3ASDA

Mama r50e mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
137
structure length
137
Chain Sequence
FDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
molecule keywords MamA
total genus 53
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asdA00
2Y4UA 2C2LA 3CVQA 4GYOA 3ZN3A 3GW4A 3GZ2A 4U0ZA 4UQXA 2ONDA 1NA0A 4J8FA 3Q15A 4WNEA 4GZ3A 2KCVA 5G05C 4I2WA 5JJ6A 3MEKA 3N71A 3FP3A 3RU0A 2IF4A 3Q4AB 5G04C 3CEQA 3MV3B 4HOSA 4G2VA 4GYWA 4BWRA 3LPZA 4KXKB 1A17A 1XNFA 4J8EA 2AVPA 5AYWD 3ZPJA 1PC2A 2L6JA 4U04A 3GZ1A 3ZFWA 3EDTB 4WNFA 4U07A 3ASGA 4JA9A 2YHCA 4CDRA 4J8DA 2KC7A 3LY8A 5G05J 5BW8C 2E2EA 2C0LA 2FO7A 3QDNA 4GZ5A 4N3AA 4U0SA 5C1DA 2HYZA 2YQ8A 4GCNA 2XCCA 4ME2A 4AY5A 3ASDA 2LSUA 4N5CA 4BTAA 4I9CA 5M72A 2JLBA 1ZU2A 2VGYA 3ASFA 4ABNA 4GPKA 1NA3A 2XGMA 4I9EA 1HXIA 2DBAA 3RIBA 4N2SA 4YVQC 4HOQA 1E96B 2UWJG 4G24A 4H7XA 3LYAA 1ZBPA 2FF4A 2HO1A 3LY9A 4RG9A 2VGXA 4UI9C 5CHEE 4O6FA 4GCOA 4HOUA 5FTPA 3TAXA 4CGWA 2KCLA 3LY7A 1KT0A 2XGSA 3LCAA 3URZA 3CVNA 1ELRA 3OXGA 4N39A 2V5FA 5EKQD 1WM5A 5G04J 4BTBA 4BT9A 2VQ2A 3Q5MA 4GA2A 3K9IA 2IFUA 1KLXA 3VTYA 2PQRA 5CCMA 4G1TA 3QKYA 1FCHA 3QWVA 1QQEA 3PE4A 4I2ZA 5A6CA 3MKRA 4UI9K 4HOTA 3CV0A 3CKBA 3WXXA 3ASHA 4B94A 1Y8MA 2GW1A 4G23A 4GA1A 3AS5A 3SF4A 5FZSA 3OXFA 3GYZA 5KJLA 2Y4TA 4HORA 2FI7A 2I6HA 2C0MA 3Q47B 4JA7A 4IN3B 2XGOA 5ARFA 4JL0A 3R9AB 3RO3A 2OOEA 3AS4A 3QWPA 3UQ3A 3ZHEA 2MHKA 3TG4A 5LCWC 4N2QA 1HZ4A 3CVLA 1IYGA 3ESKA 5CCLA 3ZGQA 4A1SA 4AM9A 1OUVA 2P58C 2QFCA 3MV2B 2FBNA 3NF1A 5KJNA 4XIFA 2KCKA 5DIZA 5KJKA 4AY6A 4APOA 2J9QA 3FFLA 3FWVA 3KD7A 4U0UA 5FZRA 3S7JA 3SZ7A 4WUYA 5HI7A 1TJCA 1P5QA 3PE3A 4UQYA 3VTXA 5JJ7A 2VYIA 2XPIA 2KATA 5FZQA 1YA0A 3TGOA 2Q7FA 3PDNA 4I17A 4N3BA 4XI0A 2PQNA 2XCBA 4CGVA 3RJVA 1W3BA 3TG5A 5FT9A 2FEZA 3QWWA 3S7DA 4XI9A 4AIFA 1B89A 4GYYA 5EX3A 2BUGA 3KAEA 5EX0A 5HQ8A 2VGXB 3HYMB 3MA5A 2LSVA 4G26A 4UQZA 4WNGA 3RKVA 3S7BA 4RG6A 4WNDA 4NQ0A 2PZIA 2XEVA 4BT8A 4EQFA 4Y6WA 3IEGA 2NC9A 3CK9A 5BNWA 2UY1B 2HR2A 2UY1A 1KT1A 4F3VA 3CK8A 1WAO1 5D0QD 2PL2A 3O48A 2LNIA 2WPVA 4JHRA 4NRHB 3UPVA 4UI9J 1ELWA 1IHGA 3BEEA 3Q49B 3UUXA 4GZ6A 4YNDA 3QOUA 5D0OD 2R5SA 3OXLA 3ULQA 4KYOB 3CVPA 5BT1A 4Y6CA 5A7DB 3E4BA 5FJYA 3KS2A 2VSYA 3ZHEB 5JJTA 4J0UA 1HH8A 2VSNA 4W9RA 4GA0A 3S7FA 3RO2A 3AS8A 5KJMA 3U4TA 3U3WA 4H7YA 5LCWJ 3LKUA 4G25A 3JYSA 4LEUA 3CKCA 4I1AA 4KBQA 1QZ2A 3CK7A 5ARGA 4N3CA 5DBKA 1NZNA 2WQHA 4YVOA
chains in the Genus database with same CATH superfamily
2X6KA 4CDMA 2AWIA 4L2YA 4JB8P 4DX2A 3DEOA 3Q9UC 1TR4A 4JPSA 2XRYA 4ILGA 4U04A 3TWRA 2JABA 5AN8A 3CGHA 5C1DA 4I43A 3UM0A 5ENQD 4OVUA 4APFA 4RVBA 2WXMA 1IXVA 3DEPA 3I5PA 2CFZA 2E0IA 5T8IA 2J07A 2QYJA 2HO1A 3NAWA 1H6KA 4KZCA 5FWQA 2XHEA 2ZISA 2KCLA 3D9MA 5J08A 1TNOA 5EKQD 4Q94A 3LJNA 5A6CA 3WXXA 3ZYKA 4B94A 2PNNA 3J5QB 4GTRA 2F8YA 3D9JA 1A5EA 5CCLA 1EDUA 3D9NA 3TXNA 4V3IA 1WY6A 4A3TA 1EF1C 2Q7FA 1JPLA 3EIJA 1YCSB 4OYSA 1HE8A 4G26A 5BXOA 4DK5A 1D8DA 3WG7E 3FUMA 3UPVA 2LNIA 3CVUA 3QOUA 1VDYA 3C3RA 5JA4D 3AS8A 2H6FA 1U3DA 3CKCA 3Q75A 1UJJA 3W9FA 3FUFA 2X6JA 4HVBA 4DX7D 3GW4A 2IO2C 3JCKC 3PZ2A 4DX5D 2H6IA 2R2LA 1O1SA 3BQOA 3VLDA 2V5QC 2HM8A 2LXMA 2XCCA 4ME2A 3B7UX 4CDNA 4GPKA 1E90A 2XEHA 4ACLA 4GAAA 2PM6A 3C72A 4ACKA 2R05A 2RD0A 3UIPC 2V5FA 1SQMA 3RRMB 4CT0A 2R17C 4GZCA 5EYLA 4UWLA 2RKKA 4DLQA 1QYMA 2DZOA 2WXHA 3ZGQA 3UMVA 3MYVA 3Q73A 4OAVB 4FULA 2ZIRA 2WXJA 2Y1LE 5ENSD 3HHMA 5HI7A 1TEZA 2IQCA 4WWPA 3PRZA 2LAIA 5EX0A 3EHRA 2VGXB 5JHBA 2YHEA 2VJ8A 4B8CB 1MX6A 2GRNB 5J90A 3T5VA 3RRUA 4DJAA 4DX6D 2IU1A 3ULQA 3I4GA 4KVMA 4EBAA 4WAFA 2L0IA 4EZLA 2VSNA 1E8YA 3B7TA 4PDXA 3QJZA 5BPPA 2KZTB 4YDOA 1FT1A 3TWWA 4UWHA 3AG3E 4GU5A 1XNFA 5CECB 2BEDA 2OVBA 4N5QA 5BW8C 2E2EA 3CVWA 4FHJA 4N3AA 2J4BA 4E6HA 4YDWA 2VSOE 1K8KG 3SZ7A 3CVXA 4UI9C 4D10C 4L9PA 3IHYA 4BTBA 5G04J 2AW6A 1OXJA 3FU3A 3LXUX 3FDHA 2BKGA 1FCHA 3QKYA 1TN7A 3CKBA 4JHKA 3EHNA 2Y4TA 3FUJA 3Q47B 3EHMA 3TWVA 2XGOA 1IHBA 4C9BB 2OOEA 1D9SA 2CG3A 5H7PA 4GTQA 3AG2E 4I1MA 2XS8A 2VYIA 2XPIA 4JZYA 3NBNB 4ANXA 1H0AA 2V4HC 3B7SA 1H6PA 3CHOA 3RK6A 4FP7A 3UX4A 4F7AA 4RG6A 2FULA 1FPPA 4HLEA 2NC9A 1OWMA 2WXKA 1UN8A 4DI4A 2ILRA 4CZ2D 4JHRA 3B13A 1IHGA 1HG2A 2EIME 5ANLA 4GZ6A 1OWLA 4Y6CA 4ILIA 4BSZB 4GMRA 4GA0A 5KJMA 1KZOA 2IJGX 3ZYMA 2J09A 3N71A 4GTOA 3UM3A 4KXKB 5AYWD 2BF0X 4A63B 2EIJE 3QDNA 1BPOA 2HYZA 2L9BA 1X81A 4PS8A 1Z5SC 5A23A 2P9IG 4KZ0A 4G24A 4GZDA 4O6FA 4HOUA 1OWPA 1KT0A 4K5CA 3CIAA 1MX4A 3CHPA 4MRUA 3FUDA 3ZVVA 3T5XA 4G23A 3CSFA 3AG1E 4G11A 3PNTB 3TG4A 3UINC 5FQ8A 2P58C 2XEEA 3U9WA 3FWVA 1RZ4A 1TJCA 4XI0A 1W3BA 1AP7A 2LSVA 4LNBA 3UI2A 3ML8A 3IHVA 2OVFA 2V8SE 2AXVA 3MX3A 3CHRA 1EYHA 4TXRA 4AOFA 2OEWA 4Q96A 1S64A 5A7DB 5FJYA 4EECA 2DYRE 4GB9A 1FVHA 1QNFA 2ZGGA 3PUJA 4O1PA 4I1AA 2X6IA 4YVOA 4KT6B 3Q15A 4TUUA 3CLJA 3QK0A 1Z3XA 1KZPA 2RFMA 1N4SA 4AXHA 3ZNGA 1SA4A 4I6GA 3NOCD 4XX5A 4B0ZA 2CHXA 3OTNA 4UWGA 4ABNA 3ASFA 4LNUD 3FU6A 4N2SA 5ENOD 4NURA 3CVNA 2VQ2A 3Q5MA 5CMYA 3HRAA 5LOZA 4ATZD 3QWVA 1QQEA 4L2LA 4BSXA 1LD7A 3L9TA 3BUAA 3E30A 4JD2G 5FZSA 3OXFA 3ONKA 2C0MA 3JQ1A 3AS4A 2XENA 1PAQA 1WDYA 1NP7A 1TN8A 4AM9A 4LNGA 4BERA 3VTXA 3ML9A 1H2UA 3TGOA 4DUIA 1BLXB 3L82A 4XI9A 2AXUA 2VSXE 3RKVA 4I6EA 4KMOA 3JXJA 3CK9A 3D9IA 5BT1A 4XE0A 3C98A 2ZXWE 2B6CA 4W9RA 3RO2A 3ZKJA 3JYSA 4UUCA 3SNXA 4ATGA 1QZ2A 4TXPA 1L5JA 4GTVA 2Y4UA 4K5AB 4FADA 1NA0A 