3AS5A

Mama amb-1 p212121
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
183
structure length
183
Chain Sequence
DDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELALVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
molecule keywords MamA
total genus 69
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as5A01
4AY6A 2FO7A 2YHCA 3ASGA 4G2VA 5EX0A 3KS2A 4UI9C 2Y4TA 1FCHA 3S7BA 3UPVA 4KBQA 2FEZA 1HXIA 1HH8A 3OXFA 4RG6A 3RKVA 4GYYA 4EQFA 2XPIA 4UQXA 5JJTA 4HORA 2MHKA 2XGSA 5G05C 5HI7A 3NF1A 1OUVA 3PE3A 4J8EA 1PC2A 4WUYA 5DBKA 5BNWA 4HOTA 4LEUA 4I9CA 3AS8A 3Q47B 3LY7A 5FZQA 2C0LA 3GYZA 4N39A 2HYZA 3QWPA 5A6CA 5G05J 5JJ6A 2KATA 2WQHA 3ULQA 4G26A 1NA3A 2AVPA 2L6JA 5FJYA 2NC9A 4I17A 3ZN3A 4N3BA 3CVPA 3RIBA 4GA0A 2I6HA 4G1TA 4GZ3A 2VYIA 1A17A 2BUGA 2KCLA 2XCBA 4H7YA 3UUXA 4I2WA 4BTAA 3U3WA 3S7FA 1NA0A 3LKUA 2PQRA 3ASFA 4N2QA 4G25A 3ZFWA 4YVOA 4ME2A 3PDNA 5ARGA 5AYWD 2XGMA 4JL0A 4Y6CA 3AS5A 3ZHEA 3ZGQA 3CK8A 4GPKA 2VGXB 3LPZA 2C2LA 2HO1A 2LSUA 5ARFA 1XNFA 3CK9A 3RO2A 1KT0A 5EX3A 5KJKA 3CKCA 4O6FA 1E96B 4RG9A 5BW8C 3KAEA 2E2EA 1WAO1 4U0SA 2KC7A 4I9EA 1B89A 2FI7A 2R5SA 3MEKA 4G24A 2LNIA 3GZ1A 4UI9K 4WNDA 4HOUA 4WNFA 3U4TA 3JYSA 1ZBPA 5BT1A 5G04J 3EDTB 5LCWC 2YQ8A 4GA1A 4HOSA 2C0MA 3ASDA 4GYOA 5G04C 4GZ6A 3HYMB 3R9AB 3VTXA 5KJMA 3LY9A 3TG5A 3K9IA 2UY1A 2VSNA 4Y6WA 3S7DA 3TG4A 3ZHEB 2WPVA 3CVQA 4U04A 4XIFA 3TAXA 2XEVA 2VGXA 4B94A 4WNGA 2HR2A 4GYWA 4CGVA 5CCLA 3RO3A 5CHEE 1ELWA 3CV0A 4NRHB 4XI9A 5FTPA 3ESKA 4GA2A 1ELRA 3QWWA 4GCNA 4KYOB 3FFLA 4CDRA 4CGWA 2QFCA 3FWVA 5LCWJ 4JHRA 3URZA 1QQEA 3GW4A 3QWVA 4U0ZA 3QDNA 5FZSA 3AS4A 3S7JA 1P5QA 2DBAA 4U07A 4W9RA 3ZPJA 4I1AA 4UQZA 5HQ8A 4N3AA 4HOQA 1IHGA 2UWJG 2V5FA 4BTBA 4J0UA 4BT9A 2JLBA 3ASHA 3VTYA 4F3VA 1YA0A 4GCOA 5KJNA 2KCKA 3CEQA 4I2ZA 3LYAA 2UY1B 2GW1A 2OOEA 2Y4UA 4J8FA 5EKQD 4N2SA 3MA5A 1HZ4A 5FZRA 3Q49B 2Q7FA 3N71A 4KXKB 2FF4A 3Q4AB 3O48A 5FT9A 4WNEA 1WM5A 3MV3B 4N5CA 4AM9A 3LCAA 3KD7A 5M72A 3E4BA 3PE4A 4XI0A 4IN3B 4AY5A 5CCMA 3QKYA 3WXXA 1KT1A 1IYGA 2FBNA 5C1DA 3CVNA 3FP3A 3IEGA 3Q15A 5D0OD 1Y8MA 3TGOA 2XCCA 4UI9J 1QZ2A 3CVLA 5D0QD 2KCVA 4G23A 5A7DB 3Q5MA 2PZIA 3MKRA 3MV2B 3UQ3A 4A1SA 3BEEA 4UQYA 4AIFA 4APOA 3RU0A 2XGOA 3CK7A 4U0UA 3OXGA 5DIZA 4JA9A 3SF4A 4H7XA 4BT8A 1TJCA 4ABNA 5KJLA 2J9QA 3LY8A 3SZ7A 2P58C 2VGYA 2VSYA 4YVQC 5JJ7A 3OXLA 2LSVA 2PL2A 1KLXA 3QOUA 4N3CA 2VQ2A 4NQ0A 2IFUA 4J8DA 2IF4A 3RJVA 4GZ5A 1W3BA 4BWRA 3CKBA 3GZ2A 1ZU2A 2PQNA 1NZNA 4JA7A 2ONDA 4YNDA
chains in the Genus database with same CATH superfamily
4DPRA 4UI9C 3HXDA 2MHKA 2J4DA 3C72A 5EYPF 4C0EA 4FADA 2AWIA 3I5PA 1SA4A 1E90A 4G26A 3CVPA 3FU6A 1ZB1A 4IYPA 3EIQC 4APFA 4K5BA 2F8YA 4YVOA 4KVOA 4GTRA 3DSVA 2J4BA 5BW8C 4JC8A 4PS7A 3HXEA 4GA1A 5G04C 5KJMA 2GRMA 2VSNA 4Y6WA 2AXZA 4I1OB 2BEDA 2VGXA 4WNGA 2HR2A 1K1AA 1ELWA 3ZIMA 1HS6A 4AXHA 3GW4A 2VSXE 1SVXA 2XRYA 2AJAA 4RQIA 4V3IA 3T8MA 4JHKA 3SNXA 3TXMA 2DBAA 2X38A 4J0UA 2JLBA 5HS0A 3CEQA 4J8FA 2KXPC 2AW6A 2FF4A 1DCQA 1WM5A 3ASNE 3LCAA 4FJZA 5FQ7A 1TNOA 1H2TC 1DNPA 4O1OA 5LP0A 2FULA 3UM2A 3SFZA 4U0UA 4ILIA 1QBQA 3SF4A 4BFRA 4OVVA 2VGYA 4A3TA 4DK5A 3HVEA 1SQMA 3SHFA 4HI8A 3B7BA 4TUMA 5FWQA 4NQ0A 1SW6A 3V79K 3KEZA 2ILRA 1Q2ZA 4UWFA 1PY1A 2XZTG 3AS8A 4MBGA 3PZ3A 3CR3A 2P2CP 3TWUA 4FJYA 3FH5A 3FTSA 3FUDA 1SA5A 5J90A 3NOCD 3LPZA 2XENA 3CKCA 1B89A 4WWNA 4U8YD 5BV0A 3CQCB 3ESLA 4GZ6A 2RFMA 4TV3A 3PZDA 2JEKA 4I1MA 1UN8A 3FHEA 4XEIG 3NZSA 5T3RA 4XI9A 4DLOA 3B7SA 2R59A 1DC2A 4TXPA 2WXKA 2X6FA 3CHSA 4B93B 1FT1A 4LNBA 4M7CA 5EKQD 5KNGA 4PH4B 2Y4UA 4BESA 2WMOA 3ULEG 3ZRHA 1WY6A 3D9PA 2XRZA 5D0OD 1QZ2A 3MV2B 3BEEA 4CT4A 3CHQA 4GMLA 4EHMA 2WXMA 4F1SA 5CRVA 1TNYA 3CHRA 3PZ4A 3D9LA 4N3CA 3SFXA 4JA7A 3ASOE 3TWRA 3EU9A 4HLLA 4MLPA 3B7TA 5BNWA 5A23A 3LY7A 2WXJA 4X8QA 2R03A 3G2WA 3UUXA 3HHMA 2PQRA 2WXPA 4ATGA 2XGMA 3SY2A 3ZGQA 4MRUA 3UMVA 3FTXA 2CFUA 3RO2A 4GPMA 1TYQG 3D9IA 2VTBA 4G24A 2X6KA 4HRNA 2J49A 2R2LA 2WXGA 3APDA 3ZXPA 4JEUA 2J07A 5CRUA 2XPYA 4GTMA 3R9MA 2QFCA 2Y0BG 2WXOA 3AS4A 4PUCA 4QQIA 2KM4A 3L13A 3ZPJA 4W9RA 4BTBA 3E33A 5ENPD 4KT6B 5C1DA 1TR4A 1N95A 3QNKA 4A1SA 4AIFA 1AWCB 3D9NA 3RU0A 4O60A 1H2UA 1TJCA 3T5XA 3B7RL 2V0PA 2VSYA 4YVQC 5CMWA 1WG0A 3KS2A 1FCHA 4RG6A 5AENA 1HFAA 2DIWA 4F53A 1BD8A 1OUVA 1PC2A 2GRPB 3RRUA 4DJAA 3TWVA 5LFAA 1KZPA 3GYZA 3ZXSA 5BV1A 3EUVA 3CSTA 5B1BE 3ZU7B 4DX7D 2L6JA 2ZU6B 2XPZA 2E0IA 3NQPA 4HQDA 3PDNA 4DX6D 4JL0A 3TWXA 3EHQA 5E75A 4B8AA 2IOSA 2WXIA 1LD8A 2E2EA 3CHPA 4HBDA 2FI7A 2DYSE 2MOWA 2LNIA 4WNFA 3IKOB 4BY6A 4BX9A 3HXBA 4GYOA 3LJ3A 3NZUA 1WDYA 1JWFA 3LY9A 5LX8A 4LG6A 4JVSA 4P29A 3L54A 2NSZA 4CGVA 1E7VA 3ZUVB 1QQEA 2J08A 4F1PA 3PH0C 1E8XA 4RSYA 2QYUA 2UWJG 2X6JA 1JCQA 1U3DA 4FLBA 4FU3A 3QJZA 4EZKA 3Q49B 4AM9A 5BXOA 3PE4A 3IHYA 2RG8A 1S63A 2XCCA 2I1JA 5D0QD 5EN5D 1D8EA 3ONLA 2ZGDA 3CVXA 3AG3E 3Q7AA 2LUHA 3L22A 2MRIA 2GRQB 4JB8P 3ZEFA 1TNBA 2XGSA 1RW2A 1KZOA 4J8EA 1LTXA 4ANWA 4PDXA 2C0LA 3FUNA 5G05J 2WQHA 3ULQA 3BQOA 4G8LA 2B6CA 4C0MA 4G1TA 4XKCA 3ZYQA 4I2WA 2HM8A 4BTAA 5CBOA 3L16A 3UIOC 5JMND 1FVHA 3MEKA 4WNDA 3GZSA 2GRRB 4YDEA 2WM9A 3R9AB 5CMYA 3LS8A 3HIZA 2PM6A 1DVPA 2KBXA 4I6JA 2XEVA 4AJWA 3V30A 3EHMA 1FT2A 1N4QA 1Z5SC 3JQ1A 1S64A 5D2MC 2P9PG 3QDNA 3SO8A 3FTYA 2J09A 3FEYA 1HO8A 3N71A 3QARA 3W9GA 1EYHA 3FP3A 4LCTA 3EHRA 4U8VD 3L08A 4Q96A 3UQ3A 4BT8A 2CFZA 2V4HC 1LD7A 4J8YA 4J8DA 2IF4A 