3ASDA

Mama r50e mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
137
structure length
137
Chain Sequence
FDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
total genus 53
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asdA00
3ZHEB 2FF4A 5LCWC 2XCBA 4LEUA 1KLXA 4CDRA 5DIZA 1A17A 1ELRA 4N3CA 3CVQA 5EX0A 4O6FA 4WNGA 2BUGA 3QKYA 3ZHEA 2Q7FA 2VGYA 2OOEA 3WXXA 1IYGA 2UWJG 3PE4A 3ASHA 4APOA 2PQNA 1ZBPA 3NF1A 2UY1B 3KS2A 5KJLA 3Q15A 3SZ7A 1KT1A 2YHCA 4CGVA 5KJNA 4WNDA 4U0ZA 4GA0A 4I17A 3GYZA 2FBNA 2C0LA 3PE3A 1WAO1 5KJMA 4GPKA 3EDTB 5HI7A 5LCWJ 1TJCA 3QOUA 4XIFA 3TAXA 1FCHA 2DBAA 4RG6A 4YVOA 5JJ7A 4Y6CA 4JHRA 3MA5A 3HYMB 3TGOA 2LSVA 5JJTA 3ZPJA 2XGMA 2PZIA 3AS4A 4N3BA 3K9IA 3RIBA 4G25A 1W3BA 2WPVA 3CK7A 2HO1A 3LY8A 4EQFA 2P58C 3URZA 4U04A 4JA7A 4J8FA 4XI9A 3KAEA 1XNFA 4N5CA 4AIFA 3AS8A 4AY6A 2VSYA 4J8DA 3GW4A 2ONDA 4GZ6A 2J9QA 4AM9A 4HOSA 3ASFA 3CVLA 5M72A 2PL2A 4BWRA 5D0OD 3CVNA 3TG5A 2KATA 3ZFWA 2LNIA 3OXFA 3Q4AB 4WUYA 4AY5A 3AS5A 3CEQA 5JJ6A 5EKQD 5A7DB 5FZQA 3U3WA 2XGOA 4IN3B 4GCNA 3ASDA 4ABNA 5FTPA 5HQ8A 2Y4TA 4GZ5A 5CCMA 2HYZA 1PC2A 2GW1A 3S7DA 3CV0A 2IF4A 4HOUA 1KT0A 2XCCA 4G2VA 2C2LA 4U0UA 2FI7A 2YQ8A 5BNWA 2Y4UA 3O48A 2UY1A 4HOTA 3LYAA 4I2WA 4N2SA 3VTXA 3S7BA 4G23A 4KXKB 3TG4A 3UPVA 3GZ2A 4BTBA 3SF4A 4UQYA 1ELWA 2R5SA 3MV2B 2JLBA 1HXIA 3LPZA 5G05C 5FZSA 3LY7A 3CKBA 2KC7A 3QWPA 3CK8A 3LCAA 4UQXA 3N71A 4G26A 4JL0A 3VTYA 3S7JA 2VYIA 2LSUA 4GA2A 3Q49B 3ZN3A 2L6JA 3UUXA 1P5QA 4YNDA 2VGXB 4KYOB 3CK9A 5ARGA 1Y8MA 4B94A 1IHGA 1B89A 5D0QD 2VSNA 1E96B 3MEKA 3JYSA 5A6CA 4WNEA 1QQEA 3MKRA 3CVPA 5G05J 2AVPA 5FZRA 3IEGA 2I6HA 3RU0A 4N2QA 3QWVA 4HORA 4GZ3A 3GZ1A 4H7YA 2IFUA 5C1DA 4F3VA 5DBKA 5FT9A 3FP3A 4ME2A 5EX3A 1WM5A 4CGWA 5BW8C 4WNFA 2E2EA 1NZNA 2XEVA 4I9EA 3UQ3A 4J8EA 2KCVA 4RG9A 3RJVA 4I9CA 3U4TA 3QWWA 4H7XA 2WQHA 4UI9C 3RKVA 5AYWD 3E4BA 3FWVA 2MHKA 1NA0A 2HR2A 4NQ0A 1ZU2A 2V5FA 4BT9A 5ARFA 4N39A 4GYWA 5KJKA 4JA9A 4BTAA 3RO3A 3Q47B 3MV3B 4UQZA 3FFLA 4GA1A 4Y6WA 4I2ZA 2KCKA 4YVQC 2C0MA 3PDNA 1QZ2A 2PQRA 4XI0A 3CKCA 5BT1A 4UI9J 3OXLA 2XGSA 4GCOA 2VQ2A 1HZ4A 4A1SA 4U07A 4GYYA 3RO2A 5G04C 2NC9A 4G1TA 4HOQA 4KBQA 2VGXA 4NRHB 2XPIA 1HH8A 4I1AA 5FJYA 3S7FA 2KCLA 3BEEA 4N3AA 3ESKA 2QFCA 5CCLA 1NA3A 3LY9A 2FEZA 4G24A 5CHEE 4UI9K 3Q5MA 4U0SA 3QDNA 3ULQA 3ZGQA 2FO7A 3ASGA 4BT8A 1OUVA 1YA0A 3KD7A 3OXGA 4W9RA 4J0UA 3LKUA 4GYOA 5G04J 3R9AB
chains in the Genus database with same CATH superfamily
2FF4A 4HRMB 4LEUA 5DIZA 5ENTD 1XGWA 4BEPA 2GRQB 4LNBA 2MOWA 5A23A 4DX2A 4EECA 4GTPA 3FU6A 3CVYA 1JCRA 2UY1B 3PS6A 4GMLA 4EBAG 1Q2ZA 3L22A 4OVUA 2XZDG 3SZ7A 1G3NB 1KT1A 4LSZE 4CGVA 3FTUA 3PEVB 4WNDA 4U63A 3B13A 5ITZF 4EHMA 4I17A 3X2QE 4JW1A 3PE3A 4A3VA 1WAO1 2PNNA 1E8WA 5J90A 1UN8A 3F6QA 4QQIA 2IJGX 1SA4A 3BQOA 5KNHD 1BI8B 1QNFA 3HXCA 3CVXA 2BKGA 1MX6A 4I1OB 2EINE 5JJ7A 3MA5A 2IO2C 3DWLG 2WXLA 2LSVA 3ZVVA 3K9IA 3RIBA 2P9KG 3SQVA 2FULA 3CK7A 1TNBA 4OVVA 3R7RA 5LX8A 1A5EA 3LY8A 3ZYMA 2P58C 4XI9A 1H19A 3ZIMA 1VDYA 4I6GA 1XNFA 4N5CA 5BXOA 3D9MA 2F8XK 2ONDA 3NB2A 3UXGA 4HOSA 2B0OE 1X5BA 4IULA 2XENA 4KVOA 4X8QA 3C98A 5ENRD 3DEPA 3HRAA 3SGHA 4TXRA 4GPMA 4GTVA 3CEQA 1FT1A 4OAVB 5FZQA 2XPYA 2H6IA 2LXMA 4ANWA 2CHXA 2HYZA 3IBEA 2J09A 1AWCB 4K0RA 1KT0A 1N4SA 3LVRE 1N0QA 4O1OA 4U0UA 3CVWA 2Y69E 2Y4UA 3O48A 4PS3A 3LYAA 3S7BA 2QYJA 3HXFA 4AOFA 4K5AB 4UWGA 2A4ZA 1HS6A 5CMWA 3SF4A 2JLBA 2BEDA 5FZSA 2WMOA 1E7UA 3CKBA 4UWFA 2P9SG 1N4PA 3QWPA 3NZSA 3LCAA 3G2VA 3AJIA 1S63A 2EQXA 4HFGA 3U66A 1HE8A 3Q7FA 1DCEA 5G55A 2L6JA 1N4QA 2H6GA 1N9AA 2X6KA 3APDA 4AEZC 2R59A 3HXEA 3C5RA 1JUQA 5EIBE 1SVXA 3TL5A 1Z6TA 1OWLA 3LVQE 4BX8A 2VGEA 1K1BA 3MEKA 4C48B 3DSXA 3JYSA 4WNEA 2MYOA 2X38A 4EBAA 3ML9A 5FZRA 2XRZA 3IEGA 4N2QA 4URKA 1NI1A 1K8KG 2XEEA 2L0TB 4OYSA 2HM8A 4GZ3A 5JA4D 5KCMA 5D2MC 2IFUA 2Y1LE 3PZ4A 3FU0A 1OXJA 4F3VA 2IEJA 4CDNA 5HRYA 5EX3A 5G2NA 2OCCE 1D8EA 1N54A 5AJLA 3ULYA 3HG0D 4WWNA 2J8SD 4BY6A 3UQ3A 4HRNA 4RG9A 1D8DA 1O5MA 1H2UA 4JB8P 3MZLB 5BV0A 2R2LA 1UW4B 3JQ1A 4M7CA 3V2XA 1BLXB 1E90A 3FTYA 2OVFA 4C9BB 3PZ2A 1TEZA 4GTQA 3AG1E 2WVIA 2WQ7A 3FY4A 3D9PA 4CT0A 4CZ2D 3ASNE 1FT2A 5T4YA 3CIAA 4JA9A 2R05A 4BTAA 1OWOA 3Q47B 3MV3B 2WXNA 3C3OA 4GA1A 4UWKA 4U95D 1IQUA 4J6IA 3TXNA 3B95A 5IY5E 4UUCA 3CLJA 3E34A 3SFYA 3OXLA 1Z3YA 4GCOA 4U07A 4HI8A 3T8KA 2ETBA 3RO2A 2VGXA 3RRUA 3B7BA 4F53A 2WXJA 3ISMC 3UI2A 3ZXPA 3ZYLA 3I4GA 4R7LA 4WAFA 2I9CA 5CCLA 3V79K 2FEZA 5ENSD 1AP7A 4I6JA 2FO7A 4HVBA 3EHRA 5CERB 3CVVA 3G2TA 3KD7A 4M3OA 4J0UA 3LKUA 3UM1A 3VLFA 1N94A 2X6HA 3ENEA 3ZKJA 3ZHEB 3UTMA 3FUDA 5AENA 4AP2A 1KLXA 4U96D 1K3ZD 1A17A 1ELRA 2RFMA 3PNLB 3CHSA 4WWPA 3SHFA 1OCOE 5EX0A 2RD0A 4N5QA 1H2VC 4WNGA 3QKYA 4GZDA 3DSUA 5C2YA 3CHMA 3FHEA 1IYGA 2AXVA 3MKQB 2LUHA 1KPSB 3JQ0A 2PQNA 1ZBPA 4I6EA 3RRMB 2VTBA 3U64A 3ZNGA 1EYHA 3UT4A 3UKUG 5KJLA 3Q15A 2XS8A 3CSTA 4U0ZA 4LNUD 3EHQA 3UM2A 4LNGA 4GPKA 3EDTB 1HFAA 5HI7A 4ANVA 1YCSB 1RW2A 4GAAA 3FTVA 1HO8A 1S64A 3AG2E 3KEAA 2CHWA 1FCHA 2QZAA 3FU3A 4RG6A 3CVUA 4CEMA 3P1UA 4IRUA 4NACA 3KEZA 3ONKA 4JVSA 3ZPJA 2PZIA 3AS4A 3FUEA 4K5CA 1E8ZA 2WPVA 2ZISA 4ACLA 2BTDA 1JPLA 2ZU6B 3FUNA 2HO1A 1HX8A 5AN8A 2ILRA 4DLOA 3KAEA 5JHAA 4FHKA 2IOLA 5HS0A 4WWOA 1BPOA 3AS8A 4TV3A 4AXHA 2VSYA 4DRXE 1H6PA 3GW4A 1O1RA 2AXUA 1SZAA 4AM9A 3ASFA 1U3CA 5M72A 5D0OD 3CVNA 2KATA 5T3RA 2CFUA 1H0AA 4BETA 4AY5A 3UKRG 3AS5A 