD 4G26A 2VGXA 4PH4B 4WNGA 1ZBPA 2A4ZA 4FLHA 4U8VD 2WXMA 3CV0A 1K3ZD 3DPDA 3QK0A 5AQ9A 3ZYKA 3EU5A 1OCCE 4O6FA 3AG4E 1K1BA 3ZUVB 3LY8A 2XCBA 4J8YA 4GPMA 2P9PG 4XIFA 4A63B 4EBAG 1FT1A 4M7CA 1ELKA 4ANWA 5FQ8A 4F3VA 1JPLA 3ZIMA 3ZRHA 4F7AA 1OWPA 3DXKG 1TEZA 3FTXA 5ITZF 3FH5A 2VSYA 4YDOA 4N3AA 4HLEA 3ESKA 3FUIA 3C5RA 4OVUA 4N3CA 5FQ7A 3L82A 3B7SA 3WG7E 5FINA 3DEOA 4KZ0A 4UQZA 5BV0A 3B7UX 4OYSA 4UQYA 5IY5E 3HRAA 3S2AA 5G55A 3FWVA 1NA0A 4UQXA 2I1KA 1FT2A 5H7PA 1TYQG 3FU0A 4Z68A 1N4PA 4XZ4A 3X2QE 1W3BA 3UPVA 4J6IA 2OVFA 4GMJA 3ZNGA 4C48B 2KC7A 4F6RD 1Z5SC 1D8DA 3PE3A 4BSZB 5ENSD 4DJAA 3D9OA 4ILGA 1LF8A 2WVIA 2C0LA 4U04A 3TL5A 2WXPA 1EDUA 5EIDA 3RAUA 3TGOA 5DIZA 2QYJA 4GA2A 2A5UA 4KVOA 2VGYA 3CHRA 1U3DA 4UUCA 3JXJA 1O5MA 2VQ2A 2KATA 2J09A 4I6GA 5FWQA 4F53A 4AJWA 2WM9A 4JD2G 4YVQC 3PUKA 4GTQA 4N3BA 5B1BE 4Y6CA 3SBSA 3O4ZA 1EPUA 4MKTA 4PS8A 4JZYA 4K03A 3NQPA 4G2VA 4GPKA 4KXKB 1OXJA 2WQ6A 3FTVA 3AAAC 2NYJA 3L22A 2CG3A 2R05A 4DLOA 5BXOA 5KNGA 3FUHA 2WMNA 4X8QA 4GTSA 2WXQA 1O1TA 5JA4D 4A55A 1SW6A 4PS7A 3CQCB 1FVHA 1ZB1A 3DPYA 1H0AA 4L1BA 4N5CA 3OXLA 5FZSA 3UIOC 3TWQA 1RW2A 3SFYA 5EN5D 5A6CA 4JEHA 4RQIA 1Q2ZA 1HXIA 1EYHA 4DX6D 2MOWA 4DX7D 2JEKA 5CEDB 2I2OA 4CYMD 3EDTB 1EF1C 4WWOA 3UXGA 3JUIA 4ANXA 5A23A 4GTPA 1A5EA 5AJDA 1WDYA 3PE4A 5CBNA 1BLXB 4U96D 4AXHA 4U0ZA 4FU3A 3BQOA 3CLJA 1MX6A 4OVVA 2WMOA 2EIKE 4HORA 4FHKA 2F0YA 2HYZA 3LVQE 3ABME 3PUJA 4JW1A 3SO8A 4AEZC 4J8FA 3PZ2A 3ESLA 4J0UA 4ILIA 5EIBE 4JA9A 4JHJA 4CT4A 2I9CA 2XPZA 5FZQA 4Q94A 2LSUA 4UWFA 2GRLA 2PZIA 3CEQA 4CEMA 3Q78A 2XGSA 2X3MA 2C2LA 3UM2A 1H2VC 5JJ6A 4U8HA 5FTPA 2BKGA 3PNTB 3F6QA 1YA0A 3KS2A 3RK6A 1TN6A 5BXUA 3FUMA 2P9IG 3LY7A 2CHZA 4G8LA 2LO6A 4H7YA 4GYYA 1AWCB 5ENRD 1NFIE 1V55E 3ONLA 1RZ4A 3CHPA 4TV3A 5E75A 4C9BB 3OXFA 2E0IA 3MX3A 3CKCA 3Q73A 3S7FA 2GRRB 2AWIA 5EKQD 1DCQA 3AG1E 3MKRA 3R9MA 5C1DA 3APCA 3FULA 3FTSA 3C3RA 3CVQA 3AU4A 4WNFA 2IONA 2XHEA 2XS1A 3LS8A 4I1AA 4GZ3A 1DVPA 1MQSA 4GTRA 4CT0A 2R2LA 2F8YA 3ZYQA 1UN8A 4YNDA 4QFVA 2WXJA 3VLDA 1A17A 2LNIA 5ENNA 3MA5A 2C0MA 4HOQA 2IEJA 2NSZA 4UI9K 4IN3B 2P9KG 4TRQA 1S64A 5KJKA 1DCEA 1JWGA 4U8YD 4EZKA 1MJ0A 3I4GA 3QC1A 1TNYA 2I6HA 1FVFA 5JHAA 3QB2A 1IKND 2PM7A 3C72A 3E4BA 2WXIA 2AVPA 3L17A 3QWWA 5G05J 3VLEA 4B89A 4ABNA 4B8AA 4LCTA 2M63A 3QNKA 1NI1A 5B3SE 2L6JA 3PRZA 4HLLA 3TWWA 4J7WA 3TG5A 3EU9A 3EHNA 3GW4A 2HE0A 2H6HA 4KBQA 4APOA 3IKOB 1E8XA 3W9FA 1H19A 2IO3C 4WNDA 5HQ8A 5FIOA 2IOLA 2RFAA 2Y69E 1HG5A 4YDEA 4O60A 1LD7A 2DIWA 4IULA 4XKCA 2WXFA 1H6KA 1S70B 3NZUA 5KJMA 4HI9A 3NF1A 1G3NB 2X6IA 3UM3A 2WPVA 4AOFA 3Q47B 2XRYA 4HOTA 2HM8A 3CKBA 2VSOE 2JLBA 2DBAA 2ZISA 4DUIA 4GCNA 3L9TA 4G11A 3CVYA 1MYOA 2I1JA 4PS3A 3CVUA 3FUKA 3ML8A 1D9SA 3VLFA 4GYWA 2CFZA 4CZ2D 2IOSA 1OUVA 1X5BA 1XGWA 4G24A 3QJZA 4U63A 3QAQA 1OCZE 4G25A 1HU3A 3T5XA 2AJAA 2J8SD 3CK9A 2CHXA 3EIQC 4J8SA 5BW8C 3D9NA 5D66A 5CCMA 1OCOE 2L6BA 3UM0A 4URKA 2CHWA 4UWKA 3SNXA 1O1RA 1OWLA 3TXMA 4XX5A 2H6IA 4DI4A 3HIZA 3CQGB 3R7RA 4FADA 4FHJA 3LCAA 4U07A 4CDNA 4OAUC 5KJNA 4WWPA 2P9NG 1OWNA 4BX9A 1JCQA 1TNBA 4K0RA 5BV1A 3ASFA 2NXPA 3ULQA 5HI7A 1PC2A 4IYPA 3FUEA 3U66A 3DXMG 1BPOA 5ARFA 3J5PA 3PVLA 4N5QA 4BT8A 4QQIA 3DSXA 2YNQA 3G2TA 1JCRA 3ABLE 1LD8A 2VTBA 3UINC 2P9LG 2P9UG 4CRWA 4EZLA 3DBSA 4JEUA 3ZVVA 4I2ZA 4HXIA 3CVPA 1N52A 3FU6A 4AV7A 4ACKA 4C0MA 4DPRA 1UOHA 3ISMC 3QWVA 3B7TA 5T4YA 2XPYA 3T9KA 1N4SA 2ETAA 3KSQA 2GW1A 5LX8A 4ACLA 2L9BA 3BEEA 3NBNB 3W9GA 3FUFA 3DSTA 4HNAD 1WY6A 4FC8A 3URZA 4NACA 1YCSB 4HI8A 4XE0A 3CSTA 2IQCA 2LAIA 3DSUA 4GTMA 2BUGA 5AQ7A 4DX5D 2H6FA 3I4RB 3D9IA 4G1TA 4I17A 3V2OA 3LEWA 4WAFA 3FTUA 3Q79A 1TN7A 2ZGGA 5AYWD 4GTTA 5HKPA 5G04J 3SBTB 3SD5A 3Q9UC 4GZ5A 2R59A 2WXHA 3SZ7A 2WQ7A 4K5BA 1Y8MA 1UG3A 4PDXA 3FTZA 4BY6A 1N11A 3AG2E 3HXCA 1WM5A 3E33A 4BX8A 1MX2A 3DEPA 1FCHA 5T8IA 3ZXSA 5KWDA 3ZW3A 4K5AB 3D9KA 1Z6TA 5BT1A 1MX4A 4J8EA 2V4HC 3G2UA 4BSXA 1UN9A 4I2WA 3JQ1A 1BU9A 4HRNA 2LXMA 2LSVA 4W9RA 4ATGA 2DVWA 5EYLA 3FEYA 3G2WA 1E8WA 5LCWJ 3RRUA 2J4DA 5AENA 5J90A 2J9QA 4J8DA 2R17C 4L2LA 2RD0A 4KVMA 4JPSA 3JUEA 2V0PA 3IHVA 2ONDA 4HBDA 2L0TB 3FY4A 3IXEA 4L23A 3HXDA 4BFRA 3GZ1A 5J08A 3PZ4A 3CSFA 3D9PA 1INZA 1N4RA 2Y4TA 4RG9A 4DRXE 3V2XA 1Z3XA 3L13A 3FDHA 4BETA 3CVNA 2FF4A 3HXFA 3SF4A 1N94A 3JYSA 4FJZA 2J07A 2FEZA 1JWFA 5CERB 1S63A 5G05C 4I6EA 3ZPJA 1HZ4A 2X38A 1K8KG 3Q9NC 2PQNA 1SA4A 1NA3A 2FULA 3TWXA 3Q15A 3E32A 2IJGX 4HOUA 4AIFA 1XNFA 4CCAA 2X6KA 3PH0C 2X6HA 4I43A 3SFXA 3HVEB 1PAQA 3ZHEB 2PQRA 5EILA 2XGOA 3AS5A 5KBAA 4BTAA 2P9SG 1TJCA 3DSWA 3UT7A 3IBEA 2Y3AA 4UWGA 3D9MA 1KT1A 2QFCA 5DBKA 3N71A 4WNEA 2ZU6B 4BEPA 4EQFA 2V5FA 3HXBA 