3PVLA 4I2WA 4PS3A 4NACA 2DVWA 3FH7A 4B93B 3FTXA 3TWUA 3L22A 4E85A 2C0LA 3DXKG 3D9HA 4DI3A 2H6GA 3ASDA 3Q7AA 4GTSA 4RSYA 2KBXA 3EUVA 4ILHB 4MBGA 3G2WA 3FU0A 1UJKA 4HFGA 4IYPA 3CVVA 1N4PA 3G2SA 1OWNA 3DPYA 3OXGA 1WM5A 3FEYA 2IFUA 5CBOA 2XZDG 5EILA 4HOTA 1SW6A 4I2ZA 2FI7A 5FQ7A 3SD5A 2MHKA 3ABKE 5AARA 1HZ4A 1IQUA 1OUVA 4JC8A 4IULA 3G2VA 3J5PA 4WWNA 1ELKA 3SQVA 2KATA 4HBDA 3SO8A 3HDXA 4O60A 3MGBA 4BESA 2X6FA 3DPDA 4YNDA 1E8ZA 2VSYA 2R59A 3FUIA 3L54A 1DCQA 4BEPA 2KZTA 2FO1E 3C5RA 5E75A 1JCSA 3UM2A 2IF4A 4HOSA 1HX8A 1TNBA 1HG5A 4UWKA 3IXEA 4BETA 5G05J 2WXGA 2YQ8A 4L1BA 4L23A 4AY5A 3CHSA 2X3MA 4YVQC 3FULA 1H2TC 3ABLE 1XGWA 3TWSA 4GA1A 4HRMB 4JL0A 1UN9A 4TV3A 2Y0BG 1S70B 1YMPA 2FBNA 3EU9A 4B8AA 3RRNB 3DXMG 5FZRA 3DSWA 3QC1A 2J8SD 1K3ZD 2XCBA 3PH0C 3L08A 3HYMB 4WNGA 3DRAA 4HLLA 3UT4A 1LTXA 3ULYA 2CHZA 2WQ7A 2IOLA 1N4QA 3FUEA 3BEEA 3I3NA 4GTPA 2NXPA 4I6JA 3ZHEB 3HVEB 4HNAD 1U2VG 3S7FA 3X2QE 4G25A 3AU4A 4BY6A 2QZAA 3MZLB 3L13A 3NQPA 2WM9A 4GYOA 3V79K 4HB5A 2P9SG 3B95A 1FT2A 1K1AA 3L6AA 3FEXA 1MQSA 1E7UA 2BTDA 3P2BA 2VGYA 1NA3A 3ZUVB 5G2NA 3F6QA 3E37A 3LYAA 3RIBA 5CHEE 3LY9A 5FTPA 3JUIA 4N39A 1ELRA 2KXPC 2WQ6A 3LVQE 4GA2A 1IKND 4UI9K 4CYMD 1N11A 3UKUG 3PZDA 3LDZA 4JA7A 1H2VC 5C2YA 1QBQA 2F8XK 2A4ZA 2X6HA 3NF1A 1UW4B 4MS6A 4CCAA 2J9QA 3S7JA 1DC2A 4TXQA 3TG5A 4GYYA 1N0RA 2PZIA 4URKA 5KNHD 2I2OA 2DWZA 5CEDB 5FINA 4C0EA 1TNZA 3APCA 5B3SE 3HG0D 3CVPA 1MZCA 3KS2A 4JEUA 5KNGA 2XPYA 1OCRE 5DBKA 4GZ3A 4CEMA 2XQ0A 3NB2A 4NIKA 5KWDA 5G04C 4G2VA 4GYWA 3UT8A 1OY3D 3LEWA 2FO7A 1OCZE 1O1TA 2QYUA 2XGMA 3G2UA 4I9EA 1E8XA 3FH8A 5JJ7A 3HXDA 3Q9NC 2GRRB 3JXIA 4KVOA 3G2TA 1G3NB 3VTYA 2L0TB 5CCMA 2WMNA 4HI9A 1E8WA 3ASHA 3AS5A 5KJLA 3UQ3A 3FTUA 3NZUA 2LAHA 3ESKA 5KJKA 1OCOE 3CQCB 3ZEFA 4C0MA 1B89A 3KAEA 2I9CA 4XZ4A 3ZRHA 5EN5D 2M63A 3PS6A 4Y6WA 1Y6IA 1INZA 3O48A 4AJWA 2WPVA 3AJIA 3KEAA 4AP2A 1OWOA 3Q49B 4I1OB 4K03A 1O5MA 3GZSA 1SZAA 5ENPD 3L17A 4LERA 5G55A 1E7VA 4F6RD 3LKUA 4OVVA 3SBTB 2VTBA 1JCQA 3EIQC 2IO3C 1Z6TA 4ZHBA 1S0PA 4ANVA 2XZTG 3FP3A 2LO6A 3Q4AB 4DRXE 3PNLB 3EDTB 4U07A 3ASGA 2ZGDA 2A5EA 4LG6A 3DBSA 1HXIA 4J8SA 1SA5A 4H7XA 2NSZA 5CRVA 3TJPA 4DX1A 3TWQA 5EYPF 4GTMA 3SHFA 2XGSA 4XKBA 1IQRA 3NZSA 3GYZA 4ANUA 4CGWA 3HXFA 3RO3A 5CMWA 5BXUA 3LVRE 2QFCA 2NYJA 3PZ4A 5CRUA 5T4YA 2KCKA 2EILE 5DIZA 4EBAG 3FFLA 3KD7A 3SBSA 4UQYA 3PDNA 3QWWA 2IOSA 4TRQA 1MYOA 4G8KA 4Q69A 2IEJA 3CQGB 3CK8A 2DCPA 4BFRA 3SFXA 2JEKA 3V30A 4J0UA 3V2OA 1UG3A 4PUCA 3U3WA 3S2AA 3TXMA 3DSUA 4KBQA 4N3CA 2OEVA 5AJLA 3CVQA 1HU3A 4O1OA 3ESLA 4K5BA 2I1KA 3ASNE 3FUNA 2XRZA 2F0YA 4JA9A 4J8DA 2KC7A 1FVFA 1ZU2A 1O1RA 3AAAC 1E96B 3E34A 3FTSA 4U7EB 2VGXA 4GCOA 3DSSA 3HXEA 4K0RA 1BI7B 4J8YA 4U8VD 4BT9A 5JHAA 1KLXA 4U95D 4G1TA 3PE4A 4YDYA 2WXQA 1NL4A 4JEHA 4U63A 3TWTA 2WXIA 2BKKB 2CG2A 4HORA 3R9AB 4IN3B 5EDSA 4PS7A 3OAWA 3U66A 2A5UA 4N2QA 1IYGA 2RFAA 2KM4A 2V4LA 1N54A 3VLEA 5FZQA 1NI1A 5AQ9A 4I17A 3ZYLA 3S7DA 3FU5A 3QB2A 5EX3A 2GRLA 4UQZA 3S7BA 3IEGA 3Q79A 4B89A 1UOHA 5D0QD 1LD8A 4EPZA 3OXLA 3ASOE 3HVEA 2WXNA 1MJ0A 3CSTA 4H7YA 5ENTD 4RQIA 3ZN3A 1U3CA 4R7LA 4U0ZA 4WNEA 2P9KG 3Q78A 1K1BA 3CEQA 3UTMA 3IV0A 3ZPJA 3GZ1A 2YHCA 4CDRA 1TNUA 2P2CP 1NFIE 4GMJA 4GCNA 4FC8A 2MYOA 2ETAA 2LSUA 4N5CA 3PZ1A 3DSTA 4QFVA 4HOQA 3ZU7B 2DYSE 5D2MC 2FF4A 3D3MA 2GROB 3K9IA 2P9NG 4UWFA 2P9UG 3PREA 4J6IA 1PY1A 4JW1A 4MLPA 1S63A 3E33A 1WG0A 4XIFA 1DVPA 4LSZE 3NOGD 4WUYA 2EINE 3AG4E 5AQ7A 2GRMA 3B7BA 2F37A 5EIDA 5HQ8A 4BT8A 3D9LA 4FLHA 1Q2ZA 4F3VA 2GGFA 3DWLG 2GRQB 4HRLA 2Y3AA 4KYOB 3O4ZA 4HI8A 5JJTA 1HH8A 4LEUA 3T9KA 1MHQA 3GZ2A 4J8FA 2KCVA 3KSLA 3MEKA 3IKOB 5LX8A 2P9LG 5ENNA 3UKRG 2AVPA 1PC2A 4A1GA 2IONA 4LCTA 4F1PA 4BX8A 3UIOC 3T8KA 2RG8A 5BUZA 3PUKA 2WXLA 4BX9A 1JWGA 2OV8A 3MKRA 3CV0A 3JUEA 4HXIA 1Y8MA 4GPMA 3PEVB 1V55E 3ZHEA 3QWPA 4X8QA 1N9AA 1TNYA 3B7RL 1N94A 2WXPA 5KJNA 3IBEA 3SFZA 4FA6A 3FTYA 1N95A 5AQBA 3PE3A 2WMOA 4C48B 1YA0A 1GW6A 5ITZF 3BG1B 3W9GA 2PQNA 4RLYA 3ONLA 4AIFA 1DCEA 3MA5A 4JXTA 2EQXA 2VTBB 3ZXPA 3FUHA 2UY1B 2UY1A 1KT1A 3C3QA 3ENEA 4FJYA 5B1AE 4GTTA 5FQ6A 1RW2A 1H6OA 4U8YD 2YINA 3HIZA 4G8LA 3SI5A 1D8EA 2R03A 5LCWJ 3E32A 5FIOA 1N0QA 4HS2A 1YYHA 2WQHA 3FHEA 4EZJA 4UQXA 5G05C 5JJ6A 5FQ4A 5EIBE 4BWRA 4WWOA 2V0PA 5IY5E 4WNFA 2ZU6B 3LY8A 4GZ5A 1N4RA 4BTAA 2DBAA 3MJWA 3ISMC 3U4TA 1ZBPA 2DIWA 3U64A 3P1UA 2XPZA 3KSQA 3CVYA 3R7RA 3URZA 1HS6A 3L16A 1BU9A 2LXLA 4ANWA 1N52A 3D9OA 4LUNU 5AQAA 1JUQA 5AAOA 4L7TA 2I6HA 5D66A 2MRIA 5LCWC 1HO8A 3BU8A 4DPRA 4A1SA 2LUHA 3MV2B 4AY6A 4CT4A 5JMND 4APOA 3PZ3A 3QARA 4U0UA 2ETCA 3DSVA 1P5QA 4J7WA 3UT7A 2QY7A 2J4DA 4F53A 3APDA 5HS0A 4NQ0A 4MKTA 5BNWA 3SFYA 3D9KA 3ZXSA 2WB2A 4NRHB 1X5BA 4FJZA 3SGHA 2MOWA 2Y69E 5LFAA 3AU5A 3EJNA 5E76A 3R7QA 2GRPB 3ZW3A 2DZNA 2J08A 3MCXA 5ARGA 1OT8A 1NZNA 1TN6A 2C2LA 5HRYA 3Q7FA 2ONDA 3ZYQA 4LRZA 2L6JA 1JWFA 2AXZA 1JCRA 4YDEA 2J49A 3UM1A 5M72A 2EIKE 1MX2A 2JLBA 4EZKA 5CBNA 4HRNA 5T3RA 3JQ0A 3TAXA 3BG0B 3LY7A 2L6BA 2B0OE 3LCAA 2IY0C 1KPSB 1HFAA 3LJ3A 3MKQB 3CHQA 2PQRA 1DNPA 4FU3A 4XKCA 2WXOA 5CERB 2WXRA 5AJDA 4CRWA 5KCMA 4F1SA 5ARFA 1V54E 2OCCE 3FTZA 3CVLA 3T8MA 1BI8B 3FH5A 1LF8A 2HE0A 2R02A 3TWXA 4N3BA 3ZIMA 5FT9A 2FEZA 3FTVA 2BUGA 3SY2A 5ENRD 3C3OA 3VLFA 2XEVA 4QQIA 4EQFA 4ZFHA 4U8HA 2H6HA 4TUMA 3CR3A 5B1BE 1WAO1 2ETBA 1ELWA 1SZ9A 3KEZA 5D0OD 5BV1A 3QNKA 1H19A 3HXBA 4P29A 3E4BA 2YNQA 2QC9A 2WVIA 3APFA 4AEZC 4OAUC 2WXFA 3ABME 3PEUB 3ULEG 3CK7A 2I1JA 3EU5A 1TJFA 5HKPA 3RU0A 3MV3B 3CHMA 3LPZA 1A17A 4J8EA 1EPUA 4M3OA 5KBAA 4Z68A 3ZFWA 2X38A 4U0SA 2P9PG 5BV0A 4M7CA 1HF8A 4EHMA 4A3VA 3UXGA 4I9CA 3TL5A 4FHKA 4FLBA 4AV7A 1Z3YA 2UWJG 4RG9A 2XS1A 5AENA 4IRUA 3QAQA 1OCCE 5AIJA 5ANRA 5CEAA 2VGEA 4JVSA 2GW1A 2PM7A 3SF4A 3V31A 3LS8A 3I4RB 1AWCB 4GMLA 1BD8A 4U96D 1SVXA 3FTWA 4AVXA 4CGVA 3RJVA 4JHJA 4DLOA 3FUKA 1TYQG 3V2XA 3DSXA 4WNDA 2CHWA 4A55A 5LP0A 3RAUA 2HR2A 2PL2A 3HXCA 4UI9J 3UUXA 2AJAA 4HQDA 2R5SA 4XEIG 3EHQA 1ZB1A 3R9MA 2CFUA 3D9PA 4PH4B 3FY4A 3MKQA 3RSEG
