4BERA

Crystal structure of the legionella pneumophila fic domain-containing effector ankx protein in complex with cytidine monophosphate
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
477
structure length
475
Chain Sequence
GVKIMPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLHPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOCHOLINE TRANSFERASE ANKX
publication title Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Transferase
total genus 167
structure length 475
sequence length 477
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4berA02
4ZFHA 4QQIA 1MJ0A 5ENPD 5EIDA 2AJAA 4O60A 1OY3D 1AWCB 2DZOA 3V30A 1BD8A 1A5EA 3EHRA 5AAOA 4JB8P 4U95D 2DZNA 4F6RD 3KEAA 5ENTD 3HRAA 3ZKJA 3ZNGA 5FINA 2QC9A 4HRLA 3F6QA 5HKPA 2F37A 4HRNA 4DX6D 1YCSB 4HQDA 5AN8A 2P2CP 1OT8A 4LG6A 3TWXA 1D9SA 5EYLA 5KWDA 4HLLA 4G8KA 2MYOA 5AQAA 4HRMB 4C48B 1IKND 3TWTA 2XZTG 5BXUA 4HI9A 3EU9A 1BLXB 2XEEA 4LSZE 3SO8A 3TWVA 3DEPA 4BEPA 3UI2A 1WDYA 3LJNA 4U8YD 3TWQA 4J7WA 5BXOA 4DX5D 2J8SD 5ITZF 3DEOA 4RLYA 2RFMA 5CERB 3V2OA 2DVWA 2ZGGA 5JMND 4B93B 3NOGD 1N0RA 1IHBA 4DUIA 1SW6A 4HBDA 2JABA 4K5AB 3Q9UC 3UXGA 4K5BA 5CECB 1K1AA 3NOCD 5AQ7A 2F8XK 3J5QB 1BI7B 5CEDB 2V5QC 3TWRA 1K1BA 4CYMD 3AJIA 1MYOA 4O1PA 3ZUVB 4DRXE 3AAAC 5D66A 4BESA 2ZGDA 5FIOA 2KBXA 1MX6A 4ZHBA 1MX4A 3B7BA 3C5RA 5EN5D 5JA4D 3T8KA 4NIKA 5AARA 4U8VD 4DX7D 5CEAA 5ENQD 5ENOD 3D9HA 1DC2A 4OAVB 4HB5A 2F8YA 5EIBE 2FO1E 4BETA 4BSZB 2BKGA 4N5QA 4DX2A 4UUCA 2VGEA 4Z68A 2L6BA 5AQBA 1IXVA 4J8YA 2PNNA 4HNAD 4LNUD 4QFVA 3JXJA 3ZU7B 3EHQA 4F1PA 3IXEA 4GMRA 5KNHD 1QYMA 2A5EA 2NYJA 4HI8A 4GPMA 2Y0BG 1N11A 1S70B 2RFAA 4CZ2D 3NBNB 1AP7A 3B95A 4YDYA 3W9FA 1NFIE 4K5CA 3Q9NC 1MX2A 3T9KA 5ENRD 3W9GA 2ETBA 2DWZA 3TWSA 1N0QA 3UTMA 4A63B 4DX1A 1UOHA 4ATZD 3V31A 2KXPC 1K3ZD 1WG0A 1DCQA 3JXIA 2BKKB 3JUEA 4YDWA 5EYPF 5KNGA 3HG0D 2Y1LE 1BU9A 5HRYA 1BI8B 2QYJA 2ETCA 5CBNA 2XENA 5ENSD 2ETAA 3J5PA 1SVXA 5HS0A 4BERA 4TUMA 2B0OE 3TWUA 4O1OA 2HE0A 4G8LA 2XZDG 3V2XA 1YYHA 5EILA 4U96D 5AQ9A 5CBOA 3V79K 4OAUC 1YMPA 1G3NB 3TWWA 1TR4A 2V4HC 2XEHA 5KBAA
chains in the Genus database with same CATH superfamily
4QQIA 3CSTA 4GTTA 4HORA 4FHJA 4GU5A 1JCRA 4I9EA 4UI9J 2LAIA 4N39A 2QC9A 2HO1A 4AV7A 4ANUA 5EYLA 4A1SA 4AY6A 5KJNA 4L2YA 2KATA 3RAUA 4C0MA 2IOLA 3EU5A 4A1GA 3LY7A 1PAQA 5B1AE 2XQ0A 1E8WA 1N52A 3MKQB 3S7BA 4B93B 5T4YA 4EQFA 1JUQA 3GW4A 1N0RA 2VYIA 3QWPA 4CDRA 4WWPA 3CVQA 4JEHA 1HX8A 4J6IA 5G2NA 2RKKA 3L08A 3I4GA 5G05J 3S7JA 3RK6A 3T8KA 1E7UA 5EIBE 4GYWA 1RZ4A 4JEUA 4BSZB 5HQ8A 4A55A 3KS2A 3L13A 3PUJA 2XRYA 4MBGA 4F1PA 3DPDA 2IY0C 4L7TA 4NURA 3FUHA 1MX2A 3U4TA 4DX1A 2XEVA 2J49A 4L9PA 3IHVA 2MOWA 3AS4A 2ZXWE 3HG0D 5EX3A 2OVFA 1E8ZA 1KZOA 1QNFA 3AU4A 2LSUA 3ZXPA 5D0QD 2VGXA 4BERA 4U0UA 2WB2A 3KSLA 1YYHA 1N54A 5BV1A 1TR4A 2GRLA 4B8CB 1AWCB 3CEQA 3NB2A 4JB8P 3D9MA 3ZNGA 1H2TC 2WVIA 3JCKC 1D8DA 4HQDA 4Q69A 4HS2A 5B1BE 4YDEA 1EYHA 3FTUA 3DEPA 2MHKA 4WAFA 3PZ4A 3I3NA 1N9AA 5CERB 5FQ7A 5FZSA 3EJNA 3RO2A 2H6GA 2LXLA 1SW6A 4K5AB 3CKBA 3Q9UC 4HXIA 4TXQA 2ZIRA 3CK8A 1S0PA 4FADA 1TNYA 4HFGA 4OAVB 4BETA 4KVOA 2J09A 4GZCA 3ZU7B 4FU3A 1FPPA 2NYJA 1JWGA 2WXIA 4B94A 3W9FA 2EIJE 1OWLA 2L9BA 3UM1A 3T5VA 1UOHA 1K3ZD 2UWJG 4M7CA 1SQMA 4GB9A 1BI8B 3KAEA 2I6HA 1QQEA 2OEVA 4J8FA 2V0PA 3FFLA 3Q7FA 2FBNA 2R2LA 2P9LG 4FJYA 2GRNB 2X6HA 5ARGA 1PY1A 4U95D 2LAHA 2A4ZA 4TXRA 2Y69E 4UI9C 4HRLA 4XX5A 2PL2A 2XPYA 4HLLA 2KZTA 5BXUA 3Q75A 4GMJA 3PEVB 4AOFA 4RSYA 4IYPA 4DX5D 2CFUA 2EQXA 4WWNA 2BEDA 3CVUA 5CECB 4GTOA 1TEZA 3UMVA 4I6EA 2VTBB 2ZGDA 1ZBPA 3FU0A 4WWOA 4BWRA 2QFCA 5G05C 2IU1A 4Z68A 4J8YA 5FTPA 1N11A 4CZ2D 4UWGA 2WM9A 2WXOA 3DRAA 1WAO1 3ZVVA 2EILE 1OCRE 4U0SA 4KZ0A 3ASHA 3E30A 4CRWA 3AG1E 4XI9A 2X6JA 4F1SA 3TL5A 4DI4A 2I2OA 4GA2A 4EZKA 2ETCA 2V8SE 3ZN3A 3MV2B 