4GCOA

Central domain of stress-induced protein-1 (sti-1) from c.elegans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
120
structure length
120
Chain Sequence
b'YINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein STI-1
publication title Central domain of stress-induced protein-1 (STI-1) from C.elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 52
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gcoA00
3BEEA 4IN3B 2PL2A 3MV2B 2IF4A 4UQZA 2AVPA 5C1DA 4GCOA 5D0QD 3TGOA 4J0UA 4KXKB 4YVOA 3GZ1A 3HYMB 1ELWA 1FCHA 1A17A 2IFUA 4H7YA 2PQNA 4N2SA 2PZIA 2XEVA 2R5SA 3VTYA 1KT0A 2HYZA 4BTBA 4GYYA 4ME2A 4U0UA 3RJVA 3CEQA 1TJCA 3U3WA 4RG6A 3QWWA 4HORA 2J9QA 2YQ8A 1PC2A 3AS8A 2UWJG 3RO2A 4N2QA 4WNFA 3ZHEA 5JJ7A 3FWVA 4XI0A 1ZU2A 4I2ZA 2OOEA 3CV0A 3IEGA 3OXGA 4JA7A 3QDNA 4WNGA 2KC7A 1B89A 3S7BA 4CGVA 2UY1B 5A7DB 2VQ2A 3LKUA 5FZSA 4GA0A 5DBKA 4BWRA 4JHRA 3ZHEB 3OXFA 1Y8MA 3ASFA 4WNDA 2VSNA 4Y6WA 4YNDA 3VTXA 3KS2A 4BT9A 4XIFA 2LSUA 3GZ2A 3CKCA 5EX0A 4I9EA 3CK7A 4AY5A 3GYZA 2VGXB 2FEZA 4I2WA 2VGYA 2KCKA 1QQEA 2QFCA 4G24A 3PE3A 2Y4UA 3ZFWA 3E4BA 5AYWD 4GYWA 4U07A 2WQHA 2KCLA 4HOSA 3Q49B 5BNWA 3MEKA 4U0ZA 4AM9A 2V5FA 4GZ6A 2HO1A 2C0MA 3S7FA 5FT9A 2FBNA 2Q7FA 5G05J 4F3VA 5BT1A 4G2VA 1E96B 2MHKA 4G1TA 3LY8A 2KCVA 4CDRA 3FP3A 3KAEA 4N3AA 2KATA 4UI9J 3MV3B 5KJKA 3RKVA 5G04J 4I1AA 3S7JA 3CVPA 3PDNA 4KYOB 3LPZA 2UY1A 3UUXA 3JYSA 3LCAA 1WAO1 3RU0A 4JA9A 3CVNA 4GCNA 3AS5A 3URZA 1KLXA 2Y4TA 4KBQA 3WXXA 3EDTB 4G25A 2BUGA 4N3BA 3ZN3A 5A6CA 2HR2A 1YA0A 4G23A 3CVLA 3ASGA 3QWPA 3SZ7A 2FI7A 5JJTA 2VGXA 5ARFA 4U0SA 4WUYA 4EQFA 3AS4A 1HH8A 5G05C 3ASDA 5HI7A 4BT8A 5CCLA 4WNEA 5LCWJ 2VSYA 2L6JA 2XCCA 5ARGA 3QOUA 3KD7A 4UI9C 3ULQA 2XGSA 5G04C 2XPIA 3RO3A 4ABNA 2XGOA 3O48A 3UPVA 4N5CA 4RG9A 5DIZA 3S7DA 2YHCA 3FFLA 3CKBA 3ESKA 5FJYA 4UQYA 4UI9K 3ZPJA 3R9AB 1ZBPA 1XNFA 4GPKA 3LYAA 3Q4AB 4GZ3A 5EX3A 4Y6CA 5KJNA 3ZGQA 1QZ2A 3MKRA 4W9RA 1NA3A 2C0LA 4B94A 4NQ0A 3QKYA 4I9CA 5FTPA 5KJLA 3SF4A 4O6FA 3GW4A 4GA2A 4YVQC 4APOA 3TG4A 1IHGA 2P58C 2E2EA 4H7XA 5M72A 5CCMA 4CGWA 4NRHB 4I17A 5LCWC 4J8EA 3CK8A 3TAXA 2PQRA 1NA0A 4N3CA 4J8FA 4HOTA 3ASHA 5BW8C 5FZQA 4HOUA 2LNIA 4J8DA 3MA5A 3LY9A 1HXIA 2XCBA 3CVQA 4LEUA 4U04A 3Q47B 1OUVA 4UQXA 4HOQA 1WM5A 3Q15A 3CK9A 5KJMA 2DBAA 4A1SA 2VYIA 4AIFA 1HZ4A 1ELRA 5EKQD 4BTAA 3QWVA 4G26A 1P5QA 4GA1A 3Q5MA 2WPVA 1NZNA 1W3BA 5D0OD 2XGMA 2LSVA 2FO7A 5CHEE 2FF4A 5HQ8A 2JLBA 4JL0A 3NF1A 1KT1A 5JJ6A 4N39A 3LY7A 3N71A 4AY6A 1IYGA 4GYOA 4GZ5A 5FZRA 2ONDA 3RIBA 3TG5A 2C2LA 3PE4A 2NC9A 3U4TA 3UQ3A 2GW1A 4XI9A 2I6HA 3OXLA 3K9IA
chains in the Genus database with same CATH superfamily
3PS6A 3BEEA 3LVQE 4NURA 4UQZA 2XEHA 1OXJA 3ONKA 5ENOD 2KZTA 4U8YD 2A4ZA 1FT2A 2IU1A 3MKQB 5BXOA 4DK5A 2QC9A 3B7UX 3W9GA 4J0UA 4URKA 3LXUX 2MYOA 4FP7A 5JMND 5AQ7A 3CVXA 3TWXA 3TWRA 3CHQA 4AOFA 4B93B 4WAFA 4AXHA 1H2TC 1TNZA 4U0UA 1JCQA 4WWOA 3RSEG 3L22A 1TJCA 2J49A 2BF0X 3NOGD 4O1PA 1PC2A 3MGBA 4AEZC 4FJZA 5FIOA 2UWJG 3RO2A 3RRUA 4XZ4A 4MRUA 1PAQA 4L9PA 3ZXPA 3SI5A 1TN8A 4K5AB 1VDYA 4XI0A 3TWUA 3BG1B 4I2ZA 2OOEA 3CVUA 3OXGA 4JA7A 2KC7A 4EHMA 3S7BA 1KZOA 4GB9A 3TWTA 3ZKJA 3FUHA 4PH4B 2P9NG 4GA0A 2I9CA 3LJNA 3OXFA 4UWGA 3U64A 4Y6WA 1N0QA 4Q96A 3TJPA 2LSUA 1K1AA 3GZ2A 4J7WA 5EX0A 4I9EA 5CBNA 4MKTA 2X3MA 4JPSA 3GYZA 4JVSA 3IV0A 3JXIA 2KCKA 3NZUA 3CSFA 3JUIA 4Q94A 3UM2A 1MYOA 5HKPA 4JB8P 4BETA 4C48B 3ZW3A 3OTNA 3ZYLA 3Q9NC 3Q49B 3MJWA 1IQUA 1V55E 2DWZA 3MEKA 1EPUA 4AM9A 3UIOC 5T8IA 4GZ6A 2YINA 1N4QA 3E34A 2Q7FA 5BT1A 3WG7E 3TWWA 3W9FA 3HG0D 5BUZA 3LY8A 4XKCA 4CDRA 4A3VA 2KATA 4UI9J 3RKVA 4FA6A 1OT8A 3CVVA 4CCAA 2BTDA 2WXNA 3S7JA 3ZYQA 3PDNA 4HVBA 2WXPA 2UY1A 1FPPA 4TV3A 3LCAA 5AENA 4HRLA 4A63B 1SW6A 2HM8A 1QYMA 2V8SE 3AS5A 3CQCB 2BUGA 4KVMA 4DX1A 1YA0A 4IRUA 3CVYA 3QWPA 5AN8A 4PS3A 3DSSA 4EECA 3UT7A 4NIKA 4EQFA 3FTXA 3L17A 5HI7A 1ZB1A 1K8KG 5CCLA 4U8HA 2L6JA 4LNGA 5FINA 4BFRA 1UJJA 5G04C 2XPIA 1E7VA 4L2LA 3Q73A 4ABNA 1OCOE 1OY3D 4RG9A 3MX3A 2XS8A 3EU5A 4B89A 3ESKA 3APDA 3IKOB 3ZPJA 3L9TA 3ASOE 3Q4AB 2EINE 1OCRE 3E30A 2XPYA 3CHSA 4Y6CA 4HI9A 4ANVA 3ZGQA 2V0PA 3Q78A 4PS7A 5D66A 3LJ3A 2OEVA 3MKRA 4W9RA 2C0LA 2GGFA 2GRNB 4ILGA 1UOHA 5AQAA 1MZCA 3SFXA 2WXFA 1DNPA 3L6AA 3SF4A 2YNQA 3GW4A 1D8EA 2WXKA 4U7EB 1IHGA 3FY4A 3SQVA 3SBTB 3G2UA 4FJYA 4MLPA 1YYHA 3CGHA 3ASNE 3TAXA 1SVXA 2R02A 3DRAA 4GTOA 3L08A 5KNHD 4HOTA 3ASHA 3FTZA 2J4DA 5FZQA 4HOUA 2LNIA 4J8DA 1U2VG 1IKND 1TNYA 1ELKA 3PNLB 2XCBA 1HG2A 2ETBA 1EF1C 3NZSA 2EQXA 2AXVA 4LEUA 5EN5D 4HQDA 3KSQA 3FUEA 5B1AE 1WM5A 2F37A 3CK9A 2A5UA 1RW2A 4HI8A 3DEOA 2DBAA 4BTAA 2KM4A 3D9NA 2CHXA 3SFYA 5BV1A 3OAWA 3HXFA 3PZDA 4HLEA 1IHBA 3PEUB 2XGMA 2LSVA 2FF4A 3D9HA 4JL0A 1SA4A 4TXPA 3EJNA 3V31A 1TYQG 1IYGA 4AY6A 2LAHA 3LY7A 2QY7A 3N71A 5ENNA 3SBSA 3RIBA 1KZPA 4G11A 2C2LA 3PE4A 4JW1A 2NC9A 2CHZA 1HF8A 4U96D 2DCPA 4HFGA 2CFUA 2LXMA 3UINC 4IN3B 2I1JA 3O4ZA 5CERB 5BPPA 2AW6A 3G2WA 1N9AA 2DVWA 2AVPA 5C1DA 4GCOA 5D0QD 1O5MA 5LP0A 2ZU6B 2X6KA 3UT8A 1YMPA 3QARA 4UWLA 3UTMA 3DXKG 1IQRA 1ELWA 1H6PA 1FCHA 3ZRHA 4JZYA 2IFUA 2F0YA 3V79K 2PZIA 3B7RL 1N94A 3VTYA 3UI2A 2HYZA 4BTBA 4GYYA 5IY5E 5ITZF 4GPMA 4I6JA 5FQ6A 1LD7A 3U3WA 3DSUA 1OWNA 4HORA 2J9QA 2YQ8A 1FVHA 4ACKA 3T5XA 4GTMA 4PDXA 1MQSA 2P9PG 2DYSE 2WXHA 2R03A 3UKUG 3D9MA 5EIBE 3EUVA 1ZU2A 2FO1E 3CV0A 4J8YA 3HXEA 3IXEA 2IY0C 5EYLA 1H2VC 3ZU7B 3ZUVB 1RZ4A 4G8KA 