chains in the Genus database with same CATH topology
4KT6B 3GZ2A 4J8FA 2X6KA 3Q15A 4TUUA 2AWIA 2KCVA 4GZ3A 4CEMA 4CDMA 3MEKA 4L2YA 2XQ0A 3CLJA 3IKOB 5LX8A 3QK0A 4JPSA 5G04C 1Z3XA 4G2VA 4GYWA 5ENNA 4AXHA 2XRYA 2AVPA 3UT8A 1PC2A 4ILGA 4U04A 4A1GA 4I6GA 3LEWA 2FO7A 3CGHA 2IONA 5C1DA 4I43A 4XX5A 4B0ZA 2CHXA 4OVUA 4LCTA 4APFA 3OTNA 4UWGA 4RVBA 2WXMA 4ABNA 3ASFA 4BX8A 2XGMA 3G2UA 4I9EA 3FU6A 1E8XA 3I5PA 2CFZA 2E0IA 2RG8A 5T8IA 4N2SA 3FH8A 2J07A 4AY6A 2HO1A 5BUZA 5JJ7A 3PUKA 1H6KA 4KZCA 5FWQA 2XHEA 2KCLA 4NURA 3D9MA 5J08A 2WXLA 4KVOA 3CVNA 5EKQD 2VQ2A 3Q5MA 3G2TA 5CMYA 3VTYA 5LOZA 1JWGA 2L0TB 2OV8A 4BX9A 4Q94A 5CCMA 2WMNA 1E8WA 1QQEA 3QWVA 5A6CA 3MKRA 4L2LA 3CV0A 4HXIA 4BSXA 3WXXA 3ASHA 3ZYKA 1Y8MA 4B94A 3AS5A 3PEVB 3OXFA 5FZSA 5KJLA 3ONKA 2C0MA 3ZHEA 3JQ1A 3AS4A 3UQ3A 3QWPA 3FTUA 3B7RL 3D9JA 3NZUA 2LAHA 1PAQA 3ESKA 2WXPA 5CCLA 1NP7A 1EDUA 3D9NA 4AM9A 5KJKA 5KJNA 3IBEA 3SFZA 3TXNA 4FA6A 4V3IA 3FTYA 3VTXA 1WY6A 3PE3A 4A3TA 2WMOA 1EF1C 1H2UA 3ML9A 1YA0A 3TGOA 1GW6A 2Q7FA 1JPLA 3BG1B 3EIJA 2PQNA 3CQCB 4OYSA 3ZEFA 1HE8A 4C0MA 3ONLA 4XI9A 4AIFA 1B89A 2AXUA 2VSXE 3KAEA 2I9CA 4XZ4A 3MA5A 3RKVA 4G26A 3ZRHA 4JXTA 2M63A 3PS6A 4I6EA 4KMOA 4DK5A 2EQXA 4Y6WA 2VTBB 3CK9A 1Y6IA 3FUHA 3D9IA 2UY1B 2UY1A 1KT1A 3FUMA 1INZA 3O48A 4AJWA 2LNIA 2WPVA 3UPVA 4AP2A 1OWOA 3CVUA 3ENEA 4FJYA 3Q49B 4I1OB 3QOUA 4K03A 3GZSA 5FQ6A 5BT1A 1SZAA 4XE0A 3C98A 2YINA 1VDYA 3HIZA 3L17A 4LERA 5G55A 1E7VA 3SI5A 4W9RA 3RO2A 3AS8A 5LCWJ 3LKUA 3JYSA 1U3DA 4OVVA 3SNXA 3CKCA 3SBTB 1UJJA 4HS2A 4ATGA 1QZ2A 3FUFA 2VTBA 1L5JA 2X6JA 2WQHA 2Y4UA 3EIQC 3FHEA 4FADA 4EZJA 4HVBA 3GW4A 4UQXA 1NA0A 3PVLA 1Z6TA 5G05C 5JJ6A 1S0PA 4I2WA 5FQ4A 4ANVA 3FP3A 4PS3A 2LO6A 3JCKC 4NACA 3Q4AB 4BWRA 3FH7A 3PNLB 3FTXA 2V0PA 4WWOA 3EDTB 4WNFA 4U07A 3ASGA 3L22A 3VLDA 2ZU6B 3LY8A 4E85A 2HM8A 2C0LA 4GZ5A 4DI3A 2XCCA 4ME2A 3ASDA 3B7UX 4BTAA 4RSYA 4CDNA 4ILHB 4GPKA 3DBSA 1E90A 3G2WA 3FU0A 1HXIA 2DBAA 3MJWA 1UJKA 4HFGA 4J8SA 4ACLA 4GAAA 4IYPA 4H7XA 2NSZA 1ZBPA 3TJPA 2DIWA 3U4TA 3U64A 3CVVA 3P1UA 2PM6A 2XPZA 3SHFA 3CVYA 2XGSA 3G2SA 4XKBA 3R7RA 1OWNA 1IQRA 3URZA 4ACKA 2RD0A 3OXGA 2V5FA 1WM5A 1SQMA 3FEYA 2IFUA 1HS6A 3L16A 4HOTA 4I2ZA 3NZSA 3RRMB 4ANWA 4CT0A 1N52A 3D9OA 4LUNU 1JUQA 3GYZA 2FI7A 2I6HA 2R17C 4L7TA 4ANUA 4CGWA 5FQ7A 4GZCA 3RO3A 3SD5A 2MRIA 5CMWA 2MHKA 4UWLA 4DLQA 5LCWC 3LVRE 1HZ4A 1HO8A 2WXHA 3ZGQA 4DPRA 1IQUA 3UMVA 4A1SA 1OUVA 3MYVA 2QFCA 3MV2B 4JC8A 5T4YA 2KCKA 4FULA 4IULA 5DIZA 2WXJA 4APOA 3G2VA 3QARA 4CT4A 3FFLA 3KD7A 4WWNA 4U0UA 3SBSA 4EBAG 3HHMA 1ELKA 5HI7A 4UQYA 1P5QA 1TEZA 2KATA 2IQCA 3PDNA 4WWPA 3UT7A 2QY7A 3HDXA 3PRZA 3QWWA 2J4DA 2LAIA 2IOSA 4TRQA 3APDA 5EX0A 4F53A 2VGXB 5JHBA 3MGBA 2YHEA 2VJ8A 4NQ0A 2X6FA 4Q69A 4MKTA 5BNWA 4B8CB 3CQGB 3CK8A 3ZXSA 3D9KA 2WB2A 4NRHB 1X5BA 4FJZA 5J90A 3SGHA 3DPDA 2MOWA 2DCPA 3RRUA 4DJAA 3T5VA 2IU1A 4YNDA 3ULQA 4BFRA 2JEKA 5LFAA 3I4GA 3AU5A 4KVMA 1E8ZA 2VSYA 4EBAA 2R59A 3EJNA 3FUIA 4J0UA 4WAFA 2L0IA 4EZLA 5E76A 2VSNA 3R7QA 1UG3A 1E8YA 4PUCA 3B7TA 3ZW3A 3U3WA 3L54A 3QJZA 4PDXA 3S2AA 5BPPA 3TXMA 2J08A 3MCXA 4KBQA 5ARGA 2KZTB 4N3CA 2KZTA 1NZNA 5AJLA 2C2LA 1HU3A 3CVQA 2ONDA 5E75A 4UWHA 3ESLA 3ZYQA 2IF4A 4HOSA 2I1KA 1HX8A 4GU5A 1HG5A 1XNFA 4LRZA 4UWKA 3FUNA 2L6JA 1JWFA 2XRZA 2OVBA 4JA9A 4J8DA 2KC7A 5G05J 5BW8C 2AXZA 2E2EA 2WXGA 3CVWA 4FHJA 1FVFA 4N3AA 2J49A 2J4BA 2YQ8A 4L1BA 4E6HA 4L23A 4AY5A 3CHSA 5M72A 2JLBA 1ZU2A 2X3MA 4EZKA 4YVQC 2VSOE 1E96B 3FULA 5T3RA 3FTSA 3SZ7A 3CVXA 4UI9C 2VGXA 1H2TC 4GCOA 3JQ0A 3TAXA 3BG0B 3LY7A 4D10C 3IHYA 4K0RA 3LCAA 1HFAA 4BTBA 3LJ3A 5G04J 4BT9A 2AW6A 3MKQB 1XGWA 5JHAA 1KLXA 3CHQA 3FU3A 2PQRA 3FDHA 3LXUX 4G1TA 3QKYA 1DNPA 1FCHA 3PE4A 4FU3A 4XKCA 2WXOA 2WXQA 3CKBA 4JEHA 4U63A 2WXRA 2WXIA 4GA1A 4JHKA 3EHNA 5AJDA 2CG2A 4CRWA 4HORA 2Y4TA 3FUJA 5KCMA 3Q47B 3EHMA 4IN3B 2XGOA 5ARFA 4JL0A 3R9AB 4C9BB 2OOEA 4F1SA 5EDSA 3FTZA 1UN9A 4PS7A 3OAWA 4TV3A 3U66A 2A5UA 4N2QA 3CVLA 1IYGA 2CG3A 2KM4A 3T8MA 2FBNA 4B8AA 3RRNB 2V4LA 4I1MA 5FZRA 1N54A 3QC1A 3FH5A 1LF8A 2VYIA 2XPIA 4JZYA 5FZQA 3VLEA 4I17A 4N3BA 2XCBA 3ZIMA 4ANXA 1H0AA 3B7SA 3ZYLA 3PH0C 5FT9A 3CHOA 2FEZA 3L08A 3FU5A 3QB2A 4FP7A 3FTVA 3RK6A 3S7DA 5EX3A 2BUGA 3UX4A 4F7AA 3HYMB 2GRLA 4UQZA 4WNGA 3S7BA 4RG6A 3VLFA 2XEVA 3UT4A 4EQFA 2FULA 4U8HA 3IEGA 2CHZA 2NC9A 4HLEA 1OWMA 2WQ7A 4B89A 2WXKA 1UN8A 2IOLA 3CR3A 4DI4A 2ILRA 5D0QD 1WAO1 4JHRA 3FUEA 3B13A 1ELWA 1IHGA 1HG2A 3BEEA 4EPZA 1SZ9A 3I3NA 3KEZA 4GZ6A 5D0OD 5ANLA 5BV1A 1OWLA 3OXLA 3QNKA 1H19A 2NXPA 4Y6CA 4I6JA 4P29A 3E4BA 4ILIA 2YNQA 3HVEA 2WXNA 3ZHEB 2WVIA 3HVEB 4GA0A 3APFA 3S7FA 3CSTA 4AEZC 5KJMA 4H7YA 4G25A 2WXFA 3AU4A 4BY6A 3PEUB 3MZLB 3CK7A 3L13A 2I1JA 3NQPA 2WM9A 4GYOA 3ZN3A 1U3CA 4R7LA 1TJFA 4U0ZA 4WNEA 2IJGX 3ZYMA 2J09A 3N71A 3RU0A 3CEQA 