4GCOA

Central domain of stress-induced protein-1 (sti-1) from c.elegans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
120
structure length
120
Chain Sequence
YINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein STI-1
publication title Central domain of stress-induced protein-1 (STI-1) from C.elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 52
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gcoA00
1KLXA 3FP3A 1HZ4A 1XNFA 4CGVA 3U3WA 3SF4A 3ZPJA 1E96B 4H7YA 5FJYA 3KAEA 2P58C 5D0QD 4WNEA 4AM9A 4H7XA 3MV2B 1HXIA 3CVNA 2UWJG 2XGSA 3E4BA 3ZGQA 2C0MA 2Y4TA 3ASFA 2KCLA 2C2LA 2PQRA 5JJTA 4GYWA 4BTBA 1HH8A 2OOEA 2C0LA 4GCOA 1B89A 1P5QA 4KXKB 5ARGA 5EKQD 4HOSA 4U04A 5A6CA 4GA1A 1KT1A 4ABNA 5FT9A 2FI7A 5JJ6A 5BT1A 5KJMA 3EDTB 2IFUA 2XEVA 2FEZA 4KYOB 5A7DB 4UQYA 4J8DA 4YVQC 4GZ3A 3AS5A 4A1SA 4JL0A 4BTAA 4WUYA 4G2VA 4U07A 3Q4AB 3IEGA 3LY8A 4J0UA 1YA0A 4G26A 2ONDA 4N2QA 5KJKA 3LPZA 3R9AB 3BEEA 2HO1A 3GZ2A 3URZA 1ZBPA 4YNDA 4GA2A 3QDNA 2UY1A 3GZ1A 3HYMB 2VGXA 1QQEA 2LSUA 5CCMA 3QWPA 2KCKA 2HYZA 4XI0A 4N3BA 4BT9A 2HR2A 5KJNA 4GPKA 2YHCA 4G23A 4O6FA 5FTPA 1TJCA 5BNWA 2XGOA 5ARFA 2PL2A 2BUGA 2KATA 4I17A 2Y4UA 3ULQA 3CK7A 3ZN3A 3Q49B 2FBNA 2NC9A 2WPVA 4NQ0A 3KD7A 5G04J 4UQXA 4UQZA 4GYOA 3ZHEA 2IF4A 5AYWD 2XGMA 3CVLA 2FF4A 1NA3A 4NRHB 3OXLA 3ASGA 1A17A 4RG9A 5G04C 2I6HA 4YVOA 2VSNA 1W3BA 4I9EA 4F3VA 3NF1A 3WXXA 3S7JA 3QWVA 2V5FA 1ZU2A 4Y6WA 2QFCA 2VGYA 4I1AA 4G25A 2XCBA 4J8FA 2FO7A 5LCWJ 5G05J 2L6JA 3RO3A 1ELWA 4HOUA 3ASHA 3O48A 3LKUA 4LEUA 3VTXA 3RJVA 3UPVA 1NZNA 2LNIA 3CEQA 2WQHA 2R5SA 3RU0A 3OXGA 4N3AA 5DIZA 2MHKA 3CK8A 5FZSA 2PZIA 3LY9A 4ME2A 3TAXA 2J9QA 3GYZA 3Q5MA 3LY7A 1PC2A 4JA9A 3S7BA 3QOUA 4WNDA 1Y8MA 1QZ2A 4W9RA 3S7FA 4HOTA 3QKYA 5HI7A 3RKVA 3N71A 4U0SA 3SZ7A 4GCNA 3FFLA 4JHRA 1WAO1 4I2ZA 3CKCA 4IN3B 4BT8A 3MA5A 4I2WA 2YQ8A 4J8EA 5FZRA 2DBAA 1KT0A 3UQ3A 4UI9J 3OXFA 3GW4A 4GYYA 2XPIA 4HOQA 2VQ2A 2E2EA 3MV3B 4HORA 3RO2A 3CV0A 4WNFA 1IHGA 5C1DA 4UI9C 2UY1B 3MEKA 4GZ6A 4Y6CA 3TG4A 3PDNA 2VGXB 2JLBA 3RIBA 3CVQA 5BW8C 4BWRA 3LCAA 2VSYA 3K9IA 2PQNA 4AY5A 5HQ8A 3PE4A 5DBKA 4KBQA 5KJLA 4CDRA 2AVPA 3AS4A 5CHEE 2KCVA 5EX0A 1ELRA 4XIFA 4AY6A 1OUVA 4G24A 3CKBA 4WNGA 4N2SA 3QWWA 3LYAA 5EX3A 4AIFA 2GW1A 4GA0A 3TG5A 1FCHA 4I9CA 3VTYA 3KS2A 4GZ5A 2LSVA 3U4TA 3CVPA 4RG6A 5LCWC 4U0ZA 5G05C 4N5CA 5M72A 3Q15A 2XCCA 1NA0A 4G1TA 3ZHEB 3ESKA 4EQFA 3MKRA 5D0OD 1WM5A 1IYGA 3S7DA 3FWVA 4XI9A 3UUXA 4CGWA 2Q7FA 5FZQA 3AS8A 4UI9K 5JJ7A 4B94A 4APOA 3Q47B 3ZFWA 4JA7A 3JYSA 3TGOA 2KC7A 2VYIA 5CCLA 3CK9A 4U0UA 3ASDA 3PE3A 4N39A 4N3CA
chains in the Genus database with same CATH superfamily
2XEHA 2WXHA 4GTRA 2J09A 2ZISA 1HZ4A 4CGVA 3CVUA 2NYJA 3B13A 2X6IA 3KSLA 3CHQA 3QARA 5FJYA 4WNEA 4H7XA 3FH8A 4AV7A 1SA5A 4X8QA 2XGSA 3QNKA 3ZIMA 2C0MA 3JQ0A 4B93B 4GYWA 1HH8A 2HE0A 2P9UG 1B89A 3JUIA 3FULA 4OVUA 3CHRA 3SY2A 2DWZA 3NAWA 4HOSA 1TNYA 3LJ3A 1EYHA 1LTXA 2GRPB 1TNBA 4GMLA 4ILIA 1TR4A 2XPZA 5FT9A 3SNXA 2FI7A 3W9GA 2IFUA 3NZUA 3ZRHA 3HXBA 2Y0BG 5A7DB 2EILE 4J8DA 3CVYA 2XS1A 5AENA 4EHMA 3ZYKA 3BU8A 2XRZA 4K5CA 3AS5A 4A1SA 1K3ZD 4PS8A 1YMPA 4WUYA 1HE8A 1IQRA 3IEGA 3C3RA 1TN6A 2CFUA 4G26A 2ONDA 4MBGA 1HF8A 2ETBA 3LPZA 4HRNA 3R9AB 3PZDA 4JZYA 3URZA 1OXJA 4YNDA 1Q2ZA 1OWNA 2WMNA 3EHRA 3GZ1A 3HYMB 3C72A 4UUCA 3PUKA 2X6JA 3ZEFA 2HYZA 3UM1A 3TJPA 4BT9A 4HRLA 4HI9A 3HHMA 5FTPA 3HVEB 4AXHA 3TWRA 4HQDA 3Q9NC 4I6GA 2WQ7A 3FUEA 3HXEA 4Z68A 1IKND 3PZ2A 3B7BA 5C2YA 3B7RL 3ULQA 1H2UA 3ZN3A 3FTVA 2RFAA 3JUEA 2L6BA 2WPVA 2KZTB 3PZ1A 4UWKA 5G04J 1DCEA 4GYOA 5E76A 5H7PA 5T8IA 3DSTA 2EIME 3OXLA 2J4BA 1N4PA 4ACKA 4K0RA 4PUCA 3FTZA 5IY5E 4LCTA 3MGBA 1OWLA 3UM0A 4TXPA 4ATGA 3FTWA 1JWFA 1V55E 4GMRA 3D9OA 4NIKA 1FVFA 3CGHA 2VGYA 3I4GA 3L08A 3UT7A 1FT1A 3E37A 5CRUA 4F1SA 4G25A 4WWNA 4WWPA 2XCBA 3SHFA 2EQXA 4O60A 5B1AE 3RO3A 4ZFHA 4LNBA 5BXOA 4TXQA 1N95A 3ULEG 2WXQA 4CRWA 3DSUA 2IQCA 1UOHA 3IHYA 3VTXA 3UPVA 2LNIA 3CEQA 1HO8A 2WVIA 3PZ4A 5D66A 3UIOC 2MHKA 2AXVA 1K1BA 2PZIA 4A1GA 1N4QA 4HFGA 4LERA 4RVBA 4CDNA 1E8ZA 2X38A 3CVWA 3DPYA 4ILGA 3CHMA 2XQ0A 4EZJA 4LNGA 3IXEA 3IKOB 4U0SA 1IXVA 4JHRA 4DX1A 5AQ9A 4DI3A 3CLJA 2PNNA 4DRXE 3RK6A 4GZDA 3UINC 3DSSA 3UM2A 3TXMA 5FZRA 1KZPA 2DBAA 2V4LA 4ANWA 3F6QA 2NXPA 4E85A 3VLEA 3MYVA 3C5RA 2YHEA 2XPIA 2EIKE 3LEWA 4WNFA 2KXPC 2YNQA 5ENPD 5BV0A 1DCQA 4UI9C 2VGXB 5FINA 5BW8C 4BWRA 2VSYA 2BKGA 4YDOA 3UT8A 4F1PA 5KJLA 5AN8A 2AVPA 3AS4A 1UN9A 5EX0A 2PM7A 1O1SA 2VTBA 3FH7A 4QQIA 3UX4A 4A55A 1H6KA 4DPRA 3LYAA 5EX3A 1LD8A 3QC1A 4GA0A 1UG3A 3TG5A 2LO6A 5BXUA 1K8KG 2LSVA 2ZXWE 3SGHA 2X6HA 5M72A 3Q15A 3NQPA 3ZHEB 3V2OA 4UWGA 1DNPA 1IYGA 4CGWA 2Q7FA 5FZQA 2RD0A 4LUNU 5CEAA 5T3RA 3TWSA 2DZOA 1UW4B 4CEMA 4APOA 3Q47B 3ZFWA 5EYLA 3P2BA 3ZU7B 5CCLA 2XS8A 4U0UA 3B7SA 1BD8A 4N3CA 1XNFA 1SZ9A 4DUIA 3BQOA 4JC8A 4GPMA 3R7QA 1OWMA 4DK5A 4MS6A 1HXIA 3CVNA 5AJLA 4BESA 2UWJG 4B89A 3MCXA 1O1TA 2Y4TA 1UJJA 2A5EA 2OEWA 4NACA 5JJTA 4BTBA 2OOEA 4DX7D 2C0LA 4ANUA 2CHXA 4HB5A 4MRUA 3ESLA 5T4YA 2J08A 4Q96A 1TN7A 4CT0A 4U04A 3R7RA 1Z3XA 3SQVA 4FJZA 1KT1A 1OWOA 3L9TA 2EINE 1RW2A 5BT1A 3EHNA 3EDTB 5JHAA 3ZYMA 2AJAA 3NOGD 1AP7A 4F7AA 2F0YA 2CG3A 3AU4A 3D9LA 4BETA 4GTOA 5AJDA 2OV8A 2PM6A 3FTSA 4FU3A 4JL0A 4CT4A 2Y1LE 3LY8A 1YA0A 4HRMB 2L9BA 4KVOA 3CHOA 2HO1A 4JEHA 3FEXA 2DCPA 2R17C 4AOFA 3QDNA 5HRYA 1D9SA 4HXIA 1JCRA 3UKUG 1QQEA 3AG4E 2LSUA 1BPOA 3QWPA 