3JQ0A 3DPYA 1FT1A 4I43A 4TUUA 2IOLA 3ML8A 1NFIE 1U3CA 1Y8MA 2ILRA 1U3DA 2VSNA 4YNDA 3FU0A 5ANRA 1MX6A 3R9MA 4PUCA 3KS2A 4K0RA 4BT9A 2V5QC 1TNUA 5EYPF 5JHBA 5D2MC 4HRNA 4M3OA 3CK7A 4JD2G 1OCCE 4AY5A 4RLYA 2IONA 1QQEA 4G24A 3X2QE 2Y4UA 3PEVB 3E4BA 3UT4A 3ZNGA 4DJAA 4U07A 2WQHA 5LFAA 3ZIMA 5BNWA 5ENRD 2V5FA 2HO1A 2C0MA 4J8SA 5FT9A 5G05J 4AP2A 2MHKA 4QQIA 2NXPA 3DPDA 2WXIA 1LTXA 2KCVA 3FP3A 2CHWA 5KJKA 1OWOA 2R05A 4BX9A 4AVXA 4C0MA 1BD8A 3DSWA 3KEAA 4I1AA 3PZ3A 1MJ0A 1HG5A 2QYUA 3SGHA 4A3TA 5CRUA 3L82A 3FU3A 4DX7D 3UUXA 4DI3A 2XEEA 4EZKA 2ETCA 2YHEA 3FH8A 3CVNA 3URZA 2AJAA 3IBEA 1INZA 3EDTB 4G25A 3V30A 3B95A 2F8YA 4N3BA 5FQ7A 2WQ6A 4MS6A 3ZN3A 4BX8A 2ZISA 1WDYA 4L7TA 2IQCA 2CG3A 2VGXA 5ARFA 1E8ZA 2WXOA 4F7AA 3QK0A 1HH8A 3PNTB 3ASDA 2EIME 3PZ4A 2J4BA 1UW4B 4DLOA 1DCQA 2XCCA 2Y3AA 3L13A 4UI9C 2XGSA 5HRYA 3JQ1A 3RO3A 2XGOA 3UPVA 4N5CA 3DWLG 4BEPA 1Z3XA 4B8AA 2KXPC 5FJYA 1TNOA 4CT4A 4FLBA 3R9AB 1ZBPA 4GMRA 2GROB 1D8DA 2B0OE 3FUIA 3DSVA 3V2XA 3BUAA 1QZ2A 2QZAA 2WXLA 4JEHA 1NA3A 3FTUA 5J08A 4L23A 2WXJA 1N0RA 4O6FA 4GA2A 4IULA 5ENSD 3AAAC 2BEDA 3I5PA 5ENQD 2P9UG 5KNGA 4I17A 4I6GA 2XS1A 2A5EA 4J8EA 1TJFA 4LRZA 3LEWA 4FHKA 2PQRA 3NQPA 2LUHA 5LX8A 4JXTA 4N3CA 3UM1A 3ML9A 5G2NA 1BI8B 3G2VA 3EIQC 3C3QA 4HS2A 3LY9A 3CVQA 4U04A 5J90A 2JEKA 4OYSA 3HVEA 1OUVA 2KBXA 4HOQA 3Q15A 3EHQA 2RKKA 2IOSA 2GRMA 4CDMA 3AG3E 3FTWA 3HIZA 3QWVA 5H7PA 2WXQA 4G26A 1P5QA 3Q5MA 5LOZA 3DEPA 1OWPA 2WPVA 5T3RA 1W3BA 4M7CA 3Q79A 2R2LA 3VLEA 5D0OD 1JWFA 3KEZA 1X81A 4ANXA 2H6HA 4E85A 2GRQB 4GZDA 4JC8A 5JJ6A 4N39A 3T5VA 1EDUA 3R7RA 4GYOA 1PY1A 1WY6A 2XRZA 3TG5A 2VGEA 3P1UA 1MX4A 4DI4A 4HXIA 5FQ4A 4K5BA 3D9IA 3UQ3A 4OAUC 3SNXA 2L6BA 3K9IA 5T4YA 3PRZA 2EIJE 5ANLA 3APFA 3FEYA 1DCEA 3TGOA 3FUMA 1HO8A 4KXKB 3GZ1A 3UIPC 3P2BA 4IYPA 3HYMB 2FULA 4H7YA 4V3IA 4N2SA 3MYVA 1S64A 4D10C 3PZ2A 4Z68A 2ZXWE 3PREA 1UN8A 3RJVA 3PVLA 2X6HA 1Z6TA 3B7SA 4RG6A 5C2YA 3QWWA 2B6CA 4TXQA 3AS8A 3L54A 3JCKC 4CEMA 3C72A 4O1OA 4N2QA 4WNFA 2EIKE 3E37A 3LDZA 3IEGA 4LUNU 1QNFA 4QFVA 3QDNA 3QNKA 3NOCD 4UWFA 4CGVA 2UY1B 3TL5A 5A7DB 4FHJA 2VQ2A 1G3NB 2H6FA 3LKUA 5DBKA 2V4LA 3ZHEB 3ASFA 5EIDA 4AJWA 4WNDA 3VTXA 1N4RA 2AXUA 2L0TB 4XIFA 4BESA 4GTVA 3FTSA 3C98A 3L16A 3CKCA 3Q7AA 4E6HA 3CIAA 3SHFA 4DPRA 5ENPD 3DSTA 2H6IA 4XKBA 2FEZA 3MKQA 1Y6IA 4DLQA 4RSYA 3ABLE 2DZNA 3FH5A 4APFA 3GZSA 1OWLA 4I1MA 3ZXSA 2XENA 3ABME 2WMOA 3CHMA 2KCLA 2OVBA 2IO2C 4U0ZA 5G55A 3S7FA 3ZVVA 4F1SA 2FBNA 3CHOA 2ZGGA 3HXDA 4F3VA 4GTSA 1L5JA 2M63A 1E96B 3QJZA 4G1TA 3UX4A 2PNNA 3FHEA 3MV3B 1SZAA 3FUFA 3TWQA 2X6FA 3HDXA 3CLJA 4CZ2D 4FULA 4JHJA 2ETAA 2V4HC 1DVPA 1H6OA 4BERA 3J5PA 2P9SG 4I6EA 3LPZA 1UG3A 2I2OA 4AV7A 3RU0A 4JA9A 1OCZE 1JPLA 4GCNA 3IHYA 2OCCE 2P9LG 3WXXA 4FU3A 2RFAA 4BSZB 2HR2A 3D9LA 4G23A 3CVLA 2WB2A 3ASGA 2DIWA 2FI7A 5JJTA 4R7LA 1HU3A 1EYHA 1GW6A 4WUYA 5B1BE 3B13A 1H0AA 3AS4A 1N95A 5G05C 2H6GA 2P2CP 4XX5A 5LCWJ 3ZYKA 4KZ0A 2J8SD 1BPOA 5ARGA 3QOUA 3ULQA 4F53A 3NAWA 3CSTA 5AQ9A 4UWHA 5FWQA 4KMOA 3O48A 5DIZA 4B0ZA 2IEJA 1OWMA 3EU9A 5ENTD 1BLXB 3S7DA 2DYRE 3CKBA 4DRXE 2L9BA 4GMLA 4GPKA 4GZ3A 5EX3A 5AARA 5KJNA 3FUJA 4A1GA 4I9CA 5FTPA 1O1RA 3PUKA 5KJLA 5B3SE 3TXMA 3Q75A 4APOA 5AAOA 4TRQA 5KCMA 2CFZA 5M72A 4H7XA 2J08A 1Q2ZA 5CCMA 4DUIA 4NRHB 2WQ7A 4HLLA 4LNBA 2QYJA 3AJIA 1A5EA 2VTBB 4LNUD 4UWKA 4C0EA 5BW8C 1N54A 4F6RD 1HXIA 2VSXE 2Y0BG 5AIJA 3D9OA 1JCSA 2PM7A 3Q47B 4EZJA 4UQXA 2I1KA 3EHMA 5CECB 4RQIA 3FU6A 3FH7A 3RRMB 3ENEA 1K3ZD 2XZTG 1ELRA 3ZYMA 1TN6A 3ONLA 4GA1A 2P9IG 1NZNA 4HNAD 2Y69E 4LERA 3I4RB 3I4GA 5CHEE 1S63A 4OAVB 3QC1A 4Q69A 1H19A 1KT1A 4ACLA 3JXJA 2VSOE 3EHNA 4U63A 4NACA 3EHRA 1N4SA 3D3MA 4GAAA 4GZ5A 4L2YA 2NSZA 2ONDA 5HS0A 1O1SA 1HS6A 3U4TA 1NI1A 3T8KA 2F8XK 4XI9A 1YCSB 5CRVA 4FLHA 4I1OB 2PL2A 4FADA 3MV2B 2IF4A 3Q7FA 1E8XA 2AXZA 4ANUA 5KWDA 4ANWA 1MX2A 4RVBA 3UXGA 2BKGA 3CQGB 1S70B 4YVOA 3FU5A 4YDEA 5EDSA 3RRNB 3C3RA 2VJ8A 3D9KA 3RAUA 1A17A 2WVIA 2IJGX 2PQNA 1UN9A 2XEVA 2R5SA 4J6IA 3LS8A 1KT0A 2EILE 2KZTB 4BY6A 1V54E 1E90A 3I3NA 4GMJA 4ME2A 3E33A 3CEQA 3FULA 3C5RA 4JEUA 1AWCB 4GTPA 3R7QA 1E8WA 1N52A 3FDHA 4KZCA 2MOWA 3SO8A 3TWSA 2WMNA 3ZHEA 3CVWA 1JCRA 5JJ7A 3FWVA 1NL4A 1LD8A 2OV8A 2L0IA 2XZDG 3ESLA 4YDYA 4TXRA 2XQ0A 3MCXA 4OVUA 5BV0A 2XRYA 3G2SA 4WNGA 4GTQA 1B89A 3E32A 3RK6A 4F1PA 1IXVA 3ISMC 3CHRA 4CT0A 5FZSA 4BWRA 4JHRA 4U8VD 1HFAA 3D9JA 4ILIA 5AQBA 3NB2A 3S2AA 4XE0A 3AG4E 2RD0A 3CR3A 4K5CA 2WXRA 4B8CB 3NBNB 2VGXB 3T9KA 4I2WA 2VGYA 4WWPA 4A55A 2QFCA 4HB5A 3PE3A 2OEWA 5AJDA 3ZFWA 4CRWA 1H6KA 5AYWD 4GYWA 2WM9A 3HXBA 4HOSA 1E7UA 3UMVA 5BXUA 2X6JA 1JUQA 2DZOA 1X5BA 3AU5A 1BU9A 4G2VA 3HRAA 4N3AA 3KAEA 3JUEA 2PM6A 2P9KG 5JHAA 5G04J 4ATZD 3CVPA 2IO3C 1FVFA 1BI7B 3ULYA 3SY2A 4KYOB 3PH0C 2GRRB 3JYSA 4P29A 1WAO1 2E0IA 3MZLB 4BSXA 1HE8A 3BU8A 3LVRE 1D9SA 1KLXA 1QBQA 3QAQA 2Y4TA 4KBQA 1Z3YA 4XEIG 2MRIA 4GU5A 3UKRG 3APCA 4TUMA 4YDOA 1TNBA 5CEAA 5A6CA 4PS8A 4WWNA 1NP7A 4JHKA 3SZ7A 1O1TA 3SFZA 4U0SA 3HXCA 1LF8A 1WG0A 4BT8A 4WNEA 2VSYA 3PUJA 4EZLA 2X6IA 4ATGA 3KD7A 4ZFHA 1AP7A 4DX5D 2HE0A 3HVEB 4N5QA 4MBGA 4LCTA 5E75A 2BKKB 3CHPA 3BG0B 3UM0A 2NYJA 3QB2A 5CBOA 2R17C 4CDNA 3FUDA 4YDWA 3EIJA 1SA5A 1XGWA 3U66A 1HX8A 4X8QA 3TXNA 2YHCA 3PZ1A 4CYMD 3FFLA 4KVOA 4UQYA 4UI9K 1KPSB 1XNFA 5E76A 3KSLA 3LYAA 2ZIRA 2CG2A 2WXMA 1JWGA 3AG2E 3VLDA 2LXLA 2LO6A 4B94A 3F6QA 4NQ0A 5CMWA 1TN7A 2R59A 1TR4A 3QKYA 5CEDB 1H2UA 3FEXA 3DXMG 2VTBA 3B7BA 4YVQC 3TG4A 3T8MA 4K03A 2P58C 2E2EA 3UM3A 4GTRA 1N11A 3B7TA 3V2OA 4CGWA 4LSZE 1E8YA 2WXGA 3AG1E 5LCWC 3HHMA 3CK8A 4EBAG 1K1BA 2X38A 1NA0A 3Q9UC 2J07A 5CMYA 3G2TA 4J8FA 4O60A 2OVFA 2Y1LE 2RFMA 3MA5A 4ZHBA 3SD5A 5FQ8A 3IHVA 4L1BA 5EILA 5A23A 4G8LA 4ILHB 1SQMA 1UJKA 3AU4A 2JABA 4KT6B 4EPZA 4HBDA 2RG8A 2GRLA 5KJMA 4A1SA 4FC8A 3ZEFA 2VYIA 4EBAA 3DSXA 4C9BB 4GZCA 4AIFA 1HZ4A 3DBSA 3FTVA 3J5QB 2ZGDA 5EKQD 3U9WA 4OVVA 4U95D 2XHEA 1MHQA 3BQOA 5JA4D 3C3OA 3TWVA 5AJLA 1N4PA 3FTYA 2XPZA 1TEZA 2FO7A 1Z5SC 1SZ9A 5HQ8A 2JLBA 4DX2A 1S0PA 3NF1A 3VLFA 5KBAA 4DX6D 4HRMB 2J09A 3FUNA 3ULEG 3FUKA 5FZRA 1DC2A 3ABKE 4UUCA 3D9PA 2LAIA 2AWIA 4LG6A 2GW1A 4GTTA 2GRPB 2I6HA 3OXLA
