5G05J

Cryo-em structure of combined apo phosphorylated apc
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
b'NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 179
structure length 504
sequence length 532
chains with identical sequence K
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5g05J00
2HO1A 2PQNA 4J8EA 4HOTA 1IYGA 4WNFA 4AY6A 3UQ3A 2GW1A 3IEGA 3GZ1A 3S7JA 4BTBA 3CK9A 2YQ8A 4G23A 3PE4A 5CCMA 3CVPA 3NF1A 1FCHA 2ONDA 4W9RA 5FZRA 5KJLA 5G05J 4HOSA 3BEEA 3GYZA 2UY1B 4XIFA 2J9QA 4NRHB 2WQHA 5JJ7A 1ZBPA 4KYOB 3MV2B 4I17A 4JA9A 3Q47B 4G24A 3UUXA 5D0QD 3LY9A 4U07A 4UQXA 4N3CA 3S7BA 3CKCA 3MA5A 5EKQD 2BUGA 4BWRA 3FFLA 3OXLA 4WUYA 3CKBA 4U0ZA 3R9AB 2KC7A 2XEVA 4GYWA 4GYYA 1KT1A 3FP3A 4G26A 1KLXA 4GCOA 3CK8A 4BTAA 5HQ8A 4IN3B 2FBNA 2HR2A 4GZ6A 2C2LA 3VTXA 2UWJG 5LCWJ 4JA7A 4RG6A 5A6CA 1YA0A 3SZ7A 3URZA 3KD7A 3QWWA 3O48A 3CVNA 2JLBA 3CVQA 3LYAA 4N3AA 3ZGQA 2FF4A 3CVLA 2VGXA 5A7DB 3U3WA 5FT9A 1HXIA 4XI9A 4ABNA 3Q15A 1QZ2A 3N71A 3TAXA 1NA3A 5DBKA 4BT8A 2C0MA 5EX0A 5G05C 2VSYA 2DBAA 3ESKA 3TG4A 2QFCA 3GZ2A 4RG9A 4N2QA 4N5CA 4AIFA 4G25A 4WNGA 4J8DA 1NZNA 4F3VA 2VQ2A 4NQ0A 5HI7A 4GZ5A 5ARGA 4I2ZA 5KJMA 3RKVA 5JJTA 3ULQA 4N3BA 3Q5MA 2PZIA 4XI0A 2FI7A 2E2EA 2L6JA 3ZPJA 1B89A 2I6HA 4GA0A 4GCNA 4U0UA 1P5QA 3S7DA 3ASDA 4N2SA 3KAEA 3ZHEA 5LCWC 2YHCA 4N39A 2NC9A 3QWPA 2KCLA 1HH8A 4GA2A 5BT1A 4Y6WA 1IHGA 5AYWD 4H7YA 3E4BA 4I9CA 5KJKA 2IF4A 3CK7A 3PE3A 1PC2A 4O6FA 1Y8MA 1WAO1 2VGXB 2MHKA 3ZFWA 5CHEE 3AS5A 3EDTB 4BT9A 1XNFA 1KT0A 5KJNA 4G1TA 4CGWA 3KS2A 4U04A 4B94A 1E96B 3VTYA 4YNDA 3QWVA 4A1SA 2AVPA 3RJVA 4H7XA 5D0OD 3ZN3A 1ELWA 3QOUA 4ME2A 4EQFA 3FWVA 3LPZA 3OXGA 1W3BA 2KATA 3AS4A 5ARFA 4GPKA 2XPIA 2FO7A 3JYSA 3UPVA 3LKUA 2VSNA 3RO2A 5BNWA 2V5FA 5FJYA 3MV3B 1QQEA 3AS8A 2Y4TA 2XGSA 2FEZA 2PQRA 4GA1A 2LNIA 2KCKA 2LSVA 4AM9A 2XCCA 4UI9C 4GZ3A 2PL2A 4JL0A 1ELRA 2WPVA 4HOUA 2VGYA 5G04J 3TGOA 3Q49B 3S7FA 3ZHEB 3GW4A 5FTPA 3WXXA 1TJCA 4WNDA 4UQYA 2KCVA 4CDRA 4JHRA 4AY5A 1ZU2A 4UI9J 3CV0A 3K9IA 1HZ4A 4KBQA 4J8FA 5JJ6A 2Y4UA 5EX3A 4CGVA 3ASFA 4UQZA 4HOQA 3ASHA 3Q4AB 4GYOA 2R5SA 3CEQA 4HORA 2UY1A 4U0SA 4KXKB 3TG5A 2C0LA 5C1DA 3LY8A 2OOEA 4I9EA 3ASGA 5FZQA 5CCLA 3LY7A 4UI9K 2XGMA 3RO3A 3RIBA 3QDNA 1NA0A 4LEUA 3MKRA 5M72A 2Q7FA 2XGOA 4I2WA 4WNEA 3MEKA 2VYIA 4G2VA 2IFUA 4YVOA 2HYZA 2XCBA 4Y6CA 3SF4A 5DIZA 3LCAA 2LSUA 4J0UA 1A17A 3U4TA 3HYMB 3QKYA 5FZSA 3PDNA 4YVQC 3RU0A 4APOA 3OXFA 1WM5A 2P58C 4I1AA 5BW8C 5G04C 1OUVA
