3ASDA

Mama r50e mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
137
structure length
137
Chain Sequence
FDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
molecule keywords MamA
total genus 53
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asdA00
2VSNA 2VGXA 2PZIA 4H7YA 4I9EA 4GYOA 5M72A 3URZA 3CK9A 5D0QD 5BT1A 2IFUA 2XCCA 2KC7A 3RO3A 2HYZA 5KJKA 4CGWA 4J8DA 2VSYA 3ASHA 4JHRA 4RG6A 5G05C 5LCWC 1ZBPA 2VGXB 4J0UA 4ME2A 2OOEA 3S7DA 5CCLA 2FEZA 1KLXA 4H7XA 2Y4UA 4G25A 4U04A 3ZPJA 4HOUA 4APOA 2KCLA 4YVOA 4YNDA 3TAXA 4ABNA 5FZSA 3LY8A 1Y8MA 2AVPA 5DIZA 4GZ3A 5ARFA 3MEKA 1TJCA 3ASFA 3QWWA 4JA9A 2DBAA 3MA5A 1YA0A 3CK8A 5G04J 4BTAA 3VTXA 1WAO1 4WNDA 4UI9J 3ULQA 5LCWJ 3KD7A 2E2EA 2C2LA 2KCVA 4RG9A 2VYIA 2XGOA 4UQYA 4CDRA 2WPVA 4WNFA 5EKQD 4KYOB 3PE3A 4NQ0A 2LSUA 4N3CA 5FT9A 2ONDA 4G26A 3TG5A 2XPIA 2LNIA 3Q15A 3ZN3A 2VGYA 4GYWA 3ESKA 2YHCA 4AY6A 1FCHA 2PQNA 2PQRA 3IEGA 2MHKA 3LCAA 4W9RA 2JLBA 5G05J 4UQZA 2FO7A 3CVLA 3OXLA 4GA2A 4GZ6A 4BT8A 3UUXA 3PDNA 3U3WA 3VTYA 1KT0A 5FTPA 4U0ZA 3LYAA 1QQEA 2J9QA 3JYSA 3NF1A 5KJNA 2FI7A 3LY7A 5FZRA 4GA0A 3R9AB 3TG4A 4YVQC 1PC2A 3CKBA 2Q7FA 3PE4A 2KCKA 2C0MA 4NRHB 2UWJG 3LPZA 3ASDA 4XI0A 3S7JA 2HO1A 4HOSA 2BUGA 3K9IA 1IHGA 5D0OD 5BNWA 4N2SA 4I9CA 3QWPA 3TGOA 3GW4A 3RO2A 4B94A 1OUVA 4U07A 3RIBA 4EQFA 1ELRA 1IYGA 4J8FA 4WNEA 1HH8A 5FZQA 4F3VA 5C1DA 4LEUA 4U0SA 4KXKB 4UQXA 3OXGA 3AS8A 1NA3A 4XIFA 4AM9A 1ZU2A 5EX0A 3CKCA 3QKYA 1E96B 2R5SA 2XGMA 3CK7A 3KAEA 3HYMB 4I1AA 5FJYA 3RKVA 3UQ3A 4WNGA 1P5QA 4A1SA 4GPKA 5JJTA 2Y4TA 3FFLA 4JL0A 4Y6WA 2L6JA 2VQ2A 3GZ2A 3N71A 3Q4AB 3QDNA 4GZ5A 4G1TA 3CVNA 3WXXA 3ZGQA 4GCOA 4UI9K 2QFCA 5JJ6A 3EDTB 3Q49B 4J8EA 3QOUA 3ZFWA 4HOTA 3LY9A 3O48A 2I6HA 1QZ2A 4HOQA 3CV0A 1A17A 4GA1A 4I2ZA 2LSVA 5HI7A 3S7BA 5HQ8A 3SF4A 5CHEE 4GYYA 2HR2A 4BWRA 3GYZA 1XNFA 3AS5A 4N3AA 3AS4A 2FF4A 3OXFA 5A7DB 5KJLA 4CGVA 4N3BA 2WQHA 3ASGA 3RU0A 3ZHEA 4AY5A 3RJVA 4BT9A 1B89A 1W3BA 3QWVA 2IF4A 3E4BA 3LKUA 4O6FA 1ELWA 2NC9A 3GZ1A 5EX3A 3S7FA 1KT1A 3FP3A 3MV3B 4WUYA 5AYWD 1NA0A 4N39A 2UY1B 4N5CA 4G23A 4JA7A 4U0UA 4Y6CA 5ARGA 3MKRA 4IN3B 1WM5A 5KJMA 2GW1A 3Q5MA 5A6CA 4BTBA 4HORA 2UY1A 3UPVA 3BEEA 3CVQA 2V5FA 4I2WA 5G04C 4GCNA 2C0LA 5CCMA 3CVPA 4N2QA 5BW8C 4G2VA 3Q47B 3ZHEB 3CEQA 4I17A 2PL2A 2XCBA 5JJ7A 2XGSA 4AIFA 4UI9C 2YQ8A 3SZ7A 1HZ4A 1HXIA 1NZNA 3FWVA 4KBQA 2XEVA 4XI9A 2P58C 2KATA 3KS2A 5DBKA 4G24A 3U4TA 3MV2B 2FBNA
chains in the Genus database with same CATH superfamily
3CK9A 1FPPA 4K5AB 2VGXB 4UWFA 1HFAA 4ABNA 3MA5A 2YINA 5LCWJ 1SQMA 4RQIA 3G2SA 5AQ7A 4CDMA 5J90A 3UI2A 2ONDA 4ZHBA 2XPIA 3Q15A 4GYWA 2L6BA 5ENNA 3E32A 1Q2ZA 2JLBA 2WQ7A 1MX2A 4LSZE 4HFGA 3HVEB 4KZCA 4FP7A 3PZ2A 4DRXE 3MYVA 3LVRE 3AG2E 5BNWA 4K5CA 4I6EA 1N54A 2AXVA 4F53A 5CRVA 1JUQA 1NA3A 3EJNA 4TXPA 5FJYA 2EQXA 4I1OB 5JJTA 4JL0A 1UG3A 1EYHA 3WXXA 4ACKA 2BKGA 2PM6A 2Y0BG 2E0IA 3CIAA 1BI8B 3S7BA 3HXDA 3I3NA 3D3MA 2M63A 1X5BA 1IQUA 3GZSA 4KZ0A 4C48B 4CRWA 4Y6CA 1LF8A 5CERB 4QQIA 1OCCE 5D66A 1JCSA 3ZYMA 3KEZA 2A4ZA 3HIZA 1Z3XA 4BSZB 1HXIA 1NZNA 2ZIRA 3KS2A 5BXOA 1WG0A 4XIFA 2FBNA 3EU9A 5D0QD 2AW6A 2A5UA 3ASHA 3PZ4A 1ZBPA 2J09A 4TUUA 5CBOA 4G25A 3JQ0A 3E34A 1UJJA 2XPYA 3Q7AA 1TJCA 1OWOA 4KMOA 2P9KG 4XKBA 3HXFA 4J8SA 3QJZA 2LSUA 2XEHA 4G26A 3EU5A 4AJWA 4UUCA 5G05J 3IEGA 2WXIA 4UQZA 3SFZA 5FTPA 3LYAA 2BUGA 2NXPA 4I9CA 4TXRA 5KBAA 3FH7A 5HS0A 1OUVA 5C1DA 3V31A 3QAQA 4GMJA 3SY2A 4J8EA 5BPPA 1H2TC 5EILA 4CT0A 1E8ZA 2AXUA 5BXUA 2XHEA 2KXPC 4FJYA 1X81A 1HO8A 4CGVA 2X6HA 3G2WA 5D2MC 1W3BA 2IF4A 3S7FA 3FU6A 3NOGD 3LJNA 1U3CA 3DBSA 3T8KA 5CMWA 2GW1A 4GCNA 4E6HA 3MGBA 3EUVA 2KBXA 3Q73A 3ZU7B 4NURA 3T8MA 4AOFA 4CCAA 2J4DA 1K8KG 4HORA 3L22A 4AVXA 5AJDA 4HI8A 5IY5E 2H6GA 4L2LA 3ESLA 2OV8A 3LDZA 3OAWA 1K1BA 1E7UA 4NIKA 3IKOB 4TRQA 5C2YA 3LEWA 3FTSA 1YA0A 3ZW3A 2E2EA 3EIQC 4KYOB 3DPDA 3TG5A 3B13A 5BV0A 2YHCA 4AY6A 2I2OA 3PZDA 1TN7A 2BEDA 5ENSD 2Q7FA 1MQSA 4PS3A 4NRHB 3MZLB 1SZAA 4UWKA 1N4PA 1MJ0A 4B93B 2IONA 3ZN3A 3HYMB 3UQ3A 3N71A 3CVUA 5HRYA 2X6FA 4HOTA 4FU3A 4OAVB 1A17A 1YCSB 4HVBA 5HQ8A 5A23A 3FTUA 3FHEA 4GU5A 3DSVA 3D9MA 1KT1A 3I4GA 2QC9A 4HI9A 4DX7D 3CLJA 4MS6A 3BU8A 4ILGA 3CVPA 5CEDB 2LXMA 2XCBA 4AIFA 2AJAA 3UT7A 2XRZA 2XEVA 4CEMA 3CHQA 4B8CB 4IRUA 4C0MA 4E85A 5G05C 2ETAA 2VJ8A 1K3ZD 3W9GA 1DVPA 3CQCB 5ARFA 2EINE 5ENQD 4WNDA 2KCVA 2J07A 2XGOA 4TV3A 3LXUX 1OXJA 3R9MA 2ZISA 1AWCB 2AWIA 3MX3A 5FZRA 4FC8A 2R2LA 4YVQC 1TNUA 3UMVA 4A1GA 4XI0A 5D0OD 3GW4A 3S2AA 2DIWA 1HH8A 3JUEA 1U3DA 4JW1A 2R59A 3TXNA 3RKVA 2OEVA 3CVNA 3ML8A 4AP2A 1JCQA 4B0ZA 5CHEE 1UOHA 2MOWA 3ZHEA 4JPSA 5BUZA 4WUYA 3MCXA 3CGHA 1S63A 3BG0B 1TJFA 1RZ4A 2RFAA 2PL2A 3NZSA 4XI9A 1Y6IA 4LERA 2KC7A 5CBNA 4RG6A 4YDWA 3FULA 1OWPA 4U96D 2JABA 2VTBB 1FT2A 3ONLA 3AG1E 4L1BA 3RAUA 1S0PA 4JA9A 4O1OA 3CK8A 4K0RA 3KD7A 4WNFA 2ZGGA 3SHFA 4EBAG 5LP0A 4CZ2D 1N4SA 3KSQA 2B0OE 5KJNA 2PNNA 2WXKA 2C0MA 2B6CA 3K9IA 1NI1A 3CVXA 5CRUA 2OVBA 4L2YA 4GTVA 1NFIE 3CHSA 3CK7A 3L6AA 4BX8A 3SBSA 4F1SA 2P9IG 2OVFA 5JJ6A 4UI9K 2GROB 1SA5A 4CDNA 4EBAA 2DZNA 4TXQA 4BFRA 1DNPA 3CHPA 3HXEA 1L5JA 1OWLA 4V3IA 1WM5A 5KJMA 4BTBA 2UY1A 1N52A 4FADA 3EIJA 4KVOA 1E8XA 2YQ8A 5AARA 3W9FA 3MV2B 3URZA 2WM9A 2XCCA 5AN8A 2DYSE 4CGWA 1SA4A 2FEZA 1KLXA 4H7XA 3L16A 4CT4A 3B7UX 1MHQA 2ETBA 3HG0D 4BTAA 3HXCA 3DXKG 4N3CA 4NQ0A 3DWLG 1FCHA 2OCCE 4GA2A 3BQOA 1D8EA 3U3WA 1KT0A 