chains in the Genus database with same CATH topology
3PS6A 3BEEA 4IN3B 5T4YA 2I1JA 3O4ZA 2PL2A 3PRZA 4FADA 3LVQE 5BPPA 2AW6A 3G2WA 3MV2B 2IF4A 4NURA 4UQZA 5ANLA 2AVPA 3APFA 3ONKA 1E8XA 2AXZA 5C1DA 2KZTA 4ANUA 2A4ZA 4ANWA 3FEYA 4GCOA 2IU1A 4RVBA 5D0QD 5LP0A 3TGOA 3MKQB 2ZU6B 4DK5A 3B7UX 2X6KA 3FUMA 1HO8A 3CQGB 4J0UA 4KXKB 4YVOA 4URKA 3GZ1A 3LXUX 3UT8A 3P2BA 3FU5A 3QARA 4FP7A 4UWLA 4IYPA 5EDSA 3RRNB 2VJ8A 3CVXA 3D9KA 3HYMB 1IQRA 1ELWA 1FCHA 3ZRHA 4JZYA 1A17A 2FULA 2IFUA 2WVIA 2IJGX 2PQNA 4H7YA 4V3IA 4N2SA 3CHQA 3MYVA 2PZIA 1UN9A 2XEVA 2R5SA 4J6IA 4D10C 3B7RL 3LS8A 3VTYA 4AOFA 1KT0A 2KZTB 4BY6A 4WAFA 1E90A 2HYZA 4AXHA 3I3NA 1H2TC 4BTBA 4GYYA 3PREA 4GMJA 1UN8A 4ME2A 4U0UA 3RJVA 4I6JA 4WWOA 5FQ6A 3CEQA 3L22A 3FULA 3PVLA 2X6HA 1TJCA 1Z6TA 3U3WA 3B7SA 4JEUA 4RG6A 2J49A 1OWNA 5C2YA 3QWWA 2BF0X 4HORA 2J9QA 3R7QA 2YQ8A 1N52A 1E8WA 3FDHA 1PC2A 1FVHA 4ACKA 3MGBA 3T5XA 4AEZC 4FJZA 1IYGA 3AS8A 2UWJG 3L54A 3JCKC 4KZCA 4PDXA 3RO2A 4CEMA 2MOWA 3RRUA 1MQSA 4XZ4A 2WXHA 2WMNA 4N2QA 4WNFA 4MRUA 1PAQA 3D9MA 3ZHEA 5JJ7A 3CVWA 3FWVA 3SI5A 1VDYA 4XI0A 3LDZA 1ZU2A 2OV8A 2L0IA 3BG1B 4I2ZA 3ESLA 2XQ0A 2OOEA 3CV0A 3IEGA 3MCXA 1QNFA 4LUNU 3CVUA 4OVUA 3OXGA 2XRYA 5BV0A 4JA7A 4QFVA 3G2SA 3QDNA 3QNKA 4WNGA 2KC7A 1B89A 3RK6A 1H2VC 4UWFA 3S7BA 4CGVA 2UY1B 4GB9A 3TL5A 3JQ0A 5A7DB 4FHJA 2VQ2A 4I43A 4TUUA 2IOLA 3CHRA 3FUHA 4CT0A 4PH4B 3LKUA 5FZSA 3ML8A 4GA0A 5DBKA 4BWRA 4JHRA 2V4LA 3ZHEB 1U3CA 2I9CA 1Y8MA 3OXFA 3ASFA 1HFAA 3D9JA 2ILRA 1U3DA 4AJWA 4ILIA 4UWGA 4WNDA 2VSNA 4Y6WA 4YNDA 3U64A 3FU0A 5ANRA 3VTXA 3S2AA 4PUCA 3KS2A 4Q96A 4K0RA 4XE0A 4BT9A 2AXUA 2L0TB 4XIFA 3TJPA 2LSUA 2RD0A 3FTSA 5JHBA 3C98A 3L16A 3GZ2A 3CKCA 3CR3A 5EX0A 3CIAA 4E6HA 4I9EA 2WXRA 3SHFA 4M3OA 4DPRA 3CK7A 4MKTA 4B8CB 2X3MA 4JPSA 4XKBA 4AY5A 3GYZA 2VGXB 4JVSA 3IV0A 2FEZA 4I2WA 2IONA 3MKQA 2VGYA 2KCKA 1Y6IA 3NZUA 4WWPA 4A55A 3CSFA 3JUIA 4Q94A 4DLQA 4RSYA 1QQEA 2QFCA 4G24A 3PE3A 3FH5A 4APFA 3GZSA 5AJDA 2Y4UA 3ZFWA 3PEVB 4CRWA 1OWLA 3E4BA 1H6KA 3UT4A 4I1MA 5AYWD 4GYWA 3ZXSA 4U07A 3ZW3A 2WQHA 4DJAA 5LFAA 2WM9A 3OTNA 2WMOA 3CHMA 3ZYLA 2KCLA 4HOSA 3Q49B 2OVBA 3MJWA 3ZIMA 1IQUA 5BNWA 1E7UA 3MEKA 3UMVA 1EPUA 4U0ZA 2X6JA 1JUQA 4AM9A 5G55A 2V5FA 4GZ6A 5T8IA 2HO1A 2C0MA 3S7FA 2YINA 3ZVVA 4J8SA 4F1SA 5FT9A 2FBNA 2Q7FA 3CHOA 5G05J 4F3VA 1X5BA 3AU5A 1L5JA 4AP2A 5BT1A 2M63A 4G2VA 1E96B 2MHKA 3QJZA 4G1TA 2NXPA 3DPDA 5BUZA 2WXIA 3LY8A 4XKCA 3UX4A 2KCVA 4A3VA 3FP3A 3KAEA 2CHWA 4N3AA 4CDRA 2KATA 4UI9J 3FHEA 2PM6A 1SZAA 1OWOA 3FUFA 3MV3B 3RKVA 5KJKA 2X6FA 5JHAA 4BX9A 4AVXA 5G04J 4FA6A 3HDXA 4C0MA 3CLJA 4FULA 3CVVA 4JHJA 4CCAA 4I1AA 1DVPA 2BTDA 1HG5A 2WXNA 3S7JA 3SGHA 4A3TA 3ZYQA 3CVPA 1FVFA 3PDNA 4HVBA 4I6EA 4KYOB 3LPZA 3FU3A 2WXPA 3PH0C 1UG3A 2UY1A 4TV3A 3UUXA 4DI3A 3JYSA 2I2OA 3LCAA 4EZKA 4P29A 1WAO1 4AV7A 5AENA 2E0IA 3RU0A 2HM8A 2YHEA 3MZLB 3FH8A 4JA9A 3CVNA 1JPLA 4GCNA 3IHYA 4BSXA 1HE8A 2V8SE 3AS5A 3LVRE 3URZA 3IBEA 1INZA 1KLXA 3CQCB 3QAQA 2Y4TA 4KBQA 3WXXA 3EDTB 4G25A 1Z3YA 2BUGA 4KVMA 4N3BA 2MRIA 4FU3A 4GU5A 5FQ7A 2WQ6A 4MS6A 3APCA 3ZN3A 4BX8A 5A6CA 4PS8A 2HR2A 1YA0A 3D9LA 4IRUA 4WWNA 4G23A 3CVLA 1NP7A 3CVYA 4JHKA 2WB2A 3ASGA 3QWPA 4L7TA 2DIWA 3SZ7A 2FI7A 2IQCA 3SFZA 5JJTA 2CG3A 4R7LA 2VGXA 1HU3A 1EYHA 4PS3A 5ARFA 4U0SA 4EECA 1GW6A 3T5VA 4WUYA 3UT7A 1E8ZA 2WXOA 4EQFA 3B13A 4F7AA 1H0AA 3AS4A 3FTXA 3L17A 3QK0A 1LF8A 1HH8A 3PNTB 3ASDA 5G05C 5HI7A 4XX5A 4BT8A 5CCLA 2J4BA 4WNEA 5LCWJ 2VSYA 3ZYKA 4U8HA 4KZ0A 1UW4B 1BPOA 2L6JA 3PUJA 4DLOA 2XCCA 2Y3AA 5ARGA 3QOUA 4BFRA 4EZLA 2X6IA 3L13A 4ATGA 3KD7A 4UI9C 3ULQA 2XGSA 4F53A 1UJJA 3HVEB 3CSTA 5G04C 4LCTA 3JQ1A 5E75A 2XPIA 3RO3A 4UWHA 1E7VA 5FWQA 3CHPA 4KMOA 3BG0B 4L2LA 4ABNA 3QB2A 2XGOA 3O48A 2R17C 4CDNA 3UPVA 4N5CA 4RG9A 3FUDA 3MX3A 3EIJA 5DIZA 4B0ZA 4B89A 1XGWA 3U66A 1OWMA 1HX8A 1Z3XA 4B8AA 3TXNA 3S7DA 2YHCA 3FFLA 3CKBA 3ESKA 4KVOA 5FJYA 4UQYA 2L9BA 4UI9K 3APDA 3IKOB 3ZPJA 4FLBA 4CT4A 3R9AB 1ZBPA 1XNFA 4GMLA 5E76A 4GPKA 3LYAA 3Q4AB 4GZ3A 5EX3A 3FUIA 2CG2A 4Y6CA 2XPYA 3CHSA 5KJNA 4ANVA 2WXMA 3ZGQA 1QZ2A 2V0PA 1JWGA 4PS7A 3VLDA 3LJ3A 2LO6A 2WXLA 3MKRA 4W9RA 4JEHA 1NA3A 2C0LA 2GGFA 4B94A 4ILGA 4NQ0A 5CMWA 3FUJA 2R59A 3QKYA 4A1GA 3FTUA 4I9CA 5J08A 1H2UA 3FEXA 2VTBA 5FTPA 4L23A 3PUKA 2WXFA 5KJLA 1DNPA 3L6AA 2WXJA 3SF4A 2YNQA 4O6FA 3GW4A 4GA2A 3TXMA 4YVQC 2WXKA 4APOA 3TG4A 4TRQA 3T8MA 4IULA 1IHGA 2P58C 3FY4A 2CFZA 4K03A 2E2EA 4H7XA 5KCMA 3SBTB 5M72A 2J08A 3I5PA 3G2UA 5CCMA 4FJYA 4MLPA 3B7TA 4CGWA 3CGHA 4NRHB 4I17A 1E8YA 2WXGA 4I6GA 2WQ7A 5LCWC 3HHMA 4J8EA 3CK8A 1TJFA 4EBAG 3TAXA 4LRZA 3LEWA 3L08A 2PQRA 4FHKA 2X38A 1NA0A 3NQPA 2VTBB 5LX8A 4JXTA 4UWKA 4N3CA 2J07A 5CMYA 