4HNAD 2KCKA 2RG8A 3L82A 5B1BE 4ACLA 4G8KA 3TWVA 5KJNA 4GPKA 4O6FA 3G2UA 5KCMA 2WXKA 2VGEA 2XGOA 4Q69A 5ARFA 1NP7A 2KATA 2QYJA 5KNHD 4DLQA 2VSOE 5CBOA 3CQCB 3PEVB 2A5UA 3BUAA 2Y4UA 4JEUA 4GTPA 3VLDA 3CK7A 4MKTA 1LD7A 2L0IA 4HI8A 1DC2A 3D9JA 3KD7A 3KEZA 4UQXA 4U7EB 4UQZA 4AP2A 4RSYA 3FUFA 4RLYA 5AYWD 2XGMA 4XKBA 1NL4A 3V2XA 3QAQA 1E90A 4GU5A 4HLEA 3OTNA 4YDWA 5CEDB 4BX9A 1AWCB 2VSNA 4FJYA 3T9KA 4HBDA 3EHMA 1NFIE 3WXXA 2V5FA 2ZU6B 1YYHA 2OCCE 4BEPA 4AJWA 2R03A 1NI1A 4B8AA 1JCQA 1FPPA 1N52A 2LUHA 3T8MA 2J49A 3HVEA 4HOUA 3ASHA 3NBNB 2WM9A 4G11A 1KPSB 1TYQG 3I5PA 3RJVA 1NZNA 2R59A 3ASNE 3B7UX 5JA4D 3Q9UC 5DIZA 3CK8A 3AG3E 2OEVA 5FZSA 4JW1A 5ENOD 4U96D 2IJGX 3QOUA 2X6KA 4WWOA 4WNDA 4JD2G 4C9BB 4EZLA 1QZ2A 5JHBA 3SZ7A 3FTXA 3E34A 3C3OA 2P9KG 3T5XA 3CR3A 4TXRA 3RSEG 2WMOA 3U9WA 3DXKG 3GZSA 2X3MA 4LSZE 2WXLA 4L7TA 4U8VD 3GW4A 4FULA 4GYYA 4HOQA 4ANVA 1LF8A 2E2EA 5CERB 3MKQA 1S0PA 3MV3B 3W9FA 1JPLA 3PREA 5ANLA 5EN5D 4FHJA 2MYOA 2LXMA 1E7UA 3EU5A 3PRZA 4LRZA 3AJIA 4DX6D 3MEKA 4GZ6A 5G55A 4Y6CA 2FO1E 3RIBA 3JXIA 5LOZA 3HXCA 3K9IA 3V30A 3CSTA 5HQ8A 1EDUA 3G2TA 3ML8A 1TEZA 4MLPA 4F53A 1ELRA 1BU9A 3CHPA 4AY6A 4URKA 4G24A 3DXMG 1N94A 3ULYA 3QK0A 1HG5A 5D2MC 4AIFA 3SO8A 3VTYA 4EZKA 3KS2A 3I3NA 3CVPA 5E75A 2JABA 4RG6A 3UTMA 5LCWC 2ETCA 4BX8A 3S2AA 3UXGA 3DSXA 3G2SA 3O4ZA 2NSZA 4G1TA 1MJ0A 4EQFA 1OY3D 5D0OD 3V31A 2A4ZA 2IOSA 1U3CA 2L0TB 4NURA 4DLOA 2XEEA 4HS2A 2GRNB 3L54A 1GW6A 1BI8B 3FHEA 4UI9K 5JJ7A 4B94A 1Z6TA 4U95D 2MOWA 5CMWA 2JEKA 1OCCE 2I1KA 2Y3AA 3CK9A 4M3OA 3NZSA 3DBSA 5FQ7A 3IBEA 5J90A 1KLXA 3TXNA 3TWUA 5BPPA 3U3WA 3SF4A 3CHSA 3ZPJA 1Z3YA 1OCZE 3KAEA 3JXJA 4A3VA 2P9NG 3HIZA 1ELKA 3UMVA 4J7WA 4D10C 3CIAA 3E4BA 1S70B 3EJNA 3BG0B 3ENEA 1H2VC 3ASFA 2C2LA 5ENNA 4YDEA 5AQBA 3FU5A 3HXDA 3EUVA 5CRVA 1N0RA 3ZXPA 4KXKB 4WAFA 2M63A 2P2CP 4Q94A 3PNLB 4LNUD 3EU9A 2VSXE 1TN8A 2BF0X 3FUKA 5KJMA 2XEVA 4KYOB 2VJ8A 4J8YA 2ZGDA 3LDZA 4L2LA 3TWXA 2XENA 1D8DA 3ONKA 3FY4A 4G2VA 4DX5D 4U07A 2GGFA 3Q4AB 1D8EA 1H2TC 1SVXA 4C48B 4N2QA 5KJKA 3L16A 4KZCA 3GZ2A 5EDSA 1ZBPA 4GA2A 2P9PG 2X6FA 1X81A 3D9NA 2UY1A 1H6OA 1VDYA 4L9PA 5CCMA 5CBNA 2YINA 5AIJA 1TNOA 4A63B 4XZ4A 2HR2A 2YHCA 4G23A 1TJCA 2BKKB 2XZTG 5BNWA 3D9HA 4I43A 3EHQA 2WXRA 5HS0A 2PL2A 2B6CA 3DEOA 1OWPA 3E30A 4ATZD 1N9AA 3DSVA 4PDXA 4K5BA 2AXZA 1JWGA 1TNZA 1SA4A 3SD5A 2IU1A 1H19A 1MX4A 4FP7A 1N11A 3FU0A 4ILHB 2ETAA 5FQ4A 2R02A 3UI2A 3LVRE 2AWIA 1IQUA 4CYMD 1QBQA 4C0MA 1WDYA 4B0ZA 4RG9A 5G04C 1N0QA 2I6HA 4YVOA 5LX8A 4I9EA 4CZ2D 3B7TA 4I6JA 4I1MA 3L17A 3E32A 3S7JA 1HG2A 3QWVA 4GTQA 2J8SD 3DSWA 1QNFA 4I1AA 1JUQA 4BY6A 1MQSA 4CCAA 3P1UA 3AU5A 5LCWJ 3CSFA 2XHEA 1ZB1A 1ELWA 3PVLA 3Q7FA 4XX5A 5FIOA 4OAVB 3TWTA 3O48A 1S63A 2QZAA 2I2OA 4LEUA 4BERA 3X2QE 4KVMA 3APFA 3CQGB 4BSZB 2R5SA 3OXGA 4N3AA 4EPZA 3J5PA 4ME2A 2J9QA 1PC2A 1E8XA 3S7BA 3PUJA 2WXNA 4JB8P 5BV1A 4W9RA 3S7FA 4HOTA 2WXGA 4CDMA 3AG1E 5HI7A 3R9MA 3U64A 2R2LA 4GCNA 4I1OB 1EPUA 2GRLA 1U2VG 1E8YA 1WAO1 4UWFA 2V8SE 4PS3A 5ITZF 4G8LA 3NB2A 5ANRA 5FQ8A 4I2WA 3FUJA 4AEZC 4OVVA 3ABKE 4UI9J 4OAUC 3FUDA 4TV3A 2DVWA 2XRYA 3KEAA 2VQ2A 2H6GA 3VLFA 2H6IA 3ZVVA 2BEDA 3ZW3A 3RO2A 2IEJA 2XZDG 3SFXA 1IHGA 5C1DA 3LJNA 2B0OE 3PDNA 2JLBA 4ZHBA 2WXIA 3DPDA 2F8XK 2WXPA 2WXOA 4M7CA 2PQNA 1MZCA 2WB2A 3D9KA 3PE4A 5DBKA 3SBTB 3TWWA 4P29A 3FUIA 5CHEE 2KCVA 4IULA 1O1RA 3D9MA 2V5QC 2HM8A 1OUVA 2DZNA 4WNGA 3FU3A 1N4RA 1L5JA 2AW6A 3FTUA 2QYUA 2GW1A 2OVBA 1FCHA 2V4HC 1N54A 5FQ6A 3ZUVB 3PH0C 3U4TA 4UWLA 2OVFA 3BG1B 3L6AA 5LP0A 5G05C 4N5CA 3PNTB 1NA0A 3AG2E 1K1AA 2MRIA 1MHQA 3ESKA 5ENRD 4BFRA 3MKRA 3EIQC 2KZTA 3SI5A 3S7DA 3FWVA 4XI9A 4TRQA 3ZNGA 3TWQA 1G3NB 3MZLB 2DIWA 4IRUA 2CG2A 4JA7A 2DYRE 3FU6A 4K5AB 4YDYA 5KNGA 3PZ3A 1BLXB 3JCKC 3JYSA 2VYIA 2R05A 1WY6A 4N39A 4GAAA 3AAAC 1HX8A 3DRAA 4GMJA 1S64A 3Q7AA 3FP3A 3T8KA 1E96B 3FDHA 4H7YA 4AVXA 2P58C 2IO3C 3FTYA 5D0QD 1KZOA 4AM9A 3MV2B 1OCRE 4F6RD 2Y69E 3V79K 3G2WA 3ZGQA 3LXUX 1O5MA 2KCLA 2PQRA 1MX6A 3FUMA 4DJAA 2F37A 1Z5SC 4EECA 1HU3A 5EYPF 1OT8A 4GCOA 1YCSB 1FT2A 2I9CA 3FUNA 1P5QA 4PS7A 2J4DA 3EIJA 5ARGA 5EKQD 5A6CA 4GA1A 1PY1A 4ANXA 2LXLA 4ABNA 4JHKA 4APFA 5JJ6A 4HLLA 2FEZA 1DVPA 1XGWA 4UQYA 5FWQA 3RRUA 4YVQC 4GZ3A 3T5VA 4FLBA 4TUUA 4BTAA 2I1JA 4LG6A 2XPYA 3ONLA 3MKQB 5EIBE 4GTSA 4J0UA 1Y6IA 3FH5A 4J8SA 3MX3A 1TNUA 5AAOA 3BEEA 3ABME 1TJFA 2J07A 1INZA 3Q75A 3UIPC 4DX2A 3JQ1A 3Q73A 1IHBA 4K03A 3L22A 1N4SA 1WG0A 4O1OA 2VGXA 2QC9A 3PS6A 4UWHA 4OYSA 3SFYA 4FLHA 3CVXA 4XI0A 4N3BA 2FULA 1SZAA 3UKRG 5AQ7A 3DWLG 3CVVA 3UM3A 4FA6A 2ZIRA 2BUGA 5CMYA 1RZ4A 2ZGGA 2RFMA 5ENQD 1JCSA 2QY7A 3DEPA 1FVHA 4DI4A 1X5BA 3LVQE 2V0PA 5A23A 4I17A 3ABLE 3NOCD 3OAWA 4TUMA 3Q49B 5G2NA 2FBNA 2NC9A 3ISMC 4NQ0A 2BTDA 3TL5A 3IV0A 4J6IA 3ZHEA 2IF4A 1H6PA 5ENTD 2GROB 3CVLA 2GRRB 1OCOE 2FF4A 1NA3A 4NRHB 3ASGA 1HFAA 3QB2A 2F8YA 1A17A 4FADA 3Q79A 1PAQA 1W3BA 4F3VA 3E33A 5ENSD 3NF1A 1ZU2A 4Y6WA 3APDA 2QFCA 4JHJA 4XE0A 1U3DA 2GRMA 3HG0D 2AXUA 2IONA 4E6HA 4J8FA 2FO7A 4RQIA 3SFZA 5G05J 2L6JA 3SBSA 2ILRA 3Q78A 4GTVA 1UN8A 4QFVA 4L2YA 4FHKA 4EBAA 3LKUA 3HXFA 2E0IA 2WQHA 4KZ0A 3C3QA 3RU0A 3LY9A 4JXTA 2WQ6A 1UJKA 3U66A 3TAXA 3GYZA 3Q5MA 3LY7A 3IHVA 4JA9A 1V54E 2VTBB 4U8HA 4B8CB 5KWDA 3J5QB 5AARA 1Y8MA 3PEUB 3B95A 3QKYA 4I6EA 3RKVA 3N71A 4U63A 4XEIG 3FFLA 2CHWA 4I2ZA 4R7LA 5KBAA 3CKCA 5CECB 4IN3B 4BT8A 3MA5A 4HVBA 2LAIA 2EIJE 1MX2A 2YQ8A 2CHZA 4J8EA 1KT0A 1E7VA 3WG7E 2IO2C 3UQ3A 2RKKA 3OXFA 4GB9A 2GRQB 3G2VA 2KM4A 3ZKJA 1H0AA 5AQAA 4U8YD 3FUHA 5JMND 5J08A 3HDXA 3D9IA 4HORA 2WXFA 5EIDA 3CV0A 4XKCA 2UY1B 2LAHA 3APCA 3ZYLA 3TG4A 2H6FA 3RAUA 3CVQA 4EBAG 3LCAA 4BSXA 3KSQA 3UT4A 2WXJA 1SW6A 4GTTA 4C0EA 1EF1C 4AY5A 2P9IG 4KBQA 3RRMB 2KBXA 4IYPA 4CDRA 3ASOE 2H6HA 3I4RB 4GTMA 3LS8A 4XIFA 4KMOA 4JPSA 3ML9A 2P9SG 1SQMA 3CKBA 5HKPA 3ZYQA 4A3TA 5BUZA 4N2SA 3QWWA 3FEYA 4L23A 3HRAA 2DYSE 2IOLA 2CFZA 4I9CA 4GZ5A 4L1BA 2IY0C 3RRNB 2WXMA 4U0ZA 1A5EA 3C98A 2XCCA 1BI7B 3ZXSA 3L13A 3D3MA 3QJZA 3D9PA 4PH4B 1WM5A 1MYOA 5EILA 3UUXA 3MJWA 3AS8A 4FC8A 1HS6A 2P9LG 5LFAA 1QYMA 5B3SE 4V3IA 4O1PA 4N5QA 1E8WA 3TGOA 4GZCA 2KC7A 3ASDA 3PE3A 4JVSA 4KT6B