2J9QA 3LY7A 3ZYQA 4IYPA 3SBTB 3TG4A 3TL5A 3CHOA 3SO8A 3CSTA 2RFMA 3DSUA 4KT6B 3VLDA 2HE0A 3AS8A 2YNQA 3QKYA 1EDUA 1P5QA 3IV0A 4G1TA 3L17A 3Q49B 2KZTA 2HM8A 4I2ZA 4HBDA 3WG7E 1JCRA 3AS5A 3AG3E 2V4HC 4N3BA 3QNKA 4AV7A 2WXQA 3AU5A 5FQ7A 1ELWA 4G8KA 3KEAA 3DXMG 2V4LA 4JA7A 3CVWA 3DRAA 4IN3B 4U8YD 4I6GA 3TWXA 3CEQA 3FDHA 4HLEA 3G2UA 3SZ7A 2I9CA 2KM4A 4IULA 1O1SA 2LXLA 5KJKA 2I1JA 3C3RA 2X38A 4ME2A 1MZCA 1XGWA 4PS8A 2XS8A 4GZ3A 3MEKA 3ASFA 4JD2G 3NAWA 4DX6D 5AQBA 1LD8A 4M7CA 4L7TA 3UX4A 3CHRA 2VGYA 4L23A 2DCPA 4BSXA 5T4YA 2FO7A 3BUAA 4GTRA 4JB8P 2WMOA 4JHJA 3PE4A 4BY6A 2XEEA 2EILE 2HO1A 4GMRA 3PZ3A 4B94A 3RRUA 4U07A 3VLEA 1MX4A 4J8FA 3UM1A 1KZOA 4PDXA 2GRRB 1ZU2A 1N95A 5AAOA 2XGMA 4A1SA 2IY0C 2L6JA 3QDNA 1U2VG 1S70B 2I6HA 2CHXA 3ZKJA 4GA1A 3L08A 3TWVA 2XS1A 3ZUVB 2LO6A 2WVIA 3T5XA 1TNYA 2FF4A 1BU9A 2WQHA 1B89A 1IKND 1UW4B 3P2BA 4N5CA 2WB2A 4XEIG 2DYRE 1OWMA 5G04C 3AU4A 4TUMA 5FWQA 3NOCD 1H2UA 3V79K 3MKQB 5AIJA 1D8DA 3UM2A 5KNHD 1HZ4A 2CFUA 2X6JA 4WWPA 5J08A 5LCWC 4C0EA 5H7PA 1Y8MA 4J8YA 4MRUA 4RSYA 3JQ1A 2L9BA 4OAUC 1NP7A 3FY4A 2PQNA 2WXJA 1PY1A 3PDNA 3FH5A 5B1BE 1A5EA 4U0ZA 3FU5A 1EF1C 2R03A 3B95A 5EIBE 4U63A 2UWJG 4D10C 3V2OA 1IHGA 3QWPA 2QY7A 1INZA 4EQFA 2XZTG 2J4BA 3EHNA 3FUKA 4LCTA 1E96B 2R5SA 2WXHA 3X2QE 2WXOA 3VLFA 3ZGQA 1JWFA 1JWGA 3LVQE 2H6HA 3FTXA 3O48A 1QZ2A 1Z3YA 2XRYA 2BF0X 1S64A 1G3NB 3TXMA 1N0RA 1KPSB 1HX8A 5AYWD 3SD5A 3UKUG 4HXIA 5ARGA 1H2VC 2CHWA 2ZGDA 4HRMB 3E37A 4J6IA 2ILRA 3TWUA 2R17C 5KWDA 4HLLA 3NZUA 1IQRA 1HF8A 5KJLA 4JC8A 3LS8A 4XZ4A 1IYGA 4U04A 2VSXE 3PS6A 2DBAA 3VTXA 4F6RD 4UI9J 4GZCA 3HRAA 3EHQA 3NQPA 3IBEA 2DZOA 3ESKA 4DI3A 1Z6TA 1TR4A 5ENRD 4O60A 3R7QA 3IXEA 4AXHA 3JYSA 3U9WA 3IHVA 5LX8A 3SGHA 2CG2A 3ZVVA 4N2SA 1MYOA 2WQ6A 3RO2A 2KZTB 1H0AA 3LJ3A 4WNEA 4F3VA 4AM9A 5EX0A 3L13A 5BW8C 3FTZA 3UINC 1YMPA 4X8QA 3GZ2A 3FTVA 3CR3A 2R05A 4GTQA 5B1AE 5FIOA 3DSSA 2Y1LE 2HR2A 4BWRA 1XNFA 4Q96A 4OVUA 3AJIA 4APFA 1AP7A 3ULYA 2GRLA 1E8YA 1DCEA 5JHAA 1PAQA 3MV3B 4U0UA 1BLXB 3DPYA 4RLYA 2IOSA 3B7RL 1UN8A 4G2VA 3ZHEB 3NB2A 3ZXSA 2EIKE 4KBQA 4JEHA 2H6FA 1H6PA 4I9EA 3FUIA 4J8DA 4F1PA 4ACLA 4EZKA 2OOEA 4N5QA 4APOA 2KCLA 4A63B 3DSXA 3V30A 3P1UA 4CDRA 1UJKA 4JXTA 2IU1A 5FT9A 1O5MA 3UT8A 2XENA 4PH4B 2MHKA 2WXRA 4GZ6A 3UUXA 3NF1A 1QQEA 5JMND 3T9KA 5AQAA 2GRMA 3TWSA 3ZNGA 4BETA 4A3VA 2KCKA 4LUNU 2J49A 3ASDA 1WY6A 1OY3D 4BERA 4MKTA 2P9LG 4A55A 4FLHA 1IHBA 3G2VA 1N4QA 2WMNA 2J08A 2J8SD 3CKCA 4GPKA 3D9NA 2Y4TA 3UT4A 3TWRA 4HRLA 2WXPA 2GGFA 3Q78A 2QZAA 4WWOA 1HS6A 2OEWA 2IO2C 3APCA 4DX5D 4O6FA 3QWVA 3V2XA 2V5QC 2P9UG 3CQGB 4K5BA 4GB9A 5A6CA 4NACA 3B7TA 3L9TA 2P9NG 5CCMA 4FJZA 4GTOA 4Q94A 3T5VA 1TNZA 4ILIA 2VSNA 2PZIA 4H7YA 5M72A 1FVFA 3Q7FA 3PEVB 2VSYA 2EIME 3ML9A 4YVOA 3U64A 3ULEG 3QB2A 4HRNA 1TYQG 3HXBA 3JUIA 3OTNA 5G04J 1WAO1 1MX6A 4EZLA 4DUIA 4ATGA 1VDYA 5E75A 2WPVA 3UTMA 3FU0A 2LNIA 1N0QA 3TWWA 2MYOA 2V8SE 2PQRA 4LG6A 5ANLA 4U8VD 3ONKA 3CVLA 4BT8A 3VTYA 3UIOC 3R9AB 1PC2A 1E90A 5FQ8A 4UWHA 3D9LA 1HG5A 3D9HA 1OWNA 3APDA 4ANXA 4I6JA 4JHKA 4LEUA 3DSTA 2BKKB 3OXGA 1QYMA 2LUHA 1GW6A 4O1PA 3FFLA 3O4ZA 1ZB1A 3CV0A 5EYLA 3ABKE 3JXIA 2ZU6B 1YYHA 1O1RA 3ASGA 3FUJA 2CG3A 3C5RA 2NC9A 3GZ1A 5FQ4A 2CFZA 3JCKC 3E30A 4GTTA 3I5PA 3Q5MA 4B89A 5G55A 3UPVA 3BEEA 3AG4E 4R7LA 3DEPA 4I17A 2P9SG 2P58C 2KATA 5ENOD 2AXZA 5FINA 1TNOA 1E7VA 3JXJA 3PNLB 4GYOA 2IFUA 5G2NA 2Y4UA 3SNXA 3TAXA 5FZSA 5DIZA 2RD0A 5B3SE 1N9AA 2BTDA 3RSEG 2WXNA 3ULQA 2VSOE 2C2LA 3SQVA 4HS2A 4A3TA 2NSZA 3PE3A 4FHKA 3UKRG 1HG2A 3ASNE 3FU3A 4Q69A 4G11A 2H6IA 3PUJA 4DLOA 3EHRA 5CECB 3FUMA 1H19A 3F6QA 1OCOE 3CHMA 2WXFA 4WNGA 3SFXA 4MBGA 2VQ2A 4GZ5A 1K1AA 4XX5A 4YDOA 5ENPD 2QFCA 3ZFWA 3PREA 4XKCA 2XZDG 3MKQA 3FH8A 3SF4A 4GYYA 4N3AA 3L54A 1TEZA 2VGEA 4BT9A 1LD7A 3J5QB 5EX3A 4KVMA 4G23A 5AJLA 3FTWA 4URKA 3C72A 4I2WA 3C3OA 2F8YA 5JJ7A 3FEXA 2XQ0A 5BT1A 3Q9NC 4G8LA 4GAAA 3AAAC 3G2TA 3D9IA 3J5PA 1N4RA 4UWLA 3PUKA 3Q79A 3PNTB 4WAFA 5T3RA 1SW6A 3LCAA 2FI7A 2CHZA 3D9OA 3QK0A 4OVVA 3UXGA 3UM0A 3RRNB 4C9BB 2RKKA 2NYJA 1ELRA 3PZ1A 4KXKB 5EDSA 2XPZA 3CSFA 4GMLA 4GCOA 4JVSA 3EDTB 4HOQA 3ZEFA 3Q9UC 4FA6A 2FULA 2WXGA 3D9KA 3APFA 2L0IA 5T8IA 4FULA 3C3QA 3OXFA 3RJVA 2GRNB 3E33A 4PUCA 4N39A 1OT8A 3PVLA 3FEYA 5CMYA 3EHMA 3CVQA 3L82A 4I1MA 4F7AA 1D9SA 4LNGA 4PS7A 2WXMA 3I4RB 4BEPA 2IOLA 2YHEA 1OCZE 4G24A 2VTBA 4GTPA 5KNGA 3RO3A 3HVEA 3UM3A 5KCMA 4J0UA 3S7DA 3TWQA 3ABLE 2X3MA 4AEZC 4HQDA 4HOUA 1TNBA 4WWNA 4YNDA 5FQ6A 2AVPA 4L9PA 3QWWA 4U95D 3KSLA 1H6KA 1FT1A 4DK5A 4UQYA 3ZYLA 1TN6A 2P9PG 1UN9A 3UIPC 4ANUA 5CEAA 3SI5A 4W9RA 3MJWA 4GZDA 5LOZA 1BI7B 3CKBA 3NBNB 2WXLA 3LPZA 3S7JA 5JA4D 2RG8A 2EIJE 2MRIA 4EZJA 5ENTD 1ELKA 4BX9A 4BESA 1Z5SC 5EN5D 4QFVA 4YDEA 4DLQA 2ZXWE 3TWTA 4Y6WA 4ATZD 4J7WA 1V54E 4LNBA 2LAHA 3ENEA 1OCRE 3PRZA 3GYZA 3PEUB 1IXVA 4I43A 3AS4A 5A7DB 3RU0A 2P2CP 5AENA 4EHMA 3QARA 3E4BA 1TN8A 2UY1B 3HHMA 2V0PA 2QYJA 4DPRA 4EECA 4Z68A 3PH0C 1EPUA 2I1KA 4HNAD 1QNFA 2XGSA 2FO1E 4UI9C 3FWVA 3D9PA 3FUEA 3ZRHA 2VGXA 2DVWA 2Y69E 4JHRA 3RRMB 3SFYA 4DX2A 5CCLA 3ZPJA 4ZFHA 1WDYA 3LY8A 1DC2A 5HKPA 4UWGA 3RK6A 5E76A 4ILHB 4U7EB 2VYIA 2A5EA 5EKQD 2QYUA 2IO3C 4ANVA 3D9JA 3IHYA 3ISMC 4GTSA 5JHBA 3FUNA 4OYSA 1HE8A 4ANWA 1E8WA 3RIBA 3U66A 1O1TA 2F8XK 5FZQA 4UQXA 3B7SA 4FHJA 3QC1A 1BD8A 2IQCA 4U8HA 1RW2A 1N94A 3R7RA 2Y3AA 3LY9A 4CYMD 5ANRA 5HI7A 4MLPA 4LRZA 5BV1A 4HB5A 2R02A 3LKUA 2X6KA 1JPLA 4XE0A 5LFAA 3ZIMA 4B8AA 3DSWA 4JEUA 3Q47B 1BPOA 1H6OA 2LAIA 5DBKA 2IEJA 3ZYKA 3ZXPA 2HYZA 2GRQB 2JEKA 4GPMA 3TJPA 4K03A 4RG9A 5EIDA 1FVHA 1KZPA 3B7BA 4RVBA 4DJAA 3OXLA 4YDYA 3Q75A 1LTXA 3FUDA 4GA0A 3C98A 4FLBA 4M3OA 5ITZF 2F0YA 4HOSA 5EYPF 3TGOA 4DX1A 1N11A 1V55E 3CVVA 4U0SA 4P29A 2IJGX 4LNUD 3KAEA 4I1AA 2PM7A 3Q4AB 3QOUA 3FUFA 4DI4A 2L0TB 4GTMA 2LSVA 1HU3A 1SVXA 2DWZA 3BG1B 2X6IA 2ETCA 2F37A 3DEOA 3HDXA 4AY5A 1QBQA 4JZYA 3FP3A 1DCQA 1NA0A 3CVYA 3FUHA 2GRPB 3MKRA 3FTYA 2V5FA 1NL4A 2C0LA 4N2QA 5AQ9A 3ASOE 1SZ9A 3ABME 3U4TA 4EPZA
