3ASDA

Mama r50e mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
137
structure length
137
Chain Sequence
FDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
total genus 53
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asdA00
3LKUA 3TGOA 4HORA 3CK8A 2VGXB 3PE4A 4U0SA 2WPVA 5KJMA 3LYAA 5DBKA 5G04J 4BTAA 5LCWC 3CVLA 4J8DA 3U4TA 5FZRA 5DIZA 2VSYA 2LSUA 3GYZA 3QKYA 1B89A 4I17A 2IFUA 2R5SA 3LY7A 3LPZA 3AS8A 3ZN3A 3ESKA 4H7XA 5A6CA 2XEVA 1ZU2A 3GW4A 4JL0A 4I1AA 2OOEA 5CCLA 4YNDA 2E2EA 2KATA 2KCKA 1YA0A 3HYMB 2KCVA 3OXGA 5EKQD 5FJYA 2ONDA 1ELRA 3SF4A 2VGYA 1IYGA 3MEKA 4W9RA 3FFLA 4J8FA 4N3AA 1HZ4A 3N71A 2XGMA 5ARGA 3AS4A 3Q47B 5LCWJ 3CVQA 2VGXA 3QWPA 4BT9A 4I9EA 4JHRA 4BTBA 2Q7FA 2GW1A 3E4BA 4XI0A 4GCOA 2LNIA 4JA7A 3KS2A 3TG4A 3CVPA 5D0OD 3QOUA 3CK9A 1ELWA 4AY6A 1ZBPA 3QWWA 4HOSA 5JJ7A 4JA9A 4UI9J 3OXLA 2HO1A 2VYIA 2Y4UA 4G24A 2J9QA 4U0ZA 4WUYA 2Y4TA 4G1TA 3FP3A 4A1SA 1P5QA 5JJTA 3LY8A 3RO2A 3Q4AB 5FTPA 1NA0A 4GA1A 3R9AB 5M72A 5FZSA 3OXFA 4ME2A 4N2SA 5D0QD 4NRHB 2LSVA 5AYWD 4GYWA 2PL2A 2MHKA 3ZHEB 2I6HA 4Y6CA 2IF4A 4N2QA 3KAEA 4GYYA 4UI9C 4H7YA 4GZ3A 4AIFA 3ASFA 4KYOB 1OUVA 5EX3A 2FI7A 4RG9A 4F3VA 1HXIA 3ASDA 2HR2A 3UQ3A 5G05J 3AS5A 3GZ1A 4G2VA 2L6JA 1NZNA 1PC2A 3CEQA 4J8EA 2NC9A 4CGWA 3TAXA 3UPVA 4G23A 2FEZA 5BT1A 4J0UA 1XNFA 3EDTB 3VTXA 4WNEA 3UUXA 5KJKA 3K9IA 5HQ8A 2FBNA 4UQZA 5HI7A 2KCLA 4GA2A 1E96B 3VTYA 2AVPA 2FO7A 3FWVA 2KC7A 4YVOA 4BT8A 4HOTA 4CDRA 4CGVA 3S7BA 5FT9A 1FCHA 5FZQA 2XGSA 3ZHEA 3SZ7A 2PQRA 4KBQA 2V5FA 2YHCA 3RU0A 5G05C 3ZFWA 4AY5A 5A7DB 3S7FA 4LEUA 5C1DA 3MV3B 3Q15A 2XCBA 4GCNA 4XI9A 5BW8C 3MA5A 3QDNA 4AM9A 1Y8MA 3LCAA 4GPKA 1W3BA 1KT1A 4U04A 5EX0A 3CKCA 1QZ2A 5BNWA 3MKRA 3Q49B 2UY1A 4Y6WA 1QQEA 3URZA 3RO3A 2PZIA 3ULQA 2QFCA 3RIBA 2C0LA 4RG6A 4BWRA 4KXKB 3CV0A 3BEEA 4G25A 2VQ2A 4GZ5A 4ABNA 4UQXA 2C0MA 3CK7A 5CHEE 1A17A 3WXXA 4WNGA 3QWVA 3ZPJA 3PDNA 4UQYA 2VSNA 3NF1A 5KJLA 3KD7A 4U07A 4YVQC 4N39A 2UY1B 4I2WA 1IHGA 2XCCA 3S7JA 4UI9K 4GZ6A 1HH8A 2DBAA 4O6FA 3PE3A 2PQNA 3LY9A 3GZ2A 1KT0A 5G04C 3ZGQA 4XIFA 4EQFA 4WNFA 3MV2B 4NQ0A 4GYOA 4WNDA 4APOA 2YQ8A 5ARFA 4HOUA 3TG5A 1KLXA 4N5CA 2XGOA 2WQHA 3CVNA 4IN3B 2P58C 1WM5A 2JLBA 4B94A 4N3BA 4GA0A 3Q5MA 5KJNA 4I9CA 2UWJG 3IEGA 4N3CA 5JJ6A 3S7DA 4G26A 2C2LA 1TJCA 2BUGA 2XPIA 3ASGA 3JYSA 2FF4A 3ASHA 1WAO1 1NA3A 3CKBA 3O48A 4HOQA 3RKVA 4I2ZA 4U0UA 3U3WA 2HYZA 5CCMA 3RJVA
chains in the Genus database with same CATH superfamily
3TGOA 3FUHA 3SFYA 1H2UA 1N52A 2EIME 1FT1A 3NQPA 2F37A 2CHWA 4HXIA 4GMLA 5G04J 4BTAA 4J8DA 5FZRA 4ANUA 5LX8A 4V3IA 1NL4A 2VSYA 3AU4A 3MGBA 4K5BA 4WWNA 2XZTG 2R5SA 4CT0A 3CQCB 2WXNA 3T8KA 3QAQA 3LPZA 2RFMA 1PY1A 4JL0A 5BV1A 1Z5SC 2P9LG 4I1AA 5CCLA 3CVYA 2A4ZA 2E2EA 2KATA 2QC9A 4GZCA 2KCKA 3T9KA 2H6FA 3HYMB 4F7AA 3CVUA 3AG1E 1OWNA 4GU5A 4XE0A 3CHQA 3E33A 4FLHA 4GB9A 1S63A 3SF4A 2EILE 4JEUA 4L2YA 4J8FA 5A23A 3VLFA 4XKCA 3N71A 2A5EA 5ARGA 3AS4A 4JHJA 2YHEA 3PNTB 5LCWJ 1O1RA 3MKQA 3PVLA 3UT4A 3FUDA 2IO2C 3WG7E 4HRLA 1BU9A 4BTBA 3CIAA 3E4BA 4XI0A 3I4RB 4OAVB 4BESA 3ESLA 3D9LA 4ZFHA 4AP2A 2DYRE 5D0OD 3Q9NC 3CK9A 1O1TA 5AQAA 1EF1C 3ZYMA 5FQ4A 4TV3A 3JUIA 3D9OA 2WXPA 4UI9J 3OXLA 3UX4A 3U64A 2VYIA 3MKQB 4FULA 2LAHA 2WXMA 4F6RD 3FUIA 4WUYA 1JCQA 2NSZA 2Y4TA 1TN8A 2R59A 3FP3A 4A1SA 3RO2A 3AAAC 1NA0A 3AG2E 3FH7A 3T5VA 3R9AB 2J8SD 4ME2A 4DLOA 3FU5A 4GYWA 4RLYA 3VLEA 5D66A 2DZNA 3C3QA 3ONLA 2MHKA 5KNHD 4TRQA 4JPSA 4MKTA 1S64A 5ITZF 1KZOA 4Y6CA 4HLLA 3V2OA 4ZHBA 2YINA 3B7TA 3I3NA 2P9NG 1E8ZA 2PNNA 1UJKA 4KYOB 1D9SA 1OY3D 2XS1A 1SZ9A 1TNUA 1HXIA 3ZIMA 3SI5A 2P9UG 3SY2A 1E7VA 3AS5A 4G2VA 1FVFA 1NZNA 2LO6A 3L08A 4BEPA 3E30A 2XRYA 1LTXA 4Z68A 5FQ7A 3ULEG 4URKA 3PZDA 4ANXA 1MQSA 3L82A 3QB2A 1OWOA 4WNEA 3HDXA 1UN8A 5KJKA 3L17A 1HO8A 3V30A 1E8XA 5HI7A 2KCLA 3AG3E 4GA2A 1E96B 5ENQD 4HRNA 2QYJA 2DCPA 2IU1A 4AXHA 2IY0C 3HG0D 2XEEA 4CDRA 4CGVA 3S7BA 5CRVA 2XZDG 5FZQA 4O60A 1TYQG 1Q2ZA 3TXMA 4KBQA 2X3MA 3FH8A 3RU0A 5G05C 4AY5A 4LCTA 4LEUA 4FJZA 4DI4A 3MV3B 4XZ4A 2J09A 2XCBA 4GCNA 4HQDA 5BW8C 1UG3A 3QDNA 3MJWA 1QYMA 4AM9A 1Y8MA 1H19A 1W3BA 2R17C 3PZ1A 5B3SE 4GTVA 2DIWA 4AV7A 1OWPA 2QY7A 4OYSA 5LP0A 2XEHA 3FTZA 4Y6WA 4YDEA 2IONA 4FADA 2DVWA 3ZU7B 2QFCA 3NOGD 5EILA 1FPPA 5BV0A 2CFUA 4G25A 3RRUA 4DK5A 2AWIA 3ZKJA 1D8EA 2C0MA 3CHMA 3FUKA 3ZYLA 5C2YA 3TWSA 2GRLA 4WNGA 3QWVA 3PREA 3PDNA 4UQYA 3AU5A 2WXFA 3SFZA 3NF1A 4BSXA 5KJLA 4U07A 3RSEG 3R7RA 4M7CA 1NI1A 4I2WA 1BI7B 5JMND 3S7JA 1IHBA 2Y69E 4C0MA 3EJNA 3PE3A 3GZ2A 3JUEA 3V2XA 4WNFA 3MV2B 3R9MA 4GYOA 5JHAA 1K3ZD 2YQ8A 3UKRG 5ENPD 4MRUA 4HOUA 4C48B 2BKKB 3HIZA 2CG2A 3QNKA 2ILRA 4LRZA 3LJ3A 3U9WA 3C3RA 1OWLA 3CVNA 3PEVB 1OWMA 2RFAA 4DPRA 4N3BA 2IQCA 3P2BA 1YMPA 5JJ6A 2F8XK 1N4QA 2C2LA 3ENEA 3ASHA 4U96D 2WMOA 3SBSA 5B1AE 1GW6A 4ATZD 5ENTD 1N0QA 1IQUA 4GTSA 3ONKA 4FHKA 4KMOA 5CCMA 3CSTA 5FIOA 2P9KG 4JHKA 3UM0A 2J4BA 3KSQA 4HORA 4APFA 1MX4A 3CK8A 2VGXB 4AJWA 4Q69A 1EYHA 2X6FA 1E8YA 3QARA 1H6KA 3Q7AA 3R7QA 5KJMA 4BX8A 1SW6A 3CVWA 3U4TA 2LSUA 3PNLB 5ENOD 1D8DA 3GYZA 3F6QA 3D9MA 3QKYA 3ZEFA 1LD8A 4J8YA 3E37A 3C5RA 3CVVA 1DNPA 1SQMA 4MBGA 3LY7A 4C9BB 1JUQA 2IO3C 4U8HA 1LF8A 1O5MA 5LFAA 3ZN3A 4H7XA 5EDSA 1ZU2A 3D9PA 3B95A 3GW4A 1QBQA 2OOEA 2X6JA 5E75A 3JQ0A 2KCVA 3OXGA 2RKKA 4OVUA 2NXPA 2VGYA 3NAWA 3C3OA 1UOHA 1TR4A 4W9RA 2OV8A 3FFLA 4HI9A 4D10C 1HZ4A 3D9JA 3BUAA 3CGHA 3AG4E 