4G8LA 3R7QA 5CCMA 3FUJA 3TGOA 2V4HC 2XEHA 4UWKA 2GRPB 1HFAA 4XKBA 4BT8A 2DYRE 4V3IA 1UW4B 3PVLA 3SF4A 3FULA 3G2WA 1TNZA 4JD2G 3MYVA 1NA3A 3D9KA 3UINC 1FT2A 3C3RA 1WM5A 4G26A 1XGWA 5M72A 4G11A 5C1DA 4EZJA 1DVPA 2IO3C 3JUIA 1Q2ZA 3CHSA 5AQ7A 1TNOA 5CEDB 1K8KG 3AJIA 4HOSA 4R7LA 3WXXA 2LNIA 4RG9A 3LY8A 3TJPA 3FH7A 4HVBA 2WXNA 4CCAA 4I1MA 5CRVA 3E37A 3HYMB 2WMNA 4YDYA 4JZYA 4KT6B 4LNGA 4HLEA 4H7YA 1NZNA 2R05A 3ZIMA 3HVEA 2FF4A 1X81A 3FUIA 3AG2E 3FP3A 1HG2A 4AP2A 4O1OA 3KD7A 5EILA 4OAUC 4NACA 3FWVA 4EHMA 3APDA 2VJ8A 5FINA 3SHFA 3FH8A 3HXEA 3ONLA 4LG6A 1BPOA 2NC9A 3T8MA 4C48B 2LXMA 1MQSA 2XPIA 4LSZE 4UQYA 2AXUA 3ML8A 1IYGA 3UI2A 1WDYA 4GZDA 3FUMA 3ASFA 2WQ7A 4XKCA 3G2VA 1KPSB 2ZGGA 3NOGD 4GCOA 1OWNA 4HBDA 4L1BA 1N95A 3BQOA 5D66A 3PS6A 3MA5A 4DJAA 5AARA 4RG6A 4AEZC 5EKQD 1DC2A 5KJLA 1FCHA 2L6BA 1IXVA 1N4SA 2V5FA 4GMRA 2UY1A 2R59A 4HI8A 1HU3A 3FEYA 2RFAA 4JHJA 3E32A 2L0IA 2HR2A 3I4RB 5HI7A 2XGMA 4BX9A 5BV0A 4KMOA 2ETAA 3EIQC 4MLPA 1SVXA 3FU3A 2B0OE 1ELWA 3IEGA 4PDXA 3V79K 1YMPA 3L6AA 2YINA 5KBAA 4GTVA 4AJWA 2AJAA 1OY3D 4ILIA 2DIWA 1WY6A 3HDXA 2XPZA 4PH4B 3QARA 3ZHEB 4KVMA 4I9CA 3UT4A 2OVBA 3L22A 4TXPA 4IULA 2MYOA 1N4RA 2X3MA 3D3MA 3EU9A 2XEEA 3URZA 3CIAA 4RLYA 4ABNA 3V2OA 3Q4AB 5CHEE 4O6FA 1D8EA 3T5XA 4DUIA 1Z6TA 2VSOE 4LCTA 1PC2A 3DSXA 3ASGA 4K0RA 3D9PA 3AAAC 4BY6A 2LSVA 3CQGB 4ACLA 4DX7D 5CEAA 2WXFA 3B7UX 2BKGA 3CR3A 1MZCA 4M3OA 3EHQA 2F0YA 4K03A 3TXNA 4K5CA 4GYOA 4J8DA 4APFA 3AS8A 3UTMA 4EECA 4BT9A 3P2BA 1WG0A 1DCQA 3CHQA 4EBAA 5KNGA 2NSZA 4G24A 3QNKA 3J5PA 3CVYA 3HXFA 3CVPA 4ATGA 1IQUA 3HXDA 1G3NB 4U0ZA 2GRMA 5ANRA 3C3OA 2ONDA 3TXMA 1UN9A 2CG3A 3UIOC 5AAOA 3KEAA 4YNDA 3CK7A 3F6QA 1HS6A 3MZLB 3D9OA 2VGXB 1H6OA 3CHPA 4GTPA 3TWTA 2OV8A 4U7EB 3RJVA 4ME2A 3KSQA 2YNQA 2R17C 2LO6A 3DEOA 5JMND 1IHGA 4Q94A 1H2VC 1V55E 1A17A 3B7RL 1KT1A 3D9NA 2ILRA 3QC1A 2M63A 5E75A 2ZISA 1EPUA 2Y4UA 3O4ZA 3NQPA 5KJKA 4ZHBA 2XGOA 3SBSA 2C0LA 2Q7FA 5A23A 3OXGA 5ARFA 5A6CA 2VGEA 2FEZA 3LEWA 4G25A 3UM3A 3ZFWA 3L17A 2DYSE 1Y6IA 2PQNA 3IBEA 1NL4A 5AJDA 4ILGA 2WXJA 3NBNB 1AP7A 3FUKA 3B7TA 3Q9NC 3TWSA 5B3SE 2OEWA 4MRUA 4CDNA 5JJTA 3CVNA 2Y1LE 4GA0A 1JCSA 4PS7A 3FHEA 3FUDA 2J08A 2X6IA 2J07A 4C9BB 1E7VA 2C0MA 2PZIA 3Q79A 3R9AB 1BD8A 3EHRA 4N3CA 4CGVA 3QJZA 2F37A 4DX6D 2L6JA 2KM4A 4ACKA 4N3BA 4G8KA 2P9NG 4HRMB 4JL0A 3DSVA 1H6KA 3CVXA 2L0TB 4GTSA 2IEJA 2EIKE 2GRQB 3CGHA 2XRZA 4BX8A 1L5JA 2QY7A 4RVBA 3SY2A 2F8XK 3UT7A 2KZTB 1BI7B 3TWRA 5A7DB 4FLHA 4FA6A 1LTXA 5BW8C 3C98A 2MRIA 3RRNB 5LX8A 3CQCB 4HB5A 2JEKA 4N5QA 3UT8A 3IHYA 1OCCE 4HNAD 4N2SA 2IJGX 3ZYLA 3FU5A 3ZW3A 1RW2A 2VSXE 4URKA 3O48A 2AXVA 4J8EA 5C2YA 4APOA 5ENNA 3FY4A 3CSFA 5CCLA 3LKUA 3TG4A 1TN7A 3CKCA 2RG8A 2XENA 3L82A 5G55A 3CVLA 2E2EA 4N5CA 3V2XA 2WXPA 3EUVA 4GAAA 4ZFHA 1EF1C 1UJJA 3TAXA 4TV3A 4GTMA 1FT1A 4OVVA 3OAWA 1SZ9A 2WXRA 2EINE 5BUZA 3GZ1A 3ML9A 5AQAA 2IO2C 3U9WA 3FTXA 3HXCA 4ANWA 2WXKA 2A5UA 2I1KA 3DXKG 4U8YD 3TWQA 3X2QE 5AENA 3QDNA 5FZQA 2FULA 3AS5A 3UXGA 3CHRA 2WQ6A 3PDNA 5FQ8A 4RQIA 4FULA 3DSTA 1X5BA 2BUGA 2KBXA 1MX4A 3R7RA 4C0EA 3D9HA 4G2VA 4FP7A 2FO1E 3C3QA 4DK5A 4QFVA 3AU5A 4GZ6A 5EDSA 2P9PG 3ABLE 4I1OB 3FU6A 4PS8A 3FTSA 3PEUB 3T9KA 3IV0A 5D2MC 4OVUA 3PZ1A 1U3CA 1BU9A 5HRYA 3U3WA 4JVSA 4IN3B 2CHZA 3OXLA 3SZ7A 2XS8A 3TWUA 2CG2A 3RKVA 4E6HA 4U96D 5AQ9A 1MHQA 3GZ2A 4UI9K 4HOQA 1TNUA 5FZRA 2CFZA 1XNFA 1OXJA 5EIDA 4O60A 3ZYMA 3V30A 1A5EA 5ENTD 3HVEB 3SI5A 1ELRA 4HRNA 1H0AA 1OT8A 4B0ZA 3SGHA 1D9SA 4LNBA 3L16A 4GMLA 4D10C 4GZ5A 4G1TA 4GA1A 3OTNA 3UM0A 4HI9A 3UKUG 1BLXB 4I6GA 3QWWA 4KXKB 4MKTA 5LOZA 2DBAA 3ABKE 4DPRA 2P9IG 1JPLA 1HF8A 4UWLA 4U8HA 3LY9A 3ENEA 1OWPA 1TJCA 3S7FA 4GTRA 4I2WA 5AIJA 1MX6A 5LP0A 3MEKA 4I1AA 5ENQD 3APCA 3UX4A 4I17A 4L23A 5T3RA 2RD0A 4BTAA 3PE4A 4LNUD 3OXFA 4GPMA 1S70B 3WG7E 1SA4A 3HXBA 5ENRD 