chains in the Genus database with same CATH topology
4JC8A 1Y6IA 2XQ0A 4LERA 3LS8A 3CK9A 5BT1A 4XZ4A 2KC7A 1IYGA 4GAAA 4RG6A 3FULA 2VGXB 1OWPA 4U04A 4UWFA 2VTBB 1HFAA 2VSXE 3ONLA 3G2TA 3D9IA 4ABNA 4L1BA 1S0PA 4JA9A 3PS6A 2DBAA 3MA5A 3CK8A 4K0RA 3VTXA 2YINA 4UI9J 1SQMA 4UWLA 3KD7A 5LCWJ 3PUKA 3G2SA 4GZCA 4WNFA 3PNTB 3NQPA 4CDMA 5J90A 2ONDA 4WAFA 3SHFA 2XPIA 3IBEA 4EBAG 3Q15A 5T3RA 5LP0A 4GYWA 3ESKA 4DI3A 1Z6TA 5ENNA 3LCAA 2JLBA 3R7QA 2WQ7A 4AXHA 5KJNA 4HFGA 3JYSA 3HVEB 2FI7A 4FP7A 4KZCA 2CHZA 3D9OA 2WXKA 3IHVA 3U9WA 5LX8A 3SGHA 2C0MA 2CG2A 3MYVA 3ZVVA 3LVRE 3QK0A 3K9IA 5BNWA 4N2SA 4OVVA 2WQ6A 3RO2A 4I6EA 2KZTB 3RRNB 1H0AA 1N54A 2AXVA 3LJ3A 4C9BB 4F53A 3CVXA 2OVBA 1ELRA 4L2YA 4WNEA 1JUQA 4F3VA 4KXKB 1NA3A 4AM9A 3EJNA 3CHSA 5EDSA 5EX0A 3L13A 5BW8C 3FTZA 3CK7A 2XPZA 5FJYA 2EQXA 3L6AA 4BX8A 4I1OB 5JJTA 3CSFA 1UG3A 4JL0A 3GZ2A 3FTVA 3SBSA 4GMLA 4F1SA 1EYHA 2OVFA 3WXXA 4ACKA 3CR3A 4GCOA 4UI9K 4JVSA 5JJ6A 2PM6A 3EDTB 4HOQA 2E0IA 3ZEFA 3CIAA 4FA6A 4CDNA 2FULA 4EBAA 2WXGA 3S7BA 3I3NA 3D9KA 2HR2A 4BWRA 3APFA 3D3MA 1XNFA 4BFRA 2L0IA 1X5BA 1DNPA 2M63A 4FULA 4Q96A 3OXFA 4OVUA 5T8IA 4APFA 1IQUA 1E8YA 2GRLA 3GZSA 4KZ0A 3RJVA 5JHAA 1PAQA 3MV3B 4PUCA 3CHPA 1L5JA 4N39A 1OWLA 4CRWA 3PVLA 4U0UA 4Y6CA 4V3IA 1LF8A 1WM5A 3FEYA 5KJMA 5CMYA 4BTBA 3EHMA 2UY1A 1N52A 2IOSA 4FADA 3B7RL 3CVQA 3EIJA 4I1MA 4F7AA 1UN8A 3ZYMA 3KEZA 4G2VA 4PS7A 2A4ZA 2WXMA 3I4RB 3HIZA 2IOLA 3ZHEB 4KVOA 1E8XA 1Z3XA 3ZXSA 2YQ8A 4EPZA 4KBQA 1HXIA 1NZNA 2YHEA 4JEHA 3KS2A 4G24A 3MV2B 2FBNA 4XIFA 4I9EA 3URZA 2VTBA 5D0QD 2WM9A 3FUIA 2XCCA 3RO3A 2AW6A 3HVEA 4CGWA 4J8DA 2A5UA 3ASHA 5KCMA 4ACLA 4EZKA 1ZBPA 4J0UA 2OOEA 3S7DA 2J09A 2FEZA 1KLXA 4H7XA 2X3MA 4G25A 4TUUA 4AEZC 3L16A 4HOUA 4APOA 2KCLA 4WWNA 4YNDA 4CT4A 3JQ0A 1UJJA 1MHQA 2XPYA 3B7UX 2AVPA 5FQ6A 1TJCA 3QWWA 1OWOA 4KMOA 4BTAA 1H6KA 3P1UA 4DK5A 4UQYA 4CDRA 1UJKA 4JXTA 4XKBA 3ZYLA 2IU1A 4J8SA 5FT9A 3QJZA 4N3CA 4NQ0A 2LSUA 4G26A 1UN9A 3UT8A 4AJWA 4ANUA 1FCHA 3IEGA 4PH4B 5G05J 2MHKA 4W9RA 2WXIA 3SI5A 4UQZA 2WXRA 4GA2A 4GZ6A 3SFZA 3MJWA 3UUXA 3U3WA 1KT0A 5FTPA 3LYAA 1QQEA 2J9QA 3NF1A 4GZDA 5LOZA 3LY7A 2GRMA 3ZYQA 4IYPA 3SBTB 4A3VA 3TG4A 3CKBA 2KCKA 2WXLA 4LUNU 3LPZA 2J49A 3ASDA 3S7JA 2RG8A 2BUGA 1WY6A 2NXPA 3TL5A 4I9CA 2MRIA 3FH7A 4MKTA 3CHOA 3CSTA 4EZJA 1OUVA 1ELKA 4BX9A 4KT6B 3VLDA 4A55A 4FLHA 5C1DA 3G2VA 3AS8A 2WMNA 3QAQA 2J08A 3CKCA 2YNQA 3QKYA 4QFVA 1EDUA 4DLQA 4GPKA 1P5QA 3D9NA 4GMJA 3IV0A 2Y4TA 4Y6WA 3UT4A 4G1TA 3L17A 3Q49B 4J8EA 2KZTA 2GGFA 2WXPA 5BPPA 1H2TC 2HM8A 2LAHA 3ENEA 4CT0A 4I2ZA 1E8ZA 2AXUA 4WWOA 1HS6A 2XHEA 3PRZA 3GYZA 3PEUB 3AS5A 4FJYA 4I43A 3AS4A 1HO8A 5A7DB 4CGVA 4N3BA 3APCA 3QNKA 3RU0A 2X6HA 4AV7A 5AENA 3G2WA 2WXQA 3AU5A 4O6FA 1W3BA 3QWVA 2IF4A 3E4BA 3QARA 5FQ7A 1ELWA 3S7FA 3FU6A 2V4LA 2UY1B 1U3CA 4JA7A 3CVWA 3DBSA 3CQGB 2V0PA 3HHMA 4IN3B 4GB9A 5CMWA 2GW1A 5A6CA 4NACA 3B7TA 4DPRA 4EECA 3PH0C 1EPUA 2I1KA 4GCNA 3MGBA 4E6HA 5CCMA 4I6GA 4FJZA 4NURA 4Q94A 3T8MA 4AOFA 3CEQA 4CCAA 3FDHA 2J4DA 3T5VA 1QNFA 4HLEA 2XGSA 4UI9C 3G2UA 3SZ7A 4HORA 3FWVA 3L22A 4AVXA 4ILIA 3D9PA 2I9CA 5AJDA 2KM4A 3FUEA 2VSNA 2VGXA 4IULA 2PZIA 4H7YA 3ZRHA 5M72A 1FVFA 4L2LA 3PEVB 3ESLA 5KJKA 2I1JA 2VSYA 4JHRA 2OV8A 3RRMB 3LDZA 3OAWA 2X38A 4ME2A 5CCLA 3ML9A 3ZPJA 4YVOA 1XGWA 1E7UA 4PS8A 3U64A 3LY8A 3QB2A 3IKOB 4GZ3A 3MEKA 4TRQA 3ASFA 5C2YA 3JUIA 3LEWA 3FTSA 1YA0A 3OTNA 5G04J 3ZW3A 1WAO1 4EZLA 4UWGA 3RK6A 5E76A 4ILHB 2E2EA 2VYIA 3EIQC 4ATGA 1VDYA 5E75A 2WPVA 5EKQD 4KYOB 3DPDA 3TG5A 3FU0A 3B13A 4L7TA 5BV0A 2LNIA 3CHRA 3UX4A 2VGYA 2YHCA 4AY6A 4L23A 2V8SE 2DCPA 2PQRA 5ANLA 4BSXA 5T4YA 2I2OA 3ONKA 2FO7A 3CVLA 3PZDA 4ANVA 4BT8A 3D9JA 3IHYA 3VTYA 2WMOA 4JHJA 3R9AB 5JHBA 1PC2A 3PE4A 2Q7FA 1MQSA 1E90A 4PS3A 4NRHB 3FUNA 5FQ8A 4BY6A 2HO1A 4UWHA 3D9LA 1HG5A 4OYSA 1OWNA 1HE8A 4ANWA 3APDA 4B94A 3RRUA 4ANXA 1E8WA 3RIBA 4U07A 3VLEA 3U66A 3MZLB 4J8FA 4I6JA 4JHKA 4UWKA 5FZQA 4PDXA 4LEUA 4UQXA 3OXGA 1ZU2A 2IONA 3ZN3A 2XGMA 4A1SA 3HYMB 3B7SA 3UQ3A 1GW6A 4FHJA 3FFLA 3QC1A 2L6JA 3N71A 3QDNA 2IQCA 3O4ZA 4U8HA 3CVUA 2X6FA 4HOTA 4FU3A 3R7RA 2Y3AA 3LY9A 2I6HA 2CHXA 3CV0A 1A17A 4GA1A 3L08A 4HVBA 5ANRA 5HI7A 5HQ8A 2LO6A 2ZU6B 5A23A 2WVIA 3T5XA 3FTUA 4MLPA 2FF4A 3FHEA 4LRZA 5BV1A 4GU5A 2WQHA 3ASGA 3D9MA 3FUJA 1B89A 2CG3A 2X6KA 3LKUA 1UW4B 2NC9A 3GZ1A 5FQ4A 3P2BA 1KT1A 3I4GA 1JPLA 4XE0A 4N5CA 2CFZA 3JCKC 5LFAA 2WB2A 3I5PA 3Q5MA 4B89A 3CLJA 3ZIMA 5G55A 4B8AA 4JEUA 4MS6A 3UPVA 3BEEA 1OWMA 5G04C 4ILGA 3AU4A 4R7LA 3CVPA 5FWQA 1H2UA 3Q47B 4I17A 3MKQB 2XCBA 1BPOA 5AIJA 4AIFA 3UT7A 1HZ4A 2CFUA 2LAIA 2XRZA 2XEVA 4CEMA 2P58C 2KATA 5DBKA 2AXZA 2X6JA 1E7VA 3CHQA 4B8CB 4GYOA 3PNLB 4IRUA 3ZYKA 4C0MA 2IFUA 5G2NA 2HYZA 4E85A 4WWPA 5J08A 5G05C 5LCWC 2VJ8A 2JEKA 2Y4UA 3SNXA 3TAXA 4C0EA 5FZSA 