5FINA 1HG2A 2WXIA 4R7LA 4BT9A 2VTBA 3DSVA 4I9EA 2RG8A 4JHRA 3EIJA 2BEDA 2HE0A 3HXEA 2GW1A 5BUZA 4GCOA 3LEWA 4CZ2D 4JA7A 5LOZA 3Q79A 3KS2A 1BI8B 3B7UX 4BY6A 3CVPA 3QOUA 4IULA 1ELWA 1TNYA 2PM6A 3FEYA 2VSOE 4GZDA 3CSFA 3EHQA 3G2TA 2J9QA 3FTVA 1TN6A 2VTBB 2KBXA 3L54A 3L16A 2ZU6B 5T3RA 4LUNU 2WXKA 3B7BA 1MX2A 5FTPA 2H6HA 4UWGA 1N54A 1KPSB 4JW1A 3IBEA 4N2SA 5D0QD 4NRHB 1SVXA 4BERA 3ZW3A 2AXVA 2J49A 4CRWA 2X6HA 4PS8A 2NYJA 4CEMA 3J5QB 3X2QE 3PH0C 3RRNB 3I4GA 4GPMA 4DX6D 1TNBA 3AJIA 1YYHA 3KAEA 1HS6A 4B8CB 4GTMA 1N94A 4EZJA 1MYOA 3ASFA 5HKPA 3NZSA 1MZCA 3UM2A 5EX3A 2FI7A 3P1UA 4FU3A 4MS6A 3UQ3A 2FO1E 3NOCD 5G05J 4LG6A 4CDNA 3GZ1A 4O1OA 3PZ4A 1DC2A 4QQIA 3RK6A 3D9IA 4U7EB 4J8EA 3RAUA 3APFA 4CGWA 2GRRB 2WMNA 1BLXB 3UPVA 4G23A 5B1BE 4BSZB 4FP7A 5KCMA 2WM9A 1RW2A 5ENNA 3QC1A 5HQ8A 1S70B 2AVPA 1VDYA 4XKBA 4ACLA 3FWVA 3D9KA 3MZLB 4YVOA 3L9TA 3Q75A 4BT8A 3SQVA 4AEZC 2XGSA 5AQBA 4HBDA 3VLDA 1FT2A 3ZFWA 4BFRA 3S7FA 4LNBA 2R05A 5CECB 2DWZA 3G2SA 3LXUX 1HE8A 1JCSA 4XI9A 1AP7A 4TUMA 3LCAA 3I5PA 2JABA 4U04A 4CDMA 3HVEA 1A5EA 1QZ2A 5JHBA 5BNWA 3MKRA 3TWUA 2UY1A 1Z3XA 3JXJA 4KZ0A 3FTUA 2I1KA 3ZVVA 2YNQA 3RO3A 3ULQA 2B6CA 2EIJE 3FEXA 4GMRA 3RIBA 3IHYA 2C0LA 4KXKB 4AVXA 3BEEA 3UT7A 3SGHA 2GROB 4GZ5A 4L1BA 2R02A 5CHEE 3Q7FA 1A17A 5T4YA 1E8WA 3MCXA 1ZB1A 4GTOA 3WXXA 3ZPJA 3HVEB 2VJ8A 3NB2A 2VSNA 2BF0X 1N4PA 4YVQC 1DVPA 2UY1B 1LD7A 1IHGA 2IOLA 2XCCA 4L23A 4UI9K 5AAOA 2OVBA 2R03A 1X5BA 4O6FA 1UW4B 1E90A 4G8KA 5G04C 2VSXE 4UWFA 2WXOA 4WNDA 1S0PA 3CLJA 4APOA 3TWXA 4TXPA 5ARFA 4ILIA 3TG5A 2XS8A 3PZ3A 2ZGDA 1KLXA 2XGOA 3CHOA 2WQHA 1TJFA 3DRAA 5CRUA 5EYPF 4FJYA 3DSSA 4UWKA 2JLBA 4HRMB 4B94A 4I6EA 3ZNGA 4ILHB 2QZAA 2AXZA 5KBAA 3W9GA 1TJCA 2WXGA 3ASGA 2FF4A 3ASOE 3NZUA 3FULA 1BPOA 4U95D 1WAO1 2GGFA 3ML9A 3O48A 3W9FA 3IXEA 3U3WA 4DX2A 5T8IA 2CHZA 4WAFA 3LKUA 1L5JA 1K1AA 4ACKA 3D9NA 3CHPA 4NURA 2WB2A 5EIDA 5G2NA 3PE4A 3JQ1A 2WPVA 5HRYA 2ZIRA 4Q94A 5LCWC 4NACA 3CVLA 4DUIA 5DIZA 4EECA 1WG0A 3TJPA 3FUEA 3DWLG 2LXMA 1B89A 1HX8A 1HF8A 2OCCE 4PH4B 3ESKA 2J4DA 4YDOA 5A6CA 2XEVA 2Y1LE 1OXJA 1INZA 3T5XA 3TWWA 1YA0A 3FH5A 2X6IA 2V4HC 3FUMA 5EKQD 3ABME 5AJLA 2WXHA 3MYVA 5FJYA 2ONDA 1ELRA 2GRQB 3DSTA 1H6OA 1Y6IA 2ZGGA 5D2MC 3KSLA 4N3AA 1K1BA 3EU5A 2Y3AA 5FWQA 1N9AA 3CVQA 3SD5A 3EHRA 2BTDA 2VGXA 3TWVA 4IYPA 1SZAA 4NIKA 2KM4A 2H6IA 3FTYA 4GMJA 2Q7FA 1OCCE 4DX7D 3G2VA 1N0RA 3HXCA 2AJAA 4KT6B 2F8YA 2LNIA 3TWQA 4FA6A 3PUJA 3PEUB 1HG5A 1N95A 3TG4A 1TNZA 3DSUA 3DPYA 4RVBA 4HOSA 3D3MA 4JA9A 5KNGA 2Y4UA 3APCA 1DCEA 2QYUA 4UWLA 2IEJA 4G1TA 4GTPA 2EIKE 3UM1A 3C98A 3LY8A 1JCRA 3BU8A 1NFIE 4GA1A 1H2TC 1MX6A 3ABKE 3LS8A 4B89A 5FZSA 3SO8A 2LSVA 1X81A 4YDWA 4PS3A 4E6HA 3ZHEB 1HFAA 4G11A 5EIBE 4E85A 3DXKG 2IF4A 3TWTA 2V0PA 4AOFA 4H7YA 3FU6A 3DPDA 5BXUA 3LJNA 4OAUC 3TL5A 3CQGB 2XQ0A 4F3VA 3UM3A 3ASDA 4X8QA 2BKGA 2OEWA 4JB8P 1SA4A 3CHSA 3S2AA 4C0EA 3SFXA 1V54E 1PC2A 2ETCA 3CEQA 1U3DA 1Z6TA 2MOWA 3ZXPA 4DRXE 3UI2A 2NC9A 3JXIA 5BT1A 4J0UA 4UUCA 3UT8A 2AW6A 4F53A 3EUVA 1TNOA 5ENSD 5HS0A 4UQZA 2FBNA 2WXJA 3B7SA 3Q9UC 4RSYA 2P9PG 3VTYA 4N5QA 2FO7A 1E7UA 1OCRE 3HXDA 3ISMC 3J5PA 1JPLA 4LNUD 4HVBA 3EHNA 1IKND 1K8KG 3APDA 3C72A 5FT9A 2V5FA 1FVHA 4GTRA 4ANWA 3O4ZA 2P2CP 5AN8A 1H2VC 4EZKA 4B8AA 3ULYA 1U2VG 3MA5A 5CMWA 4A63B 3G2UA 1KT1A 4K5AB 2LAIA 3G2WA 1IQRA 3BQOA 3Q49B 2GRNB 1QQEA 3URZA 4CCAA 1H6PA 1XGWA 4TUUA 4PUCA 4RG6A 3LDZA 4BWRA 3LVQE 1V55E 2VQ2A 4ABNA 3CK7A 3JCKC 3DSXA 2P9SG 3TXNA 4KVOA 3FHEA 2X38A 1PAQA 4HB5A 3KD7A 4N39A 2EQXA 4OVVA 3UXGA 4I6GA 3L6AA 4CT4A 4GZ6A 3FTXA 2XHEA 2PQNA 3LY9A 2WQ7A 1KT0A 3ZGQA 4EZLA 3MX3A 4J6IA 2OEVA 4I1OB 2E0IA 1O1SA 2MRIA 4DJAA 3Q78A 4IN3B 2IJGX 4EBAG 1WM5A 1TN7A 4KZCA 4WWOA 4I43A 4DX5D 4GA0A 3Q5MA 2DZOA 5KJNA 3KEZA 4I9CA 2UWJG 3IEGA 3NBNB 3S7DA 2CG3A 4TXRA 3ZYKA 4QFVA 1KZPA 2IOSA 3ZUVB 3FU3A 2XPYA 4GTQA 3FU0A 4I1MA 3CKBA 4HOQA 1EPUA 5ANRA 3RKVA 4I2ZA 4U0UA 3D9HA 4LERA 4JZYA 4DI3A 3E34A 3EU9A 4A3VA 3ML8A 2WXQA 4FC8A 3SHFA 2GRPB 4U0SA 2AXUA 3LYAA 5DBKA 3ZRHA 2CFZA 1SA5A 2OVFA 4MLPA 3UKUG 3FY4A 4I17A 2WXLA 4DX1A 4ILGA 4A3TA 2IFUA 5G55A 3QJZA 2PM7A 1ELKA 3AS8A 3L13A 5E76A 2M63A 2V8SE 2MYOA 3KEAA 2KXPC 4RQIA 3HXFA 4YNDA 4TXQA 4L2LA 1MHQA 2B0OE 1DCQA 3B13A 3QK0A 1N4SA 1H0AA 1IYGA 3MEKA 1YCSB 2J08A 2XGMA 3Q47B 5CBOA 3QWPA 1JWFA 4DLQA 3CHRA 5H7PA 5BXOA 3HRAA 4A1GA 4JC8A 2P9IG 3T8MA 4M3OA 5J90A 3FDHA 3V31A 5CERB 4AY6A 3B7RL 1OCZE 1IXVA 1ZBPA 3QWWA 3LVRE 5JJ7A 2ETAA 3PRZA 2LUHA 2HO1A 3U66A 4G24A 3V79K 4GTTA 4GAAA 4U0ZA 3DEPA 5AARA 3CR3A 1P5QA 5JJTA 1U3CA 3Q4AB 5KWDA 4A55A 1OCOE 2F0YA 2WVIA 5FQ6A 5CBNA 3DEOA 2R2LA 4P29A 4O1PA 2ETBA 2HM8A 5M72A 3OXFA 4K0RA 1WY6A 4CYMD 5AYWD 2FULA 2PL2A 1N11A 4FLBA 4U63A 3SNXA 2I1JA 5J08A 2H6GA 1N4RA 2I6HA 1NP7A 4N2QA 2VGEA 4GYYA 4UI9C 4LSZE 1OT8A 4GZ3A 4L7TA 4AIFA 5IY5E 1OUVA 3FUFA 4RG9A 4G8LA 2HR2A 3DXMG 4K5CA 3ZXSA 3FTSA 3L22A 3IKOB 2XRZA 2L6JA 2XPZA 2I2OA 2A5UA 4XX5A 4IRUA 2L9BA 4ANVA 4EPZA 4ATGA 2Y0BG 3TAXA 1TEZA 2FEZA 4FHJA 1XNFA 2EINE 3EDTB 3VTXA 4UWHA 2XENA 3UUXA 4KVMA 3BG1B 2DYSE 3K9IA 4WWPA 3ZYQA 4BX9A 3Q73A 3PS6A 3UIOC 3FTWA 1JWGA 2KC7A 5FQ8A 5CEDB 3TWRA 4HOTA 5AJDA 3PZ2A 1FCHA 2CHXA 3HHMA 4K03A 3ZHEA 3SZ7A 4U8YD 2PQRA 1Z3YA 1WDYA 2YHCA 3UMVA 3ABLE 4EBAA 4HS2A 5A7DB 1EDUA 4JEHA 4HLEA 5C1DA 3PUKA 1QNFA 3Q15A 1RZ4A 2X6KA 5CMYA 4GPKA 2JEKA 4B0ZA 2WXRA 2WQ6A 3E32A 4PS7A 5EX0A 4XEIG 3CKCA 5AIJA 3UINC 4HI8A 4EHMA 4F1SA 3RRMB 2PZIA 1HU3A 3BG0B 3IHVA 4HFGA 4J8SA 4JXTA 3CV0A 3EIQC 5BPPA 4UQXA 4B93B 2LXLA 4I6JA 1G3NB 4U8VD 3CVXA 4JVSA 4HNAD 5AQ7A 4F1PA 2V5QC 2L6BA 5JA4D 2KZTA 4BETA 2ZXWE 2ZISA 3UIPC 3FUJA 1HH8A 2DBAA 3DBSA 1BD8A 3SBTB 3DSWA 1UN9A 2GRMA 5EN5D 4PDXA 4XIFA 4EQFA 4NQ0A 1AWCB 2I9CA 2J07A 5CEAA 4YDYA 1UJJA 4LNGA 3EHMA 3UTMA 1MJ0A 2L0IA 3HXBA 4N5CA 4JD2G 2V4LA 3OAWA 3IV0A 3FUNA 2P58C 2L0TB 4Q96A 2KZTB 4L9PA 5AQ9A 3ASNE 4N3CA 4G26A 2BUGA 2XPIA 3JYSA 5EYLA 3OTNA 5ENRD 5ANLA 1NA3A 2RD0A 3GZSA 5AENA 4J7WA 2HYZA 3RJVA