chains in the Genus database with same CATH superfamily
3SFZA 3JQ1A 4GB9A 4GTOA 2CFZA 2XRYA 3EHMA 1LTXA 1QBQA 3GZ1A 1TNBA 4PUCA 2L6BA 3S2AA 1H6KA 4G23A 1UJKA 3DSTA 4J8SA 4W9RA 2OV8A 5G05J 4L9PA 4HOSA 3BEEA 4I6JA 3GYZA 3JXIA 4AJWA 3Q7FA 5JHBA 5AAOA 4EBAA 3UUXA 4N3CA 4ZHBA 4JD2G 3JUEA 5EKQD 4WUYA 1JCQA 3SI5A 4DX2A 2XPZA 3R9AB 4EHMA 2A5EA 1KT1A 2VSXE 2DZOA 2L0IA 1OWOA 4GCOA 1TJFA 1PAQA 4EECA 2KXPC 4IN3B 4HRMB 3SBSA 5LOZA 2WMNA 4GZ6A 5EIBE 2UWJG 4XKCA 3FTSA 3PNTB 1YA0A 3KD7A 5B1BE 3O48A 2Y1LE 1O1TA 3LYAA 4ACLA 3ZGQA 2IEJA 3D9PA 5A7DB 5EYPF 1SQMA 3HXDA 4L1BA 5J90A 1HXIA 1JWFA 2QY7A 3W9FA 1H2TC 3ZYLA 3E30A 3QC1A 5CBOA 4B8AA 3N71A 5CEDB 4BSZB 4OAUC 5CRVA 2P9UG 2VSYA 2ETBA 2WB2A 1OCZE 3HG0D 3TG4A 1Q2ZA 4HRLA 3LEWA 4WWPA 3AG4E 3RRMB 2KBXA 4N2QA 4B89A 4N5CA 2BF0X 4AIFA 1S70B 4G25A 2P9NG 4J8DA 1NZNA 1E8XA 2GGFA 4GTTA 4NQ0A 1S0PA 4ILHB 3R7RA 2GROB 3FTVA 1LD8A 4GTQA 3ULQA 2PZIA 2L0TB 2Y0BG 4XI0A 3F6QA 1N11A 2FI7A 2E2EA 2X6FA 4O1OA 1BI8B 1B89A 2I6HA 1S64A 5HRYA 4U0UA 5AENA 1P5QA 1V55E 2YINA 5G2NA 3FUEA 2WXOA 4C0EA 1FPPA 4PS8A 1E7VA 5E76A 4JXTA 2IOLA 2NC9A 3BU8A 3QWPA 5FINA 5BT1A 4LRZA 4Y6WA 1IHGA 4GMLA 5ANRA 1MZCA 3SD5A 1UJJA 1QYMA 1N54A 3SFXA 1HF8A 4I9CA 5KJKA 3CK7A 1EPUA 4Q96A 2YHEA 1WAO1 4BERA 3ZFWA 4NIKA 5CHEE 4DLOA 1MYOA 3NBNB 5CEAA 5EILA 4CGWA 3EIQC 2BKGA 3AAAC 2RD0A 3KS2A 5CBNA 1BLXB 4L2YA 4A1SA 5A23A 3ESLA 5ENOD 3V2OA 4Q94A 3DSXA 2XENA 3P1UA 2X3MA 3BQOA 5D0OD 4CEMA 4EQFA 5FWQA 2DIWA 5AJDA 5T3RA 2XPIA 1H6PA 2VTBA 3UPVA 3JQ0A 4EBAG 1E8YA 1TYQG 2LO6A 3ENEA 4I6EA 3G2WA 2V5FA 5AQBA 4U8HA 3UMVA 1UN8A 2XGSA 3L22A 2FEZA 4CZ2D 4TUMA 2GRRB 4HNAD 2KCKA 4GAAA 2LSVA 3L08A 3C3RA 3SFYA 4GZ3A 2WVIA 2WXFA 4ILIA 1ELRA 2WPVA 3TGOA 2P9IG 2OVFA 1MJ0A 3D9OA 2B0OE 4KZCA 3FUIA 3GW4A 3B7TA 3HVEA 3L17A 2X6JA 2V4LA 4G8LA 2EIME 2VGEA 3C5RA 2BEDA 3LJNA 2CHZA 1HZ4A 2MYOA 3Q7AA 3DSUA 2Y4UA 5EX3A 4NACA 2X6IA 2NSZA 1NFIE 1Z5SC 2GRQB 1ZB1A 4JHKA 2LXLA 3PVLA 5C1DA 5FZQA 1N52A 1WDYA 3RO3A 3QDNA 3CVYA 3MKRA 2Q7FA 2XS1A 3HXBA 3MEKA 3ONLA 2WXHA 1N4PA 4OVUA 2HYZA 2XCBA 4HLEA 4MKTA 3AU5A 3FDHA 1KPSB 5AJLA 2VTBB 1K1BA 2IO2C 5BXUA 4I6GA 3MX3A 3HXEA 3QKYA 4K5CA 1OY3D 5FZSA 4DK5A 3Q79A 1AWCB 3OXFA 1N0QA 2H6IA 5FIOA 2HO1A 2GRPB 2MOWA 3MGBA 3AG1E 3EUVA 4WNFA 3UX4A 3VLEA 3D9NA 1OWNA 3HVEB 3PUJA 3IEGA 3OTNA 3DSSA 3UM2A 3IBEA 3UKRG 3S7JA 1QNFA 3QK0A 5D2MC 3PEVB 4U8VD 4GTMA 4HS2A 