chains in the Genus database with same CATH topology
5FQ7A 3IBEA 4GMJA 5J90A 1KLXA 4JC8A 2WXHA 3FP3A 2J09A 3TXNA 3R7QA 1OWMA 1HZ4A 4N3CA 5BPPA 4CGVA 3U3WA 3CVUA 3SF4A 3CHSA 3B13A 3ZPJA 1E96B 2X6IA 4B8AA 1Z3YA 3FDHA 4H7YA 3CHQA 3QARA 5FJYA 3KAEA 4AVXA 4DK5A 2P58C 5D0QD 3FTYA 4WNEA 4A3VA 4AM9A 4H7XA 3MV2B 3FH8A 3HIZA 4MS6A 1ELKA 1HXIA 3CVNA 5AJLA 4AV7A 3UMVA 2UWJG 4D10C 3G2WA 3CIAA 2XGSA 3E4BA 3QNKA 3ZGQA 3ZIMA 4B89A 2C0MA 3MCXA 3EJNA 3LXUX 3BG0B 2Y4TA 3ENEA 1H2VC 3ASFA 1UJJA 2C2LA 2KCLA 2PQRA 3JQ0A 5ENNA 3FUMA 4DJAA 4EECA 4NACA 3FU5A 5JJTA 4GYWA 1HU3A 1HH8A 2OOEA 4BTBA 2C0LA 4ANUA 2CHXA 4MRUA 4GCOA 3ESLA 1B89A 3JUIA 3FULA 4OVUA 2I9CA 3CHRA 3FUNA 1P5QA 5T4YA 4PS7A 2J4DA 2J08A 4Q96A 3EIJA 4KXKB 4WAFA 5ARGA 2M63A 5EKQD 4CT0A 4HOSA 4U04A 3R7RA 1Z3XA 3LJ3A 4Q94A 5A6CA 1EYHA 3PNLB 4FJZA 4GA1A 1KT1A 1OWOA 1PY1A 4ANXA 4GMLA 4ILIA 2XPZA 4ABNA 5FT9A 2VSXE 4JHKA 2FI7A 5JJ6A 3SNXA 4APFA 5BT1A 3EHNA 2BF0X 3FUKA 3EDTB 5KJMA 5JHAA 2IFUA 2XEVA 3NZUA 3ZYMA 2FEZA 4KYOB 1DVPA 2VJ8A 3ZRHA 1XGWA 5A7DB 4UQYA 5FWQA 3RRUA 4J8DA 4F7AA 3CVYA 4YVQC 2CG3A 4GZ3A 3AU4A 3T5VA 5AENA 3ZYKA 3D9LA 4FLBA 3LDZA 4L2LA 4TUUA 5AJDA 2XRZA 2OV8A 3AS5A 2PM6A 3FTSA 4A1SA 4FU3A 4GAAA 4JL0A 3ONKA 4PS8A 3FY4A 4BTAA 2I1JA 4WUYA 4G2VA 1HE8A 4U07A 2XPYA 1IQRA 3ONLA 4CT4A 3MKQB 2GGFA 3Q4AB 3IEGA 3LY8A 4J0UA 1YA0A 2CFUA 4G26A 2ONDA 1HF8A 1Y6IA 3FH5A 1H2TC 4J8SA 4N2QA 2L9BA 5KJKA 3LPZA 3MX3A 4KT6B 3R9AB 3PZDA 4KVOA 3CHOA 3BEEA 2HO1A 3L16A 4KZCA 3GZ2A 4JZYA 4JEHA 3URZA 3FEXA 5EDSA 1TJFA 1ZBPA 2J07A 1INZA 2DCPA 4YNDA 4GA2A 2R17C 3JQ1A 2X6FA 4AOFA 3QDNA 1OWNA 2WMNA 3D9NA 4K03A 2UY1A 3L22A 3GZ1A 4HXIA 3HYMB 1VDYA 2VGXA 1QQEA 3PS6A 2LSUA 5CCMA 1BPOA 4UWHA 3QWPA 4OYSA 2YINA 4FLHA 3PUKA 2X6JA 2KCKA 5AIJA 3CVXA 3ZEFA 2RG8A 2HYZA 4XI0A 4XZ4A 4N3BA 3TJPA 4ACLA 2FULA 4BT9A 1SZAA 2HR2A 5KJNA 4GPKA 2YHCA 4G23A 4O6FA 3G2UA 5KCMA 3HHMA 5FTPA 1TJCA 2WXKA 3HVEB 3CVVA 5BNWA 2XGOA 4AXHA 4Q69A 4I43A 4I6GA 4FA6A 5ARFA 2WXRA 2PL2A 2BUGA 2WQ7A 5CMYA 1NP7A 2KATA 3FUEA 2VSOE 4DLQA 2QY7A 1OWPA 1FVHA 4DI4A 1X5BA 3CQCB 3PEVB 3LVQE 2V0PA 2A5UA 5A23A 4I17A 2Y4UA 4JEUA 5C2YA 3OAWA 3VLDA 3B7RL 3ULQA 3CK7A 1H2UA 3ZN3A 4PDXA 4MKTA 3FTVA 3Q49B 2L0IA 5G2NA 2AXZA 2FBNA 1JWGA 2NC9A 3SD5A 2IU1A 2WPVA 1H19A 3D9JA 2KZTB 4NQ0A 3KD7A 4UWKA 2BTDA 4FP7A 3KEZA 3FU0A 5G04J 4ILHB 4UQXA 3TL5A 4UQZA 4GYOA 5E76A 4AP2A 5FQ4A 4RSYA 3IV0A 4J6IA 3FUFA 3ZHEA 2IF4A 5AYWD 2XGMA 3LVRE 4XKBA 2AWIA 5T8IA 1IQUA 3QAQA 3CVLA 2FF4A 1E90A 1NA3A 4C0MA 4GU5A 3OXLA 3ASGA 4NRHB 1HFAA 2J4BA 3QB2A 4ACKA 4K0RA 1A17A 4B0ZA 1HX8A 4PUCA 4RG9A 5G04C 4HLEA 3OTNA 3FTZA 4FADA 4LCTA 3MGBA 1OWLA 4BX9A 1PAQA 2I6HA 4YVOA 2VSNA 1W3BA 5LX8A 4I9EA 4F3VA 4FJYA 4ATGA 3B7TA 4I6JA 3FTWA 4I1MA 1JWFA 3EHMA 3L17A 3NF1A 3WXXA 3S7JA 1HG2A 3QWVA 2V5FA 1ZU2A 4Y6WA 2ZU6B 3APDA 2QFCA 3D9OA 4JHJA 1FVFA 3CGHA 2VGYA 3I4GA 1QNFA 3L08A 4I1AA 4XE0A 3UT7A 1JUQA 4BY6A 1U3DA 2GRMA 4AJWA 4F1SA 2AXUA 2IONA 4G25A 4WWNA 4WWPA 1MQSA 2XCBA 4J8FA 3P1UA 2FO7A 3AU5A 3SHFA 3SFZA 4CCAA 5LCWJ 5G05J 2L6JA 3SBSA 3CSFA 1N52A 2EQXA 2ILRA 2XHEA 3RO3A 3T8MA 1ELWA 3PVLA 2J49A 3HVEA 4HOUA 1UN8A 2WXQA 3ASHA 4XX5A 4CRWA 4QFVA 3DBSA 4L2YA 4FHKA 4EBAA 2IQCA 2WM9A 3LKUA 3O48A 4G11A 4LEUA 2I2OA 3IHYA 3VTXA 3I5PA 3RJVA 4KVMA 3UPVA 1NZNA 2R59A 2E0IA 3APFA 2LNIA 3CEQA 1HO8A 3CQGB 2WQHA 4KZ0A 2WVIA 3B7UX 2R5SA 3RU0A 3OXGA 4N3AA 5DIZA 2MHKA 3CK8A 2AXVA 5FZSA 4EPZA 2PZIA 4JW1A 3LY9A 4JXTA 4A1GA 2WQ6A 1UJKA 4ME2A 3U66A 3TAXA 2IJGX 2J9QA 3GYZA 4HFGA 3Q5MA 4LERA 3LY7A 4RVBA 4CDNA 1E8ZA 1PC2A 3IHVA 4JA9A 1E8XA 3S7BA 3QOUA 2VTBB 2X6KA 2X38A 3PUJA 4U8HA 4WWOA 4WNDA 4B8CB 3CVWA 4ILGA 2WXNA 4C9BB 1Y8MA 4EZLA 3PEUB 3CHMA 1QZ2A 4W9RA 5BV1A 3S7FA 4HOTA 5JHBA 2WXGA 2XQ0A 4CDMA 3QKYA 4I6EA 4EZJA 5HI7A 3IKOB 3RKVA 3N71A 4U0SA 3SZ7A 3FTXA 4U63A 3U64A 5LP0A 4GCNA 4I1OB 1EPUA 2GRLA 3FFLA 4JHRA 2CHWA 1E8YA 1WAO1 4I2ZA 4UWFA 2V8SE 4R7LA 4PS3A 4DI3A 3CKCA 3CLJA 4IN3B 3T5XA 3RK6A 4GZDA 3CR3A 4BT8A 3MA5A 4HVBA 2WMOA 2LAIA 5ANRA 3U9WA 3GZSA 2X3MA 5FQ8A 4I2WA 2YQ8A 3TXMA 2CHZA 3FUJA 4J8EA 5FZRA 2DBAA 2WXLA 2V4LA 4AEZC 1KT0A 4OVVA 4L7TA 1E7VA 4ANWA 3UQ3A 2NXPA 4UI9J 3OXFA 4E85A 4GB9A 3VLEA 3FUDA 4TV3A 3G2VA 3MYVA 3GW4A 4FULA 2XRYA 4GYYA 2KM4A 2YHEA 2XPIA 4HOQA 4ANVA 2VQ2A 1H0AA 1LF8A 2E2EA 3VLFA 3MKQA 3FUHA 1S0PA 5J08A 3HDXA 3ZVVA 3LEWA 3MV3B 3ZW3A 3D9IA 4HORA 2WXFA 3RO2A 1JPLA 3CV0A 3PREA 5ANLA 4WNFA 2YNQA 4FHJA 4XKCA 5BV0A 1IHGA 1E7UA 5C1DA 3PRZA 4UI9C 2UY1B 4LRZA 2LAHA 3APCA 3MEKA 4GZ6A 5G55A 4Y6CA 3TG4A 3ZYLA 3PDNA 2VGXB 2JLBA 3RIBA 3CVQA 5BW8C 4EBAG 4BWRA 5LOZA 3LCAA 2VSYA 2WXIA 3DPDA 4BSXA 3K9IA 3UT4A 3UT8A 2WXJA 2WXPA 2WXOA 4C0EA 2PQNA 