3G2TA 3ML9A 4J8FA 4HOTA 4C0EA 5G2NA 2OVFA 3ASHA 5BW8C 3FTZA 2J4DA 3G2VA 3EIQC 4HOUA 5FZQA 2LNIA 4J8DA 3MA5A 4HS2A 3SD5A 1N54A 1ELKA 3PNLB 3LY9A 5FQ8A 1HXIA 2XCBA 1HG2A 1EF1C 3NZSA 2EQXA 2AXVA 3CVQA 2VSXE 3IHVA 4L1BA 4LEUA 5AIJA 3D9OA 4U04A 5A23A 2PM7A 3FUEA 3Q47B 4EZJA 4ILHB 5J90A 1SQMA 2JEKA 4OYSA 3HVEA 1OUVA 1UJKA 4UQXA 4HOQA 1WM5A 3AU4A 3Q15A 2I1KA 3EHMA 2IOSA 2GRMA 4KT6B 3CK9A 4EPZA 2A5UA 2RG8A 2GRLA 5KJMA 2DBAA 4A1SA 4FC8A 3ZEFA 3FU6A 4CDMA 2VYIA 4EBAA 4C9BB 3FH7A 3RRMB 3ENEA 4GZCA 4AIFA 1HZ4A 3DBSA 3FTVA 1ELRA 3FTWA 3ZYMA 5EKQD 4BTAA 3HIZA 3QWVA 3U9WA 4OVVA 2WXQA 4G26A 1P5QA 2KM4A 3ONLA 4AY6A 4GA1A 3Q5MA 3D9NA 5LOZA 2CHXA 1OWPA 2WPVA 2XHEA 5BV1A 3OAWA 1NZNA 1MHQA 5T3RA 3PZDA 4HLEA 1W3BA 3VLEA 5AJLA 1JWFA 3KEZA 3FTYA 3PEUB 2XGMA 5D0OD 2XPZA 4LERA 2LSVA 2FO7A 3I4RB 3I4GA 5CHEE 4ANXA 1TEZA 1SZ9A 2FF4A 5HQ8A 2JLBA 3QC1A 4E85A 1S0PA 4JL0A 4Q69A 1H19A 3NF1A 3VLFA 1KT1A 4GZDA 4ACLA 3EJNA 2VSOE 4JC8A 3EHNA 4U63A 4NACA 5JJ6A 4N39A 2LAHA 1EDUA 2J09A 2QY7A 3FUNA 3LY7A 3N71A 4GYOA 3R7RA 3D3MA 4GAAA 4GZ5A 3FUKA 5ENNA 5FZRA 1PY1A 3SBSA 4L2YA 1WY6A 2NSZA 2ONDA 3RIBA 2XRZA 3TG5A 3P1UA 4DI4A 3D9PA 1HS6A 4G11A 2C2LA 3PE4A 4JW1A 2LAIA 2NC9A 4HXIA 5FQ4A 3U4TA 3D9IA 2AWIA 2CHZA 1HF8A 3UQ3A 2GW1A 2DCPA 4XI9A 3SNXA 4HFGA 2CFUA 4FLHA 2I6HA 3OXLA 4I1OB 3K9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEE A;  4IN3 B;  2PL2 A;  3MV2 B;  2IF4 A;  4UQZ A;  2AVP A;  5C1D A;  4GCO A;  5D0Q D;  3TGO A;  4J0U A;  4KXK B;  4YVO A;  3GZ1 A;  3HYM B;  1ELW A;  1FCH A;  1A17 A;  2IFU A;  4H7Y A;  2PQN A;  4N2S A;  2PZI A;  2XEV A;  2R5S A;  3VTY A;  1KT0 A;  2HYZ A;  4BTB A;  4GYY A;  4ME2 A;  4U0U A;  3RJV A;  3CEQ A;  1TJC A;  3U3W A;  4RG6 A;  3QWW A;  4HOR A;  2J9Q A;  2YQ8 A;  1PC2 A;  3AS8 A;  2UWJ G;  3RO2 A;  4N2Q A;  4WNF A;  3ZHE A;  5JJ7 A;  3FWV A;  4XI0 A;  1ZU2 A;  4I2Z A;  2OOE A;  3CV0 A;  3IEG A;  3OXG A;  4JA7 A;  3QDN A;  4WNG A;  2KC7 A;  1B89 A;  3S7B A;  4CGV A;  2UY1 B;  5A7D B;  2VQ2 A;  3LKU A;  5FZS A;  4GA0 A;  5DBK A;  4BWR A;  4JHR A;  3ZHE B;  3OXF A;  1Y8M A;  3ASF A;  4WND A;  2VSN A;  4Y6W A;  4YND A;  3VTX A;  3KS2 A;  4BT9 A;  4XIF A;  2LSU A;  3GZ2 A;  3CKC A;  5EX0 A;  4I9E A;  3CK7 A;  4AY5 A;  3GYZ A;  2VGX B;  2FEZ A;  4I2W A;  2VGY A;  2KCK A;  1QQE A;  2QFC A;  4G24 A;  3PE3 A;  2Y4U A;  3ZFW A;  3E4B A;  5AYW D;  4GYW A;  4U07 A;  2WQH A;  2KCL A;  4HOS A;  3Q49 B;  5BNW A;  3MEK A;  4U0Z A;  4AM9 A;  2V5F A;  4GZ6 A;  2HO1 A;  2C0M A;  3S7F A;  5FT9 A;  2FBN A;  2Q7F A;  5G05 J;  4F3V A;  5BT1 A;  4G2V A;  1E96 B;  2MHK A;  4G1T A;  3LY8 A;  2KCV A;  4CDR A;  3FP3 A;  3KAE A;  4N3A A;  2KAT A;  4UI9 J;  3MV3 B;  5KJK A;  3RKV A;  5G04 J;  4I1A A;  3S7J A;  3CVP A;  3PDN A;  4KYO B;  3LPZ A;  2UY1 A;  3UUX A;  3JYS A;  3LCA A;  1WAO 1;  3RU0 A;  4JA9 A;  3CVN A;  4GCN A;  3AS5 A;  3URZ A;  1KLX A;  2Y4T A;  4KBQ A;  3WXX A;  3EDT B;  4G25 A;  2BUG A;  4N3B A;  3ZN3 A;  5A6C A;  2HR2 A;  1YA0 A;  4G23 A;  3CVL A;  3ASG A;  3QWP A;  3SZ7 A;  2FI7 A;  5JJT A;  2VGX A;  5ARF A;  4U0S A;  4WUY A;  4EQF A;  3AS4 A;  1HH8 A;  5G05 C;  3ASD A;  5HI7 A;  4BT8 A;  5CCL A;  4WNE A;  5LCW J;  2VSY A;  2L6J A;  2XCC A;  5ARG A;  3QOU A;  3KD7 A;  4UI9 C;  3ULQ A;  2XGS A;  5G04 C;  2XPI A;  3RO3 A;  4ABN A;  2XGO A;  3O48 A;  3UPV A;  4N5C A;  4RG9 A;  5DIZ A;  3S7D A;  2YHC A;  3FFL A;  3CKB A;  3ESK A;  5FJY A;  4UQY A;  4UI9 K;  3ZPJ A;  3R9A B;  1ZBP A;  1XNF A;  4GPK A;  3LYA A;  3Q4A B;  4GZ3 A;  5EX3 A;  4Y6C A;  5KJN A;  3ZGQ A;  1QZ2 A;  3MKR A;  4W9R A;  1NA3 A;  2C0L A;  4B94 A;  4NQ0 A;  3QKY A;  4I9C A;  5FTP A;  5KJL A;  3SF4 A;  4O6F A;  3GW4 A;  4GA2 A;  4YVQ C;  4APO A;  3TG4 A;  1IHG A;  2P58 C;  2E2E A;  4H7X A;  5M72 A;  5CCM A;  4CGW A;  4NRH B;  4I17 A;  5LCW C;  4J8E A;  3CK8 A;  3TAX A;  2PQR A;  1NA0 A;  4N3C A;  4J8F A;  4HOT A;  3ASH A;  5BW8 C;  5FZQ A;  4HOU A;  2LNI A;  4J8D A;  3MA5 A;  3LY9 A;  1HXI A;  2XCB A;  3CVQ A;  4LEU A;  4U04 A;  3Q47 B;  1OUV A;  4UQX A;  4HOQ A;  1WM5 A;  3Q15 A;  3CK9 A;  5KJM A;  2DBA A;  4A1S A;  2VYI A;  4AIF A;  1HZ4 A;  1ELR A;  5EKQ D;  4BTA A;  3QWV A;  4G26 A;  1P5Q A;  4GA1 A;  3Q5M A;  2WPV A;  1NZN A;  1W3B A;  5D0O D;  2XGM A;  2LSV A;  2FO7 A;  5CHE E;  2FF4 A;  5HQ8 A;  2JLB A;  4JL0 A;  3NF1 A;  1KT1 A;  5JJ6 A;  4N39 A;  3LY7 A;  3N71 A;  4AY6 A;  1IYG A;  4GYO A;  4GZ5 A;  5FZR A;  2OND A;  3RIB A;  3TG5 A;  2C2L A;  3PE4 A;  2NC9 A;  3U4T A;  3UQ3 A;  2GW1 A;  4XI9 A;  2I6H A;  3OXL A;  3K9I A; 
#chains in the Genus database with same CATH topology
