3AS5A

Mama amb-1 p212121
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
183
structure length
183
Chain Sequence
b'DDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELALVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
total genus 69
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as5A01
2XGOA 2J9QA 5ARFA 3S7FA 3EDTB 3GW4A 1KLXA 2VYIA 2YQ8A 1A17A 4YVQC 4GA2A 1QQEA 2R5SA 5BT1A 4XI9A 3KAEA 3QWWA 3OXLA 4N39A 3ASDA 2JLBA 5CCMA 2KCKA 1KT1A 4J8DA 4GZ5A 3LY7A 4WNFA 1OUVA 4NRHB 3ZHEA 5KJLA 3ZN3A 4IN3B 2FBNA 3LY8A 2Y4UA 1TJCA 5A7DB 3ZGQA 2KCVA 3AS8A 3AS5A 2XPIA 4N5CA 3CK7A 5FZSA 3JYSA 4G23A 2L6JA 3CVLA 4G1TA 4I2WA 5DIZA 2VSYA 4GZ3A 1ZU2A 3MV2B 5FTPA 2VSNA 1PC2A 2NC9A 3PE4A 4I2ZA 3RO3A 3E4BA 2C0MA 2XCCA 3CKCA 3KD7A 4CGWA 3ASHA 2LNIA 1ZBPA 3RIBA 5HQ8A 2UY1A 2WPVA 5FT9A 1XNFA 1Y8MA 2PQRA 3GZ1A 4B94A 3RKVA 3CKBA 3UUXA 4JL0A 2FO7A 4GYYA 2HYZA 2KATA 3RU0A 4HOUA 1FCHA 2VGYA 5G05C 2MHKA 2IF4A 3HYMB 4Y6CA 4KYOB 4UI9K 2GW1A 3VTXA 4UQZA 3OXGA 1YA0A 3PDNA 2WQHA 5BW8C 4AM9A 4CDRA 4HORA 5G04C 3GYZA 2ONDA 4J8EA 2AVPA 2VGXA 1NA0A 4LEUA 5JJ6A 3LYAA 4I17A 2XGMA 4J0UA 4G25A 4G24A 3MEKA 3U4TA 4GZ6A 2FF4A 3TG5A 4WNEA 2E2EA 3O48A 4WNGA 3ZFWA 2P58C 3LCAA 4ABNA 3ZPJA 2Y4TA 3QDNA 5EX0A 4G2VA 4I9EA 4I1AA 4GA1A 5G05J 4G26A 4GCOA 4BT9A 1ELRA 4UI9C 3S7BA 4CGVA 1QZ2A 5A6CA 3FP3A 3CV0A 3RJVA 4AY6A 3TGOA 1IHGA 3FFLA 2PL2A 5FZQA 2FI7A 2YHCA 5G04J 2OOEA 2C0LA 5D0OD 4HOQA 1NZNA 1E96B 4BT8A 4W9RA 4Y6WA 2QFCA 3TAXA 4N2SA 3CK8A 3URZA 4H7XA 3Q4AB 4J8FA 5CHEE 5M72A 3FWVA 3OXFA 5LCWC 3N71A 5KJMA 3WXXA 3UQ3A 3LKUA 1NA3A 4NQ0A 5HI7A 2PQNA 4UI9J 2PZIA 1HZ4A 4U04A 3MA5A 5BNWA 4O6FA 1WAO1 4JA7A 2DBAA 4H7YA 5C1DA 4GPKA 3Q5MA 5FJYA 3TG4A 3U3WA 5CCLA 1W3BA 4U0ZA 5KJKA 3BEEA 3CEQA 2I6HA 3LY9A 3IEGA 3QWVA 3PE3A 3Q49B 4N2QA 5DBKA 4A1SA 4WUYA 4AY5A 4U07A 4GA0A 3MV3B 3SF4A 5LCWJ 3QWPA 3ZHEB 3CK9A 3R9AB 2C2LA 4JHRA 3LPZA 1ELWA 1KT0A 3KS2A 4XIFA 3UPVA 2LSVA 3Q47B 4RG9A 5ARGA 4N3CA 4RG6A 1P5QA 2FEZA 3S7DA 4WNDA 4AIFA 4GYWA 2BUGA 3ASGA 3AS4A 3CVNA 4UQXA 3NF1A 1WM5A 4YVOA 4KXKB 5FZRA 4BWRA 2XEVA 4I9CA 4BTAA 4F3VA 3ULQA 3VTYA 2Q7FA 5KJNA 4HOTA 4KBQA 4ME2A 4N3BA 2UY1B 2XGSA 3QOUA 3SZ7A 2HO1A 3S7JA 4GCNA 2XCBA 4GYOA 4YNDA 1B89A 1HH8A 4XI0A 3Q15A 5D0QD 4U0SA 5AYWD 3GZ2A 2LSUA 5EKQD 5JJTA 1IYGA 2IFUA 5EX3A 3ESKA 4UQYA 4U0UA 2KC7A 4EQFA 4N3AA 2V5FA 2KCLA 3RO2A 4HOSA 5JJ7A 4BTBA 3K9IA 3ASFA 3MKRA 1HXIA 2VGXB 3QKYA 2VQ2A 4APOA 2HR2A 4JA9A 2UWJG 3CVPA 3CVQA
chains in the Genus database with same CATH superfamily
3SFZA 3S7FA 4ILGA 2WXRA 4BESA 1OXJA 4JPSA 3UXGA 2EIJE 2ETCA 2GRLA 3L13A 1IKND 1A17A 2V5QC 3J5PA 1QQEA 5CERB 3KAEA 5ANRA 2JLBA 3BU8A 4C0EA 3ZXPA 3ULEG 3FEYA 5AARA 2VSXE 3DPYA 4TUUA 3C98A 1TN8A 4TXQA 2FBNA 3LY8A 2Y4UA 1AWCB 1H6PA 5A7DB 3PS6A 3D3MA 3AS8A 5C2YA 3CGHA 2FO1E 3D9OA 2XQ0A 4BSZB 1O1RA 4HS2A 3ZIMA 4JEHA 5ENQD 3JQ1A 4G1TA 4I2WA 2Y3AA 1DNPA 1LD8A 3LJ3A 2VSNA 3KSLA 4IYPA 3PUJA 3NOGD 1OWOA 3RO3A 3E4BA 2AWIA 2VSOE 3ASHA 2XHEA 4GZCA 3RIBA 5HQ8A 2UY1A 4GB9A 4A3TA 1XNFA 2V4HC 3PZDA 3RKVA 3SQVA 3CKBA 1IQUA 3L54A 4TRQA 4BX9A 2XRZA 4GYYA 2ZU6B 2VJ8A 3RU0A 4AV7A 2GRQB 3D9NA 1Z3XA 4MS6A 2IF4A 3HHMA 4HFGA 4DX2A 4DLQA 4IULA 2X38A 2DZNA 3EUVA 3PNTB 4E6HA 2Y69E 1TYQG 4EBAG 1TN6A 5AJDA 2JABA 2WQHA 5BW8C 1S63A 3R9MA 3EU5A 5G04C 3B7UX 1JWFA 4G8LA 3DSVA 4UUCA 2VGXA 4I17A 4HNAD 3FH8A 1U2VG 4J0UA 3FY4A 2DYSE 3MEKA 2BEDA 4GZ6A 2EINE 5AQBA 2Y1LE 3TWXA 4ABNA 2XS8A 3E33A 4ILHB 3QDNA 2MOWA 1H2UA 5G05J 4G26A 4BT9A 4UI9C 3CVUA 3JQ0A 3MYVA 4JZYA 5A6CA 3IHVA 4AY6A 3JXIA 1IHGA 3V79K 4QQIA 4UWFA 3CHPA 3ZNGA 5AQAA 3S2AA 2P9NG 3G2VA 1QNFA 4RQIA 2WQ6A 5G55A 2OVBA 3TWTA 2VTBA 3CK8A 2KZTB 3CR3A 1JWGA 2ZXWE 3RK6A 3HXFA 3UINC 2HE0A 3DXKG 3UT8A 3OXFA 4WWPA 1JCRA 5KJMA 2B6CA 2H6FA 4CDNA 3WXXA 2WXJA 4F7AA 4C9BB 4EZLA 4PS7A 3BG0B 4NQ0A 5HI7A 3C5RA 4CEMA 3SY2A 2PZIA 4U04A 4A1GA 2F8XK 1H0AA 5BNWA 3IBEA 5H7PA 4XKCA 1MYOA 4XE0A 1XGWA 1S0PA 4JA7A 1NFIE 2OCCE 3C3QA 1N0RA 2MYOA 5FJYA 5JMND 4J7WA 3CVXA 3G2UA 3T5VA 2A5EA 3TG4A 4HVBA 5BPPA 1W3BA 2YINA 3IXEA 1NI1A 3NOCD 2CHZA 2X3MA 3PE3A 1HG5A 2IOLA 2PNNA 3NB2A 3CHMA 3TWRA 1DC2A 3G2SA 3VLDA 3RRMB 2KM4A 2X6HA 3SF4A 4HB5A 4A63B 3MZLB 5LCWJ 3QWPA 2EIKE 3ONKA 3HXEA 3CK9A 1K1AA 4M7CA 3SNXA 3LPZA 1ELWA 1KT0A 3JUIA 5ENPD 3UPVA 1MJ0A 3PZ1A 3Q47B 3D9KA 3UKRG 1L5JA 3CHQA 3Q7AA 4C48B 2J08A 2BUGA 3ASGA 3LVQE 3AG4E 2L0IA 3CVNA 4CZ2D 2ZGGA 1UOHA 3ZUVB 4BTAA 1N0QA 4I6JA 3CIAA 2X6KA 4GTOA 4GZDA 2GRMA 4KBQA 4U8HA 4ME2A 4N3BA 2XZTG 1QBQA 2UY1B 4BSXA 4MBGA 1E8XA 3QOUA 1OWMA 5JA4D 2OEVA 5J90A 2RKKA 2XCBA 3SFXA 2IO3C 1O1TA 4KVMA 1HH8A 3I4RB 2H6GA 2R05A 3FUFA 4DRXE 1DVPA 3FTWA 4AOFA 1IYGA 2WXPA 3ESLA 3U9WA 4U0UA 1HF8A 4EPZA 5KCMA 3T8MA 2CFZA 3PZ3A 1Q2ZA 4EQFA 4F1PA 2WM9A 4GTTA 4F53A 2IY0C 2E0IA 3K9IA 3DSSA 3MKRA 1HXIA 5FQ7A 4B93B 4GAAA 5KWDA 2VGXB 3QKYA 2HR2A 3CVPA 2DYRE 4DX1A 5FWQA 5ARFA 2NSZA 3UM3A 2QC9A 1SA5A 3GW4A 3L22A 4EHMA 4URKA 3ZKJA 4OYSA 4YVQC 3PRZA 4MKTA 1BI7B 4XI9A 5KBAA 4N39A 4I6GA 5HS0A 4J8DA 4GZ5A 3RRUA 1WG0A 1N94A 3ZHEA 1DCEA 2LXMA 3ZN3A 2XS1A 4CYMD 3BQOA 3ZGQA 4GPMA 2KCVA 5CMYA 2IOSA 3AS5A 3EJNA 2WB2A 3FTSA 4N5CA 2VTBB 3E34A 3SHFA 2L6JA 2ZISA 3ZU7B 3FH7A 1ZU2A 3MV2B 4Z68A 5FTPA 3CVVA 1OWNA 3EHRA 1TNBA 4U96D 1E8WA 2NC9A 3PE4A 3NZSA 4AP2A 1N95A 2P9KG 2C0MA 4ANVA 2R17C 1HU3A 1IQRA 3KD7A 3X2QE 4CGWA 2LO6A 3NZUA 3HXCA 1EF1C 1E7UA 