1EF1C 4AY5A 3CSTA 5HQ8A 2WB2A 3D9KA 1EDUA 3PE4A 3G2TA 5DBKA 3ML8A 4KBQA 3RRMB 5KJLA 4IYPA 3SBTB 4CDRA 1TEZA 4MLPA 2AVPA 3AS4A 3I4RB 1UN9A 4P29A 3FUIA 5CHEE 2KCVA 2PM7A 5EX0A 4F53A 1ELRA 4IULA 3D9MA 3LS8A 2HM8A 3CHPA 4XIFA 4AY6A 4URKA 1OUVA 2VTBA 4G24A 4KMOA 4JPSA 3ML9A 3FH7A 1SQMA 3CKBA 4WNGA 3ZYQA 4A3TA 5BUZA 4N2SA 3QWWA 3UX4A 4A55A 3FEYA 3QK0A 1H6KA 4L23A 1HG5A 3FU3A 4DPRA 3LYAA 5EX3A 1L5JA 2AW6A 3FTUA 4AIFA 2IOLA 3QC1A 2GW1A 4GA0A 1UG3A 3TG5A 2LO6A 2OVBA 2CFZA 1FCHA 4I9CA 3VTYA 4EZKA 1N54A 5FQ6A 3KS2A 3PH0C 2LSVA 4GZ5A 4L1BA 3U4TA 4UWLA 3SGHA 3I3NA 3CVPA 5E75A 2OVFA 4RG6A 3RRNB 3BG1B 3L6AA 2WXMA 4U0ZA 2X6HA 5G05C 4N5CA 3S2AA 4BX8A 5LCWC 3PNTB 5M72A 3C98A 3Q15A 2XCCA 1NA0A 3G2SA 3NQPA 3O4ZA 2NSZA 4G1TA 2MRIA 3ZXSA 1MHQA 3ZHEB 3L13A 3D3MA 3ESKA 4EQFA 4BFRA 3MKRA 3QJZA 3EIQC 3D9PA 4PH4B 4UWGA 5D0OD 2KZTA 1DNPA 1WM5A 2A4ZA 3SI5A 2IOSA 1IYGA 1U3CA 3S7DA 2L0TB 3FWVA 4NURA 4XI9A 3UUXA 4DLOA 2Q7FA 4CGWA 4HS2A 4TRQA 5FZQA 2RD0A 3MJWA 3AS8A 3L54A 1GW6A 3FHEA 4LUNU 4UI9K 4FC8A 5T3RA 1HS6A 3MZLB 5JJ7A 5LFAA 4B94A 1UW4B 1Z6TA 2DIWA 4CEMA 4E6HA 4APOA 4IRUA 2CG2A 3Q47B 4JA7A 3ZFWA 2MOWA 3FU6A 5CMWA 4V3IA 1E8WA 2JEKA 3JCKC 3JYSA 3P2BA 4GZCA 3TGOA 2I1KA 2KC7A 2VYIA 2Y3AA 5CCLA 3CK9A 4U0UA 4M3OA 3ASDA 3PE3A 3NZSA 1WY6A 3B7SA 4JVSA 4N39A 1XNFA 1SZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KLX A;  3FP3 A;  1HZ4 A;  1XNF A;  4CGV A;  3U3W A;  3SF4 A;  3ZPJ A;  1E96 B;  4H7Y A;  5FJY A;  3KAE A;  2P58 C;  5D0Q D;  4WNE A;  4AM9 A;  4H7X A;  3MV2 B;  1HXI A;  3CVN A;  2UWJ G;  2XGS A;  3E4B A;  3ZGQ A;  2C0M A;  2Y4T A;  3ASF A;  2KCL A;  2C2L A;  2PQR A;  5JJT A;  4GYW A;  4BTB A;  1HH8 A;  2OOE A;  2C0L A;  4GCO A;  1B89 A;  1P5Q A;  4KXK B;  5ARG A;  5EKQ D;  4HOS A;  4U04 A;  5A6C A;  4GA1 A;  1KT1 A;  4ABN A;  5FT9 A;  2FI7 A;  5JJ6 A;  5BT1 A;  5KJM A;  3EDT B;  2IFU A;  2XEV A;  2FEZ A;  4KYO B;  5A7D B;  4UQY A;  4J8D A;  4YVQ C;  4GZ3 A;  3AS5 A;  4A1S A;  4JL0 A;  4BTA A;  4WUY A;  4G2V A;  4U07 A;  3Q4A B;  3IEG A;  3LY8 A;  4J0U A;  1YA0 A;  4G26 A;  2OND A;  4N2Q A;  5KJK A;  3LPZ A;  3R9A B;  3BEE A;  2HO1 A;  3GZ2 A;  3URZ A;  1ZBP A;  4YND A;  4GA2 A;  3QDN A;  2UY1 A;  3GZ1 A;  3HYM B;  2VGX A;  1QQE A;  2LSU A;  5CCM A;  3QWP A;  2KCK A;  2HYZ A;  4XI0 A;  4N3B A;  4BT9 A;  2HR2 A;  5KJN A;  4GPK A;  2YHC A;  4G23 A;  4O6F A;  5FTP A;  1TJC A;  5BNW A;  2XGO A;  5ARF A;  2PL2 A;  2BUG A;  2KAT A;  4I17 A;  2Y4U A;  3ULQ A;  3CK7 A;  3ZN3 A;  3Q49 B;  2FBN A;  2NC9 A;  2WPV A;  4NQ0 A;  3KD7 A;  5G04 J;  4UQX A;  4UQZ A;  4GYO A;  3ZHE A;  2IF4 A;  5AYW D;  2XGM A;  3CVL A;  2FF4 A;  1NA3 A;  4NRH B;  3OXL A;  3ASG A;  1A17 A;  4RG9 A;  5G04 C;  2I6H A;  4YVO A;  2VSN A;  1W3B A;  4I9E A;  4F3V A;  3NF1 A;  3WXX A;  3S7J A;  3QWV A;  2V5F A;  1ZU2 A;  4Y6W A;  2QFC A;  2VGY A;  4I1A A;  4G25 A;  2XCB A;  4J8F A;  2FO7 A;  5LCW J;  5G05 J;  2L6J A;  3RO3 A;  1ELW A;  4HOU A;  3ASH A;  3O48 A;  3LKU A;  4LEU A;  3VTX A;  3RJV A;  3UPV A;  1NZN A;  2LNI A;  3CEQ A;  2WQH A;  2R5S A;  3RU0 A;  3OXG A;  4N3A A;  5DIZ A;  2MHK A;  3CK8 A;  5FZS A;  2PZI A;  3LY9 A;  4ME2 A;  3TAX A;  2J9Q A;  3GYZ A;  3Q5M A;  3LY7 A;  1PC2 A;  4JA9 A;  3S7B A;  3QOU A;  4WND A;  1Y8M A;  1QZ2 A;  4W9R A;  3S7F A;  4HOT A;  3QKY A;  5HI7 A;  3RKV A;  3N71 A;  4U0S A;  3SZ7 A;  4GCN A;  3FFL A;  4JHR A;  1WAO 1;  4I2Z A;  3CKC A;  4IN3 B;  4BT8 A;  3MA5 A;  4I2W A;  2YQ8 A;  4J8E A;  5FZR A;  2DBA A;  1KT0 A;  3UQ3 A;  4UI9 J;  3OXF A;  3GW4 A;  4GYY A;  2XPI A;  4HOQ A;  2VQ2 A;  2E2E A;  3MV3 B;  4HOR A;  3RO2 A;  3CV0 A;  4WNF A;  1IHG A;  5C1D A;  4UI9 C;  2UY1 B;  3MEK A;  4GZ6 A;  4Y6C A;  3TG4 A;  3PDN A;  2VGX B;  2JLB A;  3RIB A;  3CVQ A;  5BW8 C;  4BWR A;  3LCA A;  2VSY A;  3K9I A;  2PQN A;  4AY5 A;  5HQ8 A;  3PE4 A;  5DBK A;  4KBQ A;  5KJL A;  4CDR A;  2AVP A;  3AS4 A;  5CHE E;  2KCV A;  5EX0 A;  1ELR A;  4XIF A;  4AY6 A;  1OUV A;  4G24 A;  3CKB A;  4WNG A;  4N2S A;  3QWW A;  3LYA A;  5EX3 A;  4AIF A;  2GW1 A;  4GA0 A;  3TG5 A;  1FCH A;  4I9C A;  3VTY A;  3KS2 A;  4GZ5 A;  2LSV A;  3U4T A;  3CVP A;  4RG6 A;  5LCW C;  4U0Z A;  5G05 C;  4N5C A;  5M72 A;  3Q15 A;  2XCC A;  1NA0 A;  4G1T A;  3ZHE B;  3ESK A;  4EQF A;  3MKR A;  5D0O D;  1WM5 A;  1IYG A;  3S7D A;  3FWV A;  4XI9 A;  3UUX A;  4CGW A;  2Q7F A;  5FZQ A;  3AS8 A;  4UI9 K;  5JJ7 A;  4B94 A;  4APO A;  3Q47 B;  3ZFW A;  4JA7 A;  3JYS A;  3TGO A;  2KC7 A;  2VYI A;  5CCL A;  3CK9 A;  4U0U A;  3ASD A;  3PE3 A;  4N39 A;  4N3C A; 
#chains in the Genus database with same CATH topology