2IY0C 4B0ZA 4BWRA 1NZNA 5EIDA 2IONA 3FDHA 3AJIA 3Q75A 5ENRD 3UTMA 2GRNB 3UM3A 1HX8A 2QY7A 4KBQA 3ZNGA 2WQ7A 2QZAA 2LO6A 2ZXWE 4EPZA 3C3RA 3R7QA 2OEVA 4I6GA 3FUEA 3RK6A 3LJNA 3RIBA 4GZ3A 1A17A 3FUIA 3TWWA 4GZDA 3APFA 3FUKA 4G25A 4AV7A 2WXFA 3QC1A 3PRZA 2AXUA 2LSUA 4WWOA 3RSEG 1MX6A 5ENSD 3P1UA 4GZCA 4GAAA 1FVFA 5AQ9A 2CG2A 4HLEA 3S2AA 1O5MA 3IXEA 1Y6IA 2WPVA 4MS6A 1IQUA 3DSUA 3DEPA 4YDOA 3ESKA 5LCWJ 4JHRA 3TL5A 3IBEA 3HG0D 2L0TB 2UY1B 2LXMA 4JPSA 2Q7FA 3MGBA 4HRMB 1E8WA 3PUKA 3W9FA 1HE8A 3G2TA 5BXUA 3Q15A 4GTTA 3D9KA 4GB9A 2P9LG 2PZIA 4FP7A 3KSQA 2XS8A 3E37A 1N4RA 1H6KA 3D9OA 4JA9A 5KWDA 3MJWA 3OXLA 2L6BA 3L9TA 5J08A 3FWVA 2XS1A 2Y1LE 1HU3A 2Y4TA 4BETA 3DRAA 3OXFA 2XZDG 4NIKA 2IO3C 4JZYA 5G05C 3PE3A 3C3OA 4A1GA 1MJ0A 4XE0A 2HYZA 3U64A 4FA6A 4EZLA 3JQ0A 2VSOE 4N2QA 4KZ0A 3IHVA 5AIJA 4Q69A 5IY5E 3NOGD 4ILHB 1JCRA 2R5SA 1TN7A 1AP7A 1L5JA 4HOUA 1OWMA 2P9NG 3ASDA 3WG7E 3KSLA 3TG5A 4K5AB 1VDYA 3TAXA 4DLQA 4GYWA 3ENEA 1Z3XA 1UJJA 1PAQA 2A4ZA 5C2YA 3ML9A 4IULA 4N3AA 4BT9A 3U66A 1YA0A 5FZRA 2YNQA 3FTUA 4KXKB 3Q4AB 5FT9A 4IN3B 4AY5A 5CCMA 1KT1A 3L82A 1IQRA 4JHJA 5AQ7A 2XGOA 3CK7A 4H7XA 2VJ8A 2A5UA 1XGWA 2IJGX 4TXRA 3QOUA 3G2VA 3UT4A 1OWOA 4ZHBA 5CERB 2JABA 2FO7A 4G2VA 1OWNA 2H6IA 5CECB 5JJTA 4HORA 3NF1A 2OVBA 3TWTA 2XEEA 2P9IG 3UX4A 5JJ6A 2WXHA 1NA3A 2R02A 2OEWA 2BUGA 2F37A 3ASFA 3ZFWA 3B13A 2VGXB 3U9WA 4JXTA 5ANLA 2HO1A 5ARFA 4YDYA 4XKBA 2MYOA 4U0SA 4URKA 1S0PA 3QK0A 4M3OA 4CYMD 4KZCA 3K9IA 5ENNA 1H0AA 1INZA 3CV0A 3MCXA 4GA2A 3LDZA 3J5PA 1E7UA 5JA4D 2KZTB 4NACA 3AU5A 1IKND 3NB2A 3LYAA 1HZ4A 4DUIA 3MX3A 2ETCA 3WXXA 5FQ4A 4UWLA 1Y8MA 3G2UA 1YMPA 4FLHA 3JUEA 4UQYA 1BLXB 2WMNA 5DIZA 3LY8A 4GMJA 4BEPA 3FEXA 2X6IA 1ZU2A 3APCA 4C9BB 2ONDA 4LERA 3LVRE 5AAOA 3UPVA 4GTSA 3RKVA 1TNUA 2XPIA 4PS3A 3CSFA 3O4ZA 1MX4A 5JHBA 2A5EA 2WQ6A 2XHEA 2H6FA 5A6CA 4GMRA 5G2NA 3ZN3A 2XCBA 5AJLA 2BKKB 5AYWD 5AQBA 3KEAA 1Z6TA 1EPUA 5AQAA 1XNFA 5KJKA 1GW6A 1OXJA 1H19A 4GU5A 2H6GA 4D10C 5AN8A 4OAVB 2YQ8A 2C0MA 2R05A 4WAFA 3T5VA 2GRLA 3ZHEB 4DRXE 3B95A 3SI5A 4B94A 1V55E 3PZ1A 2IO2C 3CVWA 3I4RB 3QWVA 4AOFA 3S7JA 1P5QA 4J6IA 5HQ8A 2EQXA 4I1AA 1IHGA 2VGEA 3R7RA 3E30A 4HS2A 2KCKA 2IQCA 3O48A 4UUCA 4N5CA 3KD7A 2YINA 2FO1E 4L23A 2LXLA 1N54A 3CVLA 4OVUA 1MZCA 4APOA 2DYRE 3UINC 3TXNA 3ML8A 1NI1A 3Q79A 3UM0A 3D9HA 4FULA 3ASGA 2DCPA 4XX5A 3ZYLA 2OVFA 3J5QB 4L9PA 5D66A 3QWPA 5E76A 2IOLA 1OWPA 3LKUA 1ELKA 2NXPA 3VLFA 5B3SE 3CK9A 2P9KG 3EU5A 1DCEA 4LNUD 4O1PA 4DI4A 3EDTB 1OY3D 3ZYKA 3TG4A 3FTVA 3ABKE 2ETBA 3C5RA 3QWWA 4CDRA 3OAWA 4KYOB 2QC9A 3VTYA 4I2ZA 4C48B 4N2SA 1HF8A 3MA5A 3HXFA 4ANUA 3X2QE 3I4GA 4AEZC 3IEGA 2XQ0A 4TRQA 2DZNA 3Q5MA 5KJLA 4CRWA 2PL2A 4G11A 3BUAA 3DSTA 1SZAA 3SBTB 3S7BA 4FHKA 4EQFA 1Z3YA 3PEVB 1A5EA 5DBKA 4HOTA 3F6QA 4Z68A 5FZQA 4KVMA 4N39A 2KATA 3HVEB 3TJPA 4U8HA 2NC9A 4U95D 2YHEA 3FH7A 3U3WA 3S7FA 3MKQA 1O1RA 3AG1E 1UN9A 3DWLG 4CZ2D 3Q7FA 4E85A 3L17A 3KAEA 1WAO1 2IU1A 2CHXA 3U4TA 4NURA 4HRLA 5BT1A 4EBAG 2V5QC 1U2VG 3PVLA 1H6OA 3FTZA 4HFGA 3AG4E 2H6HA 1TEZA 3RO3A 5CHEE 1ELRA 4GCNA 3UI2A 3FFLA 4TXQA 3UKRG 5BUZA 4U0ZA 2RD0A 3SQVA 1N0QA 3DBSA 5FQ6A 4RVBA 2L9BA 2V5FA 4ACKA 4CDMA 5LOZA 4FC8A 1FPPA 2X6HA 1E8ZA 3V2XA 2GW1A 1N9AA 4GTQA 4BX8A 1EF1C 4Q94A 5CBNA 3QKYA 2J8SD 3HXCA 4G23A 1X5BA 1HG5A 1N4SA 4JW1A 1NP7A 4YNDA 2Y69E 4LSZE 1HXIA 5HRYA 2L0IA 2I9CA 3LXUX 4AVXA 4EECA 1O1SA 2BTDA 5AJDA 3ULYA 4DX1A 2AVPA 5EDSA 5A7DB 4H7YA 3BG1B 4JD2G 1UW4B 1NFIE 2R17C 1TJFA 1KT0A 1D9SA 1IHBA 3FUJA 4ANVA 3NBNB 4ZFHA 4MKTA 1JPLA 4UWHA 2PM7A 3VTXA 3FH8A 4J7WA 4HB5A 3JUIA 3SBSA 5ENTD 3S7DA 4U04A 3VLDA 3CQGB 4UWGA 3IV0A 3ZVVA 2VTBB 4CGWA 4FHJA 2IEJA 3TWQA 2QYJA 3C98A 4UQZA 5H7PA 5JHAA 3CVUA 3UT7A 4F3VA 1HG2A 2OCCE 2EIME 4WNEA 4DI3A 3E4BA 2WXNA 3CIAA 4YDWA 2BF0X 5EYLA 3CLJA 2ZGGA 3OXGA 4LRZA 4HXIA 2EILE 3PREA 5JJ7A 2LSVA 2KZTA 4ILGA 2IFUA 3RJVA 1W3BA 1UOHA 3CKBA 3GZ2A 1IYGA 2EIKE 4AY6A 5EX0A 3OTNA 4J8SA 1UG3A 2XEHA 1N0RA 3DSWA 1MYOA 3PNTB 4F6RD 1K3ZD 3HDXA 1JCSA 4I17A 4N3BA 3HRAA 3FUMA 1S70B 3D9MA 4BSZB 4GPKA 3CK8A 3ABME 2C2LA 3P2BA 3DPDA 5KNHD 3Q78A 2KC7A 4GTOA 4LNGA 2LAIA 4UI9K 5BPPA 1ZBPA 3CGHA 4K5CA 5LCWC 4L2YA 2P9UG 1TN8A 2UY1A 4EBAA 4L7TA 3SFYA 3PUJA 3G2SA 3LEWA 1E8YA 3JCKC 1JUQA 2WVIA 4U07A 3FU3A 1D8DA 3PNLB 1SZ9A 3ASHA 4GCOA 3V31A 1QNFA 3D3MA 1G3NB 4K03A 4F7AA 5M72A 3DXMG 2OV8A 4UI9J 3I3NA 2KCVA 3ONKA 3MYVA 3MKRA 1N11A 3ZKJA 3T9KA 3UT8A 3ZYMA 2GGFA 1MHQA 1KPSB 5B1AE 4G8KA 4EZJA 4GZ5A 2B0OE 3VLEA 2LAHA 4RG9A 3T8KA 3ABLE 3SGHA 1HH8A 3UIPC 4N5QA 4GYYA 2P9SG 3FU5A 2F8XK 4GA0A 3Q9UC 2VYIA 1BPOA 3FY4A 1RZ4A 3LVQE 2X3MA 4RLYA 2DWZA 2ZISA 4BSXA 4A3VA 5EX3A 4U96D 5KCMA 3FU0A 5FIOA 4GTPA 3GZ1A 3QAQA 3JYSA 3UXGA 4U63A 1EDUA 1OCZE 2M63A 3B7UX 4NRHB 2WXLA 2EIJE 4IRUA 3UKUG 5FZSA 3FUHA 4WWPA 4OYSA 4HOQA 5G55A 3NAWA 3EJNA 5CEDB 1OCOE 3DEOA 4CDNA 4CT0A 4BERA 3MV3B 4XI0A 3E32A 2ZIRA 1TNZA 2Y3AA 3SD5A 3PS6A 3QB2A 1U3CA 4ACLA 1UJKA 3DSXA 4CEMA 2P58C 4K0RA 2EINE 3JXIA 2CHWA 2DVWA 5ANRA 1KLXA 3BG0B 4QFVA 1TN6A 4L1BA 4B89A 2CHZA 2V8SE 4UWKA 4HVBA 3AU4A 4I43A 2FEZA 4UQXA 2V4LA 3CHOA 5HI7A 3CVYA 1N52A 1OWLA 3RAUA 4KMOA 3V2OA 3ISMC 3EIJA 2F0YA 4TUUA 1N94A 2RKKA 3AAAC 1OCCE 1BU9A 4AP2A 4I6EA 3DXKG 4OAUC 3MZLB 3Q9NC 3AS5A 4U7EB 5FINA 3CHMA 1QYMA 2BKGA 2RFAA 1E96B 4O6FA 3FTWA 5G04J 4HOSA 2AXVA 1BI8B 2ETAA 5CCLA 4LUNU 3MKQB 5FTPA 1MQSA 3JXJA 3BU8A 3URZA 4DX2A 5KJNA 3EHNA 2OOEA 2PNNA 5FQ8A 5ENQD 1V54E 1X81A 3DPYA 3UM1A 1YCSB 4E6HA 1K8KG 2FBNA 3CVNA 3TGOA 2WXRA 3L6AA 3SZ7A 1NL4A 4B8CB 2DZOA 1BI7B 2J9QA 2YHCA 4DX5D 3C3QA 3PEUB 3RRNB 3ZW3A 3CVVA 4L2LA 4WUYA 2WXQA 4LEUA 4I9CA 5EIBE 3Q47B 3PZ2A 2CG3A 1K1BA 5FJYA 5ITZF 2GROB 2I6HA 3FULA 4CCAA 2KCLA 1NA0A 2NYJA 4ME2A 5ARGA 4Y6CA 3ZHEA 4JEHA 5KBAA 3RRMB 2I1KA 3Q73A 4HNAD 3TWSA 4I9EA 5T8IA 5EILA 4A63B 5ENOD 4XZ4A 1YYHA 1OCRE 1IXVA 3HYMB 1H6PA 5HKPA 3CVQA 4XIFA 5T4YA 1JWGA 1MX2A 4A55A 4PS8A 4HI9A 5CEAA 2WB2A 4ATZD 1H2VC 2I2OA 1OT8A 4R7LA 2HE0A 1N4PA 3FUFA 3AG2E 1O1TA 3E34A 1LF8A 4ABNA 4ANXA 3D9JA 4GTVA 5AARA 3DSSA 2VQ2A 2PQNA