3QK0A 3UM3A 4EZLA 4MRUA 4LRZA 2WXKA 5A7DB 5EN5D 3U3WA 4GCNA 3EJNA 4ABNA 5FTPA 5EYPF 2Y0BG 2V0PA 3QARA 5AARA 3S7DA 2IF4A 1MYOA 3ABLE 2XCCA 4KZ0A 2YINA 3V30A 3FH8A 4EPZA 2L0IA 3JUEA 3U9WA 2YQ8A 3HVEB 1JWGA 4HOTA 2BKKB 3VTXA 3D3MA 4U8VD 1NFIE 3UPVA 4B8CB 4BTBA 3APFA 3LJ3A 4ILHB 3AAAC 1ELWA 3MV2B 4UQYA 3FUFA 1K1AA 3UINC 1JWFA 3I3NA 4BFRA 2EIJE 1Z3XA 2OEWA 5CBOA 3J5PA 2OEVA 4GA2A 5CMYA 2DZOA 4JXTA 2F8YA 1P5QA 4L2YA 5KNGA 5EIDA 3PZDA 3DPYA 4K03A 2P9PG 3E33A 3G2SA 1O1TA 2OV8A 4DX5D 3ONLA 2Y3AA 3B7TA 3ABME 3G2UA 2IQCA 3RAUA 4GTTA 3RU0A 4J8YA 3QWVA 2I1KA 2KBXA 4HI9A 3EUVA 3TWQA 1BU9A 3SFXA 5C1DA 3JXJA 3B7UX 3D9HA 4C0MA 4JPSA 4O1PA 3FH5A 5FT9A 3FP3A 3QAQA 1WM5A 4L9PA 1TNYA 3SBTB 2WXMA 3V31A 2XQ0A 1DC2A 3E37A 2DIWA 4GMRA 1NZNA 3VLDA 3CGHA 2XEVA 4J8EA 2H6HA 1D9SA 2H6FA 1EDUA 4ANUA 3SBSA 1U2VG 3W9GA 2XPZA 3U4TA 2NYJA 2WQ6A 4H7XA 4GTRA 4BX9A 3EU5A 3JXIA 4UI9C 2LAIA 3DSWA 5LP0A 1NA0A 2HR2A 2VSOE 4FLBA 2V5FA 3OTNA 4BT9A 4RLYA 4N39A 2QY7A 3APCA 1TNUA 4I43A 4HBDA 4A1GA 5B1AE 1YYHA 3DRAA 4U7EB 2KCKA 3AU4A 4FADA 2V4LA 2YHEA 4UI9J 4FJYA 4YDEA 2ETAA 3DSTA 3UM0A 2WB2A 4RSYA 1TJFA 4DX7D 4LCTA 5FINA 4GYYA 5G04C 2NC9A 3O4ZA 5ENPD 2R03A 3CHOA 3Q7AA 2E0IA 2XPIA 4DUIA 2KZTA 2J4BA 2YNQA 1HH8A 3KSQA 5FJYA 3PVLA 4N3AA 1EPUA 2QFCA 1UG3A 2J4DA 2NXPA 5CHEE 1FVFA 3CR3A 2EILE 3ULQA 2F0YA 3MX3A 4BT8A 3R7QA 1YA0A 4KMOA 4Q96A 3PZ3A 4G8KA 4GYOA 4DLQA 5G04J 3R9AB 3DEOA 2KXPC 3CHPA 2AXZA 3QB2A 3TWVA 4LG6A 2GRNB 5LCWC 2XCBA 4V3IA 4MKTA 2XS1A 3Q75A 4O6FA 3MCXA 3ZHEA 2Q7FA 3DXMG 1EF1C 5T8IA 2V5QC 3ASHA 4APOA 4BSZB 1UJKA 1E8YA 5CBNA 3L17A 3TWSA 2YHCA 2WXGA 5KJNA 3D9IA 4FP7A 1H6OA 3QC1A 4GA0A 3TJPA 3Q9NC 3KSLA 2FBNA 5KJMA 3BU8A 5LCWJ 3L6AA 3SFZA 2WXRA 2LO6A 5ANLA 4JHKA 1TJCA 3HIZA 3L16A 3QOUA 5KWDA 2J49A 3R9MA 1HU3A 4TRQA 1QYMA 4G11A 1GW6A 2DBAA 4YVOA 3FUIA 2GGFA 3D9KA 1S70B 1JCSA 4Y6CA 3TWUA 4JHRA 2VJ8A 5LFAA 3HYMB 2XGMA 4N3BA 2AJAA 4G25A 4B0ZA 2WMNA 3MYVA 1UOHA 2PM6A 4EQFA 1N95A 3ZXSA 2V8SE 3URZA 4U04A 4JA7A 1E7VA 1OWPA 4AY6A 2DCPA 1ZB1A 1TNZA 3LXUX 4J8DA 3V2OA 3MJWA 2X6IA 2JEKA 3FTWA 4GTOA 4XE0A 3FDHA 4FJZA 4GZ6A 2J9QA 1SQMA 1Y6IA 3CVLA 4CYMD 3CQGB 3T9KA 2ETCA 3ZFWA 2LNIA 4JEUA 3OXFA 3Q4AB 4Z68A 4WUYA 4I1MA 3CQCB 4FHJA 1N11A 2A5EA 2R02A 2OVBA 5JJ6A 4HNAD 5EKQD 3TWRA 4CRWA 1N52A 4NURA 2XGOA 2IOSA 1FPPA 4GZ5A 3RRNB 2MRIA 4O60A 1FVHA 3PUKA 2GRLA 3ABKE 4TXQA 5FQ8A 4F6RD 2WXQA 2A5UA 1IHBA 3L13A 1WY6A 4LUNU 3LJNA 1YMPA 2UY1A 1MJ0A 4B8AA 4I2WA 4N2SA 2M63A 4MBGA 4GU5A 4GZCA 3LEWA 4AV7A 3IXEA 3GZ2A 2RFAA 2R5SA 1HXIA 3LPZA 4CT4A 5G05C 2FO1E 5E75A 4DPRA 3NOGD 3S2AA 1LD8A 2KC7A 3BG0B 4JD2G 3UT7A 4UQXA 4HLEA 4G8LA 5D66A 3VTYA 2LSUA 3I4RB 4HXIA 3ZN3A 5FQ7A 2VGXB 4KYOB 3CK9A 3SY2A 1Y8MA 3NOCD 1MX4A 4GMJA 1IHGA 1U3DA 1B89A 4HB5A 4PDXA 5D0QD 4IYPA 4JHJA 2VSNA 1V54E 3C3QA 1MX2A 1MQSA 2JABA 3CVPA 4RQIA 5G05J 1L5JA 5ENOD 1UJJA 2DWZA 2GROB 4HORA 1TN8A 3GZ1A 3CHRA 3L9TA 1OCCE 3ZU7B 4FU3A 1SW6A 5DBKA 1NL4A 4KT6B 4ME2A 3HDXA 5AQ7A 4EZKA 4E85A 4UWHA 4E6HA 4CGWA 5BW8C 1NP7A 1H6KA 2E2EA 4B93B 5CECB 3J5QB 4F1SA 3ZW3A 3Q78A 4I9CA 1OWNA 4YDOA 3QWWA 3BG1B 2QC9A 2DYSE 2J07A 4Q69A 2VTBB 3RKVA 5AYWD 5AQBA 3G2WA 2EIKE 2IU1A 2J08A 4A63B 2XZTG 4NQ0A 3TXMA 2CG3A 4ZHBA 1BI7B 4GYWA 1IXVA 3B7SA 3DBSA 4HLLA 3DSVA 3RO3A 4KZCA 4UQZA 3FH7A 4MLPA 3TWWA 4Y6WA 4I2ZA 1JCQA 3PH0C 1HG5A 4JEHA 4YVQC 3UMVA 3IV0A 5EILA 1QZ2A 2PQRA 3UX4A 3CKCA 5BT1A 2IO3C 4F7AA 3SNXA 3FTXA 4PS7A 2XGSA 2VQ2A 4A1SA 3PZ1A 2WXHA 3PUJA 4G1TA 2P9NG 2I2OA 3W9FA 4U8HA 2GRPB 4APFA 5CRUA 4KBQA 2P9LG 2DZNA 3ESLA 3T8MA 2R17C 1OCZE 3I5PA 3IHVA 1DVPA 3OAWA 4JC8A 5FWQA 1HG2A 2F37A 2KCLA 3ZYQA 3ESKA 2RKKA 1NA3A 3ML8A 4K5BA 4RVBA 4G24A 1UN9A 4AJWA 3NBNB 3HXBA 2I1JA 4J7WA 3Q5MA 3QDNA 2CFZA 1S0PA 3ASGA 4DJAA 5ANRA 4GTSA 4J8SA 2L6BA 4XZ4A 3NQPA 5JMND 1N0RA 3FEYA 4DK5A 3D9JA 4HRLA 3TWXA 3JUIA 2P9IG 1TYQG 4CDRA 2WXPA 4DI3A 2ZGGA 4N3CA 4CCAA 3CVQA 3AG4E 2BUGA 4F1PA 4C0EA 3TWTA 3Q9UC 2VGYA 4TUMA 2OOEA 2VSXE 1E8XA 5BXUA 3WXXA 3WG7E 2UWJG 3PE4A 3UIPC 3SD5A 2P2CP 3BUAA 3NF1A 3KS2A 3JCKC 2WXFA 2NSZA 4A3TA 2X6FA 3L82A 3GYZA 2C0LA 3E30A 4OAUC 4FA6A 3DSSA 3PREA 1LF8A 1KZOA 3RSEG 1TN7A 3UT8A 5BPPA 2AWIA 4XIFA 3TAXA 2KM4A 2WXIA 2XHEA 2CHZA 5CRVA 1PAQA 2LAHA 5JHBA 2PM7A 4ZFHA 3C3RA 1OCRE 3ZEFA 1MZCA 4KVMA 4FC8A 3TGOA 2P9UG 5AJDA 5JJTA 1DCQA 1OY3D 3QJZA 1W3BA 5B3SE 5AAOA 3FTSA 4GTMA 1QBQA 5B1BE 4J8FA 4CDMA 4AIFA 2EIME 2ZGDA 4TUUA 3SI5A 3RK6A 5EDSA 4EZJA 3IKOB 2PL2A 4BWRA 3TG5A 3ULEG 1RZ4A 1LTXA 2ZIRA 4YDYA 1INZA 2GRRB 4D10C 1KZPA 5EYLA 4ATGA 3B7RL 4JZYA 2DYRE 2WXOA 4IN3B 4DX6D 3ASDA 3EIQC 4ILIA 2X3MA 5HQ8A 2Y4TA 5E76A 5CCMA 1PC2A 2HE0A 5FIOA 2GW1A 2IY0C 4DX1A 3CV0A 2ZXWE 4HOUA 3NAWA 4G2VA 5ENQD 3LDZA 5AIJA 2C2LA 3SO8A 1WG0A 3MKQA 1TN6A 4XEIG 2FI7A 3VLEA 3QNKA 5AQAA 2CG2A 5BNWA 1OT8A 3NZUA 4G23A 1ELKA 4KXKB 3TG4A 1TR4A 3PEUB 3D9OA 3MGBA 5KBAA 3P2BA 2X6JA 4QFVA 1HF8A 3LY7A 5CEDB 4ANXA 1OWMA 3CK8A 3LS8A 3N71A 4G26A 4JL0A 3S7JA 3AU5A 5FQ6A 2VYIA 3ZUVB 3FUMA 4FLHA 3Q49B 3EIJA 3UUXA 4YNDA 1WDYA 5ARGA 4B94A 4U8YD 2KZTB 4BSXA 2V4HC 3DPDA 5CEAA 4DI4A 4PH4B 4FULA 3FUJA 1E96B 5LOZA 4NIKA 5A6CA 4LERA 1QQEA 3MKRA 2AVPA 2I6HA 2QYUA 4HS2A 3FUKA 1Z5SC 2BF0X 3D9LA 4H7YA 4BESA 4A55A 3PRZA 4L1BA 3C72A 2GRMA 3FEXA 3EU9A 4B89A 1TNOA 4ATZD 3FU5A 4WNFA 3FULA 4I9EA 2KCVA 3RJVA 3L54A 5AQ9A 4UWLA 2WM9A 3CSFA 1MHQA 4PUCA 2WQHA 3T5VA 1IKND 3ZRHA 3E4BA 3FWVA 2MHKA 2DVWA 3Q79A 3HHMA 1ZU2A 4L7TA 5ARFA 3D9NA 4HQDA 2L9BA 3E32A 2AW6A 4ILGA 1BD8A 4BERA 1V55E 5KJKA 5FQ4A 3HVEA 3Q73A 4ACKA 4TXPA 5ENNA 3L08A 1PY1A 1DNPA 3FFLA 3FUHA 5BV1A 4AVXA 3UIOC 2C0MA 1O1SA 3PDNA 4XX5A 3AG3E 4GB9A 4L23A 5J08A 4XI0A 3IHYA 3CHQA 4PS8A 4XKCA 2RG8A 4MS6A 5HKPA 4P29A 1H2TC 1HZ4A 1N4RA 3EHMA 3ZYKA 4HOQA 3FTZA 3HXDA 4NRHB 1SZ9A 2B6CA 4I1AA 3S7FA 3BEEA 3DXKG 3PNTB 2LXLA 4Q94A 3LY9A 4L2LA 1X81A 5H7PA 4UI9K 2IONA 3ASOE 4YDWA 5BUZA 2XRYA 3GZSA 4U0SA 3ZGQA 1LD7A 1OUVA 1IQRA 3EHNA 3OXGA 4W9RA 4XKBA 2XEHA 3T5XA 1SA5A