 3PS6 A;  3BEE A;  3LVQ E;  4NUR A;  4UQZ A;  2XEH A;  1OXJ A;  3ONK A;  5ENO D;  2KZT A;  4U8Y D;  2A4Z A;  1FT2 A;  2IU1 A;  3MKQ B;  5BXO A;  4DK5 A;  2QC9 A;  3B7U X;  3W9G A;  4J0U A;  4URK A;  3LXU X;  2MYO A;  4FP7 A;  5JMN D;  5AQ7 A;  3CVX A;  3TWX A;  3TWR A;  3CHQ A;  4AOF A;  4B93 B;  4WAF A;  4AXH A;  1H2T C;  1TNZ A;  4U0U A;  1JCQ A;  4WWO A;  3RSE G;  3L22 A;  1TJC A;  2J49 A;  2BF0 X;  3NOG D;  4O1P A;  1PC2 A;  3MGB A;  4AEZ C;  4FJZ A;  5FIO A;  2UWJ G;  3RO2 A;  3RRU A;  4XZ4 A;  4MRU A;  1PAQ A;  4L9P A;  3ZXP A;  3SI5 A;  1TN8 A;  4K5A B;  1VDY A;  4XI0 A;  3TWU A;  3BG1 B;  4I2Z A;  2OOE A;  3CVU A;  3OXG A;  4JA7 A;  2KC7 A;  4EHM A;  3S7B A;  1KZO A;  4GB9 A;  3TWT A;  3ZKJ A;  3FUH A;  4PH4 B;  2P9N G;  4GA0 A;  2I9C A;  3LJN A;  3OXF A;  4UWG A;  3U64 A;  4Y6W A;  1N0Q A;  4Q96 A;  3TJP A;  2LSU A;  1K1A A;  3GZ2 A;  4J7W A;  5EX0 A;  4I9E A;  5CBN A;  4MKT A;  2X3M A;  4JPS A;  3GYZ A;  4JVS A;  3IV0 A;  3JXI A;  2KCK A;  3NZU A;  3CSF A;  3JUI A;  4Q94 A;  3UM2 A;  1MYO A;  5HKP A;  4JB8 P;  4BET A;  4C48 B;  3ZW3 A;  3OTN A;  3ZYL A;  3Q9N C;  3Q49 B;  3MJW A;  1IQU A;  1V55 E;  2DWZ A;  3MEK A;  1EPU A;  4AM9 A;  3UIO C;  5T8I A;  4GZ6 A;  2YIN A;  1N4Q A;  3E34 A;  2Q7F A;  5BT1 A;  3WG7 E;  3TWW A;  3W9F A;  3HG0 D;  5BUZ A;  3LY8 A;  4XKC A;  4CDR A;  4A3V A;  2KAT A;  4UI9 J;  3RKV A;  4FA6 A;  1OT8 A;  3CVV A;  4CCA A;  2BTD A;  2WXN A;  3S7J A;  3ZYQ A;  3PDN A;  4HVB A;  2WXP A;  2UY1 A;  1FPP A;  4TV3 A;  3LCA A;  5AEN A;  4HRL A;  4A63 B;  1SW6 A;  2HM8 A;  1QYM A;  2V8S E;  3AS5 A;  3CQC B;  2BUG A;  4KVM A;  4DX1 A;  1YA0 A;  4IRU A;  3CVY A;  3QWP A;  5AN8 A;  4PS3 A;  3DSS A;  4EEC A;  3UT7 A;  4NIK A;  4EQF A;  3FTX A;  3L17 A;  5HI7 A;  1ZB1 A;  1K8K G;  5CCL A;  4U8H A;  2L6J A;  4LNG A;  5FIN A;  4BFR A;  1UJJ A;  5G04 C;  2XPI A;  1E7V A;  4L2L A;  3Q73 A;  4ABN A;  1OCO E;  1OY3 D;  4RG9 A;  3MX3 A;  2XS8 A;  3EU5 A;  4B89 A;  3ESK A;  3APD A;  3IKO B;  3ZPJ A;  3L9T A;  3ASO E;  3Q4A B;  2EIN E;  1OCR E;  3E30 A;  2XPY A;  3CHS A;  4Y6C A;  4HI9 A;  4ANV A;  3ZGQ A;  2V0P A;  3Q78 A;  4PS7 A;  5D66 A;  3LJ3 A;  2OEV A;  3MKR A;  4W9R A;  2C0L A;  2GGF A;  2GRN B;  4ILG A;  1UOH A;  5AQA A;  1MZC A;  3SFX A;  2WXF A;  1DNP A;  3L6A A;  3SF4 A;  2YNQ A;  3GW4 A;  1D8E A;  2WXK A;  4U7E B;  1IHG A;  3FY4 A;  3SQV A;  3SBT B;  3G2U A;  4FJY A;  4MLP A;  1YYH A;  3CGH A;  3ASN E;  3TAX A;  1SVX A;  2R02 A;  3DRA A;  4GTO A;  3L08 A;  5KNH D;  4HOT A;  3ASH A;  3FTZ A;  2J4D A;  5FZQ A;  4HOU A;  2LNI A;  4J8D A;  1U2V G;  1IKN D;  1TNY A;  1ELK A;  3PNL B;  2XCB A;  1HG2 A;  2ETB A;  1EF1 C;  3NZS A;  2EQX A;  2AXV A;  4LEU A;  5EN5 D;  4HQD A;  3KSQ A;  3FUE A;  5B1A E;  1WM5 A;  2F37 A;  3CK9 A;  2A5U A;  1RW2 A;  4HI8 A;  3DEO A;  2DBA A;  4BTA A;  2KM4 A;  3D9N A;  2CHX A;  3SFY A;  5BV1 A;  3OAW A;  3HXF A;  3PZD A;  4HLE A;  1IHB A;  3PEU B;  2XGM A;  2LSV A;  2FF4 A;  3D9H A;  4JL0 A;  1SA4 A;  4TXP A;  3EJN A;  3V31 A;  1TYQ G;  1IYG A;  4AY6 A;  2LAH A;  3LY7 A;  2QY7 A;  3N71 A;  5ENN A;  3SBS A;  3RIB A;  1KZP A;  4G11 A;  2C2L A;  3PE4 A;  4JW1 A;  2NC9 A;  2CHZ A;  1HF8 A;  4U96 D;  2DCP A;  4HFG A;  2CFU A;  2LXM A;  3UIN C;  4IN3 B;  2I1J A;  3O4Z A;  5CER B;  5BPP A;  2AW6 A;  3G2W A;  1N9A A;  2DVW A;  2AVP A;  5C1D A;  4GCO A;  5D0Q D;  1O5M A;  5LP0 A;  2ZU6 B;  2X6K A;  3UT8 A;  1YMP A;  3QAR A;  4UWL A;  3UTM A;  3DXK G;  1IQR A;  1ELW A;  1H6P A;  1FCH A;  3ZRH A;  4JZY A;  2IFU A;  2F0Y A;  3V79 K;  2PZI A;  3B7R L;  1N94 A;  3VTY A;  3UI2 A;  2HYZ A;  4BTB A;  4GYY A;  5IY5 E;  5ITZ F;  4GPM A;  4I6J A;  5FQ6 A;  1LD7 A;  3U3W A;  3DSU A;  1OWN A;  4HOR A;  2J9Q A;  2YQ8 A;  1FVH A;  4ACK A;  3T5X A;  4GTM A;  4PDX A;  1MQS A;  2P9P G;  2DYS E;  2WXH A;  2R03 A;  3UKU G;  3D9M A;  5EIB E;  3EUV A;  1ZU2 A;  2FO1 E;  3CV0 A;  4J8Y A;  3HXE A;  3IXE A;  2IY0 C;  5EYL A;  1H2V C;  3ZU7 B;  3ZUV B;  1RZ4 A;  4G8K A;  3JQ0 A;  3DPY A;  1FT1 A;  4I43 A;  4TUU A;  2IOL A;  3ML8 A;  1NFI E;  1U3C A;  1Y8M A;  2ILR A;  1U3D A;  2VSN A;  4YND A;  3FU0 A;  5ANR A;  1MX6 A;  3R9M A;  4PUC A;  3KS2 A;  4K0R A;  4BT9 A;  2V5Q C;  1TNU A;  5EYP F;  5JHB A;  5D2M C;  4HRN A;  4M3O A;  3CK7 A;  4JD2 G;  1OCC E;  4AY5 A;  4RLY A;  2ION A;  1QQE A;  4G24 A;  3X2Q E;  2Y4U A;  3PEV B;  3E4B A;  3UT4 A;  3ZNG A;  4DJA A;  4U07 A;  2WQH A;  5LFA A;  3ZIM A;  5BNW A;  5ENR D;  2V5F A;  2HO1 A;  2C0M A;  4J8S A;  5FT9 A;  5G05 J;  4AP2 A;  2MHK A;  4QQI A;  2NXP A;  3DPD A;  2WXI A;  1LTX A;  2KCV A;  3FP3 A;  2CHW A;  5KJK A;  1OWO A;  2R05 A;  4BX9 A;  4AVX A;  4C0M A;  1BD8 A;  3DSW A;  3KEA A;  4I1A A;  3PZ3 A;  1MJ0 A;  1HG5 A;  2QYU A;  3SGH A;  4A3T A;  5CRU A;  3L82 A;  3FU3 A;  4DX7 D;  3UUX A;  4DI3 A;  2XEE A;  4EZK A;  2ETC A;  2YHE A;  3FH8 A;  3CVN A;  3URZ A;  2AJA A;  3IBE A;  1INZ A;  3EDT B;  4G25 A;  3V30 A;  3B95 A;  2F8Y A;  4N3B A;  5FQ7 A;  2WQ6 A;  4MS6 A;  3ZN3 A;  4BX8 A;  2ZIS A;  1WDY A;  4L7T A;  2IQC A;  2CG3 A;  2VGX A;  5ARF A;  1E8Z A;  2WXO A;  4F7A A;  3QK0 A;  1HH8 A;  3PNT B;  3ASD A;  2EIM E;  3PZ4 A;  2J4B A;  1UW4 B;  4DLO A;  1DCQ A;  2XCC A;  2Y3A A;  3L13 A;  4UI9 C;  2XGS A;  5HRY A;  3JQ1 A;  3RO3 A;  2XGO A;  3UPV A;  4N5C A;  3DWL G;  4BEP A;  1Z3X A;  4B8A A;  2KXP C;  5FJY A;  1TNO A;  4CT4 A;  4FLB A;  3R9A B;  1ZBP A;  4GMR A;  2GRO B;  1D8D A;  2B0O E;  3FUI A;  3DSV A;  3V2X A;  3BUA A;  1QZ2 A;  2QZA A;  2WXL A;  4JEH A;  1NA3 A;  3FTU A;  5J08 A;  4L23 A;  2WXJ A;  1N0R A;  4O6F A;  4GA2 A;  4IUL A;  5ENS D;  3AAA C;  2BED A;  3I5P A;  5ENQ D;  2P9U G;  5KNG A;  4I17 A;  4I6G A;  2XS1 A;  2A5E A;  4J8E A;  1TJF A;  4LRZ A;  3LEW A;  4FHK A;  2PQR A;  3NQP A;  2LUH A;  5LX8 A;  4JXT A;  4N3C A;  3UM1 A;  3ML9 A;  5G2N A;  1BI8 B;  3G2V A;  3EIQ C;  3C3Q A;  4HS2 A;  3LY9 A;  3CVQ A;  4U04 A;  5J90 A;  2JEK A;  4OYS A;  3HVE A;  1OUV A;  2KBX A;  4HOQ A;  3Q15 