3NF1A 4YDWA 2H6FA 2F8XK 5FZRA 3RK6A 3O4ZA 1ZBPA 4KVOA 2OCCE 2DZNA 2R05A 4EZLA 4KYOB 4I17A 3Q47B 3V30A 2P2CP 2IY0C 1LF8A 2XQ0A 3LDZA 3MA5A 2CHXA 2CG2A 2BUGA 4BFRA 4I43A 2WXKA 3CQGB 2DYRE 2KC7A 2XEVA 3T5VA 2X6HA 2ZXWE 5EN5D 4PS3A 3TWVA 3LVRE 3B13A 2J08A 4BTAA 2RFAA 4O1PA 5HQ8A 2XZDG 4ILGA 5HKPA 2FBNA 3I5PA 2HR2A 3ZEFA 2E0IA 5LCWJ 4RG6A 3DEPA 1UN9A 2R59A 4XZ4A 4LG6A 3FH7A 2HE0A 3URZA 5KNHD 4ATZD 4U95D 4BESA 2J4BA 4OYSA 3PZ3A 3QWWA 4DX1A 2JLBA 3CVQA 3DXMG 2H6GA 3SBTB 4N3AA 2FF4A 1IQRA 3APFA 4P29A 4YDOA 2LAIA 5FT9A 4BETA 4ABNA 3EJNA 3SGHA 1BPOA 1QZ2A 3DBSA 2BTDA 4FLHA 5DBKA 5BV1A 5EX0A 5G05C 1HS6A 2X6KA 2IO3C 4FJZA 4UUCA 4CT4A 1HU3A 1K8KG 2AWIA 3KSLA 4CDMA 3MJWA 3V79K 4EPZA 1E8ZA 1N4RA 4WNGA 3T5XA 1MQSA 4F3VA 3NAWA 5JHAA 4JZYA 3LVQE 2AJAA 4DX7D 4RQIA 4GZ5A 1O1SA 1NL4A 3VLFA 5KJMA 3RKVA 1U3CA 5B3SE 2L6JA 2NXPA 5B1AE 4FC8A 3APCA 3T9KA 1DVPA 4UWKA 3ASDA 2IQCA 4HXIA 3DPYA 4FADA 4UWFA 2YHCA 4QQIA 4URKA 1HFAA 4GZDA 4N39A 1HH8A 3G2SA 1TNYA 5T8IA 3CVUA 2L9BA 1ELKA 1TN7A 4TXRA 3ZYMA 3UXGA 5H7PA 3NZUA 3B95A 1OCRE 4GZCA 3CHPA 2R17C 2EILE 1SA5A 3SY2A 1PC2A 1WG0A 1Y8MA 3FHEA 1D9SA 2BKKB 2IONA 4U96D 4KMOA 4I1OB 3AS5A 4BT9A 3HXCA 1XNFA 1BU9A 2LXMA 4G11A 4CYMD 3VTYA 4YNDA 4H7XA 4C9BB 3FU5A 4D10C 3NZSA 4QFVA 4DJAA 1IHBA 1E8WA 3ASOE 4ACKA 2I9CA 3FWVA 1UW4B 3AS4A 3R9MA 2XRZA 3V31A 4GPKA 3UI2A 3RRNB 3JYSA 4U7EB 4JB8P 3LKUA 2VSNA 5FQ7A 5FJYA 1QQEA 3IXEA 3C3QA 3HDXA 4AM9A 4DRXE 2PL2A 1SVXA 3FUDA 4HOUA 2VGYA 3PH0C 3EHRA 1FVHA 2Y69E 3RSEG 4C48B 3IKOB 2XHEA 3D9HA 3ABKE 1TJCA 4YDEA 3FU0A 4DI4A 2QZAA 4UQYA 4JHRA 4AY5A 2EIKE 3K9IA 4KBQA 1HX8A 1RW2A 4J8FA 4DUIA 5FQ6A 4CGVA 2CFUA 3RRUA 3D9KA 4HOQA 3ASHA 4JHJA 3Q4AB 3FH8A 4HORA 3CEQA 5AQAA 4CT0A 3TXMA 4KXKB 3E37A 5D66A 2OOEA 4I9EA 2OEWA 3LY7A 1YCSB 3KEZA 2HM8A 1DCEA 4U8YD 4ANUA 1N0RA 3RIBA 3U64A 3FUHA 4HRNA 1SZAA 4I2WA 4EZJA 3R7QA 4OAVB 2VYIA 3ZXPA 1TN6A 3EU9A 3LCAA 1A17A 4M7CA 4LERA 4APFA 2FULA 3CHMA 4CDNA 4YVQC 2M63A 2FO1E 1Z3XA 2P58C 5BW8C 1OUVA 2I2OA 4OVVA 5FQ8A 2LUHA 4HOTA 2EINE 3WG7E 1IYGA 2AW6A 2WXLA 5AQ7A 4LCTA 3UQ3A 2MRIA 1BI7B 4TXQA 2J8SD 5ENTD 5AN8A 3AU4A 3ZU7B 4FHJA 1H6OA 2H6HA 4C0MA 4HVBA 3PE4A 2J07A 4ANWA 5CRUA 3CVPA 5CCMA 1OWPA 1FCHA 1N4QA 2ONDA 1Y6IA 5KJLA 1O1RA 3BG1B 3I4GA 3RAUA 2J9QA 4NRHB 5JJ7A 3SNXA 4UWHA 3GZSA 3E32A 3HIZA 1XGWA 2AXUA 1YMPA 4G24A 3LY9A 3S7BA 3CKCA 3L13A 4HB5A 2KZTA 3NQPA 3ULYA 3JCKC 3FFLA 3OXLA 3T8MA 3IV0A 3CKBA 