chains in the Genus database with same CATH topology
2X6HA 3ENEA 3QB2A 3FEYA 3ZHEB 4DK5A 2FF4A 3D9JA 3FUDA 3JUIA 5AENA 5LCWC 2XCBA 4AP2A 4LEUA 1KLXA 4CDRA 2WXPA 5DIZA 1A17A 4DI3A 1ELRA 4V3IA 3PNLB 3CHSA 4MKTA 4WWPA 3SHFA 4N3CA 4CCAA 3CVQA 2RD0A 4O6FA 5EX0A 1H2VC 1XGWA 4WNGA 2BUGA 3QKYA 3MCXA 4GZDA 5C2YA 4C0EA 3CHMA 3FHEA 3ZHEA 2Q7FA 2VGYA 2OOEA 2VSXE 1EF1C 1E8XA 5T8IA 3WXXA 1IYGA 2AXVA 2UWJG 2MOWA 3MKQB 3PE4A 5A23A 3ASHA 4APOA 4EECA 3JQ0A 2PQNA 3SD5A 1ZBPA 4I6EA 3RRMB 3FU6A 3CVYA 3NF1A 1UJKA 1E8YA 2UY1B 3PS6A 2VTBA 3U64A 3L17A 4GMLA 1EYHA 3KS2A 4EBAG 3UT4A 3L22A 4OVUA 3Q15A 5KJLA 3SZ7A 1KT1A 3JCKC 2WXFA 2YHCA 2NSZA 2WXGA 3FTUA 3PEVB 4A3TA 4CGVA 5KJNA 4WNDA 3CSTA 3D9IA 4FP7A 4U63A 4U0ZA 2X6FA 3B13A 3QC1A 4GA0A 3TJPA 4I17A 3GYZA 4JW1A 2FBNA 2C0LA 3PE3A 4A3VA 1WAO1 5KJMA 1E8WA 4GPKA 3EDTB 4FA6A 5J90A 1HFAA 5HI7A 4ANVA 1UN8A 2IJGX 5LCWJ 3L6AA 3PREA 3SFZA 2WXRA 1LF8A 2LO6A 5ANLA 4JHKA 4GAAA 3FTVA 1HO8A 1TJCA 3HIZA 3L16A 3UT8A 3QOUA 5BPPA 2AWIA 2J49A 4XIFA 3TAXA 1QNFA 1HU3A 4TRQA 2KM4A 3CVXA 2WXIA 2XHEA 2CHWA 1FCHA 4G11A 1GW6A 2CHZA 1PAQA 2DBAA 3FU3A 4RG6A 4YVOA 4I1OB 3CVUA 3FUIA 2LAHA 4CEMA 5JHBA 2PM7A 2GGFA 3D9KA 3P1UA 4IRUA 5JJ7A 4NACA 4Y6CA 3KEZA 4JHRA 2VJ8A 3MA5A 3ZEFA 5LFAA 3ONKA 4KVMA 4JVSA 3HYMB 4FC8A 3TGOA 2WXLA 2LSVA 5AJDA 5JJTA 3ZVVA 3ZPJA 2XGMA 2PZIA 3AS4A 4N3BA 3K9IA 3FUEA 3QJZA 3RIBA 4G25A 4B0ZA 1W3BA 2WMNA 3MYVA 1E8ZA 2WPVA 2FULA 3CK7A 4OVVA 4ACLA 2PM6A 3FTSA 2BTDA 1JPLA 2ZU6B 3FUNA 3R7RA 5LX8A 2HO1A 1HX8A 3LY8A 4EQFA 2ILRA 3ZXSA 4DLOA 3ZYMA 2V8SE 2P58C 3URZA 4U04A 4JA7A 1E7VA 4J8FA 4XI9A 1H19A 3KAEA 1OWPA 3ZIMA 1VDYA 4I6GA 4CDMA 5JHAA 4FHKA 1XNFA 2IOLA 4WWOA 1BPOA 4N5CA 4AIFA 3AS8A 4TV3A 4AXHA 4AY6A 2DCPA 2VSYA 3LXUX 4J8DA 4TUUA 3MJWA 3D9MA 2X6IA 3SI5A 3GW4A 2JEKA 3FTWA 4XE0A 2ONDA 3FDHA 4FJZA 3RK6A 4GZ6A 2J9QA 1SQMA 5EDSA 1Y6IA 2AXUA 1SZAA 4AM9A 4EZJA 4HOSA 3ASFA 3IKOB 1U3CA 1X5BA 3CVLA 4IULA 4KVOA 2PL2A 3CQGB 4BWRA 3C98A 5M72A 5D0OD 3CVNA 3TG5A 2KATA 3ZFWA 2LNIA 4JEUA 3OXFA 3Q4AB 5T3RA 4WUYA 2CFUA 1H0AA 4I1MA 4AY5A 3AS5A 3SGHA 3CQCB 1INZA 3QK0A 4FHJA 4D10C 4EZLA 2OVBA 3CEQA 5JJ6A 5EKQD 4MRUA 4ATGA 4CRWA 3B7RL 1N52A 4JZYA 4LRZA 2WXKA 5A7DB 5FZQA 4NURA 2XGOA 2WXOA 2XPYA 4IN3B 3U3WA 2IOSA 4GCNA 3ASDA 3EIQC 3EJNA 4ILIA 2X3MA 4ABNA 5FTPA 5HQ8A 2Y4TA 4ANWA 5E76A 2CHXA 2V0PA 3QARA 4GZ5A 3RRNB 2HYZA 5CCMA 1PC2A 2MRIA 1FVHA 2GW1A 3IBEA 3PUKA 3S7DA 2J09A 3CV0A 4K0RA 2GRLA 2IF4A 5FQ8A 4HOUA 2WXQA 1KT0A 2A5UA 2XCCA 4G2VA 3LVRE 4KZ0A 2YINA 3FH8A 3LDZA 3L13A 2C2LA 4U0UA 4EPZA 5AIJA 1WY6A 2L0IA 3MKQA 2FI7A 3U9WA 3CVWA 2YQ8A 4LUNU 3VLEA 3QNKA 5BNWA 2CG2A 2Y4UA 3HVEB 3O48A 4PS3A 1JWGA 2UY1A 4HOTA 3NZUA 3LYAA 4B8AA 4I2WA 4N2SA 3VTXA 2M63A 3D3MA 4G23A 3S7BA 1ELKA 4GU5A 4GZCA 3LEWA 4KXKB 4AV7A 4AOFA 3TG4A 3PEUB 3UPVA 4B8CB 4UWGA 2A4ZA 3GZ2A 4BTBA 3D9OA 3APFA 1HS6A 3MGBA 3LJ3A 4ILHB 3P2BA 3SF4A 1ELWA 2R5SA 3MV2B 2JLBA 4UQYA 5CMWA 1HXIA 3LPZA 4CT4A 5G05C 5E75A 2X6JA 5FZSA 2WMOA 1E7UA 4QFVA 4DPRA 1HF8A 3FUFA 3LY7A 3CKBA 4UWFA 3S2AA 2KC7A 3BG0B 4ANXA 1JWFA 3UT7A 1OWMA 3QWPA 3I3NA 3CK8A 3NZSA 3LCAA 3G2VA 4BFRA 1Z3XA 3LS8A 3N71A 4UQXA 4G26A 4HLEA 4JL0A 4HFGA 2EQXA 3VTYA 3S7JA 3AU5A 3U66A 1HE8A 5FQ6A 2VYIA 2LSUA 3I4RB 4GA2A 5CMYA 3FUMA 4FLHA 4HXIA 3Q49B 4JXTA 3EIJA 3ZN3A 5G55A 2L6JA 3UUXA 1P5QA 4YNDA 5FQ7A 2VGXB 4KYOB 3CK9A 4L2YA 2X6KA 3APDA 5ARGA 1Y8MA 4AEZC 4B94A 3PZDA 2KZTB 4BSXA 4K03A 2R59A 4GMJA 1IHGA 1U3DA 1B89A 3DPDA 3G2SA 4PDXA 1JUQA 4DI4A 5D0QD 3TL5A 4PH4B 4IYPA 4JHJA 1Z6TA 2OV8A 2VSNA 1OWLA 3LVQE 4FULA 4BX8A 3ONLA 2Y3AA 3FUJA 1MQSA 1E96B 3MEKA 5LOZA 3JYSA 5A6CA 4LERA 3B7TA 4WNEA 3G2UA 1QQEA 3MKRA 2X38A 4EBAA 2IQCA 3CVPA 5G05J 2AVPA 3ML9A 1L5JA 5FZRA 2XRZA 3IEGA 2I6HA 3RU0A 4N2QA 1UJJA 4URKA 3QWVA 2I1KA 4HS2A 3FUKA 2L0TB 4OYSA 2HM8A 2BF0X 3D9LA 4HORA 4GZ3A 3GZ1A 3CHRA 5KCMA 4H7YA 2IFUA 5C1DA 3B7UX 3FU0A 4C0MA 4FU3A 4JPSA 4A55A 4F3VA 3FH5A 3PRZA 5DBKA 5FT9A 3FP3A 4KT6B 4L1BA 4CDNA 2GRMA 4ME2A 3HDXA 5EX3A 3FEXA 3QAQA 5G2NA 1WM5A 4EZKA 4E85A 1N54A 5AJLA 3SBTB 2WXMA 4B89A 4UWHA 4E6HA 3FU5A 4CGWA 2XQ0A 5BW8C 1NP7A 4WNFA 2DIWA 1H6KA 4WWNA 2E2EA 1NZNA 3VLDA 3CGHA 4BY6A 3FULA 2XEVA 4I9EA 3UQ3A 4J8EA 2KCVA 4RG9A 3RJVA 3L54A 1EDUA 4ANUA 4UWLA 3SBSA 4F1SA 3ZW3A 2WM9A 4I9CA 1OWNA 2XPZA 3U4TA 3QWWA 1H2UA 3BG1B 3MZLB 5BV0A 2WQ6A 3CSFA 2J07A 1MHQA 4H7XA 4Q69A 4PUCA 2WQHA 4BX9A 1UW4B 3T5VA 4UI9C 2VTBB 2LAIA 3JQ1A 3RKVA 5AYWD 3E4BA 3ZRHA 1E90A 3FWVA 5LP0A 3FTYA 3G2WA 2OVFA 2MHKA 4C9BB 2IU1A 1NA0A 2J08A 2HR2A 1TEZA 2VSOE 4FLBA 3HHMA 1ZU2A 4NQ0A 2V5FA 2WVIA 3OTNA 4L7TA 5ARFA 4BT9A 4N39A 2WQ7A 3TXMA 2QY7A 3APCA 3D9NA 2CG3A 3FY4A 2L9BA 3D9PA 2AW6A 4ILGA 4CT0A 4GYWA 5KJKA 5FQ4A 3HVEA 4I43A 3B7SA 3DBSA 5T4YA 4ACKA 3CIAA 4JA9A 5ENNA 4BTAA 3RO3A 1OWOA 3L08A 3Q47B 3MV3B 