3EHMA 3L54A 3V31A 1KLXA 4U07A 3UKRG 1HXIA 4JW1A 2VSNA 3DWLG 2GW1A 2XHEA 5E76A 2QYJA 1O1TA 3SFZA 4EPZA 3LCAA 2WMOA 3ONKA 2WXQA 4TUMA 3PNLB 2HE0A 5G04J 5KCMA 4KZCA 3AG4E 4YVOA 3ESLA 3FTWA 5LCWJ 4YDOA 2E0IA 4GZ3A 5D0OD 3LVQE 5AN8A 3EIJA 2XZTG 2BTDA 1E8YA 4WNFA 5H7PA 3G2UA 1Z3YA 2IFUA 5JHBA 4EBAG 3SD5A 3SFXA 2VQ2A 3LJNA 1OCOE 4B8AA 3PREA 3MJWA 3FDHA 2VSYA 1DCEA 4FC8A 1KT0A 4JPSA 4K5BA 3NOCD 2J9QA 5BT1A 3LYAA 1LD7A 3VLDA 4DRXE 1DNPA 1ELKA 3B7BA 4CT4A 4N2QA 3NZSA 2WXHA 5DIZA 2QZAA 1O1RA 3MGBA 4DX2A 4UWHA 2X6FA 2KC7A 4XI0A 5FJYA 2I9CA 1QZ2A 1N94A 4GTQA 1TYQG 5CMWA 3B95A 3FH5A 4WNEA 4P29A 4U63A 2J4BA 4F53A 2ETBA 4AXHA 3FUFA 2PM7A 2V4LA 2WXGA 3Q73A 2ZU6B 2H6HA 2QYUA 1FVHA 3PRZA 3UM2A 2VGYA 1TNBA 4W9RA 4L2LA 3TWWA 1JWFA 4J7WA 3ZXSA 1MJ0A 5ENPD 3PH0C 4B89A 4BSXA 1SA5A 3MKQA 2DZNA 4YVQC 3RSEG 4TRQA 3ASOE 5HKPA 3LVRE 5DBKA 2P58C 4UWFA 5KWDA 1U2VG 1QBQA 3RU0A 2PQRA 4GYYA 2YHEA 3SO8A 3DSSA 3TG5A 4KYOB 3JYSA 3KEZA 3GYZA 3Q78A 2DCPA 4PS3A 2KCKA 4I43A 1OCZE 3Q7AA 1K1AA 4FJZA 3QKYA 3GZSA 3ESKA 1U3DA 4XZ4A 1H6PA 4O1PA 3ZUVB 3C5RA 4PUCA 5EN5D 5CRUA 3G2SA 1V54E 3DBSA 2OCCE 5BNWA 3JXJA 3MCXA 2A5EA 3CLJA 1B89A 3D9IA 1HZ4A 3W9GA 2P9KG 4A63B 1N0QA 4ATZD 2H6IA 3JXIA 3QK0A 4YDWA 5T8IA 4CEMA 5JJ7A 5JJ6A 3RRUA 3PNTB 3S2AA 1HE8A 1E90A 3K9IA 5FQ4A 4BFRA 5G04C 1ZB1A 4LRZA 3NZUA 1YA0A 1E8XA 5LCWC 4JXTA 2AWIA 1TN6A 2Y4TA 4FLBA 4I6JA 1YCSB 2HM8A 1N4QA 1W3BA 3N71A 2XCBA 5IY5E 3G2TA 4UQZA 4J0UA 4N3AA 2X38A 3APFA 5FWQA 4BEPA 5BXOA 2J8SD 4UQXA 3ASDA 3P1UA 4JC8A 2J4DA 2DVWA 2IQCA 4TUUA 3QAQA 4JHRA 1K1BA 1UN8A 1JCQA 4X8QA 1EDUA 3VTYA 1GW6A 4AY5A 3JQ0A 4UUCA 3NAWA 1P5QA 2R02A 1QYMA 1NA0A 3I5PA 3CVWA 3LDZA 3ZYKA 5J08A 3BEEA 4JA7A 3MX3A 1SZAA 2KCVA 5AYWD 3ZEFA 3ZGQA 4JHKA 2BKKB 3EDTB 3SQVA 3AG3E 2GGFA 2PM6A 1O5MA 3MV3B 4WNDA 3E34A 3HHMA 3QWVA 3B7SA 3LS8A 4CT0A 5ITZF 5BPPA 4F6RD 3HRAA 2R03A 2P2CP 4LEUA 3PUKA 3QOUA 1IKND 5CMYA 3LJ3A 4I2ZA 2VTBA 5AJLA 3DSWA 4GCNA 4A3VA 3FUEA 1OUVA 2WXMA 1UG3A 3UQ3A 2V5QC 1N4PA 2OOEA 3D9JA 5FIOA 4OYSA 5JA4D 1KZPA 4U8VD 4DLOA 1ZU2A 5ENOD 1IQRA 4AVXA 4Q96A 3LPZA 4LUNU 4EZLA 1NP7A 4XIFA 4CGWA 3ZYQA 5LFAA 5FQ6A 3CV0A 4J8SA 2DWZA 3DXMG 3DPYA 1HG5A 1VDYA 2AXZA 5FT9A 3JQ1A 2GRRB 3RIBA 5CBNA 3ISMC 3U64A 4E85A 4ANXA 5ENSD 4Y6CA 3S7DA 3FTYA 2XZDG 3Q15A 5EX0A 4WUYA 3PZ2A 2Y3AA 2AW6A 2FI7A 2DZOA 3CK9A 3ZPJA 4DLQA 3ULQA 3BUAA 4AIFA 3ULEG 3HIZA 4G23A 3Q47B 3PE3A 4ANVA 5JHAA 3TWVA 3R9MA 3ABME 3BG1B 2RFMA 4XEIG 3FTVA 4CDMA 4JA9A 2I1JA 1OWOA 5KJMA 2JABA 4LERA 1TN8A 4HOTA 3J5QB 1INZA 4KBQA 5ANLA 4CYMD 3SBTB 3IKOB 3PZDA 3SFYA 4WNGA 2BF0X 4NIKA 2XS1A 2P9SG 3UUXA 3E4BA 2WQHA 4Y6WA 1HO8A 3IXEA 3EHNA 2Y0BG 4BTBA 3ASNE 2B6CA 1HH8A 1NFIE 2GROB 4XE0A 4A3TA 4ILHB 1Y8MA 2YHCA 1LF8A 2IONA 2EIME 2JLBA 3UIPC 4AM9A 2R5SA 2FO7A 2WXLA 4NQ0A 3PZ3A 4GPKA 5CBOA 2AVPA 3LXUX 3FEXA 3BG0B 2LUHA 3NF1A 3ULYA 1H19A 3U66A 3ZKJA 4IRUA 2CHWA 3CVVA 2CHXA 3TWXA 3B13A 2C2LA 2UY1B 1NI1A 3E33A 1H2UA 3VTXA 4F7AA 3L9TA 3CHOA 4DI3A 1S63A 2X6KA 4HOUA 3DSUA 2XCCA 4MS6A 4NRHB 2YQ8A 3D9LA 2NXPA 4U04A 3C72A 1UJKA 1IHBA 3Q5MA 4F3VA 3CHMA 5J90A 3RRMB 1MYOA 3FUNA 4BESA 4H7XA 1TJFA 1Z5SC 2WPVA 2IF4A 2F8YA 1Z3XA 3Q49B 5AQBA 3UPVA 2PNNA 1OWMA 5KNHD 2P9UG 3FTZA 3RO3A 3VLFA 3MKRA 1FVFA 2IOSA 1E96B 2H6FA 2KXPC 3JUEA 5EYPF 2KCLA 1O1SA 2XGSA 3ZRHA 4FHKA 3ZHEA 3SNXA 1S64A 5HS0A 1LD8A 3VLEA 3QB2A 2HYZA 3BU8A
chains in the Genus database with same CATH topology