2WXIA 3UUXA 2FO7A 3Q9UC 1SZ9A 1NL4A 4K5CA 1FCHA 3TWSA 2GGFA 2VGYA 4L7TA 4LNUD 5B1BE 5G05C 2MRIA 1RW2A 3NAWA 4KYOB 3C72A 5AJLA 3VTXA 2NXPA 4UQZA 5ENNA 1ELKA 3OXGA 3QC1A 1SW6A 1YA0A 4CDRA 1O1SA 3IHYA 2ONDA 4J8EA 2AVPA 3QNKA 3AJIA 4CCAA 3RAUA 1V55E 1EPUA 1UJJA 3UIPC 3L08A 4DX7D 1BI8B 4JB8P 3OAWA 2XPYA 3ZPJA 1U3CA 1OWPA 5LP0A 2OEWA 4I9EA 3EHNA 2I9CA 4OAUC 4JHKA 3S7BA 1QZ2A 4CGVA 3FP3A 2PM6A 3RJVA 4U8YD 3B95A 3AU4A 4YDYA 4LNGA 4U8VD 3FFLA 3ZYMA 2PL2A 5FZQA 2YNQA 2EIME 3ZVVA 5AQ9A 3PZ4A 4I43A 4GMRA 3B7BA 4BT8A 2L0TB 3ABLE 4W9RA 4UWGA 4RLYA 4BY6A 4GTSA 5ANLA 2WXQA 3DXMG 5M72A 2CG2A 3AG1E 4LCTA 3G2TA 5LCWC 2CG3A 4U95D 1QYMA 4GMJA 4OVVA 3L17A 2PQNA 3ZYQA 4KZ0A 4J6IA 2WXFA 3BUAA 2IO2C 5D2MC 3AG2E 2EILE 3L16A 1MX6A 1G3NB 1BU9A 1E8YA 4FHJA 3RRNB 3L6AA 5KNGA 3BEEA 1UN9A 3FTZA 3Q78A 3QWVA 3FU5A 3Q49B 3CSTA 5FIOA 4GTPA 2P9LG 4A1SA 1YCSB 4X8QA 3MKQA 5EILA 2L9BA 5CBNA 3PVLA 3ZHEB 4K03A 3EHMA 2XPZA 4PS8A 1SVXA 2WXGA 2WXNA 2DZOA 3FUEA 4J8SA 4RG9A 5ARGA 2BTDA 3S7DA 3R7QA 2X6FA 4YDEA 4GYWA 2WXLA 4DI3A 1WM5A 4YVOA 3ZYLA 4JW1A 4DI4A 2R02A 4MRUA 4N5QA 3UIOC 4BWRA 2XEVA 4F3VA 3ULQA 5KJNA 4DK5A 3FULA 4HOTA 1E8ZA 2XGSA 4B8AA 4HRLA 4GTRA 4FU3A 4LNBA 4M3OA 4GYOA 1OCRE 5FQ4A 3D9LA 2DIWA 4ATGA 3SBTB 4YNDA 1B89A 2GRPB 4L23A 2F37A 4AVXA 3Q15A 5D0QD 2J8SD 2LXLA 5JJTA 1OCCE 2IFUA 3TWVA 3UMVA 3LS8A 3FUHA 2VGEA 1H6OA 2AXZA 4N3AA 2BKGA 2V5FA 2KCLA 4E85A 4F6RD 3JCKC 1E90A 4BTBA 1N52A 1JPLA 4AJWA 2VQ2A 4ANWA 4APFA 4JA9A 2UWJG 1FT2A 3CVQA 2IQCA 2J9QA 4FHKA 3EDTB 2XEHA 5G2NA 4XZ4A 1SQMA 1KLXA 2YQ8A 4GMLA 1D8EA 1TNUA 4GA2A 4A3VA 5JHBA 2R5SA 1OCOE 5A23A 5BT1A 5BXUA 3QWWA 3EHQA 3OXLA 3ASDA 5CCMA 2KCKA 1KT1A 3LY7A 4WNFA 4PDXA 3HG0D 3V30A 3FU6A 3PZ2A 5AENA 5EDSA 1WY6A 1OWLA 5KJLA 3L9TA 2P9SG 2DVWA 4IN3B 4ZHBA 5ITZF 1TJCA 5T3RA 4G8KA 4KMOA 3DSUA 3BG1B 4HXIA 5FZSA 4NIKA 3JYSA 5CMWA 5DIZA 5JHAA 1EYHA 4WWNA 3C3OA 4I1OB 4ATZD 2IEJA 4HLLA 3UI2A 4CT4A 4UWKA 3PUKA 5J08A 4TUMA 4XX5A 3L82A 4DPRA 2M63A 3Q75A 1H2TC 4O60A 2CFUA 2LNIA 3QARA 2WPVA 2PQRA 3FTYA 4EBAA 3B13A 5LFAA 4JL0A 1Z6TA 4B89A 2HYZA 3CVWA 4HI8A 3P1UA 4U63A 4HOUA 4AEZC 1KPSB 2MHKA 3UKUG 1MZCA 4UI9K 3MKQB 2J4DA 2GW1A 2AW6A 1YYHA 4Q96A 3FH5A 1RZ4A 4NURA 2ILRA 3SGHA 1LTXA 5EIDA 4EZKA 4DX6D 3HXDA 3AG3E 1FPPA 4LEUA 3LYAA 3QB2A 2XGMA 2H6IA 1H2VC 4I6EA 3U4TA 4FULA 2F0YA 3ASOE 2E2EA 3UTMA 2YHEA 3ZFWA 3LCAA 1HFAA 2A4ZA 5HKPA 2X6IA 2Y4TA 5EX0A 2WXHA 3HIZA 4G2VA 2JEKA 4GA1A 5E76A 1N4RA 4Q94A 1TJFA 5FQ6A 4GCOA 2ETBA 1S70B 3W9GA 3EIJA 4XKBA 3SO8A 1Z3YA 3ZEFA 3V2XA 3HVEA 3FUNA 1K1BA 3TGOA 4TXPA 4D10C 1OCZE 3ZXSA 2YHCA 3DWLG 1V54E 5D0OD 4HOQA 3G2WA 5HRYA 2RFMA 3AU5A 1E96B 1H6KA 4Y6WA 3C3RA 3TAXA 5T4YA 4H7XA 4FLHA 3ML9A 3FEXA 3UM2A 5IY5E 2CHXA 2NYJA 4J8FA 3ENEA 3IV0A 1TEZA 3FU0A 2R03A 3HXBA 3UT4A 1INZA 3CVYA 4PS3A 3APCA 3UQ3A 2B0OE 3LKUA 4L1BA 1NA3A 3APFA 1AP7A 4HLEA 1HZ4A 3MA5A 1YMPA 4ANUA 1U3DA 1WAO1 3ULYA 5LOZA 2DBAA 2OV8A 4H7YA 1HO8A 3O4ZA 3EU9A 4I1MA 4GPKA 3Q5MA 1H19A 3E32A 4AXHA 4G11A 3CQCB 4U0ZA 5CECB 3CEQA 4JVSA 2I6HA 4HQDA 5DBKA 1BLXB 5EIBE 1PY1A 4GA0A 2XEEA 3FTUA 4HRMB 5FQ8A 1MQSA 4LERA 2BKKB 4JHJA 2C2LA 3DSXA 4J8YA 3FUKA 3FUDA 1BPOA 2GRNB 2QYUA 2QYJA 3TL5A 1TNZA 3KS2A 3MGBA 4N3CA 4RG6A 1N4PA 3QJZA 2LAHA 1E7VA 2RD0A 2HM8A 2OVFA 4ILIA 1TN7A 4NACA 4ACLA 4UQXA 1MX2A 4KXKB 3FTXA 2EQXA 3I5PA 5FZRA 5LX8A 4FADA 3KEAA 3KSQA 2WMOA 1IXVA 2BF0X 3LXUX 2Q7FA 5CRUA 3J5QB 4R7LA 1A5EA 3FTVA 3T5XA 4Q69A 3SZ7A 3JXJA 4GCNA 5ENSD 5B1AE 4KZCA 2XENA 1HG2A 1DCQA 4WAFA 2WXMA 3ISMC 3SFYA 4B8CB 4XI0A 4U0SA 3GZ2A 2LSUA 1KZOA 5EKQD 4FA6A 3QK0A 5AQ7A 3WG7E 4ANXA 3ESKA 4UQYA 3TWWA 3T9KA 1D8DA 1JCQA 4DJAA 4DLOA 4BX8A 1IHBA 5AAOA 3RO2A 5BXOA 3PH0C 3EIQC 1D9SA 2A5UA 2F8YA 2XGOA 1JUQA 2ETAA 2VYIA 2L6BA 4FJZA 2R2LA 5BV1A 4PUCA 4YDOA 4CDMA 5T8IA 1N11A 1LD7A 5BUZA 3SD5A 3JUEA 3GZSA 2PM7A 2AJAA 3ABKE 3HVEB 4C0MA 1OUVA 4NRHB 4B0ZA 2RG8A 3MJWA 1OY3D 5ENTD 2J09A 1K8KG 2J4BA 3F6QA 3SBSA 2XPIA 4L9PA 2P9UG 1WDYA 2FULA 2P9PG 2J49A 3PREA 3CK7A 2ZIRA 4BFRA 5CEDB 4CT0A 3I3NA 4G23A 2WMNA 3CVLA 3PEUB 3LJNA 2GROB 1JCSA 2ZGDA 3DEPA 2VSYA 3Q7FA 4GZ3A 4U7EB 1EDUA 3UM1A 3KEZA 2WQ7A 3MCXA 1SA4A 3NBNB 1PC2A 2P2CP 4MLPA 3SI5A 3DBSA 4I2ZA 3P2BA 4CRWA 1GW6A 2XCCA 3U64A 3CKCA 4DX5D 1UJKA 1UN8A 4LG6A 2CHWA 1ZBPA 4LSZE 5FT9A 1Y8MA 3B7TA 3W9FA 3GZ1A 4B94A 2IU1A 3RSEG 4WWOA 3ZYKA 1TNYA 3R7RA 2XZDG 5KNHD 3OTNA 2KATA 5CBOA 1N4SA 2V0PA 4UWHA 4HBDA 3HYMB 4Y6CA 5FINA 4JC8A 1X5BA 1TNOA 3B7SA 2I1KA 3LEWA 1Y6IA 3FUIA 1O5MA 3PDNA 3CSFA 4AM9A 4HORA 4RVBA 3GYZA 4QFVA 3CLJA 1HX8A 1NA0A 1S64A 3ZRHA 1N9AA 5JJ6A 3D9HA 4G25A 3T8KA 2QZAA 1FVFA 1MHQA 4K5BA 4G24A 4HRNA 5B3SE 2XRYA 4GTQA 2FF4A 3ASNE 3TG5A 4WNEA 4UWLA 3O48A 4WNGA 2P58C 4BERA 1KZPA 1UG3A 3E30A 1FVHA 4A55A 3DPDA 4I1AA 4TV3A 4L2LA 5AN8A 1ELRA 3ABME 4GTVA 4L2YA 3D9JA 1ZB1A 2KXPC 4JXTA 3Q73A 4IRUA 4ACKA 3CV0A 3NQPA 4JEUA 2RFAA 3FHEA 4BEPA 3FU3A 3TXNA 2LUHA 3HDXA 1PAQA 1UW4B 2FI7A 2WVIA 2OOEA 2C0LA 5G04J 3PNLB 5ENOD 3Q79A 1HE8A 3LVRE 1LF8A 4KVOA 3D9IA 1NZNA 2P9IG 2QFCA 2X6JA 4N2SA 3DRAA 3URZA 3Q4AB 2IJGX 5AIJA 2IONA 5CHEE 3V31A 5BV0A 3APDA 4GU5A 4BETA 2DCPA 3FWVA 3LDZA 3VLEA 1VDYA 3N71A 3ONLA 4XEIG 4P29A 3DSTA 4OVUA 1BD8A 1K3ZD 4UI9J 3D9PA 2I2OA 4O1OA 3B7RL 4O6FA 3TJPA 1OT8A 2R59A 2GRRB 5C1DA 1TR4A 3TWUA 4DUIA 2QY7A 1SZAA 2KBXA 4LRZA 3U3WA 5CCLA 3Q9NC 4FC8A 4RSYA 5EYLA 5KJKA 4KT6B 3LY9A 4GTMA 3IEGA 3DSWA 3QAQA 4N2QA 1NP7A 3UM0A 4FJYA 4WUYA 2DWZA 3IKOB 4AY5A 4U07A 4EECA 3MV3B 4ZFHA 1N4QA 4F1SA 3R9AB 4TXRA 2AXVA 3E37A 5D66A 4JHRA 3DEOA 3MX3A 4XIFA 2LSVA 3FUMA 1MX4A 1Z5SC 2AXUA 5ENRD 1P5QA 2FEZA 3UX4A 4WNDA 5E75A 4AIFA 2I1JA 3AS4A 2WXOA 3U66A 3TXMA 3NF1A 3AAAC 3UT7A 3ZW3A 2J07A 5CRVA 2WXKA 4I9CA 4JD2G 3VTYA 3PEVB 1HS6A 3CQGB 4FLBA 2V4LA 2HO1A 3S7JA 3FUJA 3TWQA 4YDWA 3CHRA 4O1PA 4EZJA 4LUNU 3VLFA 3CHOA 5CEAA 5AYWD 2LAIA 5EN5D 5EYPF 2KZTA 5EX3A 2H6HA 3I4GA 1X81A 3V2OA 1N54A 2KC7A 4K0RA 3CHSA 4V3IA 3ML8A 4PH4B 2V8SE 2Y0BG 4HOSA 5JJ7A 3FDHA 4K5AB 3ASFA 4OAVB 4FP7A 3D9MA 3HRAA 4APOA 4HI9A 1FT1A