4KZCA 4UQZA 3FH7A 4A1GA 4MLPA 1PY1A 2WXNA 1DNPA 3FFLA 3FUHA 5BV1A 4GA1A 4Y6WA 4I2ZA 4UWKA 3PH0C 2KCKA 1HG5A 1IQUA 4JEHA 4J6IA 4YVQC 4AVXA 3TXNA 3UMVA 3IV0A 2C0MA 3AU4A 3PDNA 4XX5A 1QZ2A 2PQRA 4FADA 3UX4A 4GB9A 4L23A 5J08A 4XI0A 3CKCA 3IHYA 5BT1A 3CHQA 3CLJA 4PS8A 4XKCA 2V4LA 2YHEA 2RG8A 4F7AA 4MS6A 4UI9J 3OXLA 4FJYA 3SNXA 3FTXA 4PS7A 2XGSA 1Z3YA 4GCOA 4P29A 2VQ2A 1H2TC 1HZ4A 4A1SA 2WB2A 4RSYA 4U07A 1TJFA 4LCTA 4GYYA 2WXHA 3PUJA 5G04C 2NC9A 3EHMA 4G1TA 3RO2A 3ZYKA 3O4ZA 4HOQA 2I2OA 3FTZA 4U8HA 4APFA 4KBQA 2VGXA 3T8MA 3ESLA 4NRHB 2R17C 3CHOA 2E0IA 3I5PA 1SZ9A 2XPIA 2KZTA 2J4BA 2YNQA 3IHVA 1HH8A 3RRUA 4I1AA 4F53A 2WXJA 1DVPA 3OAWA 4JC8A 5FJYA 3S7FA 3PVLA 5FWQA 1HG2A 3ZYLA 3I4GA 2KCLA 3BEEA 4N3AA 4R7LA 4WAFA 2I9CA 3ZYQA 3ESKA 1EPUA 2QFCA 3PNTB 1UG3A 1NA3A 3ML8A 5CCLA 2J4DA 4Q94A 3LY9A 4L2LA 2NXPA 2FEZA 4RVBA 4G24A 1UN9A 4AJWA 5CHEE 2I1JA 4UI9K 2IONA 5BUZA 3Q5MA 2XRYA 1FVFA 3CR3A 3GZSA 4I6JA 3QDNA 4U0SA 2CFZA 1S0PA 3ULQA 3ZGQA 2FO7A 3ASGA 4DJAA 3MX3A 4BT8A 4HVBA 5ANRA 1OUVA 3CVVA 3R7QA 1YA0A 3G2TA 3KD7A 1IQRA 4J8SA 3EHNA 4M3OA 4KMOA 3OXGA 4W9RA 4J0UA 3LKUA 4Q96A 3NQPA 4GYOA 4XZ4A 4DLQA 5G04J 4XKBA 3R9AB 3T5XA 3VLFA 3CHPA 2AXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZHE B;  2FF4 A;  5LCW C;  2XCB A;  4LEU A;  1KLX A;  4CDR A;  5DIZ A;  1A17 A;  1ELR A;  4N3C A;  3CVQ A;  5EX0 A;  4O6F A;  4WNG A;  2BUG A;  3QKY A;  3ZHE A;  2Q7F A;  2VGY A;  2OOE A;  3WXX A;  1IYG A;  2UWJ G;  3PE4 A;  3ASH A;  4APO A;  2PQN A;  1ZBP A;  3NF1 A;  2UY1 B;  3KS2 A;  5KJL A;  3Q15 A;  3SZ7 A;  1KT1 A;  2YHC A;  4CGV A;  5KJN A;  4WND A;  4U0Z A;  4GA0 A;  4I17 A;  3GYZ A;  2FBN A;  2C0L A;  3PE3 A;  1WAO 1;  5KJM A;  4GPK A;  3EDT B;  5HI7 A;  5LCW J;  1TJC A;  3QOU A;  4XIF A;  3TAX A;  1FCH A;  2DBA A;  4RG6 A;  4YVO A;  5JJ7 A;  4Y6C A;  4JHR A;  3MA5 A;  3HYM B;  3TGO A;  2LSV A;  5JJT A;  3ZPJ A;  2XGM A;  2PZI A;  3AS4 A;  4N3B A;  3K9I A;  3RIB A;  4G25 A;  1W3B A;  2WPV A;  3CK7 A;  2HO1 A;  3LY8 A;  4EQF A;  2P58 C;  3URZ A;  4U04 A;  4JA7 A;  4J8F A;  4XI9 A;  3KAE A;  1XNF A;  4N5C A;  4AIF A;  3AS8 A;  4AY6 A;  2VSY A;  4J8D A;  3GW4 A;  2OND A;  4GZ6 A;  2J9Q A;  4AM9 A;  4HOS A;  3ASF A;  3CVL A;  5M72 A;  2PL2 A;  4BWR A;  5D0O D;  3CVN A;  3TG5 A;  2KAT A;  3ZFW A;  2LNI A;  3OXF A;  3Q4A B;  4WUY A;  4AY5 A;  3AS5 A;  3CEQ A;  5JJ6 A;  5EKQ D;  5A7D B;  5FZQ A;  3U3W A;  2XGO A;  4IN3 B;  4GCN A;  3ASD A;  4ABN A;  5FTP A;  5HQ8 A;  2Y4T A;  4GZ5 A;  5CCM A;  2HYZ A;  1PC2 A;  2GW1 A;  3S7D A;  3CV0 A;  2IF4 A;  4HOU A;  1KT0 A;  2XCC A;  4G2V A;  2C2L A;  4U0U A;  2FI7 A;  2YQ8 A;  5BNW A;  2Y4U A;  3O48 A;  2UY1 A;  4HOT A;  3LYA A;  4I2W A;  4N2S A;  3VTX A;  3S7B A;  4G23 A;  4KXK B;  3TG4 A;  3UPV A;  3GZ2 A;  4BTB A;  3SF4 A;  4UQY A;  1ELW A;  2R5S A;  3MV2 B;  2JLB A;  1HXI A;  3LPZ A;  5G05 C;  5FZS A;  3LY7 A;  3CKB A;  2KC7 A;  3QWP A;  3CK8 A;  3LCA A;  4UQX A;  3N71 A;  4G26 A;  4JL0 A;  3VTY A;  3S7J A;  2VYI A;  2LSU A;  4GA2 A;  3Q49 B;  3ZN3 A;  2L6J A;  3UUX A;  1P5Q A;  4YND A;  2VGX B;  4KYO B;  3CK9 A;  5ARG A;  1Y8M A;  4B94 A;  1IHG A;  1B89 A;  5D0Q D;  2VSN A;  1E96 B;  3MEK A;  3JYS A;  5A6C A;  4WNE A;  1QQE A;  3MKR A;  3CVP A;  5G05 J;  2AVP A;  5FZR A;  3IEG A;  2I6H A;  3RU0 A;  4N2Q A;  3QWV A;  4HOR A;  4GZ3 A;  3GZ1 A;  4H7Y A;  2IFU A;  5C1D A;  4F3V A;  5DBK A;  5FT9 A;  3FP3 A;  4ME2 A;  5EX3 A;  1WM5 A;  4CGW A;  5BW8 C;  4WNF A;  2E2E A;  1NZN A;  2XEV A;  4I9E A;  3UQ3 A;  4J8E A;  2KCV A;  4RG9 A;  3RJV A;  4I9C A;  3U4T A;  3QWW A;  4H7X A;  2WQH A;  4UI9 C;  3RKV A;  5AYW D;  3E4B A;  3FWV A;  2MHK A;  1NA0 A;  2HR2 A;  4NQ0 A;  1ZU2 A;  2V5F A;  4BT9 A;  5ARF A;  4N39 A;  4GYW A;  5KJK A;  4JA9 A;  4BTA A;  3RO3 A;  3Q47 B;  3MV3 B;  4UQZ A;  3FFL A;  4GA1 A;  4Y6W A;  4I2Z A;  2KCK A;  4YVQ C;  2C0M A;  3PDN A;  1QZ2 A;  2PQR A;  4XI0 A;  3CKC A;  5BT1 A;  4UI9 J;  3OXL A;  2XGS A;  4GCO A;  2VQ2 A;  1HZ4 A;  4A1S A;  4U07 A;  4GYY A;  3RO2 A;  5G04 C;  2NC9 A;  4G1T A;  4HOQ A;  4KBQ A;  2VGX A;  4NRH B;  2XPI A;  1HH8 A;  4I1A A;  5FJY A;  3S7F A;  2KCL A;  3BEE A;  4N3A A;  3ESK A;  2QFC A;  5CCL A;  1NA3 A;  3LY9 A;  2FEZ A;  4G24 A;  5CHE E;  4UI9 K;  3Q5M A;  4U0S A;  3QDN A;  3ULQ A;  3ZGQ A;  2FO7 A;  3ASG A;  4BT8 A;  1OUV A;  1YA0 A;  3KD7 A;  3OXG A;  4W9R A;  4J0U A;  3LKU A;  4GYO A;  5G04 J;  3R9A B; 
#chains in the Genus database with same CATH topology
 2FF4 A;  4HRM B;  4LEU A;  5DIZ A;  5ENT D;  1XGW A;  4BEP A;  2GRQ B;  4LNB A;  2MOW A;  5A23 A;  4DX2 A;  4EEC A;  4GTP A;  3FU6 A;  3CVY A;  1JCR A;  2UY1 B;  3PS6 A;  4GML A;  4EBA G;  1Q2Z A;  3L22 A;  4OVU A;  2XZD G;  3SZ7 A;  1G3N B;  1KT1 A;  4LSZ E;  4CGV A;  3FTU A;  3PEV B;  4WND A;  4U63 A;  3B13 A;  5ITZ F;  4EHM A;  4I17 A;  3X2Q E;  4JW1 A;  3PE3 A;  4A3V A;  1WAO 1;  2PNN A;  1E8W A;  5J90 A;  1UN8 A;  3F6Q A;  4QQI A;  2IJG X;  1SA4 A;  3BQO A;  5KNH D;  1BI8 B;  1QNF A;  3HXC A;  3CVX A;  2BKG A;  1MX6 A;  4I1O B;  2EIN E;  5JJ7 A;  3MA5 A;  2IO2 C;  3DWL G;  2WXL A;  2LSV A;  3ZVV A;  3K9I A;  3RIB A;  2P9K G;  3SQV A;  2FUL A;  3CK7 A;  1TNB A;  4OVV A;  3R7R A;  5LX8 A;  1A5E A;  3LY8 A;  3ZYM A;  2P58 C;  4XI9 A;  1H19 A;  3ZIM A;  1VDY