4ZFHA 4QQIA 1MJ0A 5ENPD 5EIDA 2AJAA 4O60A 1OY3D 1AWCB 2DZOA 3V30A 1BD8A 1A5EA 3EHRA 5AAOA 4JB8P 4U95D 2DZNA 4F6RD 3KEAA 5ENTD 3HRAA 3ZKJA 3ZNGA 5FINA 2QC9A 4HRLA 3F6QA 5HKPA 2F37A 4HRNA 4DX6D 1YCSB 4HQDA 5AN8A 2P2CP 1OT8A 4LG6A 3TWXA 1D9SA 5EYLA 5KWDA 4HLLA 4G8KA 2MYOA 5AQAA 4HRMB 4C48B 1IKND 3TWTA 2XZTG 5BXUA 4HI9A 3EU9A 1BLXB 2XEEA 4LSZE 3SO8A 3TWVA 3DEPA 4BEPA 3UI2A 1WDYA 3LJNA 4U8YD 3TWQA 4J7WA 5BXOA 4DX5D 2J8SD 5ITZF 3DEOA 4RLYA 2RFMA 5CERB 3V2OA 2DVWA 2ZGGA 5JMND 4B93B 3NOGD 1N0RA 1IHBA 4DUIA 1SW6A 4HBDA 2JABA 4K5AB 3Q9UC 3UXGA 4K5BA 5CECB 1K1AA 3NOCD 5AQ7A 2F8XK 3J5QB 1BI7B 5CEDB 2V5QC 3TWRA 1K1BA 4CYMD 3AJIA 1MYOA 4O1PA 3ZUVB 4DRXE 3AAAC 5D66A 4BESA 2ZGDA 5FIOA 2KBXA 1MX6A 4ZHBA 1MX4A 3B7BA 3C5RA 5EN5D 5JA4D 3T8KA 4NIKA 5AARA 4U8VD 4DX7D 5CEAA 5ENQD 5ENOD 3D9HA 1DC2A 4OAVB 4HB5A 2F8YA 5EIBE 2FO1E 4BETA 4BSZB 2BKGA 4N5QA 4DX2A 4UUCA 2VGEA 4Z68A 2L6BA 5AQBA 1IXVA 4J8YA 2PNNA 4HNAD 4LNUD 4QFVA 3JXJA 3ZU7B 3EHQA 4F1PA 3IXEA 4GMRA 5KNHD 1QYMA 2A5EA 2NYJA 4HI8A 4GPMA 2Y0BG 1N11A 1S70B 2RFAA 4CZ2D 3NBNB 1AP7A 3B95A 4YDYA 3W9FA 1NFIE 4K5CA 3Q9NC 1MX2A 3T9KA 5ENRD 3W9GA 2ETBA 2DWZA 3TWSA 1N0QA 3UTMA 4A63B 4DX1A 1UOHA 4ATZD 3V31A 2KXPC 1K3ZD 1WG0A 1DCQA 3JXIA 2BKKB 3JUEA 4YDWA 5EYPF 5KNGA 3HG0D 2Y1LE 1BU9A 5HRYA 1BI8B 2QYJA 2ETCA 5CBNA 2XENA 5ENSD 2ETAA 3J5PA 1SVXA 5HS0A 4BERA 4TUMA 2B0OE 3TWUA 4O1OA 2HE0A 4G8LA 2XZDG 3V2XA 1YYHA 5EILA 4U96D 5AQ9A 5CBOA 3V79K 4OAUC 1YMPA 1G3NB 3TWWA 1TR4A 2V4HC 2XEHA 5KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZFH A;  4QQI A;  1MJ0 A;  5ENP D;  5EID A;  2AJA A;  4O60 A;  1OY3 D;  1AWC B;  2DZO A;  3V30 A;  1BD8 A;  1A5E A;  3EHR A;  5AAO A;  4JB8 P;  4U95 D;  2DZN A;  4F6R D;  3KEA A;  5ENT D;  3HRA A;  3ZKJ A;  3ZNG A;  5FIN A;  2QC9 A;  4HRL A;  3F6Q A;  5HKP A;  2F37 A;  4HRN A;  4DX6 D;  1YCS B;  4HQD A;  5AN8 A;  2P2C P;  1OT8 A;  4LG6 A;  3TWX A;  1D9S A;  5EYL A;  5KWD A;  4HLL A;  4G8K A;  2MYO A;  5AQA A;  4HRM B;  4C48 B;  1IKN D;  3TWT A;  2XZT G;  5BXU A;  4HI9 A;  3EU9 A;  1BLX B;  2XEE A;  4LSZ E;  3SO8 A;  3TWV A;  3DEP A;  4BEP A;  3UI2 A;  1WDY A;  3LJN A;  4U8Y D;  3TWQ A;  4J7W A;  5BXO A;  4DX5 D;  2J8S D;  5ITZ F;  3DEO A;  4RLY A;  2RFM A;  5CER B;  3V2O A;  2DVW A;  2ZGG A;  5JMN D;  4B93 B;  3NOG D;  1N0R A;  1IHB A;  4DUI A;  1SW6 A;  4HBD A;  2JAB A;  4K5A B;  3Q9U C;  3UXG A;  4K5B A;  5CEC B;  1K1A A;  3NOC D;  5AQ7 A;  2F8X K;  3J5Q B;  1BI7 B;  5CED B;  2V5Q C;  3TWR A;  1K1B A;  4CYM D;  3AJI A;  1MYO A;  4O1P A;  3ZUV B;  4DRX E;  3AAA C;  5D66 A;  4BES A;  2ZGD A;  5FIO A;  2KBX A;  1MX6 A;  4ZHB A;  1MX4 A;  3B7B A;  3C5R A;  5EN5 D;  5JA4 D;  3T8K A;  4NIK A;  5AAR A;  4U8V D;  4DX7 D;  5CEA A;  5ENQ D;  5ENO D;  3D9H A;  1DC2 A;  4OAV B;  4HB5 A;  2F8Y A;  5EIB E;  2FO1 E;  4BET A;  4BSZ B;  2BKG A;  4N5Q A;  4DX2 A;  4UUC A;  2VGE A;  4Z68 A;  2L6B A;  5AQB A;  1IXV A;  4J8Y A;  2PNN A;  4HNA D;  4LNU D;  4QFV A;  3JXJ A;  3ZU7 B;  3EHQ A;  4F1P A;  3IXE A;  4GMR A;  5KNH D;  1QYM A;  2A5E A;  2NYJ A;  4HI8 A;  4GPM A;  2Y0B G;  1N11 A;  1S70 B;  2RFA A;  4CZ2 D;  3NBN B;  1AP7 A;  3B95 A;  4YDY A;  3W9F A;  1NFI E;  4K5C A;  3Q9N C;  1MX2 A;  3T9K A;  5ENR D;  3W9G A;  2ETB A;  2DWZ A;  3TWS A;  1N0Q A;  3UTM A;  4A63 B;  4DX1 A;  1UOH A;  4ATZ D;  3V31 A;  2KXP C;  1K3Z D;  1WG0 A;  1DCQ A;  3JXI A;  2BKK B;  3JUE A;  4YDW A;  5EYP F;  5KNG A;  3HG0 D;  2Y1L E;  1BU9 A;  5HRY A;  1BI8 B;  2QYJ A;  2ETC A;  5CBN A;  2XEN A;  5ENS D;  2ETA A;  3J5P A;  1SVX A;  5HS0 A;  4BER A;  4TUM A;  2B0O E;  3TWU A;  4O1O A;  2HE0 A;  4G8L A;  2XZD G;  3V2X A;  1YYH A;  5EIL A;  4U96 D;  5AQ9 A;  5CBO A;  3V79 K;  4OAU C;  1YMP A;  1G3N B;  3TWW A;  1TR4 A;  2V4H C;  2XEH A;  5KBA A; 
#chains in the Genus database with same CATH topology