chains in the Genus database with same CATH topology
2MRIA 4AY6A 4DPRA 5EX0A 4UI9C 3UPVA 3OTNA 4J8SA 3ZEFA 3RKVA 2XPIA 4PS3A 2MHKA 2XGSA 2J4DA 1UG3A 3CSFA 3O4ZA 4J8EA 4ANWA 5JHBA 4PDXA 4C0EA 4FADA 3PNTB 2C0LA 2AWIA 3I5PA 2WQ6A 3HDXA 3FUNA 2XHEA 5A6CA 5G05J 2WQHA 3ULQA 1E90A 4G26A 5G2NA 4I17A 3ZN3A 4N3BA 3CVPA 4C0MA 4G1TA 2XCBA 4XKCA 3FU6A 5AJLA 3ZYQA 4IYPA 2HM8A 4I2WA 3EIQC 4BTAA 4APFA 3FUMA 4YVOA 3D9MA 5AYWD 3L16A 4KVOA 4GPKA 3CK8A 1Z6TA 1EPUA 2C2LA 3P2BA 2J4BA 1XNFA 3DPDA 5KJKA 5BW8C 1GW6A 4JC8A 1FVHA 2KC7A 4PS7A 1H19A 3MEKA 2LAIA 3GZSA 4UI9K 4WNDA 4GU5A 5BPPA 4D10C 1ZBPA 3CGHA 5LCWC 2YQ8A 4GA1A 2C0MA 5G04C 2WM9A 3R9AB 4L2YA 5KJMA 5CMYA 3LS8A 2GRMA 4WAFA 3HIZA 2UY1A 2VSNA 4Y6WA 3T5VA 2AXZA 1DVPA 2GRLA 2PM6A 3SI5A 4I6JA 3ZHEB 4I1OB 2XEVA 4EBAA 2VGXA 4B94A 4WNGA 2HR2A 4AJWA 4L7TA 1ELWA 3EHMA 3ZIMA 1HS6A 4AXHA 3PUJA 3CVWA 3JQ1A 3G2SA 3I4RB 3LEWA 3GW4A 2VSXE 1E8YA 3JCKC 3QWVA 3QDNA 2XRYA 1JUQA 4V3IA 3S7JA 4AOFA 3T8MA 4JHKA 1P5QA 3SNXA 4J6IA 2DBAA 2WVIA 4U07A 3TXMA 2EQXA 3FU3A 4I1AA 5HQ8A 3FTYA 3PNLB 1IHGA 2X38A 4J0UA 3R7RA 1SZ9A 2J09A 2JLBA 3ASHA 4HS2A 4GCOA 3CEQA 2KCKA 4J8FA 3FEYA 1HO8A 1QNFA 2IQCA 2AW6A 3N71A 2FF4A 3D3MA 3O48A 4K03A 1WM5A 4N5CA 3LCAA 4F7AA 3KD7A 3QARA 5M72A 2YINA 4FJZA 5FQ7A 1IYGA 1EYHA 4L23A 1H2TC 3FP3A 2OV8A 4LCTA 4UI9J 1DNPA 1N54A 3CVLA 3I3NA 4OVUA 5LP0A 2KCVA 2FULA 3ONKA 3MYVA 3L08A 3MKRA 4Q96A 3UQ3A 4APOA 3SFZA 4U0UA 3TXNA 4ILIA 3ML8A 3SF4A 4BT8A 3UT8A 4BFRA 3ZYMA 2PQNA 4OVVA 2VGYA 4A3TA 2GGFA 1MHQA 4DK5A 3HVEA 1SQMA 3SHFA 2CFZA 5FWQA 4NQ0A 4B0ZA 4J8DA 2IF4A 4EZJA 4GZ5A 3VLEA 4BWRA 2LAHA 1NZNA 4RG9A 2IONA 3KEZA 3FDHA 4FULA 3ASGA 2DCPA 4XX5A 3ZYLA 3SGHA 2OVFA 1HX8A 2QY7A 4KBQA 1HH8A 2ILRA 2WQ7A 4GYYA 2LO6A 4UWFA 3FU5A 1PY1A 4EPZA 3AS8A 3QWPA 3R7QA 4I6GA 3CR3A 3FUEA 3RK6A 4C9BB 3RIBA 4FJYA 4GA0A 4GZ3A 5E76A 2VYIA 1A17A 3FH5A 1BPOA 3FTSA 3FUDA 2IOLA 3FUIA 1OWPA 3FY4A 3LKUA 4GZDA 3APFA 3FUKA 4G25A 3LVQE 2X3MA 5J90A 4AV7A 2WXFA 3QC1A 3PRZA 3LPZA 1ELKA 2NXPA 2AXUA 3VLFA 2LSUA 4BSXA 3CK9A 4A3VA 5EX3A 3CKCA 4WWOA 5KCMA 3FU0A 1B89A 4WWNA 3GZ1A 3P1UA 3QAQA 3JYSA 4GZCA 4DI4A 4GAAA 1FVFA 3EDTB 2CG2A 4HLEA 5BV0A 4U63A 3CQCB 1EDUA 3ESLA 4GZ6A 3S2AA 4TV3A 3PZDA 3ZYKA 3TG4A 1Y6IA 2M63A 2WPVA 2JEKA 4I1MA 1UN8A 3FTVA 3FHEA 3B7UX 4MS6A 1IQUA 3NZSA 5T3RA 4NRHB 4XI9A 3ESKA 4DLOA 3QWWA 3B7SA 4CDRA 2R59A 3OAWA 4KYOB 2WXLA 5LCWJ 4JHRA 4IRUA 5FZSA 2WXKA 3TL5A 3FUHA 3IBEA 4WWPA 4OYSA 2X6FA 3CHSA 4HOQA 5G55A 3VTYA 2L0TB 4I2ZA 3EJNA 4PH4B 5EKQD 2UY1B 4N2SA 1HF8A 2Y4UA 3MA5A 4JPSA 4CDNA 4CT0A 2Q7FA 3MGBA 4ANUA 2WMOA 3MV3B 1E8WA 3PUKA 3I4GA 3ZRHA 4XI0A 1WY6A 3D9PA 2XRZA 4AEZC 1HE8A 3G2TA 3Q15A 3IEGA 2XQ0A 5D0OD 3D9KA 4GB9A 1QZ2A 2Y3AA 4TRQA 3SD5A 3Q5MA 2PZIA 3PS6A 3MV2B 4FP7A 3BEEA 3QB2A 4CT4A 1U3CA 1H6KA 3CHQA 3D9OA 1UJKA 4GMLA 4JA9A 2WXMA 4ACLA 5KJLA 4F1SA 4CEMA 2P58C 4CRWA 4K0RA 3CHRA 2CHWA 3MJWA 3OXLA 2PL2A 4G11A 5ANRA 1KLXA 3D9LA 4N3CA 3BG0B 5J08A 4JA7A 3FWVA 4QFVA 4L1BA 1SZAA 4B89A 2CHZA 2V8SE 3SBTB 1HU3A 4UWKA 2Y4TA 4HVBA 3S7BA 3AU4A 4I43A 2FEZA 3B7TA 3OXFA 4MLPA 4FHKA 4EQFA 4UQXA 2V4LA 4JZYA 5G05C 5BNWA 3CHOA 5HI7A 3PE3A 1Z3YA 3PEVB 3CVYA 5DBKA 1N52A 1OWLA 4HOTA 4KMOA 4A1GA 5A23A 3EIJA 3LY7A 5FZQA 4KVMA 4N39A 2WXJA 4XE0A 2HYZA 4TUUA 3U64A 2KATA 3HVEB 3TJPA 4U8HA 4FA6A 4EZLA 2NC9A 2YHEA 3G2WA 3UUXA 3HHMA 3JQ0A 3FH7A 4AP2A 3U3WA 2VSOE 4I6EA 3S7FA 2PQRA 4N2QA 2WXPA 3MKQA 4KZ0A 3IHVA 4ATGA 3MZLB 2XGMA 5AIJA 3AS5A 1UN9A 3ZGQA 4Q69A 4MRUA 3UMVA 3FTXA 3CHMA 4E85A 2CFUA 3RO2A 3L17A 1E96B 4O6FA 4ILHB 3D9IA 3KAEA 2VTBA 1WAO1 3FTWA 2R5SA 4G24A 2IU1A 2CHXA 2X6KA 3U4TA 1L5JA 4HOUA 4NURA 5BT1A 5G04J 4HOSA 1OWMA 4EBAG 2J49A 3ASDA 2AXVA 2WXGA 3TG5A 1VDYA 3PVLA 3TAXA 3FTZA 4HFGA 3APDA 4DLQA 4GYWA 1TEZA 3ENEA 5CCLA 3RO3A 5CHEE 4JEUA 2J07A 2XPYA 4LUNU 3MKQB 1Z3XA 1MQSA 5FTPA 1UJJA 1PAQA 1ELRA 4GCNA 3FFLA 2QFCA 2A4ZA 5C2YA 3URZA 5BUZA 4U0ZA 2WXOA 2RD0A 3AS4A 4PUCA 3ML9A 2KM4A 3L13A 3DBSA 3ZPJA 4W9RA 4IULA 4N3AA 4RVBA 2L9BA 2V5FA 5FQ6A 4ACKA 4BTBA 4BT9A 3U66A 4CDMA 5LOZA 4FC8A 1YA0A 5KJNA 5FZRA 2X6HA 1E8ZA 3EHNA 4KT6B 2GW1A 2OOEA 2YNQA 4BX8A 3FTUA 5FQ8A 4KXKB 1EF1C 3Q4AB 5FT9A 4Q94A 4IN3B 4AY5A 4E6HA 3QKYA 5CCMA 1KT1A 2FBNA 5C1DA 3CVNA 3TGOA 4G23A 3QNKA 4A1SA 2WXRA 1IQRA 3L6AA 4AIFA 3D9NA 4JHJA 3RU0A 2XGOA 3CK7A 1H2UA 4H7XA 1X5BA 1TJCA 2VJ8A 2A5UA 3T5XA 3SZ7A 1XGWA 3B7RL 1HG5A 2IJGX 2V0PA 2VSYA 4YVQC 4B8CB 3QOUA 4JW1A 3G2VA 3UT4A 1OWOA 2J9QA 1NP7A 4YNDA 5CMWA 2FO7A 2YHCA 4G2VA 1OWNA 3KS2A 1FCHA 1HXIA 3PEUB 4RG6A 2L0IA 2I9CA 3RRNB 5AENA 1HFAA 2DIWA 5JJTA 3ZW3A 4F53A 4HORA 3CVVA 3NF1A 1OUVA 3LXUX 4L2LA 1PC2A 4WUYA 2OVBA 2WXQA 3RRUA 4LEUA 4AVXA 4I9CA 4DJAA 4EECA 3Q47B 5LFAA 3GYZA 3UX4A 3ZXSA 5BV1A 2BTDA 5AJDA 