3KSLA 5JJ7A 3JQ0A 2J4BA 1H2UA 4UWLA 5ANLA 1MHQA 4GMRA 2KM4A 2XZTG 2XENA 1IHBA 2P58C 2KCKA 1B89A 3ULYA 3FTWA 1TNZA 4BWRA 2Y4UA 2VJ8A 4U0SA 5CEAA 3ASNE 4E85A 4UI9J 4N39A 3BG0B 2VGEA 1L5JA 2GGFA 2VYIA 1D8EA 4KYOB 2R5SA 3LKUA 2QC9A 4FP7A 5HRYA 1UJKA 3PEUB 1JUQA 3HVEA 3KEZA 2VSNA 3ZHEA 2BF0X 3HG0D 2WXGA 4JHKA 4DK5A 1SZAA 1TN8A 3PZ3A 3RKVA 4OAVB 4AY5A 3LJNA 4TUUA 3FUJA 2OOEA 1IHGA 4RVBA 3E37A 4Y6WA 3SI5A 4BESA 2B0OE 4JHRA 4BTBA 3FUNA 4NIKA 1WG0A 2KBXA 2GRPB 2Y0BG 4IRUA 2FO7A 1NP7A 1E90A 5ENPD 2WXLA 4B0ZA 1E7VA 5AQAA 3EHQA 3MZLB 3DWLG 1E8YA 3T8MA 3E34A 3ZYLA 3LJ3A 1QYMA 3CK7A 4CGWA 2XEHA 4GCOA 4EHMA 3FEXA 2XS8A 1QBQA 3AJIA 3ZU7B 2BKKB 3KAEA 3MV3B 4ANUA 5T3RA 1KZOA 3ONKA 3Q75A 3FUDA 4MLPA 4GU5A 5AJLA 3Q5MA 4HOSA 1HF8A 2KZTB
chains in the Genus database with same CATH topology
3CVLA 4A1GA 3L22A 2NC9A 4GZCA 4KZCA 1HG2A 2CG3A 3Q49B 4JVSA 4DLOA 2VTBA 3TG4A 1QNFA 3FUHA 2WMNA 3QOUA 3VTXA 3PS6A 3B7RL 2WXQA 3ASHA 5EX3A 4I9EA 2PM6A 1H2TC 4CRWA 3FFLA 3DBSA 2VGXB 4A55A 1SQMA 2XGMA 4EZLA 4PS7A 3UT4A 3CQCB 4JEUA 3ZVVA 3OXGA 4I2ZA 5D0OD 2AXUA 1FVHA 3CVPA 1N52A 4HXIA 4I6JA 3FU6A 3G2SA 1E8ZA 1H0AA 4L1BA 4N5CA 4AV7A 4Q96A 4ACKA 1E96B 2V4LA 3OXLA 5FZSA 5ANRA 4JL0A 3L16A 4JA7A 4C0MA 4DPRA 4B94A 3MYVA 3I5PA 3QWVA 3B7TA 3TXNA 4FLBA 4BT9A 5T4YA 2XPYA 4F1SA 4AY6A 3PREA 5A6CA 2GW1A 4JEHA 4NQ0A 5LX8A 4ACLA 1ELWA 3ML9A 2L9BA 3RJVA 2QY7A 3BEEA 3BG1B 1ELRA 3FUFA 1HXIA 2CFUA 1EYHA 1WY6A 2MOWA 4FC8A 3URZA 2X6FA 2UWJG 2WXKA 4NACA 2JEKA 2WXRA 4M3OA 3FH8A 3QWPA 2I2OA 4XE0A 5A7DB 4A3VA 3CSTA 2IQCA 3EDTB 1EF1C 3FU5A 2LAIA 4WWOA 3JUIA 3APFA 5C2YA 1KLXA 4LUNU 2BUGA 4ANXA 5A23A 3U64A 1QZ2A 3TAXA 3PEVB 3OTNA 5AJDA 4N2QA 3I4RB 3D9IA 4Q69A 3PE4A 4G1TA 4AXHA 3UT8A 3CHOA 4I17A 4U0ZA 4FU3A 2GRMA 3LEWA 4WAFA 3FTUA 4LERA 3CLJA 4PUCA 1ZU2A 3U9WA 4A1SA 3P1UA 3RRMB 3CHSA 3CIAA 4OVVA 2WMOA 3S7BA 4HORA 4FHKA 3K9IA 4P29A 3AU5A 2HYZA 3LVQE 5G04J 5CMYA 4NURA 3ASGA 5AYWD 3O48A 3SBTB 1E7UA 3SD5A 3PUJA 4LEUA 3CHQA 4JW1A 4GZ5A 3LVRE 2R59A 2WXHA 4J8FA 3FHEA 3TJPA 3FH7A 4AEZC 3ESLA 3SZ7A 2WQ7A 4J0UA 2J08A 4UWHA 3RIBA 3CVWA 1Y8MA 1UG3A 4I9CA 4PDXA 3CVVA 3FTZA 4ILIA 4N2SA 4JA9A 3QDNA 4JHJA 3HYMB 4CT4A 2I9CA 2XPZA 5FZQA 4Q94A 4FULA 4BY6A 1Z3YA 2LSUA 1UW4B 4UWFA 5KCMA 3UUXA 4JC8A 3S7JA 2GRLA 2PZIA 4I1MA 2OV8A 3CEQA 4A3TA 1WM5A 4CEMA 2HR2A 2CG2A 4BX8A 2XGSA 2X3MA 1GW6A 3FTYA 2YHCA 2C2LA 1FCHA 3FU3A 4EBAA 5T8IA 1H2VC 3EJNA 2X6JA 5JJ6A 3ZXSA 3AS4A 3ZW3A 4JXTA 4U8HA 3T5VA 5FTPA 2IF4A 4D10C 3D9KA 4GMLA 1Z6TA 5BT1A 3PNTB 4EECA 4WWNA 3PZDA 3PDNA 4J8EA 1HFAA 3G2UA 5M72A 2J49A 4RG6A 4BSXA 1UN9A 2XPIA 2L0IA 4I2WA 3RRNB 1YA0A 3JQ1A 3KS2A 3RK6A 2LSVA 4W9RA 2AXZA 4FA6A 5LCWC 5JJTA 3FUMA 4ATGA 3LY7A 3MCXA 3WXXA 2CHZA 2LO6A 3FEYA 3G2WA 4H7YA 4GYYA 1E8WA 1HX8A 3EIJA 3UMVA 4R7LA 1IQUA 3IHYA 5LCWJ 3RRUA 4GA0A 2J4DA 2KCVA 3ONLA 1TJFA 3CHPA 4TV3A 5E75A 5AENA 3GYZA 3SFZA 4C9BB 3OXFA 2E0IA 5J90A 2VTBB 2J9QA 3MX3A 4XI0A 5ARGA 3CKCA 4AVXA 3S7FA 4J8DA 2R17C 4I1OB 4L2LA 2RD0A 4G23A 2AWIA 3MKQB 5EKQD 2WB2A 3MKRA 4GYOA 4KVMA 5FQ4A 2AXVA 4JPSA 3MJWA 3S7DA 3SGHA 5C1DA 2PL2A 3APCA 3FULA 3FTSA 5G2NA 3CVQA 3SHFA 2BTDA 2V0PA 3MGBA 3IHVA 3AU4A 5BPPA 4WNFA 2IONA 2ONDA 2XHEA 3L54A 4ME2A 3AS8A 3RU0A 2XRZA 3LS8A 4FJYA 4GZDA 4I1AA 4GZ3A 3CR3A 4E6HA 2L0TB 2YHEA 1DVPA 1MQSA 3ASDA 1U3CA 3FY4A 3HHMA 4CT0A 2FI7A 2OVBA 3ZEFA 4DLQA 3ZYQA 3L6AA 4L23A 5FQ6A 1UN8A 4YNDA 4BFRA 3GZ1A 3QARA 4RSYA 3VTYA 5J08A 4YVOA 4QFVA 4KT6B 2WXJA 3CSFA 3VLDA 1A17A 3D9PA 2LNIA 5ENNA 2YINA 1NZNA 2Y4TA 1INZA 4RG9A 3G2VA 5EX0A 3MA5A 1OWOA 3LY9A 5CCLA 3RO2A 1Z3XA 2C0MA 2WXOA 3L13A 1WAO1 2NSZA 3FDHA 4HOQA 4UI9K 4IN3B 3CVNA 2FF4A 3L08A 4TRQA 3GZSA 4XKBA 3SF4A 4DI3A 3JYSA 2LAHA 4FJZA 4AM9A 2J07A 5KJKA 1JWGA 3NZSA 3OAWA 3UX4A 4EZKA 1Y6IA 4U0UA 2FBNA 4KMOA 2FEZA 3RO3A 4CDMA 5KJLA 3I4GA 1JWFA 3QC1A 4GA1A 2I6HA 1FVFA 3R7QA 5G05C 4NRHB 2AW6A 5JHAA 5G04C 3QB2A 4I6EA 2PM7A 3ZPJA 1HZ4A 2X38A 3E4BA 2WXIA 5EDSA 2KZTA 2PQNA 1NA3A 1PY1A 2AVPA 2EQXA 3L17A 2FULA 3APDA 3QWWA 2XCCA 5G05J 3VLEA 4B89A 4H7XA 1IYGA 3Q15A 3R9AB 2RG8A 4ABNA 2IJGX 3LXUX 4GZ6A 4HVBA 1HO8A 4HOUA 5FZRA 4AIFA 1XNFA 4B8CB 4B8AA 4CCAA 4CGVA 4LCTA 2M63A 2X6KA 3PH0C 3QKYA 1HE8A 2X6HA 4GB9A 4I43A 5D0QD 3QNKA 2VGXA 4G26A 4PH4B 3CK8A 4WNGA 1ZBPA 2L6JA 2A4ZA 2IU1A 3PRZA 3CGHA 4FLHA 2UY1B 3MKQA 3HVEB 2WXMA 1N54A 5FJYA 3CV0A 5LFAA 1PAQA 1S0PA 3ZHEB 2PQRA 3TG5A 3D9JA 2XEVA 3DPDA 3QK0A 4MS6A 3EHNA 4MRUA 2XGOA 3HDXA 2XQ0A 3GW4A 3AS5A 3LPZA 4BTAA 3IV0A 3ZYKA 1KT0A 1TJCA 5CHEE 1IQRA 3UT7A 4KBQA 5E76A 3IBEA 2Y3AA 4O6FA 4UWGA 1VDYA 3LY8A 3D9MA 4APOA 3IKOB 1E8XA 1QQEA 4HS2A 3LYAA 1H19A 1KT1A 