4BERA

Crystal structure of the legionella pneumophila fic domain-containing effector ankx protein in complex with cytidine monophosphate
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
477
structure length
475
Chain Sequence
GVKIMPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLHPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHOCHOLINE TRANSFERASE ANKX
publication title Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 167
structure length 475
sequence length 477
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4berA02
2DVWA 2ZGGA 3ZUVB 5EN5D 4N5QA 5EILA 5ENPD 1DC2A 2FO1E 3UXGA 2Y1LE 4U96D 5ENOD 4ZHBA 4J8YA 2P2CP 5KNHD 3TWVA 4BSZB 4LG6A 3KEAA 4QQIA 2ETAA 4HQDA 3SO8A 3JXJA 3J5QB 4F6RD 4K5CA 1OT8A 4K5AB 3LJNA 1OY3D 2ETCA 5ENQD 1YYHA 1MX4A 2AJAA 2NYJA 1K3ZD 3HG0D 4HI9A 5AQ7A 5JMND 3TWQA 1MX2A 3T9KA 3UTMA 5ENSD 4G8KA 3W9GA 1N11A 5EIDA 2PNNA 1BI7B 4BESA 4OAVB 3AJIA 3AAAC 1BD8A 3F6QA 1BI8B 4HI8A 5HRYA 3B95A 3EU9A 5AAOA 3Q9UC 2MYOA 1D9SA 4F1PA 2HE0A 4O1OA 3T8KA 5ITZF 4CYMD 4HBDA 5HKPA 3UI2A 3TWXA 4K5BA 1IHBA 4G8LA 3NOCD 3IXEA 1MJ0A 4O1PA 4U8YD 3D9HA 3DEPA 3B7BA 1NFIE 2XEHA 4A63B 5BXUA 1N0RA 4DX1A 2F8XK 3V2XA 4TUMA 3V30A 2L6BA 5D66A 2Y0BG 4UUCA 4DRXE 5CERB 1UOHA 2QC9A 5AN8A 3JUEA 3V2OA 2B0OE 3ZNGA 3V79K 1TR4A 2F8YA 2J8SD 1IKND 2KBXA 5FINA 3W9FA 4ATZD 5EIBE 1AP7A 4QFVA 2ETBA 5KWDA 3ZU7B 4O60A 1DCQA 1SVXA 2BKKB 3ZKJA 3EHRA 4LSZE 4BEPA 4GMRA 5EYPF 4B93B 2XENA 2DWZA 1N0QA 4YDWA 2XZTG 5ENRD 1K1AA 4YDYA 4U95D 1S70B 4DX7D 4DX5D 3NOGD 1YMPA 4J7WA 1AWCB 5AQBA 2A5EA 2RFAA 4C48B 5CECB 1YCSB 1MX6A 5CBOA 5BXOA 1K1BA 4CZ2D 1QYMA 1MYOA 4HRMB 3Q9NC 5ENTD 5FIOA 4DX2A 5CBNA 5CEAA 3TWSA 3C5RA 1G3NB 4HNAD 3TWWA 2ZGDA 4HLLA 1SW6A 2DZOA 1A5EA 2BKGA 3JXIA 3DEOA 2VGEA 4DX6D 1BU9A 2RFMA 4HRLA 2XEEA 2XZDG 4Z68A 2V5QC 5AARA 2F37A 3EHQA 1BLXB 5HS0A 3TWRA 4OAUC 3TWTA 2DZNA 5KNGA 2QYJA 4HRNA 2KXPC 3NBNB 1WDYA 3HRAA 4HB5A 3V31A 5JA4D 4DUIA 2V4HC 1WG0A 5EYLA 4U8VD 2JABA 4BETA 4JB8P 3TWUA 4LNUD 5AQAA 5CEDB 4RLYA 1IXVA 5AQ9A 5KBAA 4GPMA 4ZFHA 4NIKA 3J5PA 4BERA
chains in the Genus database with same CATH superfamily
4I2WA 1HG2A 3PZ1A 5T4YA 2LAHA 1TN8A 4QQIA 2A4ZA 4I6EA 4EBAA 3S2AA 4U7EB 5FTPA 2A5UA 4PS7A 4G8KA 4P29A 3AG2E 1BI7B 2IOLA 3F6QA 3Q47B 1K8KG 1Q2ZA 3OXFA 4CYMD 3Q78A 4I1AA 4GTTA 4LUNU 4AXHA 4FA6A 1NA0A 4GTVA 3L6AA 3CVVA 3R9AB 3PE4A 3B7SA 4BT8A 5KJKA 1KZOA 3FUFA 4FC8A 1QZ2A 1NI1A 1K1AA 2XEVA 3SI5A 2WQ6A 1FVFA 5G55A 1AWCB 5CECB 2ZXWE 4UQXA 4B89A 1MX6A 1U3DA 3BEEA 3ML9A 4HLLA 3DEOA 2XEEA 1D8EA 3FTYA 2CG3A 2V5QC 2WXKA 3CQGB 2X3MA 3EDTB 3DSUA 3NBNB 3LKUA 3CGHA 4ILGA 3EU5A 2XPIA 3G2UA 3DXMG 5KBAA 4GTRA 4YNDA 2OOEA 5E76A 2ZGGA 3BU8A 5FWQA 4LNGA 2P2CP 3U66A 1OWMA 3Q7AA 4HFGA 4AV7A 3C72A 3FUDA 3RO3A 3E33A 3SBTB 3OXLA 1ZB1A 1DVPA 4UWFA 1N4PA 3U9WA 2IU1A 3FUMA 3QKYA 5BV1A 2EINE 1EYHA 3Q4AB 4APFA 3V30A 1RZ4A 3ESLA 3BG0B 4KMOA 4GU5A 2B0OE 2WXOA 3SFZA 2GRQB 4MS6A 2EIJE 3L17A 1U3CA 4EBAG 2VQ2A 3FU5A 3SHFA 2V4LA 4DX7D 4B94A 4BSXA 4C48B 2PM7A 1YCSB 1TJFA 5BXOA 1UN9A 1N4QA 4TUUA 5KJNA 3TWSA 3C5RA 5CHEE 4U0SA 4J8FA 4RSYA 1A5EA 1OWPA 3FY4A 4TV3A 3NF1A 3SD5A 3DSXA 1HX8A 3E37A 3RO2A 1WDYA 1BPOA 3AG1E 3D9MA 2PZIA 3CHPA 3FUKA 3LYAA 3TJPA 2P9UG 1IXVA 1N52A 4OVVA 3HDXA 3BUAA 1OUVA 1PAQA 4GMLA 4N5QA 4YDEA 4LNBA 5FZSA 1N95A 3MGBA 3PS6A 4YDOA 5AIJA 2LSUA 1O1TA 4U0UA 3URZA 3HG0D 5JMND 3CQCB 2FBNA 4A3VA 4UWKA 5FQ8A 2FULA 3MKQB 1B89A 2WPVA 4L2YA 1DNPA 2P58C 4FU3A 5HKPA 2V8SE 2LNIA 5BUZA 3UIPC 3NQPA 4DX1A 5ARGA 4WUYA 5EDSA 2VGYA 3ONKA 5DIZA 4CGVA 3QJZA 1N9AA 4JPSA 2V5FA 2DCPA 1NP7A 2CHXA 3CV0A 3CVLA 4U04A 2GW1A 3PUJA 2PL2A 4LSZE 1OWNA 4BEPA 4GMRA 4BX9A 1N0QA 4I6GA 4JD2G 4A3TA 1IQRA 2KC7A 3CVNA 5DBKA 3O48A 5CEAA 3UQ3A 3TGOA 1XGWA 3PZ3A 4HOQA 3PUKA 3L54A 4DX6D 3CVQA 3CK7A 1H19A 4GYWA 