 2XEH A;  2WXH A;  4GTR A;  2J09 A;  2ZIS A;  1HZ4 A;  4CGV A;  3CVU A;  2NYJ A;  3B13 A;  2X6I A;  3KSL A;  3CHQ A;  3QAR A;  5FJY A;  4WNE A;  4H7X A;  3FH8 A;  4AV7 A;  1SA5 A;  4X8Q A;  2XGS A;  3QNK A;  3ZIM A;  2C0M A;  3JQ0 A;  4B93 B;  4GYW A;  1HH8 A;  2HE0 A;  2P9U G;  1B89 A;  3JUI A;  3FUL A;  4OVU A;  3CHR A;  3SY2 A;  2DWZ A;  3NAW A;  4HOS A;  1TNY A;  3LJ3 A;  1EYH A;  1LTX A;  2GRP B;  1TNB A;  4GML A;  4ILI A;  1TR4 A;  2XPZ A;  5FT9 A;  3SNX A;  2FI7 A;  3W9G A;  2IFU A;  3NZU A;  3ZRH A;  3HXB A;  2Y0B G;  5A7D B;  2EIL E;  4J8D A;  3CVY A;  2XS1 A;  5AEN A;  4EHM A;  3ZYK A;  3BU8 A;  2XRZ A;  4K5C A;  3AS5 A;  4A1S A;  1K3Z D;  4PS8 A;  1YMP A;  4WUY A;  1HE8 A;  1IQR A;  3IEG A;  3C3R A;  1TN6 A;  2CFU A;  4G26 A;  2OND A;  4MBG A;  1HF8 A;  2ETB A;  3LPZ A;  4HRN A;  3R9A B;  3PZD A;  4JZY A;  3URZ A;  1OXJ A;  4YND A;  1Q2Z A;  1OWN A;  2WMN A;  3EHR A;  3GZ1 A;  3HYM B;  3C72 A;  4UUC A;  3PUK A;  2X6J A;  3ZEF A;  2HYZ A;  3UM1 A;  3TJP A;  4BT9 A;  4HRL A;  4HI9 A;  3HHM A;  5FTP A;  3HVE B;  4AXH A;  3TWR A;  4HQD A;  3Q9N C;  4I6G A;  2WQ7 A;  3FUE A;  3HXE A;  4Z68 A;  1IKN D;  3PZ2 A;  3B7B A;  5C2Y A;  3B7R L;  3ULQ A;  1H2U A;  3ZN3 A;  3FTV A;  2RFA A;  3JUE A;  2L6B A;  2WPV A;  2KZT B;  3PZ1 A;  4UWK A;  5G04 J;  1DCE A;  4GYO A;  5E76 A;  5H7P A;  5T8I A;  3DST A;  2EIM E;  3OXL A;  2J4B A;  1N4P A;  4ACK A;  4K0R A;  4PUC A;  3FTZ A;  5IY5 E;  4LCT A;  3MGB A;  1OWL A;  3UM0 A;  4TXP A;  4ATG A;  3FTW A;  1JWF A;  1V55 E;  4GMR A;  3D9O A;  4NIK A;  1FVF A;  3CGH A;  2VGY A;  3I4G A;  3L08 A;  3UT7 A;  1FT1 A;  3E37 A;  5CRU A;  4F1S A;  4G25 A;  4WWN A;  4WWP A;  2XCB A;  3SHF A;  2EQX A;  4O60 A;  5B1A E;  3RO3 A;  4ZFH A;  4LNB A;  5BXO A;  4TXQ A;  1N95 A;  3ULE G;  2WXQ A;  4CRW A;  3DSU A;  2IQC A;  1UOH A;  3IHY A;  3VTX A;  3UPV A;  2LNI A;  3CEQ A;  1HO8 A;  2WVI A;  3PZ4 A;  5D66 A;  3UIO C;  2MHK A;  2AXV A;  1K1B A;  2PZI A;  4A1G A;  1N4Q A;  4HFG A;  4LER A;  4RVB A;  4CDN A;  1E8Z A;  2X38 A;  3CVW A;  3DPY A;  4ILG A;  3CHM A;  2XQ0 A;  4EZJ A;  4LNG A;  3IXE A;  3IKO B;  4U0S A;  1IXV A;  4JHR A;  4DX1 A;  5AQ9 A;  4DI3 A;  3CLJ A;  2PNN A;  4DRX E;  3RK6 A;  4GZD A;  3UIN C;  3DSS A;  3UM2 A;  3TXM A;  5FZR A;  1KZP A;  2DBA A;  2V4L A;  4ANW A;  3F6Q A;  2NXP A;  4E85 A;  3VLE A;  3MYV A;  3C5R A;  2YHE A;  2XPI A;  2EIK E;  3LEW A;  4WNF A;  2KXP C;  2YNQ A;  5ENP D;  5BV0 A;  1DCQ A;  4UI9 C;  2VGX B;  5FIN A;  5BW8 C;  4BWR A;  2VSY A;  2BKG A;  4YDO A;  3UT8 A;  4F1P A;  5KJL A;  5AN8 A;  2AVP A;  3AS4 A;  1UN9 A;  5EX0 A;  2PM7 A;  1O1S A;  2VTB A;  3FH7 A;  4QQI A;  3UX4 A;  4A55 A;  1H6K A;  4DPR A;  3LYA A;  5EX3 A;  1LD8 A;  3QC1 A;  4GA0 A;  1UG3 A;  3TG5 A;  2LO6 A;  5BXU A;  1K8K G;  2LSV A;  2ZXW E;  3SGH A;  2X6H A;  5M72 A;  3Q15 A;  3NQP A;  3ZHE B;  3V2O A;  4UWG A;  1DNP A;  1IYG A;  4CGW A;  2Q7F A;  5FZQ A;  2RD0 A;  4LUN U;  5CEA A;  5T3R A;  3TWS A;  2DZO A;  1UW4 B;  4CEM A;  4APO A;  3Q47 B;  3ZFW A;  5EYL A;  3P2B A;  3ZU7 B;  5CCL A;  2XS8 A;  4U0U A;  3B7S A;  1BD8 A;  4N3C A;  1XNF A;  1SZ9 A;  4DUI A;  3BQO A;  4JC8 A;  4GPM A;  3R7Q A;  1OWM A;  4DK5 A;  4MS6 A;  1HXI A;  3CVN A;  5AJL A;  4BES A;  2UWJ G;  4B89 A;  3MCX A;  1O1T A;  2Y4T A;  1UJJ A;  2A5E A;  2OEW A;  4NAC A;  5JJT A;  4BTB A;  2OOE A;  4DX7 D;  2C0L A;  4ANU A;  2CHX A;  4HB5 A;  4MRU A;  3ESL A;  5T4Y A;  2J08 A;  4Q96 A;  1TN7 A;  4CT0 A;  4U04 A;  3R7R A;  1Z3X A;  3SQV A;  4FJZ A;  1KT1 A;  1OWO A;  3L9T A;  2EIN E;  1RW2 A;  5BT1 A;  3EHN A;  3EDT B;  5JHA A;  3ZYM A;  2AJA A;  3NOG D;  1AP7 A;  4F7A A;  2F0Y A;  2CG3 A;  3AU4 A;  3D9L A;  4BET A;  4GTO A;  5AJD A;  2OV8 A;  2PM6 A;  3FTS A;  4FU3 A;  4JL0 A;  4CT4 A;  2Y1L E;  3LY8 A;  1YA0 A;  4HRM B;  2L9B A;  4KVO A;  3CHO A;  2HO1 A;  4JEH A;  3FEX A;  2DCP A;  2R17 C;  4AOF A;  3QDN A;  5HRY A;  1D9S A;  4HXI A;  1JCR A;  3UKU G;  1QQE A;  3AG4 E;  2LSU A;  1BPO A;  3QWP A;  4HNA D;  2KCK A;  2RG8 A;  3L82 A;  5B1B E;  4ACL A;  4G8K A;  3TWV A;  5KJN A;  4GPK A;  4O6F A;  3G2U A;  5KCM A;  2WXK A;  2VGE A;  2XGO A;  4Q69 A;  5ARF A;  1NP7 A;  2KAT A;  2QYJ A;  5KNH D;  4DLQ A;  2VSO E;  5CBO A;  3CQC B;  3PEV B;  2A5U A;  3BUA A;  2Y4U A;  4JEU A;  4GTP A;  3VLD A;  3CK7 A;  4MKT A;  1LD7 A;  2L0I A;  4HI8 A;  1DC2 A;  3D9J A;  3KD7 A;  3KEZ A;  4UQX A;  4U7E B;  4UQZ A;  4AP2 A;  4RSY A;  3FUF A;  4RLY A;  5AYW D;  2XGM A;  4XKB A;  1NL4 A;  3V2X A;  3QAQ A;  1E90 A;  4GU5 A;  4HLE A;  3OTN A;  4YDW A;  5CED B;  4BX9 A;  1AWC B;  2VSN A;  4FJY A;  3T9K A;  4HBD A;  3EHM A;  1NFI E;  3WXX A;  2V5F A;  2ZU6 B;  1YYH A;  2OCC E;  4BEP A;  4AJW A;  2R03 A;  1NI1 A;  4B8A A;  1JCQ A;  1FPP A;  1N52 A;  2LUH A;  3T8M A;  2J49 A;  3HVE A;  4HOU A;  3ASH A;  3NBN B;  2WM9 A;  4G11 A;  1KPS B;  1TYQ G;  3I5P A;  3RJV A;  1NZN A;  2R59 A;  3ASN E;  3B7U X;  5JA4 D;  3Q9U C;  5DIZ A;  3CK8 A;  3AG3 E;  2OEV A;  5FZS A;  4JW1 A;  5ENO D;  4U96 D;  2IJG X;  3QOU A;  2X6K A;  4WWO A;  4WND A;  4JD2 G;  4C9B B;  4EZL A;  1QZ2 A;  5JHB A;  3SZ7 A;  3FTX A;  3E34 A;  3C3O A;  2P9K G;  3T5X A;  3CR3 A;  4TXR A;  3RSE G;  2WMO A;  3U9W A;  3DXK G;  3GZS A;  2X3M A;  4LSZ E;  2WXL A;  4L7T A;  4U8V D;  3GW4 A;  4FUL A;  4GYY A;  4HOQ A;  4ANV A;  1LF8 A;  2E2E A;  5CER B;  3MKQ A;  1S0P A;  3MV3 B;  3W9F A;  1JPL A;  3PRE A;  5ANL A;  5EN5 D;  4FHJ A;  2MYO A;  2LXM A;  1E7U A;  3EU5 A;  3PRZ A;  4LRZ A;  3AJI A;  4DX6 D;  3MEK A;  4GZ6 A;  5G55 A;  4Y6C A;  2FO1 E;  3RIB A;  3JXI A;  5LOZ A;  3HXC A;  3K9I A;  3V30 A;  3CST A;  5HQ8 A;  1EDU A;  3G2T A;  3ML8 A;  1TEZ A;  4MLP A;  4F53 A;  1ELR A;  1BU9 A;  3CHP A;  4AY6 A;  4URK A;  4G24 A;  3DXM G;  1N94 A;  3ULY A;  3QK0 A;  1HG5 A;  5D2M C;  4AIF A;  3SO8 A;  3VTY A;  4EZK A;  3KS2 A;  3I3N A;  3CVP A;  5E75 A;  2JAB A;  4RG6 A;  3UTM A;  5LCW C;  2ETC A;  4BX8 A;  3S2A A;  3UXG A;  3DSX A;  3G2S A;  3O4Z