2QFCA 2XCBA 5DBKA 4L2YA 1HH8A 3N71A 4WNEA 4WNDA 5HQ8A 2IOLA 2E2EA 2ZU6B 3D3MA 4EQFA 2V5FA 2DCPA 1HG5A 1OWMA 4XIFA 3MEKA 5JJ7A 4EBAG 3JQ0A 4V3IA 1ELKA 4ANWA 5FQ8A 2J4BA 1H2UA 4UWLA 5ANLA 5CMWA 2DIWA 1MHQA 4IULA 4F3VA 1JPLA 2KM4A 4XKCA 3ZIMA 2WXFA 3ZYMA 4HFGA 3ZRHA 4F7AA 1H6KA 3NZUA 1OWPA 2WXNA 4GAAA 1TEZA 3FTXA 5KJMA 2P58C 4L7TA 4UI9C 3FH5A 2KCKA 3NF1A 1B89A 2VSYA 3FTWA 2X6IA 2WPVA 3MV2B 4N3AA 4HLEA 4BWRA 2Y4UA 2VJ8A 4U0SA 4AOFA 3ESKA 2IFUA 3FUIA 2XRYA 3Q47B 4HOTA 4E85A 4UI9J 1UJJA 3ZGQA 4OVUA 2HM8A 4N39A 3CKBA 4N3CA 2VSOE 3BG0B 1L5JA 2JLBA 5FQ7A 2GGFA 2VYIA 4KYOB 2DBAA 2R5SA 3LKUA 3B7SA 4APFA 3P2BA 4GCNA 4FP7A 4G11A 3CVYA 2I1JA 4PS3A 1UJKA 4KZ0A 4UQZA 3PEUB 5BV0A 2UY1A 3B7UX 4OYSA 1JUQA 3FP3A 3HVEA 4UQYA 3KEZA 3B13A 3CVUA 2VSNA 3FUKA 3ML8A 3ZHEA 1P5QA 3S2AA 4ANVA 2BF0X 5G55A 3VLFA 2WXGA 5FT9A 3FWVA 1NA0A 4GYWA 2HO1A 4JHKA 2MRIA 2CFZA 3KD7A 4UQXA 4DK5A 1SZAA 2I1KA 1OUVA 2IOSA 3GZ2A 4EPZA 4LRZA 1X5BA 3RKVA 3FU0A 1XGWA 3CHMA 2ILRA 3C98A 4AY5A 4G24A 5BUZA 4XZ4A 3QJZA 4U63A 1W3BA 4TUUA 3UPVA 3QAQA 4J6IA 2OVFA 3FUJA 2V8SE 4G25A 4WUYA 3FTVA 1HU3A 4GMJA 2OOEA 4XI9A 3T5XA 1IHGA 4RVBA 4Y6WA 3SI5A 2KC7A 3CK9A 3JCKC 3D9LA 3EHMA 2CHXA 3PE3A 4JHRA 3IEGA 4DJAA 4BTBA 3D9OA 4ILGA 1LF8A 3EIQC 2WVIA 2C0LA 4J8SA 3FUNA 5BW8C 3PNLB 2Q7FA 2VSXE 4U04A 3TL5A 3D9NA 2WXPA 3Q4AB 3UQ3A 1EDUA 4ILHB 3U3WA 5CCMA 3ENEA 4IRUA 3TGOA 2KCLA 2WQHA 4AP2A 5DIZA 4URKA 2FO7A 2CHWA 1NP7A 4UWKA 1E90A 2A5UA 2WXLA 4GA2A 4KVOA 3SNXA 4B0ZA 2VGYA 1E7VA 1OWLA 4C0EA 3TXMA 3CHRA 4XX5A 3MZLB 1U3DA 4DI4A 1E8YA 3ZFWA 4EZJA 1HS6A 3HIZA 2MHKA 3CQGB 3T8MA 3ZYLA 3LJ3A 3R7RA 2VQ2A 1SZ9A 5LOZA 2KATA 3CK7A 4FADA 2J09A 4CGWA 4FHJA 3LCAA 4U07A 4CDNA 1DNPA 5KJNA 4WWPA 5LP0A 4GCOA 4I6GA 3I3NA 5FWQA 4F53A 1OWNA 3U4TA 4AJWA 5JHBA 4BX9A 3FEXA 3CVXA 5AIJA 2WM9A 4YVQC 3KAEA 4K0RA 3MV3B 3PUKA 4N3BA 4ANUA 5BV1A 3ASFA 2NXPA 3ULQA 5HI7A 4Y6CA 3SBSA 5BNWA 5T3RA 3O4ZA 3ZN3A 1PC2A 4IYPA 1EPUA 3FUEA 3U66A 4MKTA 4PS8A 4JZYA 3ONKA 1BPOA 5ARFA 4K03A 3NQPA 3PVLA 3FUDA 4G2VA 2YQ8A 4GU5A 4MLPA 5AJLA 3LDZA 4GPKA 4BT8A 3Q5MA 4KXKB 4CDRA 4HOSA 1HF8A 2YNQA 2WQ6A 3G2TA 2KZTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVL A;  2NC9 A;  3Q49 B;  3TG4 A;  3QOU A;  3VTX A;  3ASH A;  5EX3 A;  4I9E A;  3FFL A;  2VGX B;  2XGM A;  3OXG A;  4I2Z A;  5D0O D;  3CVP A;  4N5C A;  1E96 B;  3OXL A;  5FZS A;  4JL0 A;  4JA7 A;  4B94 A;  3QWV A;  4BT9 A;  4AY6 A;  5A6C A;  2GW1 A;  4NQ0 A;  1ELW A;  3RJV A;  3BEE A;  1ELR A;  1HXI A;  3URZ A;  2UWJ G;  3QWP A;  5A7D B;  3EDT B;  1KLX A;  2BUG A;  1QZ2 A;  3TAX A;  4N2Q A;  3PE4 A;  4G1T A;  4I17 A;  4U0Z A;  1ZU2 A;  4A1S A;  3S7B A;  4HOR A;  3K9I A;  2HYZ A;  5AYW D;  5G04 J;  3ASG A;  3O48 A;  4LEU A;  4GZ5 A;  4J8F A;  3SZ7 A;  4J0U A;  3RIB A;  1Y8M A;  4I9C A;  4N2S A;  4JA9 A;  3QDN A;  3HYM B;  5FZQ A;  2LSU A;  3UUX A;  3S7J A;  2PZI A;  3CEQ A;  1WM5 A;  2HR2 A;  2XGS A;  2YHC A;  2C2L A;  1FCH A;  5JJ6 A;  3AS4 A;  5FTP A;  2IF4 A;  5BT1 A;  3PDN A;  4J8E A;  5M72 A;  4RG6 A;  2XPI A;  4I2W A;  1YA0 A;  3KS2 A;  2LSV A;  4W9R A;  5LCW C;  5JJT A;  3LY7 A;  3WXX A;  4H7Y A;  4GYY A;  5LCW J;  4GA0 A;  2KCV A;  3GYZ A;  3OXF A;  2J9Q A;  4XI0 A;  5ARG A;  3CKC A;  3S7F A;  4J8D A;  4G23 A;  5EKQ D;  3MKR A;  4GYO A;  3S7D A;  5C1D A;  2PL2 A;  3CVQ A;  4WNF A;  2OND A;  4ME2 A;  3AS8 A;  3RU0 A;  4I1A A;  4GZ3 A;  3ASD A;  2FI7 A;  4YND A;  3GZ1 A;  3VTY A;  4YVO A;  1A17 A;  2LNI A;  1NZN A;  2Y4T A;  4RG9 A;  5EX0 A;  3MA5 A;  3LY9 A;  5CCL A;  3RO2 A;  2C0M A;  4HOQ A;  1WAO 1;  4UI9 K;  4IN3 B;  3CVN A;  2FF4 A;  3SF4 A;  3JYS A;  4AM9 A;  5KJK A;  4U0U A;  2FBN A;  2FEZ A;  3RO3 A;  5KJL A;  4GA1 A;  2I6H A;  5G05 C;  4NRH B;  5G04 C;  3ZPJ A;  1HZ4 A;  3E4B A;  2PQN A;  1NA3 A;  2AVP A;  3QWW A;  5G05 J;  2XCC A;  1IYG A;  4H7X A;  3Q15 A;  3R9A B;  4ABN A;  4GZ6 A;  4HOU A;  5FZR A;  4AIF A;  1XNF A;  4CGV A;  3QKY A;  5D0Q D;  4G26 A;  2VGX A;  3CK8 A;  4WNG A;  1ZBP A;  2L6J A;  2UY1 B;  5FJY A;  3CV0 A;  3ZHE B;  2PQR A;  3TG5 A;  2XEV A;  2XGO A;  3GW4 A;  3AS5 A;  3LPZ A;  4BTA A;  1KT0 A;  1TJC A;  5CHE E;  4KBQ A;  4O6F A;  3LY8 A;  4APO A;  1QQE A;  3LYA A;  1KT1 A;  2QFC A;  2XCB A;  5DBK A;  1HH8 A;  3N71 A;  4WNE A;  4WND A;  5HQ8 A;  2E2E A;  4EQF A;  2V5F A;  4XIF A;  3MEK A;  5JJ7 A;  4F3V A;  5KJM A;  2P58 C;  4UI9 C;  2KCK A;  3NF1 A;  1B89 A;  2VSY A;  2WPV A;  3MV2 B;  4N3A A;  4BWR A;  2Y4U A;  4U0S A;  3ESK A;  2IFU A;  3Q47 B;  4HOT A;  4UI9 J;  3ZGQ A;  4N39 A;  3CKB A;  4N3C A;  2JLB A;  2VYI A;  