A;  3EHQ A;  2RKK A;  2IOS A;  2GRM A;  4CDM A;  3AG3 E;  3FTW A;  3HIZ A;  3QWV A;  5H7P A;  2WXQ A;  4G26 A;  1P5Q A;  3Q5M A;  5LOZ A;  3DEP A;  1OWP A;  2WPV A;  5T3R A;  1W3B A;  4M7C A;  3Q79 A;  2R2L A;  3VLE A;  5D0O D;  1JWF A;  3KEZ A;  1X81 A;  4ANX A;  2H6H A;  4E85 A;  2GRQ B;  4GZD A;  4JC8 A;  5JJ6 A;  4N39 A;  3T5V A;  1EDU A;  3R7R A;  4GYO A;  1PY1 A;  1WY6 A;  2XRZ A;  3TG5 A;  2VGE A;  3P1U A;  1MX4 A;  4DI4 A;  4HXI A;  5FQ4 A;  4K5B A;  3D9I A;  3UQ3 A;  4OAU C;  3SNX A;  2L6B A;  3K9I A;  5T4Y A;  3PRZ A;  2EIJ E;  5ANL A;  3APF A;  3FEY A;  1DCE A;  3TGO A;  3FUM A;  1HO8 A;  4KXK B;  3GZ1 A;  3UIP C;  3P2B A;  4IYP A;  3HYM B;  2FUL A;  4H7Y A;  4V3I A;  4N2S A;  3MYV A;  1S64 A;  4D10 C;  3PZ2 A;  4Z68 A;  2ZXW E;  3PRE A;  1UN8 A;  3RJV A;  3PVL A;  2X6H A;  1Z6T A;  3B7S A;  4RG6 A;  5C2Y A;  3QWW A;  2B6C A;  4TXQ A;  3AS8 A;  3L54 A;  3JCK C;  4CEM A;  3C72 A;  4O1O A;  4N2Q A;  4WNF A;  2EIK E;  3E37 A;  3LDZ A;  3IEG A;  4LUN U;  1QNF A;  4QFV A;  3QDN A;  3QNK A;  3NOC D;  4UWF A;  4CGV A;  2UY1 B;  3TL5 A;  5A7D B;  4FHJ A;  2VQ2 A;  1G3N B;  2H6F A;  3LKU A;  5DBK A;  2V4L A;  3ZHE B;  3ASF A;  5EID A;  4AJW A;  4WND A;  3VTX A;  1N4R A;  2AXU A;  2L0T B;  4XIF A;  4BES A;  4GTV A;  3FTS A;  3C98 A;  3L16 A;  3CKC A;  3Q7A A;  4E6H A;  3CIA A;  3SHF A;  4DPR A;  5ENP D;  3DST A;  2H6I A;  4XKB A;  2FEZ A;  3MKQ A;  1Y6I A;  4DLQ A;  4RSY A;  3ABL E;  2DZN A;  3FH5 A;  4APF A;  3GZS A;  1OWL A;  4I1M A;  3ZXS A;  2XEN A;  3ABM E;  2WMO A;  3CHM A;  2KCL A;  2OVB A;  2IO2 C;  4U0Z A;  5G55 A;  3S7F A;  3ZVV A;  4F1S A;  2FBN A;  3CHO A;  2ZGG A;  3HXD A;  4F3V A;  4GTS A;  1L5J A;  2M63 A;  1E96 B;  3QJZ A;  4G1T A;  3UX4 A;  2PNN A;  3FHE A;  3MV3 B;  1SZA A;  3FUF A;  3TWQ A;  2X6F A;  3HDX A;  3CLJ A;  4CZ2 D;  4FUL A;  4JHJ A;  2ETA A;  2V4H C;  1DVP A;  1H6O A;  4BER A;  3J5P A;  2P9S G;  4I6E A;  3LPZ A;  1UG3 A;  2I2O A;  4AV7 A;  3RU0 A;  4JA9 A;  1OCZ E;  1JPL A;  4GCN A;  3IHY A;  2OCC E;  2P9L G;  3WXX A;  4FU3 A;  2RFA A;  4BSZ B;  2HR2 A;  3D9L A;  4G23 A;  3CVL A;  2WB2 A;  3ASG A;  2DIW A;  2FI7 A;  5JJT A;  4R7L A;  1HU3 A;  1EYH A;  1GW6 A;  4WUY A;  5B1B E;  3B13 A;  1H0A A;  3AS4 A;  1N95 A;  5G05 C;  2H6G A;  2P2C P;  4XX5 A;  5LCW J;  3ZYK A;  4KZ0 A;  2J8S D;  1BPO A;  5ARG A;  3QOU A;  3ULQ A;  4F53 A;  3NAW A;  3CST A;  5AQ9 A;  4UWH A;  5FWQ A;  4KMO A;  3O48 A;  5DIZ A;  4B0Z A;  2IEJ A;  1OWM A;  3EU9 A;  5ENT D;  1BLX B;  3S7D A;  2DYR E;  3CKB A;  4DRX E;  2L9B A;  4GML A;  4GPK A;  4GZ3 A;  5EX3 A;  5AAR A;  5KJN A;  3FUJ A;  4A1G A;  4I9C A;  5FTP A;  1O1R A;  3PUK A;  5KJL A;  5B3S E;  3TXM A;  3Q75 A;  4APO A;  5AAO A;  4TRQ A;  5KCM A;  2CFZ A;  5M72 A;  4H7X A;  2J08 A;  1Q2Z A;  5CCM A;  4DUI A;  4NRH B;  2WQ7 A;  4HLL A;  4LNB A;  2QYJ A;  3AJI A;  1A5E A;  2VTB B;  4LNU D;  4UWK A;  4C0E A;  5BW8 C;  1N54 A;  4F6R D;  1HXI A;  2VSX E;  2Y0B G;  5AIJ A;  3D9O A;  1JCS A;  2PM7 A;  3Q47 B;  4EZJ A;  4UQX A;  2I1K A;  3EHM A;  5CEC B;  4RQI A;  3FU6 A;  3FH7 A;  3RRM B;  3ENE A;  1K3Z D;  2XZT G;  1ELR A;  3ZYM A;  1TN6 A;  3ONL A;  4GA1 A;  2P9I G;  1NZN A;  4HNA D;  2Y69 E;  4LER A;  3I4R B;  3I4G A;  5CHE E;  1S63 A;  4OAV B;  3QC1 A;  4Q69 A;  1H19 A;  1KT1 A;  4ACL A;  3JXJ A;  2VSO E;  3EHN A;  4U63 A;  4NAC A;  3EHR A;  1N4S A;  3D3M A;  4GAA A;  4GZ5 A;  4L2Y A;  2NSZ A;  2OND A;  5HS0 A;  1O1S A;  1HS6 A;  3U4T A;  1NI1 A;  3T8K A;  2F8X K;  4XI9 A;  1YCS B;  5CRV A;  4FLH A;  4I1O B;  2PL2 A;  4FAD A;  3MV2 B;  2IF4 A;  3Q7F A;  1E8X A;  2AXZ A;  4ANU A;  5KWD A;  4ANW A;  1MX2 A;  4RVB A;  3UXG A;  2BKG A;  3CQG B;  1S70 B;  4YVO A;  3FU5 A;  4YDE A;  5EDS A;  3RRN B;  3C3R A;  2VJ8 A;  3D9K A;  3RAU A;  1A17 A;  2WVI A;  2IJG X;  2PQN A;  1UN9 A;  2XEV A;  2R5S A;  4J6I A;  3LS8 A;  1KT0 A;  2EIL E;  2KZT B;  4BY6 A;  1V54 E;  1E90 A;  3I3N A;  4GMJ A;  4ME2 A;  3E33 A;  3CEQ A;  3FUL A;  3C5R A;  4JEU A;  1AWC B;  4GTP A;  3R7Q A;  1E8W A;  1N52 A;  3FDH A;  4KZC A;  2MOW A;  3SO8 A;  3TWS A;  2WMN A;  3ZHE A;  3CVW A;  1JCR A;  5JJ7 A;  3FWV A;  1NL4 A;  1LD8 A;  2OV8 A;  2L0I A;  2XZD G;  3ESL A;  4YDY A;  4TXR A;  2XQ0 A;  3MCX A;  4OVU A;  5BV0 A;  2XRY A;  3G2S A;  4WNG A;  4GTQ A;  1B89 A;  3E32 A;  3RK6 A;  4F1P A;  1IXV A;  3ISM C;  3CHR A;  4CT0 A;  5FZS A;  4BWR A;  4JHR A;  4U8V D;  1HFA A;  3D9J A;  4ILI A;  5AQB A;  3NB2 A;  3S2A A;  4XE0 A;  3AG4 E;  2RD0 A;  3CR3 A;  4K5C A;  2WXR A;  4B8C B;  3NBN B;  2VGX B;  3T9K A;  4I2W A;  2VGY A;  4WWP A;  4A55 A;  2QFC A;  4HB5 A;  3PE3 A;  2OEW A;  5AJD A;  3ZFW A;  4CRW A;  1H6K A;  5AYW D;  4GYW A;  2WM9 A;  3HXB A;  4HOS A;  1E7U A;  3UMV A;  5BXU A;  2X6J A;  1JUQ A;  2DZO A;  1X5B A;  3AU5 A;  1BU9 A;  4G2V A;  3HRA A;  4N3A A;  3KAE A;  3JUE A;  2PM6 A;  2P9K G;  5JHA A;  5G04 J;  4ATZ D;  3CVP A;  2IO3 C;  1FVF A;  1BI7 B;  3ULY A;  3SY2 A;  4KYO B;  3PH0 C;  2GRR B;  3JYS A;  4P29 A;  1WAO 1;  2E0I A;  3MZL B;  4BSX A;  1HE8 A;  3BU8 A;  3LVR E;  1D9S A;  1KLX A;  1QBQ A;  3QAQ A;  2Y4T A;  4KBQ A;  1Z3Y A;  4XEI G;  2MRI A;  4GU5 A;  3UKR G;  3APC A;  4TUM A;  4YDO A;  1TNB A;  5CEA A;  5A6C A;  4PS8 A;  4WWN A;  1NP7 A;  4JHK A;  3SZ7 A;  1O1T A;  