5DIZA 1Y8MA 1DVPA 2RD0A 3CQCB 5ARFA 3TJPA 2BTDA 2WXNA 4MRUA 4RSYA 2VSOE 3JQ1A 4WNDA 3ULQA 2KCVA 2C2LA 2J07A 4K03A 4RG9A 2XGOA 4HS2A 4A3TA 1FVHA 2NSZA 3PE3A 4TV3A 2L9BA 4FHKA 3LXUX 4RVBA 1NP7A 3FY4A 2PQNA 2WXJA 1HG2A 4DJAA 3OXLA 1PY1A 3PDNA 3FH5A 2AWIA 4U0ZA 3MX3A 3FU5A 1EF1C 3FU3A 3FUDA 4FC8A 3C98A 4GA0A 5FZRA 4Q69A 4U63A 4YVQC 4G11A 4FLBA 3UMVA 2UWJG 3PUJA 4M3OA 4A1GA 4D10C 4XI0A 4DLOA 4HOSA 1IHGA 5D0OD 3FUMA 3QWPA 3TGOA 3GW4A 1H19A 2QY7A 1INZA 4EQFA 3S2AA 2J4BA 2DIWA 1HH8A 3EHNA 3CVVA 4U0SA 3FUKA 4P29A 4LCTA 1U3DA 4JW1A 2IJGX 3CHMA 1E96B 2R5SA 3KAEA 2WXFA 2R59A 4I1AA 3TXNA 2WXHA 3RKVA 4WNGA 2WXOA 2PM7A 2VQ2A 3Q4AB 4GZ5A 3VLFA 4XX5A 3CVNA 3ZGQA 1JWFA 1JWGA 2QFCA 3ZFWA 3LVQE 3ML8A 3QOUA 3FTXA 3O48A 3PREA 1QZ2A 1Z3YA 4XKCA 3FUFA 2XRYA 4AP2A 4DI4A 2L0TB 4B0ZA 3MKQA 2LSVA 3FH8A 1HU3A 3SF4A 5CHEE 4GYYA 2BF0X 3BG1B 2X6IA 4N3AA 3L54A 1TEZA 2MOWA 3TXMA 3ZHEA 3HDXA 4AY5A 4JPSA 4JZYA 4BT9A 1HX8A 5BUZA 5EX3A 3FP3A 4KVMA 5AYWD 4WUYA 3SD5A 1NA0A 3CVYA 4HXIA 3MCXA 4G23A 3FUHA 5ARGA 1H2VC 2CHWA 3CGHA 3MKRA 5AJLA 3FTWA 4URKA 4J6IA 2ILRA 3FTYA 2R17C 2V5FA 4I2WA 2C0LA 4N2QA 3BG0B 1TJFA 3NZUA 1IQRA 2PL2A 5JJ7A 3FEXA 3NZSA 4XI9A 1SZ9A 3U4TA 1HF8A 1SZAA 5KJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSN A;  2VGX A;  2PZI A;  4H7Y A;  4I9E A;  4GYO A;  5M72 A;  3URZ A;  3CK9 A;  5D0Q D;  5BT1 A;  2IFU A;  2XCC A;  2KC7 A;  3RO3 A;  2HYZ A;  5KJK A;  4CGW A;  4J8D A;  2VSY A;  3ASH A;  4JHR A;  4RG6 A;  5G05 C;  5LCW C;  1ZBP A;  2VGX B;  4J0U A;  4ME2 A;  2OOE A;  3S7D A;  5CCL A;  2FEZ A;  1KLX A;  4H7X A;  2Y4U A;  4G25 A;  4U04 A;  3ZPJ A;  4HOU A;  4APO A;  2KCL A;  4YVO A;  4YND A;  3TAX A;  4ABN A;  5FZS A;  3LY8 A;  1Y8M A;  2AVP A;  5DIZ A;  4GZ3 A;  5ARF A;  3MEK A;  1TJC A;  3ASF A;  3QWW A;  4JA9 A;  2DBA A;  3MA5 A;  1YA0 A;  3CK8 A;  5G04 J;  4BTA A;  3VTX A;  1WAO 1;  4WND A;  4UI9 J;  3ULQ A;  5LCW J;  3KD7 A;  2E2E A;  2C2L A;  2KCV A;  4RG9 A;  2VYI A;  2XGO A;  4UQY A;  4CDR A;  2WPV A;  4WNF A;  5EKQ D;  4KYO B;  3PE3 A;  4NQ0 A;  2LSU A;  4N3C A;  5FT9 A;  2OND A;  4G26 A;  3TG5 A;  2XPI A;  2LNI A;  3Q15 A;  3ZN3 A;  2VGY A;  4GYW A;  3ESK A;  2YHC A;  4AY6 A;  1FCH A;  2PQN A;  2PQR A;  3IEG A;  2MHK A;  3LCA A;  4W9R A;  2JLB A;  5G05 J;  4UQZ A;  2FO7 A;  3CVL A;  3OXL A;  4GA2 A;  4GZ6 A;  4BT8 A;  3UUX A;  3PDN A;  3U3W A;  3VTY A;  1KT0 A;  5FTP A;  4U0Z A;  3LYA A;  1QQE A;  2J9Q A;  3JYS A;  3NF1 A;  5KJN A;  2FI7 A;  3LY7 A;  5FZR A;  4GA0 A;  3R9A B;  3TG4 A;  4YVQ C;  1PC2 A;  3CKB A;  2Q7F A;  3PE4 A;  2KCK A;  2C0M A;  4NRH B;  2UWJ G;  3LPZ A;  3ASD A;  4XI0 A;  3S7J A;  2HO1 A;  4HOS A;  2BUG A;  3K9I A;  1IHG A;  5D0O D;  5BNW A;  4N2S A;  4I9C A;  3QWP A;  3TGO A;  3GW4 A;  3RO2 A;  4B94 A;  1OUV A;  4U07 A;  3RIB A;  4EQF A;  1ELR A;  1IYG A;  4J8F A;  4WNE A;  1HH8 A;  5FZQ A;  4F3V A;  5C1D A;  4LEU A;  4U0S A;  4KXK B;  4UQX A;  3OXG A;  3AS8 A;  1NA3 A;  4XIF A;  4AM9 A;  1ZU2 A;  5EX0 A;  3CKC A;  3QKY A;  1E96 B;  2R5S A;  2XGM A;  3CK7 A;  3KAE A;  3HYM B;  4I1A A;  5FJY A;  3RKV A;  3UQ3 A;  4WNG A;  1P5Q A;  4A1S A;  4GPK A;  5JJT A;  2Y4T A;  3FFL A;  4JL0 A;  4Y6W A;  2L6J A;  2VQ2 A;  3GZ2 A;  3N71 A;  3Q4A B;  3QDN A;  4GZ5 A;  4G1T A;  3CVN A;  3WXX A;  3ZGQ A;  4GCO A;  4UI9 K;  2QFC A;  5JJ6 A;  3EDT B;  3Q49 B;  4J8E A;  3QOU A;  3ZFW A;  4HOT A;  3LY9 A;  3O48 A;  2I6H A;  1QZ2 A;  4HOQ A;  3CV0 A;  1A17 A;  4GA1 A;  4I2Z A;  2LSV A;  5HI7 A;  3S7B A;  5HQ8 A;  3SF4 A;  5CHE E;  4GYY A;  2HR2 A;  4BWR A;  3GYZ A;  1XNF A;  3AS5 A;  4N3A A;  3AS4 A;  2FF4 A;  3OXF A;  5A7D B;  5KJL A;  4CGV A;  4N3B A;  2WQH A;  3ASG A;  3RU0 A;  3ZHE A;  4AY5 A;  3RJV A;  4BT9 A;  1B89 A;  1W3B A;  3QWV A;  2IF4 A;  3E4B A;  3LKU A;  4O6F A;  1ELW A;  2NC9 A;  3GZ1 A;  5EX3 A;  3S7F A;  1KT1 A;  3FP3 A;  3MV3 B;  4WUY A;  5AYW D;  1NA0 A;  4N39 A;  2UY1 B;  4N5C A;  4G23 A;  4JA7 A;  4U0U A;  4Y6C A;  5ARG A;  3MKR A;  4IN3 B;  1WM5 A;  5KJM A;  2GW1 A;  3Q5M A;  5A6C A;  4BTB A;  4HOR A;  2UY1 A;  3UPV A;  3BEE A;  3CVQ A;  2V5F A;  4I2W A;  5G04 C;  4GCN A;  2C0L A;  5CCM A;  3CVP A;  4N2Q A;  5BW8 C;  4G2V A;  3Q47 B;  3ZHE B;  3CEQ A;  4I17 A;  2PL2 A;  2XCB A;  5JJ7 A;  2XGS A;  4AIF A;  4UI9 C;  2YQ8 A;  3SZ7 A;  1HZ4 A;  1HXI A;  1NZN A;  3FWV A;  4KBQ A;  2XEV A;  4XI9 A;  2P58 C;  2KAT A;  3KS2 A;  5DBK A;  4G24 A;  3U4T A;  3MV2 B;  2FBN A; 
#chains in the Genus database with same CATH topology