4KYO B;  2DBA A;  2R5S A;  3LKU A;  4GCN A;  4UQZ A;  2UY1 A;  4UQY A;  3FP3 A;  2VSN A;  3ZHE A;  1P5Q A;  5FT9 A;  3FWV A;  1NA0 A;  4GYW A;  2HO1 A;  3KD7 A;  4UQX A;  1OUV A;  3GZ2 A;  3RKV A;  4AY5 A;  4G24 A;  1W3B A;  3UPV A;  4G25 A;  4WUY A;  2OOE A;  4XI9 A;  1IHG A;  4Y6W A;  2KC7 A;  3CK9 A;  3PE3 A;  4JHR A;  3IEG A;  4BTB A;  2C0L A;  5BW8 C;  2Q7F A;  4U04 A;  3Q4A B;  3UQ3 A;  3U3W A;  5CCM A;  3TGO A;  2KCL A;  2WQH A;  5DIZ A;  2FO7 A;  4GA2 A;  2VGY A;  3ZFW A;  2MHK A;  2VQ2 A;  2KAT A;  3CK7 A;  4CGW A;  4U07 A;  3LCA A;  5KJN A;  4GCO A;  3U4T A;  4YVQ C;  3KAE A;  3MV3 B;  4N3B A;  3ASF A;  3ULQ A;  5HI7 A;  4Y6C A;  5BNW A;  3ZN3 A;  1PC2 A;  5ARF A;  4G2V A;  2YQ8 A;  4GPK A;  4BT8 A;  3Q5M A;  4KXK B;  4CDR A;  4HOS A; 
#chains in the Genus database with same CATH topology
 3CVL A;  4A1G A;  5AAO A;  4GZC A;  2BED A;  4O1O A;  3Q49 B;  4JVS A;  1IXV A;  3BUA A;  3PS6 A;  3B7R L;  3ASH A;  4I9E A;  2PM6 A;  3FFL A;  2VGX B;  2XGM A;  4MBG A;  2IO2 C;  3OXG A;  5D0O D;  4I6J A;  1H6P A;  1E8Z A;  3E30 A;  4Q96 A;  4B94 A;  1N9A A;  2DZN A;  3TXN A;  4BT9 A;  3HXE A;  3TWS A;  3EHR A;  4F1S A;  3PRE A;  1X81 A;  2QY7 A;  3BG1 B;  1ELR A;  1O1S A;  1N0Q A;  2EIN E;  2UWJ G;  2WXR A;  3ZKJ A;  4A3V A;  3FU5 A;  5CEC B;  3APF A;  5C2Y A;  4LUN U;  3TAX A;  3OTN A;  4N2Q A;  4Q69 A;  5ENQ D;  4DX1 A;  2R03 A;  3C3Q A;  2RKK A;  3RRM B;  3CHS A;  5ENT D;  4HRL A;  3K9I A;  5CMY A;  4NUR A;  3ASG A;  3O48 A;  3NOG D;  4LEU A;  2KXP C;  3LVR E;  3TWU A;  3TJP A;  3FHE A;  3FH7 A;  3TWR A;  4ZFH A;  3CVW A;  1BI7 B;  3RIB A;  3CVV A;  4I9C A;  3UTM A;  5ENO D;  1UW4 B;  5KCM A;  4JC8 A;  4HQD A;  2QYU A;  2OV8 A;  2ZIR A;  1GW6 A;  2YHC A;  3EJN A;  2X6J A;  3AS4 A;  3B95 A;  4D10 C;  4GML A;  4EEC A;  3PZD A;  3PDN A;  2J49 A;  2GRO B;  4RG6 A;  3V31 A;  2GRQ B;  3RRN B;  3V30 A;  2DYS E;  4FA6 A;  5LCW C;  5JJT A;  3MCX A;  3WXX A;  4R7L A;  3TWV A;  4GA0 A;  2KCV A;  1FPP A;  3GYZ A;  5ARG A;  4AVX A;  4G23 A;  3MKQ B;  2WB2 A;  4GYO A;  3S7D A;  3SGH A;  3MJW A;  3ABK E;  2PL2 A;  1N4Q A;  5G2N A;  2BTD A;  4ME2 A;  3AS8 A;  3RU0 A;  2XRZ A;  3EUV A;  4E6H A;  2YHE A;  4ZHB A;  1N0R A;  4ATZ D;  2ZGD A;  3HHM A;  2FI7 A;  2OVB A;  3ZEF A;  3RSE G;  3L6A A;  5FQ6 A;  4HB5 A;  4RSY A;  3QAR A;  3VTY A;  4YVO A;  4KT6 B;  3T8K A;  5EYP F;  2YIN A;  5EX0 A;  5JMN D;  5CCL A;  1OWO A;  3LY9 A;  4YDY A;  1YYH A;  3RO2 A;  4XKB A;  3L08 A;  3GZS A;  4DI3 A;  4AM9 A;  2LAH A;  3UX4 A;  3KEA A;  2B6C A;  5AN8 A;  2FO1 E;  4U0U A;  4YDW A;  3RO3 A;  4CDM A;  2QZA A;  1TNO A;  3R7Q A;  4NRH B;  3ULE G;  5AAR A;  5EDS A;  3AG3 E;  1PY1 A;  3Q7F A;  3APD A;  2R02 A;  1IYG A;  3R9A B;  2RG8 A;  4U7E B;  2GRN B;  4TXR A;  4GZ6 A;  3Q7A A;  4B8C B;  4CGV A;  3CK8 A;  2IU1 A;  3CGH A;  2UY1 B;  3MKQ A;  4K5C A;  2PNN A;  1N54 A;  5FJY A;  5LFA A;  1S0P A;  3D9J A;  2XEV A;  4MS6 A;  4MRU A;  3HDX A;  2XQ0 A;  2ETC A;  3LPZ A;  5B1A E;  3IV0 A;  1KT0 A;  5CHE E;  1IQR A;  5E76 A;  3DSV A;  1VDY A;  2P2C P;  4HRM B;  3UKR G;  1QQE A;  4HS2 A;  3LYA A;  3DSS A;  4L2Y A;  1HH8 A;  2E2E A;  3D3M A;  4GTV A;  2DCP A;  1OWM A;  3MEK A;  4O1P A;  4V3I A;  5CMW A;  2ETB A;  4LNG A;  2F8X K;  3ZYM A;  4DX2 A;  4HFG A;  2WXN A;  4GAA A;  4L7T A;  2DYR E;  4UI9 C;  3MV2 B;  2IFU A;  1UJJ A;  3ZGQ A;  2XZD G;  5HS0 A;  1OT8 A;  4APF A;  1U2V G;  3P2B A;  1BD8 A;  3SY2 A;  2OEV A;  2EIM E;  2UY1 A;  3FP3 A;  3B13 A;  3DRA A;  1P5Q A;  4ANV A;  4TUM A;  5FT9 A;  5CRU A;  2HO1 A;  2MRI A;  4LNU D;  3KD7 A;  4EPZ A;  3GZ2 A;  4LRZ A;  2V5Q C;  3CHM A;  2ILR A;  3C98 A;  5BUZ A;  3SQV A;  4WUY A;  2V8S E;  4XI9 A;  1OY3 D;  2EIJ E;  3JCK C;  3D9L A;  3EHM A;  3IEG A;  3PNL B;  2Q7F A;  2F37 A;  2VSX E;  1TNU A;  3Q4A B;  3UQ3 A;  4ILH B;  3U3W A;  3ENE A;  2KCL A;  2WQH A;  4AP2 A;  4C0E A;  2JAB A;  3ZFW A;  4EZJ A;  1HS6 A;  1AP7 A;  2MHK A;  4B93 B;  1SZ9 A;  5LOZ A;  3UI2 A;  3BU8 A;  1DNP A;  5LP0 A;  3I3N A;  5JHB A;  3U4T A;  3CVX A;  4LSZ E;  5AIJ A;  2MYO A;  4RLY A;  4GTO A;  3TWT A;  5BNW A;  3ZN3 A;  5CBO A;  2YQ8 A;  3LDZ A;  1LTX A;  4CDR A;  1KPS B;  2NC9 A;  3UKU G;  4KZC A;  1HG2 A;  3NAW A;  3TG4 A;  1QNF A;  4F1P A;  3QOU A;  3VTX A;  5AQB A;  5EX3 A;  1H2T C;  2DZO A;  1SQM A;  3UT4 A;  3V79 K;  1SA5 A;  5BPP A;  2AXU A;  2RFM A;  3G2S A;  1MZC A;  1E96 B;  2V4L A;  5ANR A;  3NOC D;  4JL0 A;  3L16 A;  4JA7 A;  4XEI G;  3MYV A;  3I5P A;  4FLB A;  4BER A;  4AY6 A;  4NQ0 A;  1ELW A;  3ML9 A;  3RJV A;  2CFU A;  2OEW A;  2X6F A;  2WXK A;  4M3O A;  3FH8 A;  3QWP A;  3D9H A;  1OCR E;  5A7D B;  3ZXP A;  1JCS A;  1N95 A;  1KLX A;  3U64 A;  1QZ2 A;  3PEV B;  4TXP A;  3UT8 A;  3CHO A;  2DWZ A;  2GRM A;  4LER A;  4PUC A;  1NL4 A;  1ZU2 A;  3U9W A;  3P1U A;  4A1S A;  3J5Q B;  3CIA A;  3S7B A;  4P29 A;  3AU5 A;  1E7U A;  3CHQ A;  5CRV A;  2J08 A;  4TXQ A;  4UWH A;  4N2S A;  3QDN A;  3HYM B;  4FUL A;  1Z3Y A;  2EIL E;  3UUX A;  3S7J A;  1H6O A;  4I1M A;  4A3T A;  3NB2 A;  2HR2 A;  2CG2 A;  3FTY A;  4EBA A;  3FU3 A;  1TR4 A;  4JXT A;  3T5V A;  3UIP C;  2IF4 A;  2XEE A;  5D2M C;  1DC2 A;  4WWN A;  1YMP A;  1HFA A;  4U95 D;  5M72 A;  2XPI A;  2L0I A;  1KZP A;  2AXZ A;  2H6G A;  1HX8 A;  3EIJ A;  3UMV A;  1BI8 B;  1IQU A;  3IHY A;  1V54 E;  4LNB A;  1TJF A;  1SVX A;  4JB8 P;  3UM1 A;  3SFZ A;  4XI0 A;  4I1O B;  2LXL A;  5FQ4 A;  2AXV A;  2A5E A;  3SHF A;  3MGB A;  3L54 A;  3B7B A;  4FJY A;  4GZD A;  5KNH D;  3CR3 A;  3ASD A;  1U3C A;  4DLQ A;  3C3O A;  1NZN A;  2IY0 C;  4L9P A;  3G2V A;  3JXI A;  2WXO A;  1WAO 1;  3ASO E;  2ZXW E;  3NZS A;  3OAW A;  1Y6I A;  2FBN A;  4KMO A;  5KJL A;  3PZ1 A;  4GA1 A;  2AW6 A;  5G04 C;  2Y1L E;  2KZT A;  2EQX A;  2VTB B;  2XCC A;  4H7X A;  3LXU X;  2OCC E;  4HVB A;  1HO8 A;  5FZR A;  4G8K A;  3QKY A;  1K1A A;  2LUH A;  1HE8 A;  4LG6 A;  4GB9 A;  5D0Q D;  4G26 A;  2VGX A;  4PH4 B;  4WNG A;  1ZBP A;  2A4Z A;  4FLH A;  4U8V D;  2WXM A;  3CV0 A;  1K3Z D;  3DPD A;  3QK0 A;  5AQ9 A;  3ZYK A;  3EU5 A;  1OCC E;  4O6F A;  3AG4 E;  1K1B A;  3ZUV B;  3LY8 A;  2XCB A;  4J8Y A;  4GPM A;  2P9P G;  4XIF A;  4A63 B;  4EBA G;  1FT1 A;  4M7C A;  1ELK A;  4ANW A;  5FQ8 A;  4F3V A;  1JPL A;  3ZIM A;  3ZRH A;  4F7A A;  1OWP A;  3DXK G;  1TEZ A;  3FTX A;  5ITZ F;  3FH5 A;  2VSY A;  4YDO A;  4N3A A;  4HLE A;  3ESK A;  3FUI A;  3C5R A;  4OVU A;  4N3C A;  5FQ7 A;  3L82 A;  3B7S A;  3WG7 E;  5FIN A;  3DEO A;  4KZ0 A;  4UQZ A;  5BV0 A;  3B7U X;  4OYS A;  4UQY A;  5IY5 E;  3HRA A;  3S2A A;  5G55 A;  3FWV A;  1NA0 A;  4UQX A;  2I1K A;  1FT2 A;  5H7P A;  1TYQ G;  3FU0 A;  4Z68 A;  1N4P A;  4XZ4 A;  3X2Q E;  1W3B A;  3UPV A;  4J6I A;  2OVF A;  4GMJ A;  3ZNG A;  4C48 B;  2KC7 A;  4F6R D;  1Z5S C;  1D8D A;  3PE3 A;  4BSZ B;  5ENS D;  4DJA A;  3D9O A;  4ILG A;  1LF8 A;  2WVI A;  2C0L A;  4U04 A;  3TL5 A;  2WXP A;  1EDU A;  5EID A;  3RAU A;  3TGO A;  5DIZ A;  2QYJ A;  4GA2 A;  2A5U A;  4KVO A;  2VGY A;  3CHR A;  1U3D A;  4UUC A;  3JXJ A;  1O5M A;  2VQ2 A;  2KAT A;  2J09 A;  4I6G A;  5FWQ A;  4F53 A;  4AJW A;  2WM9 A;  4JD2 G;  4YVQ C;  3PUK A;  4GTQ A;  4N3B A;  5B1B E;  4Y6C A;  3SBS A;  3O4Z A;  1EPU A;  4MKT A;  4PS8 A;  4JZY A;  4K03 A;  3NQP A;  4G2V A;  4GPK A;  4KXK B;  1OXJ A;  2WQ6 A;  3FTV A;  3AAA C;  2NYJ A;  3L22 A;  2CG3 A;  2R05 A;  4DLO A;  5BXO A;  5KNG A;  3FUH A;  2WMN A;  4X8Q A;  4GTS A;  2WXQ A;  1O1T A;  5JA4 D;  4A55 A;  1SW6 A;  4PS7 A;  3CQC B;  1FVH A;  1ZB1 A;  3DPY A;  1H0A A;  4L1B A;  4N5C A;  3OXL A;  5FZS A;  3UIO C;  3TWQ A;  1RW2 A;  3SFY A;  5EN5 D;  5A6C A;  4JEH A;  4RQI A;  1Q2Z A;  1HXI A;  1EYH A;  4DX6 D;  2MOW A;  4DX7 D;  2JEK A;  5CED B;  2I2O A;  4CYM D;  3EDT B;  1EF1 C;  4WWO A;  3UXG A;  3JUI A;  4ANX A;  5A23 A;  4GTP A;  1A5E A;  5AJD A;  1WDY A;  3PE4 A;  5CBN A;  1BLX B;  4U96 D;  4AXH A;  4U0Z A;  4FU3 A;  3BQO A;  3CLJ A;  1MX6 A;  4OVV A;  2WMO A;  2EIK E;  4HOR A;  4FHK A;  2F0Y A;  2HYZ A;  3LVQ E;  3ABM E;  3PUJ A;  4JW1 A;  3SO8 A;  4AEZ C;  4J8F A;  3PZ2 A;  3ESL A;  4J0U A;  4ILI A;  5EIB E;  4JA9 A;  4JHJ A;  4CT4 A;  2I9C A;  2XPZ A;  5FZQ A;  4Q94 A;  2LSU A;  4UWF A;  2GRL A;  2PZI A;  3CEQ A;  4CEM A;  3Q78 A;  2XGS A;  2X3M A;  2C2L A;  3UM2 A;  1H2V C;  5JJ6 A;  4U8H A;  5FTP A;  2BKG A;  3PNT B;  3F6Q A;  1YA0 A;  3KS2 A;  3RK6 A;  1TN6 A;  5BXU A;  3FUM A;  2P9I G;  3LY7 A;  2CHZ A;  4G8L A;  2LO6 A;  4H7Y A;  4GYY A;  1AWC B;  5ENR D;  1NFI E;  1V55 E;  3ONL A;  1RZ4 A;  3CHP A;  4TV3 A;  5E75 A;  4C9B B;  3OXF A;  2E0I A;  3MX3 A;  3CKC A;  3Q73 A;  3S7F A;  2GRR B;  2AWI A;  5EKQ D;  1DCQ A;  3AG1 E;  3MKR A;  3R9M A;  5C1D A;  3APC A;  3FUL A;  3FTS A;  3C3R A;  3CVQ A;  3AU4 A;  4WNF A;  2ION A;  2XHE A;  2XS1 A;  3LS8 A;  4I1A A;  4GZ3 A;  1DVP A;  1MQS A;  4GTR A;  4CT0 A;  2R2L A;  2F8Y A;  3ZYQ A;  1UN8 A;  4YND A;  4QFV A;  2WXJ A;  3VLD A;  1A17 A;  2LNI A;  5ENN A;  3MA5 A;  2C0M A;  4HOQ A;  2IEJ A;  2NSZ A;  4UI9 K;  4IN3 B;  2P9K G;  4TRQ A;  1S64 A;  5KJK A;  1DCE A;  1JWG A;  4U8Y D;  4EZK A;  1MJ0 