chains in the Genus database with same CATH topology
3CSTA 1L5JA 3LKUA 4ACKA 4DI3A 4JHKA 3TGOA 3D9NA 4A3VA 2J4BA 3ML8A 3FUHA 2WXQA 4APFA 3CHPA 4FC8A 3CK8A 4NURA 4HORA 1H2UA 2VGXB 2WB2A 4AJWA 3SHFA 4Q69A 1N52A 1EYHA 5G2NA 2X6FA 3NQPA 1E8YA 3PE4A 4U0SA 3JQ1A 2WPVA 1H6KA 3QARA 2CHWA 4HXIA 3R7QA 2AXUA 5KJMA 4GMLA 3LYAA 5DBKA 3ZRHA 5G04J 4BTAA 2CFZA 4BX8A 4Q94A 5LCWC 2OVFA 4NACA 3CVWA 3CVLA 4J8DA 4MLPA 3U4TA 5FZRA 4ANUA 5LX8A 5DIZA 4EECA 4V3IA 3TJPA 3FUEA 2VSYA 2LSUA 3PNLB 3GYZA 3D9MA 3AU4A 3FY4A 1B89A 3QKYA 3ZEFA 3MGBA 4I17A 4WWNA 2WXLA 4ILGA 4A3TA 3CVVA 1HX8A 1DNPA 1SQMA 1HF8A 2IFUA 3QJZA 5G55A 2R5SA 3LY7A 4C9BB 4CT0A 3CQCB 2WXNA 1JUQA 4U8HA 2PM7A 1ELKA 3QAQA 3LPZA 1LF8A 3AS8A 3L13A 5LFAA 5E76A 2M63A 4PH4B 2V8SE 3ZN3A 3ESKA 2J4DA 4H7XA 5EDSA 5A6CA 2XEVA 1ZU2A 1PY1A 3D9PA 3GW4A 4JL0A 5BV1A 4I1AA 2OOEA 2X6JA 5E75A 5CCLA 1INZA 3CVYA 4YNDA 2A4ZA 2E2EA 2KATA 3T5XA 3JQ0A 4GZCA 2KCKA 1YA0A 3FH5A 2X6IA 3HYMB 4F7AA 4L2LA 2KCVA 3CVUA 3FUMA 3OXGA 5EKQD 5AJLA 1OWNA 2WXHA 4GU5A 4XE0A 3CHQA 1MHQA 3MYVA 4FLHA 3B13A 4GB9A 5FJYA 2ONDA 1ELRA 3QK0A 4OVUA 2NXPA 3SF4A 2VGYA 1H0AA 1Y6IA 1IYGA 4JEUA 4L2YA 3MEKA 2OV8A 4W9RA 3FFLA 4J8FA 4D10C 4N3AA 5A23A 3VLFA 4XKCA 1HZ4A 3D9JA 3N71A 2J08A 2XGMA 3CGHA 5ARGA 3AS4A 4JHJA 3Q47B 2YHEA 3PNTB 2Y3AA 5FWQA 5LCWJ 3CVQA 3SD5A 3MKQA 1HG2A 2BTDA 2WXIA 4R7LA 2VGXA 3QWPA 4BT9A 3PVLA 1JWFA 4IYPA 3UT4A 1SZAA 4DLQA 2VTBA 3FUDA 3CHRA 2KM4A 2RG8A 4I9EA 4JHRA 3EIJA 3FTYA 4GMJA 4BTBA 4A1GA 2Q7FA 3CIAA 2GW1A 3E4BA 3G2VA 3I4RB 4XI0A 5BUZA 4JC8A 4GCOA 3LEWA 4KT6B 3T8MA 2LNIA 3ESLA 3D9LA 3PUJA 4JA7A 3PEUB 5ANLA 5LOZA 4FA6A 1HG5A 3KS2A 3B7UX 3TG4A 4M3OA 4AP2A 4BY6A 3CVPA 5D0OD 3QOUA 5J90A 3CK9A 3FDHA 4IULA 1ELWA 4WAFA 4AY6A 3B7RL 2PM6A 3FEYA 1EF1C 2VSOE 5FQ4A 3ZYMA 4RVBA 1ZBPA 4TV3A 3QWWA 4GZDA 3LVRE 4HOSA 5JJ7A 3D3MA 3CSFA 3JUIA 4JA9A 3PRZA 3D9OA 2WXPA 4UI9J 3OXLA 3G2TA 3UX4A 3U64A 2HO1A 2VYIA 2Y4UA 4G24A 3U66A 3APCA 2J9QA 3MKQB 3FTVA 4FULA 4UWLA 4GAAA 4U0ZA 2LAHA 2VTBB 3L54A 2WXMA 3L16A 3FUIA 2ZU6B 4WUYA 5T3RA 2NSZA 2Y4TA 4LUNU 4G1TA 3CR3A 2R59A 3FP3A 4A1SA 1P5QA 3C98A 5JJTA 1U3CA 3LY8A 3RO2A 3Q4AB 2WXKA 4A55A 2WVIA 5FQ6A 5FTPA 1NA0A 3FH7A 3T5VA 4UWGA 4GA1A 1H2TC 3R9AB 4P29A 1N54A 3LS8A 4JW1A 2HM8A 5M72A 4B89A 5FZSA 3IBEA 3OXFA 4ME2A 4N2SA 4K0RA 1WY6A 5D0QD 4DLOA 4NRHB 2LSVA 5AYWD 2FULA 3FU5A 3ZW3A 4GYWA 2AXVA 2J49A 4CRWA 2PL2A 3VLEA 2X6HA 4PS3A 4FLBA 4PS8A 3ONLA 4U63A 4E6HA 2MHKA 4CEMA 4TRQA 3PH0C 3SNXA 3ZHEB 1HFAA 4G11A 4JPSA 4MKTA 3RRNB 2I1JA 3I4GA 5J08A 4E85A 2I6HA 1NP7A 4Y6CA 2IF4A 2YINA 2V0PA 3B7TA 3KAEA 4N2QA 3I3NA 1HS6A 4B8CB 4GYYA 4UI9C 4AOFA 1E8ZA 4H7YA 4GZ3A 4EZJA 4L7TA 4AIFA 3FU6A 1UJKA 3ASFA 3DPDA 4KYOB 3NZSA 1OUVA 1SZ9A 3FUFA 5EX3A 3TL5A 2FI7A 3CQGB 4RG9A 2XQ0A 4F3VA 3P1UA 1HXIA 4FU3A 3ASDA 3ZIMA 3SI5A 4MS6A 2HR2A 3UQ3A 1E7VA 3ZXSA 5G05J 3FTSA 3AS5A 3L22A 3GZ1A 4CDNA 3IKOB 2XRZA 4G2VA 2L6JA 2XPZA 3CHSA 3S2AA 4C0EA 1FVFA 1NZNA 1PC2A 2LO6A 3L08A 3RK6A 2I2OA 2A5UA 3CEQA 3D9IA 1U3DA 4XX5A 1Z6TA 4IRUA 2XRYA 4J8EA 2L9BA 4ANVA 4EPZA 4ATGA 2MOWA 3APFA 2NC9A 4CGWA 5FQ7A 2WMNA 3TAXA 1TEZA 4URKA 3UPVA 4G23A 2FEZA 3PZDA 4J0UA 5BT1A 4FHJA 2AW6A 3UT8A 1MQSA 4ANXA 3QB2A 4F53A 1XNFA 4FP7A 1OWOA 5KCMA 2WM9A 3EDTB 5ENNA 3VTXA 4WNEA 3HDXA 4UWHA 3QC1A 3UUXA 4KVMA 3BG1B 1UN8A 5KJKA 3L17A 3K9IA 1HO8A 5HQ8A 2FBNA 1E8XA 2WXJA 2KCLA 3B7SA 4UQZA 4RSYA 4WWPA 4GA2A 1E96B 5HI7A 2AVPA 3VTYA 3PS6A 1VDYA 2FO7A 2DCPA 1E7UA 2IU1A 3FTWA 1JWGA 4XKBA 4ACLA 3FWVA 4AXHA 2KC7A 3D9KA 3MZLB 5FQ8A 1JPLA 4HVBA 4YVOA 3EHNA 4BT8A 4HOTA 4CDRA 4CGVA 3S7BA 3APDA 5AJDA 5FT9A 1FCHA 2CHXA 5FZQA 4AEZC 2XGSA 3HHMA 4K03A 3ZHEA 3SZ7A 2PQRA 3TXMA 1Z3YA 2V5FA 2X3MA 3FH8A 2YHCA 4KBQA 1FVHA 3UMVA 3VLDA 3RU0A 5G05C 3ZFWA 4BFRA 4EBAA 4ANWA 4AY5A 4HS2A 5A7DB 3O4ZA 3S7FA 4LCTA 1EDUA 4LEUA 4JEHA 4HLEA 1H2VC 4FJZA 4DI4A 4EZKA 5C1DA 3MV3B 4B8AA 3G2SA 1QNFA 3LXUX 2J09A 3PUKA 2XCBA 3Q15A 4XZ4A 4GCNA 1HE8A 4XI9A 5BW8C 3MA5A 1UG3A 5CMWA 3QDNA 3MJWA 2X6KA 5CMYA 1Y8MA 3LCAA 1H19A 4AM9A 4GPKA 2JEKA 1W3BA 4B0ZA 2R17C 3G2UA 2DIWA 2WXRA 3I5PA 2WQ6A 1KT1A 4U04A 4AV7A 4CDMA 3HVEA 4PS7A 1OWPA 5EX0A 3CKCA 1QZ2A 5AIJA 5JHBA 2LAIA 2QY7A 1IQRA 3G2WA 3MKRA 4OYSA 5BNWA 5LP0A 3Q49B 2UY1A 1Z3XA 3FTZA 4Y6WA 1QQEA 4KZ0A 3URZA 2IONA 3FTUA 4FADA 2I1KA 3ZVVA 4BX9A 4F1SA 2YNQA 3RO3A 3RRMB 4CCAA 1XGWA 4TUUA 2PZIA 1HU3A 4PUCA 3ULQA 2QFCA 3BG0B 3FEXA 3IHVA 4HFGA 4J8SA 3RIBA 3IHYA 5BV0A 2C0LA 3LDZA 4RG6A 4BWRA 4JXTA 4KXKB 3CV0A 3EIQC 4AVXA 3BEEA 2CFUA 3LVQE 3UT7A 3SGHA 4G25A 2VQ2A 4GZ5A 4ABNA 5BPPA 4UQXA 3RRUA 4DK5A 2AWIA 4I6JA 2C0MA 3CHMA 4L1BA 3CK7A 3FUKA 3JCKC 3ZYLA 3CVXA 5CHEE 5C2YA 1A17A 3TXNA 4KVOA 5T4YA 4JVSA 1E8WA 3MCXA 3FHEA 3WXXA 2GRLA 4WNGA 3QWVA 3PREA 3ZPJA 3HVEB 2VJ8A 2X38A 3PDNA 4UQYA 1PAQA 2KZTA 2VSNA 2BF0X 