2CG3A 5JJ6A 2WXHA 3CSTA 1NA3A 5EDSA 2AVPA 2L6JA 5FJYA 2ZU6B 5A7DB 2I6HA 3FULA 4CCAA 2XPZA 2BUGA 2KCLA 4H7YA 2E0IA 3NQPA 1NA0A 3BG1B 3ASFA 3ZFWA 1UW4B 3PDNA 4ME2A 5ARGA 4JL0A 4Y6CA 3ZHEA 4JEHA 3B13A 3RRMB 2VGXB 2R17C 3U9WA 5E75A 4JXTA 5ANLA 2HO1A 4B8AA 1TJFA 2I1KA 5ARFA 2IOSA 1KT0A 2WXIA 4XKBA 2E2EA 4U0SA 3CHPA 4I9EA 2FI7A 5T8IA 3FUJA 2MOWA 2LNIA 4WNFA 3IKOB 4XZ4A 4BY6A 4ANVA 4BX9A 4MKTA 4URKA 1JPLA 4UWHA 1S0PA 4GYOA 3LJ3A 3HYMB 3NZUA 2PM7A 3QK0A 3VTXA 1JWFA 3FH8A 3LY9A 5LX8A 4M3OA 4KZCA 3JUIA 3K9IA 3SBSA 3S7DA 4JVSA 4P29A 4U04A 3CVQA 3L54A 4XIFA 5ENNA 3VLDA 3CQGB 2NSZA 1H0AA 4CGVA 1INZA 4UWGA 1E7VA 3IV0A 5T4YA 1JWGA 3CV0A 3ZVVA 4A55A 4PS8A 3MCXA 4GA2A 3LDZA 2VTBB 4CGWA 4FHJA 1QQEA 1E7UA 2J08A 3PH0C 1E8XA 2KZTB 3C98A 4RSYA 4UQZA 2WB2A 4NACA 2UWJG 5JHAA 3CVUA 1H2VC 2I2OA 2X6JA 3UT7A 3AU5A 4F3VA 1U3DA 4FLBA 4FU3A 1HG2A 3LYAA 3QJZA 4EZKA 4R7LA 1HZ4A 3Q49B 3MX3A 4AM9A 4WNEA 4DI3A 3E4BA 3FUFA 3PE4A 2WXNA 3CIAA 3IHYA 3WXXA 2RG8A 5FQ4A 4UWLA 1Y8MA 3G2UA 2XCCA 2I1JA 4FLHA 2BF0X 5D0QD 4UQYA 1LF8A 2WMNA 3CLJA 3OXGA 5DIZA 4LRZA 4HXIA 3ONLA 4ABNA 3PREA 3LY8A 4GMJA 4ANXA 3D9JA 3FEXA 3CVXA 5JJ7A 2LSVA 2KZTA 2VQ2A 4ILGA 2IFUA 2X6IA 3RJVA 3L22A 1W3BA 3CKBA 3GZ2A 1ZU2A 3APCA 2ONDA 4LERA 3LVRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AY6 A;  2FO7 A;  2YHC A;  3ASG A;  4G2V A;  5EX0 A;  3KS2 A;  4UI9 C;  2Y4T A;  1FCH A;  3S7B A;  3UPV A;  4KBQ A;  2FEZ A;  1HXI A;  1HH8 A;  3OXF A;  4RG6 A;  3RKV A;  4GYY A;  4EQF A;  2XPI A;  4UQX A;  5JJT A;  4HOR A;  2MHK A;  2XGS A;  5G05 C;  5HI7 A;  3NF1 A;  1OUV A;  3PE3 A;  4J8E A;  1PC2 A;  4WUY A;  5DBK A;  5BNW A;  4HOT A;  4LEU A;  4I9C A;  3AS8 A;  3Q47 B;  3LY7 A;  5FZQ A;  2C0L A;  3GYZ A;  4N39 A;  2HYZ A;  3QWP A;  5A6C A;  5G05 J;  5JJ6 A;  2KAT A;  2WQH A;  3ULQ A;  4G26 A;  1NA3 A;  2AVP A;  2L6J A;  5FJY A;  2NC9 A;  4I17 A;  3ZN3 A;  4N3B A;  3CVP A;  3RIB A;  4GA0 A;  2I6H A;  4G1T A;  4GZ3 A;  2VYI A;  1A17 A;  2BUG A;  2KCL A;  2XCB A;  4H7Y A;  3UUX A;  4I2W A;  4BTA A;  3U3W A;  3S7F A;  1NA0 A;  3LKU A;  2PQR A;  3ASF A;  4N2Q A;  4G25 A;  3ZFW A;  4YVO A;  4ME2 A;  3PDN A;  5ARG A;  5AYW D;  2XGM A;  4JL0 A;  4Y6C A;  3AS5 A;  3ZHE A;  3ZGQ A;  3CK8 A;  4GPK A;  2VGX B;  3LPZ A;  2C2L A;  2HO1 A;  2LSU A;  5ARF A;  1XNF A;  3CK9 A;  3RO2 A;  1KT0 A;  5EX3 A;  5KJK A;  3CKC A;  4O6F A;  1E96 B;  4RG9 A;  5BW8 C;  3KAE A;  2E2E A;  1WAO 1;  4U0S A;  2KC7 A;  4I9E A;  1B89 A;  2FI7 A;  2R5S A;  3MEK A;  4G24 A;  2LNI A;  3GZ1 A;  4UI9 K;  4WND A;  4HOU A;  4WNF A;  3U4T A;  3JYS A;  1ZBP A;  5BT1 A;  5G04 J;  3EDT B;  5LCW C;  2YQ8 A;  4GA1 A;  4HOS A;  2C0M A;  3ASD A;  4GYO A;  5G04 C;  4GZ6 A;  3HYM B;  3R9A B;  3VTX A;  5KJM A;  3LY9 A;  3TG5 A;  3K9I A;  2UY1 A;  2VSN A;  4Y6W A;  3S7D A;  3TG4 A;  3ZHE B;  2WPV A;  3CVQ A;  4U04 A;  4XIF A;  3TAX A;  2XEV A;  2VGX A;  4B94 A;  4WNG A;  2HR2 A;  4GYW A;  4CGV A;  5CCL A;  3RO3 A;  5CHE E;  1ELW A;  3CV0 A;  4NRH B;  4XI9 A;  5FTP A;  3ESK A;  4GA2 A;  1ELR A;  3QWW A;  4GCN A;  4KYO B;  3FFL A;  4CDR A;  4CGW A;  2QFC A;  3FWV A;  5LCW J;  4JHR A;  3URZ A;  1QQE A;  3GW4 A;  3QWV A;  4U0Z A;  3QDN A;  5FZS A;  3AS4 A;  3S7J A;  1P5Q A;  2DBA A;  4U07 A;  4W9R A;  3ZPJ A;  4I1A A;  4UQZ A;  5HQ8 A;  4N3A A;  4HOQ A;  1IHG A;  2UWJ G;  2V5F A;  4BTB A;  4J0U A;  4BT9 A;  2JLB A;  3ASH A;  3VTY A;  4F3V A;  1YA0 A;  4GCO A;  5KJN A;  2KCK A;  3CEQ A;  4I2Z A;  3LYA A;  2UY1 B;  2GW1 A;  2OOE A;  2Y4U A;  4J8F A;  5EKQ D;  4N2S A;  3MA5 A;  1HZ4 A;  5FZR A;  3Q49 B;  2Q7F A;  3N71 A;  4KXK B;  2FF4 A;  3Q4A B;  3O48 A;  5FT9 A;  4WNE A;  1WM5 A;  3MV3 B;  4N5C A;  4AM9 A;  3LCA A;  3KD7 A;  5M72 A;  3E4B A;  3PE4 A;  4XI0 A;  4IN3 B;  4AY5 A;  5CCM A;  3QKY A;  3WXX A;  1KT1 A;  1IYG A;  2FBN A;  5C1D A;  3CVN A;  3FP3 A;  3IEG A;  3Q15 A;  5D0O D;  1Y8M A;  3TGO A;  2XCC A;  4UI9 J;  1QZ2 A;  3CVL A;  5D0Q D;  2KCV A;  4G23 A;  5A7D B;  3Q5M A;  2PZI A;  3MKR A;  3MV2 B;  3UQ3 A;  4A1S A;  3BEE A;  4UQY A;  4AIF A;  4APO A;  3RU0 A;  2XGO A;  3CK7 A;  4U0U A;  3OXG A;  5DIZ A;  4JA9 A;  3SF4 A;  4H7X A;  4BT8 A;  1TJC A;  4ABN A;  5KJL A;  2J9Q A;  3LY8 A;  3SZ7 A;  2P58 C;  2VGY A;  2VSY A;  4YVQ C;  5JJ7 A;  3OXL A;  2LSV A;  2PL2 A;  1KLX A;  3QOU A;  4N3C A;  2VQ2 A;  4NQ0 A;  2IFU A;  4J8D A;  2IF4 A;  3RJV A;  4GZ5 A;  1W3B A;  4BWR A;  3CKB A;  3GZ2 A;  1ZU2 A;  2PQN A;  1NZN A;  4JA7 A;  2OND A;  4YND A; 
#chains in the Genus database with same CATH topology