A;  2NSZ A;  4G1T A;  1MJ0 A;  4EQF A;  1OY3 D;  5D0O D;  3V31 A;  2A4Z A;  2IOS A;  1U3C A;  2L0T B;  4NUR A;  4DLO A;  2XEE A;  4HS2 A;  2GRN B;  3L54 A;  1GW6 A;  1BI8 B;  3FHE A;  4UI9 K;  5JJ7 A;  4B94 A;  1Z6T A;  4U95 D;  2MOW A;  5CMW A;  2JEK A;  1OCC E;  2I1K A;  2Y3A A;  3CK9 A;  4M3O A;  3NZS A;  3DBS A;  5FQ7 A;  3IBE A;  5J90 A;  1KLX A;  3TXN A;  3TWU A;  5BPP A;  3U3W A;  3SF4 A;  3CHS A;  3ZPJ A;  1Z3Y A;  1OCZ E;  3KAE A;  3JXJ A;  4A3V A;  2P9N G;  3HIZ A;  1ELK A;  3UMV A;  4J7W A;  4D10 C;  3CIA A;  3E4B A;  1S70 B;  3EJN A;  3BG0 B;  3ENE A;  1H2V C;  3ASF A;  2C2L A;  5ENN A;  4YDE A;  5AQB A;  3FU5 A;  3HXD A;  3EUV A;  5CRV A;  1N0R A;  3ZXP A;  4KXK B;  4WAF A;  2M63 A;  2P2C P;  4Q94 A;  3PNL B;  4LNU D;  3EU9 A;  2VSX E;  1TN8 A;  2BF0 X;  3FUK A;  5KJM A;  2XEV A;  4KYO B;  2VJ8 A;  4J8Y A;  2ZGD A;  3LDZ A;  4L2L A;  3TWX A;  2XEN A;  1D8D A;  3ONK A;  3FY4 A;  4G2V A;  4DX5 D;  4U07 A;  2GGF A;  3Q4A B;  1D8E A;  1H2T C;  1SVX A;  4C48 B;  4N2Q A;  5KJK A;  3L16 A;  4KZC A;  3GZ2 A;  5EDS A;  1ZBP A;  4GA2 A;  2P9P G;  2X6F A;  1X81 A;  3D9N A;  2UY1 A;  1H6O A;  1VDY A;  4L9P A;  5CCM A;  5CBN A;  2YIN A;  5AIJ A;  1TNO A;  4A63 B;  4XZ4 A;  2HR2 A;  2YHC A;  4G23 A;  1TJC A;  2BKK B;  2XZT G;  5BNW A;  3D9H A;  4I43 A;  3EHQ A;  2WXR A;  5HS0 A;  2PL2 A;  2B6C A;  3DEO A;  1OWP A;  3E30 A;  4ATZ D;  1N9A A;  3DSV A;  4PDX A;  4K5B A;  2AXZ A;  1JWG A;  1TNZ A;  1SA4 A;  3SD5 A;  2IU1 A;  1H19 A;  1MX4 A;  4FP7 A;  1N11 A;  3FU0 A;  4ILH B;  2ETA A;  5FQ4 A;  2R02 A;  3UI2 A;  3LVR E;  2AWI A;  1IQU A;  4CYM D;  1QBQ A;  4C0M A;  1WDY A;  4B0Z A;  4RG9 A;  5G04 C;  1N0Q A;  2I6H A;  4YVO A;  5LX8 A;  4I9E A;  4CZ2 D;  3B7T A;  4I6J A;  4I1M A;  3L17 A;  3E32 A;  3S7J A;  1HG2 A;  3QWV A;  4GTQ A;  2J8S D;  3DSW A;  1QNF A;  4I1A A;  1JUQ A;  4BY6 A;  1MQS A;  4CCA A;  3P1U A;  3AU5 A;  5LCW J;  3CSF A;  2XHE A;  1ZB1 A;  1ELW A;  3PVL A;  3Q7F A;  4XX5 A;  5FIO A;  4OAV B;  3TWT A;  3O48 A;  1S63 A;  2QZA A;  2I2O A;  4LEU A;  4BER A;  3X2Q E;  4KVM A;  3APF A;  3CQG B;  4BSZ B;  2R5S A;  3OXG A;  4N3A A;  4EPZ A;  3J5P A;  4ME2 A;  2J9Q A;  1PC2 A;  1E8X A;  3S7B A;  3PUJ A;  2WXN A;  4JB8 P;  5BV1 A;  4W9R A;  3S7F A;  4HOT A;  2WXG A;  4CDM A;  3AG1 E;  5HI7 A;  3R9M A;  3U64 A;  2R2L A;  4GCN A;  4I1O B;  1EPU A;  2GRL A;  1U2V G;  1E8Y A;  1WAO 1;  4UWF A;  2V8S E;  4PS3 A;  5ITZ F;  4G8L A;  3NB2 A;  5ANR A;  5FQ8 A;  4I2W A;  3FUJ A;  4AEZ C;  4OVV A;  3ABK E;  4UI9 J;  4OAU C;  3FUD A;  4TV3 A;  2DVW A;  2XRY A;  3KEA A;  2VQ2 A;  2H6G A;  3VLF A;  2H6I A;  3ZVV A;  2BED A;  3ZW3 A;  3RO2 A;  2IEJ A;  2XZD G;  3SFX A;  1IHG A;  5C1D A;  3LJN A;  2B0O E;  3PDN A;  2JLB A;  4ZHB A;  2WXI A;  3DPD A;  2F8X K;  2WXP A;  2WXO A;  4M7C A;  2PQN A;  1MZC A;  2WB2 A;  3D9K A;  3PE4 A;  5DBK A;  3SBT B;  3TWW A;  4P29 A;  3FUI A;  5CHE E;  2KCV A;  4IUL A;  1O1R A;  3D9M A;  2V5Q C;  2HM8 A;  1OUV A;  2DZN A;  4WNG A;  3FU3 A;  1N4R A;  1L5J A;  2AW6 A;  3FTU A;  2QYU A;  2GW1 A;  2OVB A;  1FCH A;  2V4H C;  1N54 A;  5FQ6 A;  3ZUV B;  3PH0 C;  3U4T A;  4UWL A;  2OVF A;  3BG1 B;  3L6A A;  5LP0 A;  5G05 C;  4N5C A;  3PNT B;  1NA0 A;  3AG2 E;  1K1A A;  2MRI A;  1MHQ A;  3ESK A;  5ENR D;  4BFR A;  3MKR A;  3EIQ C;  2KZT A;  3SI5 A;  3S7D A;  3FWV A;  4XI9 A;  4TRQ A;  3ZNG A;  3TWQ A;  1G3N B;  3MZL B;  2DIW A;  4IRU A;  2CG2 A;  4JA7 A;  2DYR E;  3FU6 A;  4K5A B;  4YDY A;  5KNG A;  3PZ3 A;  1BLX B;  3JCK C;  3JYS A;  2VYI A;  2R05 A;  1WY6 A;  4N39 A;  4GAA A;  3AAA C;  1HX8 A;  3DRA A;  4GMJ A;  1S64 A;  3Q7A A;  3FP3 A;  3T8K A;  1E96 B;  3FDH A;  4H7Y A;  4AVX A;  2P58 C;  2IO3 C;  3FTY A;  5D0Q D;  1KZO A;  4AM9 A;  3MV2 B;  1OCR E;  4F6R D;  2Y69 E;  3V79 K;  3G2W A;  3ZGQ A;  3LXU X;  1O5M A;  2KCL A;  2PQR A;  1MX6 A;  3FUM A;  4DJA A;  2F37 A;  1Z5S C;  4EEC A;  1HU3 A;  5EYP F;  1OT8 A;  4GCO A;  1YCS B;  1FT2 A;  2I9C A;  3FUN A;  1P5Q A;  4PS7 A;  2J4D A;  3EIJ A;  5ARG A;  5EKQ D;  5A6C A;  4GA1 A;  1PY1 A;  4ANX A;  2LXL A;  4ABN A;  4JHK A;  4APF A;  5JJ6 A;  4HLL A;  2FEZ A;  1DVP A;  1XGW A;  4UQY A;  5FWQ A;  3RRU A;  4YVQ C;  4GZ3 A;  3T5V A;  4FLB A;  4TUU A;  4BTA A;  2I1J A;  4LG6 A;  2XPY A;  3ONL A;  3MKQ B;  5EIB E;  4GTS A;  4J0U A;  1Y6I A;  3FH5 A;  4J8S A;  3MX3 A;  1TNU A;  5AAO A;  3BEE A;  3ABM E;  1TJF A;  2J07 A;  1INZ A;  3Q75 A;  3UIP C;  4DX2 A;  3JQ1 A;  3Q73 A;  1IHB A;  4K03 A;  3L22 A;  1N4S A;  1WG0 A;  4O1O A;  2VGX A;  2QC9 A;  3PS6 A;  4UWH A;  4OYS A;  3SFY A;  4FLH A;  3CVX A;  4XI0 A;  4N3B A;  2FUL A;  1SZA A;  3UKR G;  5AQ7 A;  3DWL G;  3CVV A;  3UM3 A;  4FA6 A;  2ZIR A;  2BUG A;  5CMY A;  1RZ4 A;  2ZGG A;  2RFM A;  5ENQ D;  1JCS A;  2QY7 A;  3DEP A;  1FVH A;  4DI4 A;  1X5B A;  3LVQ E;  2V0P A;  5A23 A;  4I17 A;  3ABL E;  3NOC D;  3OAW A;  4TUM A;  3Q49 B;  5G2N A;  2FBN A;  2NC9 A;  3ISM C;  4NQ0 A;  2BTD A;  3TL5 A;  3IV0 A;  4J6I A;  3ZHE A;  2IF4 A;  1H6P A;  5ENT D;  2GRO B;  3CVL A;  2GRR B;  1OCO E;  2FF4 A;  1NA3 A;  4NRH B;  3ASG A;  1HFA A;  3QB2 A;  2F8Y A;  1A17 A;  4FAD A;  3Q79 A;  1PAQ A;  1W3B A;  4F3V A;  3E33 A;  5ENS D;  3NF1 A;  1ZU2 A;  4Y6W A;  3APD A;  2QFC A;  4JHJ A;  4XE0 A;  1U3D A;  2GRM A;  3HG0 D;  2AXU A;  2ION A;  4E6H A;  4J8F A;  2FO7 A;  4RQI A;  3SFZ A;  5G05 J;  2L6J A;  3SBS A;  2ILR A;  3Q78 A;  4GTV A;  1UN8 A;  4QFV A;  4L2Y A;  4FHK A;  4EBA A;  3LKU A;  3HXF A;  2E0I A;  2WQH A;  4KZ0 A;  3C3Q A;  3RU0 A;  3LY9 A;  4JXT A;  2WQ6 A;  1UJK A;  3U66 A;  3TAX A;  3GYZ A;  3Q5M A;  3LY7 A;  3IHV A;  4JA9 A;  1V54 E;  2VTB B;  4U8H A;  4B8C B;  5KWD A;  3J5Q B;  5AAR A;  1Y8M A;  3PEU B;  3B95 A;  3QKY A;  4I6E A;  3RKV A;  3N71 A;  4U63 A;  4XEI G;  3FFL A;  2CHW A;  4I2Z A;  4R7L A;  5KBA A;  3CKC A;  5CEC B;  4IN3 B;  4BT8 A;  3MA5 A;  4HVB A;  2LAI A;  2EIJ E;  1MX2 A;  2YQ8 A;  2CHZ A;  4J8E A;  1KT0 A;  1E7V A;  3WG7 E;  2IO2 C;  3UQ3 A;  2RKK A;  3OXF A;  4GB9 A;  2GRQ B;  3G2V A;  2KM4 A;  3ZKJ A;  1H0A A;  5AQA A;  4U8Y D;  3FUH A;  5JMN D;  5J08 A;  3HDX A;  3D9I A;  4HOR A;  2WXF A;  5EID A;  3CV0 A;  4XKC A;  2UY1 B;  2LAH A;  3APC A;  3ZYL A;  3TG4 A;  2H6F A;  3RAU A;  3CVQ A;  4EBA G;  3LCA A;  4BSX A;  3KSQ A;  3UT4 A;  2WXJ A;  1SW6 A;  4GTT A;  4C0E A;  1EF1 C;  4AY5 A;  2P9I G;  4KBQ A;  3RRM B;  2KBX A;  4IYP A;  4CDR A;  3ASO E;  2H6H A;  3I4R B;  4GTM A;  3LS8 A;  4XIF A;  4KMO A;  4JPS A;  3ML9 A;  2P9S G;  1SQM A;  3CKB A;  5HKP A;  3ZYQ A;  4A3T A;  5BUZ A;  4N2S A;  3QWW A;  3FEY A;  4L23 A;  3HRA A;  2DYS E;  2IOL A;  2CFZ A;  4I9C A;  4GZ5 A;  4L1B A;  2IY0 C;  3RRN B;  2WXM A;  4U0Z A;  1A5E A;  3C98 A;  2XCC A;  1BI7 B;  3ZXS A;  3L13 A;  3D3M A;  3QJZ A;  3D9P A;  4PH4 B;  1WM5 A;  1MYO A;  5EIL A;  3UUX A;  3MJW A;  3AS8 A;  4FC8 A;  1HS6 A;  2P9L G;  5LFA A;  1QYM A;  5B3S E;  4V3I A;  4O1P A;  4N5Q A;  1E8W A;  3TGO A;  4GZC A;  2KC7 A;  3ASD A;  3PE3 A;  4JVS A;  4KT6 B; 
#chains in the Genus database with same CATH homology
 5FQ7 A;  3IBE A;  4GMJ A;  5J90 A;  1KLX A;  4JC8 A;  2WXH A;  3FP3 A;  2J09 A;  3TXN A;  3R7Q A;  1OWM A;  1HZ4 A;  4N3C A;  5BPP A;  4CGV A;  3U3W A;  3CVU A;  3SF4 A;  3CHS A;  3B13 A;  3ZPJ A;  1E96 B;  2X6I A;  4B8A A;  1Z3Y A;  3FDH A;  4H7Y A;  3CHQ A;  3QAR A;  5FJY A;  3KAE A;  4AVX A;  4DK5 A;  2P58 C;  5D0Q D;  3FTY A;  4WNE A;  4A3V A;  4AM9 A;  4H7X A;  3MV2 B;  3FH8 A;  3HIZ A;  4MS6 A;  1ELK A;  1HXI A;  3CVN A;  5AJL A;  4AV7 A;  3UMV A;  2UWJ G;  4D10 C;  3G2W A;  3CIA A;  2XGS A;  3E4B A;  3QNK A;  3ZGQ A;  3ZIM A;  4B89 A;  2C0M A;  3MCX A;  3EJN A;  3LXU X;  3BG0 B;  2Y4T A;  3ENE A;  1H2V C;  3ASF A;  1UJJ A;  2C2L A;  2KCL A;  2PQR A;  3JQ0 A;  5ENN A;  3FUM A;  4DJA A;  4EEC A;  4NAC A;  3FU5 A;  5JJT A;  4GYW A;  1HU3 A;  1HH8 A;  2OOE A;  4BTB A;  2C0L A;  4ANU A;  2CHX A;  4MRU A;  4GCO A;  3ESL A;  1B89 A;  3JUI A;  3FUL A;  4OVU A;  2I9C A;  3CHR A;  3FUN A;  1P5Q A;  5T4Y A;  4PS7 A;  2J4D A;  2J08 A;  4Q96 A;  3EIJ A;  4KXK B;  4WAF A;  5ARG A;  2M63 A;  5EKQ D;  4CT0 A;  4HOS A;  4U04 A;  3R7R A;  1Z3X A;  3LJ3 A;  4Q94 A;  5A6C A;  1EYH A;  3PNL B;  4FJZ A;  4GA1 A;  1KT1 A;  1OWO A;  1PY1 A;  4ANX A;  4GML A;  4ILI A;  2XPZ A;  4ABN A;  5FT9 A;  2VSX E;  4JHK A;  2FI7 A;  5JJ6 A;  3SNX A;  4APF A;  5BT1 A;  3EHN A;  2BF0 X;  3FUK A;  3EDT B;  5KJM A;  5JHA A;  2IFU A;  2XEV A;  3NZU A;  3ZYM A;  2FEZ A;  4KYO B;  1DVP A;  2VJ8 A;  3ZRH A;  1XGW A;  5A7D B;  4UQY A;  5FWQ A;  3RRU A;  4J8D A;  4F7A A;  3CVY A;  4YVQ C;  2CG3 A;  4GZ3 A;  3AU4 A;  3T5V A;  5AEN A;  3ZYK A;  3D9L A;  4FLB A;  3LDZ A;  4L2L A;  4TUU A;  5AJD A;  2XRZ A;  2OV8 A;  3AS5 A;  2PM6 A;  3FTS A;  4A1S A;  4FU3 A;  4GAA A;  4JL0 A;  3ONK A;  4PS8 A;  3FY4 A;  4BTA A;  2I1J A;  4WUY A;  4G2V A;  1HE8 A;  4U07 A;  2XPY A;  1IQR A;  3ONL A;  4CT4 A;  3MKQ B;  2GGF A;  3Q4A B;  3IEG A;  3LY8 A;  4J0U A;  1YA0 A;  2CFU A;  4G26 A;  2OND A;  1HF8 A;  1Y6I A;  3FH5 A;  1H2T C;  4J8S A;  4N2Q A;  2L9B A;  5KJK A;  3LPZ A;  3MX3 A;  4KT6 B;  3R9A B;  3PZD A;  4KVO A;  3CHO A;  3BEE A;  2HO1 A;  3L16 A;  4KZC A;  3GZ2 A;  4JZY A;  4JEH A;  3URZ A;  3FEX A;  5EDS A;  1TJF A;  1ZBP A;  2J07 A;  1INZ A;  2DCP A;  4YND A;  4GA2 A;  2R17 C;  3JQ1 A;  2X6F A;  4AOF A;  3QDN A;  1OWN A;  2WMN A;  3D9N A;  4K03 A;  2UY1 A;  3L22 A;  3GZ1 A;  4HXI A;  3HYM B;  1VDY A;  2VGX A;  1QQE A;  3PS6 A;  2LSU A;  5CCM A;  1BPO A;  4UWH A;  3QWP A;  4OYS A;  2YIN A;  4FLH A;  3PUK A;  2X6J A;  2KCK A;  5AIJ A;  3CVX A;  3ZEF A;  2RG8 A;  2HYZ A;  4XI0 A;  4XZ4 A;  4N3B A;  3TJP A;  4ACL A;  2FUL A;  4BT9 A;  1SZA A;  2HR2 A;  5KJN A;  4GPK A;  2YHC A;  4G23 A;  4O6F A;  3G2U A;  5KCM A;  3HHM A;  5FTP A;  1TJC A;  2WXK A;  3HVE B;  3CVV A;  5BNW A;  2XGO A;  4AXH A;  4Q69 A;  4I43 A;  4I6G A;  4FA6 A;  5ARF A;  2WXR A;  2PL2 A;  2BUG A;  2WQ7 A;  5CMY A;  1NP7 A;  2KAT A;  3FUE A;  2VSO E;  4DLQ A;  2QY7 A;  1OWP A;  1FVH A;  4DI4 A;  1X5B A;  3CQC B;  3PEV B;  3LVQ E;  2V0P A;  2A5U A;  5A23 A;  4I17 A;  2Y4U A;  4JEU A;  5C2Y A;  3OAW A;  3VLD A;  3B7R L;  3ULQ A;  3CK7 A;  1H2U A;  3ZN3 A;  4PDX A;  4MKT A;  3FTV A;  3Q49 B;  2L0I A;  5G2N A;  2AXZ A;  2FBN A;  1JWG A;  2NC9 A;  3SD5 A;  2IU1 A;  2WPV A;  1H19 A;  3D9J A;  2KZT B;  4NQ0 A;  3KD7 A;  4UWK A;  2BTD A;  4FP7 A;  3KEZ A;  3FU0 A;  5G04 J;  4ILH B;  4UQX A;  3TL5 A;  4UQZ A;  4GYO A;  5E76 A;  4AP2 A;  5FQ4 A;  4RSY A;  3IV0 A;  4J6I A;  3FUF A;  3ZHE A;  2IF4 A;  5AYW D;  