3PZDA 4GPMA 4DI4A 2ILRA 4I1MA 2FF4A 5D0QD 2OV8A 5LOZA 3UXGA 2XS1A 4DUIA 3PREA 3KEAA 4AJWA 4F6RD 1TN6A 3AG3E 1JPLA 1H2TC 1EDUA 2NYJA 2FEZA 3ZRHA 3MJWA 5J08A 1Z3YA 3QB2A 1LD7A 1BI8B 5AAOA 3SGHA 4GPKA 5FQ7A 4GCNA 4GZ6A 3TXNA 2XQ0A 5FINA 3B7RL 4ATZD 4RQIA 1AP7A 3AU4A 2VJ8A 2YINA 5CRUA 3DSWA 3KSLA 4N2QA 3APCA 3CVXA 3E30A 5AENA 1SA4A 4Q96A 1VDYA 4WNFA 3VLDA 4CZ2D 3QK0A 3AS8A 5G05C 3HVEB 3MZLB 4AVXA 3FU3A 4F1SA 2R02A 1BU9A 2XGMA 4RVBA 3EUVA 5KJMA 4OVUA 1H6OA 4HB5A 2HR2A 4IYPA 3TL5A 5AQAA 5AQ9A 2XGOA 3FTZA 1X5BA 5EILA 4LEUA 3JYSA 3LY9A 3JQ0A 3ASOE 3UT8A 4L1BA 3I4GA 5KJLA 3P1UA 1OY3D 2YHEA 3IBEA 1OCCE 2I2OA 4W9RA 3T9KA 2VYIA 3W9GA 4I17A 4HI8A 3UM0A 5ITZF 4IRUA 4HBDA 5BW8C 3ZHEA 2CFZA 2VTBA 3FP3A 3U3WA 3E32A 1IHBA 3B7BA 2L6JA 4A63B 2WQ7A 4DI3A 5CCMA 3TAXA 2NC9A 3ZNGA 1OCRE 3D9KA 2FI7A 4BTBA 2BTDA 3ZKJA 3EHRA 1QBQA 3R7QA 3X2QE 3ZFWA 3PH0C 2IO2C 4KZ0A 1SZ9A 2DWZA 4O6FA 3ABKE 3T5VA 4YVOA 1ZU2A 4EPZA 3ZYKA 3RRNB 3MKRA 3I4RB 4RG9A 1U2VG 4KVMA 2ZU6B 2J49A 3CHSA 4FJYA 4K03A 3BQOA 3ZPJA 3SY2A 5KNGA 5CMWA 3LVRE 3SO8A 2DVWA 4HS2A 2RD0A 3ZUVB 1JUQA 2Y1LE 3HXEA 4BSZB 4LG6A 1FT2A 5AYWD 4ABNA 3RK6A 5ENQD 3JUIA 1MX4A 5FQ6A 2VGXB 2WXLA 4BESA 4JA7A 3B95A 4C9BB 4F3VA 3RAUA 3T8MA 2AW6A 3IV0A 2LSVA 3CVYA 2VSYA 4U8HA 3U64A 4U8YD 3CIAA 1NFIE 1N0RA 2AXUA 2WXHA 4OYSA 4UUCA 5T8IA 1OWLA 2WMNA 4GCOA 1MZCA 4WWPA 4CDRA 1Z3XA 2BKKB 5ANLA 2CHWA 2VTBB 4JC8A 4JZYA 2HYZA 3ZW3A 3NB2A 2WXGA 3EHNA 4CRWA 2A5EA 1IYGA 1E8ZA 2OVBA 5CBOA 4GB9A 1MYOA 5FIOA 5ENTD 3N71A 4U07A 1Z6TA 1E7VA 2H6GA 2DZOA 4FHKA 4DK5A 3D9LA 2XRYA 2KCVA 4ILIA 4CGWA 3ML8A 4CCAA 2J4DA 3HXBA 2J09A 2FO7A 2GRRB 4KT6B 3PZ4A 3ZEFA 3T5XA 4JB8P 3TWUA 1WM5A 4EZLA 3ONLA 4JHKA 4WNEA 4D10C 4NQ0A 3J5QB 2P9KG 3D9NA 3HHMA 3L82A 3LJNA 2AJAA 1OWOA 5AQ7A 2IO3C 1MX2A 4JA9A 3UTMA 3HIZA 3ABME 2Q7FA 1D9SA 4I9CA 2IJGX 1O5MA 3PNLB 3FU6A 3B7TA 3EIQC 2XHEA 4JHJA 3IEGA 3PE3A 5EX3A 3CEQA 1W3BA 3L9TA 2L6BA 3GZ1A 4HVBA 2P9SG 2EQXA 4NRHB 2J8SD 2KCKA 4ACKA 1HS6A 1JCSA 4O60A 2CHZA 4J8EA 3UM2A 5ENRD 5KCMA 3UKRG 1NL4A 1QYMA 3FH5A 3PZ2A 3QDNA 2VGEA 3QC1A 4GTOA 4I6JA 4HRLA 4UQZA 3DRAA 3MYVA 3LEWA 2F37A 4R7LA 4EHMA 3D3MA 3G2VA 3NAWA 1MHQA 5CEDB 1S0PA 1HZ4A 3J5PA 1LF8A 2IEJA 3CHMA 1SA5A 1DCEA 2Y4TA 3LXUX 1EF1C 2EIKE 4NACA 3ASGA 1H2VC 4K5AB 4CT0A 3DPDA 4HI9A 2WXMA 3HXDA 5ENSD 4J0UA 1TEZA 3FUIA 5HRYA 2GRPB 1PY1A 1TNYA 1UG3A 1Z5SC 4MRUA 4KYOB 3UUXA 1SZAA 2F8XK 2CFUA 4ME2A 3SQVA 4ANVA 2PM6A 4E6HA 2KBXA 4N2SA 4WNGA 1XNFA 4CDNA 4JXTA 1YA0A 2WXFA 4V3IA 2WXJA 3IHYA 1QNFA 4BY6A 4GA1A 4UI9C 2UWJG 2I6HA 1EPUA 1HH8A 2KCLA 4C0MA 3CLJA 3KEZA 3UPVA 4K0RA 5BV0A 1P5QA 4LERA 3ZXPA 1WAO1 3ISMC 2EILE 4OAUC 3TWRA 2UY1A 3RIBA 1H6PA 2DZNA 5JHBA 2R5SA 3R9MA 3UINC 1WG0A 4U8VD 4BETA 3LJ3A 4BERA 1UN8A 3DPYA 3D9IA 3PEUB 5JHAA 4HQDA 2AVPA 4FJZA 4PDXA 1JWGA 4WWNA 1ZBPA 1K3ZD 1ELWA 3AAAC 5LCWC 2B6CA 2MYOA 2HE0A 4U63A 5B1AE 2IF4A 4JEUA 1E8XA 4I2ZA 4PS8A 3DWLG 2C0MA 2H6HA 2XRZA 3UMVA 2H6IA 4KBQA 4L23A 4WNDA 3WXXA 2R59A 3V79K 3ESKA 3QWVA 4GTPA 4GMJA 4L7TA 3VTXA 3I5PA 4Y6WA 2QY7A 2WVIA 2XENA 4YDWA 5A23A 5T3RA 4DX5D 3Q75A 5E75A 3LPZA 4HRMB 3S7JA 2R17C 3NZSA 4HOSA 2RG8A 3FEXA 2Y3AA 2E2EA 3UT4A 1WY6A 4G24A 3OTNA 1NZNA 1TN7A 4KXKB 3HRAA 3V31A 4XZ4A 2JABA 3UKUG 3SFYA 3AG4E 4PS3A 4AEZC 5EN5D 4J6IA 3SNXA 4ZHBA 4J8YA 3Q73A 1GW6A 4I1OB 4UI9K 3RRUA 3O4ZA 1O1SA 2KZTA 2IONA 2QYUA 4OAVB 3RJVA 4U0ZA 5EKQD 1KT1A 3T8KA 5C1DA 4GTSA 2QZAA 3FUEA 3MEKA 4B8CB 2XEHA 4TUMA 4DRXE 3CK9A 5AN8A 5CMYA 1O1RA 3VTYA 1HO8A 5EIBE 3CHQA 4BTAA 3VLFA 1N94A 4UI9J 4HOTA 2XZTG 1TYQG 1QQEA 3NOGD 2YQ8A 1TJCA 1UJJA 4G25A 1L5JA 2E0IA 3E4BA 4M3OA 4N39A 4XIFA 3FTUA 4BX8A 1KZPA 3ASHA 2VSNA 4AY5A 3D9PA 4ATGA 2KATA 1N54A 4RG6A 5G04C 2QYJA 4ACLA 3EHMA 4EECA 3PVLA 4GA0A 1E7UA 3D9OA 3K9IA 4EQFA 3FH8A 3L08A 4GZDA 4FLBA 5B3SE 2L0IA 4FP7A 5ENOD 