 4DPR A;  4UI9 C;  3HXD A;  2MHK A;  2J4D A;  3C72 A;  5EYP F;  4C0E A;  4FAD A;  2AWI A;  3I5P A;  1SA4 A;  1E90 A;  4G26 A;  3CVP A;  3FU6 A;  1ZB1 A;  4IYP A;  3EIQ C;  4APF A;  4K5B A;  2F8Y A;  4YVO A;  4KVO A;  4GTR A;  3DSV A;  2J4B A;  5BW8 C;  4JC8 A;  4PS7 A;  3HXE A;  4GA1 A;  5G04 C;  5KJM A;  2GRM A;  2VSN A;  4Y6W A;  2AXZ A;  4I1O B;  2BED A;  2VGX A;  4WNG A;  2HR2 A;  1K1A A;  1ELW A;  3ZIM A;  1HS6 A;  4AXH A;  3GW4 A;  2VSX E;  1SVX A;  2XRY A;  2AJA A;  4RQI A;  4V3I A;  3T8M A;  4JHK A;  3SNX A;  3TXM A;  2DBA A;  2X38 A;  4J0U A;  2JLB A;  5HS0 A;  3CEQ A;  4J8F A;  2KXP C;  2AW6 A;  2FF4 A;  1DCQ A;  1WM5 A;  3ASN E;  3LCA A;  4FJZ A;  5FQ7 A;  1TNO A;  1H2T C;  1DNP A;  4O1O A;  5LP0 A;  2FUL A;  3UM2 A;  3SFZ A;  4U0U A;  4ILI A;  1QBQ A;  3SF4 A;  4BFR A;  4OVV A;  2VGY A;  4A3T A;  4DK5 A;  3HVE A;  1SQM A;  3SHF A;  4HI8 A;  3B7B A;  4TUM A;  5FWQ A;  4NQ0 A;  1SW6 A;  3V79 K;  3KEZ A;  2ILR A;  1Q2Z A;  4UWF A;  1PY1 A;  2XZT G;  3AS8 A;  4MBG A;  3PZ3 A;  3CR3 A;  2P2C P;  3TWU A;  4FJY A;  3FH5 A;  3FTS A;  3FUD A;  1SA5 A;  5J90 A;  3NOC D;  3LPZ A;  2XEN A;  3CKC A;  1B89 A;  4WWN A;  4U8Y D;  5BV0 A;  3CQC B;  3ESL A;  4GZ6 A;  2RFM A;  4TV3 A;  3PZD A;  2JEK A;  4I1M A;  1UN8 A;  3FHE A;  4XEI G;  3NZS A;  5T3R A;  4XI9 A;  4DLO A;  3B7S A;  2R59 A;  1DC2 A;  4TXP A;  2WXK A;  2X6F A;  3CHS A;  4B93 B;  1FT1 A;  4LNB A;  4M7C A;  5EKQ D;  5KNG A;  4PH4 B;  2Y4U A;  4BES A;  2WMO A;  3ULE G;  3ZRH A;  1WY6 A;  3D9P A;  2XRZ A;  5D0O D;  1QZ2 A;  3MV2 B;  3BEE A;  4CT4 A;  3CHQ A;  4GML A;  4EHM A;  2WXM A;  4F1S A;  5CRV A;  1TNY A;  3CHR A;  3PZ4 A;  3D9L A;  4N3C A;  3SFX A;  4JA7 A;  3ASO E;  3TWR A;  3EU9 A;  4HLL A;  4MLP A;  3B7T A;  5BNW A;  5A23 A;  3LY7 A;  2WXJ A;  4X8Q A;  2R03 A;  3G2W A;  3UUX A;  3HHM A;  2PQR A;  2WXP A;  4ATG A;  2XGM A;  3SY2 A;  3ZGQ A;  4MRU A;  3UMV A;  3FTX A;  2CFU A;  3RO2 A;  4GPM A;  1TYQ G;  3D9I A;  2VTB A;  4G24 A;  2X6K A;  4HRN A;  2J49 A;  2R2L A;  2WXG A;  3APD A;  3ZXP A;  4JEU A;  2J07 A;  5CRU A;  2XPY A;  4GTM A;  3R9M A;  2QFC A;  2Y0B G;  2WXO A;  3AS4 A;  4PUC A;  4QQI A;  2KM4 A;  3L13 A;  3ZPJ A;  4W9R A;  4BTB A;  3E33 A;  5ENP D;  4KT6 B;  5C1D A;  1TR4 A;  1N95 A;  3QNK A;  4A1S A;  4AIF A;  1AWC B;  3D9N A;  3RU0 A;  4O60 A;  1H2U A;  1TJC A;  3T5X A;  3B7R L;  2V0P A;  2VSY A;  4YVQ C;  5CMW A;  1WG0 A;  3KS2 A;  1FCH A;  4RG6 A;  5AEN A;  1HFA A;  2DIW A;  4F53 A;  1BD8 A;  1OUV A;  1PC2 A;  2GRP B;  3RRU A;  4DJA A;  3TWV A;  5LFA A;  1KZP A;  3GYZ A;  3ZXS A;  5BV1 A;  3EUV A;  3CST A;  5B1B E;  3ZU7 B;  4DX7 D;  2L6J A;  2ZU6 B;  2XPZ A;  2E0I A;  3NQP A;  4HQD A;  3PDN A;  4DX6 D;  4JL0 A;  3TWX A;  3EHQ A;  5E75 A;  4B8A A;  2IOS A;  2WXI A;  1LD8 A;  2E2E A;  3CHP A;  4HBD A;  2FI7 A;  2DYS E;  2MOW A;  2LNI A;  4WNF A;  3IKO B;  4BY6 A;  4BX9 A;  3HXB A;  4GYO A;  3LJ3 A;  3NZU A;  1WDY A;  1JWF A;  3LY9 A;  5LX8 A;  4LG6 A;  4JVS A;  4P29 A;  3L54 A;  2NSZ A;  4CGV A;  1E7V A;  3ZUV B;  1QQE A;  2J08 A;  4F1P A;  3PH0 C;  1E8X A;  4RSY A;  2QYU A;  2UWJ G;  2X6J A;  1JCQ A;  1U3D A;  4FLB A;  4FU3 A;  3QJZ A;  4EZK A;  3Q49 B;  4AM9 A;  5BXO A;  3PE4 A;  3IHY A;  2RG8 A;  1S63 A;  2XCC A;  2I1J A;  5D0Q D;  5EN5 D;  1D8E A;  3ONL A;  2ZGD A;  3CVX A;  3AG3 E;  3Q7A A;  2LUH A;  3L22 A;  2MRI A;  2GRQ B;  4JB8 P;  3ZEF A;  1TNB A;  2XGS A;  1RW2 A;  1KZO A;  4J8E A;  1LTX A;  4ANW A;  4PDX A;  2C0L A;  3FUN A;  5G05 J;  2WQH A;  3ULQ A;  3BQO A;  4G8L A;  2B6C A;  4C0M A;  4G1T A;  4XKC A;  3ZYQ A;  4I2W A;  2HM8 A;  4BTA A;  5CBO A;  3L16 A;  3UIO C;  5JMN D;  1FVH A;  3MEK A;  4WND A;  3GZS A;  2GRR B;  4YDE A;  2WM9 A;  3R9A B;  5CMY A;  3LS8 A;  3HIZ A;  2PM6 A;  1DVP A;  2KBX A;  4I6J A;  2XEV A;  4AJW A;  3V30 A;  3EHM A;  1FT2 A;  1N4Q A;  1Z5S C;  3JQ1 A;  1S64 A;  5D2M C;  2P9P G;  3QDN A;  3SO8 A;  3FTY A;  2J09 A;  3FEY A;  1HO8 A;  3N71 A;  3QAR A;  3W9G A;  1EYH A;  3FP3 A;  4LCT A;  3EHR A;  4U8V D;  3L08 A;  4Q96 A;  3UQ3 A;  4BT8 A;  2CFZ A;  2V4H C;  1LD7 A;  4J8Y A;  4J8D A;  2IF4 A;  2IY0 C;  4B0Z A;  4BWR A;  1NZN A;  5EID A;  2ION A;  3FDH A;  3AJI A;  3Q75 A;  5ENR D;  3UTM A;  2GRN B;  3UM3 A;  1HX8 A;  2QY7 A;  4KBQ A;  3ZNG A;  2WQ7 A;  2QZA A;  2LO6 A;  2ZXW E;  4EPZ A;  3C3R A;  3R7Q A;  2OEV A;  4I6G A;  3FUE A;  3RK6 A;  3LJN A;  3RIB A;  4GZ3 A;  1A17 A;  3FUI A;  3TWW A;  4GZD A;  3APF A;  3FUK A;  4G25 A;  4AV7 A;  2WXF A;  3QC1 A;  3PRZ A;  2AXU A;  2LSU A;  4WWO A;  3RSE G;  1MX6 A;  5ENS D;  3P1U A;  4GZC A;  4GAA A;  1FVF A;  5AQ9 A;  2CG2 A;  4HLE A;  3S2A A;  1O5M A;  3IXE A;  1Y6I A;  2WPV A;  4MS6 A;  1IQU A;  3DSU A;  3DEP A;  4YDO A;  3ESK A;  5LCW J;  4JHR A;  3TL5 A;  3IBE A;  3HG0 D;  2L0T B;  2UY1 B;  2LXM A;  4JPS A;  2Q7F A;  3MGB A;  4HRM B;  1E8W A;  3PUK A;  3W9F A;  1HE8 A;  3G2T A;  5BXU A;  3Q15 A;  4GTT A;  3D9K A;  4GB9 A;  2P9L G;  2PZI A;  4FP7 A;  3KSQ A;  2XS8 A;  3E37 A;  1N4R A;  1H6K A;  3D9O A;  4JA9 A;  5KWD A;  3MJW A;  3OXL A;  2L6B A;  3L9T A;  5J08 A;  3FWV A;  2XS1 A;  2Y1L E;  1HU3 A;  2Y4T A;  4BET A;  3DRA A;  3OXF A;  2XZD G;  4NIK A;  2IO3 C;  4JZY A;  5G05 C;  3PE3 A;  3C3O A;  4A1G A;  1MJ0 A;  4XE0 A;  2HYZ A;  3U64 A;  4FA6 A;  4EZL A;  3JQ0 A;  2VSO E;  4N2Q A;  4KZ0 A;  3IHV A;  5AIJ A;  4Q69 A;  5IY5 E;  3NOG D;  4ILH B;  1JCR A;  2R5S A;  1TN7 A;  1AP7 A;  1L5J A;  4HOU A;  1OWM A;  2P9N G;  3ASD A;  3WG7 E;  3KSL A;  3TG5 A;  4K5A B;  1VDY A;  3TAX A;  4DLQ A;  4GYW A;  3ENE A;  1Z3X A;  1UJJ A;  1PAQ A;  2A4Z A;  5C2Y A;  3ML9 A;  4IUL A;  4N3A A;  4BT9 A;  3U66 A;  1YA0 A;  5FZR A;  2YNQ A;  3FTU A;  4KXK B;  3Q4A B;  5FT9 A;  4IN3 B;  4AY5 A;  5CCM A;  1KT1 A;  3L82 A;  1IQR A;  4JHJ A;  5AQ7 A;  2XGO A;  3CK7 A;  4H7X A;  2VJ8 A;  2A5U A;  1XGW A;  2IJG X;  4TXR A;  3QOU A;  3G2V A;  3UT4 A;  1OWO A;  4ZHB A;  5CER B;  2JAB A;  2FO7 A;  4G2V A;  1OWN A;  2H6I A;  5CEC B;  5JJT A;  4HOR A;  3NF1 A;  2OVB