 3CK9 A;  1FPP A;  4K5A B;  2VGX B;  4UWF A;  1HFA A;  4ABN A;  3MA5 A;  2YIN A;  5LCW J;  1SQM A;  4RQI A;  3G2S A;  5AQ7 A;  4CDM A;  5J90 A;  3UI2 A;  2OND A;  4ZHB A;  2XPI A;  3Q15 A;  4GYW A;  2L6B A;  5ENN A;  3E32 A;  1Q2Z A;  2JLB A;  2WQ7 A;  1MX2 A;  4LSZ E;  4HFG A;  3HVE B;  4KZC A;  4FP7 A;  3PZ2 A;  4DRX E;  3MYV A;  3LVR E;  3AG2 E;  5BNW A;  4K5C A;  4I6E A;  1N54 A;  2AXV A;  4F53 A;  5CRV A;  1JUQ A;  1NA3 A;  3EJN A;  4TXP A;  5FJY A;  2EQX A;  4I1O B;  5JJT A;  4JL0 A;  1UG3 A;  1EYH A;  3WXX A;  4ACK A;  2BKG A;  2PM6 A;  2Y0B G;  2E0I A;  3CIA A;  1BI8 B;  3S7B A;  3HXD A;  3I3N A;  3D3M A;  2M63 A;  1X5B A;  1IQU A;  3GZS A;  4KZ0 A;  4C48 B;  4CRW A;  4Y6C A;  1LF8 A;  5CER B;  4QQI A;  1OCC E;  5D66 A;  1JCS A;  3ZYM A;  3KEZ A;  2A4Z A;  3HIZ A;  1Z3X A;  4BSZ B;  1HXI A;  1NZN A;  2ZIR A;  3KS2 A;  5BXO A;  1WG0 A;  4XIF A;  2FBN A;  3EU9 A;  5D0Q D;  2AW6 A;  2A5U A;  3ASH A;  3PZ4 A;  1ZBP A;  2J09 A;  4TUU A;  5CBO A;  4G25 A;  3JQ0 A;  3E34 A;  1UJJ A;  2XPY A;  3Q7A A;  1TJC A;  1OWO A;  4KMO A;  2P9K G;  4XKB A;  3HXF A;  4J8S A;  3QJZ A;  2LSU A;  2XEH A;  4G26 A;  3EU5 A;  4AJW A;  4UUC A;  5G05 J;  3IEG A;  2WXI A;  4UQZ A;  3SFZ A;  5FTP A;  3LYA A;  2BUG A;  2NXP A;  4I9C A;  4TXR A;  5KBA A;  3FH7 A;  5HS0 A;  1OUV A;  5C1D A;  3V31 A;  3QAQ A;  4GMJ A;  3SY2 A;  4J8E A;  5BPP A;  1H2T C;  5EIL A;  4CT0 A;  1E8Z A;  2AXU A;  5BXU A;  2XHE A;  2KXP C;  4FJY A;  1X81 A;  1HO8 A;  4CGV A;  2X6H A;  3G2W A;  5D2M C;  1W3B A;  2IF4 A;  3S7F A;  3FU6 A;  3NOG D;  3LJN A;  1U3C A;  3DBS A;  3T8K A;  5CMW A;  2GW1 A;  4GCN A;  4E6H A;  3MGB A;  3EUV A;  2KBX A;  3Q73 A;  3ZU7 B;  4NUR A;  3T8M A;  4AOF A;  4CCA A;  2J4D A;  1K8K G;  4HOR A;  3L22 A;  4AVX A;  5AJD A;  4HI8 A;  5IY5 E;  2H6G A;  4L2L A;  3ESL A;  2OV8 A;  3LDZ A;  3OAW A;  1K1B A;  1E7U A;  4NIK A;  3IKO B;  4TRQ A;  5C2Y A;  3LEW A;  3FTS A;  1YA0 A;  3ZW3 A;  2E2E A;  3EIQ C;  4KYO B;  3DPD A;  3TG5 A;  3B13 A;  5BV0 A;  2YHC A;  4AY6 A;  2I2O A;  3PZD A;  1TN7 A;  2BED A;  5ENS D;  2Q7F A;  1MQS A;  4PS3 A;  4NRH B;  3MZL B;  1SZA A;  4UWK A;  1N4P A;  1MJ0 A;  4B93 B;  2ION A;  3ZN3 A;  3HYM B;  3UQ3 A;  3N71 A;  3CVU A;  5HRY A;  2X6F A;  4HOT A;  4FU3 A;  4OAV B;  1A17 A;  1YCS B;  4HVB A;  5HQ8 A;  5A23 A;  3FTU A;  3FHE A;  4GU5 A;  3DSV A;  3D9M A;  1KT1 A;  3I4G A;  2QC9 A;  4HI9 A;  4DX7 D;  3CLJ A;  4MS6 A;  3BU8 A;  4ILG A;  3CVP A;  5CED B;  2LXM A;  2XCB A;  4AIF A;  2AJA A;  3UT7 A;  2XRZ A;  2XEV A;  4CEM A;  3CHQ A;  4B8C B;  4IRU A;  4C0M A;  4E85 A;  5G05 C;  2ETA A;  2VJ8 A;  1K3Z D;  3W9G A;  1DVP A;  3CQC B;  5ARF A;  2EIN E;  5ENQ D;  4WND A;  2KCV A;  2J07 A;  2XGO A;  4TV3 A;  3LXU X;  1OXJ A;  3R9M A;  2ZIS A;  1AWC B;  2AWI A;  3MX3 A;  5FZR A;  4FC8 A;  2R2L A;  4YVQ C;  1TNU A;  3UMV A;  4A1G A;  4XI0 A;  5D0O D;  3GW4 A;  3S2A A;  2DIW A;  1HH8 A;  3JUE A;  1U3D A;  4JW1 A;  2R59 A;  3TXN A;  3RKV A;  2OEV A;  3CVN A;  3ML8 A;  4AP2 A;  1JCQ A;  4B0Z A;  5CHE E;  1UOH A;  2MOW A;  3ZHE A;  4JPS A;  5BUZ A;  4WUY A;  3MCX A;  3CGH A;  1S63 A;  3BG0 B;  1TJF A;  1RZ4 A;  2RFA A;  2PL2 A;  3NZS A;  4XI9 A;  1Y6I A;  4LER A;  2KC7 A;  5CBN A;  4RG6 A;  4YDW A;  3FUL A;  1OWP A;  4U96 D;  2JAB A;  2VTB B;  1FT2 A;  3ONL A;  3AG1 E;  4L1B A;  3RAU A;  1S0P A;  4JA9 A;  4O1O A;  3CK8 A;  4K0R A;  3KD7 A;  4WNF A;  2ZGG A;  3SHF A;  4EBA G;  5LP0 A;  4CZ2 D;  1N4S A;  3KSQ A;  2B0O E;  5KJN A;  2PNN A;  2WXK A;  2C0M A;  2B6C A;  3K9I A;  1NI1 A;  3CVX A;  5CRU A;  2OVB A;  4L2Y A;  4GTV A;  1NFI E;  3CHS A;  3CK7 A;  3L6A A;  4BX8 A;  3SBS A;  4F1S A;  2P9I G;  2OVF A;  5JJ6 A;  4UI9 K;  2GRO B;  1SA5 A;  4CDN A;  4EBA A;  2DZN A;  4TXQ A;  4BFR A;  1DNP A;  3CHP A;  3HXE A;  1L5J A;  1OWL A;  4V3I A;  1WM5 A;  5KJM A;  4BTB A;  2UY1 A;  1N52 A;  4FAD A;  3EIJ A;  4KVO A;  1E8X A;  2YQ8 A;  5AAR A;  3W9F A;  3MV2 B;  3URZ A;  2WM9 A;  2XCC A;  5AN8 A;  2DYS E;  4CGW A;  1SA4 A;  2FEZ A;  1KLX A;  4H7X A;  3L16 A;  4CT4 A;  3B7U X;  1MHQ A;  2ETB A;  3HG0 D;  4BTA A;  3HXC A;  3DXK G;  4N3C A;  4NQ0 A;  3DWL G;  1FCH A;  2OCC E;  4GA2 A;  3BQO A;  1D8E A;  3U3W A;  1KT0 A;  2J9Q A;  3LY7 A;  3ZYQ A;  4IYP A;  3SBT B;  3TG4 A;  3TL5 A;  3CHO A;  3SO8 A;  3CST A;  2RFM A;  3DSU A;  4KT6 B;  3VLD A;  2HE0 A;  3AS8 A;  2YNQ A;  3QKY A;  1EDU A;  1P5Q A;  3IV0 A;  4G1T A;  3L17 A;  3Q49 B;  2KZT A;  2HM8 A;  4I2Z A;  4HBD A;  3WG7 E;  1JCR A;  3AS5 A;  3AG3 E;  2V4H C;  4N3B A;  3QNK A;  4AV7 A;  2WXQ A;  3AU5 A;  5FQ7 A;  1ELW A;  4G8K A;  3KEA A;  3DXM G;  2V4L A;  4JA7 A;  3CVW A;  3DRA A;  4IN3 B;  4U8Y D;  4I6G A;  3TWX A;  3CEQ A;  3FDH A;  4HLE A;  3G2U A;  3SZ7 A;  2I9C A;  2KM4 A;  4IUL A;  1O1S A;  2LXL A;  5KJK A;  2I1J A;  3C3R A;  2X38 A;  4ME2 A;  1MZC A;  1XGW A;  4PS8 A;  2XS8 A;  4GZ3 A;  3MEK A;  3ASF A;  4JD2 G;  3NAW A;  4DX6 D;  5AQB A;  1LD8 A;  4M7C A;  4L7T A;  3UX4 A;  3CHR A;  2VGY A;  4L23 A;  2DCP A;  4BSX A;  5T4Y A;  2FO7 A;  3BUA A;  4GTR A;  4JB8 P;  2WMO A;  4JHJ A;  3PE4 A;  4BY6 A;  2XEE A;  2EIL E;  2HO1 A;  4GMR A;  3PZ3 A;  4B94 A;  3RRU A;  4U07 A;  3VLE A;  1MX4 A;  4J8F A;  3UM1 A;  1KZO A;  4PDX A;  2GRR B;  1ZU2 A;  1N95 A;  5AAO A;  2XGM A;  4A1S A;  2IY0 C;  2L6J A;  3QDN A;  1U2V G;  1S70 B;  2I6H A;  2CHX A;  3ZKJ A;  4GA1 A;  3L08 A;  3TWV A;  2XS1 A;  3ZUV B;  2LO6 A;  2WVI A;  3T5X A;  1TNY A;  2FF4 A;  1BU9 A;  2WQH A;  1B89 A;  1IKN D;  1UW4 B;  3P2B A;  4N5C A;  2WB2 A;  4XEI G;  2DYR E;  1OWM A;  5G04 C;  3AU4 A;  4TUM A;  5FWQ A;  3NOC D;  1H2U A;  3V79 K;  3MKQ B;  5AIJ A;  1D8D A;  3UM2 A;  5KNH D;  1HZ4 A;  2CFU A;  2X6J A;  4WWP A;  5J08 A;  5LCW C;  4C0E A;  5H7P A;  1Y8M A;  4J8Y A;  4MRU A;  4RSY A;  3JQ1 A;  2L9B A;  4OAU C;  1NP7 A;  3FY4 A;  2PQN A;  2WXJ A;  1PY1 A;  3PDN A;  3FH5 A;  5B1B E;  1A5E A;  4U0Z A;  3FU5 A;  1EF1 C;  2R03 A;  3B95 A;  5EIB E;  4U63 A;  2UWJ G;  4D10 C;  3V2O A;  1IHG A;  3QWP A;  2QY7 A;  1INZ A;  4EQF A;  2XZT