3V2XA 2IJGX 4GYWA 4K5BA 4G26A 3BG0B 3CK8A 4GU5A 1S63A 4GTRA 4GMJA 4MBGA 1NP7A 4M3OA 3D3MA 4V3IA 3EHQA 3PEUB 2C2LA 2JABA 1HG2A 3HRAA 3APDA 4JA7A 4CRWA 4WWNA 5JA4D 5A6CA 3TWQA 3UTMA 4N5QA 5KCMA 3E33A 1MHQA 3CVNA 4MLPA 1D8DA 4PDXA 2WXMA 3Q9NC 3U3WA 1G3NB 2I1JA 4HI8A 4K5AB 1NA3A 5KBAA 2C0MA 3X2QE 3QB2A 4AV7A 2DBAA 2ZGGA 2XEEA 3IHYA 3ESKA 1EDUA 1TN8A 4RG9A 1YYHA 2ZU6B 4UWGA 1N9AA 2DYSE 1SZ9A 3G2TA 1DCQA 4IRUA 4L23A 4F1PA 3PREA 4HI9A 5EIDA 5KWDA 1Z6TA 3C72A 2KZTB 1IKND 3TWXA 2R03A 5HI7A 1FVFA 3FUKA 5HS0A 3ASNE 5ARGA 4I2ZA 2P9LG 2PNNA 3MYVA 4A3TA 2J4DA 5JJTA 4N3BA 1TNZA 4IYPA 3ZPJA 4GCNA 4ANVA 4AP2A 4DPRA 5CERB 1GW6A 2V4HC 2PM6A 3FU3A 2ETAA 2J49A 3L9TA 3PZ4A 5LCWC 1JPLA 2KCLA 3FU6A 4TRQA 2V0PA 3B7SA 4FJYA 1E90A 3P2BA 4H7YA 2GRNB 3CIAA 4WWOA 2XPYA 5IY5E 3UT7A 4LUNU 2CHWA 1TR4A 1UG3A 1Z3YA 2DWZA 2NYJA 2MHKA 3TJPA 1E7UA 3FEYA 4PS7A 3EDTB 4IULA 3CSTA 5ANLA 4G1TA 4BSXA 1OWLA 3FY4A 1JWGA 3PZDA 4B94A 3QWVA 3ZYQA 3G2UA 4K03A 3ZW3A 3DWLG 4KT6B 2QYUA 1MX4A 3ZN3A 3CVXA 5EYLA 1BD8A 5JMND 1UOHA 3LPZA 3TWUA 2KATA 2EQXA 5ARFA 2RFMA 2FO7A 4J6IA 2ZGDA 3ZXSA 2WXQA 2F37A 4B93B 2A4ZA 2V8SE 4O60A 2CG3A 3MV3B 3AS8A 1OCOE 2V5QC 3LJ3A 1KZOA 3BUAA 4Q69A 5ITZF 5KNGA 2WQ6A 5FQ4A 2DVWA 3B7RL 4B0ZA 1EF1C 5G04J 3MZLB 3ML9A 3Q49B 3S7FA 3LXUX 4TV3A 5CMYA 3FTZA 1PY1A 2ILRA 3Q73A 3FUFA 4JVSA 4WNDA 2KCVA 4CDRA 1O5MA 3AJIA 3PRZA 3CR3A 3FTXA 3CLJA 3CGHA 3FULA 1H2UA 3FUNA 4GYOA 2IOSA 2R02A 2R5SA 5AQ9A 2UY1A 3ZYKA 3TG5A 2C0LA 1L5JA 3OAWA 1H0AA 3LY8A 3HHMA 3ONKA 5CCLA 4GMRA 4UI9K 4BX8A 3DXKG 4LEUA 5M72A 3PZ1A 3DPDA 2F0YA 4YVOA 4E85A 3SF4A 1U3DA 3PUKA 5DIZA 3ML8A 3NB2A 4GTSA 2RKKA 2LSUA 3QNKA 1H2VC 1OT8A 4L7TA 4DI3A 3J5QB 4J8YA 1KZPA 3VLDA 5LP0A 3L54A 4A1GA 4R7LA 3RU0A 4APOA 3Q78A 4I1MA 1WM5A 2WXNA 4JEHA 2WM9A 2PQNA 4J8EA 4U63A 2AXVA 4AY6A 2GW1A 3ABME 2WXIA 1DNPA 4JEUA 3UT4A 5AIJA 2WXJA 3ZRHA 3B7BA 3SQVA 3ZKJA 4BTBA 3CK9A 1VDYA 2YQ8A 4E6HA 1MX2A 1A5EA 2B6CA 2GRLA 3ZNGA 2VJ8A 3UT8A 2ZIRA 3FEXA 1TNOA 1OWMA 4F1SA 4LNBA 2UY1B 3TWRA 4XIFA 4B8CB 2F8YA 2WQHA 3Q9UC 3CVWA 3MV2B 3KSQA 4JA9A 2WQ7A 2ZISA 5D0QD 4U07A 4UQXA 3CQCB 4BX9A 3FTWA 1SW6A 4BWRA 3ZVVA 4LNGA 3EHNA 4JPSA 4U0ZA 2XEHA 4GYYA 4HQDA 1OCCE 3C98A 3D9IA 4GTVA 3UINC 3FP3A 1KLXA 4XEIG 4RVBA 3IHVA 3L82A 3C3OA 4HLLA 5CMWA 1OXJA 4KZ0A 2XZTG 1JCRA 4LSZE 4XE0A 3VTXA 3TWTA 2P9SG 2A5UA 4F53A 2JEKA 3J5PA 3FTUA 2DCPA 3SZ7A 3QARA 3ULEG 5C2YA 1X5BA 2PM7A 1RZ4A 3FTYA 3CHQA 3D9JA 4JC8A 3CVLA 1TNUA 2VGXA 4YDYA 3HXFA 4AEZC 1IQUA 3QAQA 3SHFA 4A63B 4XI9A 4F7AA 3Q15A 3PZ2A 4XKBA 3TAXA 4BT8A 3I3NA 5LFAA 4FU3A 3UIOC 2QFCA 5BV0A 4WAFA 3GZ2A 4LNUD 4GTPA 1V54E 4MRUA 2R2LA 2AXZA 3G2VA 3ABLE 2VQ2A 4UWLA 1LD7A 1N94A 1NI1A 5BPPA 1HO8A 4JW1A 4CCAA 3UM0A 3Q5MA 1N95A 3JXJA 3UKUG 3PS6A 2Y3AA 4GA0A 3S7DA 4DLQA 5BXOA 4TXPA 4N2SA 1TEZA 3KAEA 3CSFA 3ZHEA 2WMOA 3T8KA 2LAHA 3NOGD 3ISMC 3B7UX 1D8EA 2EIJE 1HE8A 4GA2A 5AYWD 4DX5D 1N4SA 3E4BA 3FUMA 5J08A 2IF4A 1X81A 3D9LA 2X38A 3PE3A 2OVBA 1U2VG 2OEVA 4O6FA 2VGXB 3TXNA 4ANXA 2QYJA 1JCSA 3E34A 1KT0A 3DEOA 5KJNA 3U9WA 4U04A 5G55A 4HFGA 1E96B 2AVPA 3RJVA 3AG3E 3DSVA 2IU1A 5ENSD 4PH4B 3TWSA 3CHSA 2J09A 1ELWA 2WXRA 3QOUA 4ME2A 2GRMA 4G8KA 1DC2A 3OXGA 1W3BA 5ENPD 3MKQA 4L2LA 3DRAA 4GPMA 1IXVA 3EIJA 3RO2A 4J7WA 5BUZA 5BNWA 1K1AA 3JUIA 5AARA 3FUJA 3QJZA 2Y4TA 4ZFHA 1EYHA 2PQRA 4GA1A 3L16A 2LNIA 3D9MA 2KM4A 4AVXA 5EDSA 2XCCA 4UI9C 5CECB 4JL0A 3U66A 4KVMA 4X8QA 4F6RD 1FT1A 4DX6D 2VSOE 4Z68A 4A55A 3ZHEB 3TL5A 5FTPA 3PNLB 1K3ZD 3WXXA 1INZA 3NOCD 3SO8A 4RLYA 3ZUVB 3FH5A 1ZU2A 2QC9A 4UI9J 3CV0A 2RG8A 5ENQD 3W9GA 1H19A 5T4YA 3I4RB 4FLBA 3EU5A 4MS6A 5JJ6A 1SA4A 4BY6A 3ASFA 1FT2A 2P9KG 4UQZA 4K0RA 3UM3A 4AXHA 3CHOA 4EZKA 4U0SA 3ASGA 2I1KA 3Q75A 5LX8A 1HG5A 2XGMA 4RSYA 4FHKA 1NA0A 2XS8A 5ENNA 4A3VA 2P9PG 2XGOA 3DSWA 3TWWA 2ETCA 2YNQA 4WNEA 4XX5A 4G2VA 3CVVA 2IFUA 4HBDA 1AP7A 4AOFA 4Y6CA 4ATGA 3LS8A 1JUQA 2WXGA 3MKQB 4J0UA 3CHRA 3UIPC 1WY6A 4BEPA 4FULA 3U4TA 4TUUA 4FP7A 4NURA 3KEAA 3HYMB 3MCXA 3PDNA 4FA6A 3UM1A 5E75A 5ENRD 3AG2E 3L6AA 1MX6A 4I1AA 2WXPA 5G04C 3ZIMA
chains in the Genus database with same CATH topology
2HO1A 4OVVA 4JEHA 5FQ8A 2WM9A 2PQNA 4J8EA 2MOWA 3MGBA 4U63A 4HOTA 1IYGA 2AW6A 2AXVA 3SFZA 2WXLA 3JQ1A 4GB9A 4WNFA 3UX4A 3VLEA 4LCTA 4AY6A 3UQ3A 3D9NA 1OWNA 2CFZA 2GW1A 3HVEB 3PUJA 2XRYA 2MRIA 3EHMA 2WXIA 3IEGA 3GZ1A 1DNPA 3OTNA 3IBEA 4JEUA 3UT4A 5AIJA 2WXJA 3AU4A 4PUCA 3S7JA 1QNFA 3S2AA 3ZRHA 4FHJA 3QK0A 4BTBA 1H6KA 3PEVB 3CK9A 4C0MA 1VDYA 2YQ8A 4G23A 4HVBA 3PE4A 2J07A 4HS2A 4ANWA 1UJKA 3CVPA 4J8SA 1OWPA 3NF1A 4E6HA 5CCMA 2GRLA 1FCHA 2VJ8A 2ONDA 1Y6IA 4W9RA 5FZRA 3UT8A 5KJLA 2OV8A 5G05J 3FEXA 4HOSA 3BEEA 4I6JA 3GYZA 1OWMA 3BG1B 4F1SA 3RK6A 3I4GA 2UY1B 3O4ZA 4XIFA 4B8CB 2J9QA 4NRHB 2WQHA 5JJ7A 3SNXA 1ZBPA 4KVOA 4UWHA 3GZSA 3CVWA 4AJWA 3HIZA 1XGWA 5JHBA 2AXUA 4EZLA 4KYOB 3MV2B 4I17A 4EBAA 4JA9A 2WQ7A 3Q47B 4G24A 3UUXA 