A;  3TWT A;  2XEE A;  2P9I G;  3UX4 A;  5JJ6 A;  2WXH A;  1NA3 A;  2R02 A;  2OEW A;  2BUG A;  2F37 A;  3ASF A;  3ZFW A;  3B13 A;  2VGX B;  3U9W A;  4JXT A;  5ANL A;  2HO1 A;  5ARF A;  4YDY A;  4XKB A;  2MYO A;  4U0S A;  4URK A;  1S0P A;  3QK0 A;  4M3O A;  4CYM D;  4KZC A;  3K9I A;  5ENN A;  1H0A A;  1INZ A;  3CV0 A;  3MCX A;  4GA2 A;  3LDZ A;  3J5P A;  1E7U A;  5JA4 D;  2KZT B;  4NAC A;  3AU5 A;  1IKN D;  3NB2 A;  3LYA A;  1HZ4 A;  4DUI A;  3MX3 A;  2ETC A;  3WXX A;  5FQ4 A;  4UWL A;  1Y8M A;  3G2U A;  1YMP A;  4FLH A;  3JUE A;  4UQY A;  1BLX B;  2WMN A;  5DIZ A;  3LY8 A;  4GMJ A;  4BEP A;  3FEX A;  2X6I A;  1ZU2 A;  3APC A;  4C9B B;  2OND A;  4LER A;  3LVR E;  5AAO A;  3UPV A;  4GTS A;  3RKV A;  1TNU A;  2XPI A;  4PS3 A;  3CSF A;  3O4Z A;  1MX4 A;  5JHB A;  2A5E A;  2WQ6 A;  2XHE A;  2H6F A;  5A6C A;  4GMR A;  5G2N A;  3ZN3 A;  2XCB A;  5AJL A;  2BKK B;  5AYW D;  5AQB A;  3KEA A;  1Z6T A;  1EPU A;  5AQA A;  1XNF A;  5KJK A;  1GW6 A;  1OXJ A;  1H19 A;  4GU5 A;  2H6G A;  4D10 C;  5AN8 A;  4OAV B;  2YQ8 A;  2C0M A;  2R05 A;  4WAF A;  3T5V A;  2GRL A;  3ZHE B;  4DRX E;  3B95 A;  3SI5 A;  4B94 A;  1V55 E;  3PZ1 A;  2IO2 C;  3CVW A;  3I4R B;  3QWV A;  4AOF A;  3S7J A;  1P5Q A;  4J6I A;  5HQ8 A;  2EQX A;  4I1A A;  1IHG A;  2VGE A;  3R7R A;  3E30 A;  4HS2 A;  2KCK A;  2IQC A;  3O48 A;  4UUC A;  4N5C A;  3KD7 A;  2YIN A;  2FO1 E;  4L23 A;  2LXL A;  1N54 A;  3CVL A;  4OVU A;  1MZC A;  4APO A;  2DYR E;  3UIN C;  3TXN A;  3ML8 A;  1NI1 A;  3Q79 A;  3UM0 A;  3D9H A;  4FUL A;  3ASG A;  2DCP A;  4XX5 A;  3ZYL A;  2OVF A;  3J5Q B;  4L9P A;  5D66 A;  3QWP A;  5E76 A;  2IOL A;  1OWP A;  3LKU A;  1ELK A;  2NXP A;  3VLF A;  5B3S E;  3CK9 A;  2P9K G;  3EU5 A;  1DCE A;  4LNU D;  4O1P A;  4DI4 A;  3EDT B;  1OY3 D;  3ZYK A;  3TG4 A;  3FTV A;  3ABK E;  2ETB A;  3C5R A;  3QWW A;  4CDR A;  3OAW A;  4KYO B;  2QC9 A;  3VTY A;  4I2Z A;  4C48 B;  4N2S A;  1HF8 A;  3MA5 A;  3HXF A;  4ANU A;  3X2Q E;  3I4G A;  4AEZ C;  3IEG A;  2XQ0 A;  4TRQ A;  2DZN A;  3Q5M A;  5KJL A;  4CRW A;  2PL2 A;  4G11 A;  3BUA A;  3DST A;  1SZA A;  3SBT B;  3S7B A;  4FHK A;  4EQF A;  1Z3Y A;  3PEV B;  1A5E A;  5DBK A;  4HOT A;  3F6Q A;  4Z68 A;  5FZQ A;  4KVM A;  4N39 A;  2KAT A;  3HVE B;  3TJP A;  4U8H A;  2NC9 A;  4U95 D;  2YHE A;  3FH7 A;  3U3W A;  3S7F A;  3MKQ A;  1O1R A;  3AG1 E;  1UN9 A;  3DWL G;  4CZ2 D;  3Q7F A;  4E85 A;  3L17 A;  3KAE A;  1WAO 1;  2IU1 A;  2CHX A;  3U4T A;  4NUR A;  4HRL A;  5BT1 A;  4EBA G;  2V5Q C;  1U2V G;  3PVL A;  1H6O A;  3FTZ A;  4HFG A;  3AG4 E;  2H6H A;  1TEZ A;  3RO3 A;  5CHE E;  1ELR A;  4GCN A;  3UI2 A;  3FFL A;  4TXQ A;  3UKR G;  5BUZ A;  4U0Z A;  2RD0 A;  3SQV A;  1N0Q A;  3DBS A;  5FQ6 A;  4RVB A;  2L9B A;  2V5F A;  4ACK A;  4CDM A;  5LOZ A;  4FC8 A;  1FPP A;  2X6H A;  1E8Z A;  3V2X A;  2GW1 A;  1N9A A;  4GTQ A;  4BX8 A;  1EF1 C;  4Q94 A;  5CBN A;  3QKY A;  2J8S D;  3HXC A;  4G23 A;  1X5B A;  1HG5 A;  1N4S A;  4JW1 A;  1NP7 A;  4YND A;  2Y69 E;  4LSZ E;  1HXI A;  5HRY A;  2L0I A;  2I9C A;  3LXU X;  4AVX A;  4EEC A;  1O1S A;  2BTD A;  5AJD A;  3ULY A;  4DX1 A;  2AVP A;  5EDS A;  5A7D B;  4H7Y A;  3BG1 B;  4JD2 G;  1UW4 B;  1NFI E;  2R17 C;  1TJF A;  1KT0 A;  1D9S A;  1IHB A;  3FUJ A;  4ANV A;  3NBN B;  4ZFH A;  4MKT A;  1JPL A;  4UWH A;  2PM7 A;  3VTX A;  3FH8 A;  4J7W A;  4HB5 A;  3JUI A;  3SBS A;  5ENT D;  3S7D A;  4U04 A;  3VLD A;  3CQG B;  4UWG A;  3IV0 A;  3ZVV A;  2VTB B;  4CGW A;  4FHJ A;  2IEJ A;  3TWQ A;  2QYJ A;  3C98 A;  4UQZ A;  5H7P A;  5JHA A;  3CVU A;  3UT7 A;  4F3V A;  1HG2 A;  2OCC E;  2EIM E;  4WNE A;  4DI3 A;  3E4B A;  2WXN A;  3CIA A;  4YDW A;  2BF0 X;  5EYL A;  3CLJ A;  2ZGG A;  3OXG A;  4LRZ A;  4HXI A;  2EIL E;  3PRE A;  5JJ7 A;  2LSV A;  2KZT A;  4ILG A;  2IFU A;  3RJV A;  1W3B A;  1UOH A;  3CKB A;  3GZ2 A;  1IYG A;  2EIK E;  4AY6 A;  5EX0 A;  3OTN A;  4J8S A;  1UG3 A;  2XEH A;  1N0R A;  3DSW A;  1MYO A;  3PNT B;  4F6R D;  1K3Z D;  3HDX A;  1JCS A;  4I17 A;  4N3B A;  3HRA A;  3FUM A;  1S70 B;  3D9M A;  4BSZ B;  4GPK A;  3CK8 A;  3ABM E;  2C2L A;  3P2B A;  3DPD A;  5KNH D;  3Q78 A;  2KC7 A;  4GTO A;  4LNG A;  2LAI A;  4UI9 K;  5BPP A;  1ZBP A;  3CGH A;  4K5C A;  5LCW C;  4L2Y A;  2P9U G;  1TN8 A;  2UY1 A;  4EBA A;  4L7T A;  3SFY A;  3PUJ A;  3G2S A;  3LEW A;  1E8Y A;  3JCK C;  1JUQ A;  2WVI A;  4U07 A;  3FU3 A;  1D8D A;  3PNL B;  1SZ9 A;  3ASH A;  4GCO A;  3V31 A;  1QNF A;  3D3M A;  1G3N B;  4K03 A;  4F7A A;  5M72 A;  3DXM G;  2OV8 A;  4UI9 J;  3I3N A;  2KCV A;  3ONK A;  3MYV A;  3MKR A;  1N11 A;  3ZKJ A;  3T9K A;  3UT8 A;  3ZYM A;  2GGF A;  1MHQ A;  1KPS B;  5B1A E;  4G8K A;  4EZJ A;  4GZ5 A;  2B0O E;  3VLE A;  2LAH A;  4RG9 A;  3T8K A;  3ABL E;  3SGH A;  1HH8 A;  3UIP C;  4N5Q A;  4GYY A;  2P9S G;  3FU5 A;  2F8X K;  4GA0 A;  3Q9U C;  2VYI A;  1BPO A;  3FY4 A;  1RZ4 A;  3LVQ E;  2X3M A;  4RLY A;  2DWZ A;  2ZIS A;  4BSX A;  4A3V A;  5EX3 A;  4U96 D;  5KCM A;  3FU0 A;  5FIO A;  4GTP A;  3GZ1 A;  3QAQ A;  3JYS A;  3UXG A;  4U63 A;  1EDU A;  1OCZ E;  2M63 A;  3B7U X;  4NRH B;  2WXL A;  2EIJ E;  4IRU A;  3UKU G;  5FZS A;  3FUH A;  4WWP A;  4OYS A;  4HOQ A;  5G55 A;  3NAW A;  3EJN A;  5CED B;  1OCO E;  3DEO A;  4CDN A;  4CT0 A;  4BER A;  3MV3 B;  4XI0 A;  3E32 A;  2ZIR A;  1TNZ A;  2Y3A A;  3SD5 A;  3PS6 A;  3QB2 A;  1U3C A;  4ACL A;  1UJK A;  3DSX A;  4CEM A;  2P58 C;  4K0R A;  2EIN E;  3JXI A;  2CHW A;  2DVW A;  5ANR A;  1KLX A;  3BG0 B;  4QFV A;  1TN6 A;  4L1B A;  4B89 A;  2CHZ A;  2V8S E;  4UWK A;  4HVB A;  3AU4 A;  4I43 A;  2FEZ A;  4UQX A;  2V4L A;  3CHO A;  5HI7 A;  3CVY A;  1N52 A;  1OWL A;  3RAU A;  4KMO A;  3V2O A;  3ISM C;  3EIJ A;  2F0Y A;  4TUU A;  1N94 A;  2RKK A;  3AAA C;  1OCC E;  1BU9 A;  4AP2 A;  4I6E A;  3DXK G;  4OAU C;  3MZL B;  3Q9N C;  3AS5 A;  4U7E B;  5FIN A;  3CHM A;  1QYM A;  2BKG A;  2RFA A;  1E96 B;  4O6F A;  3FTW A;  5G04 J;  4HOS A;  2AXV A;  1BI8 B;  2ETA A;  5CCL A;  4LUN U;  3MKQ B;  5FTP A;  1MQS A;  3JXJ A;  3BU8 A;  3URZ A;  4DX2 A;  5KJN A;  3EHN A;  2OOE A;  2PNN A;  5FQ8 A;  5ENQ D;  1V54 E;  1X81 A;  3DPY A;  3UM1 A;  1YCS B;  4E6H A;  1K8K G;  2FBN A;  3CVN A;  3TGO A;  2WXR A;  3L6A A;  3SZ7 A;  1NL4 A;  4B8C B;  2DZO A;  1BI7 B;  2J9Q A;  2YHC A;  4DX5 D;  3C3Q A;  3PEU B;  3RRN B;  3ZW3 A;  3CVV A;  4L2L A;  4WUY A;  2WXQ A;  4LEU A;  4I9C A;  5EIB E;  3Q47 B;  3PZ2 A;  2CG3 A;  1K1B A;  5FJY A;  5ITZ F;  2GRO B;  2I6H A;  3FUL A;  4CCA A;  2KCL A;  1NA0 A;  2NYJ A;  4ME2 A;  5ARG A;  4Y6C A;  3ZHE A;  4JEH A;  5KBA A;  3RRM B;  2I1K A;  3Q73 A;  4HNA D;  3TWS A;  4I9E A;  5T8I A;  5EIL A;  4A63 B;  5ENO D;  4XZ4 A;  1YYH A;  1OCR E;  1IXV A;  3HYM B;  1H6P A;  5HKP A;  3CVQ A;  4XIF A;  5T4Y A;  1JWG A;  1MX2 A;  4A55 A;  4PS8 A;  4HI9 A;  5CEA A;  2WB2 A;  4ATZ D;  1H2V C;  2I2O A;  1OT8 A;  4R7L A;  2HE0 A;  1N4P A;  3FUF A;  3AG2 E;  1O1T A;  3E34 A;  1LF8 A;  4ABN A;  4ANX A;  3D9J A;  4GTV A;  5AAR A;  3DSS A;  2VQ2 A;  2PQN A; 
#chains in the Genus database with same CATH homology
 2MRI A;  4AY6 A;  4DPR A;  5EX0 A;  4UI9 C;  3UPV A;  3OTN A;  4J8S A;  3ZEF A;  3RKV A;  2XPI A;  4PS3 A;  2MHK A;  2XGS A;  2J4D A;  1UG3 A;  3CSF A;  3O4Z A;  4J8E A;  4ANW A;  5JHB A;  4PDX A;  4C0E A;  4FAD A;  3PNT B;  2C0L A;  2AWI A;  3I5P A;  2WQ6 A;  3HDX A;  3FUN A;  2XHE A;  5A6C A;  5G05 J;  2WQH A;  3ULQ A;  1E90 A;  4G26 A;  5G2N A;  4I17 A;  3ZN3 A;  4N3B A;  3CVP A;  4C0M A;  4G1T A;  2XCB A;  4XKC A;  3FU6 A;  5AJL A;  3ZYQ A;  4IYP A;  2HM8 A;  4I2W A;  3EIQ C;  4BTA A;  4APF A;  3FUM A;  4YVO A;  3D9M A;  5AYW D;  3L16 A;  4KVO A;  4GPK A;  3CK8 A;  1Z6T A;  1EPU A;  2C2L A;  3P2B A;  2J4B A;  1XNF A;  3DPD A;  5KJK A;  5BW8 C;  1GW6 A;  4JC8 A;  1FVH A;  2KC7 A;  4PS7 A;  1H19 A;  3MEK A;  2LAI A;  3GZS A;  4UI9 K;  4WND A;  4GU5 A;  5BPP A;  4D10 C;  1ZBP A;  3CGH A;  5LCW C;  2YQ8 A;  4GA1 A;  2C0M A;  5G04 C;  2WM9 A;  3R9A B;  4L2Y A;  5KJM A;  5CMY A;  3LS8 A;  2GRM A;  4WAF A;  3HIZ A;  2UY1 A;  2VSN A;  4Y6W A;  3T5V A;  2AXZ A;  1DVP A;  2GRL A;  2PM6 A;  3SI5 A;  4I6J A;  3ZHE B;  4I1O B;  2XEV A;  4EBA A;  2VGX A;  4B94 A;  4WNG A;  2HR2 A;  4AJW A;  4L7T A;  1ELW A;  3EHM A;  3ZIM A;  1HS6 A;  4AXH A;  3PUJ A;  3CVW A;  3JQ1 A;  3G2S A;  3I4R B;  3LEW A;  3GW4 A;  2VSX E;  1E8Y A;  3JCK C;  3QWV A;  3QDN A;  2XRY A;  1JUQ A;  4V3I A;  3S7J A;  4AOF A;  3T8M A;  4JHK A;  1P5Q A;  3SNX A;  4J6I A;  2DBA A;  2WVI A;  4U07 A;  3TXM A;  2EQX A;  3FU3 A;  4I1A A;  5HQ8 A;  3FTY A;  3PNL B;  1IHG A;  2X38 A;  4J0U A;  3R7R A;  1SZ9 A;  2J09 A;  2JLB A;  3ASH A;  4HS2 A;  4GCO A;  3CEQ A;  2KCK A;  4J8F A;  3FEY A;  1HO8 A;  1QNF A;  2IQC A;  2AW6 A;  3N71 A;  2FF4 A;  3D3M A;  3O48 A;  4K03 A;  1WM5 A;  4N5C A;  3LCA A;  4F7A A;  3KD7 A;  3QAR A;  5M72 A;  2YIN A;  4FJZ A;  5FQ7 A;  1IYG A;  1EYH A;  4L23 A;  1H2T C;  3FP3 A;  2OV8 A;  4LCT A;  4UI9 J;  1DNP A;  1N54 A;  3CVL A;  3I3N A;  4OVU A;  5LP0 A;  2KCV A;  2FUL A;  3ONK A;  3MYV A;  3L08 A;  3MKR A;  4Q96 A;  3UQ3 A;  4APO A;  3SFZ A;  4U0U A;  3TXN A;  4ILI A;  3ML8 A;  3SF4 A;  4BT8 A;  3UT8 A;  4BFR A;  3ZYM A;  2PQN A;  4OVV A;  2VGY A;  4A3T A;  2GGF A;  1MHQ A;  4DK5 A;  3HVE A;  1SQM A;  3SHF A;  2CFZ A;  5FWQ A;  4NQ0 A;  4B0Z A;  4J8D A;  2IF4 A;  4EZJ A;  4GZ5 A;  3VLE A;  4BWR A;  2LAH A;  1NZN A;  4RG9 A;  2ION A;  3KEZ A;  3FDH A;  4FUL A;  3ASG A;  2DCP A;  4XX5 A;  3ZYL A;  3SGH A;  2OVF A;  1HX8 A;  2QY7 A;  4KBQ A;  1HH8 A;  2ILR A;  2WQ7 A;  4GYY A;  2LO6 A;  4UWF A;  3FU5 A;  1PY1 A;  4EPZ A;  3AS8 A;  3QWP A;  3R7Q A;  4I6G A;  3CR3 A;  3FUE A;  3RK6 A;  4C9B B;  3RIB A;  4FJY A;  4GA0 A;  4GZ3 A;  5E76 A;  2VYI A;  1A17 A;  3FH5 A;  1BPO A;  3FTS A;  3FUD A;  2IOL A;  3FUI A;  1OWP A;  3FY4 A;  3LKU A;  4GZD A;  3APF A;  3FUK A;  4G25 A;  3LVQ E;  2X3M A;  5J90 A;  4AV7 A;  2WXF A;  3QC1 A;  3PRZ A;  3LPZ A;  1ELK A;  2NXP A;  2AXU A;  3VLF A;  2LSU A;  4BSX A;  3CK9 A;  4A3V A;  5EX3 A;  3CKC A;  4WWO A;  5KCM A;  3FU0 A;  1B89 A;  4WWN A;  3GZ1 A;  3P1U A;  3QAQ A;  3JYS A;  4GZC A;  4DI4 A;  4GAA A;  1FVF A;  3EDT B;  2CG2 A;  4HLE A;  5BV0 A;  4U63 A;  3CQC B;  1EDU A;  3ESL A;  4GZ6 A;  3S2A A;  4TV3 A;  3PZD A;  3ZYK A;  3TG4 A;  1Y6I A;  2M63 A;  2WPV A;  2JEK A;  4I1M A;  1UN8 A;  3FTV A;  3FHE A;  3B7U X;  4MS6 A;  1IQU A;  3NZS A;  5T3R A;  4NRH B;  4XI9 A;  3ESK A;  4DLO A;  3QWW A;  3B7S A;  4CDR A;  2R59 A;  3OAW A;  4KYO B;  2WXL A;  5LCW J;  4JHR A;  4IRU A;  5FZS A;  2WXK A;  3TL5 A;  3FUH A;  3IBE A;  4WWP