 4QQI A;  3CST A;  4GTT A;  4HOR A;  4FHJ A;  4GU5 A;  1JCR A;  4I9E A;  4UI9 J;  2LAI A;  4N39 A;  2QC9 A;  2HO1 A;  4AV7 A;  4ANU A;  5EYL A;  4A1S A;  4AY6 A;  5KJN A;  4L2Y A;  2KAT A;  3RAU A;  4C0M A;  2IOL A;  3EU5 A;  4A1G A;  3LY7 A;  1PAQ A;  5B1A E;  2XQ0 A;  1E8W A;  1N52 A;  3MKQ B;  3S7B A;  4B93 B;  5T4Y A;  4EQF A;  1JUQ A;  3GW4 A;  1N0R A;  2VYI A;  3QWP A;  4CDR A;  4WWP A;  3CVQ A;  4JEH A;  1HX8 A;  4J6I A;  5G2N A;  2RKK A;  3L08 A;  3I4G A;  5G05 J;  3S7J A;  3RK6 A;  3T8K A;  1E7U A;  5EIB E;  4GYW A;  1RZ4 A;  4JEU A;  4BSZ B;  5HQ8 A;  4A55 A;  3KS2 A;  3L13 A;  3PUJ A;  2XRY A;  4MBG A;  4F1P A;  3DPD A;  2IY0 C;  4L7T A;  4NUR A;  3FUH A;  1MX2 A;  3U4T A;  4DX1 A;  2XEV A;  2J49 A;  4L9P A;  3IHV A;  2MOW A;  3AS4 A;  2ZXW E;  3HG0 D;  5EX3 A;  2OVF A;  1E8Z A;  1KZO A;  1QNF A;  3AU4 A;  2LSU A;  3ZXP A;  5D0Q D;  2VGX A;  4BER A;  4U0U A;  2WB2 A;  3KSL A;  1YYH A;  1N54 A;  5BV1 A;  1TR4 A;  2GRL A;  4B8C B;  1AWC B;  3CEQ A;  3NB2 A;  4JB8 P;  3D9M A;  3ZNG A;  1H2T C;  2WVI A;  3JCK C;  1D8D A;  4HQD A;  4Q69 A;  4HS2 A;  5B1B E;  4YDE A;  1EYH A;  3FTU A;  3DEP A;  2MHK A;  4WAF A;  3PZ4 A;  3I3N A;  1N9A A;  5CER B;  5FQ7 A;  5FZS A;  3EJN A;  3RO2 A;  2H6G A;  2LXL A;  1SW6 A;  4K5A B;  3CKB A;  3Q9U C;  4HXI A;  4TXQ A;  2ZIR A;  3CK8 A;  1S0P A;  4FAD A;  1TNY A;  4HFG A;  4OAV B;  4BET A;  4KVO A;  2J09 A;  4GZC A;  3ZU7 B;  4FU3 A;  1FPP A;  2NYJ A;  1JWG A;  2WXI A;  4B94 A;  3W9F A;  2EIJ E;  1OWL A;  2L9B A;  3UM1 A;  3T5V A;  1UOH A;  1K3Z D;  2UWJ G;  4M7C A;  1SQM A;  4GB9 A;  1BI8 B;  3KAE A;  2I6H A;  1QQE A;  2OEV A;  4J8F A;  2V0P A;  3FFL A;  3Q7F A;  2FBN A;  2R2L A;  2P9L G;  4FJY A;  2GRN B;  2X6H A;  5ARG A;  1PY1 A;  4U95 D;  2LAH A;  2A4Z A;  4TXR A;  2Y69 E;  4UI9 C;  4HRL A;  4XX5 A;  2PL2 A;  2XPY A;  4HLL A;  2KZT A;  5BXU A;  3Q75 A;  4GMJ A;  3PEV B;  4AOF A;  4RSY A;  4IYP A;  4DX5 D;  2CFU A;  2EQX A;  4WWN A;  2BED A;  3CVU A;  5CEC B;  4GTO A;  1TEZ A;  3UMV A;  4I6E A;  2VTB B;  2ZGD A;  1ZBP A;  3FU0 A;  4WWO A;  4BWR A;  2QFC A;  5G05 C;  2IU1 A;  4Z68 A;  4J8Y A;  5FTP A;  1N11 A;  4CZ2 D;  4UWG A;  2WM9 A;  2WXO A;  3DRA A;  1WAO 1;  3ZVV A;  2EIL E;  1OCR E;  4U0S A;  4KZ0 A;  3ASH A;  3E30 A;  4CRW A;  3AG1 E;  4XI9 A;  2X6J A;  4F1S A;  3TL5 A;  4DI4 A;  2I2O A;  4GA2 A;  4EZK A;  2ETC A;  2V8S E;  3ZN3 A;  3MV2 B;  4G8L A;  3R7Q A;  5CCM A;  3FUJ A;  3TGO A;  2V4H C;  2XEH A;  4UWK A;  2GRP B;  1HFA A;  4XKB A;  4BT8 A;  2DYR E;  4V3I A;  1UW4 B;  3PVL A;  3SF4 A;  3FUL A;  3G2W A;  1TNZ A;  4JD2 G;  3MYV A;  1NA3 A;  3D9K A;  3UIN C;  1FT2 A;  3C3R A;  1WM5 A;  4G26 A;  1XGW A;  5M72 A;  4G11 A;  5C1D A;  4EZJ A;  1DVP A;  2IO3 C;  3JUI A;  1Q2Z A;  3CHS A;  5AQ7 A;  1TNO A;  5CED B;  1K8K G;  3AJI A;  4HOS A;  4R7L A;  3WXX A;  2LNI A;  4RG9 A;  3LY8 A;  3TJP A;  3FH7 A;  4HVB A;  2WXN A;  4CCA A;  4I1M A;  5CRV A;  3E37 A;  3HYM B;  2WMN A;  4YDY A;  4JZY A;  4KT6 B;  4LNG A;  4HLE A;  4H7Y A;  1NZN A;  2R05 A;  3ZIM A;  3HVE A;  2FF4 A;  1X81 A;  3FUI A;  3AG2 E;  3FP3 A;  1HG2 A;  4AP2 A;  4O1O A;  3KD7 A;  5EIL A;  4OAU C;  4NAC A;  3FWV A;  4EHM A;  3APD A;  2VJ8 A;  5FIN A;  3SHF A;  3FH8 A;  3HXE A;  3ONL A;  4LG6 A;  1BPO A;  2NC9 A;  3T8M A;  4C48 B;  2LXM A;  1MQS A;  2XPI A;  4LSZ E;  4UQY A;  2AXU A;  3ML8 A;  1IYG A;  3UI2 A;  1WDY A;  4GZD A;  3FUM A;  3ASF A;  2WQ7 A;  4XKC A;  3G2V A;  1KPS B;  2ZGG A;  3NOG D;  4GCO A;  1OWN A;  4HBD A;  4L1B A;  1N95 A;  3BQO A;  5D66 A;  3PS6 A;  3MA5 A;  4DJA A;  5AAR A;  4RG6 A;  4AEZ C;  5EKQ D;  1DC2 A;  5KJL A;  1FCH A;  2L6B A;  1IXV A;  1N4S A;  2V5F A;  4GMR A;  2UY1 A;  2R59 A;  4HI8 A;  1HU3 A;  3FEY A;  2RFA A;  4JHJ A;  3E32 A;  2L0I A;  2HR2 A;  3I4R B;  5HI7 A;  2XGM A;  4BX9 A;  5BV0 A;  4KMO A;  2ETA A;  3EIQ C;  4MLP A;  1SVX A;  3FU3 A;  2B0O E;  1ELW A;  3IEG A;  4PDX A;  3V79 K;  1YMP A;  3L6A A;  2YIN A;  5KBA A;  4GTV A;  4AJW A;  2AJA A;  1OY3 D;  4ILI A;  2DIW A;  1WY6 A;  3HDX A;  2XPZ A;  4PH4 B;  