5D0QD 3LY9A 4U07A 4UQXA 4N3CA 3CQCB 3S7BA 1LF8A 2XQ0A 3CKCA 3LDZA 3L13A 3MA5A 4BX9A 2KZTA 2CHXA 2CG2A 3FTWA 3NQPA 5EKQD 2BUGA 3JCKC 4BWRA 3FFLA 3OXLA 3T8MA 3ZVVA 4BFRA 4WUYA 3SI5A 4I43A 3IV0A 2WXKA 3CKBA 3EHNA 2XPZA 4JPSA 2IJGX 3CQGB 4U0ZA 3R9AB 2KC7A 2XEVA 4GYWA 4GYYA 3T5VA 2X6HA 3C98A 1KT1A 3D9IA 4PS3A 2VSXE 3FP3A 3LVRE 4G26A 1KLXA 3BG0B 2L0IA 3B13A 1OWOA 2J08A 3CK8A 3IHVA 4GCOA 4GU5A 4RVBA 1TJFA 4GMJA 1NP7A 1PAQA 4M3OA 4BTAA 4EECA 3D3MA 4V3IA 5HQ8A 5CMWA 4ILGA 4KZ0A 4IN3B 2FBNA 3I5PA 2HR2A 3SBSA 5LOZA 2WMNA 3PEUB 4GZ6A 3ZEFA 2C2LA 4XE0A 1HG2A 3VTXA 2UWJG 2E0IA 5LCWJ 3APDA 4JA7A 4RG6A 4XKCA 4CRWA 4WWNA 3FTSA 2A5UA 4F53A 5A6CA 3PNTB 2JEKA 1UN9A 1YA0A 2R59A 2DCPA 3FTUA 3SZ7A 4XZ4A 3FH7A 5KCMA 3QARA 3URZA 3KD7A 2J4BA 4OYSA 1X5BA 5C2YA 3QWWA 1MHQA 3O48A 2PM7A 3CVNA 2JLBA 3CVQA 4MLPA 3FTYA 3LYAA 4N3AA 3SBTB 4PDXA 3ZGQA 2FF4A 3CHQA 3D9JA 4ACLA 1IQRA 4JC8A 2WXMA 3CVLA 3APFA 3D9PA 2VGXA 4P29A 5A7DB 1SQMA 2LAIA 4L1BA 5FT9A 3U3WA 4AEZC 1IQUA 2I1JA 1HXIA 5J90A 3QAQA 3SHFA 4F7AA 1JWFA 2QY7A 4XI9A 4ABNA 1H2TC 3EJNA 3SGHA 3ZYLA 1BPOA 3QC1A 3Q15A 1QZ2A 4XKBA 3DBSA 2BTDA 4B8AA 3N71A 3TAXA 1NA3A 4FLHA 5DBKA 5BV1A 4BT8A 2C0MA 3I3NA 5EX0A 5G05C 1HS6A 5LFAA 2X6KA 2VSYA 3QB2A 4AV7A 2WB2A 4FU3A 4FJZA 2DBAA 4CT4A 3IHYA 3ESKA 3TG4A 1EDUA 1HU3A 2QFCA 3LEWA 4WWPA 5BV0A 4WAFA 3GZ2A 2AWIA 4CDMA 3RRMB 4RG9A 4N2QA 4B89A 3MJWA 4N5CA 2ZU6B 4UWGA 2BF0X 4MRUA 4EPZA 1E8ZA 4AIFA 4G25A 4WNGA 3G2TA 1SZ9A 4IRUA 4J8DA 1NZNA 4L23A 2AXZA 3PREA 3T5XA 1MQSA 3G2VA 1E8XA 4F3VA 1Z6TA 2GGFA 2VQ2A 4NQ0A 4UWLA 5JHAA 4JZYA 1S0PA 3LVQE 2KZTB 4ILHB 5HI7A 1FVFA 3FUKA 4GZ5A 5ARGA 3R7RA 5BPPA 1HO8A 3FTVA 3MYVA 4JW1A 4I2ZA 4A3TA 5KJMA 3VLFA 2J4DA 3RKVA 4CCAA 5JJTA 3ULQA 4N3BA 3Q5MA 1U3CA 2PZIA 4IYPA 2L0TB 4XI0A 2FI7A 2E2EA 2X6FA 2L6JA 3PS6A 2NXPA 3ZPJA 1B89A 2I6HA 2Y3AA 4GA0A 4GCNA 4ANVA 4U0UA 5AENA 1P5QA 4FC8A 3S7DA 3APCA 4AP2A 2YINA 4DPRA 5G2NA 4DLQA 1GW6A 1DVPA 3FUEA 4UWKA 2PM6A 3ASDA 2IQCA 4HXIA 2WXOA 3FU3A 4FADA 1TEZA 4N2SA 4C0EA 3KAEA 4PS8A 2J49A 3CSFA 4UWFA 1E7VA 3ZHEA 2WMOA 5E76A 5LCWC 2YHCA 2LAHA 4URKA 4JXTA 1JPLA 2IOLA 1HFAA 4GZDA 2NC9A 4N39A 3B7UX 3QWPA 2KCLA 1HH8A 3FU6A 4TRQA 2V0PA 1HE8A 4GA2A 5BT1A 4LRZA 4Y6WA 1IHGA 4GMLA 5ANRA 3G2SA 5AYWD 3B7SA 4FJYA 3SD5A 1E90A 5T8IA 3CVUA 2L9BA 1UJJA 1ELKA 3P2BA 4H7YA 3ZYMA 3NZUA 3CIAA 4WWOA 1N54A 2XPYA 1HF8A 3UT7A 4LUNU 3E4BA 4I9CA 2CHWA 5KJKA 4GZCA 3FUMA 5J08A 2IF4A 