A;  4OYS A;  2X6F A;  3CHS A;  4HOQ A;  5G55 A;  3VTY A;  2L0T B;  4I2Z A;  3EJN A;  4PH4 B;  5EKQ D;  2UY1 B;  4N2S A;  1HF8 A;  2Y4U A;  3MA5 A;  4JPS A;  4CDN A;  4CT0 A;  2Q7F A;  3MGB A;  4ANU A;  2WMO A;  3MV3 B;  1E8W A;  3PUK A;  3I4G A;  3ZRH A;  4XI0 A;  1WY6 A;  3D9P A;  2XRZ A;  4AEZ C;  1HE8 A;  3G2T A;  3Q15 A;  3IEG A;  2XQ0 A;  5D0O D;  3D9K A;  4GB9 A;  1QZ2 A;  2Y3A A;  4TRQ A;  3SD5 A;  3Q5M A;  2PZI A;  3PS6 A;  3MV2 B;  4FP7 A;  3BEE A;  3QB2 A;  4CT4 A;  1U3C A;  1H6K A;  3CHQ A;  3D9O A;  1UJK A;  4GML A;  4JA9 A;  2WXM A;  4ACL A;  5KJL A;  4F1S A;  4CEM A;  2P58 C;  4CRW A;  4K0R A;  3CHR A;  2CHW A;  3MJW A;  3OXL A;  2PL2 A;  4G11 A;  5ANR A;  1KLX A;  3D9L A;  4N3C A;  3BG0 B;  5J08 A;  4JA7 A;  3FWV A;  4QFV A;  4L1B A;  1SZA A;  4B89 A;  2CHZ A;  2V8S E;  3SBT B;  1HU3 A;  4UWK A;  2Y4T A;  4HVB A;  3S7B A;  3AU4 A;  4I43 A;  2FEZ A;  3B7T A;  3OXF A;  4MLP A;  4FHK A;  4EQF A;  4UQX A;  2V4L A;  4JZY A;  5G05 C;  5BNW A;  3CHO A;  5HI7 A;  3PE3 A;  1Z3Y A;  3PEV B;  3CVY A;  5DBK A;  1N52 A;  1OWL A;  4HOT A;  4KMO A;  4A1G A;  5A23 A;  3EIJ A;  3LY7 A;  5FZQ A;  4KVM A;  4N39 A;  2WXJ A;  4XE0 A;  2HYZ A;  4TUU A;  3U64 A;  2KAT A;  3HVE B;  3TJP A;  4U8H A;  4FA6 A;  4EZL A;  2NC9 A;  2YHE A;  3G2W A;  3UUX A;  3HHM A;  3JQ0 A;  3FH7 A;  4AP2 A;  3U3W A;  2VSO E;  4I6E A;  3S7F A;  2PQR A;  4N2Q A;  2WXP A;  3MKQ A;  4KZ0 A;  3IHV A;  4ATG A;  3MZL B;  2XGM A;  5AIJ A;  3AS5 A;  1UN9 A;  3ZGQ A;  4Q69 A;  4MRU A;  3UMV A;  3FTX A;  3CHM A;  4E85 A;  2CFU A;  3RO2 A;  3L17 A;  1E96 B;  4O6F A;  4ILH B;  3D9I A;  3KAE A;  2VTB A;  1WAO 1;  3FTW A;  2R5S A;  4G24 A;  2IU1 A;  2CHX A;  2X6K A;  3U4T A;  1L5J A;  4HOU A;  4NUR A;  5BT1 A;  5G04 J;  4HOS A;  1OWM A;  4EBA G;  2J49 A;  3ASD A;  2AXV A;  2WXG A;  3TG5 A;  1VDY A;  3PVL A;  3TAX A;  3FTZ A;  4HFG A;  3APD A;  4DLQ A;  4GYW A;  1TEZ A;  3ENE A;  5CCL A;  3RO3 A;  5CHE E;  4JEU A;  2J07 A;  2XPY A;  4LUN U;  3MKQ B;  1Z3X A;  1MQS A;  5FTP A;  1UJJ A;  1PAQ A;  1ELR A;  4GCN A;  3FFL A;  2QFC A;  2A4Z A;  5C2Y A;  3URZ A;  5BUZ A;  4U0Z A;  2WXO A;  2RD0 A;  3AS4 A;  4PUC A;  3ML9 A;  2KM4 A;  3L13 A;  3DBS A;  3ZPJ A;  4W9R A;  4IUL A;  4N3A A;  4RVB A;  2L9B A;  2V5F A;  5FQ6 A;  4ACK A;  4BTB A;  4BT9 A;  3U66 A;  4CDM A;  5LOZ A;  4FC8 A;  1YA0 A;  5KJN A;  5FZR A;  2X6H A;  1E8Z A;  3EHN A;  4KT6 B;  2GW1 A;  2OOE A;  2YNQ A;  4BX8 A;  3FTU A;  5FQ8 A;  4KXK B;  1EF1 C;  3Q4A B;  5FT9 A;  4Q94 A;  4IN3 B;  4AY5 A;  4E6H A;  3QKY A;  5CCM A;  1KT1 A;  2FBN A;  5C1D A;  3CVN A;  3TGO A;  4G23 A;  3QNK A;  4A1S A;  2WXR A;  1IQR A;  3L6A A;  4AIF A;  3D9N A;  4JHJ A;  3RU0 A;  2XGO A;  3CK7 A;  1H2U A;  4H7X A;  1X5B A;  1TJC A;  2VJ8 A;  2A5U A;  3T5X A;  3SZ7 A;  1XGW A;  3B7R L;  1HG5 A;  2IJG X;  2V0P A;  2VSY A;  4YVQ C;  4B8C B;  3QOU A;  4JW1 A;  3G2V A;  3UT4 A;  1OWO A;  2J9Q A;  1NP7 A;  4YND A;  5CMW A;  2FO7 A;  2YHC A;  4G2V A;  1OWN A;  3KS2 A;  1FCH A;  1HXI A;  3PEU B;  4RG6 A;  2L0I A;  2I9C A;  3RRN B;  5AEN A;  1HFA A;  2DIW A;  5JJT A;  3ZW3 A;  4F53 A;  4HOR A;  3CVV A;  3NF1 A;  1OUV A;  3LXU X;  4L2L A;  1PC2 A;  4WUY A;  2OVB A;  2WXQ A;  3RRU A;  4LEU A;  4AVX A;  4I9C A;  4DJA A;  4EEC A;  3Q47 B;  5LFA A;  3GYZ A;  3UX4 A;  3ZXS A;  5BV1 A;  2BTD A;  5AJD A;  2CG3 A;  5JJ6 A;  2WXH A;  3CST A;  1NA3 A;  5EDS A;  2AVP A;  2L6J A;  5FJY A;  2ZU6 B;  5A7D B;  2I6H A;  3FUL A;  4CCA A;  2XPZ A;  2BUG A;  2KCL A;  4H7Y A;  2E0I A;  3NQP A;  1NA0 A;  3BG1 B;  3ASF A;  3ZFW A;  1UW4 B;  3PDN A;  4ME2 A;  5ARG A;  4JL0 A;  4Y6C A;  3ZHE A;  4JEH A;  3B13 A;  3RRM B;  2VGX B;  2R17 C;  3U9W A;  5E75 A;  4JXT A;  5ANL A;  2HO1 A;  4B8A A;  1TJF A;  2I1K A;  5ARF A;  2IOS A;  1KT0 A;  2WXI A;  4XKB A;  2E2E A;  4U0S A;  3CHP A;  4I9E A;  2FI7 A;  5T8I A;  3FUJ A;  2MOW A;  2LNI A;  4WNF A;  3IKO B;  4XZ4 A;  4BY6 A;  4ANV A;  4BX9 A;  4MKT A;  4URK A;  1JPL A;  4UWH A;  1S0P A;  4GYO A;  3LJ3 A;  3HYM B;  3NZU A;  2PM7 A;  3QK0 A;  3VTX A;  1JWF A;  3FH8 A;  3LY9 A;  5LX8 A;  4M3O A;  4KZC A;  3JUI A;  3K9I A;  3SBS A;  3S7D A;  4JVS A;  4P29 A;  4U04 A;  3CVQ A;  3L54 A;  4XIF A;  5ENN A;  3VLD A;  3CQG B;  2NSZ A;  1H0A A;  4CGV A;  1INZ A;  4UWG A;  1E7V A;  3IV0 A;  5T4Y A;  1JWG A;  3CV0 A;  3ZVV A;  4A55 A;  4PS8 A;  3MCX A;  4GA2 A;  3LDZ A;  2VTB B;  4CGW A;  4FHJ A;  1QQE A;  1E7U A;  2J08 A;  3PH0 C;  1E8X A;  2KZT B;  3C98 A;  4RSY A;  4UQZ A;  2WB2 A;  4NAC A;  2UWJ G;  5JHA A;  3CVU A;  1H2V C;  2I2O A;  2X6J A;  3UT7 A;  3AU5 A;  4F3V A;  1U3D A;  4FLB A;  4FU3 A;  1HG2 A;  3LYA A;  3QJZ A;  4EZK A;  4R7L A;  1HZ4 A;  3Q49 B;  3MX3 A;  4AM9 A;  4WNE A;  4DI3 A;  3E4B A;  3FUF A;  3PE4 A;  2WXN A;  3CIA A;  3IHY A;  3WXX A;  2RG8 A;  5FQ4 A;  4UWL A;  1Y8M A;  3G2U A;  2XCC A;  2I1J A;  4FLH A;  2BF0 X;  5D0Q D;  4UQY A;  1LF8 A;  2WMN A;  3CLJ A;  3OXG A;  5DIZ A;  4LRZ A;  4HXI A;  3ONL A;  4ABN A;  3PRE A;  3LY8 A;  4GMJ A;  4ANX A;  3D9J A;  3FEX A;  3CVX A;  5JJ7 A;  2LSV A;  2KZT A;  2VQ2 A;  4ILG A;  2IFU A;  2X6I A;  3RJV A;  3L22 A;  1W3B A;  3CKB A;  3GZ2 A;  1ZU2 A;  3APC A;  2OND A;  4LER A;  3LVR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...