3AU5A 2WXFA 3SFZA 3NF1A 4BSXA 3KD7A 4U07A 5KJLA 4YVQC 3R7RA 1DVPA 4N39A 2EQXA 2UY1B 4OVVA 4I6GA 4I2WA 3L6AA 1IHGA 2IOLA 3FUJA 4CT4A 2XCCA 3S7JA 4L23A 4UI9K 4GZ6A 1HH8A 2DBAA 3FTXA 3DBSA 2OVBA 4C0MA 1X5BA 3EJNA 2XHEA 4O6FA 3SBTB 3PE3A 2PQNA 3LY9A 1UN9A 3GZ2A 1UW4B 2GRMA 2WQ7A 1E90A 1KT0A 5G04C 3ZGQA 4EZLA 4PDXA 2VSXE 3MX3A 4UWFA 4XIFA 2WXOA 4WNFA 4J6IA 3ZYQA 4I1OB 4EQFA 3MV2B 2E0IA 4NQ0A 5JHAA 2MRIA 1S0PA 4GYOA 4WNDA 2I9CA 2J07A 3CLJA 4APOA 1UJJA 2YQ8A 5ARFA 3EHMA 4ILIA 4MRUA 4HOUA 3TG5A 1KLXA 2L0IA 4DJAA 3HIZA 2CG2A 4N5CA 3QNKA 2ILRA 2XGOA 3CHOA 2V4LA 3OAWA 2WQHA 4LRZA 3LJ3A 3U9WA 1OWLA 3CVNA 3IV0A 1TJFA 2P58C 3FUNA 2IJGX 3PEVB 4IN3B 2L0TB 4FJYA 4Q96A 4EBAG 1OWMA 1WM5A 2KZTB 4UWKA 2JLBA 4KZCA 4B94A 4DPRA 4I6EA 4WWOA 4N3BA 4I43A 4ILHB 4GA0A 3Q5MA 2IQCA 3P2BA 5KJNA 3KEZA 4I9CA 2UWJG 3IEGA 2AXZA 4N3CA 5JJ6A 3S7DA 2CG3A 4G26A 2C2LA 1TJCA 2BUGA 2WXGA 2XPIA 3ASGA 3ZYKA 3JYSA 4QFVA 2FF4A 3ASHA 3ENEA 2IOSA 3FU3A 2XPYA 3NZUA 2WMOA 3FU0A 3SBSA 3FULA 3OTNA 4I1MA 1BPOA 1GW6A 1NA3A 1WAO1 2GGFA 2RD0A 3CKBA 3GZSA 1EPUA 3ML9A 3O48A 4HOQA 5ANRA 3RKVA 4I2ZA 4U0UA 3U3WA 5AENA 1IQUA 4LERA 5T8IA 2CHZA 3ONKA 4JZYA 4FHKA 4KMOA 2HYZA 5CCMA 3RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKU A;  3TGO A;  4HOR A;  3CK8 A;  2VGX B;  3PE4 A;  4U0S A;  2WPV A;  5KJM A;  3LYA A;  5DBK A;  5G04 J;  4BTA A;  5LCW C;  3CVL A;  4J8D A;  3U4T A;  5FZR A;  5DIZ A;  2VSY A;  2LSU A;  3GYZ A;  3QKY A;  1B89 A;  4I17 A;  2IFU A;  2R5S A;  3LY7 A;  3LPZ A;  3AS8 A;  3ZN3 A;  3ESK A;  4H7X A;  5A6C A;  2XEV A;  1ZU2 A;  3GW4 A;  4JL0 A;  4I1A A;  2OOE A;  5CCL A;  4YND A;  2E2E A;  2KAT A;  2KCK A;  1YA0 A;  3HYM B;  2KCV A;  3OXG A;  5EKQ D;  5FJY A;  2OND A;  1ELR A;  3SF4 A;  2VGY A;  1IYG A;  3MEK A;  4W9R A;  3FFL A;  4J8F A;  4N3A A;  1HZ4 A;  3N71 A;  2XGM A;  5ARG A;  3AS4 A;  3Q47 B;  5LCW J;  3CVQ A;  2VGX A;  3QWP A;  4BT9 A;  4I9E A;  4JHR A;  4BTB A;  2Q7F A;  2GW1 A;  3E4B A;  4XI0 A;  4GCO A;  2LNI A;  4JA7 A;  3KS2 A;  3TG4 A;  3CVP A;  5D0O D;  3QOU A;  3CK9 A;  1ELW A;  4AY6 A;  1ZBP A;  3QWW A;  4HOS A;  5JJ7 A;  4JA9 A;  4UI9 J;  3OXL A;  2HO1 A;  2VYI A;  2Y4U A;  4G24 A;  2J9Q A;  4U0Z A;  4WUY A;  2Y4T A;  4G1T A;  3FP3 A;  4A1S A;  1P5Q A;  5JJT A;  3LY8 A;  3RO2 A;  3Q4A B;  5FTP A;  1NA0 A;  4GA1 A;  3R9A B;  5M72 A;  5FZS A;  3OXF A;  4ME2 A;  4N2S A;  5D0Q D;  4NRH B;  2LSV A;  5AYW D;  4GYW A;  2PL2 A;  2MHK A;  3ZHE B;  2I6H A;  4Y6C A;  2IF4 A;  4N2Q A;  3KAE A;  4GYY A;  4UI9 C;  4H7Y A;  4GZ3 A;  4AIF A;  3ASF A;  4KYO B;  1OUV A;  5EX3 A;  2FI7 A;  4RG9 A;  4F3V A;  1HXI A;  3ASD A;  2HR2 A;  3UQ3 A;  5G05 J;  3AS5 A;  3GZ1 A;  4G2V A;  2L6J A;  1NZN A;  1PC2 A;  3CEQ A;  4J8E A;  2NC9 A;  4CGW A;  3TAX A;  3UPV A;  4G23 A;  2FEZ A;  5BT1 A;  4J0U A;  1XNF A;  3EDT B;  3VTX A;  4WNE A;  3UUX A;  5KJK A;  3K9I A;  5HQ8 A;  2FBN A;  4UQZ A;  5HI7 A;  2KCL A;  4GA2 A;  1E96 B;  3VTY A;  2AVP A;  2FO7 A;  3FWV A;  2KC7 A;  4YVO A;  4BT8 A;  4HOT A;  4CDR A;  4CGV A;  3S7B A;  5FT9 A;  1FCH A;  5FZQ A;  2XGS A;  3ZHE A;  3SZ7 A;  2PQR A;  4KBQ A;  2V5F A;  2YHC A;  3RU0 A;  5G05 C;  3ZFW A;  4AY5 A;  5A7D B;  3S7F A;  4LEU A;  5C1D A;  3MV3 B;  3Q15 A;  2XCB A;  4GCN A;  4XI9 A;  5BW8 C;  3MA5 A;  3QDN A;  4AM9 A;  1Y8M A;  3LCA A;  4GPK A;  1W3B A;  1KT1 A;  4U04 A;  5EX0 A;  3CKC A;  1QZ2 A;  5BNW A;  3MKR A;  3Q49 B;  2UY1 A;  4Y6W A;  1QQE A;  3URZ A;  3RO3 A;  2PZI A;  3ULQ A;  2QFC A;  3RIB A;  2C0L A;  4RG6 A;  4BWR A;  4KXK B;  3CV0 A;  3BEE A;  4G25 A;  2VQ2 A;  4GZ5 A;  4ABN A;  4UQX A;  2C0M A;  3CK7 A;  5CHE E;  1A17 A;  3WXX A;  4WNG A;  3QWV A;  3ZPJ A;  3PDN A;  4UQY A;  2VSN A;  3NF1 A;  5KJL A;  3KD7 A;  4U07 A;  4YVQ C;  4N39 A;  2UY1 B;  4I2W A;  1IHG A;  2XCC A;  3S7J A;  4UI9 K;  4GZ6 A;  1HH8 A;  2DBA A;  4O6F A;  3PE3 A;  2PQN A;  3LY9 A;  3GZ2 A;  1KT0 A;  5G04 C;  3ZGQ A;  4XIF A;  4EQF A;  4WNF A;  3MV2 B;  4NQ0 A;  4GYO A;  4WND A;  4APO A;  2YQ8 A;  5ARF A;  4HOU A;  3TG5 A;  1KLX A;  4N5C A;  2XGO A;  2WQH A;  3CVN A;  4IN3 B;  2P58 C;  1WM5 A;  2JLB A;  4B94 A;  4N3B A;  4GA0 A;  3Q5M A;  5KJN A;  4I9C A;  2UWJ G;  3IEG A;  4N3C A;  5JJ6 A;  3S7D A;  4G26 A;  2C2L A;  1TJC A;  2BUG A;  2XPI A;  3ASG A;  3JYS A;  2FF4 A;  3ASH A;  1WAO 1;  1NA3 A;  3CKB A;  3O48 A;  4HOQ A;  3RKV A;  4I2Z A;  4U0U A;  3U3W A;  2HYZ A;  5CCM A;  3RJV A; 
#chains in the Genus database with same CATH topology
 3TGO A;  3FUH A;  3SFY A;  1H2U A;  1N52 A;  2EIM E;  1FT1 A;  3NQP A;  2F37 A;  2CHW A;  4HXI A;  4GML A;  5G04 J;  4BTA A;  4J8D A;  5FZR A;  4ANU A;  5LX8 A;  4V3I A;  1NL4 A;  2VSY A;  3AU4 A;  3MGB A;  4K5B A;  4WWN A;  2XZT G;  2R5S A;  4CT0 A;  3CQC B;  2WXN A;  3T8K A;  3QAQ A;  3LPZ A;  2RFM A;  1PY1 A;  4JL0 A;  5BV1 A;  1Z5S C;  2P9L G;  4I1A A;  5CCL A;  3CVY A;  2A4Z A;  2E2E A;  2KAT A;  2QC9 A;  4GZC A;  2KCK A;  3T9K A;  2H6F A;  3HYM B;  4F7A A;  3CVU A;  3AG1 E;  1OWN A;  4GU5 A;  4XE0 A;  3CHQ A;  3E33 A;  4FLH A;  4GB9 A;  1S63 A;  3SF4 A;  2EIL E;  4JEU A;  4L2Y A;  4J8F A;  5A23 A;  3VLF A;  4XKC A;  3N71 A;  2A5E A;  5ARG A;  3AS4 A;  4JHJ A;  2YHE A;  3PNT B;  5LCW J;  1O1R A;  3MKQ A;  3PVL A;  3UT4 A;  3FUD A;  2IO2 C;  3WG7 E;  4HRL