3MV3B 3CHMA 3LPZA 4KXKB 1A17A 4J8EA 1EPUA 3IV0A 5AYWD 3ZPJA 4M3OA 3ZFWA 2BF0X 3GZ1A 3L6AA 2YHCA 4CDRA 3QDNA 2X38A 4U0SA 1BPOA 2HYZA 4GMJA 5BV0A 3FEXA 2L9BA 1MQSA 4GCNA 1E7UA 2BTDA 4PS8A 4FC8A 1HF8A 4A3VA 2LSUA 4N5CA 4I9CA 3P2BA 3TL5A 2VGYA 5A23A 1NA3A 4FHKA 4FLBA 4QFVA 5G2NA 4HOQA 4AV7A 1Z3YA 2UWJG 4G24A 4KZ0A 3LYAA 5CHEE 2FF4A 3LY9A 4RG9A 3JUIA 5FTPA 3RIBA 4GZDA 4O6FA 3D3MA 4HOUA 5AENA 1OWPA 1KT0A 4IRUA 3CIAA 3QAQA 4N39A 1ELRA 2WQ6A 3LVQE 5AIJA 5ANRA 4GA2A 3K9IA 4JVSA 3CHPA 4UWFA 4MRUA 3FUDA 4UI9K 3ZVVA 3T5XA 3PREA 4J6IA 2GW1A 4G23A 3PZDA 2PM7A 1PY1A 3SF4A 3CSFA 4JW1A 4MLPA 3LDZA 3LS8A 4G11A 4JA7A 1H2VC 5C2YA 3I4RB 3PNTB 3TG4A 4GMLA 5FQ8A 2A4ZA 2X6HA 2P58C 3NF1A 4XIFA 1UW4B 4MS6A 4CCAA 1DVPA 2J9QA 3U9WA 3FWVA 3S7JA 4WUYA 1TJCA 3FTWA 4XI0A 4AVXA 4CGVA 3RJVA 1W3BA 3TG5A 4JHJA 4DLOA 3FUKA 2GRMA 4GYYA 5HQ8A 2LSVA 4WNDA 4BT8A 2PZIA 2CHWA 4URKA 3D9LA 4A55A 2I2OA 5LP0A 4FLHA 3ML8A 3IHVA 2OVFA 2V8SE 2HR2A 4F3VA 2GGFA 2PL2A 2AXVA 4C0EA 3APCA 4UI9J 3MX3A 3CHRA 1EYHA 3UUXA 4AOFA 2Y3AA 2R5SA 4KYOB 3CVPA 4Q96A 5A7DB 2CFUA 3O4ZA 5FJYA 3KS2A 5JJTA 3D9PA 4JEUA 4EECA 4GB9A 1HH8A 1FVHA 1QNFA 4PH4B 2XPYA 3PUJA 3FY4A 4LEUA 1MHQA 4I1AA 5DBKA 3MKQA 2X6IA 4YVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  2C2L A;  3CVQ A;  4GYO A;  3ZN3 A;  3GW4 A;  3GZ2 A;  4U0Z A;  4UQX A;  2OND A;  1NA0 A;  4J8F A;  3Q15 A;  4WNE A;  4GZ3 A;  2KCV A;  5G05 C;  4I2W A;  5JJ6 A;  3MEK A;  3N71 A;  3FP3 A;  3RU0 A;  2IF4 A;  3Q4A B;  5G04 C;  3CEQ A;  3MV3 B;  4HOS A;  4G2V A;  4GYW A;  4BWR A;  3LPZ A;  4KXK B;  1A17 A;  1XNF A;  4J8E A;  2AVP A;  5AYW D;  3ZPJ A;  1PC2 A;  2L6J A;  4U04 A;  3GZ1 A;  3ZFW A;  3EDT B;  4WNF A;  4U07 A;  3ASG A;  4JA9 A;  2YHC A;  4CDR A;  4J8D A;  2KC7 A;  3LY8 A;  5G05 J;  5BW8 C;  2E2E A;  2C0L A;  2FO7 A;  3QDN A;  4GZ5 A;  4N3A A;  4U0S A;  5C1D A;  2HYZ A;  2YQ8 A;  4GCN A;  2XCC A;  4ME2 A;  4AY5 A;  3ASD A;  2LSU A;  4N5C A;  4BTA A;  4I9C A;  5M72 A;  2JLB A;  1ZU2 A;  2VGY A;  3ASF A;  4ABN A;  4GPK A;  1NA3 A;  2XGM A;  4I9E A;  1HXI A;  2DBA A;  3RIB A;  4N2S A;  4YVQ C;  4HOQ A;  1E96 B;  2UWJ G;  4G24 A;  4H7X A;  3LYA A;  1ZBP A;  2FF4 A;  2HO1 A;  3LY9 A;  4RG9 A;  2VGX A;  4UI9 C;  5CHE E;  4O6F A;  4GCO A;  4HOU A;  5FTP A;  3TAX A;  4CGW A;  2KCL A;  3LY7 A;  1KT0 A;  2XGS A;  3LCA A;  3URZ A;  3CVN A;  1ELR A;  3OXG A;  4N39 A;  2V5F A;  5EKQ D;  1WM5 A;  5G04 J;  4BTB A;  4BT9 A;  2VQ2 A;  3Q5M A;  4GA2 A;  3K9I A;  2IFU A;  1KLX A;  3VTY A;  2PQR A;  5CCM A;  4G1T A;  3QKY A;  1FCH A;  3QWV A;  1QQE A;  3PE4 A;  4I2Z A;  5A6C A;  3MKR A;  4UI9 K;  4HOT A;  3CV0 A;  3CKB A;  3WXX A;  3ASH A;  4B94 A;  1Y8M A;  2GW1 A;  4G23 A;  4GA1 A;  3AS5 A;  3SF4 A;  5FZS A;  3OXF A;  3GYZ A;  5KJL A;  2Y4T A;  4HOR A;  2FI7 A;  2I6H A;  2C0M A;  3Q47 B;  4JA7 A;  4IN3 B;  2XGO A;  5ARF A;  4JL0 A;  3R9A B;  3RO3 A;  2OOE A;  3AS4 A;  3QWP A;  3UQ3 A;  3ZHE A;  2MHK A;  3TG4 A;  5LCW C;  4N2Q A;  1HZ4 A;  3CVL A;  1IYG A;  3ESK A;  5CCL A;  3ZGQ A;  4A1S A;  4AM9 A;  1OUV A;  2P58 C;  2QFC A;  3MV2 B;  2FBN A;  3NF1 A;  5KJN A;  4XIF A;  2KCK A;  5DIZ A;  5KJK A;  4AY6 A;  4APO A;  2J9Q A;  3FFL A;  3FWV A;  3KD7 A;  4U0U A;  5FZR A;  3S7J A;  3SZ7 A;  4WUY A;  5HI7 A;  1TJC A;  1P5Q A;  3PE3 A;  4UQY A;  3VTX A;  5JJ7 A;  2VYI A;  2XPI A;  2KAT A;  5FZQ A;  1YA0 A;  3TGO A;  2Q7F A;  3PDN A;  4I17 A;  4N3B A;  4XI0 A;  2PQN A;  2XCB A;  4CGV A;  3RJV A;  1W3B A;  3TG5 A;  5FT9 A;  2FEZ A;  3QWW A;  3S7D A;  4XI9 A;  4AIF A;  1B89 A;  4GYY A;  5EX3 A;  2BUG A;  3KAE A;  5EX0 A;  5HQ8 A;  2VGX B;  3HYM B;  3MA5 A;  2LSV A;  4G26 A;  4UQZ A;  4WNG A;  3RKV A;  3S7B A;  4RG6 A;  4WND A;  4NQ0 A;  2PZI A;  2XEV A;  4BT8 A;  4EQF A;  4Y6W A;  3IEG A;  2NC9 A;  3CK9 A;  5BNW A;  2UY1 B;  2HR2 A;  2UY1 A;  1KT1 A;  4F3V A;  3CK8 A;  1WAO 1;  5D0Q D;  2PL2 A;  3O48 A;  2LNI A;  2WPV A;  4JHR A;  4NRH B;  3UPV A;  4UI9 J;  1ELW A;  1IHG A;  3BEE A;  3Q49 B;  3UUX A;  4GZ6 A;  4YND A;  3QOU A;  5D0O D;  2R5S A;  3OXL A;  3ULQ A;  4KYO B;  3CVP A;  5BT1 A;  4Y6C A;  5A7D B;  3E4B A;  5FJY A;  3KS2 A;  2VSY A;  3ZHE B;  5JJT A;  4J0U A;  1HH8 A;  2VSN A;  4W9R A;  4GA0 A;  3S7F A;  3RO2 A;  3AS8 A;  5KJM A;  3U4T A;  3U3W A;  4H7Y A;  5LCW J;  3LKU A;  4G25 A;  3JYS A;  4LEU A;  3CKC A;  4I1A A;  4KBQ A;  1QZ2 A;  3CK7 A;  5ARG A;  4N3C A;  5DBK A;  1NZN A;  2WQH A;  4YVO A; 
#chains in the Genus database with same CATH topology
 2X6K A;  4CDM A;  2AWI A;  4L2Y A;  4JB8 P;  4DX2 A;  3DEO A;  3Q9U C;  1TR4 A;  4JPS A;  2XRY A;  4ILG A;  4U04 A;  3TWR A;  2JAB A;  5AN8 A;  3CGH A;  5C1D A;  4I43 A;  3UM0 A;  5ENQ D;  4OVU A;  4APF A;  4RVB A;  2WXM A;  1IXV A;  3DEP A;  3I5P A;  2CFZ A;  2E0I A;  5T8I A;  2J07 A;  2QYJ A;  2HO1 A;  3NAW A;  1H6K A;  4KZC A;  5FWQ A;  2XHE A;  2ZIS A;  2KCL A;  3D9M A;  5J08 A;  1TNO A;  5EKQ D;  4Q94 A;  3LJN A;  5A6C A;  3WXX A;  3ZYK A;  4B94 A;  2PNN A;  3J5Q B;  4GTR A;  2F8Y A;  3D9J A;  1A5E A;  5CCL A;  1EDU A;  3D9N A;  3TXN A;  4V3I A;  1WY6 A;  4A3T A;  1EF1 C;  2Q7F A;  1JPL A;  3EIJ A;  1YCS B;  4OYS A;  1HE8 A;  4G26 A;  5BXO A;  4DK5 A;  1D8D A;  3WG7 E;  3FUM A;  3UPV A;  2LNI A;  3CVU A;  3QOU A;  1VDY A;  3C3R A;  5JA4 D;  3AS8 