3QAR A;  3ZHE B;  4KVM A;  4I9C A;  3UT4 A;  2OVB A;  3L22 A;  4TXP A;  4IUL A;  2MYO A;  1N4R A;  2X3M A;  3D3M A;  3EU9 A;  2XEE A;  3URZ A;  3CIA A;  4RLY A;  4ABN A;  3V2O A;  3Q4A B;  5CHE E;  4O6F A;  1D8E A;  3T5X A;  4DUI A;  1Z6T A;  2VSO E;  4LCT A;  1PC2 A;  3DSX A;  3ASG A;  4K0R A;  3D9P A;  3AAA C;  4BY6 A;  2LSV A;  3CQG B;  4ACL A;  4DX7 D;  5CEA A;  2WXF A;  3B7U X;  2BKG A;  3CR3 A;  1MZC A;  4M3O A;  3EHQ A;  2F0Y A;  4K03 A;  3TXN A;  4K5C A;  4GYO A;  4J8D A;  4APF A;  3AS8 A;  3UTM A;  4EEC A;  4BT9 A;  3P2B A;  1WG0 A;  1DCQ A;  3CHQ A;  4EBA A;  5KNG A;  2NSZ A;  4G24 A;  3QNK A;  3J5P A;  3CVY A;  3HXF A;  3CVP A;  4ATG A;  1IQU A;  3HXD A;  1G3N B;  4U0Z A;  2GRM A;  5ANR A;  3C3O A;  2OND A;  3TXM A;  1UN9 A;  2CG3 A;  3UIO C;  5AAO A;  3KEA A;  4YND A;  3CK7 A;  3F6Q A;  1HS6 A;  3MZL B;  3D9O A;  2VGX B;  1H6O A;  3CHP A;  4GTP A;  3TWT A;  2OV8 A;  4U7E B;  3RJV A;  4ME2 A;  3KSQ A;  2YNQ A;  2R17 C;  2LO6 A;  3DEO A;  5JMN D;  1IHG A;  4Q94 A;  1H2V C;  1V55 E;  1A17 A;  3B7R L;  1KT1 A;  3D9N A;  2ILR A;  3QC1 A;  2M63 A;  5E75 A;  2ZIS A;  1EPU A;  2Y4U A;  3O4Z A;  3NQP A;  5KJK A;  4ZHB A;  2XGO A;  3SBS A;  2C0L A;  2Q7F A;  5A23 A;  3OXG A;  5ARF A;  5A6C A;  2VGE A;  2FEZ A;  3LEW A;  4G25 A;  3UM3 A;  3ZFW A;  3L17 A;  2DYS E;  1Y6I A;  2PQN A;  3IBE A;  1NL4 A;  5AJD A;  4ILG A;  2WXJ A;  3NBN B;  1AP7 A;  3FUK A;  3B7T A;  3Q9N C;  3TWS A;  5B3S E;  2OEW A;  4MRU A;  4CDN A;  5JJT A;  3CVN A;  2Y1L E;  4GA0 A;  1JCS A;  4PS7 A;  3FHE A;  3FUD A;  2J08 A;  2X6I A;  2J07 A;  4C9B B;  1E7V A;  2C0M A;  2PZI A;  3Q79 A;  3R9A B;  1BD8 A;  3EHR A;  4N3C A;  4CGV A;  3QJZ A;  2F37 A;  4DX6 D;  2L6J A;  2KM4 A;  4ACK A;  4N3B A;  4G8K A;  2P9N G;  4HRM B;  4JL0 A;  3DSV A;  1H6K A;  3CVX A;  2L0T B;  4GTS A;  2IEJ A;  2EIK E;  2GRQ B;  3CGH A;  2XRZ A;  4BX8 A;  1L5J A;  2QY7 A;  4RVB A;  3SY2 A;  2F8X K;  3UT7 A;  2KZT B;  1BI7 B;  3TWR A;  5A7D B;  4FLH A;  4FA6 A;  1LTX A;  5BW8 C;  3C98 A;  2MRI A;  3RRN B;  5LX8 A;  3CQC B;  4HB5 A;  2JEK A;  4N5Q A;  3UT8 A;  3IHY A;  1OCC E;  4HNA D;  4N2S A;  2IJG X;  3ZYL A;  3FU5 A;  3ZW3 A;  1RW2 A;  2VSX E;  4URK A;  3O48 A;  2AXV A;  4J8E A;  5C2Y A;  4APO A;  5ENN A;  3FY4 A;  3CSF A;  5CCL A;  3LKU A;  3TG4 A;  1TN7 A;  3CKC A;  2RG8 A;  2XEN A;  3L82 A;  5G55 A;  3CVL A;  2E2E A;  4N5C A;  3V2X A;  2WXP A;  3EUV A;  4GAA A;  4ZFH A;  1EF1 C;  1UJJ A;  3TAX A;  4TV3 A;  4GTM A;  1FT1 A;  4OVV A;  3OAW A;  1SZ9 A;  2WXR A;  2EIN E;  5BUZ A;  3GZ1 A;  3ML9 A;  5AQA A;  2IO2 C;  3U9W A;  3FTX A;  3HXC A;  4ANW A;  2WXK A;  2A5U A;  2I1K A;  3DXK G;  4U8Y D;  3TWQ A;  3X2Q E;  5AEN A;  3QDN A;  5FZQ A;  2FUL A;  3AS5 A;  3UXG A;  3CHR A;  2WQ6 A;  3PDN A;  5FQ8 A;  4RQI A;  4FUL A;  3DST A;  1X5B A;  2BUG A;  2KBX A;  1MX4 A;  3R7R A;  4C0E A;  3D9H A;  4G2V A;  4FP7 A;  2FO1 E;  3C3Q A;  4DK5 A;  4QFV A;  3AU5 A;  4GZ6 A;  5EDS A;  2P9P G;  3ABL E;  4I1O B;  3FU6 A;  4PS8 A;  3FTS A;  3PEU B;  3T9K A;  3IV0 A;  5D2M C;  4OVU A;  3PZ1 A;  1U3C A;  1BU9 A;  5HRY A;  3U3W A;  4JVS A;  4IN3 B;  2CHZ A;  3OXL A;  3SZ7 A;  2XS8 A;  3TWU A;  2CG2 A;  3RKV A;  4E6H A;  4U96 D;  5AQ9 A;  1MHQ A;  3GZ2 A;  4UI9 K;  4HOQ A;  1TNU A;  5FZR A;  2CFZ A;  1XNF A;  1OXJ A;  5EID A;  4O60 A;  3ZYM A;  3V30 A;  1A5E A;  5ENT D;  3HVE B;  3SI5 A;  1ELR A;  4HRN A;  1H0A A;  1OT8 A;  4B0Z A;  3SGH A;  1D9S A;  4LNB A;  3L16 A;  4GML A;  4D10 C;  4GZ5 A;  4G1T A;  4GA1 A;  3OTN A;  3UM0 A;  4HI9 A;  3UKU G;  1BLX B;  4I6G A;  3QWW A;  4KXK B;  4MKT A;  5LOZ A;  2DBA A;  3ABK E;  4DPR A;  2P9I G;  1JPL A;  1HF8 A;  4UWL A;  4U8H A;  3LY9 A;  3ENE A;  1OWP A;  1TJC A;  3S7F A;  4GTR A;  4I2W