A;  1BU9 A;  4BTB A;  3CIA A;  3E4B A;  4XI0 A;  3I4R B;  4OAV B;  4BES A;  3ESL A;  3D9L A;  4ZFH A;  4AP2 A;  2DYR E;  5D0O D;  3Q9N C;  3CK9 A;  1O1T A;  5AQA A;  1EF1 C;  3ZYM A;  5FQ4 A;  4TV3 A;  3JUI A;  3D9O A;  2WXP A;  4UI9 J;  3OXL A;  3UX4 A;  3U64 A;  2VYI A;  3MKQ B;  4FUL A;  2LAH A;  2WXM A;  4F6R D;  3FUI A;  4WUY A;  1JCQ A;  2NSZ A;  2Y4T A;  1TN8 A;  2R59 A;  3FP3 A;  4A1S A;  3RO2 A;  3AAA C;  1NA0 A;  3AG2 E;  3FH7 A;  3T5V A;  3R9A B;  2J8S D;  4ME2 A;  4DLO A;  3FU5 A;  4GYW A;  4RLY A;  3VLE A;  5D66 A;  2DZN A;  3C3Q A;  3ONL A;  2MHK A;  5KNH D;  4TRQ A;  4JPS A;  4MKT A;  1S64 A;  5ITZ F;  1KZO A;  4Y6C A;  4HLL A;  3V2O A;  4ZHB A;  2YIN A;  3B7T A;  3I3N A;  2P9N G;  1E8Z A;  2PNN A;  1UJK A;  4KYO B;  1D9S A;  1OY3 D;  2XS1 A;  1SZ9 A;  1TNU A;  1HXI A;  3ZIM A;  3SI5 A;  2P9U G;  3SY2 A;  1E7V A;  3AS5 A;  4G2V A;  1FVF A;  1NZN A;  2LO6 A;  3L08 A;  4BEP A;  3E30 A;  2XRY A;  1LTX A;  4Z68 A;  5FQ7 A;  3ULE G;  4URK A;  3PZD A;  4ANX A;  1MQS A;  3L82 A;  3QB2 A;  1OWO A;  4WNE A;  3HDX A;  1UN8 A;  5KJK A;  3L17 A;  1HO8 A;  3V30 A;  1E8X A;  5HI7 A;  2KCL A;  3AG3 E;  4GA2 A;  1E96 B;  5ENQ D;  4HRN A;  2QYJ A;  2DCP A;  2IU1 A;  4AXH A;  2IY0 C;  3HG0 D;  2XEE A;  4CDR A;  4CGV A;  3S7B A;  5CRV A;  2XZD G;  5FZQ A;  4O60 A;  1TYQ G;  1Q2Z A;  3TXM A;  4KBQ A;  2X3M A;  3FH8 A;  3RU0 A;  5G05 C;  4AY5 A;  4LCT A;  4LEU A;  4FJZ A;  4DI4 A;  3MV3 B;  4XZ4 A;  2J09 A;  2XCB A;  4GCN A;  4HQD A;  5BW8 C;  1UG3 A;  3QDN A;  3MJW A;  1QYM A;  4AM9 A;  1Y8M A;  1H19 A;  1W3B A;  2R17 C;  3PZ1 A;  5B3S E;  4GTV A;  2DIW A;  4AV7 A;  1OWP A;  2QY7 A;  4OYS A;  5LP0 A;  2XEH A;  3FTZ A;  4Y6W A;  4YDE A;  2ION A;  4FAD A;  2DVW A;  3ZU7 B;  2QFC A;  3NOG D;  5EIL A;  1FPP A;  5BV0 A;  2CFU A;  4G25 A;  3RRU A;  4DK5 A;  2AWI A;  3ZKJ A;  1D8E A;  2C0M A;  3CHM A;  3FUK A;  3ZYL A;  5C2Y A;  3TWS A;  2GRL A;  4WNG A;  3QWV A;  3PRE A;  3PDN A;  4UQY A;  3AU5 A;  2WXF A;  3SFZ A;  3NF1 A;  4BSX A;  5KJL A;  4U07 A;  3RSE G;  3R7R A;  4M7C A;  1NI1 A;  4I2W A;  1BI7 B;  5JMN D;  3S7J A;  1IHB A;  2Y69 E;  4C0M A;  3EJN A;  3PE3 A;  3GZ2 A;  3JUE A;  3V2X A;  4WNF A;  3MV2 B;  3R9M A;  4GYO A;  5JHA A;  1K3Z D;  2YQ8 A;  3UKR G;  5ENP D;  4MRU A;  4HOU A;  4C48 B;  2BKK B;  3HIZ A;  2CG2 A;  3QNK A;  2ILR A;  4LRZ A;  3LJ3 A;  3U9W A;  3C3R A;  1OWL A;  3CVN A;  3PEV B;  1OWM A;  2RFA A;  4DPR A;  4N3B A;  2IQC A;  3P2B A;  1YMP A;  5JJ6 A;  2F8X K;  1N4Q A;  2C2L A;  3ENE A;  3ASH A;  4U96 D;  2WMO A;  3SBS A;  5B1A E;  1GW6 A;  4ATZ D;  5ENT D;  1N0Q A;  1IQU A;  4GTS A;  3ONK A;  4FHK A;  4KMO A;  5CCM A;  3CST A;  5FIO A;  2P9K G;  4JHK A;  3UM0 A;  2J4B A;  3KSQ A;  4HOR A;  4APF A;  1MX4 A;  3CK8 A;  2VGX B;  4AJW A;  4Q69 A;  1EYH A;  2X6F A;  1E8Y A;  3QAR A;  1H6K A;  3Q7A A;  3R7Q A;  5KJM A;  4BX8 A;  1SW6 A;  3CVW A;  3U4T A;  2LSU A;  3PNL B;  5ENO D;  1D8D A;  3GYZ A;  3F6Q A;  3D9M A;  3QKY A;  3ZEF A;  1LD8 A;  4J8Y A;  3E37 A;  3C5R A;  3CVV A;  1DNP A;  1SQM A;  4MBG A;  3LY7 A;  4C9B B;  1JUQ A;  2IO3 C;  4U8H A;  1LF8 A;  1O5M A;  5LFA A;  3ZN3 A;  4H7X A;  5EDS A;  1ZU2 A;  3D9P A;  3B95 A;  3GW4 A;  1QBQ A;  2OOE A;  2X6J A;  5E75 A;  3JQ0 A;  2KCV A;  3OXG A;  2RKK A;  4OVU A;  2NXP A;  2VGY A;  3NAW A;  3C3O A;  1UOH A;  1TR4 A;  4W9R A;  2OV8 A;  3FFL A;  4HI9 A;  4D10 C;  1HZ4 A;  3D9J A;  3BUA A;  3CGH A;  3AG4 E;  5FIN A;  1HG2 A;  2WXI A;  4R7L A;  4BT9 A;  2VTB A;  3DSV A;  4I9E A;  2RG8 A;  4JHR A;  3EIJ A;  2BED A;  2HE0 A;  3HXE A;  2GW1 A;  5BUZ A;  4GCO A;  3LEW A;  4CZ2 D;  4JA7 A;  5LOZ A;  3Q79 A;  3KS2 A;  1BI8 B;  3B7U X;  4BY6 A;  3CVP A;  3QOU A;  4IUL A;  1ELW A;  1TNY A;  2PM6 A;  3FEY A;  2VSO E;  4GZD A;  3CSF A;  3EHQ A;  3G2T A;  2J9Q A;  3FTV A;  1TN6 A;  2VTB B;  2KBX A;  3L54 A;  3L16 A;  2ZU6 B;  5T3R A;  4LUN U;  2WXK A;  3B7B A;  1MX2 A;  5FTP A;  2H6H A;  4UWG A;  1N54 A;  1KPS B;  4JW1 A;  3IBE A;  4N2S A;  5D0Q D;  4NRH B;  1SVX A;  4BER A;  3ZW3 A;  2AXV A;  2J49 A;  4CRW A;  2X6H A;  4PS8 A;  2NYJ A;  4CEM A;  3J5Q B;  3X2Q E;  3PH0 C;  3RRN B;  3I4G A;  4GPM A;  4DX6 D;  1TNB A;  3AJI A;  1YYH A;  3KAE A;  1HS6 A;  4B8C B;  4GTM A;  1N94 A;  4EZJ A;  1MYO A;  3ASF A;  5HKP A;  3NZS A;  1MZC A;  3UM2 A;  5EX3 A;  2FI7 A;  3P1U A;  4FU3 A;  4MS6 A;  3UQ3 A;  2FO1 E;  3NOC D;  5G05 J;  4LG6 A;  4CDN A;  3GZ1 A;  4O1O A;  3PZ4 A;  1DC2 A;  4QQI A;  3RK6 A;  3D9I A;  4U7E B;  4J8E A;  3RAU A;  3APF A;  4CGW A;  2GRR B;  2WMN A;  1BLX B;  3UPV A;  4G23 A;  5B1B E;  4BSZ B;  4FP7 A;  5KCM A;  2WM9 A;  1RW2 A;  5ENN A;  3QC1 A;  5HQ8 A;  1S70 B;  2AVP A;  1VDY A;  4XKB A;  4ACL A;  3FWV A;  3D9K A;  3MZL B;  4YVO A;  3L9T A;  3Q75 A;  4BT8 A;  3SQV A;  4AEZ C;  2XGS A;  5AQB A;  4HBD A;  3VLD A;  1FT2 A;  3ZFW A;  4BFR A;  3S7F A;  4LNB A;  2R05 A;  5CEC B;  2DWZ A;  3G2S A;  3LXU X;  1HE8 A;  1JCS A;  4XI9 A;  1AP7 A;  4TUM A;  3LCA A;  3I5P A;  2JAB A;  4U04 A;  4CDM A;  3HVE A;  1A5E A;  1QZ2 A;  5JHB A;  5BNW A;  3MKR A;  3TWU A;  2UY1 A;  1Z3X A;  3JXJ A;  4KZ0 A;  3FTU A;  2I1K A;  3ZVV A;  2YNQ A;  3RO3 A;  3ULQ A;  2B6C A;  2EIJ E;  3FEX A;  4GMR A;  3RIB A;  3IHY A;  2C0L A;  4KXK B;  4AVX