3JXJA 4XX5A 4K5CA 3CVUA 3PEVB 3ZXSA 3CHRA 3SBSA 5LCWJ 3QOUA 1N11A 2I9CA 2C0LA 2WXQA 5LP0A 1FCHA 1V54E 2JEKA 3FTWA 3TWXA 3E34A 4IULA 4DLQA 3C3OA 3PDNA 3DEPA 3FEYA 3S7BA 3UIOC 3ZN3A 1MQSA 1IKND 3AS4A 3ENEA 2ETBA 2HO1A 2XCBA 3FULA 5BT1A 3CK8A 4JL0A 4CEMA 5AQBA 2M63A 3CVPA 3UT7A 3L22A 2ONDA 1IHGA 1FT1A 3TG4A 3G2TA 2ZGDA 2PQNA 3ZHEB 3HXCA 1E8WA 4EZJA 1H0AA 2R05A 4JW1A 4BFRA 5IY5E 2NXPA 3GYZA 3LCAA 5HQ8A 2I1KA 2X6JA 4HRNA 3FFLA 2I1JA 5G05J 2YHCA 4APOA 2FO1E 4MLPA 2H6FA 3QNKA 5CRVA 1Y6IA 1OT8A 1OXJA 2P9LG 1UJKA 1V55E 4CDMA 4H7XA 4L9PA 4AM9A 4B8AA 1OCZE 2HM8A 3APDA 5BXUA 2J07A 2Y0BG 1UOHA 5BPPA 5B1BE 2F8YA 1S63A 4H7YA 4G1TA 3ZU7B 2AXZA 3CKBA 2J08A 4ANXA 2F0YA 3D9JA 3UM3A 3FTXA 4B93B 4I9EA 4IN3B 4XKBA 3LY8A 4G11A 2VSOE 5LX8A 3P2BA 3AU5A 4HOUA 3MKQA 2IFUA 4HXIA 2XPZA 1SW6A 3ABLE 5G04J 3DSSA 4Z68A 3EHQA 1BLXB 2Y69E 3TWTA 1IQUA 1FVHA 2OCCE 1TNUA 3RSEG 5JA4D 4TRQA 2EIME 1TNZA 1SQMA 4ZFHA 3Q7FA 4EZKA 5J90A 1DC2A 1HE8A 3ZYLA 2BF0X 4Q69A 4J8SA 2ETCA 3RRMB 2AWIA 5ANRA 2AXVA 2DYRE 2WXPA 4F7AA 4X8QA 4KZCA 1BD8A 2LO6A 4GYOA 3UM1A 3Q9UC 1E8YA 3DXKG 2XCCA 3HYMB 2NSZA 4XI9A 4AIFA 4I43A 2CG2A 3V2XA 5A6CA 5M72A 2P9PG 4XKCA 2DIWA 3ZVVA 3APFA 1TR4A 3CR3A 3Q15A 2MHKA 3CKCA 1NA3A 2V0PA 3SF4A 2GRLA 4TXQA 4N3BA 2OEWA 2JLBA 4LRZA 3QWWA 1ELKA 3Q5MA 2RFAA 1K1BA 2YNQA 1RW2A 4FHJA 3TWWA 3ASFA 2XGSA 5FJYA 2BKGA 2ZISA 3WG7E 4DJAA 4ANWA 3MA5A 4JHRA 3FUNA 4B0ZA 3BG1B 3L16A 4DPRA 2V4HC 3DSVA 5AJDA 5FZRA 1N4RA 4LNUD 4CT4A 2P9IG 3I3NA 3MV2B 3B7UX 4ANUA 5ENPD 5KNHD 4MKTA 3Q49B 2ETAA 4L2LA 1YYHA 4Q94A 5AJLA 2LUHA 2P9NG 2DBAA 5EIDA 5JJTA 1ELRA 5EX0A 3IKOB 3PNTB 3HVEA 3ULQA 1E90A 4F1PA 2R03A 3CHOA 1D8DA 4HORA 3G2WA 3NOCD 3IXEA 4O1PA 2GGFA 3MCXA 5G2NA 2OVFA 2LXMA 4WWOA 5D66A 2QC9A 4DLOA 5C2YA 3GZSA 3W9FA 2OEVA 1INZA 3DSTA 1DCQA 4GZCA 1Y8MA 5A7DB 5EYPF 4M7CA 3QWPA 3VLEA 4YVQC 4YDYA 3C98A 3IHVA 4A1SA 1YMPA 3QARA 4AP2A 2IOSA 3DBSA 3UX4A 1LD8A 4DX2A 2MOWA 3FDHA 3ZGQA 1G3NB 4HNAD 3AS5A 2QFCA 4E85A 2X6KA 1LTXA 2XZDG 5H7PA 5AARA 1KPSB 4XI0A 3FUHA 2XPYA 5CCLA 2KM4A 3QAQA 4RLYA 2XS8A 4NIKA 3ZYQA 1X81A 1HG5A 1KLXA 3KAEA 2WQHA 4UWGA 3S7DA 2BEDA 4PUCA 3TWVA 5FQ4A 4A1GA 4F53A 3TG5A 2X38A 4ILHB 3G2SA 3FHEA 2L0TB 3ASDA 3OXGA 2PNNA 5LFAA 2X6HA 3AJIA 5ENNA 3EU9A 1PC2A 4O1OA 4N3CA 3UI2A 4K5BA 1N4SA 3D9HA 2UY1B 3ULEG 3JCKC 4MBGA 2WMOA 3GW4A 4URKA 3FTSA 3JUEA 4GYYA 1JCQA 3KD7A 5FZQA 3PRZA 4TXRA 1KT0A 5KWDA 3ASNE 4A55A 4NURA 4C0EA 2IY0C 1HFAA 4AOFA 3B13A 5D2MC 2WB2A 4U95D 1TNBA 4J7WA 4GAAA 2VSXE 2GRNB 2VGXA 3CVWA 2WM9A 3Q9NC 5CBNA 5JJ7A 3FWVA 5ARFA 3LVQE 1H6KA 4BT9A 4FULA 3RKVA 4XE0A 4WAFA 2MRIA 1FPPA 3LS8A 5HS0A 3JQ1A 2WXIA 4JEHA 2GRMA 1A17A 3FUJA 4J8DA 1HF8A 3LDZA 3ULYA 2LXLA 4PH4B 2X6FA 5HI7A 3MX3A 1JCRA 4GZ5A 2C2LA 4G2VA 2J9QA 3KSQA 2ZIRA 2R2LA 4U96D 1HU3A 4FLHA 2DYSE 3TWQA 4G23A 4TXPA 4UWHA 4BWRA 1S64A 4HLEA 4GZ3A 3OAWA 4N5CA 3C3QA 4Y6CA 3FU0A 3SZ7A 3U4TA 1H2UA 2WXNA 3ZYMA 3TXMA 4G8LA 2IQCA 3KS2A 1MJ0A 2PQRA 3L13A 5JJ6A 4UWLA 5CERB 1OCOE 3V2OA 3MV3B 4G26A 4GTMA 2LAIA 4QFVA 3GZ2A 1SVXA 3EJNA 2WXRA 5FT9A 3HXFA 2Y4UA 1UW4B 3EIJA 1TNOA 3NZUA 4N3AA 3SFXA 2L9BA 2KZTB 1S70B 3Q79A 3LY7A 4GTQA 5BNWA 4XEIG 1E96B 3CSFA 1JWFA 2GROB 3CSTA 4FADA 4UQYA 3R7RA 3C3RA 2RKKA 3JXIA 5D0OD 2RFMA 4LCTA 3RU0A 3FH7A 3ZIMA 4KVOA 4GA2A 3FTVA 2J4BA 2KXPC 1HXIA 4AY6A 2X6IA 4JVSA 5EYLA 3S7FA 2BUGA
chains in the Genus database with same CATH topology