chains in the Genus database with same CATH topology
2XGOA 1JUQA 3SFZA 2IQCA 2J9QA 4FHKA 5ARFA 3EDTB 4ILGA 2WXRA 5FWQA 3S7FA 2NSZA 5G2NA 4JPSA 4XZ4A 1SQMA 3GW4A 1KLXA 3L22A 2GRLA 2VYIA 4URKA 2YQ8A 3L13A 4FJZA 4OYSA 5BV1A 4GMLA 1A17A 4YVQC 3PRZA 4PUCA 4MKTA 4GA2A 4CDMA 1QQEA 4A3VA 5JHBA 2R5SA 5T8IA 5A23A 5BT1A 4XI9A 3KAEA 3QWWA 3OXLA 5BUZA 3SD5A 4N39A 3ASDA 2JLBA 4I6GA 5ANRA 2KCKA 4C0EA 5CCMA 1KT1A 3FEYA 2PM7A 3GZSA 4GZ5A 4J8DA 3LY7A 3HVEB 4C0MA 4WNFA 4PDXA 3FU6A 5AENA 3RRUA 2VSXE 5EDSA 4TUUA 1OUVA 1WY6A 4NRHB 1OWLA 3C98A 3ZHEA 5KJLA 4B0ZA 2RG8A 3ZN3A 4IN3B 2FBNA 3LY8A 2Y4UA 1TJCA 3MJWA 5T3RA 5A7DB 3ZGQA 3PS6A 3D3MA 2J09A 2KCVA 2J4BA 3AS8A 5CMYA 2IOSA 5C2YA 3AS5A 4KMOA 3CGHA 3EJNA 3SBSA 2WB2A 2XPIA 3FTSA 4N5CA 3D9OA 2FULA 2J49A 2XQ0A 3PREA 3CK7A 3BG1B 4HXIA 5FZSA 4HS2A 3ZIMA 2VTBB 4BFRA 3JYSA 4CT0A 3I3NA 4G23A 5CMWA 2WMNA 4JEHA 3SHFA 2L6JA 3CVLA 3PEUB 3JQ1A 4G1TA 4I2WA 5DIZA 2Y3AA 5JHAA 2VSYA 1DNPA 1EYHA 4GZ3A 4WWNA 3FH7A 1ZU2A 1EDUA 3KEZA 3MV2B 3LJ3A 4I1OB 2WQ7A 3MCXA 5FTPA 3CVVA 2VSNA 1OWNA 1PC2A 1E8WA 2NC9A 4CT4A 4MLPA 3PE4A 4IYPA 3PUJA 4UWKA 3PUKA 3SI5A 3DBSA 3NZSA 4I2ZA 1OWOA 5J08A 3P2BA 3RO3A 4AP2A 4CRWA 4XX5A 3E4BA 4DPRA 2M63A 2C0MA 1GW6A 4ANVA 2XCCA 2AWIA 2R17C 2VSOE 1HU3A 1H2TC 3CKCA 3U64A 2CFUA 1IQRA 1UJKA 3KD7A 1UN8A 4CGWA 2LO6A 3ASHA 3NZUA 2CHWA 2XHEA 2LNIA 4GZCA 1ZBPA 3RIBA 5HQ8A 3QARA 2UY1A 2WPVA 4GB9A 4A3TA 5FT9A 1XNFA 3B7TA 1Y8MA 1EF1C 2PQRA 3GZ1A 3PZDA 2IU1A 4B94A 3RKVA 1E7UA 3FTYA 4WWOA 2WXIA 3CKBA 1IQUA 3UUXA 3ZYKA 4EBAA 3L54A 3B13A 4TRQA 5LFAA 4JL0A 2FO7A 3R7RA 4BX9A 2XRZA 1Z6TA 4GYYA 1SZ9A 4B89A 2ZU6B 3OTNA 2HYZA 2KATA 3CVWA 2V0PA 4UWHA 3P1UA 2VJ8A 3RU0A 4AV7A 3D9NA 4U63A 4HOUA 1FCHA 4AEZC 2GGFA 2VGYA 4L7TA 1Z3XA 5G05C 2MRIA 2MHKA 4MS6A 2IF4A 3HYMB 4Y6CA 3HHMA 4HFGA 4DLQA 4IULA 4KYOB 4UI9K 2X38A 3MKQB 4JC8A 5AJLA 2J4DA 1X5BA 3PNTB 2GW1A 3VTXA 2AW6A 4E6HA 3B7SA 4EBAG 4Q96A 2I1KA 2NXPA 5AJDA 4UQZA 5ENNA 3LEWA 3FH5A 1Y6IA 1ELKA 3OXGA 4NURA 3FUIA 3QC1A 1YA0A 3PDNA 2WQHA 5BW8C 3CSFA 4AM9A 4CDRA 2ILRA 3SGHA 4HORA 4RVBA 3IHYA 5G04C 3GYZA 4QFVA 4EZKA 3B7UX 3CLJA 1JWFA 2ONDA 1HX8A 4J8EA 2AVPA 3QNKA 2VGXA 4CCAA 1NA0A 3ZRHA 4LEUA 5JJ6A 3LYAA 4I17A 3FH8A 3QB2A 2XGMA 1EPUA 4I6EA 1H2VC 4G25A 4J0UA 1UJJA 3FY4A 1FVFA 1MHQA 4G24A 3L08A 3MEKA 3U4TA 4FULA 4GZ6A 2XRYA 2FF4A 3TG5A 4WNEA 4UWLA 2E2EA 3O48A 4WNGA 2YHEA 2P58C 3ZFWA 3LCAA 4ABNA 1HFAA 2A4ZA 3OAWA 2XPYA 2X6IA 3ZPJA 2Y4TA 4ILHB 3QDNA 1U3CA 2MOWA 1H2UA 1UG3A 5EX0A 1FVHA 2WXHA 1OWPA 3HIZA 4G2VA 2JEKA 4I9EA 3DPDA 4A55A 5LP0A 4I1AA 4TV3A 4GA1A 5E76A 4Q94A 3EHNA 1TJFA 5FQ6A 5G05J 4L2LA 4G26A 2I9CA 4GCOA 4BT9A 1ELRA 4L2YA 4UI9C 3CVUA 3JQ0A 3MYVA 4JZYA 3EIJA 3D9JA 4JHKA 1QZ2A 4XKBA 3S7BA 4CGVA 5A6CA 4JXTA 3IHVA 4IRUA 4ACKA 1Z3YA 2PM6A 3FP3A 3ZEFA 3CV0A 3HVEA 3FUNA 3RJVA 4AY6A 3NQPA 4JEUA 3TGOA 3FHEA 3FU3A 3TXNA 4D10C 1IHGA 3AU4A 3HDXA 3ZXSA 3FFLA 4UWFA 1PAQA 3ZYMA 2PL2A 3CHPA 5FZQA 1UW4B 2FI7A 2YNQA 2YHCA 2WVIA 2OOEA 2C0LA 5D0OD 5G04J 3PNLB 1HE8A 3LVRE 4HOQA 3G2WA 3ZVVA 1LF8A 3S2AA 4KVOA 3G2VA 3D9IA 1NZNA 1QNFA 4I43A 3AU5A 2WQ6A 1E96B 4BT8A 5G55A 2L0TB 2OVBA 4W9RA 1H6KA 4UWGA 4Y6WA 2VTBA 2QFCA 2X6JA 4BY6A 3TAXA 5ANLA 5T4YA 3CK8A 4N2SA 3URZA 4H7XA 4FLHA 2KZTB 3ML9A 3FEXA 3CR3A 3Q4AB 1JWGA 2IJGX 5AIJA 2CHXA 2IONA 2WXQA 4J8FA 5CHEE 3RK6A 2CG2A 5BV0A 4LCTA 5M72A 3APDA 4GU5A 3ENEA 2DCPA 3IV0A 3UT8A 1TEZA 3FWVA 3FU0A 3LDZA 3OXFA 3G2TA 3UT4A 3VLEA 5LCWC 1INZA 1VDYA 2CG3A 3N71A 4WWPA 5KJMA 3CVYA 3ONLA 4PS3A 4CDNA 3WXXA 2WXJA 4F7AA 4C9BB 4EZLA 3APCA 4GMJA 3UQ3A 3LKUA 4L1BA 4OVVA 1NA3A 3APFA 4P29A 4PS7A 3L17A 3BG0B 4NQ0A 4OVUA 5HI7A 4CEMA 2PQNA 3ZYQA 4UI9J 4HLEA 3D9PA 2PZIA 1HZ4A 4U04A 2I2OA 3MA5A 4KZ0A 4A1GA 1H0AA 5BNWA 3IBEA 4ANUA 1U3DA 4XKCA 3B7RL 4O6FA 3TJPA 4J6IA 4XE0A 1WAO1 1XGWA 2WXFA 1S0PA 4JA7A 5LOZA 2DBAA 2OV8A 2R59A 4H7YA 1HO8A 3O4ZA 5C1DA 4I1MA 3L16A 4GPKA 2QY7A 3Q5MA 1SZAA 5FJYA 1H19A 3CVXA 3G2UA 3T5VA 4AXHA 3TG4A 4LRZA 3U3WA 1E8YA 5CCLA 4HVBA 5BPPA 1W3BA 2YINA 4FHJA 4G11A 3CQCB 3RRNB 4U0ZA 4FC8A 4RSYA 5KJKA 3L6AA 3BEEA 3CEQA 4JVSA 2I6HA 1UN9A 3FTZA 3LY9A 4KT6B 2CHZA 3IEGA 2X3MA 3QWVA 3FU5A 1HG5A 2IOLA 3PE3A 3Q49B 3QAQA 4N2QA 3CSTA 5DBKA 1NP7A 4FJYA 3CHMA 4A1SA 4WUYA 3MKQA 3G2SA 3IKOB 1PY1A 3VLDA 3RRMB 4AY5A 4U07A 4EECA 2KM4A 2L9BA 2X6HA 4GA0A 3FTUA 3MV3B 3SF4A 3MZLB 1MQSA 3PVLA 3QWPA 5FQ8A 5LCWJ 3ZHEB 4LERA 3ONKA 4F1SA 3CK9A 4JHJA 3R9AB 2AXVA 2C2LA 4K03A 4JHRA 3FUKA 3EHMA 2XPZA 3FUDA 1BPOA 3MX3A 3LPZA 4PS8A 1ELWA 3SNXA 3TL5A 1KT0A 2WXGA 3JUIA 3KS2A 2WXNA 4XIFA 3UPVA 2LSVA 3FUMA 3MGBA 3FUEA 4J8SA 2AXUA 3Q47B 4RG9A 5ARGA 3D9KA 4N3CA 4RG6A 1P5QA 2BTDA 1L5JA 3CHQA 2FEZA 3QJZA 3S7DA 2LAHA 1E7VA 4WNDA 3UX4A 3R7QA 2RD0A 2X6FA 5E75A 4AIFA 2J08A 