A;  2H6F A;  1U3D A;  3CKC A;  3Q75 A;  1UJJ A;  3W9F A;  3FUF A;  2X6J A;  4HVB A;  4DX7 D;  3GW4 A;  2IO2 C;  3JCK C;  3PZ2 A;  4DX5 D;  2H6I A;  2R2L A;  1O1S A;  3BQO A;  3VLD A;  2V5Q C;  2HM8 A;  2LXM A;  2XCC A;  4ME2 A;  3B7U X;  4CDN A;  4GPK A;  1E90 A;  2XEH A;  4ACL A;  4GAA A;  2PM6 A;  3C72 A;  4ACK A;  2R05 A;  2RD0 A;  3UIP C;  2V5F A;  1SQM A;  3RRM B;  4CT0 A;  2R17 C;  4GZC A;  5EYL A;  4UWL A;  2RKK A;  4DLQ A;  1QYM A;  2DZO A;  2WXH A;  3ZGQ A;  3UMV A;  3MYV A;  3Q73 A;  4OAV B;  4FUL A;  2ZIR A;  2WXJ A;  2Y1L E;  5ENS D;  3HHM A;  5HI7 A;  1TEZ A;  2IQC A;  4WWP A;  3PRZ A;  2LAI A;  5EX0 A;  3EHR A;  2VGX B;  5JHB A;  2YHE A;  2VJ8 A;  4B8C B;  1MX6 A;  2GRN B;  5J90 A;  3T5V A;  3RRU A;  4DJA A;  4DX6 D;  2IU1 A;  3ULQ A;  3I4G A;  4KVM A;  4EBA A;  4WAF A;  2L0I A;  4EZL A;  2VSN A;  1E8Y A;  3B7T A;  4PDX A;  3QJZ A;  5BPP A;  2KZT B;  4YDO A;  1FT1 A;  3TWW A;  4UWH A;  3AG3 E;  4GU5 A;  1XNF A;  5CEC B;  2BED A;  2OVB A;  4N5Q A;  5BW8 C;  2E2E A;  3CVW A;  4FHJ A;  4N3A A;  2J4B A;  4E6H A;  4YDW A;  2VSO E;  1K8K G;  3SZ7 A;  3CVX A;  4UI9 C;  4D10 C;  4L9P A;  3IHY A;  4BTB A;  5G04 J;  2AW6 A;  1OXJ A;  3FU3 A;  3LXU X;  3FDH A;  2BKG A;  1FCH A;  3QKY A;  1TN7 A;  3CKB A;  4JHK A;  3EHN A;  2Y4T A;  3FUJ A;  3Q47 B;  3EHM A;  3TWV A;  2XGO A;  1IHB A;  4C9B B;  2OOE A;  1D9S A;  2CG3 A;  5H7P A;  4GTQ A;  3AG2 E;  4I1M A;  2XS8 A;  2VYI A;  2XPI A;  4JZY A;  3NBN B;  4ANX A;  1H0A A;  2V4H C;  3B7S A;  1H6P A;  3CHO A;  3RK6 A;  4FP7 A;  3UX4 A;  4F7A A;  4RG6 A;  2FUL A;  1FPP A;  4HLE A;  2NC9 A;  1OWM A;  2WXK A;  1UN8 A;  4DI4 A;  2ILR A;  4CZ2 D;  4JHR A;  3B13 A;  1IHG A;  1HG2 A;  2EIM E;  5ANL A;  4GZ6 A;  1OWL A;  4Y6C A;  4ILI A;  4BSZ B;  4GMR A;  4GA0 A;  5KJM A;  1KZO A;  2IJG X;  3ZYM A;  2J09 A;  3N71 A;  4GTO A;  3UM3 A;  4KXK B;  5AYW D;  2BF0 X;  4A63 B;  2EIJ E;  3QDN A;  1BPO A;  2HYZ A;  2L9B A;  1X81 A;  4PS8 A;  1Z5S C;  5A23 A;  2P9I G;  4KZ0 A;  4G24 A;  4GZD A;  4O6F A;  4HOU A;  1OWP A;  1KT0 A;  4K5C A;  3CIA A;  1MX4 A;  3CHP A;  4MRU A;  3FUD A;  3ZVV A;  3T5X A;  4G23 A;  3CSF A;  3AG1 E;  4G11 A;  3PNT B;  3TG4 A;  3UIN C;  5FQ8 A;  2P58 C;  2XEE A;  3U9W A;  3FWV A;  1RZ4 A;  1TJC A;  4XI0 A;  1W3B A;  1AP7 A;  2LSV A;  4LNB A;  3UI2 A;  3ML8 A;  3IHV A;  2OVF A;  2V8S E;  2AXV A;  3MX3 A;  3CHR A;  1EYH A;  4TXR A;  4AOF A;  2OEW A;  4Q96 A;  1S64 A;  5A7D B;  5FJY A;  4EEC A;  2DYR E;  4GB9 A;  1FVH A;  1QNF A;  2ZGG A;  3PUJ A;  4O1P A;  4I1A A;  2X6I A;  4YVO A;  4KT6 B;  3Q15 A;  4TUU A;  3CLJ A;  3QK0 A;  1Z3X A;  1KZP A;  2RFM A;  1N4S A;  4AXH A;  3ZNG A;  1SA4 A;  4I6G A;  3NOC D;  4XX5 A;  4B0Z A;  2CHX A;  3OTN A;  4UWG A;  4ABN A;  3ASF A;  4LNU D;  3FU6 A;  4N2S A;  5ENO D;  4NUR A;  3CVN A;  2VQ2 A;  3Q5M A;  5CMY A;  3HRA A;  5LOZ A;  4ATZ D;  3QWV A;  1QQE A;  4L2L A;  4BSX A;  1LD7 A;  3L9T A;  3BUA A;  3E30 A;  4JD2 G;  5FZS A;  3OXF A;  3ONK A;  2C0M A;  3JQ1 A;  3AS4 A;  2XEN A;  1PAQ A;  1WDY A;  1NP7 A;  1TN8 A;  4AM9 A;  4LNG A;  4BER A;  3VTX A;  3ML9 A;  1H2U A;  3TGO A;  4DUI A;  1BLX B;  3L82 A;  4XI9 A;  2AXU A;  2VSX E;  3RKV A;  4I6E A;  4KMO A;  3JXJ A;  3CK9 A;  3D9I A;  5BT1 A;  4XE0 A;  3C98 A;  2ZXW E;  2B6C A;  4W9R A;  3RO2 A;  3ZKJ A;  3JYS A;  4UUC A;  3SNX A;  4ATG A;  1QZ2 A;  4TXP A;  1L5J A;  4GTV A;  2Y4U A;  4K5A B;  4FAD A;  1NA0 A;  3PVL A;  4I2W A;  4PS3 A;  4NAC A;  2DVW A;  3FH7 A;  4B93 B;  3FTX A;  3TWU A;  3L22 A;  4E85 A;  2C0L A;  3DXK G;  3D9H A;  4DI3 A;  2H6G A;  3ASD A;  3Q7A A;  4GTS A;  4RSY A;  2KBX A;  3EUV A;  4ILH B;  4MBG A;  3G2W A;  3FU0 A;  1UJK A;  4HFG A;  4IYP A;  3CVV A;  1N4P A;  3G2S A;  1OWN A;  3DPY A;  3OXG A;  1WM5 A;  3FEY A;  2IFU A;  5CBO A;  2XZD G;  5EIL A;  4HOT A;  1SW6 A;  4I2Z A;  2FI7 A;  5FQ7 A;  3SD5 A;  2MHK A;  3ABK E;  5AAR A;  1HZ4 A;  1IQU A;  1OUV A;  4JC8 A;  4IUL A;  3G2V A;  3J5P A;  4WWN A;  1ELK A;  3SQV A;  2KAT A;  4HBD A;  3SO8 A;  3HDX A;  4O60 A;  3MGB A;  4BES A;  2X6F A;  3DPD A;  4YND A;  1E8Z A;  2VSY A;  2R59 A;  3FUI A;  3L54 A;  1DCQ A;  4BEP A;  2KZT A;  2FO1 E;  3C5R A;  5E75 A;  1JCS A;  3UM2 A;  2IF4 A;  4HOS A;  1HX8 A;  1TNB A;  1HG5 A;  4UWK A;  3IXE A;  4BET A;  5G05 J;  2WXG A;  2YQ8 A;  4L1B A;  4L23 A;  4AY5 A;  3CHS A;  2X3M A;  4YVQ C;  3FUL A;  1H2T C;  3ABL E;  1XGW A;  3TWS A;  4GA1 A;  4HRM B;  4JL0 A;  1UN9 A;  4TV3 A;  2Y0B G;  1S70 B;  1YMP A;  2FBN A;  3EU9 A;  4B8A A;  3RRN B;  3DXM G;  5FZR A;  3DSW A;  3QC1 A;  2J8S D;  1K3Z D;  2XCB A;  3PH0 C;  3L08 A;  3HYM B;  4WNG A;  3DRA A;  4HLL A;  3UT4 A;  1LTX A;  3ULY A;  2CHZ A;  2WQ7 A;  2IOL A;  1N4Q A;  3FUE A;  3BEE A;  3I3N A;  4GTP A;  2NXP A;  4I6J A;  3ZHE B;  3HVE B;  4HNA D;  1U2V G;  3S7F A;  3X2Q E;  4G25 A;  3AU4 A;  4BY6 A;  2QZA A;  3MZL B;  3L13 A;  3NQP A;  2WM9 A;  4GYO A;  3V79 K;  4HB5 A;  2P9S G;  3B95 A;  1FT2 A;  1K1A A;  3L6A A;  3FEX A;  1MQS A;  1E7U A;  2BTD A;  3P2B A;  2VGY A;  1NA3 A;  3ZUV B;  5G2N A;  3F6Q A;  3E37 A;  3LYA A;  3RIB A;  5CHE E;  3LY9 A;  5FTP A;  3JUI A;  4N39 A;  1ELR A;  2KXP C;  2WQ6 A;  3LVQ E;  4GA2 A;  1IKN D;  4UI9 K;  4CYM D;  1N11 A;  3UKU G;  3PZD A;  3LDZ A;  4JA7 