3CHPA 3D9LA 2R17C 2X38A 3CK7A 3PE3A 1UG3A 1Z3YA 2OVBA 1EPUA 4Q96A 2YHEA 1PC2A 4O6FA 1Y8MA 1WAO1 2VGXB 3FHEA 2MHKA 3ZFWA 3TXNA 5CHEE 3TJPA 1E7UA 2IONA 4ANXA 4DLOA 3FEYA 4KMOA 4PS7A 4I1OB 3AS5A 3EDTB 4IULA 4BT9A 1XNFA 1KT0A 3CSTA 5ANLA 5KJNA 4G1TA 4BSXA 3U9WA 3EIQC 4CGWA 1OWLA 4G11A 2RD0A 3FY4A 1JWGA 3KS2A 4U04A 3PZDA 5G55A 4B94A 4HFGA 4L2YA 1E96B 3VTYA 4YNDA 3QWVA 3ZYQA 4A1SA 2AVPA 5A23A 3RJVA 3ESLA 4H7XA 4C9BB 3FU5A 3G2UA 4D10C 4Q94A 2IU1A 3NZSA 4K03A 3ZW3A 4PH4B 3P1UA 4KT6B 4QFVA 4DJAA 2X3MA 1E8WA 3CHSA 5D0OD 2J09A 1ELWA 2WXRA 3QOUA 4ME2A 3ZN3A 2GRMA 4CEMA 3CVXA 4ACKA 4EQFA 2I9CA 3FWVA 3LPZA 3OXGA 1W3BA 1UW4B 2KATA 3AS4A 2EQXA 5FWQA 5ARFA 2DIWA 2XRZA 5AJDA 3MKQA 5T3RA 4GPKA 2XPIA 4L2LA 2FO7A 2VTBA 3RRNB 3JYSA 3UPVA 3JQ0A 4J6IA 3LKUA 4EBAG 3ZXSA 1E8YA 2LO6A 2VSNA 3EIJA 3ENEA 3RO2A 5BNWA 2WXQA 5BUZA 4I6EA 3G2WA 2V5FA 3JUIA 4U8HA 5FJYA 5FQ7A 2A4ZA 2V8SE 3FUJA 3UMVA 2CG3A 3MV3B 1QQEA 3AS8A 1UN8A 3QJZA 2Y4TA 2XGSA 3L22A 3LJ3A 2FEZA 3HDXA 1EYHA 4Q69A 2PQRA 4GA1A 3L16A 2LNIA 2KCKA 3D9MA 4GAAA 2KM4A 2WQ6A 2LSVA 3L08A 5FQ4A 4AM9A 4AVXA 5EDSA 2XCCA 4UI9C 4GZ3A 2PL2A 3B7RL 4JL0A 3U66A 2WVIA 2WXFA 4ILIA 4B0ZA 1ELRA 4KVMA 2WPVA 3FUDA 4HOUA 1EF1C 2VGYA 5G04J 3TGOA 2OVFA 3MZLB 3PH0C 3D9OA 3ML9A 2VSOE 4KZCA 3Q49B 1FVHA 3IKOB 3S7FA 3ZHEB 3FUIA 3GW4A 3LXUX 2XHEA 3B7TA 3HVEA 4A55A 4TV3A 3TL5A 3L17A 2X6JA 3PNLB 5FTPA 3WXXA 5CMYA 1INZA 2V4LA 3FTZA 1TJCA 3FU0A 4DI4A 1PY1A 2ILRA 4WNDA 3FUFA 4JVSA 4UQYA 2KCVA 4CDRA 4JHRA 3FH5A 4AY5A 1ZU2A 3PRZA 2CHZA 4UI9J 3CV0A 3CR3A 3K9IA 1HZ4A 2RG8A 3FTXA 1H19A 3CLJA 4KBQA 5T4YA 1HX8A 4J8FA 3CGHA 3I4RB 4FLBA 4MS6A 5JJ6A 5FQ6A 3FULA 2Y4UA 5EX3A 1H2UA 4BY6A 3ASFA 4CGVA 2CFUA 3FUNA 2X6IA 4NACA 3RRUA 3D9KA 2NSZA 4HOQA 4K0RA 4UQZA 3ASHA 4JHJA 3Q4AB 3FH8A 4GYOA 4AXHA 2IOSA 2R5SA 3CEQA 4HORA 4CT0A 2UY1A 3CHOA 3TXMA 3ZYKA 4EZKA 4U0SA 4JHKA 4KXKB 3TG5A 2C0LA 1L5JA 3OAWA 1H0AA 3PVLA 5C1DA 3LY8A 2OOEA 4I9EA 3ASGA 3HHMA 1N52A 2I1KA 5FZQA 3ONKA 5CCLA 3LY7A 5LX8A 1HG5A 3KEZA 4UI9K 2XGMA 4RSYA 2HM8A 4FHKA 3RO3A 4ANUA 4BX8A 3RIBA 3QDNA 1NA0A 3U64A 3FUHA 4LEUA 5ENNA 3CVYA 4A3VA 3MKRA 5M72A 2Q7FA 2XGOA 1SZAA 4I2WA 4EZJA 2YNQA 4WNEA 3R7QA 4XX5A 3DPDA 3MEKA 2VYIA 4G2VA 3ONLA 2WXHA 3CVVA 2IFUA 4YVOA 4OVUA 2HYZA 4E85A 2XCBA 4HLEA 4AOFA 4Y6CA 4ATGA 3SF4A 3LS8A 4MKTA 1U3DA 3PUKA 5DIZA 1JUQA 2WXGA 3ML8A 3LCAA 3AU5A 3MKQB 2LSUA 3QNKA 3FDHA 5AJLA 4J0UA 1A17A 3CHRA 2VTBB 1H2VC 