4GYWA 2HM8A 2WXLA 2OVFA 2BUGA 3ASGA 3LVQE 4ILIA 2I1JA 3AS4A 2WXOA 3U66A 2L0IA 3CVNA 4NACA 4DI3A 4ACLA 4UQXA 3TXMA 3NF1A 1WM5A 4YVOA 3ZYLA 4JW1A 4DI4A 3UT7A 4KXKB 4MRUA 3FTXA 3ZW3A 2EQXA 2J07A 3I5PA 2WXKA 5FZRA 4BWRA 5LX8A 2XEVA 4I9CA 4BTAA 4FADA 2WMOA 4I6JA 2BF0X 3CIAA 4F3VA 3LXUX 3ULQA 3VTYA 2X6KA 2Q7FA 3PEVB 4GZDA 5KJNA 4R7LA 4DK5A 3FULA 4HOTA 2GRMA 1HS6A 3CQGB 1E8ZA 4KBQA 4U8HA 4ME2A 4N3BA 2UY1B 4BSXA 3FTVA 2XGSA 3T5XA 1E8XA 4Q69A 4B8AA 3QOUA 4FLBA 1OWMA 2V4LA 2HO1A 4FU3A 3S7JA 3SZ7A 4GCNA 5J90A 3FUJA 4M3OA 2XCBA 4GYOA 3CHRA 4KZCA 5FQ4A 3D9LA 1HG2A 2DIWA 4ATGA 4WAFA 2WXMA 3SBTB 4YNDA 1B89A 4KVMA 1HH8A 3I4RB 4L23A 4XI0A 4B8CB 4EZJA 4LUNU 3VLFA 4AVXA 3Q15A 3CHOA 5D0QD 4U0SA 5AYWD 3FUFA 3GZ2A 2LSUA 5EKQD 1DVPA 2LAIA 4FA6A 3QK0A 5JJTA 3FTWA 4AOFA 1IYGA 4ANXA 2IFUA 2KZTA 2WXPA 5EX3A 3ESKA 4UQYA 3I4GA 3UMVA 3LS8A 4DJAA 3ESLA 1N54A 3U9WA 4U0UA 3FUHA 2KC7A 4K0RA 1HF8A 2AXZA 4EPZA 3CHSA 4DLOA 5KCMA 4BX8A 3T8MA 2CFZA 4V3IA 4EQFA 4N3AA 3ML8A 4PH4B 2V5FA 2KCLA 2WM9A 2V8SE 4E85A 3RO2A 4F53A 3PH0C 4HOSA 3JCKC 1E90A 2E0IA 3EIQC 3FDHA 3K9IA 4BTBA 5JJ7A 1N52A 3ASFA 3MKRA 1HXIA 1JPLA 5FQ7A 4GAAA 4FP7A 2VGXB 3D9MA 3QKYA 4AJWA 2VQ2A 2A5UA 4ANWA 4APOA 2HR2A 4APFA 4JA9A 2UWJG 3CVPA 3CVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGO A;  2J9Q A;  5ARF A;  3S7F A;  3EDT B;  3GW4 A;  1KLX A;  2VYI A;  2YQ8 A;  1A17 A;  4YVQ C;  4GA2 A;  1QQE A;  2R5S A;  5BT1 A;  4XI9 A;  3KAE A;  3QWW A;  3OXL A;  4N39 A;  3ASD A;  2JLB A;  5CCM A;  2KCK A;  1KT1 A;  4J8D A;  4GZ5 A;  3LY7 A;  4WNF A;  1OUV A;  4NRH B;  3ZHE A;  5KJL A;  3ZN3 A;  4IN3 B;  2FBN A;  3LY8 A;  2Y4U A;  1TJC A;  5A7D B;  3ZGQ A;  2KCV A;  3AS8 A;  3AS5 A;  2XPI A;  4N5C A;  3CK7 A;  5FZS A;  3JYS A;  4G23 A;  2L6J A;  3CVL A;  4G1T A;  4I2W A;  5DIZ A;  2VSY A;  4GZ3 A;  1ZU2 A;  3MV2 B;  5FTP A;  2VSN A;  1PC2 A;  2NC9 A;  3PE4 A;  4I2Z A;  3RO3 A;  3E4B A;  2C0M A;  2XCC A;  3CKC A;  3KD7 A;  4CGW A;  3ASH A;  2LNI A;  1ZBP A;  3RIB A;  5HQ8 A;  2UY1 A;  2WPV A;  5FT9 A;  1XNF A;  1Y8M A;  2PQR A;  3GZ1 A;  4B94 A;  3RKV A;  3CKB A;  3UUX A;  4JL0 A;  2FO7 A;  4GYY A;  2HYZ A;  2KAT A;  3RU0 A;  4HOU A;  1FCH A;  2VGY A;  5G05 C;  2MHK A;  2IF4 A;  3HYM B;  4Y6C A;  4KYO B;  4UI9 K;  2GW1 A;  3VTX A;  4UQZ A;  3OXG A;  1YA0 A;  3PDN A;  2WQH A;  5BW8 C;  4AM9 A;  4CDR A;  4HOR A;  5G04 C;  3GYZ A;  2OND A;  4J8E A;  2AVP A;  2VGX A;  1NA0 A;  4LEU A;  5JJ6 A;  3LYA A;  4I17 A;  2XGM A;  4J0U A;  4G25 A;  4G24 A;  3MEK A;  3U4T A;  4GZ6 A;  2FF4 A;  3TG5 A;  4WNE A;  2E2E A;  3O48 A;  4WNG A;  3ZFW A;  2P58 C;  3LCA A;  4ABN A;  3ZPJ A;  2Y4T A;  3QDN A;  5EX0 A;  4G2V A;  4I9E A;  4I1A A;  4GA1 A;  5G05 J;  4G26 A;  4GCO A;  4BT9 A;  1ELR A;  4UI9 C;  3S7B A;  4CGV A;  1QZ2 A;  5A6C A;  3FP3 A;  3CV0 A;  3RJV A;  4AY6 A;  3TGO A;  1IHG A;  3FFL A;  2PL2 A;  5FZQ A;  2FI7 A;  2YHC A;  5G04 J;  2OOE A;  2C0L A;  5D0O D;  4HOQ A;  1NZN A;  1E96 B;  4BT8 A;  4W9R A;  4Y6W A;  2QFC A;  3TAX A;  4N2S A;  3CK8 A;  3URZ A;  4H7X A;  3Q4A B;  4J8F A;  5CHE E;  5M72 A;  3FWV A;  3OXF A;  5LCW C;  3N71 A;  5KJM A;  3WXX A;  3UQ3 A;  3LKU A;  1NA3 A;  4NQ0 A;  5HI7 A;  2PQN A;  4UI9 J;  2PZI A;  1HZ4 A;  4U04 A;  3MA5 A;  5BNW A;  4O6F A;  1WAO 1;  4JA7 A;  2DBA A;  4H7Y A;  5C1D A;  4GPK A;  3Q5M A;  5FJY A;  3TG4 A;  3U3W A;  5CCL A;  1W3B A;  4U0Z A;  5KJK A;  3BEE A;  3CEQ A;  2I6H A;  3LY9 A;  3IEG A;  3QWV A;  3PE3 A;  3Q49 B;  4N2Q A;  5DBK A;  4A1S A;  4WUY A;  4AY5 A;  4U07 A;  4GA0 A;  3MV3 B;  3SF4 A;  5LCW J;  3QWP A;  3ZHE B;  3CK9 A;  3R9A B;  2C2L A;  4JHR A;  3LPZ A;  1ELW A;  1KT0 A;  3KS2 A;  4XIF A;  3UPV A;  2LSV A;  3Q47 B;  4RG9 A;  5ARG A;  4N3C A;  4RG6 A;  1P5Q A;  2FEZ A;  3S7D A;  4WND A;  4AIF A;  4GYW A;  2BUG A;  3ASG A;  3AS4 A;  3CVN A;  4UQX A;  3NF1 A;  1WM5 A;  4YVO A;  4KXK B;  5FZR A;  4BWR A;  2XEV A;  4I9C A;  4BTA A;  4F3V A;  3ULQ A;  3VTY A;  2Q7F A;  5KJN A;  4HOT A;  4KBQ A;  4ME2 A;  4N3B A;  2UY1 B;  2XGS A;  3QOU A;  3SZ7 A;  2HO1 A;  3S7J A;  4GCN A;  2XCB A;  4GYO A;  4YND A;  1B89 A;  1HH8 A;  4XI0 A;  3Q15 A;  5D0Q D;  4U0S A;  5AYW D;  3GZ2 A;  2LSU A;  5EKQ D;  5JJT A;  1IYG A;  2IFU A;  5EX3 A;  3ESK A;  4UQY A;  4U0U A;  2KC7 A;  4EQF A;  4N3A A;  2V5F A;  2KCL A;  3RO2 A;  4HOS A;  5JJ7 A;  4BTB A;  3K9I A;  3ASF A;  3MKR A;  1HXI A;  2VGX B;  3QKY A;  2VQ2 A;  4APO A;  2HR2 A;  4JA9 A;  2UWJ G;  3CVP A;  3CVQ A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  3S7F A;  4ILG A;  2WXR A;  4BES A;  1OXJ A;  4JPS A;  3UXG A;  2EIJ E;  2ETC A;  2GRL A;  3L13 A;  1IKN D;  1A17 A;  2V5Q C;  3J5P A;  1QQE A;  5CER B;  3KAE A;  5ANR A;  2JLB A;  3BU8 A;  4C0E A;  3ZXP A;  3ULE G;  3FEY A;  5AAR A;  2VSX E;  3DPY A;  4TUU A;  3C98 A;  1TN8 A;  4TXQ A;  2FBN A;  3LY8 A;  2Y4U A;  1AWC B;  1H6P A;  5A7D B;  3PS6 A;  3D3M A;  3AS8 A;  5C2Y A;  3CGH A;  2FO1 E;  3D9O A;  2XQ0 A;  4BSZ B;  1O1R A;  4HS2 A;  3ZIM A;  4JEH A;  5ENQ D;  3JQ1 A;  4G1T A;  4I2W A;  2Y3A A;  1DNP A;  1LD8 A;  3LJ3 A;  2VSN A;  3KSL A;  4IYP A;  3PUJ A;  3NOG D;  1OWO A;  3RO3 A;  3E4B A;  2AWI A;  2VSO E;  3ASH A;  2XHE A;  4GZC A;  3RIB A;  5HQ8 A;  2UY1 A;  4GB9 A;  4A3T A;  1XNF A;  2V4H C;  3PZD A;  3RKV A;  3SQV