2XGM A;  3LVR E;  4XKB A;  2AWI A;  5T8I A;  1IQU A;  3QAQ A;  3CVL A;  2FF4 A;  1E90 A;  1NA3 A;  4C0M A;  4GU5 A;  3OXL A;  3ASG A;  4NRH B;  1HFA A;  2J4B A;  3QB2 A;  4ACK A;  4K0R A;  1A17 A;  4B0Z A;  1HX8 A;  4PUC A;  4RG9 A;  5G04 C;  4HLE A;  3OTN A;  3FTZ A;  4FAD A;  4LCT A;  3MGB A;  1OWL A;  4BX9 A;  1PAQ A;  2I6H A;  4YVO A;  2VSN A;  1W3B A;  5LX8 A;  4I9E A;  4F3V A;  4FJY A;  4ATG A;  3B7T A;  4I6J A;  3FTW A;  4I1M A;  1JWF A;  3EHM A;  3L17 A;  3NF1 A;  3WXX A;  3S7J A;  1HG2 A;  3QWV A;  2V5F A;  1ZU2 A;  4Y6W A;  2ZU6 B;  3APD A;  2QFC A;  3D9O A;  4JHJ A;  1FVF A;  3CGH A;  2VGY A;  3I4G A;  1QNF A;  3L08 A;  4I1A A;  4XE0 A;  3UT7 A;  1JUQ A;  4BY6 A;  1U3D A;  2GRM A;  4AJW A;  4F1S A;  2AXU A;  2ION A;  4G25 A;  4WWN A;  4WWP A;  1MQS A;  2XCB A;  4J8F A;  3P1U A;  2FO7 A;  3AU5 A;  3SHF A;  3SFZ A;  4CCA A;  5LCW J;  5G05 J;  2L6J A;  3SBS A;  3CSF A;  1N52 A;  2EQX A;  2ILR A;  2XHE A;  3RO3 A;  3T8M A;  1ELW A;  3PVL A;  2J49 A;  3HVE A;  4HOU A;  1UN8 A;  2WXQ A;  3ASH A;  4XX5 A;  4CRW A;  4QFV A;  3DBS A;  4L2Y A;  4FHK A;  4EBA A;  2IQC A;  2WM9 A;  3LKU A;  3O48 A;  4G11 A;  4LEU A;  2I2O A;  3IHY A;  3VTX A;  3I5P A;  3RJV A;  4KVM A;  3UPV A;  1NZN A;  2R59 A;  2E0I A;  3APF A;  2LNI A;  3CEQ A;  1HO8 A;  3CQG B;  2WQH A;  4KZ0 A;  2WVI A;  3B7U X;  2R5S A;  3RU0 A;  3OXG A;  4N3A A;  5DIZ A;  2MHK A;  3CK8 A;  2AXV A;  5FZS A;  4EPZ A;  2PZI A;  4JW1 A;  3LY9 A;  4JXT A;  4A1G A;  2WQ6 A;  1UJK A;  4ME2 A;  3U66 A;  3TAX A;  2IJG X;  2J9Q A;  3GYZ A;  4HFG A;  3Q5M A;  4LER A;  3LY7 A;  4RVB A;  4CDN A;  1E8Z A;  1PC2 A;  3IHV A;  4JA9 A;  1E8X A;  3S7B A;  3QOU A;  2VTB B;  2X6K A;  2X38 A;  3PUJ A;  4U8H A;  4WWO A;  4WND A;  4B8C B;  3CVW A;  4ILG A;  2WXN A;  4C9B B;  1Y8M A;  4EZL A;  3PEU B;  3CHM A;  1QZ2 A;  4W9R A;  5BV1 A;  3S7F A;  4HOT A;  5JHB A;  2WXG A;  2XQ0 A;  4CDM A;  3QKY A;  4I6E A;  4EZJ A;  5HI7 A;  3IKO B;  3RKV A;  3N71 A;  4U0S A;  3SZ7 A;  3FTX A;  4U63 A;  3U64 A;  5LP0 A;  4GCN A;  4I1O B;  1EPU A;  2GRL A;  3FFL A;  4JHR A;  2CHW A;  1E8Y A;  1WAO 1;  4I2Z A;  4UWF A;  2V8S E;  4R7L A;  4PS3 A;  4DI3 A;  3CKC A;  3CLJ A;  4IN3 B;  3T5X A;  3RK6 A;  4GZD A;  3CR3 A;  4BT8 A;  3MA5 A;  4HVB A;  2WMO A;  2LAI A;  5ANR A;  3U9W A;  3GZS A;  2X3M A;  5FQ8 A;  4I2W A;  2YQ8 A;  3TXM A;  2CHZ A;  3FUJ A;  4J8E A;  5FZR A;  2DBA A;  2WXL A;  2V4L A;  4AEZ C;  1KT0 A;  4OVV A;  4L7T A;  1E7V A;  4ANW A;  3UQ3 A;  2NXP A;  4UI9 J;  3OXF A;  4E85 A;  4GB9 A;  3VLE A;  3FUD A;  4TV3 A;  3G2V A;  3MYV A;  3GW4 A;  4FUL A;  2XRY A;  4GYY A;  2KM4 A;  2YHE A;  2XPI A;  4HOQ A;  4ANV A;  2VQ2 A;  1H0A A;  1LF8 A;  2E2E A;  3VLF A;  3MKQ A;  3FUH A;  1S0P A;  5J08 A;  3HDX A;  3ZVV A;  3LEW A;  3MV3 B;  3ZW3 A;  3D9I A;  4HOR A;  2WXF A;  3RO2 A;  1JPL A;  3CV0 A;  3PRE A;  5ANL A;  4WNF A;  2YNQ A;  4FHJ A;  4XKC A;  5BV0 A;  1IHG A;  1E7U A;  5C1D A;  3PRZ A;  4UI9 C;  2UY1 B;  4LRZ A;  2LAH A;  3APC A;  3MEK A;  4GZ6 A;  5G55 A;  4Y6C A;  3TG4 A;  3ZYL A;  3PDN A;  2VGX B;  2JLB A;  3RIB A;  3CVQ A;  5BW8 C;  4EBA G;  4BWR A;  5LOZ A;  3LCA A;  2VSY A;  2WXI A;  3DPD A;  4BSX A;  3K9I A;  3UT4 A;  3UT8 A;  2WXJ A;  2WXP A;  2WXO A;  4C0E A;  2PQN A;  1EF1 C;  4AY5 A;  3CST A;  5HQ8 A;  2WB2 A;  3D9K A;  1EDU A;  3PE4 A;  3G2T A;  5DBK A;  3ML8 A;  4KBQ A;  3RRM B;  5KJL A;  4IYP A;  3SBT B;  4CDR A;  1TEZ A;  4MLP A;  2AVP A;  3AS4 A;  3I4R B;  1UN9 A;  4P29 A;  3FUI A;  5CHE E;  2KCV A;  2PM7 A;  5EX0 A;  4F53 A;  1ELR A;  4IUL A;  3D9M A;  3LS8 A;  2HM8 A;  3CHP A;  4XIF A;  4AY6 A;  4URK A;  1OUV A;  2VTB A;  4G24 A;  4KMO A;  4JPS A;  3ML9 A;  3FH7 A;  1SQM A;  3CKB A;  4WNG A;  3ZYQ A;  4A3T A;  5BUZ A;  4N2S A;  3QWW A;  3UX4 A;  4A55 A;  3FEY A;  3QK0 A;  1H6K A;  4L23 A;  1HG5 A;  3FU3 A;  4DPR A;  3LYA A;  5EX3 A;  1L5J A;  2AW6 A;  3FTU A;  4AIF A;  2IOL A;  3QC1 A;  2GW1 A;  4GA0 A;  1UG3 A;  3TG5 A;  2LO6 A;  2OVB A;  2CFZ A;  1FCH A;  4I9C A;  3VTY A;  4EZK A;  1N54 A;  5FQ6 A;  3KS2 A;  3PH0 C;  2LSV A;  4GZ5 A;  4L1B A;  3U4T A;  4UWL A;  3SGH A;  3I3N A;  3CVP A;  5E75 A;  2OVF A;  4RG6 A;  3RRN B;  3BG1 B;  3L6A A;  2WXM A;  4U0Z A;  2X6H A;  5G05 C;  4N5C A;  3S2A A;  4BX8 A;  5LCW C;  3PNT B;  5M72 A;  3C98 A;  3Q15 A;  2XCC A;  1NA0 A;  3G2S A;  3NQP A;  3O4Z A;  2NSZ A;  4G1T A;  2MRI A;  3ZXS A;  1MHQ A;  3ZHE B;  3L13 A;  3D3M A;  3ESK A;  4EQF A;  4BFR A;  3MKR A;  3QJZ A;  3EIQ C;  3D9P A;  4PH4 B;  4UWG A;  5D0O D;  2KZT A;  1DNP A;  1WM5 A;  2A4Z A;  3SI5 A;  2IOS A;  1IYG A;  1U3C A;  3S7D A;  2L0T B;  3FWV A;  4NUR A;  4XI9 A;  3UUX A;  4DLO A;  2Q7F A;  4CGW A;  4HS2 A;  4TRQ A;  5FZQ A;  2RD0 A;  3MJW A;  3AS8 A;  3L54 A;  1GW6 A;  3FHE A;  4LUN U;  4UI9 K;  4FC8 A;  5T3R A;  1HS6 A;  3MZL B;  5JJ7 A;  5LFA A;  4B94 A;  1UW4 B;  1Z6T A;  2DIW A;  4CEM A;  4E6H A;  4APO A;  4IRU A;  2CG2 A;  3Q47 B;  4JA7 A;  3ZFW A;  2MOW A;  3FU6 A;  5CMW A;  4V3I A;  1E8W A;  2JEK A;  3JCK C;  3JYS A;  3P2B A;  4GZC A;  3TGO A;  2I1K A;  2KC7 A;  2VYI A;  2Y3A A;  5CCL A;  3CK9 A;  4U0U A;  4M3O A;  3ASD A;  3PE3 A;  3NZS A;  1WY6 A;  3B7S A;  4JVS A;  4N39 A;  1XNF A;  1SZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...