A;  5AIJ A;  1MX6 A;  5LP0 A;  3MEK A;  4I1A A;  5ENQ D;  3APC A;  3UX4 A;  4I17 A;  4L23 A;  5T3R A;  2RD0 A;  4BTA A;  3PE4 A;  4LNU D;  3OXF A;  4GPM A;  1S70 B;  3WG7 E;  1SA4 A;  3HXB A;  5ENR D;  3EHM A;  3L54 A;  3V31 A;  1KLX A;  4U07 A;  3UKR G;  1HXI A;  4JW1 A;  2VSN A;  3DWL G;  2GW1 A;  2XHE A;  5E76 A;  2QYJ A;  1O1T A;  3SFZ A;  4EPZ A;  3LCA A;  2WMO A;  3ONK A;  2WXQ A;  4TUM A;  3PNL B;  2HE0 A;  5G04 J;  5KCM A;  4KZC A;  3AG4 E;  4YVO A;  3ESL A;  3FTW A;  5LCW J;  4YDO A;  2E0I A;  4GZ3 A;  5D0O D;  3LVQ E;  5AN8 A;  3EIJ A;  2XZT G;  2BTD A;  1E8Y A;  4WNF A;  5H7P A;  3G2U A;  1Z3Y A;  2IFU A;  5JHB A;  4EBA G;  3SD5 A;  3SFX A;  2VQ2 A;  3LJN A;  1OCO E;  4B8A A;  3PRE A;  3MJW A;  3FDH A;  2VSY A;  1DCE A;  4FC8 A;  1KT0 A;  4JPS A;  4K5B A;  3NOC D;  2J9Q A;  5BT1 A;  3LYA A;  1LD7 A;  3VLD A;  4DRX E;  1DNP A;  1ELK A;  3B7B A;  4CT4 A;  4N2Q A;  3NZS A;  2WXH A;  5DIZ A;  2QZA A;  1O1R A;  3MGB A;  4DX2 A;  4UWH A;  2X6F A;  2KC7 A;  4XI0 A;  5FJY A;  2I9C A;  1QZ2 A;  1N94 A;  4GTQ A;  1TYQ G;  5CMW A;  3B95 A;  3FH5 A;  4WNE A;  4P29 A;  4U63 A;  2J4B A;  4F53 A;  2ETB A;  4AXH A;  3FUF A;  2PM7 A;  2V4L A;  2WXG A;  3Q73 A;  2ZU6 B;  2H6H A;  2QYU A;  1FVH A;  3PRZ A;  3UM2 A;  2VGY A;  1TNB A;  4W9R A;  4L2L A;  3TWW A;  1JWF A;  4J7W A;  3ZXS A;  1MJ0 A;  5ENP D;  3PH0 C;  4B89 A;  4BSX A;  1SA5 A;  3MKQ A;  2DZN A;  4YVQ C;  3RSE G;  4TRQ A;  3ASO E;  5HKP A;  3LVR E;  5DBK A;  2P58 C;  4UWF A;  5KWD A;  1U2V G;  1QBQ A;  3RU0 A;  2PQR A;  4GYY A;  2YHE A;  3SO8 A;  3DSS A;  3TG5 A;  4KYO B;  3JYS A;  3KEZ A;  3GYZ A;  3Q78 A;  2DCP A;  4PS3 A;  2KCK A;  4I43 A;  1OCZ E;  3Q7A A;  1K1A A;  4FJZ A;  3QKY A;  3GZS A;  3ESK A;  1U3D A;  4XZ4 A;  1H6P A;  4O1P A;  3ZUV B;  3C5R A;  4PUC A;  5EN5 D;  5CRU A;  3G2S A;  1V54 E;  3DBS A;  2OCC E;  5BNW A;  3JXJ A;  3MCX A;  2A5E A;  3CLJ A;  1B89 A;  3D9I A;  1HZ4 A;  3W9G A;  2P9K G;  4A63 B;  1N0Q A;  4ATZ D;  2H6I A;  3JXI A;  3QK0 A;  4YDW A;  5T8I A;  4CEM A;  5JJ7 A;  5JJ6 A;  3RRU A;  3PNT B;  3S2A A;  1HE8 A;  1E90 A;  3K9I A;  5FQ4 A;  4BFR A;  5G04 C;  1ZB1 A;  4LRZ A;  3NZU A;  1YA0 A;  1E8X A;  5LCW C;  4JXT A;  2AWI A;  1TN6 A;  2Y4T A;  4FLB A;  4I6J A;  1YCS B;  2HM8 A;  1N4Q A;  1W3B A;  3N71 A;  2XCB A;  5IY5 E;  3G2T A;  4UQZ A;  4J0U A;  4N3A A;  2X38 A;  3APF A;  5FWQ A;  4BEP A;  5BXO A;  2J8S D;  4UQX A;  3ASD A;  3P1U A;  4JC8 A;  2J4D A;  2DVW A;  2IQC A;  4TUU A;  3QAQ A;  4JHR A;  1K1B A;  1UN8 A;  1JCQ A;  4X8Q A;  1EDU A;  3VTY A;  1GW6 A;  4AY5 A;  3JQ0 A;  4UUC A;  3NAW A;  1P5Q A;  2R02 A;  1QYM A;  1NA0 A;  3I5P A;  3CVW A;  3LDZ A;  3ZYK A;  5J08 A;  3BEE A;  4JA7 A;  3MX3 A;  1SZA A;  2KCV A;  5AYW D;  3ZEF A;  3ZGQ A;  4JHK A;  2BKK B;  3EDT B;  3SQV A;  3AG3 E;  2GGF A;  2PM6 A;  1O5M A;  3MV3 B;  4WND A;  3E34 A;  3HHM A;  3QWV A;  3B7S A;  3LS8 A;  4CT0 A;  5ITZ F;  5BPP A;  4F6R D;  3HRA A;  2R03 A;  2P2C P;  4LEU A;  3PUK A;  3QOU A;  1IKN D;  5CMY A;  3LJ3 A;  4I2Z A;  2VTB A;  5AJL A;  3DSW A;  4GCN A;  4A3V A;  3FUE A;  1OUV A;  2WXM A;  1UG3 A;  3UQ3 A;  2V5Q C;  1N4P A;  2OOE A;  3D9J A;  5FIO A;  4OYS A;  5JA4 D;  1KZP A;  4U8V D;  4DLO A;  1ZU2 A;  5ENO D;  1IQR A;  4AVX A;  4Q96 A;  3LPZ A;  4LUN U;  4EZL A;  1NP7 A;  4XIF A;  4CGW A;  3ZYQ A;  5LFA A;  5FQ6 A;  3CV0 A;  4J8S A;  2DWZ A;  3DXM G;  3DPY A;  1HG5 A;  1VDY A;  2AXZ A;  5FT9 A;  3JQ1 A;  2GRR B;  3RIB A;  5CBN A;  3ISM C;  3U64 A;  4E85 A;  4ANX A;  5ENS D;  4Y6C A;  3S7D A;  3FTY A;  2XZD G;  3Q15 A;  5EX0 A;  4WUY A;  3PZ2 A;  2Y3A A;  2AW6 A;  2FI7 A;  2DZO A;  3CK9 A;  3ZPJ A;  4DLQ A;  3ULQ A;  3BUA A;  4AIF A;  3ULE G;  3HIZ A;  4G23 A;  3Q47 B;  3PE3 