A;  4I6G A;  1XNF A;  4N5C A;  5BXO A;  3D9M A;  2F8X K;  2OND A;  3NB2 A;  3UXG A;  4HOS A;  2B0O E;  1X5B A;  4IUL A;  2XEN A;  4KVO A;  4X8Q A;  3C98 A;  5ENR D;  3DEP A;  3HRA A;  3SGH A;  4TXR A;  4GPM A;  4GTV A;  3CEQ A;  1FT1 A;  4OAV B;  5FZQ A;  2XPY A;  2H6I A;  2LXM A;  4ANW A;  2CHX A;  2HYZ A;  3IBE A;  2J09 A;  1AWC B;  4K0R A;  1KT0 A;  1N4S A;  3LVR E;  1N0Q A;  4O1O A;  4U0U A;  3CVW A;  2Y69 E;  2Y4U A;  3O48 A;  4PS3 A;  3LYA A;  3S7B A;  2QYJ A;  3HXF A;  4AOF A;  4K5A B;  4UWG A;  2A4Z A;  1HS6 A;  5CMW A;  3SF4 A;  2JLB A;  2BED A;  5FZS A;  2WMO A;  1E7U A;  3CKB A;  4UWF A;  2P9S G;  1N4P A;  3QWP A;  3NZS A;  3LCA A;  3G2V A;  3AJI A;  1S63 A;  2EQX A;  4HFG A;  3U66 A;  1HE8 A;  3Q7F A;  1DCE A;  5G55 A;  2L6J A;  1N4Q A;  2H6G A;  1N9A A;  2X6K A;  3APD A;  4AEZ C;  2R59 A;  3HXE A;  3C5R A;  1JUQ A;  5EIB E;  1SVX A;  3TL5 A;  1Z6T A;  1OWL A;  3LVQ E;  4BX8 A;  2VGE A;  1K1B A;  3MEK A;  4C48 B;  3DSX A;  3JYS A;  4WNE A;  2MYO A;  2X38 A;  4EBA A;  3ML9 A;  5FZR A;  2XRZ A;  3IEG A;  4N2Q A;  4URK A;  1NI1 A;  1K8K G;  2XEE A;  2L0T B;  4OYS A;  2HM8 A;  4GZ3 A;  5JA4 D;  5KCM A;  5D2M C;  2IFU A;  2Y1L E;  3PZ4 A;  3FU0 A;  1OXJ A;  4F3V A;  2IEJ A;  4CDN A;  5HRY A;  5EX3 A;  5G2N A;  2OCC E;  1D8E A;  1N54 A;  5AJL A;  3ULY A;  3HG0 D;  4WWN A;  2J8S D;  4BY6 A;  3UQ3 A;  4HRN A;  4RG9 A;  1D8D A;  1O5M A;  1H2U A;  4JB8 P;  3MZL B;  5BV0 A;  2R2L A;  1UW4 B;  3JQ1 A;  4M7C A;  3V2X A;  1BLX B;  1E90 A;  3FTY A;  2OVF A;  4C9B B;  3PZ2 A;  1TEZ A;  4GTQ A;  3AG1 E;  2WVI A;  2WQ7 A;  3FY4 A;  3D9P A;  4CT0 A;  4CZ2 D;  3ASN E;  1FT2 A;  5T4Y A;  3CIA A;  4JA9 A;  2R05 A;  4BTA A;  1OWO A;  3Q47 B;  3MV3 B;  2WXN A;  3C3O A;  4GA1 A;  4UWK A;  4U95 D;  1IQU A;  4J6I A;  3TXN A;  3B95 A;  5IY5 E;  4UUC A;  3CLJ A;  3E34 A;  3SFY A;  3OXL A;  1Z3Y A;  4GCO A;  4U07 A;  4HI8 A;  3T8K A;  2ETB A;  3RO2 A;  2VGX A;  3RRU A;  3B7B A;  4F53 A;  2WXJ A;  3ISM C;  3UI2 A;  3ZXP A;  3ZYL A;  3I4G A;  4R7L A;  4WAF A;  2I9C A;  5CCL A;  3V79 K;  2FEZ A;  5ENS D;  1AP7 A;  4I6J A;  2FO7 A;  4HVB A;  3EHR A;  5CER B;  3CVV A;  3G2T A;  3KD7 A;  4M3O A;  4J0U A;  3LKU A;  3UM1 A;  3VLF A;  1N94 A;  2X6H A;  3ENE A;  3ZKJ A;  3ZHE B;  3UTM A;  3FUD A;  5AEN A;  4AP2 A;  1KLX A;  4U96 D;  1K3Z D;  1A17 A;  1ELR A;  2RFM A;  3PNL B;  3CHS A;  4WWP A;  3SHF A;  1OCO E;  5EX0 A;  2RD0 A;  4N5Q A;  1H2V C;  4WNG A;  3QKY A;  4GZD A;  3DSU A;  5C2Y A;  3CHM A;  3FHE A;  1IYG A;  2AXV A;  3MKQ B;  2LUH A;  1KPS B;  3JQ0 A;  2PQN A;  1ZBP A;  4I6E A;  3RRM B;  2VTB A;  3U64 A;  3ZNG A;  1EYH A;  3UT4 A;  3UKU G;  5KJL A;  3Q15 A;  2XS8 A;  3CST A;  4U0Z A;  4LNU D;  3EHQ A;  3UM2 A;  4LNG A;  4GPK A;  3EDT B;  1HFA A;  5HI7 A;  4ANV A;  1YCS B;  1RW2 A;  4GAA A;  3FTV A;  1HO8 A;  1S64 A;  3AG2 E;  3KEA A;  2CHW A;  1FCH A;  2QZA A;  3FU3 A;  4RG6 A;  3CVU A;  4CEM A;  3P1U A;  4IRU A;  4NAC A;  3KEZ A;  3ONK A;  4JVS A;  3ZPJ A;  2PZI A;  3AS4 A;  3FUE A;  4K5C A;  1E8Z A;  2WPV A;  2ZIS A;  4ACL A;  2BTD A;  1JPL A;  2ZU6 B;  3FUN A;  2HO1 A;  1HX8 A;  5AN8 A;  2ILR A;  4DLO A;  3KAE A;  5JHA A;  4FHK A;  2IOL A;  5HS0 A;  4WWO A;  1BPO A;  3AS8 A;  4TV3 A;  4AXH A;  2VSY A;  4DRX E;  1H6P A;  3GW4 A;  1O1R A;  2AXU A;  1SZA A;  4AM9 A;  3ASF A;  1U3C A;  5M72 A;  5D0O D;  3CVN A;  2KAT A;  5T3R A;  2CFU A;  1H0A A;  4BET A;  4AY5 A;  3UKR G;  3AS5 A;  3QK0 A;  3UM3 A;  4EZL A;  4MRU A;  4LRZ A;  2WXK A;  5A7D B;  5EN5 D;  3U3W A;  4GCN A;  3EJN A;  4ABN A;  5FTP A;  5EYP F;  2Y0B G;  2V0P A;  3QAR A;  5AAR A;  3S7D A;  2IF4 A;  1MYO A;  3ABL E;  2XCC A;  4KZ0 A;  2YIN A;  3V30 A;  3FH8 A;  4EPZ A;  2L0I A;  3JUE A;  3U9W A;  2YQ8 A;  3HVE B;  1JWG A;  4HOT A;  2BKK B;  3VTX A;  3D3M A;  4U8V D;  1NFI E;  3UPV A;  4B8C B;  4BTB A;  3APF A;  3LJ3 A;  4ILH B;  3AAA C;  1ELW A;  3MV2 B;  4UQY A;  3FUF A;  1K1A A;  3UIN C;  1JWF A;  3I3N A;  4BFR A;  2EIJ E;  1Z3X A;  2OEW A;  5CBO A;  3J5P A;  2OEV A;  4GA2 A;  5CMY A;  2DZO A;  4JXT A;  2F8Y A;  1P5Q A;  4L2Y A;  5KNG A;  5EID A;  3PZD A;  3DPY A;  4K03 A;  2P9P G;  3E33 A;  3G2S A;  1O1T A;  2OV8 A;  4DX5 D;  3ONL A;  2Y3A A;  3B7T A;  3ABM E;  3G2U A;  2IQC A;  3RAU A;  4GTT A;  3RU0 A;  4J8Y A;  3QWV A;  2I1K A;  2KBX A;  4HI9 A;  3EUV A;  3TWQ A;  1BU9 A;  3SFX A;  5C1D A;  3JXJ A;  3B7U X;  3D9H A;  4C0M A;  4JPS A;  4O1P A;  3FH5 A;  5FT9 A;  3FP3 A;  3QAQ A;  1WM5 A;  4L9P A;  1TNY A;  3SBT B;  2WXM A;  3V31 A;  2XQ0 A;  1DC2 A;  3E37 A;  2DIW A;  4GMR A;  1NZN A;  3VLD A;  3CGH A;  2XEV A;  4J8E A;  2H6H A;  1D9S A;  2H6F A;  1EDU A;  4ANU A;  3SBS A;  1U2V G;  3W9G A;  2XPZ A;  3U4T A;  2NYJ A;  2WQ6 A;  4H7X A;  4GTR A;  4BX9 A;  3EU5 A;  3JXI A;  4UI9 C;  2LAI A;  3DSW A;  5LP0 A;  1NA0 A;  2HR2 A;  2VSO E;  4FLB A;  2V5F A;  3OTN A;  4BT9 A;  4RLY A;  4N39 A;  2QY7 A;  3APC A;  1TNU A;  4I43 A;  4HBD A;  4A1G A;  5B1A E;  1YYH A;  3DRA A;  4U7E B;  2KCK A;  3AU4 A;  4FAD A;  2V4L A;  2YHE A;  4UI9 J;  4FJY A;  4YDE A;  2ETA A;  3DST A;  3UM0 A;  2WB2 A;  4RSY A;  1TJF A;  4DX7 D;  4LCT A;  5FIN A;  4GYY A;  5G04 C;  2NC9 A;  3O4Z A;  5ENP D;  2R03 A;  3CHO A;  3Q7A A;  2E0I A;  2XPI A;  4DUI A;  2KZT