3SFZ A;  4U0S A;  3HXC A;  1LF8 A;  1WG0 A;  4BT8 A;  4WNE A;  2VSY A;  3PUJ A;  4EZL A;  2X6I A;  4ATG A;  3KD7 A;  4ZFH A;  1AP7 A;  4DX5 D;  2HE0 A;  3HVE B;  4N5Q A;  4MBG A;  4LCT A;  5E75 A;  2BKK B;  3CHP A;  3BG0 B;  3UM0 A;  2NYJ A;  3QB2 A;  5CBO A;  2R17 C;  4CDN A;  3FUD A;  4YDW A;  3EIJ A;  1SA5 A;  1XGW A;  3U66 A;  1HX8 A;  4X8Q A;  3TXN A;  2YHC A;  3PZ1 A;  4CYM D;  3FFL A;  4KVO A;  4UQY A;  4UI9 K;  1KPS B;  1XNF A;  5E76 A;  3KSL A;  3LYA A;  2ZIR A;  2CG2 A;  2WXM A;  1JWG A;  3AG2 E;  3VLD A;  2LXL A;  2LO6 A;  4B94 A;  3F6Q A;  4NQ0 A;  5CMW A;  1TN7 A;  2R59 A;  1TR4 A;  3QKY A;  5CED B;  1H2U A;  3FEX A;  3DXM G;  2VTB A;  3B7B A;  4YVQ C;  3TG4 A;  3T8M A;  4K03 A;  2P58 C;  2E2E A;  3UM3 A;  4GTR A;  1N11 A;  3B7T A;  3V2O A;  4CGW A;  4LSZ E;  1E8Y A;  2WXG A;  3AG1 E;  5LCW C;  3HHM A;  3CK8 A;  4EBA G;  1K1B A;  2X38 A;  1NA0 A;  3Q9U C;  2J07 A;  5CMY A;  3G2T A;  4J8F A;  4O60 A;  2OVF A;  2Y1L E;  2RFM A;  3MA5 A;  4ZHB A;  3SD5 A;  5FQ8 A;  3IHV A;  4L1B A;  5EIL A;  5A23 A;  4G8L A;  4ILH B;  1SQM A;  1UJK A;  3AU4 A;  2JAB A;  4KT6 B;  4EPZ A;  4HBD A;  2RG8 A;  2GRL A;  5KJM A;  4A1S A;  4FC8 A;  3ZEF A;  2VYI A;  4EBA A;  3DSX A;  4C9B B;  4GZC A;  4AIF A;  1HZ4 A;  3DBS A;  3FTV A;  3J5Q B;  2ZGD A;  5EKQ D;  3U9W A;  4OVV A;  4U95 D;  2XHE A;  1MHQ A;  3BQO A;  5JA4 D;  3C3O A;  3TWV A;  5AJL A;  1N4P A;  3FTY A;  2XPZ A;  1TEZ A;  2FO7 A;  1Z5S C;  1SZ9 A;  5HQ8 A;  2JLB A;  4DX2 A;  1S0P A;  3NF1 A;  3VLF A;  5KBA A;  4DX6 D;  4HRM B;  2J09 A;  3FUN A;  3ULE G;  3FUK A;  5FZR A;  1DC2 A;  3ABK E;  4UUC A;  3D9P A;  2LAI A;  2AWI A;  4LG6 A;  2GW1 A;  4GTT A;  2GRP B;  2I6H A;  3OXL A; 
#chains in the Genus database with same CATH homology
 3PS6 A;  3BEE A;  4IN3 B;  5T4Y A;  2I1J A;  3O4Z A;  2PL2 A;  3PRZ A;  4FAD A;  3LVQ E;  5BPP A;  2AW6 A;  3G2W A;  3MV2 B;  2IF4 A;  4NUR A;  4UQZ A;  5ANL A;  2AVP A;  3APF A;  3ONK A;  1E8X A;  2AXZ A;  5C1D A;  2KZT A;  4ANU A;  2A4Z A;  4ANW A;  3FEY A;  4GCO A;  2IU1 A;  4RVB A;  5D0Q D;  5LP0 A;  3TGO A;  3MKQ B;  2ZU6 B;  4DK5 A;  3B7U X;  2X6K A;  3FUM A;  1HO8 A;  3CQG B;  4J0U A;  4KXK B;  4YVO A;  4URK A;  3GZ1 A;  3LXU X;  3UT8 A;  3P2B A;  3FU5 A;  3QAR A;  4FP7 A;  4UWL A;  4IYP A;  5EDS A;  3RRN B;  2VJ8 A;  3CVX A;  3D9K A;  3HYM B;  1IQR A;  1ELW A;  1FCH A;  3ZRH A;  4JZY A;  1A17 A;  2FUL A;  2IFU A;  2WVI A;  2IJG X;  2PQN A;  4H7Y A;  4V3I A;  4N2S A;  3CHQ A;  3MYV A;  2PZI A;  1UN9 A;  2XEV A;  2R5S A;  4J6I A;  4D10 C;  3B7R L;  3LS8 A;  3VTY A;  4AOF A;  1KT0 A;  2KZT B;  4BY6 A;  4WAF A;  1E90 A;  2HYZ A;  4AXH A;  3I3N A;  1H2T C;  4BTB A;  4GYY A;  3PRE A;  4GMJ A;  1UN8 A;  4ME2 A;  4U0U A;  3RJV A;  4I6J A;  4WWO A;  5FQ6 A;  3CEQ A;  3L22 A;  3FUL A;  3PVL A;  2X6H A;  1TJC A;  1Z6T A;  3U3W A;  3B7S A;  4JEU A;  4RG6 A;  2J49 A;  1OWN A;  5C2Y A;  3QWW A;  2BF0 X;  4HOR A;  2J9Q A;  3R7Q A;  2YQ8 A;  1N52 A;  1E8W A;  3FDH A;  1PC2 A;  1FVH A;  4ACK A;  3MGB A;  3T5X A;  4AEZ C;  4FJZ A;  1IYG A;  3AS8 A;  2UWJ G;  3L54 A;  3JCK C;  4KZC A;  4PDX A;  3RO2 A;  4CEM A;  2MOW A;  3RRU A;  1MQS A;  4XZ4 A;  2WXH A;  2WMN A;  4N2Q A;  4WNF A;  4MRU A;  1PAQ A;  3D9M A;  3ZHE A;  5JJ7 A;  3CVW A;  3FWV A;  3SI5 A;  1VDY A;  4XI0 A;  3LDZ A;  1ZU2 A;  2OV8 A;  2L0I A;  3BG1 B;  4I2Z A;  3ESL A;  2XQ0 A;  2OOE A;  3CV0 A;  3IEG A;  3MCX A;  1QNF A;  4LUN U;  3CVU A;  4OVU A;  3OXG A;  2XRY A;  5BV0 A;  4JA7 A;  4QFV A;  3G2S A;  3QDN A;  3QNK A;  4WNG A;  2KC7 A;  1B89 A;  3RK6 A;  1H2V C;  4UWF A;  3S7B A;  4CGV A;  2UY1 B;  4GB9 A;  3TL5 A;  3JQ0 A;  5A7D B;  4FHJ A;  2VQ2 A;  4I43 A;  4TUU A;  2IOL A;  3CHR A;  3FUH A;  4CT0 A;  4PH4 B;  3LKU A;  5FZS A;  3ML8 A;  4GA0 A;  5DBK A;  4BWR A;  4JHR A;  2V4L A;  3ZHE B;  1U3C A;  2I9C A;  1Y8M A;  3OXF A;  3ASF A;  1HFA A;  3D9J A;  2ILR A;  1U3D A;  4AJW A;  4ILI A;  4UWG A;  4WND A;  2VSN A;  4Y6W A;  4YND A;  3U64 A;  3FU0 A;  5ANR A;  3VTX A;  3S2A A;  4PUC A;  3KS2 A;  4Q96 A;  4K0R A;  4XE0 A;  4BT9 A;  2AXU A;  2L0T B;  4XIF A;  3TJP A;  2LSU A;  2RD0 A;  3FTS A;  5JHB A;  3C98 A;  3L16 A;  3GZ2 A;  3CKC A;  3CR3 A;  5EX0 A;  3CIA A;  4E6H A;  4I9E A;  2WXR A;  3SHF A;  4M3O A;  4DPR A;  3CK7 A;  4MKT A;  4B8C B;  2X3M A;  4JPS A;  4XKB A;  4AY5 A;  3GYZ A;  2VGX B;  4JVS A;  3IV0 A;  2FEZ A;  4I2W A;  2ION A;  3MKQ A;  2VGY A;  2KCK A;  1Y6I A;  3NZU A;  4WWP A;  4A55 A;  3CSF A;  3JUI A;  4Q94 A;  4DLQ A;  4RSY A;  1QQE A;  2QFC A;  4G24 A;  3PE3 A;  3FH5 A;  4APF A;  3GZS A;  5AJD A;  2Y4U A;  3ZFW A;  3PEV B;  4CRW A;  1OWL A;  3E4B A;  1H6K A;  3UT4 A;  4I1M A;  5AYW D;  4GYW A;  3ZXS A;  4U07 A;  3ZW3 A;  2WQH A;  4DJA A;  5LFA A;  2WM9 A;  3OTN A;  2WMO A;  3CHM A;  3ZYL A;  2KCL A;  4HOS A;  3Q49 B;  2OVB A;  3MJW A;  3ZIM A;  1IQU A;  5BNW A;  1E7U A;  3MEK A;  3UMV A;  1EPU A;  4U0Z A;  2X6J A;  1JUQ A;  4AM9 A;  5G55 A;  2V5F A;  4GZ6 A;  5T8I A;  2HO1 A;  2C0M A;  3S7F A;  2YIN A;  3ZVV A;  4J8S A;  4F1S A;  5FT9 A;  2FBN A;  2Q7F A;  3CHO A;  5G05 J;  4F3V A;  1X5B A;  3AU5 A;  1L5J A;  4AP2 A;  5BT1 A;  2M63 A;  4G2V A;  1E96 B;  2MHK A;  3QJZ A;  4G1T A;  2NXP A;  3DPD A;  5BUZ A;  2WXI A;  3LY8 A;  4XKC A;  3UX4 A;  