A;  3CKB A;  1IQU A;  3L54 A;  4TRQ A;  4BX9 A;  2XRZ A;  4GYY A;  2ZU6 B;  2VJ8 A;  3RU0 A;  4AV7 A;  2GRQ B;  3D9N A;  1Z3X A;  4MS6 A;  2IF4 A;  3HHM A;  4HFG A;  4DX2 A;  4DLQ A;  4IUL A;  2X38 A;  2DZN A;  3EUV A;  3PNT B;  4E6H A;  2Y69 E;  1TYQ G;  4EBA G;  1TN6 A;  5AJD A;  2JAB A;  2WQH A;  5BW8 C;  1S63 A;  3R9M A;  3EU5 A;  5G04 C;  3B7U X;  1JWF A;  4G8L A;  3DSV A;  4UUC A;  2VGX A;  4I17 A;  4HNA D;  3FH8 A;  1U2V G;  4J0U A;  3FY4 A;  2DYS E;  3MEK A;  2BED A;  4GZ6 A;  2EIN E;  5AQB A;  2Y1L E;  3TWX A;  4ABN A;  2XS8 A;  3E33 A;  4ILH B;  3QDN A;  2MOW A;  1H2U A;  5G05 J;  4G26 A;  4BT9 A;  4UI9 C;  3CVU A;  3JQ0 A;  3MYV A;  4JZY A;  5A6C A;  3IHV A;  4AY6 A;  3JXI A;  1IHG A;  3V79 K;  4QQI A;  4UWF A;  3CHP A;  3ZNG A;  5AQA A;  3S2A A;  2P9N G;  3G2V A;  1QNF A;  4RQI A;  2WQ6 A;  5G55 A;  2OVB A;  3TWT A;  2VTB A;  3CK8 A;  2KZT B;  3CR3 A;  1JWG A;  2ZXW E;  3RK6 A;  3HXF A;  3UIN C;  2HE0 A;  3DXK G;  3UT8 A;  3OXF A;  4WWP A;  1JCR A;  5KJM A;  2B6C A;  2H6F A;  4CDN A;  3WXX A;  2WXJ A;  4F7A A;  4C9B B;  4EZL A;  4PS7 A;  3BG0 B;  4NQ0 A;  5HI7 A;  3C5R A;  4CEM A;  3SY2 A;  2PZI A;  4U04 A;  4A1G A;  2F8X K;  1H0A A;  5BNW A;  3IBE A;  5H7P A;  4XKC A;  1MYO A;  4XE0 A;  1XGW A;  1S0P A;  4JA7 A;  1NFI E;  2OCC E;  3C3Q A;  1N0R A;  2MYO A;  5FJY A;  5JMN D;  4J7W A;  3CVX A;  3G2U A;  3T5V A;  2A5E A;  3TG4 A;  4HVB A;  5BPP A;  1W3B A;  2YIN A;  3IXE A;  1NI1 A;  3NOC D;  2CHZ A;  2X3M A;  3PE3 A;  1HG5 A;  2IOL A;  2PNN A;  3NB2 A;  3CHM A;  3TWR A;  1DC2 A;  3G2S A;  3VLD A;  3RRM B;  2KM4 A;  2X6H A;  3SF4 A;  4HB5 A;  4A63 B;  3MZL B;  5LCW J;  3QWP A;  2EIK E;  3ONK A;  3HXE A;  3CK9 A;  1K1A A;  4M7C A;  3SNX A;  3LPZ A;  1ELW A;  1KT0 A;  3JUI A;  5ENP D;  3UPV A;  1MJ0 A;  3PZ1 A;  3Q47 B;  3D9K A;  3UKR G;  1L5J A;  3CHQ A;  3Q7A A;  4C48 B;  2J08 A;  2BUG A;  3ASG A;  3LVQ E;  3AG4 E;  2L0I A;  3CVN A;  4CZ2 D;  2ZGG A;  1UOH A;  3ZUV B;  4BTA A;  1N0Q A;  4I6J A;  3CIA A;  2X6K A;  4GTO A;  4GZD A;  2GRM A;  4KBQ A;  4U8H A;  4ME2 A;  4N3B A;  2XZT G;  1QBQ A;  2UY1 B;  4BSX A;  4MBG A;  1E8X A;  3QOU A;  1OWM A;  5JA4 D;  2OEV A;  5J90 A;  2RKK A;  2XCB A;  3SFX A;  2IO3 C;  1O1T A;  4KVM A;  1HH8 A;  3I4R B;  2H6G A;  2R05 A;  3FUF A;  4DRX E;  1DVP A;  3FTW A;  4AOF A;  1IYG A;  2WXP A;  3ESL A;  3U9W A;  4U0U A;  1HF8 A;  4EPZ A;  5KCM A;  3T8M A;  2CFZ A;  3PZ3 A;  1Q2Z A;  4EQF A;  4F1P A;  2WM9 A;  4GTT A;  4F53 A;  2IY0 C;  2E0I A;  3K9I A;  3DSS A;  3MKR A;  1HXI A;  5FQ7 A;  4B93 B;  4GAA A;  5KWD A;  2VGX B;  3QKY A;  2HR2 A;  3CVP A;  2DYR E;  4DX1 A;  5FWQ A;  5ARF A;  2NSZ A;  3UM3 A;  2QC9 A;  1SA5 A;  3GW4 A;  3L22 A;  4EHM A;  4URK A;  3ZKJ A;  4OYS A;  4YVQ C;  3PRZ A;  4MKT A;  1BI7 B;  4XI9 A;  5KBA A;  4N39 A;  4I6G A;  5HS0 A;  4J8D A;  4GZ5 A;  3RRU A;  1WG0 A;  1N94 A;  3ZHE A;  1DCE A;  2LXM A;  3ZN3 A;  2XS1 A;  4CYM D;  3BQO A;  3ZGQ A;  4GPM A;  2KCV A;  5CMY A;  2IOS A;  3AS5 A;  3EJN A;  2WB2 A;  3FTS A;  4N5C A;  2VTB B;  3E34 A;  3SHF A;  2L6J A;  2ZIS A;  3ZU7 B;  3FH7 A;  1ZU2 A;  3MV2 B;  4Z68 A;  5FTP A;  3CVV A;  1OWN A;  3EHR A;  1TNB A;  4U96 D;  1E8W A;  2NC9 A;  3PE4 A;  3NZS A;  4AP2 A;  1N95 A;  2P9K G;  2C0M A;  4ANV A;  2R17 C;  1HU3 A;  1IQR A;  3KD7 A;  3X2Q E;  4CGW A;  2LO6 A;  3NZU A;  3HXC A;  1EF1 C;  1E7U A;  2WXI A;  3UUX A;  2FO7 A;  3Q9U C;  1SZ9 A;  1NL4 A;  4K5C A;  1FCH A;  3TWS A;  2GGF A;  2VGY A;  4L7T A;  4LNU D;  5B1B E;  5G05 C;  2MRI A;  1RW2 A;  3NAW A;  4KYO B;  3C72 A;  5AJL A;  3VTX A;  2NXP A;  4UQZ A;  5ENN A;  1ELK A;  3OXG A;  3QC1 A;  1SW6 A;  1YA0 A;  4CDR A;  1O1S A;  3IHY A;  2OND A;  4J8E A;  2AVP A;  3QNK A;  3AJI A;  4CCA A;  3RAU A;  1V55 E;  1EPU A;  1UJJ A;  3UIP C;  3L08 A;  4DX7 D;  1BI8 B;  4JB8 P;  3OAW A;  2XPY A;  3ZPJ A;  1U3C A;  1OWP A;  5LP0 A;  2OEW A;  4I9E A;  3EHN A;  2I9C A;  4OAU C;  4JHK A;  3S7B A;  1QZ2 A;  4CGV A;  3FP3 A;  2PM6 A;  3RJV A;  4U8Y D;  3B95 A;  3AU4 A;  4YDY A;  4LNG A;  4U8V D;  3FFL A;  3ZYM A;  2PL2 A;  5FZQ A;  2YNQ A;  2EIM E;  3ZVV A;  5AQ9 A;  3PZ4 A;  4I43 A;  4GMR A;  3B7B A;  4BT8 A;  2L0T B;  3ABL E;  4W9R A;  4UWG A;  4RLY A;  4BY6 A;  4GTS A;  5ANL A;  2WXQ A;  3DXM G;  5M72 A;  2CG2 A;  3AG1 E;  4LCT A;  3G2T A;  5LCW C;  2CG3 A;  4U95 D;  1QYM A;  4GMJ A;  4OVV A;  3L17 A;  2PQN A;  3ZYQ A;  4KZ0 A;  4J6I A;  2WXF A;  3BUA A;  2IO2 C;  5D2M C;  3AG2 E;  2EIL E;  3L16 A;  1MX6 A;  1G3N B;  1BU9 A;  1E8Y A;  4FHJ A;  3RRN B;  3L6A A;  5KNG A;  3BEE A;  1UN9 A;  3FTZ A;  3Q78 A;  3QWV A;  3FU5 A;  3Q49 B;  3CST A;  5FIO A;  4GTP A;  2P9L G;  4A1S A;  1YCS B;  4X8Q A;  3MKQ A;  5EIL A;  2L9B A;  5CBN A;  3PVL A;  3ZHE B;  4K03 A;  3EHM A;  2XPZ A;  4PS8 A;  1SVX A;  2WXG A;  2WXN A;  2DZO A;  3FUE A;  4J8S A;  4RG9 A;  5ARG A;  2BTD A;  3S7D A;  3R7Q A;  2X6F A;  4YDE A;  4GYW A;  2WXL A;  4DI3 A;  1WM5 A;  4YVO A;  3ZYL A;  4JW1 A;  4DI4 A;  2R02 A;  4MRU A;  4N5Q A;  3UIO C;  4BWR A;  2XEV A;  4F3V A;  3ULQ A;  5KJN A;  4DK5 A;  3FUL A;  4HOT A;  1E8Z A;  2XGS A;  4B8A A;  4HRL A;  4GTR A;  4FU3 A;  4LNB A;  4M3O A;  4GYO A;  1OCR E;  5FQ4 A;  3D9L A;  2DIW A;  4ATG A;  3SBT B;  4YND A;  1B89 A;  2GRP B;  