A;  2J4B A;  2YNQ A;  1HH8 A;  3KSQ A;  5FJY A;  3PVL A;  4N3A A;  1EPU A;  2QFC A;  1UG3 A;  2J4D A;  2NXP A;  5CHE E;  1FVF A;  3CR3 A;  2EIL E;  3ULQ A;  2F0Y A;  3MX3 A;  4BT8 A;  3R7Q A;  1YA0 A;  4KMO A;  4Q96 A;  3PZ3 A;  4G8K A;  4GYO A;  4DLQ A;  5G04 J;  3R9A B;  3DEO A;  2KXP C;  3CHP A;  2AXZ A;  3QB2 A;  3TWV A;  4LG6 A;  2GRN B;  5LCW C;  2XCB A;  4V3I A;  4MKT A;  2XS1 A;  3Q75 A;  4O6F A;  3MCX A;  3ZHE A;  2Q7F A;  3DXM G;  1EF1 C;  5T8I A;  2V5Q C;  3ASH A;  4APO A;  4BSZ B;  1UJK A;  1E8Y A;  5CBN A;  3L17 A;  3TWS A;  2YHC A;  2WXG A;  5KJN A;  3D9I A;  4FP7 A;  1H6O A;  3QC1 A;  4GA0 A;  3TJP A;  3Q9N C;  3KSL A;  2FBN A;  5KJM A;  3BU8 A;  5LCW J;  3L6A A;  3SFZ A;  2WXR A;  2LO6 A;  5ANL A;  4JHK A;  1TJC A;  3HIZ A;  3L16 A;  3QOU A;  5KWD A;  2J49 A;  3R9M A;  1HU3 A;  4TRQ A;  1QYM A;  4G11 A;  1GW6 A;  2DBA A;  4YVO A;  3FUI A;  2GGF A;  3D9K A;  1S70 B;  1JCS A;  4Y6C A;  3TWU A;  4JHR A;  2VJ8 A;  5LFA A;  3HYM B;  2XGM A;  4N3B A;  2AJA A;  4G25 A;  4B0Z A;  2WMN A;  3MYV A;  1UOH A;  2PM6 A;  4EQF A;  1N95 A;  3ZXS A;  2V8S E;  3URZ A;  4U04 A;  4JA7 A;  1E7V A;  1OWP A;  4AY6 A;  2DCP A;  1ZB1 A;  1TNZ A;  3LXU X;  4J8D A;  3V2O A;  3MJW A;  2X6I A;  2JEK A;  3FTW A;  4GTO A;  4XE0 A;  3FDH A;  4FJZ A;  4GZ6 A;  2J9Q A;  1SQM A;  1Y6I A;  3CVL A;  4CYM D;  3CQG B;  3T9K A;  2ETC A;  3ZFW A;  2LNI A;  4JEU A;  3OXF A;  3Q4A B;  4Z68 A;  4WUY A;  4I1M A;  3CQC B;  4FHJ A;  1N11 A;  2A5E A;  2R02 A;  2OVB A;  5JJ6 A;  4HNA D;  5EKQ D;  3TWR A;  4CRW A;  1N52 A;  4NUR A;  2XGO A;  2IOS A;  1FPP A;  4GZ5 A;  3RRN B;  2MRI A;  4O60 A;  1FVH A;  3PUK A;  2GRL A;  3ABK E;  4TXQ A;  5FQ8 A;  4F6R D;  2WXQ A;  2A5U A;  1IHB A;  3L13 A;  1WY6 A;  4LUN U;  3LJN A;  1YMP A;  2UY1 A;  1MJ0 A;  4B8A A;  4I2W A;  4N2S A;  2M63 A;  4MBG A;  4GU5 A;  4GZC A;  3LEW A;  4AV7 A;  3IXE A;  3GZ2 A;  2RFA A;  2R5S A;  1HXI A;  3LPZ A;  4CT4 A;  5G05 C;  2FO1 E;  5E75 A;  4DPR A;  3NOG D;  3S2A A;  1LD8 A;  2KC7 A;  3BG0 B;  4JD2 G;  3UT7 A;  4UQX A;  4HLE A;  4G8L A;  5D66 A;  3VTY A;  2LSU A;  3I4R B;  4HXI A;  3ZN3 A;  5FQ7 A;  2VGX B;  4KYO B;  3CK9 A;  3SY2 A;  1Y8M A;  3NOC D;  1MX4 A;  4GMJ A;  1IHG A;  1U3D A;  1B89 A;  4HB5 A;  4PDX A;  5D0Q D;  4IYP A;  4JHJ A;  2VSN A;  1V54 E;  3C3Q A;  1MX2 A;  1MQS A;  2JAB A;  3CVP A;  4RQI A;  5G05 J;  1L5J A;  5ENO D;  1UJJ A;  2DWZ A;  2GRO B;  4HOR A;  1TN8 A;  3GZ1 A;  3CHR A;  3L9T A;  1OCC E;  3ZU7 B;  4FU3 A;  1SW6 A;  5DBK A;  1NL4 A;  4KT6 B;  4ME2 A;  3HDX A;  5AQ7 A;  4EZK A;  4E85 A;  4UWH A;  4E6H A;  4CGW A;  5BW8 C;  1NP7 A;  1H6K A;  2E2E A;  4B93 B;  5CEC B;  3J5Q B;  4F1S A;  3ZW3 A;  3Q78 A;  4I9C A;  1OWN A;  4YDO A;  3QWW A;  3BG1 B;  2QC9 A;  2DYS E;  2J07 A;  4Q69 A;  2VTB B;  3RKV A;  5AYW D;  5AQB A;  3G2W A;  2EIK E;  2IU1 A;  2J08 A;  4A63 B;  2XZT G;  4NQ0 A;  3TXM A;  2CG3 A;  4ZHB A;  1BI7 B;  4GYW A;  1IXV A;  3B7S A;  3DBS A;  4HLL A;  3DSV A;  3RO3 A;  4KZC A;  4UQZ A;  3FH7 A;  4MLP A;  3TWW A;  4Y6W A;  4I2Z A;  1JCQ A;  3PH0 C;  1HG5 A;  4JEH A;  4YVQ C;  3UMV A;  3IV0 A;  5EIL A;  1QZ2 A;  2PQR A;  3UX4 A;  3CKC A;  5BT1 A;  2IO3 C;  4F7A A;  3SNX A;  3FTX A;  4PS7 A;  2XGS A;  2VQ2 A;  4A1S A;  3PZ1 A;  2WXH A;  3PUJ A;  4G1T A;  2P9N G;  2I2O A;  3W9F A;  4U8H A;  2GRP B;  4APF A;  5CRU A;  4KBQ A;  2P9L G;  2DZN A;  3ESL A;  3T8M A;  2R17 C;  1OCZ E;  3I5P A;  3IHV A;  1DVP A;  3OAW A;  4JC8 A;  5FWQ A;  1HG2 A;  2F37 A;  2KCL A;  3ZYQ A;  3ESK A;  2RKK A;  1NA3 A;  3ML8 A;  4K5B A;  4RVB A;  4G24 A;  1UN9 A;  4AJW A;  3NBN B;  3HXB A;  2I1J A;  4J7W A;  3Q5M A;  3QDN A;  2CFZ A;  1S0P A;  3ASG A;  4DJA A;  5ANR A;  4GTS A;  4J8S A;  2L6B A;  4XZ4 A;  3NQP A;  5JMN D;  1N0R A;  3FEY A;  4DK5 A;  3D9J A;  4HRL A;  3TWX A;  3JUI A;  2P9I G;  1TYQ G;  4CDR A;  2WXP A;  4DI3 A;  2ZGG A;  4N3C A;  4CCA A;  3CVQ A;  3AG4 E;  2BUG A;  4F1P A;  4C0E A;  3TWT A;  3Q9U C;  2VGY A;  4TUM A;  2OOE A;  2VSX E;  1E8X A;  5BXU A;  3WXX A;  3WG7 E;  2UWJ G;  3PE4 A;  3UIP C;  3SD5 A;  2P2C P;  3BUA A;  3NF1 A;  3KS2 A;  3JCK C;  2WXF A;  2NSZ A;  4A3T A;  2X6F A;  3L82 A;  3GYZ A;  2C0L A;  3E30 A;  4OAU C;  4FA6 A;  3DSS A;  3PRE A;  1LF8 A;  1KZO A;  3RSE G;  1TN7 A;  3UT8 A;  5BPP A;  2AWI A;  4XIF A;  3TAX A;  2KM4 A;  2WXI A;  2XHE A;  2CHZ A;  5CRV A;  1PAQ A;  2LAH A;  5JHB A;  2PM7 A;  4ZFH A;  3C3R A;  1OCR E;  3ZEF A;  1MZC A;  4KVM A;  4FC8 A;  3TGO A;  2P9U G;  5AJD A;  5JJT A;  1DCQ A;  1OY3 D;  3QJZ A;  1W3B A;  5B3S E;  5AAO A;  3FTS A;  4GTM A;  1QBQ A;  5B1B E;  4J8F A;  4CDM A;  4AIF A;  2EIM E;  2ZGD A;  4TUU A;  3SI5 A;  3RK6 A;  5EDS A;  4EZJ A;  3IKO B;  2PL2 A;  4BWR A;  3TG5 A;  3ULE G;  1RZ4 A;  1LTX A;  2ZIR A;  4YDY A;  1INZ A;  2GRR B;  4D10 C;  1KZP A;  5EYL A;  4ATG A;  3B7R L;  4JZY A;  2DYR E;  2WXO A;  4IN3 B;  4DX6 D;  3ASD A;  3EIQ C;  4ILI A;  2X3M A;  5HQ8 A;  2Y4T A;  5E76 A;  5CCM A;  1PC2 A;  2HE0 A;  5FIO A;  2GW1 A;  2IY0 C;  4DX1 A;  3CV0 A;  2ZXW E;  4HOU A;  3NAW A;  4G2V A;  5ENQ D;  3LDZ A;  5AIJ A;  2C2L A;  3SO8 A;  1WG0 A;  3MKQ A;  1TN6 A;  4XEI G;  2FI7 A;  3VLE A;  3QNK A;  5AQA A;  2CG2 A;  5BNW A;  1OT8 A;  3NZU A;  4G23 A;  1ELK A;  