2DVWA 2ZGGA 3ZUVB 5EN5D 4N5QA 5EILA 5ENPD 1DC2A 2FO1E 3UXGA 2Y1LE 4U96D 5ENOD 4ZHBA 4J8YA 2P2CP 5KNHD 3TWVA 4BSZB 4LG6A 3KEAA 4QQIA 2ETAA 4HQDA 3SO8A 3JXJA 3J5QB 4F6RD 4K5CA 1OT8A 4K5AB 3LJNA 1OY3D 2ETCA 5ENQD 1YYHA 1MX4A 2AJAA 2NYJA 1K3ZD 3HG0D 4HI9A 5AQ7A 5JMND 3TWQA 1MX2A 3T9KA 3UTMA 5ENSD 4G8KA 3W9GA 1N11A 5EIDA 2PNNA 1BI7B 4BESA 4OAVB 3AJIA 3AAAC 1BD8A 3F6QA 1BI8B 4HI8A 5HRYA 3B95A 3EU9A 5AAOA 3Q9UC 2MYOA 1D9SA 4F1PA 2HE0A 4O1OA 3T8KA 5ITZF 4CYMD 4HBDA 5HKPA 3UI2A 3TWXA 4K5BA 1IHBA 4G8LA 3NOCD 3IXEA 1MJ0A 4O1PA 4U8YD 3D9HA 3DEPA 3B7BA 1NFIE 2XEHA 4A63B 5BXUA 1N0RA 4DX1A 2F8XK 3V2XA 4TUMA 3V30A 2L6BA 5D66A 2Y0BG 4UUCA 4DRXE 5CERB 1UOHA 2QC9A 5AN8A 3JUEA 3V2OA 2B0OE 3ZNGA 3V79K 1TR4A 2F8YA 2J8SD 1IKND 2KBXA 5FINA 3W9FA 4ATZD 5EIBE 1AP7A 4QFVA 2ETBA 5KWDA 3ZU7B 4O60A 1DCQA 1SVXA 2BKKB 3ZKJA 3EHRA 4LSZE 4BEPA 4GMRA 5EYPF 4B93B 2XENA 2DWZA 1N0QA 4YDWA 2XZTG 5ENRD 1K1AA 4YDYA 4U95D 1S70B 4DX7D 4DX5D 3NOGD 1YMPA 4J7WA 1AWCB 5AQBA 2A5EA 2RFAA 4C48B 5CECB 1YCSB 1MX6A 5CBOA 5BXOA 1K1BA 4CZ2D 1QYMA 1MYOA 4HRMB 3Q9NC 5ENTD 5FIOA 4DX2A 5CBNA 5CEAA 3TWSA 3C5RA 1G3NB 4HNAD 3TWWA 2ZGDA 4HLLA 1SW6A 2DZOA 1A5EA 2BKGA 3JXIA 3DEOA 2VGEA 4DX6D 1BU9A 2RFMA 4HRLA 2XEEA 2XZDG 4Z68A 2V5QC 5AARA 2F37A 3EHQA 1BLXB 5HS0A 3TWRA 4OAUC 3TWTA 2DZNA 5KNGA 2QYJA 4HRNA 2KXPC 3NBNB 1WDYA 3HRAA 4HB5A 3V31A 5JA4D 4DUIA 2V4HC 1WG0A 5EYLA 4U8VD 2JABA 4BETA 4JB8P 3TWUA 4LNUD 5AQAA 5CEDB 4RLYA 1IXVA 5AQ9A 5KBAA 4GPMA 4ZFHA 4NIKA 3J5PA 4BERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVW A;  2ZGG A;  3ZUV B;  5EN5 D;  4N5Q A;  5EIL A;  5ENP D;  1DC2 A;  2FO1 E;  3UXG A;  2Y1L E;  4U96 D;  5ENO D;  4ZHB A;  4J8Y A;  2P2C P;  5KNH D;  3TWV A;  4BSZ B;  4LG6 A;  3KEA A;  4QQI A;  2ETA A;  4HQD A;  3SO8 A;  3JXJ A;  3J5Q B;  4F6R D;  4K5C A;  1OT8 A;  4K5A B;  3LJN A;  1OY3 D;  2ETC A;  5ENQ D;  1YYH A;  1MX4 A;  2AJA A;  2NYJ A;  1K3Z D;  3HG0 D;  4HI9 A;  5AQ7 A;  5JMN D;  3TWQ A;  1MX2 A;  3T9K A;  3UTM A;  5ENS D;  4G8K A;  3W9G A;  1N11 A;  5EID A;  2PNN A;  1BI7 B;  4BES A;  4OAV B;  3AJI A;  3AAA C;  1BD8 A;  3F6Q A;  1BI8 B;  4HI8 A;  5HRY A;  3B95 A;  3EU9 A;  5AAO A;  3Q9U C;  2MYO A;  1D9S A;  4F1P A;  2HE0 A;  4O1O A;  3T8K A;  5ITZ F;  4CYM D;  4HBD A;  5HKP A;  3UI2 A;  3TWX A;  4K5B A;  1IHB A;  4G8L A;  3NOC D;  3IXE A;  1MJ0 A;  4O1P A;  4U8Y D;  3D9H A;  3DEP A;  3B7B A;  1NFI E;  2XEH A;  4A63 B;  5BXU A;  1N0R A;  4DX1 A;  2F8X K;  3V2X A;  4TUM A;  3V30 A;  2L6B A;  5D66 A;  2Y0B G;  4UUC A;  4DRX E;  5CER B;  1UOH A;  2QC9 A;  5AN8 A;  3JUE A;  3V2O A;  2B0O E;  3ZNG A;  3V79 K;  1TR4 A;  2F8Y A;  2J8S D;  1IKN D;  2KBX A;  5FIN A;  3W9F A;  4ATZ D;  5EIB E;  1AP7 A;  4QFV A;  2ETB A;  5KWD A;  3ZU7 B;  4O60 A;  1DCQ A;  1SVX A;  2BKK B;  3ZKJ A;  3EHR A;  4LSZ E;  4BEP A;  4GMR A;  5EYP F;  4B93 B;  2XEN A;  2DWZ A;  1N0Q A;  4YDW A;  2XZT G;  5ENR D;  1K1A A;  4YDY A;  4U95 D;  1S70 B;  4DX7 D;  4DX5 D;  3NOG D;  1YMP A;  4J7W A;  1AWC B;  5AQB A;  2A5E A;  2RFA A;  4C48 B;  5CEC B;  1YCS B;  1MX6 A;  5CBO A;  5BXO A;  1K1B A;  4CZ2 D;  1QYM A;  1MYO A;  4HRM B;  3Q9N C;  5ENT D;  5FIO A;  4DX2 A;  5CBN A;  5CEA A;  3TWS A;  3C5R A;  1G3N B;  4HNA D;  3TWW A;  2ZGD A;  4HLL A;  1SW6 A;  2DZO A;  1A5E A;  2BKG A;  3JXI A;  3DEO A;  2VGE A;  4DX6 D;  1BU9 A;  2RFM A;  4HRL A;  2XEE A;  2XZD G;  4Z68 A;  2V5Q C;  5AAR A;  2F37 A;  3EHQ A;  1BLX B;  5HS0 A;  3TWR A;  4OAU C;  3TWT A;  2DZN A;  5KNG A;  2QYJ A;  4HRN A;  2KXP C;  3NBN B;  1WDY A;  3HRA A;  4HB5 A;  3V31 A;  5JA4 D;  4DUI A;  2V4H C;  1WG0 A;  5EYL A;  4U8V D;  2JAB A;  4BET A;  4JB8 P;  3TWU A;  4LNU D;  5AQA A;  5CED B;  4RLY A;  1IXV A;  5AQ9 A;  5KBA A;  4GPM A;  4ZFH A;  4NIK A;  3J5P A;  4BER A; 
#chains in the Genus database with same CATH topology