G;  2J4B A;  3EHN A;  3FUK A;  4LCT A;  1E96 B;  2R5S A;  2WXH A;  3X2Q E;  2WXO A;  3VLF A;  3ZGQ A;  1JWF A;  1JWG A;  3LVQ E;  2H6H A;  3FTX A;  3O48 A;  1QZ2 A;  1Z3Y A;  2XRY A;  2BF0 X;  1S64 A;  1G3N B;  3TXM A;  1N0R A;  1KPS B;  1HX8 A;  5AYW D;  3SD5 A;  3UKU G;  4HXI A;  5ARG A;  1H2V C;  2CHW A;  2ZGD A;  4HRM B;  3E37 A;  4J6I A;  2ILR A;  3TWU A;  2R17 C;  5KWD A;  4HLL A;  3NZU A;  1IQR A;  1HF8 A;  5KJL A;  4JC8 A;  3LS8 A;  4XZ4 A;  1IYG A;  4U04 A;  2VSX E;  3PS6 A;  2DBA A;  3VTX A;  4F6R D;  4UI9 J;  4GZC A;  3HRA A;  3EHQ A;  3NQP A;  3IBE A;  2DZO A;  3ESK A;  4DI3 A;  1Z6T A;  1TR4 A;  5ENR D;  4O60 A;  3R7Q A;  3IXE A;  4AXH A;  3JYS A;  3U9W A;  3IHV A;  5LX8 A;  3SGH A;  2CG2 A;  3ZVV A;  4N2S A;  1MYO A;  2WQ6 A;  3RO2 A;  2KZT B;  1H0A A;  3LJ3 A;  4WNE A;  4F3V A;  4AM9 A;  5EX0 A;  3L13 A;  5BW8 C;  3FTZ A;  3UIN C;  1YMP A;  4X8Q A;  3GZ2 A;  3FTV A;  3CR3 A;  2R05 A;  4GTQ A;  5B1A E;  5FIO A;  3DSS A;  2Y1L E;  2HR2 A;  4BWR A;  1XNF A;  4Q96 A;  4OVU A;  3AJI A;  4APF A;  1AP7 A;  3ULY A;  2GRL A;  1E8Y A;  1DCE A;  5JHA A;  1PAQ A;  3MV3 B;  4U0U A;  1BLX B;  3DPY A;  4RLY A;  2IOS A;  3B7R L;  1UN8 A;  4G2V A;  3ZHE B;  3NB2 A;  3ZXS A;  2EIK E;  4KBQ A;  4JEH A;  2H6F A;  1H6P A;  4I9E A;  3FUI A;  4J8D A;  4F1P A;  4ACL A;  4EZK A;  2OOE A;  4N5Q A;  4APO A;  2KCL A;  4A63 B;  3DSX A;  3V30 A;  3P1U A;  4CDR A;  1UJK A;  4JXT A;  2IU1 A;  5FT9 A;  1O5M A;  3UT8 A;  2XEN A;  4PH4 B;  2MHK A;  2WXR A;  4GZ6 A;  3UUX A;  3NF1 A;  1QQE A;  5JMN D;  3T9K A;  5AQA A;  2GRM A;  3TWS A;  3ZNG A;  4BET A;  4A3V A;  2KCK A;  4LUN U;  2J49 A;  3ASD A;  1WY6 A;  1OY3 D;  4BER A;  4MKT A;  2P9L G;  4A55 A;  4FLH A;  1IHB A;  3G2V A;  1N4Q A;  2WMN A;  2J08 A;  2J8S D;  3CKC A;  4GPK A;  3D9N A;  2Y4T A;  3UT4 A;  3TWR A;  4HRL A;  2WXP A;  2GGF A;  3Q78 A;  2QZA A;  4WWO A;  1HS6 A;  2OEW A;  2IO2 C;  3APC A;  4DX5 D;  4O6F A;  3QWV A;  3V2X A;  2V5Q C;  2P9U G;  3CQG B;  4K5B A;  4GB9 A;  5A6C A;  4NAC A;  3B7T A;  3L9T A;  2P9N G;  5CCM A;  4FJZ A;  4GTO A;  4Q94 A;  3T5V A;  1TNZ A;  4ILI A;  2VSN A;  2PZI A;  4H7Y A;  5M72 A;  1FVF A;  3Q7F A;  3PEV B;  2VSY A;  2EIM E;  3ML9 A;  4YVO A;  3U64 A;  3ULE G;  3QB2 A;  4HRN A;  1TYQ G;  3HXB A;  3JUI A;  3OTN A;  5G04 J;  1WAO 1;  1MX6 A;  4EZL A;  4DUI A;  4ATG A;  1VDY A;  5E75 A;  2WPV A;  3UTM A;  3FU0 A;  2LNI A;  1N0Q A;  3TWW A;  2MYO A;  2V8S E;  2PQR A;  4LG6 A;  5ANL A;  4U8V D;  3ONK A;  3CVL A;  4BT8 A;  3VTY A;  3UIO C;  3R9A B;  1PC2 A;  1E90 A;  5FQ8 A;  4UWH A;  3D9L A;  1HG5 A;  3D9H A;  1OWN A;  3APD A;  4ANX A;  4I6J A;  4JHK A;  4LEU A;  3DST A;  2BKK B;  3OXG A;  1QYM A;  2LUH A;  1GW6 A;  4O1P A;  3FFL A;  3O4Z A;  1ZB1 A;  3CV0 A;  5EYL A;  3ABK E;  3JXI A;  2ZU6 B;  1YYH A;  1O1R A;  3ASG A;  3FUJ A;  2CG3 A;  3C5R A;  2NC9 A;  3GZ1 A;  5FQ4 A;  2CFZ A;  3JCK C;  3E30 A;  4GTT A;  3I5P A;  3Q5M A;  4B89 A;  5G55 A;  3UPV A;  3BEE A;  3AG4 E;  4R7L A;  3DEP A;  4I17 A;  2P9S G;  2P58 C;  2KAT A;  5ENO D;  2AXZ A;  5FIN A;  1TNO A;  1E7V A;  3JXJ A;  3PNL B;  4GYO A;  2IFU A;  5G2N A;  2Y4U A;  3SNX A;  3TAX A;  5FZS A;  5DIZ A;  2RD0 A;  5B3S E;  1N9A A;  2BTD A;  3RSE G;  2WXN A;  3ULQ A;  2VSO E;  2C2L A;  3SQV A;  4HS2 A;  4A3T A;  2NSZ A;  3PE3 A;  4FHK A;  3UKR G;  1HG2 A;  3ASN E;  3FU3 A;  4Q69 A;  4G11 A;  2H6I A;  3PUJ A;  4DLO A;  3EHR A;  5CEC B;  3FUM A;  1H19 A;  3F6Q A;  1OCO E;  3CHM A;  2WXF A;  4WNG A;  3SFX A;  4MBG A;  2VQ2 A;  4GZ5 A;  1K1A A;  4XX5 A;  4YDO A;  5ENP D;  2QFC A;  3ZFW A;  3PRE A;  4XKC A;  2XZD G;  3MKQ A;  3FH8 A;  3SF4 A;  4GYY A;  4N3A A;  3L54 A;  1TEZ A;  2VGE A;  4BT9 A;  1LD7 A;  3J5Q B;  5EX3 A;  4KVM A;  4G23 A;  5AJL A;  3FTW A;  4URK A;  3C72 A;  4I2W A;  3C3O A;  2F8Y A;  5JJ7 A;  3FEX A;  2XQ0 A;  5BT1 A;  3Q9N C;  4G8L A;  4GAA A;  3AAA C;  3G2T A;  3D9I A;  3J5P A;  1N4R A;  4UWL A;  3PUK A;  3Q79 A;  3PNT B;  4WAF A;  5T3R A;  1SW6 A;  3LCA A;  2FI7 A;  2CHZ A;  3D9O A;  3QK0 A;  4OVV A;  3UXG A;  3UM0 A;  3RRN B;  4C9B B;  2RKK A;  2NYJ A;  1ELR A;  3PZ1 A;  4KXK B;  5EDS A;  2XPZ A;  3CSF A;  4GML A;  4GCO A;  4JVS A;  3EDT B;  4HOQ A;  3ZEF A;  3Q9U C;  4FA6 A;  2FUL A;  2WXG A;  3D9K A;  3APF A;  2L0I A;  5T8I A;  4FUL A;  3C3Q A;  3OXF A;  3RJV A;  2GRN B;  3E33 A;  4PUC A;  4N39 A;  1OT8 A;  3PVL A;  3FEY A;  5CMY A;  3EHM A;  3CVQ A;  3L82 A;  4I1M A;  4F7A A;  1D9S A;  4LNG A;  4PS7 A;  2WXM A;  3I4R B;  4BEP A;  2IOL A;  2YHE A;  1OCZ E;  4G24 A;  2VTB A;  4GTP A;  5KNG A;  3RO3 A;  3HVE A;  3UM3 A;  5KCM A;  4J0U A;  3S7D A;  3TWQ A;  3ABL E;  2X3M A;  4AEZ C;  4HQD A;  4HOU A;  1TNB A;  4WWN A;  4YND A;  5FQ6 A;  2AVP A;  4L9P A;  3QWW A;  4U95 D;  3KSL A;  1H6K A;  1FT1 A;  4DK5 A;  4UQY A;  3ZYL A;  1TN6 A;  2P9P G;  1UN9 A;  3UIP C;  4ANU A;  5CEA A;  3SI5 A;  4W9R A;  3MJW A;  4GZD A;  5LOZ A;  1BI7 B;  3CKB A;  3NBN B;  2WXL A;  3LPZ A;  3S7J A;  5JA4 D;  2RG8 A;  2EIJ E;  2MRI A;  4EZJ A;  5ENT D;  1ELK A;  4BX9 A;  4BES A;  1Z5S C;  5EN5 D;  4QFV A;  4YDE A;  4DLQ A;  2ZXW E;  3TWT A;  4Y6W A;  4ATZ D;  4J7W A;  1V54 E;  4LNB A;  2LAH A;  3ENE A;  1OCR E;  3PRZ A;  3GYZ A;  3PEU B;  1IXV A;  4I43 A;  3AS4 