A;  1H2V C;  5C2Y A;  1QBQ A;  2F8X K;  2A4Z A;  2X6H A;  3NF1 A;  1UW4 B;  4MS6 A;  4CCA A;  2J9Q A;  3S7J A;  1DC2 A;  4TXQ A;  3TG5 A;  4GYY A;  1N0R A;  2PZI A;  4URK A;  5KNH D;  2I2O A;  2DWZ A;  5CED B;  5FIN A;  4C0E A;  1TNZ A;  3APC A;  5B3S E;  3HG0 D;  3CVP A;  1MZC A;  3KS2 A;  4JEU A;  5KNG A;  2XPY A;  1OCR E;  5DBK A;  4GZ3 A;  4CEM A;  2XQ0 A;  3NB2 A;  4NIK A;  5KWD A;  5G04 C;  4G2V A;  4GYW A;  3UT8 A;  1OY3 D;  3LEW A;  2FO7 A;  1OCZ E;  1O1T A;  2QYU A;  2XGM A;  3G2U A;  4I9E A;  1E8X A;  3FH8 A;  5JJ7 A;  3HXD A;  3Q9N C;  2GRR B;  3JXI A;  4KVO A;  3G2T A;  1G3N B;  3VTY A;  2L0T B;  5CCM A;  2WMN A;  4HI9 A;  1E8W A;  3ASH A;  3AS5 A;  5KJL A;  3UQ3 A;  3FTU A;  3NZU A;  2LAH A;  3ESK A;  5KJK A;  1OCO E;  3CQC B;  3ZEF A;  4C0M A;  1B89 A;  3KAE A;  2I9C A;  4XZ4 A;  3ZRH A;  5EN5 D;  2M63 A;  3PS6 A;  4Y6W A;  1Y6I A;  1INZ A;  3O48 A;  4AJW A;  2WPV A;  3AJI A;  3KEA A;  4AP2 A;  1OWO A;  3Q49 B;  4I1O B;  4K03 A;  1O5M A;  3GZS A;  1SZA A;  5ENP D;  3L17 A;  4LER A;  5G55 A;  1E7V A;  4F6R D;  3LKU A;  4OVV A;  3SBT B;  2VTB A;  1JCQ A;  3EIQ C;  2IO3 C;  1Z6T A;  4ZHB A;  1S0P A;  4ANV A;  2XZT G;  3FP3 A;  2LO6 A;  3Q4A B;  4DRX E;  3PNL B;  3EDT B;  4U07 A;  3ASG A;  2ZGD A;  2A5E A;  4LG6 A;  3DBS A;  1HXI A;  4J8S A;  1SA5 A;  4H7X A;  2NSZ A;  5CRV A;  3TJP A;  4DX1 A;  3TWQ A;  5EYP F;  4GTM A;  3SHF A;  2XGS A;  4XKB A;  1IQR A;  3NZS A;  3GYZ A;  4ANU A;  4CGW A;  3HXF A;  3RO3 A;  5CMW A;  5BXU A;  3LVR E;  2QFC A;  2NYJ A;  3PZ4 A;  5CRU A;  5T4Y A;  2KCK A;  2EIL E;  5DIZ A;  4EBA G;  3FFL A;  3KD7 A;  3SBS A;  4UQY A;  3PDN A;  3QWW A;  2IOS A;  4TRQ A;  1MYO A;  4G8K A;  4Q69 A;  2IEJ A;  3CQG B;  3CK8 A;  2DCP A;  4BFR A;  3SFX A;  2JEK A;  3V30 A;  4J0U A;  3V2O A;  1UG3 A;  4PUC A;  3U3W A;  3S2A A;  3TXM A;  3DSU A;  4KBQ A;  4N3C A;  2OEV A;  5AJL A;  3CVQ A;  1HU3 A;  4O1O A;  3ESL A;  4K5B A;  2I1K A;  3ASN E;  3FUN A;  2XRZ A;  2F0Y A;  4JA9 A;  4J8D A;  2KC7 A;  1FVF A;  1ZU2 A;  1O1R A;  3AAA C;  1E96 B;  3E34 A;  3FTS A;  4U7E B;  2VGX A;  4GCO A;  3DSS A;  3HXE A;  4K0R A;  1BI7 B;  4J8Y A;  4U8V D;  4BT9 A;  5JHA A;  1KLX A;  4U95 D;  4G1T A;  3PE4 A;  4YDY A;  2WXQ A;  1NL4 A;  4JEH A;  4U63 A;  3TWT A;  2WXI A;  2BKK B;  2CG2 A;  4HOR A;  3R9A B;  4IN3 B;  5EDS A;  4PS7 A;  3OAW A;  3U66 A;  2A5U A;  4N2Q A;  1IYG A;  2RFA A;  2KM4 A;  2V4L A;  1N54 A;  3VLE A;  5FZQ A;  1NI1 A;  5AQ9 A;  4I17 A;  3ZYL A;  3S7D A;  3FU5 A;  3QB2 A;  5EX3 A;  2GRL A;  4UQZ A;  3S7B A;  3IEG A;  3Q79 A;  4B89 A;  1UOH A;  5D0Q D;  1LD8 A;  4EPZ A;  3OXL A;  3ASO E;  3HVE A;  2WXN A;  1MJ0 A;  3CST A;  4H7Y A;  5ENT D;  4RQI A;  3ZN3 A;  1U3C A;  4R7L A;  4U0Z A;  4WNE A;  2P9K G;  3Q78 A;  1K1B A;  3CEQ A;  3UTM A;  3IV0 A;  3ZPJ A;  3GZ1 A;  2YHC A;  4CDR A;  1TNU A;  2P2C P;  1NFI E;  4GMJ A;  4GCN A;  4FC8 A;  2MYO A;  2ETA A;  2LSU A;  4N5C A;  3PZ1 A;  3DST A;  4QFV A;  4HOQ A;  3ZU7 B;  2DYS E;  5D2M C;  2FF4 A;  3D3M A;  2GRO B;  3K9I A;  2P9N G;  4UWF A;  2P9U G;  3PRE A;  4J6I A;  1PY1 A;  4JW1 A;  4MLP A;  1S63 A;  3E33 A;  1WG0 A;  4XIF A;  1DVP A;  4LSZ E;  3NOG D;  4WUY A;  2EIN E;  3AG4 E;  5AQ7 A;  2GRM A;  3B7B A;  2F37 A;  5EID A;  5HQ8 A;  4BT8 A;  3D9L A;  4FLH A;  1Q2Z A;  4F3V A;  2GGF A;  3DWL G;  2GRQ B;  4HRL A;  2Y3A A;  4KYO B;  3O4Z A;  4HI8 A;  5JJT A;  1HH8 A;  4LEU A;  3T9K A;  1MHQ A;  3GZ2 A;  4J8F A;  2KCV A;  3KSL A;  3MEK A;  3IKO B;  5LX8 A;  2P9L G;  5ENN A;  3UKR G;  2AVP A;  1PC2 A;  4A1G A;  2ION A;  4LCT A;  4F1P A;  4BX8 A;  3UIO C;  3T8K A;  2RG8 A;  5BUZ A;  3PUK A;  2WXL A;  4BX9 A;  1JWG A;  2OV8 A;  3MKR A;  3CV0 A;  3JUE A;  4HXI A;  1Y8M A;  4GPM A;  3PEV B;  1V55 E;  3ZHE A;  3QWP A;  4X8Q A;  1N9A A;  1TNY A;  3B7R L;  1N94 A;  2WXP A;  5KJN A;  3IBE A;  3SFZ A;  4FA6 A;  3FTY A;  1N95 A;  5AQB A;  3PE3 A;  2WMO A;  4C48 B;  1YA0 A;  1GW6 A;  5ITZ F;  3BG1 B;  3W9G A;  2PQN A;  4RLY A;  3ONL A;  4AIF A;  1DCE A;  3MA5 A;  4JXT A;  2EQX A;  2VTB B;  3ZXP A;  3FUH A;  2UY1 B;  2UY1 A;  1KT1 A;  3C3Q A;  3ENE A;  4FJY A;  5B1A E;  4GTT A;  5FQ6 A;  1RW2 A;  1H6O A;  4U8Y D;  2YIN A;  3HIZ A;  4G8L A;  3SI5 A;  1D8E A;  2R03 A;  5LCW J;  3E32 A;  5FIO A;  1N0Q A;  4HS2 A;  1YYH A;  2WQH A;  3FHE A;  4EZJ A;  4UQX A;  5G05 C;  5JJ6 A;  5FQ4 A;  5EIB E;  4BWR A;  4WWO A;  2V0P A;  5IY5 E;  4WNF A;  2ZU6 B;  3LY8 A;  4GZ5 A;  1N4R A;  4BTA A;  2DBA A;  3MJW A;  3ISM C;  3U4T A;  1ZBP A;  2DIW A;  3U64 A;  3P1U A;  2XPZ A;  3KSQ A;  3CVY A;  3R7R A;  3URZ A;  1HS6 A;  3L16 A;  1BU9 A;  2LXL A;  4ANW A;  1N52 A;  3D9O A;  4LUN U;  5AQA A;  1JUQ A;  5AAO A;  4L7T A;  2I6H A;  5D66 A;  2MRI A;  5LCW C;  1HO8 A;  3BU8 A;  4DPR A;  4A1S A;  2LUH A;  3MV2 B;  4AY6 A;  4CT4 A;  5JMN D;  4APO A;  3PZ3 A;  3QAR A;  4U0U A;  2ETC A;  3DSV A;  1P5Q A;  4J7W A;  3UT7 A;  2QY7 A;  2J4D A;  4F53 A;  3APD A;  5HS0 A;  4NQ0 A;  4MKT A;  5BNW A;  3SFY A;  3D9K A;  3ZXS A;  2WB2 A;  4NRH B;  1X5B A;  4FJZ A;  3SGH A;  2MOW A;  2Y69 E;  5LFA A;  3AU5 A;  3EJN A;  5E76 A;  3R7Q A;  2GRP B;  3ZW3 A;  2DZN A;  2J08 A;  3MCX A;  5ARG A;  1OT8 A;  1NZN A;  1TN6 A;  2C2L A;  5HRY A;  3Q7F A;  2OND A;  3ZYQ A;  4LRZ A;  2L6J A;  1JWF A;  2AXZ A;  1JCR A;  4YDE A;  2J49 A;  3UM1 A;  5M72 A;  2EIK E;  1MX2 A;  2JLB A;  4EZK A;  5CBN A;  4HRN A;  5T3R A;  3JQ0 A;  3TAX A;  3BG0 B;  3LY7 A;  2L6B A;  2B0O E;  3LCA A;  2IY0 C;  1KPS B;  1HFA A;  3LJ3 A;  3MKQ B;  3CHQ A;  2PQR A;  1DNP A;  4FU3 A;  4XKC A;  2WXO A;  5CER B;  2WXR A;  5AJD A;  4CRW A;  5KCM A;  4F1S A;  5ARF A;  1V54 E;  2OCC E;  3FTZ A;  3CVL A;  3T8M A;  1BI8 B;  3FH5 A;  1LF8 A;  2HE0 A;  2R02 A;  3TWX A;  4N3B A;  3ZIM A;  5FT9 A;  2FEZ A;  3FTV A;  2BUG A;  3SY2 A;  5ENR D;  3C3O A;  3VLF A;  2XEV A;  4QQI A;  4EQF A;  4ZFH A;  4U8H A;  2H6H A;  4TUM A;  3CR3 A;  5B1B E;  1WAO 1;  2ETB A;  1ELW A;  1SZ9 A;  3KEZ A;  5D0O D;  5BV1 A;  3QNK A;  1H19 A;  3HXB A;  4P29 A;  3E4B A;  2YNQ A;  2QC9 A;  2WVI A;  3APF A;  4AEZ C;  4OAU C;  2WXF A;  3ABM E;  3PEU B;  3ULE G;  3CK7 A;  2I1J A;  3EU5 A;  1TJF A;  5HKP A;  3RU0 A;  3MV3 B;  3CHM A;  3LPZ A;  1A17 A;  4J8E A;  1EPU A;  4M3O A;  5KBA A;  4Z68 A;  3ZFW A;  2X38 A;  4U0S A;  2P9P G;  5BV0 A;  4M7C A;  1HF8 A;  4EHM A;  4A3V A;  3UXG A;  4I9C A;  3TL5 A;  4FHK A;  4FLB A;  4AV7 A;  1Z3Y A;  2UWJ G;  4RG9 A;  2XS1 A;  5AEN A;  4IRU A;  3QAQ A;  1OCC E;  5AIJ A;  5ANR A;  5CEA A;  2VGE A;  4JVS A;  2GW1 A;  2PM7 A;  3SF4 A;  3V31 A;  3LS8 A;  3I4R B;  1AWC B;  4GML A;  1BD8 A;  4U96 D;  1SVX A;  3FTW A;  4AVX A;  4CGV A;  3RJV A;  4JHJ A;  4DLO A;  3FUK A;  1TYQ G;  3V2X A;  3DSX A;  4WND A;  2CHW A;  4A55 A;  5LP0 A;  3RAU A;  2HR2 A;  2PL2 A;  3HXC A;  4UI9 J;  3UUX A;  2AJA A;  4HQD A;  2R5S A;  4XEI G;  3EHQ A;  1ZB1 A;  3R9M A;  2CFU A;  3D9P A;  4PH4 B;  3FY4 A;  3MKQ A;  3RSE G; 
#chains in the Genus database with same CATH homology
 4KT6 B;  3GZ2 A;  4J8F A;  2X6K A;  3Q15 A;  4TUU A;  2AWI A;  2KCV A;  4GZ3 A;  4CEM A;  4CDM A;  3MEK A;  4L2Y A;  2XQ0 A;  3CLJ A;  3IKO B;  5LX8 A;  3QK0 A;  4JPS A;  5G04 C;  1Z3X A;  4G2V A;  4GYW A;  5ENN A;  4AXH A;  2XRY A;  2AVP A;  3UT8 A;  1PC2 A;  4ILG A;  4U04 A;  4A1G A;  4I6G A;  3LEW A;  2FO7 A;  3CGH A;  2ION A;  5C1D A;  4I43 A;  4XX5 A;  4B0Z A;  2CHX A;  4OVU A;  4LCT A;  4APF A;  3OTN A;  4UWG A;  4RVB A;  2WXM A;  4ABN A;  3ASF A;  4BX8 A;  2XGM A;  3G2U A;  4I9E A;  3FU6 A;  1E8X A;  3I5P A;  2CFZ A;  2E0I A;  2RG8 A;  5T8I A;  4N2S A;  3FH8 A;  2J07 A;  4AY6 A;  2HO1 A;  5BUZ A;  5JJ7 A;  3PUK A;  1H6K A;  4KZC A;  5FWQ A;  2XHE A;  2KCL A;  4NUR A;  3D9M A;  5J08 A;  2WXL A;  4KVO A;  3CVN A;  5EKQ D;  2VQ2 A;  3Q5M A;  3G2T A;  5CMY A;  3VTY A;  5LOZ A;  1JWG A;  2L0T B;  2OV8 A;  4BX9 A;  4Q94 A;  5CCM A;  2WMN A;  1E8W A;  1QQE A;  3QWV A;  5A6C A;  3MKR A;  4L2L A;  3CV0 A;  4HXI A;  4BSX A;  3WXX A;  3ASH A;  3ZYK A;  1Y8M A;  4B94 A;  3AS5 A;  3PEV B;  3OXF A;  5FZS A;  5KJL A;  3ONK A;  2C0M A;  3ZHE A;  3JQ1 A;  3AS4 A;  3UQ3 A;  3QWP A;  3FTU A;  3B7R L;  3D9J A;  3NZU A;  2LAH A;  1PAQ A;  3ESK A;  2WXP A;  5CCL A;  1NP7 A;  1EDU A;  3D9N A;  4AM9 A;  5KJK A;  5KJN A;  3IBE A;  3SFZ A;  3TXN A;  4FA6 A;  4V3I A;  3FTY A;  3VTX A;  1WY6 A;  3PE3 A;  4A3T A;  2WMO A;  1EF1 C;  1H2U A;  3ML9 A;  1YA0 A;  3TGO A;  1GW6 A;  2Q7F A;  1JPL A;  3BG1 B;  3EIJ A;  2PQN A;  3CQC B;  4OYS A;  3ZEF A;  1HE8 A;  4C0M A;  3ONL A;  4XI9 A;  4AIF A;  1B89 A;  2AXU A;  2VSX E;  3KAE A;  2I9C A;  4XZ4 A;  3MA5 A;  3RKV A;  4G26 A;  3ZRH A;  4JXT A;  2M63 A;  3PS6 A;  4I6E A;  4KMO A;  4DK5 A;  2EQX A;  4Y6W A;  2VTB B;  3CK9 A;  1Y6I A;  3FUH A;  3D9I A;  2UY1 B;  2UY1 A;  1KT1 A;  3FUM A;  1INZ A;  3O48 A;  4AJW A;  2LNI A;  2WPV A;  3UPV A;  4AP2 A;  1OWO A;  3CVU A;  3ENE A;  4FJY A;  3Q49 B;  4I1O B;  3QOU A;  4K03 A;  3GZS A;  5FQ6 A;  5BT1 A;  1SZA A;  4XE0 A;  3C98 A;  2YIN A;  1VDY A;  3HIZ A;  3L17 A;  4LER A;  5G55 A;  1E7V A;  3SI5 A;  4W9R A;  3RO2 A;  3AS8 A;  5LCW J;  3LKU A;  3JYS A;  1U3D A;  4OVV A;  3SNX A;  3CKC A;  3SBT B;  1UJJ A;  4HS2 A;  4ATG A;  1QZ2 A;  3FUF A;  2VTB A;  1L5J A;  2X6J A;  2WQH A;  2Y4U A;  3EIQ C;  3FHE A;  4FAD A;  4EZJ A;  4HVB A;  3GW4 A;  4UQX A;  1NA0 A;  3PVL A;  1Z6T A;  5G05 C;  5JJ6 A;  1S0P A;  4I2W A;  5FQ4 A;  4ANV A;  3FP3 A;  4PS3 A;  2LO6 A;  3JCK C;  4NAC A;  3Q4A B;  4BWR A;  3FH7 A;  3PNL B;  3FTX A;  2V0P A;  4WWO A;  3EDT B;  4WNF A;  4U07 A;  3ASG A;  3L22 A;  3VLD A;  2ZU6 B;  3LY8 A;  4E85 A;  2HM8 A;  2C0L A;  4GZ5 A;  4DI3 A;  2XCC A;  4ME2 A;  3ASD A;  3B7U X;  4BTA A;  4RSY A;  4CDN A;  4ILH B;  4GPK A;  3DBS A;  1E90 A;  3G2W A;  3FU0 A;  1HXI A;  2DBA A;  3MJW A;  1UJK A;  4HFG A;  4J8S A;  4ACL A;  4GAA A;  4IYP A;  4H7X A;  2NSZ A;  1ZBP A;  3TJP A;  2DIW A;  3U4T A;  3U64 A;  3CVV A;  3P1U A;  2PM6 A;  2XPZ A;  3SHF A;  3CVY A;  2XGS A;  3G2S A;  4XKB A;  3R7R A;  1OWN A;  1IQR A;  3URZ A;  4ACK A;  2RD0 A;  3OXG A;  2V5F A;  1WM5 A;  1SQM A;  3FEY A;  2IFU A;  1HS6 A;  3L16 A;  4HOT A;  4I2Z A;  3NZS A;  3RRM B;  4ANW A;  4CT0 A;  1N52 A;  3D9O A;  4LUN U;  1JUQ A;  3GYZ A;  2FI7 A;  2I6H A;  2R17 C;  4L7T A;  4ANU A;  4CGW A;  5FQ7 A;  4GZC A;  3RO3 A;  3SD5 A;  2MRI A;  5CMW A;  2MHK A;  4UWL A;  4DLQ A;  5LCW C;  3LVR E;  1HZ4 A;  1HO8 A;  2WXH A;  3ZGQ A;  4DPR A;  1IQU A;  3UMV A;  4A1S A;  1OUV A;  3MYV A;  2QFC A;  3MV2 B;  4JC8 A;  5T4Y