4KXK B;  3TG4 A;  1TR4 A;  3PEU B;  3D9O A;  3MGB A;  5KBA A;  3P2B A;  2X6J A;  4QFV A;  1HF8 A;  3LY7 A;  5CED B;  4ANX A;  1OWM A;  3CK8 A;  3LS8 A;  3N71 A;  4G26 A;  4JL0 A;  3S7J A;  3AU5 A;  5FQ6 A;  2VYI A;  3ZUV B;  3FUM A;  4FLH A;  3Q49 B;  3EIJ A;  3UUX A;  4YND A;  1WDY A;  5ARG A;  4B94 A;  4U8Y D;  2KZT B;  4BSX A;  2V4H C;  3DPD A;  5CEA A;  4DI4 A;  4PH4 B;  4FUL A;  3FUJ A;  1E96 B;  5LOZ A;  4NIK A;  5A6C A;  4LER A;  1QQE A;  3MKR A;  2AVP A;  2I6H A;  2QYU A;  4HS2 A;  3FUK A;  1Z5S C;  2BF0 X;  3D9L A;  4H7Y A;  4BES A;  4A55 A;  3PRZ A;  4L1B A;  3C72 A;  2GRM A;  3FEX A;  3EU9 A;  4B89 A;  1TNO A;  4ATZ D;  3FU5 A;  4WNF A;  3FUL A;  4I9E A;  2KCV A;  3RJV A;  3L54 A;  5AQ9 A;  4UWL A;  2WM9 A;  3CSF A;  1MHQ A;  4PUC A;  2WQH A;  3T5V A;  1IKN D;  3ZRH A;  3E4B A;  3FWV A;  2MHK A;  2DVW A;  3Q79 A;  3HHM A;  1ZU2 A;  4L7T A;  5ARF A;  3D9N A;  4HQD A;  2L9B A;  3E32 A;  2AW6 A;  4ILG A;  1BD8 A;  4BER A;  1V55 E;  5KJK A;  5FQ4 A;  3HVE A;  3Q73 A;  4ACK A;  4TXP A;  5ENN A;  3L08 A;  1PY1 A;  1DNP A;  3FFL A;  3FUH A;  5BV1 A;  4AVX A;  3UIO C;  2C0M A;  1O1S A;  3PDN A;  4XX5 A;  3AG3 E;  4GB9 A;  4L23 A;  5J08 A;  4XI0 A;  3IHY A;  3CHQ A;  4PS8 A;  4XKC A;  2RG8 A;  4MS6 A;  5HKP A;  4P29 A;  1H2T C;  1HZ4 A;  1N4R A;  3EHM A;  3ZYK A;  4HOQ A;  3FTZ A;  3HXD A;  4NRH B;  1SZ9 A;  2B6C A;  4I1A A;  3S7F A;  3BEE A;  3DXK G;  3PNT B;  2LXL A;  4Q94 A;  3LY9 A;  4L2L A;  1X81 A;  5H7P A;  4UI9 K;  2ION A;  3ASO E;  4YDW A;  5BUZ A;  2XRY A;  3GZS A;  4U0S A;  3ZGQ A;  1LD7 A;  1OUV A;  1IQR A;  3EHN A;  3OXG A;  4W9R A;  4XKB A;  2XEH A;  3T5X A;  1SA5 A; 
#chains in the Genus database with same CATH homology
 2X6H A;  3ENE A;  3QB2 A;  3FEY A;  3ZHE B;  4DK5 A;  2FF4 A;  3D9J A;  3FUD A;  3JUI A;  5AEN A;  5LCW C;  2XCB A;  4AP2 A;  4LEU A;  1KLX A;  4CDR A;  2WXP A;  5DIZ A;  1A17 A;  4DI3 A;  1ELR A;  4V3I A;  3PNL B;  3CHS A;  4MKT A;  4WWP A;  3SHF A;  4N3C A;  4CCA A;  3CVQ A;  2RD0 A;  4O6F A;  5EX0 A;  1H2V C;  1XGW A;  4WNG A;  2BUG A;  3QKY A;  3MCX A;  4GZD A;  5C2Y A;  4C0E A;  3CHM A;  3FHE A;  3ZHE A;  2Q7F A;  2VGY A;  2OOE A;  2VSX E;  1EF1 C;  1E8X A;  5T8I A;  3WXX A;  1IYG A;  2AXV A;  2UWJ G;  2MOW A;  3MKQ B;  3PE4 A;  5A23 A;  3ASH A;  4APO A;  4EEC A;  3JQ0 A;  2PQN A;  3SD5 A;  1ZBP A;  4I6E A;  3RRM B;  3FU6 A;  3CVY A;  3NF1 A;  1UJK A;  1E8Y A;  2UY1 B;  3PS6 A;  2VTB A;  3U64 A;  3L17 A;  4GML A;  1EYH A;  3KS2 A;  4EBA G;  3UT4 A;  3L22 A;  4OVU A;  3Q15 A;  5KJL A;  3SZ7 A;  1KT1 A;  3JCK C;  2WXF A;  2YHC A;  2NSZ A;  2WXG A;  3FTU A;  3PEV B;  4A3T A;  4CGV A;  5KJN A;  4WND A;  3CST A;  3D9I A;  4FP7 A;  4U63 A;  4U0Z A;  2X6F A;  3B13 A;  3QC1 A;  4GA0 A;  3TJP A;  4I17 A;  3GYZ A;  4JW1 A;  2FBN A;  2C0L A;  3PE3 A;  4A3V A;  1WAO 1;  5KJM A;  1E8W A;  4GPK A;  3EDT B;  4FA6 A;  5J90 A;  1HFA A;  5HI7 A;  4ANV A;  1UN8 A;  2IJG X;  5LCW J;  3L6A A;  3PRE A;  3SFZ A;  2WXR A;  1LF8 A;  2LO6 A;  5ANL A;  4JHK A;  4GAA A;  3FTV A;  1HO8 A;  1TJC A;  3HIZ A;  3L16 A;  3UT8 A;  3QOU A;  5BPP A;  2AWI A;  2J49 A;  4XIF A;  3TAX A;  1QNF A;  1HU3 A;  4TRQ A;  2KM4 A;  3CVX A;  2WXI A;  2XHE A;  2CHW A;  1FCH A;  4G11 A;  1GW6 A;  2CHZ A;  1PAQ A;  2DBA A;  3FU3 A;  4RG6 A;  4YVO A;  4I1O B;  3CVU A;  3FUI A;  2LAH A;  4CEM A;  5JHB A;  2PM7 A;  2GGF A;  3D9K A;  3P1U A;  4IRU A;  5JJ7 A;  4NAC A;  4Y6C A;  3KEZ A;  4JHR A;  2VJ8 A;  3MA5 A;  3ZEF A;  5LFA A;  3ONK A;  4KVM A;  4JVS A;  3HYM B;  4FC8 A;  3TGO A;  2WXL A;  2LSV A;  5AJD A;  5JJT A;  3ZVV A;  3ZPJ A;  2XGM A;  2PZI A;  3AS4 A;  4N3B A;  3K9I A;  3FUE A;  3QJZ A;  3RIB A;  4G25 A;  4B0Z A;  1W3B A;  2WMN A;  3MYV A;  1E8Z A;  2WPV A;  2FUL A;  3CK7 A;  4OVV A;  4ACL A;  2PM6 A;  3FTS A;  2BTD A;  1JPL A;  2ZU6 B;  3FUN A;  3R7R A;  5LX8 A;  2HO1 A;  1HX8 A;  3LY8 A;  4EQF A;  2ILR A;  3ZXS A;  4DLO A;  3ZYM A;  2V8S E;  2P58 C;  3URZ A;  4U04 A;  4JA7 A;  1E7V A;  4J8F A;  4XI9 A;  1H19 A;  3KAE A;  1OWP A;  3ZIM A;  1VDY A;  4I6G A;  4CDM A;  5JHA A;  4FHK A;  1XNF A;  2IOL A;  4WWO A;  1BPO A;  4N5C A;  4AIF A;  3AS8 A;  4TV3 A;  4AXH A;  4AY6 A;  2DCP A;  2VSY A;  3LXU X;  4J8D A;  4TUU A;  3MJW A;  3D9M A;  2X6I A;  3SI5 A;  3GW4 A;  2JEK A;  3FTW A;  4XE0 A;  2OND A;  3FDH A;  4FJZ A;  3RK6 A;  4GZ6 A;  2J9Q A;  1SQM A;  5EDS A;  1Y6I A;  2AXU A;  1SZA A;  4AM9 A;  4EZJ A;  4HOS A;  3ASF A;  3IKO B;  1U3C A;  1X5B A;  3CVL A;  4IUL A;  4KVO A;  2PL2 A;  3CQG B;  4BWR A;  3C98 A;  5M72 A;  5D0O D;  3CVN A;  3TG5 A;  2KAT A;  3ZFW A;  2LNI A;  4JEU A;  3OXF A;  3Q4A B;  5T3R A;  4WUY A;  2CFU A;  1H0A A;  4I1M A;  4AY5 A;  3AS5 A;  3SGH A;  3CQC B;  1INZ A;  3QK0 A;  4FHJ A;  4D10 C;  4EZL A;  2OVB A;  3CEQ A;  5JJ6 A;  5EKQ D;  4MRU A;  4ATG A;  4CRW A;  3B7R L;  1N52 A;  4JZY A;  4LRZ A;  2WXK A;  5A7D B;  5FZQ A;  4NUR A;  2XGO A;  2WXO A;  2XPY A;  4IN3 B;  3U3W A;  2IOS A;  4GCN A;  3ASD A;  3EIQ C;  3EJN A;  4ILI A;  2X3M A;  4ABN A;  5FTP A;  5HQ8 A;  2Y4T A;  4ANW A;  5E76 A;  2CHX A;  2V0P A;  3QAR A;  4GZ5 A;  3RRN B;  2HYZ A;  5CCM A;  1PC2 A;  2MRI A;  1FVH A;  2GW1 A;  3IBE A;  3PUK A;  3S7D A;  2J09 A;  3CV0 A;  4K0R A;  2GRL A;  2IF4 