A;  3BEE A;  3UT7 A;  3SGH A;  2GRO B;  4GZ5 A;  4L1B A;  2R02 A;  5CHE E;  3Q7F A;  1A17 A;  5T4Y A;  1E8W A;  3MCX A;  1ZB1 A;  4GTO A;  3WXX A;  3ZPJ A;  3HVE B;  2VJ8 A;  3NB2 A;  2VSN A;  2BF0 X;  1N4P A;  4YVQ C;  1DVP A;  2UY1 B;  1LD7 A;  1IHG A;  2IOL A;  2XCC A;  4L23 A;  4UI9 K;  5AAO A;  2OVB A;  2R03 A;  1X5B A;  4O6F A;  1UW4 B;  1E90 A;  4G8K A;  5G04 C;  2VSX E;  4UWF A;  2WXO A;  4WND A;  1S0P A;  3CLJ A;  4APO A;  3TWX A;  4TXP A;  5ARF A;  4ILI A;  3TG5 A;  2XS8 A;  3PZ3 A;  2ZGD A;  1KLX A;  2XGO A;  3CHO A;  2WQH A;  1TJF A;  3DRA A;  5CRU A;  5EYP F;  4FJY A;  3DSS A;  4UWK A;  2JLB A;  4HRM B;  4B94 A;  4I6E A;  3ZNG A;  4ILH B;  2QZA A;  2AXZ A;  5KBA A;  3W9G A;  1TJC A;  2WXG A;  3ASG A;  2FF4 A;  3ASO E;  3NZU A;  3FUL A;  1BPO A;  4U95 D;  1WAO 1;  2GGF A;  3ML9 A;  3O48 A;  3W9F A;  3IXE A;  3U3W A;  4DX2 A;  5T8I A;  2CHZ A;  4WAF A;  3LKU A;  1L5J A;  1K1A A;  4ACK A;  3D9N A;  3CHP A;  4NUR A;  2WB2 A;  5EID A;  5G2N A;  3PE4 A;  3JQ1 A;  2WPV A;  5HRY A;  2ZIR A;  4Q94 A;  5LCW C;  4NAC A;  3CVL A;  4DUI A;  5DIZ A;  4EEC A;  1WG0 A;  3TJP A;  3FUE A;  3DWL G;  2LXM A;  1B89 A;  1HX8 A;  1HF8 A;  2OCC E;  4PH4 B;  3ESK A;  2J4D A;  4YDO A;  5A6C A;  2XEV A;  2Y1L E;  1OXJ A;  1INZ A;  3T5X A;  3TWW A;  1YA0 A;  3FH5 A;  2X6I A;  2V4H C;  3FUM A;  5EKQ D;  3ABM E;  5AJL A;  2WXH A;  3MYV A;  5FJY A;  2OND A;  1ELR A;  2GRQ B;  3DST A;  1H6O A;  1Y6I A;  2ZGG A;  5D2M C;  3KSL A;  4N3A A;  1K1B A;  3EU5 A;  2Y3A A;  5FWQ A;  1N9A A;  3CVQ A;  3SD5 A;  3EHR A;  2BTD A;  2VGX A;  3TWV A;  4IYP A;  1SZA A;  4NIK A;  2KM4 A;  2H6I A;  3FTY A;  4GMJ A;  2Q7F A;  1OCC E;  4DX7 D;  3G2V A;  1N0R A;  3HXC A;  2AJA A;  4KT6 B;  2F8Y A;  2LNI A;  3TWQ A;  4FA6 A;  3PUJ A;  3PEU B;  1HG5 A;  1N95 A;  3TG4 A;  1TNZ A;  3DSU A;  3DPY A;  4RVB A;  4HOS A;  3D3M A;  4JA9 A;  5KNG A;  2Y4U A;  3APC A;  1DCE A;  2QYU A;  4UWL A;  2IEJ A;  4G1T A;  4GTP A;  2EIK E;  3UM1 A;  3C98 A;  3LY8 A;  1JCR A;  3BU8 A;  1NFI E;  4GA1 A;  1H2T C;  1MX6 A;  3ABK E;  3LS8 A;  4B89 A;  5FZS A;  3SO8 A;  2LSV A;  1X81 A;  4YDW A;  4PS3 A;  4E6H A;  3ZHE B;  1HFA A;  4G11 A;  5EIB E;  4E85 A;  3DXK G;  2IF4 A;  3TWT A;  2V0P A;  4AOF A;  4H7Y A;  3FU6 A;  3DPD A;  5BXU A;  3LJN A;  4OAU C;  3TL5 A;  3CQG B;  2XQ0 A;  4F3V A;  3UM3 A;  3ASD A;  4X8Q A;  2BKG A;  2OEW A;  4JB8 P;  1SA4 A;  3CHS A;  3S2A A;  4C0E A;  3SFX A;  1V54 E;  1PC2 A;  2ETC A;  3CEQ A;  1U3D A;  1Z6T A;  2MOW A;  3ZXP A;  4DRX E;  3UI2 A;  2NC9 A;  3JXI A;  5BT1 A;  4J0U A;  4UUC A;  3UT8 A;  2AW6 A;  4F53 A;  3EUV A;  1TNO A;  5ENS D;  5HS0 A;  4UQZ A;  2FBN A;  2WXJ A;  3B7S A;  3Q9U C;  4RSY A;  2P9P G;  3VTY A;  4N5Q A;  2FO7 A;  1E7U A;  1OCR E;  3HXD A;  3ISM C;  3J5P A;  1JPL A;  4LNU D;  4HVB A;  3EHN A;  1IKN D;  1K8K G;  3APD A;  3C72 A;  5FT9 A;  2V5F A;  1FVH A;  4GTR A;  4ANW A;  3O4Z A;  2P2C P;  5AN8 A;  1H2V C;  4EZK A;  4B8A A;  3ULY A;  1U2V G;  3MA5 A;  5CMW A;  4A63 B;  3G2U A;  1KT1 A;  4K5A B;  2LAI A;  3G2W A;  1IQR A;  3BQO A;  3Q49 B;  2GRN B;  1QQE A;  3URZ A;  4CCA A;  1H6P A;  1XGW A;  4TUU A;  4PUC A;  4RG6 A;  3LDZ A;  4BWR A;  3LVQ E;  1V55 E;  2VQ2 A;  4ABN A;  3CK7 A;  3JCK C;  3DSX A;  2P9S G;  3TXN A;  4KVO A;  3FHE A;  2X38 A;  1PAQ A;  4HB5 A;  3KD7 A;  4N39 A;  2EQX A;  4OVV A;  3UXG A;  4I6G A;  3L6A A;  4CT4 A;  4GZ6 A;  3FTX A;  2XHE A;  2PQN A;  3LY9 A;  2WQ7 A;  1KT0 A;  3ZGQ A;  4EZL A;  3MX3 A;  4J6I A;  2OEV A;  4I1O B;  2E0I A;  1O1S A;  2MRI A;  4DJA A;  3Q78 A;  4IN3 B;  2IJG X;  4EBA G;  1WM5 A;  1TN7 A;  4KZC A;  4WWO A;  4I43 A;  4DX5 D;  4GA0 A;  3Q5M A;  2DZO A;  5KJN A;  3KEZ A;  4I9C A;  2UWJ G;  3IEG A;  3NBN B;  3S7D A;  2CG3 A;  4TXR A;  3ZYK A;  4QFV A;  1KZP A;  2IOS A;  3ZUV B;  3FU3 A;  2XPY A;  4GTQ A;  3FU0 A;  4I1M A;  3CKB A;  4HOQ A;  1EPU A;  5ANR A;  3RKV A;  4I2Z A;  4U0U A;  3D9H A;  4LER A;  4JZY A;  4DI3 A;  3E34 A;  3EU9 A;  4A3V A;  3ML8 A;  2WXQ A;  4FC8 A;  3SHF A;  2GRP B;  4U0S A;  2AXU A;  3LYA A;  5DBK A;  3ZRH A;  2CFZ A;  1SA5 A;  2OVF A;  4MLP A;  3UKU G;  3FY4 A;  4I17 A;  2WXL A;  4DX1 A;  4ILG A;  4A3T A;  2IFU A;  5G55 A;  3QJZ A;  2PM7 A;  1ELK A;  3AS8 A;  3L13 A;  5E76 A;  2M63 A;  2V8S E;  2MYO A;  3KEA A;  2KXP C;  4RQI A;  3HXF A;  4YND A;  4TXQ A;  4L2L A;  1MHQ A;  2B0O E;  1DCQ A;  3B13 A;  3QK0 A;  1N4S A;  1H0A A;  1IYG A;  3MEK A;  1YCS B;  2J08 A;  2XGM A;  3Q47 B;  5CBO A;  3QWP A;  1JWF A;  4DLQ A;  3CHR A;  5H7P A;  5BXO A;  3HRA A;  4A1G A;  4JC8 A;  2P9I G;  3T8M A;  4M3O A;  5J90 A;  3FDH A;  3V31 A;  5CER B;  4AY6 A;  3B7R L;  1OCZ E;  1IXV A;  1ZBP A;  3QWW A;  3LVR E;  5JJ7 A;  2ETA A;  3PRZ A;  2LUH A;  2HO1 A;  3U66 A;  4G24 A;  3V79 K;  4GTT A;  4GAA A;  4U0Z A;  3DEP A;  5AAR A;  3CR3 A;  1P5Q A;  5JJT A;  1U3C A;  3Q4A B;  5KWD A;  4A55 A;  1OCO E;  2F0Y A;  2WVI A;  5FQ6 A;  5CBN A;  3DEO A;  2R2L A;  4P29 A;  4O1P A;  2ETB A;  2HM8 A;  5M72 A;  3OXF A;  4K0R A;  1WY6 A;  4CYM D;  5AYW D;  2FUL A;  2PL2 A;  1N11 A;  4FLB A;  4U63 A;  3SNX A;  2I1J A;  5J08 A;  2H6G A;  1N4R A;  2I6H A;  1NP7 A;  4N2Q A;  2VGE A;  4GYY A;  4UI9 C;  4LSZ E;  1OT8 A;  4GZ3 A;  4L7T A;  4AIF A;  5IY5 E;  