A;  2KCK A;  4FUL A;  4IUL A;  5DIZ A;  2WXJ A;  4APO A;  3G2V A;  3QAR A;  4CT4 A;  3FFL A;  3KD7 A;  4WWN A;  4U0U A;  3SBS A;  4EBA G;  3HHM A;  1ELK A;  5HI7 A;  4UQY A;  1P5Q A;  1TEZ A;  2KAT A;  2IQC A;  3PDN A;  4WWP A;  3UT7 A;  2QY7 A;  3HDX A;  3PRZ A;  3QWW A;  2J4D A;  2LAI A;  2IOS A;  4TRQ A;  3APD A;  5EX0 A;  4F53 A;  2VGX B;  5JHB A;  3MGB A;  2YHE A;  2VJ8 A;  4NQ0 A;  2X6F A;  4Q69 A;  4MKT A;  5BNW A;  4B8C B;  3CQG B;  3CK8 A;  3ZXS A;  3D9K A;  2WB2 A;  4NRH B;  1X5B A;  4FJZ A;  5J90 A;  3SGH A;  3DPD A;  2MOW A;  2DCP A;  3RRU A;  4DJA A;  3T5V A;  2IU1 A;  4YND A;  3ULQ A;  4BFR A;  2JEK A;  5LFA A;  3I4G A;  3AU5 A;  4KVM A;  1E8Z A;  2VSY A;  4EBA A;  2R59 A;  3EJN A;  3FUI A;  4J0U A;  4WAF A;  2L0I A;  4EZL A;  5E76 A;  2VSN A;  3R7Q A;  1UG3 A;  1E8Y A;  4PUC A;  3B7T A;  3ZW3 A;  3U3W A;  3L54 A;  3QJZ A;  4PDX A;  3S2A A;  5BPP A;  3TXM A;  2J08 A;  3MCX A;  4KBQ A;  5ARG A;  2KZT B;  4N3C A;  2KZT A;  1NZN A;  5AJL A;  2C2L A;  1HU3 A;  3CVQ A;  2OND A;  5E75 A;  4UWH A;  3ESL A;  3ZYQ A;  2IF4 A;  4HOS A;  2I1K A;  1HX8 A;  4GU5 A;  1HG5 A;  1XNF A;  4LRZ A;  4UWK A;  3FUN A;  2L6J A;  1JWF A;  2XRZ A;  2OVB A;  4JA9 A;  4J8D A;  2KC7 A;  5G05 J;  5BW8 C;  2AXZ A;  2E2E A;  2WXG A;  3CVW A;  4FHJ A;  1FVF A;  4N3A A;  2J49 A;  2J4B A;  2YQ8 A;  4L1B A;  4E6H A;  4L23 A;  4AY5 A;  3CHS A;  5M72 A;  2JLB A;  1ZU2 A;  2X3M A;  4EZK A;  4YVQ C;  2VSO E;  1E96 B;  3FUL A;  5T3R A;  3FTS A;  3SZ7 A;  3CVX A;  4UI9 C;  2VGX A;  1H2T C;  4GCO A;  3JQ0 A;  3TAX A;  3BG0 B;  3LY7 A;  4D10 C;  3IHY A;  4K0R A;  3LCA A;  1HFA A;  4BTB A;  3LJ3 A;  5G04 J;  4BT9 A;  2AW6 A;  3MKQ B;  1XGW A;  5JHA A;  1KLX A;  3CHQ A;  3FU3 A;  2PQR A;  3FDH A;  3LXU X;  4G1T A;  3QKY A;  1DNP A;  1FCH A;  3PE4 A;  4FU3 A;  4XKC A;  2WXO A;  2WXQ A;  3CKB A;  4JEH A;  4U63 A;  2WXR A;  2WXI A;  4GA1 A;  4JHK A;  3EHN A;  5AJD A;  2CG2 A;  4CRW A;  4HOR A;  2Y4T A;  3FUJ A;  5KCM A;  3Q47 B;  3EHM A;  4IN3 B;  2XGO A;  5ARF A;  4JL0 A;  3R9A B;  4C9B B;  2OOE A;  4F1S A;  5EDS A;  3FTZ A;  1UN9 A;  4PS7 A;  3OAW A;  4TV3 A;  3U66 A;  2A5U A;  4N2Q A;  3CVL A;  1IYG A;  2CG3 A;  2KM4 A;  3T8M A;  2FBN A;  4B8A A;  3RRN B;  2V4L A;  4I1M A;  5FZR A;  1N54 A;  3QC1 A;  3FH5 A;  1LF8 A;  2VYI A;  2XPI A;  4JZY A;  5FZQ A;  3VLE A;  4I17 A;  4N3B A;  2XCB A;  3ZIM A;  4ANX A;  1H0A A;  3B7S A;  3ZYL A;  3PH0 C;  5FT9 A;  3CHO A;  2FEZ A;  3L08 A;  3FU5 A;  3QB2 A;  4FP7 A;  3FTV A;  3RK6 A;  3S7D A;  5EX3 A;  2BUG A;  3UX4 A;  4F7A A;  3HYM B;  2GRL A;  4UQZ A;  4WNG A;  3S7B A;  4RG6 A;  3VLF A;  2XEV A;  3UT4 A;  4EQF A;  2FUL A;  4U8H A;  3IEG A;  2CHZ A;  2NC9 A;  4HLE A;  1OWM A;  2WQ7 A;  4B89 A;  2WXK A;  1UN8 A;  2IOL A;  3CR3 A;  4DI4 A;  2ILR A;  5D0Q D;  1WAO 1;  4JHR A;  3FUE A;  3B13 A;  1ELW A;  1IHG A;  1HG2 A;  3BEE A;  4EPZ A;  1SZ9 A;  3I3N A;  3KEZ A;  4GZ6 A;  5D0O D;  5ANL A;  5BV1 A;  1OWL A;  3OXL A;  3QNK A;  1H19 A;  2NXP A;  4Y6C A;  4I6J A;  4P29 A;  3E4B A;  4ILI A;  2YNQ A;  3HVE A;  2WXN A;  3ZHE B;  2WVI A;  3HVE B;  4GA0 A;  3APF A;  3S7F A;  3CST A;  4AEZ C;  5KJM A;  4H7Y A;  4G25 A;  2WXF A;  3AU4 A;  4BY6 A;  3PEU B;  3MZL B;  3CK7 A;  3L13 A;  2I1J A;  3NQP A;  2WM9 A;  4GYO A;  3ZN3 A;  1U3C A;  4R7L A;  1TJF A;  4U0Z A;  4WNE A;  2IJG X;  3ZYM A;  2J09 A;  3N71 A;  3RU0 A;  3CEQ A;  3MV3 B;  3CHM A;  3LPZ A;  4KXK B;  1A17 A;  4J8E A;  1EPU A;  3IV0 A;  5AYW D;  3ZPJ A;  4M3O A;  3ZFW A;  2BF0 X;  3GZ1 A;  3L6A A;  2YHC A;  4CDR A;  3QDN A;  2X38 A;  4U0S A;  1BPO A;  2HYZ A;  4GMJ A;  5BV0 A;  3FEX A;  2L9B A;  1MQS A;  4GCN A;  1E7U A;  2BTD A;  4PS8 A;  4FC8 A;  1HF8 A;  4A3V A;  2LSU A;  4N5C A;  4I9C A;  3P2B A;  3TL5 A;  2VGY A;  5A23 A;  1NA3 A;  4FHK A;  4FLB A;  4QFV A;  5G2N A;  4HOQ A;  4AV7 A;  1Z3Y A;  2UWJ G;  4G24 A;  4KZ0 A;  3LYA A;  5CHE E;  2FF4 A;  3LY9 A;  4RG9 A;  3JUI A;  5FTP A;  3RIB A;  4GZD A;  4O6F A;  3D3M A;  4HOU A;  5AEN A;  1OWP A;  1KT0 A;  4IRU A;  3CIA A;  3QAQ A;  4N39 A;  1ELR A;  2WQ6 A;  3LVQ E;  5AIJ A;  5ANR A;  4GA2 A;  3K9I A;  4JVS A;  3CHP A;  4UWF A;  4MRU A;  3FUD A;  4UI9 K;  3ZVV A;  3T5X A;  3PRE A;  4J6I A;  2GW1 A;  4G23 A;  3PZD A;  2PM7 A;  1PY1 A;  3SF4 A;  3CSF A;  4JW1 A;  4MLP A;  3LDZ A;  3LS8 A;  4G11 A;  4JA7 A;  1H2V C;  5C2Y A;  3I4R B;  3PNT B;  3TG4 A;  4GML A;  5FQ8 A;  2A4Z A;  2X6H A;  2P58 C;  3NF1 A;  4XIF A;  1UW4 B;  4MS6 A;  4CCA A;  1DVP A;  2J9Q A;  3U9W A;  3FWV A;  3S7J A;  4WUY A;  1TJC A;  3FTW A;  4XI0 A;  4AVX A;  4CGV A;  3RJV A;  1W3B A;  3TG5 A;  4JHJ A;  4DLO A;  3FUK A;  2GRM A;  4GYY A;  5HQ8 A;  2LSV A;  4WND A;  4BT8 A;  2PZI A;  2CHW A;  4URK A;  3D9L A;  4A55 A;  2I2O A;  5LP0 A;  4FLH A;  3ML8 A;  3IHV A;  2OVF A;  2V8S E;  2HR2 A;  4F3V A;  2GGF A;  2PL2 A;  2AXV A;  4C0E A;  3APC A;  4UI9 J;  3MX3 A;  3CHR A;  1EYH A;  3UUX A;  4AOF A;  2Y3A A;  2R5S A;  4KYO B;  3CVP A;  4Q96 A;  5A7D B;  2CFU A;  3O4Z A;  5FJY A;  3KS2 A;  5JJT A;  3D9P A;  4JEU A;  4EEC A;  4GB9 A;  1HH8 A;  1FVH A;  1QNF A;  4PH4 B;  2XPY A;  3PUJ A;  3FY4 A;  4LEU A;  1MHQ A;  4I1A A;  5DBK A;  3MKQ A;  2X6I A;  4YVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...