 4I2W A;  1HG2 A;  3PZ1 A;  5T4Y A;  2LAH A;  1TN8 A;  4QQI A;  2A4Z A;  4I6E A;  4EBA A;  3S2A A;  4U7E B;  5FTP A;  2A5U A;  4PS7 A;  4G8K A;  4P29 A;  3AG2 E;  1BI7 B;  2IOL A;  3F6Q A;  3Q47 B;  1K8K G;  1Q2Z A;  3OXF A;  4CYM D;  3Q78 A;  4I1A A;  4GTT A;  4LUN U;  4AXH A;  4FA6 A;  1NA0 A;  4GTV A;  3L6A A;  3CVV A;  3R9A B;  3PE4 A;  3B7S A;  4BT8 A;  5KJK A;  1KZO A;  3FUF A;  4FC8 A;  1QZ2 A;  1NI1 A;  1K1A A;  2XEV A;  3SI5 A;  2WQ6 A;  1FVF A;  5G55 A;  1AWC B;  5CEC B;  2ZXW E;  4UQX A;  4B89 A;  1MX6 A;  1U3D A;  3BEE A;  3ML9 A;  4HLL A;  3DEO A;  2XEE A;  1D8E A;  3FTY A;  2CG3 A;  2V5Q C;  2WXK A;  3CQG B;  2X3M A;  3EDT B;  3DSU A;  3NBN B;  3LKU A;  3CGH A;  4ILG A;  3EU5 A;  2XPI A;  3G2U A;  3DXM G;  5KBA A;  4GTR A;  4YND A;  2OOE A;  5E76 A;  2ZGG A;  3BU8 A;  5FWQ A;  4LNG A;  2P2C P;  3U66 A;  1OWM A;  3Q7A A;  4HFG A;  4AV7 A;  3C72 A;  3FUD A;  3RO3 A;  3E33 A;  3SBT B;  3OXL A;  1ZB1 A;  1DVP A;  4UWF A;  1N4P A;  3U9W A;  2IU1 A;  3FUM A;  3QKY A;  5BV1 A;  2EIN E;  1EYH A;  3Q4A B;  4APF A;  3V30 A;  1RZ4 A;  3ESL A;  3BG0 B;  4KMO A;  4GU5 A;  2B0O E;  2WXO A;  3SFZ A;  2GRQ B;  4MS6 A;  2EIJ E;  3L17 A;  1U3C A;  4EBA G;  2VQ2 A;  3FU5 A;  3SHF A;  2V4L A;  4DX7 D;  4B94 A;  4BSX A;  4C48 B;  2PM7 A;  1YCS B;  1TJF A;  5BXO A;  1UN9 A;  1N4Q A;  4TUU A;  5KJN A;  3TWS A;  3C5R A;  5CHE E;  4U0S A;  4J8F A;  4RSY A;  1A5E A;  1OWP A;  3FY4 A;  4TV3 A;  3NF1 A;  3SD5 A;  3DSX A;  1HX8 A;  3E37 A;  3RO2 A;  1WDY A;  1BPO A;  3AG1 E;  3D9M A;  2PZI A;  3CHP A;  3FUK A;  3LYA A;  3TJP A;  2P9U G;  1IXV A;  1N52 A;  4OVV A;  3HDX A;  3BUA A;  1OUV A;  1PAQ A;  4GML A;  4N5Q A;  4YDE A;  4LNB A;  5FZS A;  1N95 A;  3MGB A;  3PS6 A;  4YDO A;  5AIJ A;  2LSU A;  1O1T A;  4U0U A;  3URZ A;  3HG0 D;  5JMN D;  3CQC B;  2FBN A;  4A3V A;  4UWK A;  5FQ8 A;  2FUL A;  3MKQ B;  1B89 A;  2WPV A;  4L2Y A;  1DNP A;  2P58 C;  4FU3 A;  5HKP A;  2V8S E;  2LNI A;  5BUZ A;  3UIP C;  3NQP A;  4DX1 A;  5ARG A;  4WUY A;  5EDS A;  2VGY A;  3ONK A;  5DIZ A;  4CGV A;  3QJZ A;  1N9A A;  4JPS A;  2V5F A;  2DCP A;  1NP7 A;  2CHX A;  3CV0 A;  3CVL A;  4U04 A;  2GW1 A;  3PUJ A;  2PL2 A;  4LSZ E;  1OWN A;  4BEP A;  4GMR A;  4BX9 A;  1N0Q A;  4I6G A;  4JD2 G;  4A3T A;  1IQR A;  2KC7 A;  3CVN A;  5DBK A;  3O48 A;  5CEA A;  3UQ3 A;  3TGO A;  1XGW A;  3PZ3 A;  4HOQ A;  3PUK A;  3L54 A;  4DX6 D;  3CVQ A;  3CK7 A;  1H19 A;  4GYW A;  3PZD A;  4GPM A;  4DI4 A;  2ILR A;  4I1M A;  2FF4 A;  5D0Q D;  2OV8 A;  5LOZ A;  3UXG A;  2XS1 A;  4DUI A;  3PRE A;  3KEA A;  4AJW A;  4F6R D;  1TN6 A;  3AG3 E;  1JPL A;  1H2T C;  1EDU A;  2NYJ A;  2FEZ A;  3ZRH A;  3MJW A;  5J08 A;  1Z3Y A;  3QB2 A;  1LD7 A;  1BI8 B;  5AAO A;  3SGH A;  4GPK A;  5FQ7 A;  4GCN A;  4GZ6 A;  3TXN A;  2XQ0 A;  5FIN A;  3B7R L;  4ATZ D;  4RQI A;  1AP7 A;  3AU4 A;  2VJ8 A;  2YIN A;  5CRU A;  3DSW A;  3KSL A;  4N2Q A;  3APC A;  3CVX A;  3E30 A;  5AEN A;  1SA4 A;  4Q96 A;  1VDY A;  4WNF A;  3VLD A;  4CZ2 D;  3QK0 A;  3AS8 A;  5G05 C;  3HVE B;  3MZL B;  4AVX A;  3FU3 A;  4F1S A;  2R02 A;  1BU9 A;  2XGM A;  4RVB A;  3EUV A;  5KJM A;  4OVU A;  1H6O A;  4HB5 A;  2HR2 A;  4IYP A;  3TL5 A;  5AQA A;  5AQ9 A;  2XGO A;  3FTZ A;  1X5B A;  5EIL A;  4LEU A;  3JYS A;  3LY9 A;  3JQ0 A;  3ASO E;  3UT8 A;  4L1B A;  3I4G A;  5KJL A;  3P1U A;  1OY3 D;  2YHE A;  3IBE A;  1OCC E;  2I2O A;  4W9R A;  3T9K A;  2VYI A;  3W9G A;  4I17 A;  4HI8 A;  3UM0 A;  5ITZ F;  4IRU A;  4HBD A;  5BW8 C;  3ZHE A;  2CFZ A;  2VTB A;  3FP3 A;  3U3W A;  3E32 A;  1IHB A;  3B7B A;  2L6J A;  4A63 B;  2WQ7 A;  4DI3 A;  5CCM A;  3TAX A;  2NC9 A;  3ZNG A;  1OCR E;  3D9K A;  2FI7 A;  4BTB A;  2BTD A;  3ZKJ A;  3EHR A;  1QBQ A;  3R7Q A;  3X2Q E;  3ZFW A;  3PH0 C;  2IO2 C;  4KZ0 A;  1SZ9 A;  2DWZ A;  4O6F A;  3ABK E;  3T5V A;  4YVO A;  1ZU2 A;  4EPZ A;  3ZYK A;  3RRN B;  3MKR A;  3I4R B;  4RG9 A;  1U2V G;  4KVM A;  2ZU6 B;  2J49 A;  3CHS A;  4FJY A;  4K03 A;  3BQO A;  3ZPJ A;  3SY2 A;  5KNG A;  5CMW A;  3LVR E;  3SO8 A;  2DVW A;  4HS2 A;  2RD0 A;  3ZUV B;  1JUQ A;  2Y1L E;  