1OUV A;  3FUF A;  4RG9 A;  4G8L A;  2HR2 A;  3DXM G;  4K5C A;  3ZXS A;  3FTS A;  3L22 A;  3IKO B;  2XRZ A;  2L6J A;  2XPZ A;  2I2O A;  2A5U A;  4XX5 A;  4IRU A;  2L9B A;  4ANV A;  4EPZ A;  4ATG A;  2Y0B G;  3TAX A;  1TEZ A;  2FEZ A;  4FHJ A;  1XNF A;  2EIN E;  3EDT B;  3VTX A;  4UWH A;  2XEN A;  3UUX A;  4KVM A;  3BG1 B;  2DYS E;  3K9I A;  4WWP A;  3ZYQ A;  4BX9 A;  3Q73 A;  3PS6 A;  3UIO C;  3FTW A;  1JWG A;  2KC7 A;  5FQ8 A;  5CED B;  3TWR A;  4HOT A;  5AJD A;  3PZ2 A;  1FCH A;  2CHX A;  3HHM A;  4K03 A;  3ZHE A;  3SZ7 A;  4U8Y D;  2PQR A;  1Z3Y A;  1WDY A;  2YHC A;  3UMV A;  3ABL E;  4EBA A;  4HS2 A;  5A7D B;  1EDU A;  4JEH A;  4HLE A;  5C1D A;  3PUK A;  1QNF A;  3Q15 A;  1RZ4 A;  2X6K A;  5CMY A;  4GPK A;  2JEK A;  4B0Z A;  2WXR A;  2WQ6 A;  3E32 A;  4PS7 A;  5EX0 A;  4XEI G;  3CKC A;  5AIJ A;  3UIN C;  4HI8 A;  4EHM A;  4F1S A;  3RRM B;  2PZI A;  1HU3 A;  3BG0 B;  3IHV A;  4HFG A;  4J8S A;  4JXT A;  3CV0 A;  3EIQ C;  5BPP A;  4UQX A;  4B93 B;  2LXL A;  4I6J A;  1G3N B;  4U8V D;  3CVX A;  4JVS A;  4HNA D;  5AQ7 A;  4F1P A;  2V5Q C;  2L6B A;  5JA4 D;  2KZT A;  4BET A;  2ZXW E;  2ZIS A;  3UIP C;  3FUJ A;  1HH8 A;  2DBA A;  3DBS A;  1BD8 A;  3SBT B;  3DSW A;  1UN9 A;  2GRM A;  5EN5 D;  4PDX A;  4XIF A;  4EQF A;  4NQ0 A;  1AWC B;  2I9C A;  2J07 A;  5CEA A;  4YDY A;  1UJJ A;  4LNG A;  3EHM A;  3UTM A;  1MJ0 A;  2L0I A;  3HXB A;  4N5C A;  4JD2 G;  2V4L A;  3OAW A;  3IV0 A;  3FUN A;  2P58 C;  2L0T B;  4Q96 A;  2KZT B;  4L9P A;  5AQ9 A;  3ASN E;  4N3C A;  4G26 A;  2BUG A;  2XPI A;  3JYS A;  5EYL A;  3OTN A;  5ENR D;  5ANL A;  1NA3 A;  2RD0 A;  3GZS A;  5AEN A;  4J7W A;  2HYZ A;  3RJV A; 
#chains in the Genus database with same CATH homology
 3CST A;  1L5J A;  3LKU A;  4ACK A;  4DI3 A;  4JHK A;  3TGO A;  3D9N A;  4A3V A;  2J4B A;  3ML8 A;  3FUH A;  2WXQ A;  4APF A;  3CHP A;  4FC8 A;  3CK8 A;  4NUR A;  4HOR A;  1H2U A;  2VGX B;  2WB2 A;  4AJW A;  3SHF A;  4Q69 A;  1N52 A;  1EYH A;  5G2N A;  2X6F A;  3NQP A;  1E8Y A;  3PE4 A;  4U0S A;  3JQ1 A;  2WPV A;  1H6K A;  3QAR A;  2CHW A;  4HXI A;  3R7Q A;  2AXU A;  5KJM A;  4GML A;  3LYA A;  5DBK A;  3ZRH A;  5G04 J;  4BTA A;  2CFZ A;  4BX8 A;  4Q94 A;  5LCW C;  2OVF A;  4NAC A;  3CVW A;  3CVL A;  4J8D A;  4MLP A;  3U4T A;  5FZR A;  4ANU A;  5LX8 A;  5DIZ A;  4EEC A;  4V3I A;  3TJP A;  3FUE A;  2VSY A;  2LSU A;  3PNL B;  3GYZ A;  3D9M A;  3AU4 A;  3FY4 A;  1B89 A;  3QKY A;  3ZEF A;  3MGB A;  4I17 A;  4WWN A;  2WXL A;  4ILG A;  4A3T A;  3CVV A;  1HX8 A;  1DNP A;  1SQM A;  1HF8 A;  2IFU A;  3QJZ A;  5G55 A;  2R5S A;  3LY7 A;  4C9B B;  4CT0 A;  3CQC B;  2WXN A;  1JUQ A;  4U8H A;  2PM7 A;  1ELK A;  3QAQ A;  3LPZ A;  1LF8 A;  3AS8 A;  3L13 A;  5LFA A;  5E76 A;  2M63 A;  4PH4 B;  2V8S E;  3ZN3 A;  3ESK A;  2J4D A;  4H7X A;  5EDS A;  5A6C A;  2XEV A;  1ZU2 A;  1PY1 A;  3D9P A;  3GW4 A;  4JL0 A;  5BV1 A;  4I1A A;  2OOE A;  2X6J A;  5E75 A;  5CCL A;  1INZ A;  3CVY A;  4YND A;  2A4Z A;  2E2E A;  2KAT A;  3T5X A;  3JQ0 A;  4GZC A;  2KCK A;  1YA0 A;  3FH5 A;  2X6I A;  3HYM B;  4F7A A;  4L2L A;  2KCV A;  3CVU A;  3FUM A;  3OXG A;  5EKQ D;  5AJL A;  1OWN A;  2WXH A;  4GU5 A;  4XE0 A;  3CHQ A;  1MHQ A;  3MYV A;  4FLH A;  3B13 A;  4GB9 A;  5FJY A;  2OND A;  1ELR A;  3QK0 A;  4OVU A;  2NXP A;  3SF4 A;  2VGY A;  1H0A A;  1Y6I A;  1IYG A;  4JEU A;  4L2Y A;  3MEK A;  2OV8 A;  4W9R A;  3FFL A;  4J8F A;  4D10 C;  4N3A A;  5A23 A;  3VLF A;  4XKC A;  1HZ4 A;  3D9J A;  3N71 A;  2J08 A;  2XGM A;  3CGH A;  5ARG A;  3AS4 A;  4JHJ A;  3Q47 B;  2YHE A;  3PNT B;  2Y3A A;  5FWQ A;  5LCW J;  3CVQ A;  3SD5 A;  3MKQ A;  1HG2 A;  2BTD A;  2WXI A;  4R7L A;  2VGX A;  3QWP A;  4BT9 A;  3PVL A;  1JWF A;  4IYP A;  3UT4 A;  1SZA A;  4DLQ A;  2VTB A;  3FUD A;  3CHR A;  2KM4 A;  2RG8 A;  4I9E A;  4JHR A;  3EIJ A;  3FTY A;  4GMJ A;  4BTB A;  4A1G A;  2Q7F A;  3CIA A;  2GW1 A;  3E4B A;  3G2V A;  3I4R B;  4XI0 A;  5BUZ A;  4JC8 A;  4GCO A;  3LEW A;  4KT6 B;  3T8M A;  2LNI A;  3ESL A;  3D9L A;  3PUJ A;  4JA7 A;  3PEU B;  5ANL A;  5LOZ A;  4FA6 A;  1HG5 A;  3KS2 A;  3B7U X;  3TG4 A;  4M3O A;  4AP2 A;  4BY6 A;  3CVP A;  5D0O D;  3QOU A;  5J90 A;  3CK9 A;  3FDH A;  4IUL A;  1ELW A;  4WAF A;  4AY6 A;  3B7R L;  2PM6 A;  3FEY A;  1EF1 C;  2VSO E;  5FQ4 A;  3ZYM A;  4RVB A;  1ZBP A;  4TV3 A;  3QWW A;  4GZD A;  3LVR E;  4HOS A;  5JJ7 A;  3D3M A;  3CSF A;  3JUI A;  4JA9 A;  3PRZ A;  3D9O A;  2WXP A;  4UI9 J;  3OXL A;  3G2T A;  3UX4 A;  3U64 A;  2HO1 A;  2VYI A;  2Y4U A;  4G24 A;  3U66 A;  3APC A;  2J9Q A;  3MKQ B;  3FTV A;  4FUL A;  4UWL A;  4GAA A;  4U0Z A;  2LAH A;  2VTB B;  3L54 A;  2WXM A;  3L16 A;  3FUI A;  2ZU6 B;  4WUY A;  5T3R A;  2NSZ A;  2Y4T A;  4LUN U;  4G1T A;  3CR3 A;  2R59 A;  3FP3 A;  4A1S A;  1P5Q A;  3C98 A;  5JJT A;  1U3C A;  3LY8 A;  3RO2 A;  3Q4A B;  2WXK A;  4A55 A;  2WVI A;  5FQ6 A;  5FTP A;  1NA0 A;  3FH7 A;  3T5V A;  4UWG A;  4GA1 A;  1H2T C;  3R9A B;  4P29 A;  1N54 A;  3LS8 A;  4JW1 A;  2HM8 A;  5M72 A;  4B89 A;  5FZS A;  3IBE A;  3OXF A;  4ME2 A;  4N2S A;  4K0R A;  1WY6 A;  5D0Q D;  4DLO A;  4NRH B;  2LSV A;  5AYW D;  2FUL A;  3FU5 A;  3ZW3 A;  4GYW A;  2AXV A;  2J49 A;  4CRW A;  2PL2 A;  3VLE A;  2X6H A;  4PS3 A;  4FLB A;  4PS8 A;  3ONL A;  4U63 A;  4E6H A;  2MHK