2KCV A;  4A3V A;  3FP3 A;  3KAE A;  2CHW A;  4N3A A;  4CDR A;  2KAT A;  4UI9 J;  3FHE A;  2PM6 A;  1SZA A;  1OWO A;  3FUF A;  3MV3 B;  3RKV A;  5KJK A;  2X6F A;  5JHA A;  4BX9 A;  4AVX A;  5G04 J;  4FA6 A;  3HDX A;  4C0M A;  3CLJ A;  4FUL A;  3CVV A;  4JHJ A;  4CCA A;  4I1A A;  1DVP A;  2BTD A;  1HG5 A;  2WXN A;  3S7J A;  3SGH A;  4A3T A;  3ZYQ A;  3CVP A;  1FVF A;  3PDN A;  4HVB A;  4I6E A;  4KYO B;  3LPZ A;  3FU3 A;  2WXP A;  3PH0 C;  1UG3 A;  2UY1 A;  4TV3 A;  3UUX A;  4DI3 A;  3JYS A;  2I2O A;  3LCA A;  4EZK A;  4P29 A;  1WAO 1;  4AV7 A;  5AEN A;  2E0I A;  3RU0 A;  2HM8 A;  2YHE A;  3MZL B;  3FH8 A;  4JA9 A;  3CVN A;  1JPL A;  4GCN A;  3IHY A;  4BSX A;  1HE8 A;  2V8S E;  3AS5 A;  3LVR E;  3URZ A;  3IBE A;  1INZ A;  1KLX A;  3CQC B;  3QAQ A;  2Y4T A;  4KBQ A;  3WXX A;  3EDT B;  4G25 A;  1Z3Y A;  2BUG A;  4KVM A;  4N3B A;  2MRI A;  4FU3 A;  4GU5 A;  5FQ7 A;  2WQ6 A;  4MS6 A;  3APC A;  3ZN3 A;  4BX8 A;  5A6C A;  4PS8 A;  2HR2 A;  1YA0 A;  3D9L A;  4IRU A;  4WWN A;  4G23 A;  3CVL A;  1NP7 A;  3CVY A;  4JHK A;  2WB2 A;  3ASG A;  3QWP A;  4L7T A;  2DIW A;  3SZ7 A;  2FI7 A;  2IQC A;  3SFZ A;  5JJT A;  2CG3 A;  4R7L A;  2VGX A;  1HU3 A;  1EYH A;  4PS3 A;  5ARF A;  4U0S A;  4EEC A;  1GW6 A;  3T5V A;  4WUY A;  3UT7 A;  1E8Z A;  2WXO A;  4EQF A;  3B13 A;  4F7A A;  1H0A A;  3AS4 A;  3FTX A;  3L17 A;  3QK0 A;  1LF8 A;  1HH8 A;  3PNT B;  3ASD A;  5G05 C;  5HI7 A;  4XX5 A;  4BT8 A;  5CCL A;  2J4B A;  4WNE A;  5LCW J;  2VSY A;  3ZYK A;  4U8H A;  4KZ0 A;  1UW4 B;  1BPO A;  2L6J A;  3PUJ A;  4DLO A;  2XCC A;  2Y3A A;  5ARG A;  3QOU A;  4BFR A;  4EZL A;  2X6I A;  3L13 A;  4ATG A;  3KD7 A;  4UI9 C;  3ULQ A;  2XGS A;  4F53 A;  1UJJ A;  3HVE B;  3CST A;  5G04 C;  4LCT A;  3JQ1 A;  5E75 A;  2XPI A;  3RO3 A;  4UWH A;  1E7V A;  5FWQ A;  3CHP A;  4KMO A;  3BG0 B;  4L2L A;  4ABN A;  3QB2 A;  2XGO A;  3O48 A;  2R17 C;  4CDN A;  3UPV A;  4N5C A;  4RG9 A;  3FUD A;  3MX3 A;  3EIJ A;  5DIZ A;  4B0Z A;  4B89 A;  1XGW A;  3U66 A;  1OWM A;  1HX8 A;  1Z3X A;  4B8A A;  3TXN A;  3S7D A;  2YHC A;  3FFL A;  3CKB A;  3ESK A;  4KVO A;  5FJY A;  4UQY A;  2L9B A;  4UI9 K;  3APD A;  3IKO B;  3ZPJ A;  4FLB A;  4CT4 A;  3R9A B;  1ZBP A;  1XNF A;  4GML A;  5E76 A;  4GPK A;  3LYA A;  3Q4A B;  4GZ3 A;  5EX3 A;  3FUI A;  2CG2 A;  4Y6C A;  2XPY A;  3CHS A;  5KJN A;  4ANV A;  2WXM A;  3ZGQ A;  1QZ2 A;  2V0P A;  1JWG A;  4PS7 A;  3VLD A;  3LJ3 A;  2LO6 A;  2WXL A;  3MKR A;  4W9R A;  4JEH A;  1NA3 A;  2C0L A;  2GGF A;  4B94 A;  4ILG A;  4NQ0 A;  5CMW A;  3FUJ A;  2R59 A;  3QKY A;  4A1G A;  3FTU A;  4I9C A;  5J08 A;  1H2U A;  3FEX A;  2VTB A;  5FTP A;  4L23 A;  3PUK A;  2WXF A;  5KJL A;  1DNP A;  3L6A A;  2WXJ A;  3SF4 A;  2YNQ A;  4O6F A;  3GW4 A;  4GA2 A;  3TXM A;  4YVQ C;  2WXK A;  4APO A;  3TG4 A;  4TRQ A;  3T8M A;  4IUL A;  1IHG A;  2P58 C;  3FY4 A;  2CFZ A;  4K03 A;  2E2E A;  4H7X A;  5KCM A;  3SBT B;  5M72 A;  2J08 A;  3I5P A;  3G2U A;  5CCM A;  4FJY A;  4MLP A;  3B7T A;  4CGW A;  3CGH A;  4NRH B;  4I17 A;  1E8Y A;  2WXG A;  4I6G A;  2WQ7 A;  5LCW C;  3HHM A;  4J8E A;  3CK8 A;  1TJF A;  4EBA G;  3TAX A;  4LRZ A;  3LEW A;  3L08 A;  2PQR A;  4FHK A;  2X38 A;  1NA0 A;  3NQP A;  2VTB B;  5LX8 A;  4JXT A;  4UWK A;  4N3C A;  2J07 A;  5CMY A;  3G2T A;  3ML9 A;  4J8F A;  4HOT A;  4C0E A;  5G2N A;  2OVF A;  3ASH A;  5BW8 C;  3FTZ A;  2J4D A;  3G2V A;  3EIQ C;  4HOU A;  5FZQ A;  2LNI A;  4J8D A;  3MA5 A;  4HS2 A;  3SD5 A;  1N54 A;  1ELK A;  3PNL B;  3LY9 A;  5FQ8 A;  1HXI A;  2XCB A;  1HG2 A;  1EF1 C;  3NZS A;  2EQX A;  2AXV A;  3CVQ A;  2VSX E;  3IHV A;  4L1B A;  4LEU A;  5AIJ A;  3D9O A;  4U04 A;  5A23 A;  2PM7 A;  3FUE A;  3Q47 B;  4EZJ A;  4ILH B;  5J90 A;  1SQM A;  2JEK A;  4OYS A;  3HVE A;  1OUV A;  1UJK A;  4UQX A;  4HOQ A;  1WM5 A;  3AU4 A;  3Q15 A;  2I1K A;  3EHM A;  2IOS A;  2GRM A;  4KT6 B;  3CK9 A;  4EPZ A;  2A5U A;  2RG8 A;  2GRL A;  5KJM A;  2DBA A;  4A1S A;  4FC8 A;  3ZEF A;  3FU6 A;  4CDM A;  2VYI A;  4EBA A;  4C9B B;  3FH7 A;  3RRM B;  3ENE A;  4GZC A;  4AIF A;  1HZ4 A;  3DBS A;  3FTV A;  1ELR A;  3FTW A;  3ZYM A;  5EKQ D;  4BTA A;  3HIZ A;  3QWV A;  3U9W A;  4OVV A;  2WXQ A;  4G26 A;  1P5Q A;  2KM4 A;  3ONL A;  4AY6 A;  4GA1 A;  3Q5M A;  3D9N A;  5LOZ A;  2CHX A;  1OWP A;  2WPV A;  2XHE A;  5BV1 A;  3OAW A;  1NZN A;  1MHQ A;  5T3R A;  3PZD A;  4HLE A;  1W3B A;  3VLE A;  5AJL A;  1JWF A;  3KEZ A;  3FTY A;  3PEU B;  2XGM A;  5D0O D;  2XPZ A;  4LER A;  2LSV A;  2FO7 A;  3I4R B;  3I4G A;  5CHE E;  4ANX A;  1TEZ A;  1SZ9 A;  2FF4 A;  5HQ8 A;  2JLB A;  3QC1 A;  4E85 A;  1S0P A;  4JL0 A;  4Q69 A;  1H19 A;  3NF1 A;  3VLF A;  1KT1 A;  4GZD A;  4ACL A;  3EJN A;  2VSO E;  4JC8 A;  3EHN A;  4U63 A;  4NAC A;  5JJ6 A;  4N39 A;  2LAH A;  1EDU A;  2J09 A;  2QY7 A;  3FUN A;  3LY7 A;  3N71 A;  4GYO A;  3R7R A;  3D3M A;  4GAA A;  4GZ5 A;  3FUK A;  5ENN A;  5FZR A;  1PY1 A;  3SBS A;  4L2Y A;  1WY6 A;  2NSZ A;  2OND A;  3RIB A;  2XRZ A;  3TG5 A;  3P1U A;  4DI4 A;  3D9P A;  1HS6 A;  4G11 A;  2C2L A;  3PE4 A;  4JW1 A;  2LAI A;  2NC9 A;  4HXI A;  5FQ4 A;  3U4T A;  3D9I A;  2AWI A;  2CHZ A;  1HF8 A;  3UQ3 A;  2GW1 A;  2DCP A;  4XI9 A;  3SNX A;  4HFG A;  2CFU A;  4FLH A;  2I6H A;  3OXL A;  4I1O B;  3K9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...