A;  5A7D B;  3RU0 A;  2P2C P;  5AEN A;  4EHM A;  3QAR A;  3E4B A;  1TN8 A;  2UY1 B;  3HHM A;  2V0P A;  2QYJ A;  4DPR A;  4EEC A;  4Z68 A;  3PH0 C;  1EPU A;  2I1K A;  4HNA D;  1QNF A;  2XGS A;  2FO1 E;  4UI9 C;  3FWV A;  3D9P A;  3FUE A;  3ZRH A;  2VGX A;  2DVW A;  2Y69 E;  4JHR A;  3RRM B;  3SFY A;  4DX2 A;  5CCL A;  3ZPJ A;  4ZFH A;  1WDY A;  3LY8 A;  1DC2 A;  5HKP A;  4UWG A;  3RK6 A;  5E76 A;  4ILH B;  4U7E B;  2VYI A;  2A5E A;  5EKQ D;  2QYU A;  2IO3 C;  4ANV A;  3D9J A;  3IHY A;  3ISM C;  4GTS A;  5JHB A;  3FUN A;  4OYS A;  1HE8 A;  4ANW A;  1E8W A;  3RIB A;  3U66 A;  1O1T A;  2F8X K;  5FZQ A;  4UQX A;  3B7S A;  4FHJ A;  3QC1 A;  1BD8 A;  2IQC A;  4U8H A;  1RW2 A;  1N94 A;  3R7R A;  2Y3A A;  3LY9 A;  4CYM D;  5ANR A;  5HI7 A;  4MLP A;  4LRZ A;  5BV1 A;  4HB5 A;  2R02 A;  3LKU A;  2X6K A;  1JPL A;  4XE0 A;  5LFA A;  3ZIM A;  4B8A A;  3DSW A;  4JEU A;  3Q47 B;  1BPO A;  1H6O A;  2LAI A;  5DBK A;  2IEJ A;  3ZYK A;  3ZXP A;  2HYZ A;  2GRQ B;  2JEK A;  4GPM A;  3TJP A;  4K03 A;  4RG9 A;  5EID A;  1FVH A;  1KZP A;  3B7B A;  4RVB A;  4DJA A;  3OXL A;  4YDY A;  3Q75 A;  1LTX A;  3FUD A;  4GA0 A;  3C98 A;  4FLB A;  4M3O A;  5ITZ F;  2F0Y A;  4HOS A;  5EYP F;  3TGO A;  4DX1 A;  1N11 A;  1V55 E;  3CVV A;  4U0S A;  4P29 A;  2IJG X;  4LNU D;  3KAE A;  4I1A A;  2PM7 A;  3Q4A B;  3QOU A;  3FUF A;  4DI4 A;  2L0T B;  4GTM A;  2LSV A;  1HU3 A;  1SVX A;  2DWZ A;  3BG1 B;  2X6I A;  2ETC A;  2F37 A;  3DEO A;  3HDX A;  4AY5 A;  1QBQ A;  4JZY A;  3FP3 A;  1DCQ A;  1NA0 A;  3CVY A;  3FUH A;  2GRP B;  3MKR A;  3FTY A;  2V5F A;  1NL4 A;  2C0L A;  4N2Q A;  5AQ9 A;  3ASO E;  1SZ9 A;  3ABM E;  3U4T A;  4EPZ A; 
#chains in the Genus database with same CATH homology
 4JC8 A;  1Y6I A;  2XQ0 A;  4LER A;  3LS8 A;  3CK9 A;  5BT1 A;  4XZ4 A;  2KC7 A;  1IYG A;  4GAA A;  4RG6 A;  3FUL A;  2VGX B;  1OWP A;  4U04 A;  4UWF A;  2VTB B;  1HFA A;  2VSX E;  3ONL A;  3G2T A;  3D9I A;  4ABN A;  4L1B A;  1S0P A;  4JA9 A;  3PS6 A;  2DBA A;  3MA5 A;  3CK8 A;  4K0R A;  3VTX A;  2YIN A;  4UI9 J;  1SQM A;  4UWL A;  3KD7 A;  5LCW J;  3PUK A;  3G2S A;  4GZC A;  4WNF A;  3PNT B;  3NQP A;  4CDM A;  5J90 A;  2OND A;  4WAF A;  3SHF A;  2XPI A;  3IBE A;  4EBA G;  3Q15 A;  5T3R A;  5LP0 A;  4GYW A;  3ESK A;  4DI3 A;  1Z6T A;  5ENN A;  3LCA A;  2JLB A;  3R7Q A;  2WQ7 A;  4AXH A;  5KJN A;  4HFG A;  3JYS A;  3HVE B;  2FI7 A;  4FP7 A;  4KZC A;  2CHZ A;  3D9O A;  2WXK A;  3IHV A;  3U9W A;  5LX8 A;  3SGH A;  2C0M A;  2CG2 A;  3MYV A;  3ZVV A;  3LVR E;  3QK0 A;  3K9I A;  5BNW A;  4N2S A;  4OVV A;  2WQ6 A;  3RO2 A;  4I6E A;  2KZT B;  3RRN B;  1H0A A;  1N54 A;  2AXV A;  3LJ3 A;  4C9B B;  4F53 A;  3CVX A;  2OVB A;  1ELR A;  4L2Y A;  4WNE A;  1JUQ A;  4F3V A;  4KXK B;  1NA3 A;  4AM9 A;  3EJN A;  3CHS A;  5EDS A;  5EX0 A;  3L13 A;  5BW8 C;  3FTZ A;  3CK7 A;  2XPZ A;  5FJY A;  2EQX A;  3L6A A;  4BX8 A;  4I1O B;  5JJT A;  3CSF A;  1UG3 A;  4JL0 A;  3GZ2 A;  3FTV A;  3SBS A;  4GML A;  4F1S A;  1EYH A;  2OVF A;  3WXX A;  4ACK A;  3CR3 A;  4GCO A;  4UI9 K;  4JVS A;  5JJ6 A;  2PM6 A;  3EDT B;  4HOQ A;  2E0I A;  3ZEF A;  3CIA A;  4FA6 A;  4CDN A;  2FUL A;  4EBA A;  2WXG A;  3S7B A;  3I3N A;  3D9K A;  2HR2 A;  4BWR A;  3APF A;  3D3M A;  1XNF A;  4BFR A;  2L0I A;  1X5B A;  1DNP A;  2M63 A;  4FUL A;  4Q96 A;  3OXF A;  4OVU A;  5T8I A;  4APF A;  1IQU A;  1E8Y A;  2GRL A;  3GZS A;  4KZ0 A;  3RJV A;  5JHA A;  1PAQ A;  3MV3 B;  4PUC A;  3CHP A;  1L5J A;  4N39 A;  1OWL A;  4CRW A;  3PVL A;  4U0U A;  4Y6C A;  4V3I A;  1LF8 A;  1WM5 A;  3FEY A;  5KJM A;  5CMY A;  4BTB A;  3EHM A;  2UY1 A;  1N52 A;  2IOS A;  4FAD A;  3B7R L;  3CVQ A;  3EIJ A;  4I1M A;  4F7A A;  1UN8 A;  3ZYM A;  3KEZ A;  4G2V A;  4PS7 A;  2A4Z A;  2WXM A;  3I4R B;  3HIZ A;  2IOL A;  3ZHE B;  4KVO A;  1E8X A;  1Z3X A;  3ZXS A;  2YQ8 A;  4EPZ A;  4KBQ A;  1HXI A;  1NZN A;  2YHE A;  4JEH A;  3KS2 A;  4G24 A;  3MV2 B;  2FBN A;  4XIF A;  4I9E A;  3URZ A;  2VTB A;  5D0Q D;  2WM9 A;  3FUI A;  2XCC A;  3RO3 A;  2AW6 A;  3HVE A;  4CGW A;  4J8D A;  2A5U A;  3ASH A;  5KCM A;  4ACL A;  4EZK A;  1ZBP A;  4J0U A;  2OOE A;  3S7D A;  2J09 A;  2FEZ A;  1KLX A;  4H7X A;  2X3M A;  4G25 A;  4TUU A;  4AEZ C;  3L16 A;  4HOU A;  4APO A;  2KCL A;  4WWN A;  4YND A;  4CT4 A;  3JQ0 A;  1UJJ A;  1MHQ A;  2XPY A;  3B7U X;  2AVP A;  5FQ6 A;  1TJC A;  3QWW A;  1OWO A;  4KMO A;  4BTA A;  1H6K A;  3P1U A;  4DK5 A;  4UQY A;  4CDR A;  1UJK A;  4JXT A;  4XKB A;  3ZYL A;  2IU1 A;  4J8S A;  5FT9 A;  3QJZ A;  4N3C A;  4NQ0 A;  2LSU A;  4G26 A;  1UN9 A;  3UT8 A;  4AJW A;  4ANU A;  1FCH A;  3IEG A;  4PH4 B;  5G05 J;  2MHK A;  4W9R A;  2WXI A;  3SI5 A;  4UQZ A;  2WXR A;  4GA2 A;  4GZ6 A;  3SFZ A;  3MJW A;  3UUX A;  3U3W A;  1KT0 A;  5FTP A;  3LYA A;  1QQE A;  2J9Q A;  3NF1 A;  4GZD A;  5LOZ A;  3LY7 A;  2GRM A;  3ZYQ A;  4IYP A;  3SBT B;  4A3V A;  3TG4 A;  3CKB A;  2KCK A;  2WXL A;  4LUN U;  3LPZ A;  2J49 A;  3ASD A;  3S7J A;  2RG8 A;  2BUG A;  1WY6 A;  2NXP A;  3TL5 A;  4I9C A;  2MRI A;  3FH7 A;  4MKT A;  3CHO A;  3CST A;  4EZJ A;  1OUV A;  1ELK A;  4BX9 A;  4KT6 B;  3VLD A;  4A55 A;  4FLH A;  5C1D A;  3G2V A;  3AS8 A;  2WMN A;  3QAQ A;  2J08 A;  3CKC A;  2YNQ A;  3QKY A;  4QFV A;  1EDU A;  4DLQ A;  4GPK A;  1P5Q A;  3D9N A;  4GMJ A;  3IV0 A;  2Y4T A;  4Y6W A;  3UT4 A;  4G1T A;  3L17 A;  3Q49 B;  4J8E A;  2KZT A;  2GGF A;  2WXP A;  5BPP A;  1H2T C;  2HM8 A;  2LAH A;  3ENE A;  4CT0 A;  4I2Z A;  1E8Z A;  2AXU A;  4WWO A;  1HS6 A;  2XHE A;  3PRZ A;  3GYZ A;  3PEU B;  3AS5 A;  4FJY A;  4I43 A;  3AS4 A;  1HO8 A;  5A7D B;  4CGV A;  4N3B A;  3APC A;  3QNK A;  3RU0 A;  2X6H A;  4AV7 A;  5AEN A;  3G2W A;  2WXQ A;  3AU5 A;  4O6F A;  1W3B A;  3QWV A;  2IF4 A;  3E4B A;  3QAR A;  5FQ7 A;  1ELW A;  3S7F A;  3FU6 A;  2V4L A;  2UY1 B;  1U3C A;  4JA7 A;  3CVW A;  3DBS A;  3CQG B;  2V0P A;  3HHM A;  4IN3 B;  4GB9 A;  5CMW A;  2GW1 A;  5A6C A;  4NAC A;  3B7T A;  4DPR A;  4EEC A;  3PH0 C;  1EPU A;  2I1K A;  4GCN A;  3MGB A;  4E6H A;  5CCM A;  4I6G A;  4FJZ A;  4NUR A;  4Q94 A;  3T8M A;  4AOF A;  3CEQ A;  4CCA A;  3FDH A;  2J4D A;  3T5V A;  1QNF A;  4HLE A;  2XGS A;  4UI9 C;  3G2U A;  3SZ7 A;  4HOR A;  3FWV A;  3L22 A;  4AVX A;  4ILI A;  3D9P A;  2I9C A;  5AJD A;  2KM4 A;  3FUE A;  2VSN A;  2VGX A;  4IUL A;  2PZI A;  4H7Y A;  3ZRH A;  5M72 A;  1FVF A;  4L2L A;  3PEV B;  3ESL A;  5KJK A;  2I1J A;  2VSY A;  4JHR A;  2OV8 A;  3RRM B;  3LDZ A;  3OAW A;  2X38 A;  4ME2 A;  5CCL A;  3ML9 A;  3ZPJ A;  4YVO A;  1XGW A;  1E7U A;  4PS8 A;  3U64 A;  3LY8 A;  3QB2 A;  3IKO B;  4GZ3 A;  3MEK A;  4TRQ A;  3ASF A;  5C2Y A;  3JUI A;  3LEW A;  3FTS A;  1YA0 A;  3OTN A;  5G04 J;  3ZW3 A;  1WAO 1;  4EZL A;  4UWG A;  3RK6 A;  5E76 A;  4ILH B;  2E2E A;  2VYI A;  3EIQ C;  4ATG A;  1VDY A;  5E75 A;  2WPV A;  5EKQ D;  4KYO B;  3DPD A;  3TG5 A;  3FU0 A;  3B13 A;  4L7T A;  5BV0 A;  2LNI A;  3CHR A;  3UX4 A;  2VGY A;  2YHC A;  4AY6 A;  4L23 A;  2V8S E;  2DCP A;  2PQR A;  5ANL A;  4BSX A;  5T4Y A;  2I2O A;  3ONK A;  2FO7 A;  3CVL A;  3PZD A;  4ANV A;  4BT8 A;  3D9J A;  3IHY A;  3VTY A;  2WMO A;  4JHJ A;  3R9A B;  5JHB A;  1PC2 A;  3PE4 A;  2Q7F A;  1MQS A;  1E90 A;  4PS3 A;  4NRH B;  3FUN A;  5FQ8 A;  4BY6 A;  2HO1 A;  4UWH A;  3D9L A;  1HG5 A;  4OYS A;  1OWN A;  1HE8 A;  4ANW A;  3APD A;  4B94 A;  3RRU A;  4ANX A;  1E8W A;  3RIB A;  4U07 A;  3VLE A;  3U66 A;  3MZL B;  4J8F A;  4I6J A;  4JHK A;  4UWK A;  5FZQ A;  4PDX A;  4LEU A;  4UQX A;  3OXG A;  1ZU2 A;  2ION A;  3ZN3 A;  2XGM A;  4A1S A;  3HYM B;  3B7S A;  3UQ3 A;  1GW6 A;  4FHJ A;  3FFL A;  3QC1 A;  2L6J A;  3N71 A;  3QDN A;  2IQC A;  3O4Z A;  4U8H A;  3CVU A;  2X6F A;  4HOT A;  4FU3 A;  3R7R A;  2Y3A A;  3LY9 A;  2I6H A;  2CHX A;  3CV0 A;  1A17 A;  4GA1 A;  3L08 A;  4HVB A;  5ANR A;  5HI7 A;  5HQ8 A;  2LO6 A;  2ZU6 B;  5A23 A;  2WVI A;  3T5X A;  3FTU A;  4MLP A;  2FF4 A;  3FHE A;  4LRZ A;  5BV1 A;  4GU5 A;  2WQH A;  3ASG A;  3D9M A;  3FUJ A;  1B89 A;  2CG3 A;  2X6K A;  3LKU A;  1UW4 B;  2NC9 A;  3GZ1 A;  5FQ4 A;  3P2B A;  1KT1 A;  3I4G A;  1JPL A;  4XE0 A;  4N5C A;  2CFZ A;  3JCK C;  5LFA A;  2WB2 A;  3I5P A;  3Q5M A;  4B89 A;  3CLJ A;  3ZIM A;  5G55 A;  4B8A A;  4JEU A;  4MS6 A;  3UPV A;  3BEE A;  1OWM A;  5G04 C;  4ILG A;  3AU4 A;  4R7L A;  3CVP A;  5FWQ A;  1H2U A;  3Q47 B;  4I17 A;  3MKQ B;  2XCB A;  1BPO A;  5AIJ A;  4AIF A;  3UT7 A;  1HZ4 A;  2CFU A;  2LAI A;  2XRZ A;  2XEV A;  4CEM A;  2P58 C;  2KAT A;  5DBK A;  2AXZ A;  2X6J A;  1E7V A;  3CHQ A;  4B8C B;  4GYO A;  3PNL B;  4IRU A;  3ZYK A;  4C0M A;  2IFU A;  5G2N A;  2HYZ A;  4E85 A;  4WWP A;  5J08 A;  5G05 C;  5LCW C;  2VJ8 A;  2JEK A;  2Y4U A;  3SNX A;  3TAX A;  4C0E A;  5FZS A;  5DIZ A;  1Y8M A;  1DVP A;  2RD0 A;  3CQC B;  5ARF A;  3TJP A;  2BTD A;  2WXN A;  4MRU A;  4RSY A;  2VSO E;  3JQ1 A;  4WND A;  3ULQ A;  2KCV A;  2C2L A;  2J07 A;  4K03 A;  4RG9 A;  2XGO A;  4HS2 A;  4A3T A;  1FVH A;  2NSZ A;  3PE3 A;  4TV3 A;  2L9B A;  4FHK A;  3LXU X;  4RVB A;  1NP7 A;  3FY4 A;  2PQN A;  2WXJ A;  1HG2 A;  4DJA A;  3OXL A;  1PY1 A;  3PDN A;  3FH5 A;  2AWI A;  4U0Z A;  3MX3 A;  3FU5 A;  1EF1 C;  3FU3 A;  3FUD A;  4FC8 A;  3C98 A;  4GA0 A;  5FZR A;  4Q69 A;  4U63 A;  4YVQ C;  4G11 A;  4FLB A;  3UMV A;  2UWJ G;  3PUJ A;  4M3O A;  4A1G A;  4D10 C;  4XI0 A;  4DLO A;  4HOS A;  1IHG A;  5D0O D;  3FUM A;  3QWP A;  3TGO A;  3GW4 A;  1H19 A;  2QY7 A;  1INZ A;  4EQF A;  3S2A A;  2J4B A;  2DIW A;  1HH8 A;  3EHN A;  3CVV A;  4U0S A;  3FUK A;  4P29 A;  4LCT A;  1U3D A;  4JW1 A;  2IJG X;  3CHM A;  1E96 B;  2R5S A;  3KAE A;  2WXF A;  2R59 A;  4I1A A;  3TXN A;  2WXH A;  3RKV A;  4WNG A;  2WXO A;  2PM7 A;  2VQ2 A;  3Q4A B;  4GZ5 A;  3VLF A;  4XX5 A;  3CVN A;  3ZGQ A;  1JWF A;  1JWG A;  2QFC A;  3ZFW A;  3LVQ E;  3ML8 A;  3QOU A;  3FTX A;  3O48 A;  3PRE A;  1QZ2 A;  1Z3Y A;  4XKC A;  3FUF A;  2XRY A;  4AP2 A;  4DI4 A;  2L0T B;  4B0Z A;  3MKQ A;  2LSV A;  3FH8 A;  1HU3 A;  3SF4 A;  5CHE E;  4GYY A;  2BF0 X;  3BG1 B;  2X6I A;  4N3A A;  3L54 A;  1TEZ A;  2MOW A;  3TXM A;  3ZHE A;  3HDX A;  4AY5 A;  4JPS A;  4JZY A;  4BT9 A;  1HX8 A;  5BUZ A;  5EX3 A;  3FP3 A;  4KVM A;  5AYW D;  4WUY A;  3SD5 A;  1NA0 A;  3CVY A;  4HXI A;  3MCX A;  4G23 A;  3FUH A;  5ARG A;  1H2V C;  2CHW A;  3CGH A;  3MKR A;  5AJL A;  3FTW A;  4URK A;  4J6I A;  2ILR A;  3FTY A;  2R17 C;  2V5F A;  4I2W A;  2C0L A;  4N2Q A;  3BG0 B;  1TJF A;  3NZU A;  1IQR A;  2PL2 A;  5JJ7 A;  3FEX A;  3NZS A;  4XI9 A;  1SZ9 A;  3U4T A;  1HF8 A;  1SZA A;  5KJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...