3HXE A;  4BSZ B;  4LG6 A;  1FT2 A;  5AYW D;  4ABN A;  3RK6 A;  5ENQ D;  3JUI A;  1MX4 A;  5FQ6 A;  2VGX B;  2WXL A;  4BES A;  4JA7 A;  3B95 A;  4C9B B;  4F3V A;  3RAU A;  3T8M A;  2AW6 A;  3IV0 A;  2LSV A;  3CVY A;  2VSY A;  4U8H A;  3U64 A;  4U8Y D;  3CIA A;  1NFI E;  1N0R A;  2AXU A;  2WXH A;  4OYS A;  4UUC A;  5T8I A;  1OWL A;  2WMN A;  4GCO A;  1MZC A;  4WWP A;  4CDR A;  1Z3X A;  2BKK B;  5ANL A;  2CHW A;  2VTB B;  4JC8 A;  4JZY A;  2HYZ A;  3ZW3 A;  3NB2 A;  2WXG A;  3EHN A;  4CRW A;  2A5E A;  1IYG A;  1E8Z A;  2OVB A;  5CBO A;  4GB9 A;  1MYO A;  5FIO A;  5ENT D;  3N71 A;  4U07 A;  1Z6T A;  1E7V A;  2H6G A;  2DZO A;  4FHK A;  4DK5 A;  3D9L A;  2XRY A;  2KCV A;  4ILI A;  4CGW A;  3ML8 A;  4CCA A;  2J4D A;  3HXB A;  2J09 A;  2FO7 A;  2GRR B;  4KT6 B;  3PZ4 A;  3ZEF A;  3T5X A;  4JB8 P;  3TWU A;  1WM5 A;  4EZL A;  3ONL A;  4JHK A;  4WNE A;  4D10 C;  4NQ0 A;  3J5Q B;  2P9K G;  3D9N A;  3HHM A;  3L82 A;  3LJN A;  2AJA A;  1OWO A;  5AQ7 A;  2IO3 C;  1MX2 A;  4JA9 A;  3UTM A;  3HIZ A;  3ABM E;  2Q7F A;  1D9S A;  4I9C A;  2IJG X;  1O5M A;  3PNL B;  3FU6 A;  3B7T A;  3EIQ C;  2XHE A;  4JHJ A;  3IEG A;  3PE3 A;  5EX3 A;  3CEQ A;  1W3B A;  3L9T A;  2L6B A;  3GZ1 A;  4HVB A;  2P9S G;  2EQX A;  4NRH B;  2J8S D;  2KCK A;  4ACK A;  1HS6 A;  1JCS A;  4O60 A;  2CHZ A;  4J8E A;  3UM2 A;  5ENR D;  5KCM A;  3UKR G;  1NL4 A;  1QYM A;  3FH5 A;  3PZ2 A;  3QDN A;  2VGE A;  3QC1 A;  4GTO A;  4I6J A;  4HRL A;  4UQZ A;  3DRA A;  3MYV A;  3LEW A;  2F37 A;  4R7L A;  4EHM A;  3D3M A;  3G2V A;  3NAW A;  1MHQ A;  5CED B;  1S0P A;  1HZ4 A;  3J5P A;  1LF8 A;  2IEJ A;  3CHM A;  1SA5 A;  1DCE A;  2Y4T A;  3LXU X;  1EF1 C;  2EIK E;  4NAC A;  3ASG A;  1H2V C;  4K5A B;  4CT0 A;  3DPD A;  4HI9 A;  2WXM A;  3HXD A;  5ENS D;  4J0U A;  1TEZ A;  3FUI A;  5HRY A;  2GRP B;  1PY1 A;  1TNY A;  1UG3 A;  1Z5S C;  4MRU A;  4KYO B;  3UUX A;  1SZA A;  2F8X K;  2CFU A;  4ME2 A;  3SQV A;  4ANV A;  2PM6 A;  4E6H A;  2KBX A;  4N2S A;  4WNG A;  1XNF A;  4CDN A;  4JXT A;  1YA0 A;  2WXF A;  4V3I A;  2WXJ A;  3IHY A;  1QNF A;  4BY6 A;  4GA1 A;  4UI9 C;  2UWJ G;  2I6H A;  1EPU A;  1HH8 A;  2KCL A;  4C0M A;  3CLJ A;  3KEZ A;  3UPV A;  4K0R A;  5BV0 A;  1P5Q A;  4LER A;  3ZXP A;  1WAO 1;  3ISM C;  2EIL E;  4OAU C;  3TWR A;  2UY1 A;  3RIB A;  1H6P A;  2DZN A;  5JHB A;  2R5S A;  3R9M A;  3UIN C;  1WG0 A;  4U8V D;  4BET A;  3LJ3 A;  4BER A;  1UN8 A;  3DPY A;  3D9I A;  3PEU B;  5JHA A;  4HQD A;  2AVP A;  4FJZ A;  4PDX A;  1JWG A;  4WWN A;  1ZBP A;  1K3Z D;  1ELW A;  3AAA C;  5LCW C;  2B6C A;  2MYO A;  2HE0 A;  4U63 A;  5B1A E;  2IF4 A;  4JEU A;  1E8X A;  4I2Z A;  4PS8 A;  3DWL G;  2C0M A;  2H6H A;  2XRZ A;  3UMV A;  2H6I A;  4KBQ A;  4L23 A;  4WND A;  3WXX A;  2R59 A;  3V79 K;  3ESK A;  3QWV A;  4GTP A;  4GMJ A;  4L7T A;  3VTX A;  3I5P A;  4Y6W A;  2QY7 A;  2WVI A;  2XEN A;  4YDW A;  5A23 A;  5T3R A;  4DX5 D;  3Q75 A;  5E75 A;  3LPZ A;  4HRM B;  3S7J A;  2R17 C;  3NZS A;  4HOS A;  2RG8 A;  3FEX A;  2Y3A A;  2E2E A;  3UT4 A;  1WY6 A;  4G24 A;  3OTN A;  1NZN A;  1TN7 A;  4KXK B;  3HRA A;  3V31 A;  4XZ4 A;  2JAB A;  3UKU G;  3SFY A;  3AG4 E;  4PS3 A;  4AEZ C;  5EN5 D;  4J6I A;  3SNX A;  4ZHB A;  4J8Y A;  3Q73 A;  1GW6 A;  4I1O B;  4UI9 K;  3RRU A;  3O4Z A;  1O1S A;  2KZT A;  2ION A;  2QYU A;  4OAV B;  3RJV A;  4U0Z A;  5EKQ D;  1KT1 A;  3T8K A;  5C1D A;  4GTS A;  2QZA A;  3FUE A;  3MEK A;  4B8C B;  2XEH A;  4TUM A;  4DRX E;  3CK9 A;  5AN8 A;  5CMY A;  1O1R A;  3VTY A;  1HO8 A;  5EIB E;  3CHQ A;  4BTA A;  3VLF A;  1N94 A;  4UI9 J;  4HOT A;  2XZT G;  1TYQ G;  1QQE A;  3NOG D;  2YQ8 A;  1TJC A;  1UJJ A;  4G25 A;  1L5J A;  2E0I A;  3E4B A;  4M3O A;  4N39 A;  4XIF A;  3FTU A;  4BX8 A;  1KZP A;  3ASH A;  2VSN A;  