4L23 A;  2F37 A;  4AVX A;  3Q15 A;  5D0Q D;  2J8S D;  2LXL A;  5JJT A;  1OCC E;  2IFU A;  3TWV A;  3UMV A;  3LS8 A;  3FUH A;  2VGE A;  1H6O A;  2AXZ A;  4N3A A;  2BKG A;  2V5F A;  2KCL A;  4E85 A;  4F6R D;  3JCK C;  1E90 A;  4BTB A;  1N52 A;  1JPL A;  4AJW A;  2VQ2 A;  4ANW A;  4APF A;  4JA9 A;  2UWJ G;  1FT2 A;  3CVQ A;  2IQC A;  2J9Q A;  4FHK A;  3EDT B;  2XEH A;  5G2N A;  4XZ4 A;  1SQM A;  1KLX A;  2YQ8 A;  4GML A;  1D8E A;  1TNU A;  4GA2 A;  4A3V A;  5JHB A;  2R5S A;  1OCO E;  5A23 A;  5BT1 A;  5BXU A;  3QWW A;  3EHQ A;  3OXL A;  3ASD A;  5CCM A;  2KCK A;  1KT1 A;  3LY7 A;  4WNF A;  4PDX A;  3HG0 D;  3V30 A;  3FU6 A;  3PZ2 A;  5AEN A;  5EDS A;  1WY6 A;  1OWL A;  5KJL A;  3L9T A;  2P9S G;  2DVW A;  4IN3 B;  4ZHB A;  5ITZ F;  1TJC A;  5T3R A;  4G8K A;  4KMO A;  3DSU A;  3BG1 B;  4HXI A;  5FZS A;  4NIK A;  3JYS A;  5CMW A;  5DIZ A;  5JHA A;  1EYH A;  4WWN A;  3C3O A;  4I1O B;  4ATZ D;  2IEJ A;  4HLL A;  3UI2 A;  4CT4 A;  4UWK A;  3PUK A;  5J08 A;  4TUM A;  4XX5 A;  3L82 A;  4DPR A;  2M63 A;  3Q75 A;  1H2T C;  4O60 A;  2CFU A;  2LNI A;  3QAR A;  2WPV A;  2PQR A;  3FTY A;  4EBA A;  3B13 A;  5LFA A;  4JL0 A;  1Z6T A;  4B89 A;  2HYZ A;  3CVW A;  4HI8 A;  3P1U A;  4U63 A;  4HOU A;  4AEZ C;  1KPS B;  2MHK A;  3UKU G;  1MZC A;  4UI9 K;  3MKQ B;  2J4D A;  2GW1 A;  2AW6 A;  1YYH A;  4Q96 A;  3FH5 A;  1RZ4 A;  4NUR A;  2ILR A;  3SGH A;  1LTX A;  5EID A;  4EZK A;  4DX6 D;  3HXD A;  3AG3 E;  1FPP A;  4LEU A;  3LYA A;  3QB2 A;  2XGM A;  2H6I A;  1H2V C;  4I6E A;  3U4T A;  4FUL A;  2F0Y A;  3ASO E;  2E2E A;  3UTM A;  2YHE A;  3ZFW A;  3LCA A;  1HFA A;  2A4Z A;  5HKP A;  2X6I A;  2Y4T A;  5EX0 A;  2WXH A;  3HIZ A;  4G2V A;  2JEK A;  4GA1 A;  5E76 A;  1N4R A;  4Q94 A;  1TJF A;  5FQ6 A;  4GCO A;  2ETB A;  1S70 B;  3W9G A;  3EIJ A;  4XKB A;  3SO8 A;  1Z3Y A;  3ZEF A;  3V2X A;  3HVE A;  3FUN A;  1K1B A;  3TGO A;  4TXP A;  4D10 C;  1OCZ E;  3ZXS A;  2YHC A;  3DWL G;  1V54 E;  5D0O D;  4HOQ A;  3G2W A;  5HRY A;  2RFM A;  3AU5 A;  1E96 B;  1H6K A;  4Y6W A;  3C3R A;  3TAX A;  5T4Y A;  4H7X A;  4FLH A;  3ML9 A;  3FEX A;  3UM2 A;  5IY5 E;  2CHX A;  2NYJ A;  4J8F A;  3ENE A;  3IV0 A;  1TEZ A;  3FU0 A;  2R03 A;  3HXB A;  3UT4 A;  1INZ A;  3CVY A;  4PS3 A;  3APC A;  3UQ3 A;  2B0O E;  3LKU A;  4L1B A;  1NA3 A;  3APF A;  1AP7 A;  4HLE A;  1HZ4 A;  3MA5 A;  1YMP A;  4ANU A;  1U3D A;  1WAO 1;  3ULY A;  5LOZ A;  2DBA A;  2OV8 A;  4H7Y A;  1HO8 A;  3O4Z A;  3EU9 A;  4I1M A;  4GPK A;  3Q5M A;  1H19 A;  3E32 A;  4AXH A;  4G11 A;  3CQC B;  4U0Z A;  5CEC B;  3CEQ A;  4JVS A;  2I6H A;  4HQD A;  5DBK A;  1BLX B;  5EIB E;  1PY1 A;  4GA0 A;  2XEE A;  3FTU A;  4HRM B;  5FQ8 A;  1MQS A;  4LER A;  2BKK B;  4JHJ A;  2C2L A;  3DSX A;  4J8Y A;  3FUK A;  3FUD A;  1BPO A;  2GRN B;  2QYU A;  2QYJ A;  3TL5 A;  1TNZ A;  3KS2 A;  3MGB A;  4N3C A;  4RG6 A;  1N4P A;  3QJZ A;  2LAH A;  1E7V A;  2RD0 A;  2HM8 A;  2OVF A;  4ILI A;  1TN7 A;  4NAC A;  4ACL A;  4UQX A;  1MX2 A;  4KXK B;  3FTX A;  2EQX A;  3I5P A;  5FZR A;  5LX8 A;  4FAD A;  3KEA A;  3KSQ A;  2WMO A;  1IXV A;  2BF0 X;  3LXU X;  2Q7F A;  5CRU A;  3J5Q B;  4R7L A;  1A5E A;  3FTV A;  3T5X A;  4Q69 A;  3SZ7 A;  3JXJ A;  4GCN A;  5ENS D;  5B1A E;  4KZC A;  2XEN A;  1HG2 A;  1DCQ A;  4WAF A;  2WXM A;  3ISM C;  3SFY A;  4B8C B;  4XI0 A;  4U0S A;  3GZ2 A;  2LSU A;  1KZO A;  5EKQ D;  4FA6 A;  3QK0 A;  5AQ7 A;  3WG7 E;  4ANX A;  3ESK A;  4UQY A;  3TWW A;  3T9K A;  1D8D A;  1JCQ A;  4DJA A;  4DLO A;  4BX8 A;  1IHB A;  5AAO A;  3RO2 A;  5BXO A;  3PH0 C;  3EIQ C;  1D9S A;  2A5U A;  2F8Y A;  2XGO A;  1JUQ A;  2ETA A;  2VYI A;  2L6B A;  4FJZ A;  2R2L A;  5BV1 A;  4PUC A;  4YDO A;  4CDM A;  5T8I A;  1N11 A;  1LD7 A;  5BUZ A;  3SD5 A;  3JUE A;  3GZS A;  2PM7 A;  2AJA A;  3ABK E;  3HVE B;  4C0M A;  1OUV A;  4NRH B;  4B0Z A;  2RG8 A;  3MJW A;  1OY3 D;  5ENT D;  2J09 A;  1K8K G;  2J4B A;  3F6Q A;  3SBS A;  2XPI A;  4L9P A;  2P9U G;  1WDY A;  2FUL A;  2P9P G;  2J49 A;  3PRE A;  3CK7 A;  2ZIR A;  4BFR A;  5CED B;  4CT0 A;  3I3N A;  4G23 A;  2WMN A;  3CVL A;  3PEU B;  3LJN A;  2GRO B;  1JCS A;  2ZGD A;  3DEP A;  2VSY A;  3Q7F A;  4GZ3 A;  4U7E B;  1EDU A;  3UM1 A;  3KEZ A;  2WQ7 A;  3MCX A;  1SA4 A;  3NBN B;  1PC2 A;  2P2C P;  4MLP A;  3SI5 A;  3DBS A;  4I2Z A;  3P2B A;  4CRW A;  1GW6 A;  2XCC A;  3U64 A;  3CKC A;  4DX5 D;  1UJK A;  1UN8 A;  4LG6 A;  2CHW A;  1ZBP A;  4LSZ E;  5FT9 A;  1Y8M A;  3B7T A;  3W9F A;  3GZ1 A;  4B94 A;  2IU1 A;  3RSE G;  4WWO A;  3ZYK A;  1TNY A;  3R7R A;  2XZD G;  5KNH D;  3OTN A;  2KAT A;  5CBO A;  1N4S A;  2V0P A;  4UWH A;  4HBD A;  3HYM B;  4Y6C A;  5FIN A;  4JC8 A;  1X5B A;  1TNO A;  3B7S A;  2I1K A;  3LEW A;  1Y6I A;  3FUI A;  1O5M A;  3PDN A;  3CSF A;  4AM9 A;  4HOR A;  4RVB A;  3GYZ A;  4QFV A;  3CLJ A;  1HX8 A;  1NA0 A;  1S64 A;  3ZRH A;  1N9A A;  5JJ6 A;  3D9H A;  4G25 A;  3T8K A;  2QZA A;  1FVF A;  1MHQ A;  4K5B A;  4G24 A;  4HRN A;  5B3S E;  2XRY A;  4GTQ A;  2FF4 A;  3ASN E;  3TG5 A;  4WNE A;  4UWL A;  3O48 A;  4WNG A;  2P58 C;  4BER A;  1KZP A;  1UG3 A;  3E30 A;  1FVH A;  4A55 A;  3DPD A;  4I1A A;  4TV3 A;  4L2L A;  5AN8 A;  1ELR A;  3ABM E;  4GTV A;  4L2Y A;  3D9J A;  1ZB1 A;  2KXP C;  4JXT A;  3Q73 A;  4IRU A;  4ACK A;  3CV0 A;  3NQP A;  4JEU A;  2RFA