A;  3I4G A;  3QC1 A;  1TNY A;  2I6H A;  1FVF A;  5JHA A;  3QB2 A;  1IKN D;  2PM7 A;  3C72 A;  3E4B A;  2WXI A;  2AVP A;  3L17 A;  3QWW A;  5G05 J;  3VLE A;  4B89 A;  4ABN A;  4B8A A;  4LCT A;  2M63 A;  3QNK A;  1NI1 A;  5B3S E;  2L6J A;  3PRZ A;  4HLL A;  3TWW A;  4J7W A;  3TG5 A;  3EU9 A;  3EHN A;  3GW4 A;  2HE0 A;  2H6H A;  4KBQ A;  4APO A;  3IKO B;  1E8X A;  3W9F A;  1H19 A;  2IO3 C;  4WND A;  5HQ8 A;  5FIO A;  2IOL A;  2RFA A;  2Y69 E;  1HG5 A;  4YDE A;  4O60 A;  1LD7 A;  2DIW A;  4IUL A;  4XKC A;  2WXF A;  1H6K A;  1S70 B;  3NZU A;  5KJM A;  4HI9 A;  3NF1 A;  1G3N B;  2X6I A;  3UM3 A;  2WPV A;  4AOF A;  3Q47 B;  2XRY A;  4HOT A;  2HM8 A;  3CKB A;  2VSO E;  2JLB A;  2DBA A;  2ZIS A;  4DUI A;  4GCN A;  3L9T A;  4G11 A;  3CVY A;  1MYO A;  2I1J A;  4PS3 A;  3CVU A;  3FUK A;  3ML8 A;  1D9S A;  3VLF A;  4GYW A;  2CFZ A;  4CZ2 D;  2IOS A;  1OUV A;  1X5B A;  1XGW A;  4G24 A;  3QJZ A;  4U63 A;  3QAQ A;  1OCZ E;  4G25 A;  1HU3 A;  3T5X A;  2AJA A;  2J8S D;  3CK9 A;  2CHX A;  3EIQ C;  4J8S A;  5BW8 C;  3D9N A;  5D66 A;  5CCM A;  1OCO E;  2L6B A;  3UM0 A;  4URK A;  2CHW A;  4UWK A;  3SNX A;  1O1R A;  1OWL A;  3TXM A;  4XX5 A;  2H6I A;  4DI4 A;  3HIZ A;  3CQG B;  3R7R A;  4FAD A;  4FHJ A;  3LCA A;  4U07 A;  4CDN A;  4OAU C;  5KJN A;  4WWP A;  2P9N G;  1OWN A;  4BX9 A;  1JCQ A;  1TNB A;  4K0R A;  5BV1 A;  3ASF A;  2NXP A;  3ULQ A;  5HI7 A;  1PC2 A;  4IYP A;  3FUE A;  3U66 A;  3DXM G;  1BPO A;  5ARF A;  3J5P A;  3PVL A;  4N5Q A;  4BT8 A;  4QQI A;  3DSX A;  2YNQ A;  3G2T A;  1JCR A;  3ABL E;  1LD8 A;  2VTB A;  3UIN C;  2P9L G;  2P9U G;  4CRW A;  4EZL A;  3DBS A;  4JEU A;  3ZVV A;  4I2Z A;  4HXI A;  3CVP A;  1N52 A;  3FU6 A;  4AV7 A;  4ACK A;  4C0M A;  4DPR A;  1UOH A;  3ISM C;  3QWV A;  3B7T A;  5T4Y A;  2XPY A;  3T9K A;  1N4S A;  2ETA A;  3KSQ A;  2GW1 A;  5LX8 A;  4ACL A;  2L9B A;  3BEE A;  3NBN B;  3W9G A;  3FUF A;  3DST A;  4HNA D;  1WY6 A;  4FC8 A;  3URZ A;  4NAC A;  1YCS B;  4HI8 A;  4XE0 A;  3CST A;  2IQC A;  2LAI A;  3DSU A;  4GTM A;  2BUG A;  5AQ7 A;  4DX5 D;  2H6F A;  3I4R B;  3D9I A;  4G1T A;  4I17 A;  3V2O A;  3LEW A;  4WAF A;  3FTU A;  3Q79 A;  1TN7 A;  2ZGG A;  5AYW D;  4GTT A;  5HKP A;  5G04 J;  3SBT B;  3SD5 A;  3Q9U C;  4GZ5 A;  2R59 A;  2WXH A;  3SZ7 A;  2WQ7 A;  4K5B A;  1Y8M A;  1UG3 A;  4PDX A;  3FTZ A;  4BY6 A;  1N11 A;  3AG2 E;  3HXC A;  1WM5 A;  3E33 A;  4BX8 A;  1MX2 A;  3DEP A;  1FCH A;  5T8I A;  3ZXS A;  5KWD A;  3ZW3 A;  4K5A B;  3D9K A;  1Z6T A;  5BT1 A;  1MX4 A;  4J8E A;  2V4H C;  3G2U A;  4BSX A;  1UN9 A;  4I2W A;  3JQ1 A;  1BU9 A;  4HRN A;  2LXM A;  2LSV A;  4W9R A;  4ATG A;  2DVW A;  5EYL A;  3FEY A;  3G2W A;  1E8W A;  5LCW J;  3RRU A;  2J4D A;  5AEN A;  5J90 A;  2J9Q A;  4J8D A;  2R17 C;  4L2L A;  2RD0 A;  4KVM A;  4JPS A;  3JUE A;  2V0P A;  3IHV A;  2OND A;  4HBD A;  2L0T B;  3FY4 A;  3IXE A;  4L23 A;  3HXD A;  4BFR A;  3GZ1 A;  5J08 A;  3PZ4 A;  3CSF A;  3D9P A;  1INZ A;  1N4R A;  2Y4T A;  4RG9 A;  4DRX E;  3V2X A;  1Z3X A;  3L13 A;  3FDH A;  4BET A;  3CVN A;  2FF4 A;  3HXF A;  3SF4 A;  1N94 A;  3JYS A;  4FJZ A;  2J07 A;  2FEZ A;  1JWF A;  5CER B;  1S63 A;  5G05 C;  4I6E A;  3ZPJ A;  1HZ4 A;  2X38 A;  1K8K G;  3Q9N C;  2PQN A;  1SA4 A;  1NA3 A;  2FUL A;  3TWX A;  3Q15 A;  3E32 A;  2IJG X;  4HOU A;  4AIF A;  1XNF A;  4CCA A;  2X6K A;  3PH0 C;  2X6H A;  4I43 A;  3SFX A;  3HVE B;  1PAQ A;  3ZHE B;  2PQR A;  5EIL A;  2XGO A;  3AS5 A;  5KBA A;  4BTA A;  2P9S G;  1TJC A;  3DSW A;  3UT7 A;  3IBE A;  2Y3A A;  4UWG A;  3D9M A;  1KT1 A;  2QFC A;  5DBK A;  3N71 A;  4WNE A;  2ZU6 B;  4BEP A;  4EQF A;  2V5F A;  3HXB A;  3KSL A;  5JJ7 A;  3JQ0 A;  2J4B A;  1H2U A;  4UWL A;  5ANL A;  1MHQ A;  4GMR A;  2KM4 A;  2XZT G;  2XEN A;  1IHB A;  2P58 C;  2KCK A;  1B89 A;  3ULY A;  3FTW A;  1TNZ A;  4BWR A;  2Y4U A;  2VJ8 A;  4U0S A;  5CEA A;  3ASN E;  4E85 A;  4UI9 J;  4N39 A;  3BG0 B;  2VGE A;  1L5J A;  2GGF A;  2VYI A;  1D8E A;  4KYO B;  2R5S A;  3LKU A;  2QC9 A;  4FP7 A;  5HRY A;  1UJK A;  3PEU B;  1JUQ A;  3HVE A;  3KEZ A;  2VSN A;  3ZHE A;  2BF0 X;  3HG0 D;  2WXG A;  4JHK A;  4DK5 A;  1SZA A;  1TN8 A;  3PZ3 A;  3RKV A;  4OAV B;  4AY5 A;  3LJN A;  4TUU A;  3FUJ A;  2OOE A;  1IHG A;  4RVB A;  3E37 A;  4Y6W A;  3SI5 A;  4BES A;  2B0O E;  4JHR A;  4BTB A;  3FUN A;  4NIK A;  1WG0 A;  2KBX A;  2GRP B;  2Y0B G;  4IRU A;  2FO7 A;  1NP7 A;  1E90 A;  5ENP D;  2WXL A;  4B0Z A;  1E7V A;  5AQA A;  3EHQ A;  3MZL B;  3DWL G;  1E8Y A;  3T8M A;  3E34 A;  3ZYL A;  3LJ3 A;  1QYM A;  3CK7 A;  4CGW A;  2XEH A;  4GCO A;  4EHM A;  3FEX A;  2XS8 A;  1QBQ A;  3AJI A;  3ZU7 B;  2BKK B;  3KAE A;  3MV3 B;  4ANU A;  5T3R A;  1KZO A;  3ONK A;  3Q75 A;  3FUD A;  4MLP A;  4GU5 A;  5AJL A;  3Q5M A;  4HOS A;  1HF8 A;  2KZT B; 