4AY5 A;  3D9P A;  4ATG A;  2KAT A;  1N54 A;  4RG6 A;  5G04 C;  2QYJ A;  4ACL A;  3EHM A;  4EEC A;  3PVL A;  4GA0 A;  1E7U A;  3D9O A;  3K9I A;  4EQF A;  3FH8 A;  3L08 A;  4GZD A;  4FLB A;  5B3S E;  2L0I A;  4FP7 A;  5ENO D;  3JXJ A;  4XX5 A;  4K5C A;  3CVU A;  3PEV B;  3ZXS A;  3CHR A;  3SBS A;  5LCW J;  3QOU A;  1N11 A;  2I9C A;  2C0L A;  2WXQ A;  5LP0 A;  1FCH A;  1V54 E;  2JEK A;  3FTW A;  3TWX A;  3E34 A;  4IUL A;  4DLQ A;  3C3O A;  3PDN A;  3DEP A;  3FEY A;  3S7B A;  3UIO C;  3ZN3 A;  1MQS A;  1IKN D;  3AS4 A;  3ENE A;  2ETB A;  2HO1 A;  2XCB A;  3FUL A;  5BT1 A;  3CK8 A;  4JL0 A;  4CEM A;  5AQB A;  2M63 A;  3CVP A;  3UT7 A;  3L22 A;  2OND A;  1IHG A;  1FT1 A;  3TG4 A;  3G2T A;  2ZGD A;  2PQN A;  3ZHE B;  3HXC A;  1E8W A;  4EZJ A;  1H0A A;  2R05 A;  4JW1 A;  4BFR A;  5IY5 E;  2NXP A;  3GYZ A;  3LCA A;  5HQ8 A;  2I1K A;  2X6J A;  4HRN A;  3FFL A;  2I1J A;  5G05 J;  2YHC A;  4APO A;  2FO1 E;  4MLP A;  2H6F A;  3QNK A;  5CRV A;  1Y6I A;  1OT8 A;  1OXJ A;  2P9L G;  1UJK A;  1V55 E;  4CDM A;  4H7X A;  4L9P A;  4AM9 A;  4B8A A;  1OCZ E;  2HM8 A;  3APD A;  5BXU A;  2J07 A;  2Y0B G;  1UOH A;  5BPP A;  5B1B E;  2F8Y A;  1S63 A;  4H7Y A;  4G1T A;  3ZU7 B;  2AXZ A;  3CKB A;  2J08 A;  4ANX A;  2F0Y A;  3D9J A;  3UM3 A;  3FTX A;  4B93 B;  4I9E A;  4IN3 B;  4XKB A;  3LY8 A;  4G11 A;  2VSO E;  5LX8 A;  3P2B A;  3AU5 A;  4HOU A;  3MKQ A;  2IFU A;  4HXI A;  2XPZ A;  1SW6 A;  3ABL E;  5G04 J;  3DSS A;  4Z68 A;  3EHQ A;  1BLX B;  2Y69 E;  3TWT A;  1IQU A;  1FVH A;  2OCC E;  1TNU A;  3RSE G;  5JA4 D;  4TRQ A;  2EIM E;  1TNZ A;  1SQM A;  4ZFH A;  3Q7F A;  4EZK A;  5J90 A;  1DC2 A;  1HE8 A;  3ZYL A;  2BF0 X;  4Q69 A;  4J8S A;  2ETC A;  3RRM B;  2AWI A;  5ANR A;  2AXV A;  2DYR E;  2WXP A;  4F7A A;  4X8Q A;  4KZC A;  1BD8 A;  2LO6 A;  4GYO A;  3UM1 A;  3Q9U C;  1E8Y A;  3DXK G;  2XCC A;  3HYM B;  2NSZ A;  4XI9 A;  4AIF A;  4I43 A;  2CG2 A;  3V2X A;  5A6C A;  5M72 A;  2P9P G;  4XKC A;  2DIW A;  3ZVV A;  3APF A;  1TR4 A;  3CR3 A;  3Q15 A;  2MHK A;  3CKC A;  1NA3 A;  2V0P A;  3SF4 A;  2GRL A;  4TXQ A;  4N3B A;  2OEW A;  2JLB A;  4LRZ A;  3QWW A;  1ELK A;  3Q5M A;  2RFA A;  1K1B A;  2YNQ A;  1RW2 A;  4FHJ A;  3TWW A;  3ASF A;  2XGS A;  5FJY A;  2BKG A;  2ZIS A;  3WG7 E;  4DJA A;  4ANW A;  3MA5 A;  4JHR A;  3FUN A;  4B0Z A;  3BG1 B;  3L16 A;  4DPR A;  2V4H C;  3DSV A;  5AJD A;  5FZR A;  1N4R A;  4LNU D;  4CT4 A;  2P9I G;  3I3N A;  3MV2 B;  3B7U X;  4ANU A;  5ENP D;  5KNH D;  4MKT A;  3Q49 B;  2ETA A;  4L2L A;  1YYH A;  4Q94 A;  5AJL A;  2LUH A;  2P9N G;  2DBA A;  5EID A;  5JJT A;  1ELR A;  5EX0 A;  3IKO B;  3PNT B;  3HVE A;  3ULQ A;  1E90 A;  4F1P A;  2R03 A;  3CHO A;  1D8D A;  4HOR A;  3G2W A;  3NOC D;  3IXE A;  4O1P A;  2GGF A;  3MCX A;  5G2N A;  2OVF A;  2LXM A;  4WWO A;  5D66 A;  2QC9 A;  4DLO A;  5C2Y A;  3GZS A;  3W9F A;  2OEV A;  1INZ A;  3DST A;  1DCQ A;  4GZC A;  1Y8M A;  5A7D B;  5EYP F;  4M7C A;  3QWP A;  3VLE A;  4YVQ C;  4YDY A;  3C98 A;  3IHV A;  4A1S A;  1YMP A;  3QAR A;  4AP2 A;  2IOS A;  3DBS A;  3UX4 A;  1LD8 A;  4DX2 A;  2MOW A;  3FDH A;  3ZGQ A;  1G3N B;  4HNA D;  3AS5 A;  2QFC A;  4E85 A;  2X6K A;  1LTX A;  2XZD G;  5H7P A;  5AAR A;  1KPS B;  4XI0 A;  3FUH A;  2XPY A;  5CCL A;  2KM4 A;  3QAQ A;  4RLY A;  2XS8 A;  4NIK A;  3ZYQ A;  1X81 A;  1HG5 A;  1KLX A;  3KAE A;  2WQH A;  4UWG A;  3S7D A;  2BED A;  4PUC A;  3TWV A;  5FQ4 A;  4A1G A;  4F53 A;  3TG5 A;  2X38 A;  4ILH B;  3G2S A;  3FHE A;  2L0T B;  3ASD A;  3OXG A;  2PNN A;  5LFA A;  2X6H A;  3AJI A;  5ENN A;  3EU9 A;  1PC2 A;  4O1O A;  4N3C A;  3UI2 A;  4K5B A;  1N4S A;  3D9H A;  2UY1 B;  3ULE G;  3JCK C;  4MBG A;  2WMO A;  3GW4 A;  4URK A;  3FTS A;  3JUE A;  4GYY A;  1JCQ A;  3KD7 A;  5FZQ A;  