A;  5FQ8 A;  4HOU A;  2WXQ A;  1KT0 A;  2A5U A;  2XCC A;  4G2V A;  3LVR E;  4KZ0 A;  2YIN A;  3FH8 A;  3LDZ A;  3L13 A;  2C2L A;  4U0U A;  4EPZ A;  5AIJ A;  1WY6 A;  2L0I A;  3MKQ A;  2FI7 A;  3U9W A;  3CVW A;  2YQ8 A;  4LUN U;  3VLE A;  3QNK A;  5BNW A;  2CG2 A;  2Y4U A;  3HVE B;  3O48 A;  4PS3 A;  1JWG A;  2UY1 A;  4HOT A;  3NZU A;  3LYA A;  4B8A A;  4I2W A;  4N2S A;  3VTX A;  2M63 A;  3D3M A;  4G23 A;  3S7B A;  1ELK A;  4GU5 A;  4GZC A;  3LEW A;  4KXK B;  4AV7 A;  4AOF A;  3TG4 A;  3PEU B;  3UPV A;  4B8C B;  4UWG A;  2A4Z A;  3GZ2 A;  4BTB A;  3D9O A;  3APF A;  1HS6 A;  3MGB A;  3LJ3 A;  4ILH B;  3P2B A;  3SF4 A;  1ELW A;  2R5S A;  3MV2 B;  2JLB A;  4UQY A;  5CMW A;  1HXI A;  3LPZ A;  4CT4 A;  5G05 C;  5E75 A;  2X6J A;  5FZS A;  2WMO A;  1E7U A;  4QFV A;  4DPR A;  1HF8 A;  3FUF A;  3LY7 A;  3CKB A;  4UWF A;  3S2A A;  2KC7 A;  3BG0 B;  4ANX A;  1JWF A;  3UT7 A;  1OWM A;  3QWP A;  3I3N A;  3CK8 A;  3NZS A;  3LCA A;  3G2V A;  4BFR A;  1Z3X A;  3LS8 A;  3N71 A;  4UQX A;  4G26 A;  4HLE A;  4JL0 A;  4HFG A;  2EQX A;  3VTY A;  3S7J A;  3AU5 A;  3U66 A;  1HE8 A;  5FQ6 A;  2VYI A;  2LSU A;  3I4R B;  4GA2 A;  5CMY A;  3FUM A;  4FLH A;  4HXI A;  3Q49 B;  4JXT A;  3EIJ A;  3ZN3 A;  5G55 A;  2L6J A;  3UUX A;  1P5Q A;  4YND A;  5FQ7 A;  2VGX B;  4KYO B;  3CK9 A;  4L2Y A;  2X6K A;  3APD A;  5ARG A;  1Y8M A;  4AEZ C;  4B94 A;  3PZD A;  2KZT B;  4BSX A;  4K03 A;  2R59 A;  4GMJ A;  1IHG A;  1U3D A;  1B89 A;  3DPD A;  3G2S A;  4PDX A;  1JUQ A;  4DI4 A;  5D0Q D;  3TL5 A;  4PH4 B;  4IYP A;  4JHJ A;  1Z6T A;  2OV8 A;  2VSN A;  1OWL A;  3LVQ E;  4FUL A;  4BX8 A;  3ONL A;  2Y3A A;  3FUJ A;  1MQS A;  1E96 B;  3MEK A;  5LOZ A;  3JYS A;  5A6C A;  4LER A;  3B7T A;  4WNE A;  3G2U A;  1QQE A;  3MKR A;  2X38 A;  4EBA A;  2IQC A;  3CVP A;  5G05 J;  2AVP A;  3ML9 A;  1L5J A;  5FZR A;  2XRZ A;  3IEG A;  2I6H A;  3RU0 A;  4N2Q A;  1UJJ A;  4URK A;  3QWV A;  2I1K A;  4HS2 A;  3FUK A;  2L0T B;  4OYS A;  2HM8 A;  2BF0 X;  3D9L A;  4HOR A;  4GZ3 A;  3GZ1 A;  3CHR A;  5KCM A;  4H7Y A;  2IFU A;  5C1D A;  3B7U X;  3FU0 A;  4C0M A;  4FU3 A;  4JPS A;  4A55 A;  4F3V A;  3FH5 A;  3PRZ A;  5DBK A;  5FT9 A;  3FP3 A;  4KT6 B;  4L1B A;  4CDN A;  2GRM A;  4ME2 A;  3HDX A;  5EX3 A;  3FEX A;  3QAQ A;  5G2N A;  1WM5 A;  4EZK A;  4E85 A;  1N54 A;  5AJL A;  3SBT B;  2WXM A;  4B89 A;  4UWH A;  4E6H A;  3FU5 A;  4CGW A;  2XQ0 A;  5BW8 C;  1NP7 A;  4WNF A;  2DIW A;  1H6K A;  4WWN A;  2E2E A;  1NZN A;  3VLD A;  3CGH A;  4BY6 A;  3FUL A;  2XEV A;  4I9E A;  3UQ3 A;  4J8E A;  2KCV A;  4RG9 A;  3RJV A;  3L54 A;  1EDU A;  4ANU A;  4UWL A;  3SBS A;  4F1S A;  3ZW3 A;  2WM9 A;  4I9C A;  1OWN A;  2XPZ A;  3U4T A;  3QWW A;  1H2U A;  3BG1 B;  3MZL B;  5BV0 A;  2WQ6 A;  3CSF A;  2J07 A;  1MHQ A;  4H7X A;  4Q69 A;  4PUC A;  2WQH A;  4BX9 A;  1UW4 B;  3T5V A;  4UI9 C;  2VTB B;  2LAI A;  3JQ1 A;  3RKV A;  5AYW D;  3E4B A;  3ZRH A;  1E90 A;  3FWV A;  5LP0 A;  3FTY A;  3G2W A;  2OVF A;  2MHK A;  4C9B B;  2IU1 A;  1NA0 A;  2J08 A;  2HR2 A;  1TEZ A;  2VSO E;  4FLB A;  3HHM A;  1ZU2 A;  4NQ0 A;  2V5F A;  2WVI A;  3OTN A;  4L7T A;  5ARF A;  4BT9 A;  4N39 A;  2WQ7 A;  3TXM A;  2QY7 A;  3APC A;  3D9N A;  2CG3 A;  3FY4 A;  2L9B A;  3D9P A;  2AW6 A;  4ILG A;  4CT0 A;  4GYW A;  5KJK A;  5FQ4 A;  3HVE A;  4I43 A;  3B7S A;  3DBS A;  5T4Y A;  4ACK A;  3CIA A;  4JA9 A;  5ENN A;  4BTA A;  3RO3 A;  1OWO A;  3L08 A;  3Q47 B;  3MV3 B;  4KZC A;  4UQZ A;  3FH7 A;  4A1G A;  4MLP A;  1PY1 A;  2WXN A;  1DNP A;  3FFL A;  3FUH A;  5BV1 A;  4GA1 A;  4Y6W A;  4I2Z A;  4UWK A;  3PH0 C;  2KCK A;  1HG5 A;  1IQU A;  4JEH A;  4J6I A;  4YVQ C;  4AVX A;  3TXN A;  3UMV A;  3IV0 A;  2C0M A;  3AU4 A;  3PDN A;  4XX5 A;  1QZ2 A;  2PQR A;  4FAD A;  3UX4 A;  4GB9 A;  4L23 A;  5J08 A;  4XI0 A;  3CKC A;  3IHY A;  5BT1 A;  3CHQ A;  3CLJ A;  4PS8 A;  4XKC A;  2V4L A;  2YHE A;  2RG8 A;  4F7A A;  4MS6 A;  4UI9 J;  3OXL A;  4FJY A;  3SNX A;  3FTX A;  4PS7 A;  2XGS A;  1Z3Y A;  4GCO A;  4P29 A;  2VQ2 A;  1H2T C;  1HZ4 A;  4A1S A;  2WB2 A;  4RSY A;  4U07 A;  1TJF A;  4LCT A;  4GYY A;  2WXH A;  3PUJ A;  5G04 C;  2NC9 A;  3EHM A;  4G1T A;  3RO2 A;  3ZYK A;  3O4Z A;  4HOQ A;  2I2O A;  3FTZ A;  4U8H A;  4APF A;  4KBQ A;  2VGX A;  3T8M A;  3ESL A;  4NRH B;  2R17 C;  3CHO A;  2E0I A;  3I5P A;  1SZ9 A;  2XPI A;  2KZT A;  2J4B A;  2YNQ A;  3IHV A;  1HH8 A;  3RRU A;  4I1A A;  4F53 A;  2WXJ A;  1DVP A;  3OAW A;  4JC8 A;  5FJY A;  3S7F A;  3PVL A;  5FWQ A;  1HG2 A;  3ZYL A;  3I4G A;  2KCL A;  3BEE A;  4N3A A;  4R7L A;  4WAF A;  2I9C A;  3ZYQ A;  3ESK A;  1EPU A;  2QFC A;  3PNT B;  1UG3 A;  1NA3 A;  3ML8 A;  5CCL A;  2J4D A;  4Q94 A;  3LY9 A;  4L2L A;  2NXP A;  2FEZ A;  4RVB A;  4G24 A;  1UN9 A;  4AJW A;  5CHE E;  2I1J A;  4UI9 K;  2ION A;  5BUZ A;  3Q5M A;  2XRY A;  1FVF A;  3CR3 A;  3GZS A;  4I6J A;  3QDN A;  4U0S A;  2CFZ A;  1S0P A;  3ULQ A;  3ZGQ A;  2FO7 A;  3ASG A;  4DJA A;  3MX3 A;  4BT8 A;  4HVB A;  5ANR A;  1OUV A;  3CVV A;  3R7Q A;  1YA0 A;  3G2T A;  3KD7 A;  1IQR A;  4J8S A;  3EHN A;  4M3O A;  4KMO A;  3OXG A;  4W9R A;  4J0U A;  3LKU A;  4Q96 A;  3NQP A;  4GYO A;  4XZ4 A;  4DLQ A;  5G04 J;  4XKB A;  3R9A B;  3T5X A;  3VLF A;  3CHP A;  2AXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...