#chains in the Genus database with same CATH homology
 3CVL A;  4A1G A;  3L22 A;  2NC9 A;  4GZC A;  4KZC A;  1HG2 A;  2CG3 A;  3Q49 B;  4JVS A;  4DLO A;  2VTB A;  3TG4 A;  1QNF A;  3FUH A;  2WMN A;  3QOU A;  3VTX A;  3PS6 A;  3B7R L;  2WXQ A;  3ASH A;  5EX3 A;  4I9E A;  2PM6 A;  1H2T C;  4CRW A;  3FFL A;  3DBS A;  2VGX B;  4A55 A;  1SQM A;  2XGM A;  4EZL A;  4PS7 A;  3UT4 A;  3CQC B;  4JEU A;  3ZVV A;  3OXG A;  4I2Z A;  5D0O D;  2AXU A;  1FVH A;  3CVP A;  1N52 A;  4HXI A;  4I6J A;  3FU6 A;  3G2S A;  1E8Z A;  1H0A A;  4L1B A;  4N5C A;  4AV7 A;  4Q96 A;  4ACK A;  1E96 B;  2V4L A;  3OXL A;  5FZS A;  5ANR A;  4JL0 A;  3L16 A;  4JA7 A;  4C0M A;  4DPR A;  4B94 A;  3MYV A;  3I5P A;  3QWV A;  3B7T A;  3TXN A;  4FLB A;  4BT9 A;  5T4Y A;  2XPY A;  4F1S A;  4AY6 A;  3PRE A;  5A6C A;  2GW1 A;  4JEH A;  4NQ0 A;  5LX8 A;  4ACL A;  1ELW A;  3ML9 A;  2L9B A;  3RJV A;  2QY7 A;  3BEE A;  3BG1 B;  1ELR A;  3FUF A;  1HXI A;  2CFU A;  1EYH A;  1WY6 A;  2MOW A;  4FC8 A;  3URZ A;  2X6F A;  2UWJ G;  2WXK A;  4NAC A;  2JEK A;  2WXR A;  4M3O A;  3FH8 A;  3QWP A;  2I2O A;  4XE0 A;  5A7D B;  4A3V A;  3CST A;  2IQC A;  3EDT B;  1EF1 C;  3FU5 A;  2LAI A;  4WWO A;  3JUI A;  3APF A;  5C2Y A;  1KLX A;  4LUN U;  2BUG A;  4ANX A;  5A23 A;  3U64 A;  1QZ2 A;  3TAX A;  3PEV B;  3OTN A;  5AJD A;  4N2Q A;  3I4R B;  3D9I A;  4Q69 A;  3PE4 A;  4G1T A;  4AXH A;  3UT8 A;  3CHO A;  4I17 A;  4U0Z A;  4FU3 A;  2GRM A;  3LEW A;  4WAF A;  3FTU A;  4LER A;  3CLJ A;  4PUC A;  1ZU2 A;  3U9W A;  4A1S A;  3P1U A;  3RRM B;  3CHS A;  3CIA A;  4OVV A;  2WMO A;  3S7B A;  4HOR A;  4FHK A;  3K9I A;  4P29 A;  3AU5 A;  2HYZ A;  3LVQ E;  5G04 J;  5CMY A;  4NUR A;  3ASG A;  5AYW D;  3O48 A;  3SBT B;  1E7U A;  3SD5 A;  3PUJ A;  4LEU A;  3CHQ A;  4JW1 A;  4GZ5 A;  3LVR E;  2R59 A;  2WXH A;  4J8F A;  3FHE A;  3TJP A;  3FH7 A;  4AEZ C;  3ESL A;  3SZ7 A;  2WQ7 A;  4J0U A;  2J08 A;  4UWH A;  3RIB A;  3CVW A;  1Y8M A;  1UG3 A;  4I9C A;  4PDX A;  3CVV A;  3FTZ A;  4ILI A;  4N2S A;  4JA9 A;  3QDN A;  4JHJ A;  3HYM B;  4CT4 A;  2I9C A;  2XPZ A;  5FZQ A;  4Q94 A;  4FUL A;  4BY6 A;  1Z3Y A;  2LSU A;  1UW4 B;  4UWF A;  5KCM A;  3UUX A;  4JC8 A;  3S7J A;  2GRL A;  2PZI A;  4I1M A;  2OV8 A;  3CEQ A;  4A3T A;  1WM5 A;  4CEM A;  2HR2 A;  2CG2 A;  4BX8 A;  2XGS A;  2X3M A;  1GW6 A;  3FTY A;  2YHC A;  2C2L A;  1FCH A;  3FU3 A;  4EBA A;  5T8I A;  1H2V C;  3EJN A;  2X6J A;  5JJ6 A;  3ZXS A;  3AS4 A;  3ZW3 A;  4JXT A;  4U8H A;  3T5V A;  5FTP A;  2IF4 A;  4D10 C;  3D9K A;  4GML A;  1Z6T A;  5BT1 A;  3PNT B;  4EEC A;  4WWN A;  3PZD A;  3PDN A;  4J8E A;  1HFA A;  3G2U A;  5M72 A;  2J49 A;  4RG6 A;  4BSX A;  1UN9 A;  2XPI A;  2L0I A;  4I2W A;  3RRN B;  1YA0 A;  3JQ1 A;  3KS2 A;  3RK6 A;  2LSV A;  4W9R A;  2AXZ A;  4FA6 A;  5LCW C;  5JJT A;  3FUM A;  4ATG A;  3LY7 A;  3MCX A;  3WXX A;  2CHZ A;  2LO6 A;  3FEY A;  3G2W A;  4H7Y A;  4GYY A;  1E8W A;  1HX8 A;  3EIJ A;  3UMV A;  4R7L A;  1IQU A;  3IHY A;  5LCW J;  3RRU A;  4GA0 A;  2J4D A;  2KCV A;  3ONL A;  1TJF A;  3CHP A;  4TV3 A;  5E75 A;  5AEN A;  3GYZ A;  3SFZ A;  4C9B B;  3OXF A;  2E0I A;  5J90 A;  2VTB B;  2J9Q A;  3MX3 A;  4XI0 A;  5ARG A;  3CKC A;  4AVX A;  3S7F A;  4J8D A;  2R17 C;  4I1O B;  4L2L A;  2RD0 A;  4G23 A;  2AWI A;  3MKQ B;  5EKQ D;  2WB2 A;  3MKR A;  4GYO A;  4KVM A;  5FQ4 A;  2AXV A;  4JPS A;  3MJW A;  3S7D A;  3SGH A;  5C1D A;  2PL2 A;  3APC A;  3FUL A;  3FTS A;  5G2N A;  3CVQ A;  3SHF A;  2BTD A;  2V0P A;  3MGB A;  3IHV A;  3AU4 A;  5BPP A;  4WNF A;  2ION A;  2OND A;  2XHE A;  3L54 A;  4ME2 A;  3AS8 A;  3RU0 A;  2XRZ A;  3LS8 A;  4FJY A;  4GZD A;  4I1A A;  4GZ3 A;  3CR3 A;  4E6H A;  2L0T B;  2YHE A;  1DVP A;  1MQS A;  3ASD A;  1U3C A;  3FY4 A;  3HHM A;  4CT0 A;  2FI7 A;  2OVB A;  3ZEF A;  4DLQ A;  3ZYQ A;  3L6A A;  4L23 A;  5FQ6 A;  1UN8 A;  4YND A;  4BFR A;  3GZ1 A;  3QAR A;  4RSY A;  3VTY A;  5J08 A;  4YVO A;  4QFV A;  4KT6 B;  2WXJ A;  3CSF A;  3VLD A;  1A17 A;  3D9P A;  2LNI A;  5ENN A;  2YIN A;  1NZN A;  2Y4T A;  1INZ A;  4RG9 A;  3G2V A;  5EX0 A;  3MA5 A;  1OWO A;  3LY9 A;  5CCL A;  3RO2 A;  1Z3X A;  2C0M A;  2WXO A;  3L13 A;  1WAO 1;  2NSZ A;  3FDH A;  4HOQ A;  4UI9 K;  4IN3 B;  3CVN A;  2FF4 A;  3L08 A;  4TRQ A;  3GZS A;  4XKB A;  3SF4 A;  4DI3 A;  3JYS A;  2LAH A;  4FJZ A;  4AM9 A;  2J07 