3PRZ A;  4TXR A;  1KT0 A;  5KWD A;  3ASN E;  4A55 A;  4NUR A;  4C0E A;  2IY0 C;  1HFA A;  4AOF A;  3B13 A;  5D2M C;  2WB2 A;  4U95 D;  1TNB A;  4J7W A;  4GAA A;  2VSX E;  2GRN B;  2VGX A;  3CVW A;  2WM9 A;  3Q9N C;  5CBN A;  5JJ7 A;  3FWV A;  5ARF A;  3LVQ E;  1H6K A;  4BT9 A;  4FUL A;  3RKV A;  4XE0 A;  4WAF A;  2MRI A;  1FPP A;  3LS8 A;  5HS0 A;  3JQ1 A;  2WXI A;  4JEH A;  2GRM A;  1A17 A;  3FUJ A;  4J8D A;  1HF8 A;  3LDZ A;  3ULY A;  2LXL A;  4PH4 B;  2X6F A;  5HI7 A;  3MX3 A;  1JCR A;  4GZ5 A;  2C2L A;  4G2V A;  2J9Q A;  3KSQ A;  2ZIR A;  2R2L A;  4U96 D;  1HU3 A;  4FLH A;  2DYS E;  3TWQ A;  4G23 A;  4TXP A;  4UWH A;  4BWR A;  1S64 A;  4HLE A;  4GZ3 A;  3OAW A;  4N5C A;  3C3Q A;  4Y6C A;  3FU0 A;  3SZ7 A;  3U4T A;  1H2U A;  2WXN A;  3ZYM A;  3TXM A;  4G8L A;  2IQC A;  3KS2 A;  1MJ0 A;  2PQR A;  3L13 A;  5JJ6 A;  4UWL A;  5CER B;  1OCO E;  3V2O A;  3MV3 B;  4G26 A;  4GTM A;  2LAI A;  4QFV A;  3GZ2 A;  1SVX A;  3EJN A;  2WXR A;  5FT9 A;  3HXF A;  2Y4U A;  1UW4 B;  3EIJ A;  1TNO A;  3NZU A;  4N3A A;  3SFX A;  2L9B A;  2KZT B;  1S70 B;  3Q79 A;  3LY7 A;  4GTQ A;  5BNW A;  4XEI G;  1E96 B;  3CSF A;  1JWF A;  2GRO B;  3CST A;  4FAD A;  4UQY A;  3R7R A;  3C3R A;  2RKK A;  3JXI A;  5D0O D;  2RFM A;  4LCT A;  3RU0 A;  3FH7 A;  3ZIM A;  4KVO A;  4GA2 A;  3FTV A;  2J4B A;  2KXP C;  1HXI A;  4AY6 A;  2X6I A;  4JVS A;  5EYL A;  3S7F A;  2BUG A; 
#chains in the Genus database with same CATH homology
 2DVW A;  2ZGG A;  3ZUV B;  5EN5 D;  4N5Q A;  5EIL A;  5ENP D;  1DC2 A;  2FO1 E;  3UXG A;  2Y1L E;  4U96 D;  5ENO D;  4ZHB A;  4J8Y A;  2P2C P;  5KNH D;  3TWV A;  4BSZ B;  4LG6 A;  3KEA A;  4QQI A;  2ETA A;  4HQD A;  3SO8 A;  3JXJ A;  3J5Q B;  4F6R D;  4K5C A;  1OT8 A;  4K5A B;  3LJN A;  1OY3 D;  2ETC A;  5ENQ D;  1YYH A;  1MX4 A;  2AJA A;  2NYJ A;  1K3Z D;  3HG0 D;  4HI9 A;  5AQ7 A;  5JMN D;  3TWQ A;  1MX2 A;  3T9K A;  3UTM A;  5ENS D;  4G8K A;  3W9G A;  1N11 A;  5EID A;  2PNN A;  1BI7 B;  4BES A;  4OAV B;  3AJI A;  3AAA C;  1BD8 A;  3F6Q A;  1BI8 B;  4HI8 A;  5HRY A;  3B95 A;  3EU9 A;  5AAO A;  3Q9U C;  2MYO A;  1D9S A;  4F1P A;  2HE0 A;  4O1O A;  3T8K A;  5ITZ F;  4CYM D;  4HBD A;  5HKP A;  3UI2 A;  3TWX A;  4K5B A;  1IHB A;  4G8L A;  3NOC D;  3IXE A;  1MJ0 A;  4O1P A;  4U8Y D;  3D9H A;  3DEP A;  3B7B A;  1NFI E;  2XEH A;  4A63 B;  5BXU A;  1N0R A;  4DX1 A;  2F8X K;  3V2X A;  4TUM A;  3V30 A;  2L6B A;  5D66 A;  2Y0B G;  4UUC A;  4DRX E;  5CER B;  1UOH A;  2QC9 A;  5AN8 A;  3JUE A;  3V2O A;  2B0O E;  3ZNG A;  3V79 K;  1TR4 A;  2F8Y A;  2J8S D;  1IKN D;  2KBX A;  5FIN A;  3W9F A;  4ATZ D;  5EIB E;  1AP7 A;  4QFV A;  2ETB A;  5KWD A;  3ZU7 B;  4O60 A;  1DCQ A;  1SVX A;  2BKK B;  3ZKJ A;  3EHR A;  4LSZ E;  4BEP A;  4GMR A;  5EYP F;  4B93 B;  2XEN A;  2DWZ A;  1N0Q A;  4YDW A;  2XZT G;  5ENR D;  1K1A A;  4YDY A;  4U95 D;  1S70 B;  4DX7 D;  4DX5 D;  3NOG D;  1YMP A;  4J7W A;  1AWC B;  5AQB A;  2A5E A;  2RFA A;  4C48 B;  5CEC B;  1YCS B;  1MX6 A;  5CBO A;  5BXO A;  1K1B A;  4CZ2 D;  1QYM A;  1MYO A;  4HRM B;  3Q9N C;  5ENT D;  5FIO A;  4DX2 A;  5CBN A;  5CEA A;  3TWS A;  3C5R A;  1G3N B;  4HNA D;  3TWW A;  2ZGD A;  4HLL A;  1SW6 A;  2DZO A;  1A5E A;  2BKG A;  3JXI A;  3DEO A;  2VGE A;  4DX6 D;  1BU9 A;  2RFM A;  4HRL A;  2XEE A;  2XZD G;  4Z68 A;  2V5Q C;  5AAR A;  2F37 A;  3EHQ A;  1BLX B;  5HS0 A;  3TWR A;  4OAU C;  3TWT A;  2DZN A;  5KNG A;  2QYJ A;  4HRN A;  2KXP C;  3NBN B;  1WDY A;  3HRA A;  4HB5 A;  3V31 A;  5JA4 D;  4DUI A;  2V4H C;  1WG0 A;  5EYL A;  4U8V D;  2JAB A;  4BET A;  4JB8 P;  3TWU A;  4LNU D;  5AQA A;  5CED B;  4RLY A;  1IXV A;  5AQ9 A;  5KBA A;  4GPM A;  4ZFH A;  4NIK A;  3J5P A;  4BER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...