A;  4CEM A;  4TRQ A;  3PH0 C;  3SNX A;  3ZHE B;  1HFA A;  4G11 A;  4JPS A;  4MKT A;  3RRN B;  2I1J A;  3I4G A;  5J08 A;  4E85 A;  2I6H A;  1NP7 A;  4Y6C A;  2IF4 A;  2YIN A;  2V0P A;  3B7T A;  3KAE A;  4N2Q A;  3I3N A;  1HS6 A;  4B8C B;  4GYY A;  4UI9 C;  4AOF A;  1E8Z A;  4H7Y A;  4GZ3 A;  4EZJ A;  4L7T A;  4AIF A;  3FU6 A;  1UJK A;  3ASF A;  3DPD A;  4KYO B;  3NZS A;  1OUV A;  1SZ9 A;  3FUF A;  5EX3 A;  3TL5 A;  2FI7 A;  3CQG B;  4RG9 A;  2XQ0 A;  4F3V A;  3P1U A;  1HXI A;  4FU3 A;  3ASD A;  3ZIM A;  3SI5 A;  4MS6 A;  2HR2 A;  3UQ3 A;  1E7V A;  3ZXS A;  5G05 J;  3FTS A;  3AS5 A;  3L22 A;  3GZ1 A;  4CDN A;  3IKO B;  2XRZ A;  4G2V A;  2L6J A;  2XPZ A;  3CHS A;  3S2A A;  4C0E A;  1FVF A;  1NZN A;  1PC2 A;  2LO6 A;  3L08 A;  3RK6 A;  2I2O A;  2A5U A;  3CEQ A;  3D9I A;  1U3D A;  4XX5 A;  1Z6T A;  4IRU A;  2XRY A;  4J8E A;  2L9B A;  4ANV A;  4EPZ A;  4ATG A;  2MOW A;  3APF A;  2NC9 A;  4CGW A;  5FQ7 A;  2WMN A;  3TAX A;  1TEZ A;  4URK A;  3UPV A;  4G23 A;  2FEZ A;  3PZD A;  4J0U A;  5BT1 A;  4FHJ A;  2AW6 A;  3UT8 A;  1MQS A;  4ANX A;  3QB2 A;  4F53 A;  1XNF A;  4FP7 A;  1OWO A;  5KCM A;  2WM9 A;  3EDT B;  5ENN A;  3VTX A;  4WNE A;  3HDX A;  4UWH A;  3QC1 A;  3UUX A;  4KVM A;  3BG1 B;  1UN8 A;  5KJK A;  3L17 A;  3K9I A;  1HO8 A;  5HQ8 A;  2FBN A;  1E8X A;  2WXJ A;  2KCL A;  3B7S A;  4UQZ A;  4RSY A;  4WWP A;  4GA2 A;  1E96 B;  5HI7 A;  2AVP A;  3VTY A;  3PS6 A;  1VDY A;  2FO7 A;  2DCP A;  1E7U A;  2IU1 A;  3FTW A;  1JWG A;  4XKB A;  4ACL A;  3FWV A;  4AXH A;  2KC7 A;  3D9K A;  3MZL B;  5FQ8 A;  1JPL A;  4HVB A;  4YVO A;  3EHN A;  4BT8 A;  4HOT A;  4CDR A;  4CGV A;  3S7B A;  3APD A;  5AJD A;  5FT9 A;  1FCH A;  2CHX A;  5FZQ A;  4AEZ C;  2XGS A;  3HHM A;  4K03 A;  3ZHE A;  3SZ7 A;  2PQR A;  3TXM A;  1Z3Y A;  2V5F A;  2X3M A;  3FH8 A;  2YHC A;  4KBQ A;  1FVH A;  3UMV A;  3VLD A;  3RU0 A;  5G05 C;  3ZFW A;  4BFR A;  4EBA A;  4ANW A;  4AY5 A;  4HS2 A;  5A7D B;  3O4Z A;  3S7F A;  4LCT A;  1EDU A;  4LEU A;  4JEH A;  4HLE A;  1H2V C;  4FJZ A;  4DI4 A;  4EZK A;  5C1D A;  3MV3 B;  4B8A A;  3G2S A;  1QNF A;  3LXU X;  2J09 A;  3PUK A;  2XCB A;  3Q15 A;  4XZ4 A;  4GCN A;  1HE8 A;  4XI9 A;  5BW8 C;  3MA5 A;  1UG3 A;  5CMW A;  3QDN A;  3MJW A;  2X6K A;  5CMY A;  1Y8M A;  3LCA A;  1H19 A;  4AM9 A;  4GPK A;  2JEK A;  1W3B A;  4B0Z A;  2R17 C;  3G2U A;  2DIW A;  2WXR A;  3I5P A;  2WQ6 A;  1KT1 A;  4U04 A;  4AV7 A;  4CDM A;  3HVE A;  4PS7 A;  1OWP A;  5EX0 A;  3CKC A;  1QZ2 A;  5AIJ A;  5JHB A;  2LAI A;  2QY7 A;  1IQR A;  3G2W A;  3MKR A;  4OYS A;  5BNW A;  5LP0 A;  3Q49 B;  2UY1 A;  1Z3X A;  3FTZ A;  4Y6W A;  1QQE A;  4KZ0 A;  3URZ A;  2ION A;  3FTU A;  4FAD A;  2I1K A;  3ZVV A;  4BX9 A;  4F1S A;  2YNQ A;  3RO3 A;  3RRM B;  4CCA A;  1XGW A;  4TUU A;  2PZI A;  1HU3 A;  4PUC A;  3ULQ A;  2QFC A;  3BG0 B;  3FEX A;  3IHV A;  4HFG A;  4J8S A;  3RIB A;  3IHY A;  5BV0 A;  2C0L A;  3LDZ A;  4RG6 A;  4BWR A;  4JXT A;  4KXK B;  3CV0 A;  3EIQ C;  4AVX A;  3BEE A;  2CFU A;  3LVQ E;  3UT7 A;  3SGH A;  4G25 A;  2VQ2 A;  4GZ5 A;  4ABN A;  5BPP A;  4UQX A;  3RRU A;  4DK5 A;  2AWI A;  4I6J A;  2C0M A;  3CHM A;  4L1B A;  3CK7 A;  3FUK A;  3JCK C;  3ZYL A;  3CVX A;  5CHE E;  5C2Y A;  1A17 A;  3TXN A;  4KVO A;  5T4Y A;  4JVS A;  1E8W A;  3MCX A;  3FHE A;  3WXX A;  2GRL A;  4WNG A;  3QWV A;  3PRE A;  3ZPJ A;  3HVE B;  2VJ8 A;  2X38 A;  3PDN A;  4UQY A;  1PAQ A;  2KZT A;  2VSN A;  2BF0 X;  3AU5 A;  2WXF A;  3SFZ A;  3NF1 A;  4BSX A;  3KD7 A;  4U07 A;  5KJL A;  4YVQ C;  3R7R A;  1DVP A;  4N39 A;  2EQX A;  2UY1 B;  4OVV A;  4I6G A;  4I2W A;  3L6A A;  1IHG A;  2IOL A;  3FUJ A;  4CT4 A;  2XCC A;  3S7J A;  4L23 A;  4UI9 K;  4GZ6 A;  1HH8 A;  2DBA A;  3FTX A;  3DBS A;  2OVB A;  4C0M A;  1X5B A;  3EJN A;  2XHE A;  4O6F A;  3SBT B;  3PE3 A;  2PQN A;  3LY9 A;  1UN9 A;  3GZ2 A;  1UW4 B;  2GRM A;  2WQ7 A;  1E90 A;  1KT0 A;  5G04 C;  3ZGQ A;  4EZL A;  4PDX A;  2VSX E;  3MX3 A;  4UWF A;  4XIF A;  2WXO A;  4WNF A;  4J6I A;  3ZYQ A;  4I1O B;  4EQF A;  3MV2 B;  2E0I A;  4NQ0 A;  5JHA A;  2MRI A;  1S0P A;  4GYO A;  4WND A;  2I9C A;  2J07 A;  3CLJ A;  4APO A;  1UJJ A;  2YQ8 A;  5ARF A;  3EHM A;  4ILI A;  4MRU A;  4HOU A;  3TG5 A;  1KLX A;  2L0I A;  4DJA A;  3HIZ A;  2CG2 A;  4N5C A;  3QNK A;  2ILR A;  2XGO A;  3CHO A;  2V4L A;  3OAW A;  2WQH A;  4LRZ A;  3LJ3 A;  3U9W A;  1OWL A;  3CVN A;  3IV0 A;  1TJF A;  2P58 C;  3FUN A;  2IJG X;  3PEV B;  4IN3 B;  2L0T B;  4FJY A;  4Q96 A;  4EBA G;  1OWM A;  1WM5 A;  2KZT B;  4UWK A;  2JLB A;  4KZC A;  4B94 A;  4DPR A;  4I6E A;  4WWO A;  4N3B A;  4I43 A;  4ILH B;  4GA0 A;  3Q5M A;  2IQC A;  3P2B A;  5KJN A;  3KEZ A;  4I9C A;  2UWJ G;  3IEG A;  2AXZ A;  4N3C A;  5JJ6 A;  3S7D A;  2CG3 A;  4G26 A;  2C2L A;  1TJC A;  2BUG A;  2WXG A;  2XPI A;  3ASG A;  3ZYK A;  3JYS A;  4QFV A;  2FF4 A;  3ASH A;  3ENE A;  2IOS A;  3FU3 A;  2XPY A;  3NZU A;  2WMO A;  3FU0 A;  3SBS A;  3FUL A;  3OTN A;  4I1M A;  1BPO A;  1GW6 A;  1NA3 A;  1WAO 1;  2GGF A;  2RD0 A;  3CKB A;  3GZS A;  1EPU A;  3ML9 A;  3O48 A;  4HOQ A;  5ANR A;  3RKV A;  4I2Z A;  4U0U A;  3U3W A;  5AEN A;  1IQU A;  4LER A;  5T8I A;  2CHZ A;  3ONK A;  4JZY A;  4FHK A;  4KMO A;  2HYZ A;  5CCM A;  3RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...