A;  5KJK A;  1JWG A;  3NZS A;  3OAW A;  3UX4 A;  4EZK A;  1Y6I A;  4U0U A;  2FBN A;  4KMO A;  2FEZ A;  3RO3 A;  4CDM A;  5KJL A;  3I4G A;  1JWF A;  3QC1 A;  4GA1 A;  2I6H A;  1FVF A;  3R7Q A;  5G05 C;  4NRH B;  2AW6 A;  5JHA A;  5G04 C;  3QB2 A;  4I6E A;  2PM7 A;  3ZPJ A;  1HZ4 A;  2X38 A;  3E4B A;  2WXI A;  5EDS A;  2KZT A;  2PQN A;  1NA3 A;  1PY1 A;  2AVP A;  2EQX A;  3L17 A;  2FUL A;  3APD A;  3QWW A;  2XCC A;  5G05 J;  3VLE A;  4B89 A;  4H7X A;  1IYG A;  3Q15 A;  3R9A B;  2RG8 A;  4ABN A;  2IJG X;  3LXU X;  4GZ6 A;  4HVB A;  1HO8 A;  4HOU A;  5FZR A;  4AIF A;  1XNF A;  4B8C B;  4B8A A;  4CCA A;  4CGV A;  4LCT A;  2M63 A;  2X6K A;  3PH0 C;  3QKY A;  1HE8 A;  2X6H A;  4GB9 A;  4I43 A;  5D0Q D;  3QNK A;  2VGX A;  4G26 A;  4PH4 B;  3CK8 A;  4WNG A;  1ZBP A;  2L6J A;  2A4Z A;  2IU1 A;  3PRZ A;  3CGH A;  4FLH A;  2UY1 B;  3MKQ A;  3HVE B;  2WXM A;  1N54 A;  5FJY A;  3CV0 A;  5LFA A;  1PAQ A;  1S0P A;  3ZHE B;  2PQR A;  3TG5 A;  3D9J A;  2XEV A;  3DPD A;  3QK0 A;  4MS6 A;  3EHN A;  4MRU A;  2XGO A;  3HDX A;  2XQ0 A;  3GW4 A;  3AS5 A;  3LPZ A;  4BTA A;  3IV0 A;  3ZYK A;  1KT0 A;  1TJC A;  5CHE E;  1IQR A;  3UT7 A;  4KBQ A;  5E76 A;  3IBE A;  2Y3A A;  4O6F A;  4UWG A;  1VDY A;  3LY8 A;  3D9M A;  4APO A;  3IKO B;  1E8X A;  1QQE A;  4HS2 A;  3LYA A;  1H19 A;  1KT1 A;  2QFC A;  2XCB A;  5DBK A;  4L2Y A;  1HH8 A;  3N71 A;  4WNE A;  4WND A;  5HQ8 A;  2IOL A;  2E2E A;  2ZU6 B;  3D3M A;  4EQF A;  2V5F A;  2DCP A;  1HG5 A;  1OWM A;  4XIF A;  3MEK A;  5JJ7 A;  4EBA G;  3JQ0 A;  4V3I A;  1ELK A;  4ANW A;  5FQ8 A;  2J4B A;  1H2U A;  4UWL A;  5ANL A;  5CMW A;  2DIW A;  1MHQ A;  4IUL A;  4F3V A;  1JPL A;  2KM4 A;  4XKC A;  3ZIM A;  2WXF A;  3ZYM A;  4HFG A;  3ZRH A;  4F7A A;  1H6K A;  3NZU A;  1OWP A;  2WXN A;  4GAA A;  1TEZ A;  3FTX A;  5KJM A;  2P58 C;  4L7T A;  4UI9 C;  3FH5 A;  2KCK A;  3NF1 A;  1B89 A;  2VSY A;  3FTW A;  2X6I A;  2WPV A;  3MV2 B;  4N3A A;  4HLE A;  4BWR A;  2Y4U A;  2VJ8 A;  4U0S A;  4AOF A;  3ESK A;  2IFU A;  3FUI A;  2XRY A;  3Q47 B;  4HOT A;  4E85 A;  4UI9 J;  1UJJ A;  3ZGQ A;  4OVU A;  2HM8 A;  4N39 A;  3CKB A;  4N3C A;  2VSO E;  3BG0 B;  1L5J A;  2JLB A;  5FQ7 A;  2GGF A;  2VYI A;  4KYO B;  2DBA A;  2R5S A;  3LKU A;  3B7S A;  4APF A;  3P2B A;  4GCN A;  4FP7 A;  4G11 A;  3CVY A;  2I1J A;  4PS3 A;  1UJK A;  4KZ0 A;  4UQZ A;  3PEU B;  5BV0 A;  2UY1 A;  3B7U X;  4OYS A;  1JUQ A;  3FP3 A;  3HVE A;  4UQY A;  3KEZ A;  3B13 A;  3CVU A;  2VSN A;  3FUK A;  3ML8 A;  3ZHE A;  1P5Q A;  3S2A A;  4ANV A;  2BF0 X;  5G55 A;  3VLF A;  2WXG A;  5FT9 A;  3FWV A;  1NA0 A;  4GYW A;  2HO1 A;  4JHK A;  2MRI A;  2CFZ A;  3KD7 A;  4UQX A;  4DK5 A;  1SZA A;  2I1K A;  1OUV A;  2IOS A;  3GZ2 A;  4EPZ A;  4LRZ A;  1X5B A;  3RKV A;  3FU0 A;  1XGW A;  3CHM A;  2ILR A;  3C98 A;  4AY5 A;  4G24 A;  5BUZ A;  4XZ4 A;  3QJZ A;  4U63 A;  1W3B A;  4TUU A;  3UPV A;  3QAQ A;  4J6I A;  2OVF A;  3FUJ A;  2V8S E;  4G25 A;  4WUY A;  3FTV A;  1HU3 A;  4GMJ A;  2OOE A;  4XI9 A;  3T5X A;  1IHG A;  4RVB A;  4Y6W A;  3SI5 A;  2KC7 A;  3CK9 A;  3JCK C;  3D9L A;  3EHM A;  2CHX A;  3PE3 A;  4JHR A;  3IEG A;  4DJA A;  4BTB A;  3D9O A;  4ILG A;  1LF8 A;  3EIQ C;  2WVI A;  2C0L A;  4J8S A;  3FUN A;  5BW8 C;  3PNL B;  2Q7F A;  2VSX E;  4U04 A;  3TL5 A;  3D9N A;  2WXP A;  3Q4A B;  3UQ3 A;  1EDU A;  4ILH B;  3U3W A;  5CCM A;  3ENE A;  4IRU A;  3TGO A;  2KCL A;  2WQH A;  4AP2 A;  5DIZ A;  4URK A;  2FO7 A;  2CHW A;  1NP7 A;  4UWK A;  1E90 A;  2A5U A;  2WXL A;  4GA2 A;  4KVO A;  3SNX A;  4B0Z A;  2VGY A;  1E7V A;  1OWL A;  4C0E A;  3TXM A;  3CHR A;  4XX5 A;  3MZL B;  1U3D A;  4DI4 A;  1E8Y A;  3ZFW A;  4EZJ A;  1HS6 A;  3HIZ A;  2MHK A;  3CQG B;  3T8M A;  3ZYL A;  3LJ3 A;  3R7R A;  2VQ2 A;  1SZ9 A;  5LOZ A;  2KAT A;  3CK7 A;  4FAD A;  2J09 A;  4CGW A;  4FHJ A;  3LCA A;  4U07 A;  4CDN A;  1DNP A;  5KJN A;  4WWP A;  5LP0 A;  4GCO A;  4I6G A;  3I3N A;  5FWQ A;  4F53 A;  1OWN A;  3U4T A;  4AJW A;  5JHB A;  4BX9 A;  3FEX A;  3CVX A;  5AIJ A;  2WM9 A;  4YVQ C;  3KAE A;  4K0R A;  3MV3 B;  3PUK A;  4N3B A;  4ANU A;  5BV1 A;  3ASF A;  2NXP A;  3ULQ A;  5HI7 A;  4Y6C A;  3SBS A;  5BNW A;  5T3R A;  3O4Z A;  3ZN3 A;  1PC2 A;  4IYP A;  1EPU A;  3FUE A;  3U66 A;  4MKT A;  4PS8 A;  4JZY A;  3ONK A;  1BPO A;  5ARF A;  4K03 A;  3NQP A;  3PVL A;  3FUD A;  4G2V A;  2YQ8 A;  4GU5 A;  4MLP A;  5AJL A;  3LDZ A;  4GPK A;  4BT8 A;  3Q5M A;  4KXK B;  4CDR A;  4HOS A;  1HF8 A;  2YNQ A;  2WQ6 A;  3G2T A;  2KZT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...