A;  4ANV A;  5JHA A;  3TWV A;  3R9M A;  3ABM E;  3BG1 B;  2RFM A;  4XEI G;  3FTV A;  4CDM A;  4JA9 A;  2I1J A;  1OWO A;  5KJM A;  2JAB A;  4LER A;  1TN8 A;  4HOT A;  3J5Q B;  1INZ A;  4KBQ A;  5ANL A;  4CYM D;  3SBT B;  3IKO B;  3PZD A;  3SFY A;  4WNG A;  2BF0 X;  4NIK A;  2XS1 A;  2P9S G;  3UUX A;  3E4B A;  2WQH A;  4Y6W A;  1HO8 A;  3IXE A;  3EHN A;  2Y0B G;  4BTB A;  3ASN E;  2B6C A;  1HH8 A;  1NFI E;  2GRO B;  4XE0 A;  4A3T A;  4ILH B;  1Y8M A;  2YHC A;  1LF8 A;  2ION A;  2EIM E;  2JLB A;  3UIP C;  4AM9 A;  2R5S A;  2FO7 A;  2WXL A;  4NQ0 A;  3PZ3 A;  4GPK A;  5CBO A;  2AVP A;  3LXU X;  3FEX A;  3BG0 B;  2LUH A;  3NF1 A;  3ULY A;  1H19 A;  3U66 A;  3ZKJ A;  4IRU A;  2CHW A;  3CVV A;  2CHX A;  3TWX A;  3B13 A;  2C2L A;  2UY1 B;  1NI1 A;  3E33 A;  1H2U A;  3VTX A;  4F7A A;  3L9T A;  3CHO A;  4DI3 A;  1S63 A;  2X6K A;  4HOU A;  3DSU A;  2XCC A;  4MS6 A;  4NRH B;  2YQ8 A;  3D9L A;  2NXP A;  4U04 A;  3C72 A;  1UJK A;  1IHB A;  3Q5M A;  4F3V A;  3CHM A;  5J90 A;  3RRM B;  1MYO A;  3FUN A;  4BES A;  4H7X A;  1TJF A;  1Z5S C;  2WPV A;  2IF4 A;  2F8Y A;  1Z3X A;  3Q49 B;  5AQB A;  3UPV A;  2PNN A;  1OWM A;  5KNH D;  2P9U G;  3FTZ A;  3RO3 A;  3VLF A;  3MKR A;  1FVF A;  2IOS A;  1E96 B;  2H6F A;  2KXP C;  3JUE A;  5EYP F;  2KCL A;  1O1S A;  2XGS A;  3ZRH A;  4FHK A;  3ZHE A;  3SNX A;  1S64 A;  5HS0 A;  1LD8 A;  3VLE A;  3QB2 A;  2HYZ A;  3BU8 A; 
#chains in the Genus database with same CATH homology
 4ZFH A;  4QQI A;  1MJ0 A;  5ENP D;  5EID A;  2AJA A;  4O60 A;  1OY3 D;  1AWC B;  2DZO A;  3V30 A;  1BD8 A;  1A5E A;  3EHR A;  5AAO A;  4JB8 P;  4U95 D;  2DZN A;  4F6R D;  3KEA A;  5ENT D;  3HRA A;  3ZKJ A;  3ZNG A;  5FIN A;  2QC9 A;  4HRL A;  3F6Q A;  5HKP A;  2F37 A;  4HRN A;  4DX6 D;  1YCS B;  4HQD A;  5AN8 A;  2P2C P;  1OT8 A;  4LG6 A;  3TWX A;  1D9S A;  5EYL A;  5KWD A;  4HLL A;  4G8K A;  2MYO A;  5AQA A;  4HRM B;  4C48 B;  1IKN D;  3TWT A;  2XZT G;  5BXU A;  4HI9 A;  3EU9 A;  1BLX B;  2XEE A;  4LSZ E;  3SO8 A;  3TWV A;  3DEP A;  4BEP A;  3UI2 A;  1WDY A;  3LJN A;  4U8Y D;  3TWQ A;  4J7W A;  5BXO A;  4DX5 D;  2J8S D;  5ITZ F;  3DEO A;  4RLY A;  2RFM A;  5CER B;  3V2O A;  2DVW A;  2ZGG A;  5JMN D;  4B93 B;  3NOG D;  1N0R A;  1IHB A;  4DUI A;  1SW6 A;  4HBD A;  2JAB A;  4K5A B;  3Q9U C;  3UXG A;  4K5B A;  5CEC B;  1K1A A;  3NOC D;  5AQ7 A;  2F8X K;  3J5Q B;  1BI7 B;  5CED B;  2V5Q C;  3TWR A;  1K1B A;  4CYM D;  3AJI A;  1MYO A;  4O1P A;  3ZUV B;  4DRX E;  3AAA C;  5D66 A;  4BES A;  2ZGD A;  5FIO A;  2KBX A;  1MX6 A;  4ZHB A;  1MX4 A;  3B7B A;  3C5R A;  5EN5 D;  5JA4 D;  3T8K A;  4NIK A;  5AAR A;  4U8V D;  4DX7 D;  5CEA A;  5ENQ D;  5ENO D;  3D9H A;  1DC2 A;  4OAV B;  4HB5 A;  2F8Y A;  5EIB E;  2FO1 E;  4BET A;  4BSZ B;  2BKG A;  4N5Q A;  4DX2 A;  4UUC A;  2VGE A;  4Z68 A;  2L6B A;  5AQB A;  1IXV A;  4J8Y A;  2PNN A;  4HNA D;  4LNU D;  4QFV A;  3JXJ A;  3ZU7 B;  3EHQ A;  4F1P A;  3IXE A;  4GMR A;  5KNH D;  1QYM A;  2A5E A;  2NYJ A;  4HI8 A;  4GPM A;  2Y0B G;  1N11 A;  1S70 B;  2RFA A;  4CZ2 D;  3NBN B;  1AP7 A;  3B95 A;  4YDY A;  3W9F A;  1NFI E;  4K5C A;  3Q9N C;  1MX2 A;  3T9K A;  5ENR D;  3W9G A;  2ETB A;  2DWZ A;  3TWS A;  1N0Q A;  3UTM A;  4A63 B;  4DX1 A;  1UOH A;  4ATZ D;  3V31 A;  2KXP C;  1K3Z D;  1WG0 A;  1DCQ A;  3JXI A;  2BKK B;  3JUE A;  4YDW A;  5EYP F;  5KNG A;  3HG0 D;  2Y1L E;  1BU9 A;  5HRY A;  1BI8 B;  2QYJ A;  2ETC A;  5CBN A;  2XEN A;  5ENS D;  2ETA A;  3J5P A;  1SVX A;  5HS0 A;  4BER A;  4TUM A;  2B0O E;  3TWU A;  4O1O A;  2HE0 A;  4G8L A;  2XZD G;  3V2X A;  1YYH A;  5EIL A;  4U96 D;  5AQ9 A;  5CBO A;  3V79 K;  4OAU C;  1YMP A;  1G3N B;  3TWW A;  1TR4 A;  2V4H C;  2XEH A;  5KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...