A;  3FHE A;  4BEP A;  3FU3 A;  3TXN A;  2LUH A;  3HDX A;  1PAQ A;  1UW4 B;  2FI7 A;  2WVI A;  2OOE A;  2C0L A;  5G04 J;  3PNL B;  5ENO D;  3Q79 A;  1HE8 A;  3LVR E;  1LF8 A;  4KVO A;  3D9I A;  1NZN A;  2P9I G;  2QFC A;  2X6J A;  4N2S A;  3DRA A;  3URZ A;  3Q4A B;  2IJG X;  5AIJ A;  2ION A;  5CHE E;  3V31 A;  5BV0 A;  3APD A;  4GU5 A;  4BET A;  2DCP A;  3FWV A;  3LDZ A;  3VLE A;  1VDY A;  3N71 A;  3ONL A;  4XEI G;  4P29 A;  3DST A;  4OVU A;  1BD8 A;  1K3Z D;  4UI9 J;  3D9P A;  2I2O A;  4O1O A;  3B7R L;  4O6F A;  3TJP A;  1OT8 A;  2R59 A;  2GRR B;  5C1D A;  1TR4 A;  3TWU A;  4DUI A;  2QY7 A;  1SZA A;  2KBX A;  4LRZ A;  3U3W A;  5CCL A;  3Q9N C;  4FC8 A;  4RSY A;  5EYL A;  5KJK A;  4KT6 B;  3LY9 A;  4GTM A;  3IEG A;  3DSW A;  3QAQ A;  4N2Q A;  1NP7 A;  3UM0 A;  4FJY A;  4WUY A;  2DWZ A;  3IKO B;  4AY5 A;  4U07 A;  4EEC A;  3MV3 B;  4ZFH A;  1N4Q A;  4F1S A;  3R9A B;  4TXR A;  2AXV A;  3E37 A;  5D66 A;  4JHR A;  3DEO A;  3MX3 A;  4XIF A;  2LSV A;  3FUM A;  1MX4 A;  1Z5S C;  2AXU A;  5ENR D;  1P5Q A;  2FEZ A;  3UX4 A;  4WND A;  5E75 A;  4AIF A;  2I1J A;  3AS4 A;  2WXO A;  3U66 A;  3TXM A;  3NF1 A;  3AAA C;  3UT7 A;  3ZW3 A;  2J07 A;  5CRV A;  2WXK A;  4I9C A;  4JD2 G;  3VTY A;  3PEV B;  1HS6 A;  3CQG B;  4FLB A;  2V4L A;  2HO1 A;  3S7J A;  3FUJ A;  3TWQ A;  4YDW A;  3CHR A;  4O1P A;  4EZJ A;  4LUN U;  3VLF A;  3CHO A;  5CEA A;  5AYW D;  2LAI A;  5EN5 D;  5EYP F;  2KZT A;  5EX3 A;  2H6H A;  3I4G A;  1X81 A;  3V2O A;  1N54 A;  2KC7 A;  4K0R A;  3CHS A;  4V3I A;  3ML8 A;  4PH4 B;  2V8S E;  2Y0B G;  4HOS A;  5JJ7 A;  3FDH A;  4K5A B;  3ASF A;  4OAV B;  4FP7 A;  3D9M A;  3HRA A;  4APO A;  4HI9 A;  1FT1 A; 
#chains in the Genus database with same CATH homology
 2XGO A;  1JUQ A;  3SFZ A;  2IQC A;  2J9Q A;  4FHK A;  5ARF A;  3EDT B;  4ILG A;  2WXR A;  5FWQ A;  3S7F A;  2NSZ A;  5G2N A;  4JPS A;  4XZ4 A;  1SQM A;  3GW4 A;  1KLX A;  3L22 A;  2GRL A;  2VYI A;  4URK A;  2YQ8 A;  3L13 A;  4FJZ A;  4OYS A;  5BV1 A;  4GML A;  1A17 A;  4YVQ C;  3PRZ A;  4PUC A;  4MKT A;  4GA2 A;  4CDM A;  1QQE A;  4A3V A;  5JHB A;  2R5S A;  5T8I A;  5A23 A;  5BT1 A;  4XI9 A;  3KAE A;  3QWW A;  3OXL A;  5BUZ A;  3SD5 A;  4N39 A;  3ASD A;  2JLB A;  4I6G A;  5ANR A;  2KCK A;  4C0E A;  5CCM A;  1KT1 A;  3FEY A;  2PM7 A;  3GZS A;  4GZ5 A;  4J8D A;  3LY7 A;  3HVE B;  4C0M A;  4WNF A;  4PDX A;  3FU6 A;  5AEN A;  3RRU A;  2VSX E;  5EDS A;  4TUU A;  1OUV A;  1WY6 A;  4NRH B;  1OWL A;  3C98 A;  3ZHE A;  5KJL A;  4B0Z A;  2RG8 A;  3ZN3 A;  4IN3 B;  2FBN A;  3LY8 A;  2Y4U A;  1TJC A;  3MJW A;  5T3R A;  5A7D B;  3ZGQ A;  3PS6 A;  3D3M A;  2J09 A;  2KCV A;  2J4B A;  3AS8 A;  5CMY A;  2IOS A;  5C2Y A;  3AS5 A;  4KMO A;  3CGH A;  3EJN A;  3SBS A;  2WB2 A;  2XPI A;  3FTS A;  4N5C A;  3D9O A;  2FUL A;  2J49 A;  2XQ0 A;  3PRE A;  3CK7 A;  3BG1 B;  4HXI A;  5FZS A;  4HS2 A;  3ZIM A;  2VTB B;  4BFR A;  3JYS A;  4CT0 A;  3I3N A;  4G23 A;  5CMW A;  2WMN A;  4JEH A;  3SHF A;  2L6J A;  3CVL A;  3PEU B;  3JQ1 A;  4G1T A;  4I2W A;  5DIZ A;  2Y3A A;  5JHA A;  2VSY A;  1DNP A;  1EYH A;  4GZ3 A;  4WWN A;  3FH7 A;  1ZU2 A;  1EDU A;  3KEZ A;  3MV2 B;  3LJ3 A;  4I1O B;  2WQ7 A;  3MCX A;  5FTP A;  3CVV A;  2VSN A;  1OWN A;  1PC2 A;  1E8W A;  2NC9 A;  4CT4 A;  4MLP A;  3PE4 A;  4IYP A;  3PUJ A;  4UWK A;  3PUK A;  3SI5 A;  3DBS A;  3NZS A;  4I2Z A;  1OWO A;  5J08 A;  3P2B A;  3RO3 A;  4AP2 A;  4CRW A;  4XX5 A;  3E4B A;  4DPR A;  2M63 A;  2C0M A;  1GW6 A;  4ANV A;  2XCC A;  2AWI A;  2R17 C;  2VSO E;  1HU3 A;  1H2T C;  3CKC A;  3U64 A;  2CFU A;  1IQR A;  1UJK A;  3KD7 A;  1UN8 A;  4CGW A;  2LO6 A;  3ASH A;  3NZU A;  2CHW A;  2XHE A;  2LNI A;  4GZC A;  1ZBP A;  3RIB A;  5HQ8 A;  3QAR A;  2UY1 A;  2WPV A;  4GB9 A;  4A3T A;  5FT9 A;  1XNF A;  3B7T A;  1Y8M A;  1EF1 C;  2PQR A;  3GZ1 A;  3PZD A;  2IU1 A;  4B94 A;  3RKV A;  1E7U A;  3FTY A;  4WWO A;  2WXI A;  3CKB A;  1IQU A;  3UUX A;  3ZYK A;  4EBA A;  3L54 A;  3B13 A;  4TRQ A;  5LFA A;  4JL0 A;  2FO7 A;  3R7R A;  4BX9 A;  2XRZ A;  1Z6T A;  4GYY A;  1SZ9 A;  4B89 A;  2ZU6 B;  3OTN A;  2HYZ A;  2KAT A;  3CVW A;  2V0P A;  4UWH A;  3P1U A;  2VJ8 A;  3RU0 A;  4AV7 A;  3D9N A;  4U63 A;  4HOU A;  1FCH A;  4AEZ C;  2GGF A;  2VGY A;  4L7T A;  1Z3X A;  5G05 C;  2MRI A;  2MHK A;  4MS6 A;  2IF4 A;  3HYM B;  4Y6C A;  3HHM A;  4HFG A;  4DLQ A;  4IUL A;  4KYO B;  4UI9 K;  2X38 A;  3MKQ B;  4JC8 A;  5AJL A;  2J4D A;  1X5B A;  3PNT B;  2GW1 A;  3VTX A;  2AW6 A;  4E6H A;  3B7S A;  4EBA G;  4Q96 A;  2I1K A;  2NXP A;  5AJD A;  4UQZ A;  5ENN A;  3LEW A;  3FH5 A;  1Y6I A;  1ELK A;  3OXG A;  4NUR A;  3FUI A;  3QC1 A;  1YA0 A;  3PDN A;  2WQH A;  5BW8 C;  3CSF A;  4AM9 A;  4CDR A;  2ILR A;  3SGH A;  4HOR A;  4RVB A;  3IHY A;  5G04 C;  3GYZ A;  4QFV A;  4EZK A;  3B7U X;  3CLJ A;  1JWF A;  2OND A;  1HX8 A;  4J8E A;  2AVP A;  3QNK A;  2VGX A;  4CCA A;  1NA0 A;  3ZRH A;  4LEU A;  5JJ6 A;  3LYA A;  4I17 A;  3FH8 A;  3QB2 A;  2XGM A;  1EPU A;  4I6E A;  1H2V C;  4G25 A;  4J0U A;  1UJJ A;  3FY4 A;  1FVF A;  1MHQ A;  4G24 A;  3L08 A;  3MEK A;  3U4T A;  4FUL A;  4GZ6 A;  2XRY A;  2FF4 A;  3TG5 A;  4WNE A;  4UWL A;  2E2E A;  3O48 A;  4WNG A;  2YHE A;  2P58 C;  3ZFW A;  3LCA A;  4ABN A;  1HFA A;  2A4Z A;  3OAW A;  2XPY A;  2X6I A;  3ZPJ A;  2Y4T A;  4ILH B;  3QDN A;  1U3C A;  2MOW A;  1H2U A;  1UG3 A;  5EX0 A;  1FVH A;  2WXH A;  1OWP A;  3HIZ A;  4G2V A;  2JEK A;  4I9E A;  3DPD A;  4A55 A;  5LP0 A;  4I1A A;  4TV3 A;  4GA1 A;  5E76 A;  4Q94 A;  3EHN A;  1TJF A;  5FQ6 A;  5G05 J;  4L2L A;  4G26 A;  2I9C A;  4GCO A;  4BT9 A;  1ELR A;  4L2Y A;  4UI9 C;  3CVU A;  3JQ0 A;  3MYV A;  4JZY A;  3EIJ A;  3D9J A;  4JHK A;  1QZ2 A;  4XKB A;  3S7B A;  4CGV A;  5A6C A;  4JXT A;  3IHV A;  4IRU A;  4ACK A;  1Z3Y A;  2PM6 A;  3FP3 A;  3ZEF A;  3CV0 A;  3HVE A;  3FUN A;  3RJV A;  4AY6 A;  3NQP A;  4JEU A;  3TGO A;  3FHE A;  3FU3 A;  3TXN A;  4D10 C;  1IHG A;  3AU4 A;  3HDX A;  3ZXS A;  3FFL A;  4UWF A;  1PAQ A;  3ZYM A;  2PL2 A;  3CHP A;  5FZQ A;  1UW4 B;  2FI7 A;  2YNQ A;  2YHC A;  2WVI A;  2OOE A;  2C0L A;  5D0O D;  5G04 J;  3PNL B;  1HE8 A;  3LVR E;  4HOQ A;  3G2W A;  3ZVV A;  1LF8 A;  3S2A A;  4KVO A;  3G2V A;  3D9I A;  1NZN A;  1QNF A;  4I43 A;  3AU5 A;  2WQ6 A;  1E96 B;  4BT8 A;  5G55 A;  2L0T B;  2OVB A;  4W9R A;  1H6K A;  4UWG A;  4Y6W A;  2VTB A;  2QFC A;  2X6J A;  4BY6 A;  3TAX A;  5ANL A;  5T4Y A;  3CK8 A;  4N2S A;  3URZ A;  4H7X A;  4FLH A;  2KZT B;  3ML9 A;  3FEX A;  3CR3 A;  3Q4A B;  1JWG A;  2IJG X;  5AIJ A;  2CHX A;  2ION A;  2WXQ A;  4J8F A;  5CHE E;  3RK6 A;  2CG2 A;  5BV0 A;  4LCT A;  5M72 A;  3APD A;  4GU5 A;  3ENE A;  2DCP A;  3IV0 A;  3UT8 A;  1TEZ A;  3FWV A;  3FU0 A;  3LDZ A;  3OXF A;  3G2T A;  3UT4 A;  3VLE A;  5LCW C;  1INZ A;  1VDY A;  2CG3 A;  3N71 A;  4WWP A;  5KJM A;  3CVY A;  3ONL A;  4PS3 A;  4CDN A;  3WXX A;  2WXJ A;  4F7A A;  4C9B B;  4EZL A;  3APC A;  4GMJ A;  3UQ3 A;  3LKU A;  4L1B A;  4OVV A;  1NA3 A;  3APF A;  4P29 A;  4PS7 A;  3L17 A;  3BG0 B;  4NQ0 A;  4OVU A;  5HI7 A;  4CEM A;  2PQN A;  3ZYQ A;  4UI9 J;  4HLE A;  3D9P A;  2PZI A;  1HZ4 A;  4U04 A;  2I2O A;  3MA5 A;  4KZ0 A;  4A1G A;  1H0A A;  5BNW A;  3IBE A;  4ANU A;  1U3D A;  4XKC A;  3B7R L;  4O6F A;  3TJP A;  4J6I A;  4XE0 A;  1WAO 1;  1XGW A;  2WXF A;  1S0P A;  4JA7 A;  5LOZ A;  2DBA A;  2OV8 A;  2R59 A;  4H7Y A;  1HO8 A;  3O4Z A;  5C1D A;  4I1M A;  3L16 A;  4GPK A;  2QY7 A;  3Q5M A;  1SZA A;  5FJY A;  1H19 A;  3CVX A;  3G2U A;  3T5V A;  4AXH A;  3TG4 A;  4LRZ A;  3U3W A;  1E8Y A;  5CCL A;  4HVB A;  5BPP A;  1W3B A;  2YIN A;  4FHJ A;  4G11 A;  3CQC B;  3RRN B;  4U0Z A;  4FC8 A;  4RSY A;  5KJK A;  3L6A A;  3BEE A;  3CEQ A;  4JVS A;  2I6H A;  1UN9 A;  3FTZ A;  3LY9 A;  4KT6 B;  2CHZ A;  3IEG A;  2X3M A;  3QWV A;  3FU5 A;  1HG5 A;  2IOL A;  3PE3 A;  3Q49 B;  3QAQ A;  4N2Q A;  3CST A;  5DBK A;  1NP7 A;  4FJY A;  3CHM A;  4A1S A;  4WUY A;  3MKQ A;  3G2S A;  3IKO B;  1PY1 A;  3VLD A;  3RRM B;  4AY5 A;  4U07 A;  4EEC A;  2KM4 A;  2L9B A;  2X6H A;  4GA0 A;  3FTU A;  3MV3 B;  3SF4 A;  3MZL B;  1MQS A;  3PVL A;  3QWP A;  5FQ8 A;  5LCW J;  3ZHE B;  4LER A;  3ONK A;  4F1S A;  3CK9 A;  4JHJ A;  3R9A B;  2AXV A;  2C2L A;  4K03 A;  4JHR A;  3FUK A;  3EHM A;  2XPZ A;  3FUD A;  1BPO A;  3MX3 A;  3LPZ A;  4PS8 A;  1ELW A;  3SNX A;  3TL5 A;  1KT0 A;  2WXG A;  3JUI A;  3KS2 A;  2WXN A;  4XIF A;  3UPV A;  2LSV A;  3FUM A;  3MGB A;  3FUE A;  4J8S A;  2AXU A;  3Q47 B;  4RG9 A;  5ARG A;  3D9K A;  4N3C A;  4RG6 A;  1P5Q A;  2BTD A;  1L5J A;  3CHQ A;  2FEZ A;  3QJZ A;  3S7D A;  2LAH A;  1E7V A;  4WND A;  3UX4 A;  3R7Q A;  2RD0 A;  2X6F A;  5E75 A;  4AIF A;  2J08 A;  4GYW A;  2HM8 A;  2WXL A;  2OVF A;  2BUG A;  3ASG A;  3LVQ E;  4ILI A;  2I1J A;  3AS4 A;  2WXO A;  3U66 A;  2L0I A;  3CVN A;  4NAC A;  4DI3 A;  4ACL A;  4UQX A;  3TXM A;  3NF1 A;  1WM5 A;  4YVO A;  3ZYL A;  4JW1 A;  4DI4 A;  3UT7 A;  4KXK B;  4MRU A;  3FTX A;  3ZW3 A;  2EQX A;  2J07 A;  3I5P A;  2WXK A;  5FZR A;  4BWR A;  5LX8 A;  2XEV A;  4I9C A;  4BTA A;  4FAD A;  2WMO A;  4I6J A;  2BF0 X;  3CIA A;  4F3V A;  3LXU X;  3ULQ A;  3VTY A;  2X6K A;  2Q7F A;  3PEV B;  4GZD A;  5KJN A;  4R7L A;  4DK5 A;  3FUL A;  4HOT A;  2GRM A;  1HS6 A;  3CQG B;  1E8Z A;  4KBQ A;  4U8H A;  4ME2 A;  4N3B A;  2UY1 B;  4BSX A;  3FTV A;  2XGS A;  3T5X A;  1E8X A;  4Q69 A;  4B8A A;  3QOU A;  4FLB A;  1OWM A;  2V4L A;  2HO1 A;  4FU3 A;  3S7J A;  3SZ7 A;  4GCN A;  5J90 A;  3FUJ A;  4M3O A;  2XCB A;  4GYO A;  3CHR A;  4KZC A;  5FQ4 A;  3D9L A;  1HG2 A;  2DIW A;  4ATG A;  4WAF A;  2WXM A;  3SBT B;  4YND A;  1B89 A;  4KVM A;  1HH8 A;  3I4R B;  4L23 A;  4XI0 A;  4B8C B;  4EZJ A;  4LUN U;  3VLF A;  4AVX A;  3Q15 A;  3CHO A;  5D0Q D;  4U0S A;  5AYW D;  3FUF A;  3GZ2 A;  2LSU A;  5EKQ D;  1DVP A;  2LAI A;  4FA6 A;  3QK0 A;  5JJT A;  3FTW A;  4AOF A;  1IYG A;  4ANX A;  2IFU A;  2KZT A;  2WXP A;  5EX3 A;  3ESK A;  4UQY A;  3I4G A;  3UMV A;  3LS8 A;  4DJA A;  3ESL A;  1N54 A;  3U9W A;  4U0U A;  3FUH A;  2KC7 A;  4K0R A;  1HF8 A;  2AXZ A;  4EPZ A;  3CHS A;  4DLO A;  5KCM A;  4BX8 A;  3T8M A;  2CFZ A;  4V3I A;  4EQF A;  4N3A A;  3ML8 A;  4PH4 B;  2V5F A;  2KCL A;  2WM9 A;  2V8S E;  4E85 A;  3RO2 A;  4F53 A;  3PH0 C;  4HOS A;  3JCK C;  1E90 A;  2E0I A;  3EIQ C;  3FDH A;  3K9I A;  4BTB A;  5JJ7 A;  1N52 A;  3ASF A;  3MKR A;  1HXI A;  1JPL A;  5FQ7 A;  4GAA A;  4FP7 A;  2VGX B;  3D9M A;  3QKY A;  4AJW A;  2VQ2 A;  2A5U A;  4ANW A;  4APO A;  2HR2 A;  4APF A;  4JA9 A;  2UWJ G;  3CVP A;  3CVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...