1WY6A 4L7TA 4LERA 4FULA 3U4TA 4APFA 4DI3A 4TUUA 2FULA 4FP7A 4I6GA 3CHMA 3MX3A 4NURA 3HYMB 3MCXA 3QKYA 3VLDA 4CDNA 5LP0A 3L54A 5FZSA 3PDNA 4FA6A 4A1GA 4DK5A 4YVQC 4R7LA 2M63A 5E75A 3RU0A 4APOA 3OXFA 1Z3XA 4I1MA 1WM5A 3L6AA 2P58C 4I1AA 5BW8C 2WXPA 5G04C 3ZIMA 1OUVA 2WXNA 2I2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HO1 A;  2PQN A;  4J8E A;  4HOT A;  1IYG A;  4WNF A;  4AY6 A;  3UQ3 A;  2GW1 A;  3IEG A;  3GZ1 A;  3S7J A;  4BTB A;  3CK9 A;  2YQ8 A;  4G23 A;  3PE4 A;  5CCM A;  3CVP A;  3NF1 A;  1FCH A;  2OND A;  4W9R A;  5FZR A;  5KJL A;  5G05 J;  4HOS A;  3BEE A;  3GYZ A;  2UY1 B;  4XIF A;  2J9Q A;  4NRH B;  2WQH A;  5JJ7 A;  1ZBP A;  4KYO B;  3MV2 B;  4I17 A;  4JA9 A;  3Q47 B;  4G24 A;  3UUX A;  5D0Q D;  3LY9 A;  4U07 A;  4UQX A;  4N3C A;  3S7B A;  3CKC A;  3MA5 A;  5EKQ D;  2BUG A;  4BWR A;  3FFL A;  3OXL A;  4WUY A;  3CKB A;  4U0Z A;  3R9A B;  2KC7 A;  2XEV A;  4GYW A;  4GYY A;  1KT1 A;  3FP3 A;  4G26 A;  1KLX A;  4GCO A;  3CK8 A;  4BTA A;  5HQ8 A;  4IN3 B;  2FBN A;  2HR2 A;  4GZ6 A;  2C2L A;  3VTX A;  2UWJ G;  5LCW J;  4JA7 A;  4RG6 A;  5A6C A;  1YA0 A;  3SZ7 A;  3URZ A;  3KD7 A;  3QWW A;  3O48 A;  3CVN A;  2JLB A;  3CVQ A;  3LYA A;  4N3A A;  3ZGQ A;  2FF4 A;  3CVL A;  2VGX A;  5A7D B;  3U3W A;  5FT9 A;  1HXI A;  4XI9 A;  4ABN A;  3Q15 A;  1QZ2 A;  3N71 A;  3TAX A;  1NA3 A;  5DBK A;  4BT8 A;  2C0M A;  5EX0 A;  5G05 C;  2VSY A;  2DBA A;  3ESK A;  3TG4 A;  2QFC A;  3GZ2 A;  4RG9 A;  4N2Q A;  4N5C A;  4AIF A;  4G25 A;  4WNG A;  4J8D A;  1NZN A;  4F3V A;  2VQ2 A;  4NQ0 A;  5HI7 A;  4GZ5 A;  5ARG A;  4I2Z A;  5KJM A;  3RKV A;  5JJT A;  3ULQ A;  4N3B A;  3Q5M A;  2PZI A;  4XI0 A;  2FI7 A;  2E2E A;  2L6J A;  3ZPJ A;  1B89 A;  2I6H A;  4GA0 A;  4GCN A;  4U0U A;  1P5Q A;  3S7D A;  3ASD A;  4N2S A;  3KAE A;  3ZHE A;  5LCW C;  2YHC A;  4N39 A;  2NC9 A;  3QWP A;  2KCL A;  1HH8 A;  4GA2 A;  5BT1 A;  4Y6W A;  1IHG A;  5AYW D;  4H7Y A;  3E4B A;  4I9C A;  5KJK A;  2IF4 A;  3CK7 A;  3PE3 A;  1PC2 A;  4O6F A;  1Y8M A;  1WAO 1;  2VGX B;  2MHK A;  3ZFW A;  5CHE E;  3AS5 A;  3EDT B;  4BT9 A;  1XNF A;  1KT0 A;  5KJN A;  4G1T A;  4CGW A;  3KS2 A;  4U04 A;  4B94 A;  1E96 B;  3VTY A;  4YND A;  3QWV A;  4A1S A;  2AVP A;  3RJV A;  4H7X A;  5D0O D;  3ZN3 A;  1ELW A;  3QOU A;  4ME2 A;  4EQF A;  3FWV A;  3LPZ A;  3OXG A;  1W3B A;  2KAT A;  3AS4 A;  5ARF A;  4GPK A;  2XPI A;  2FO7 A;  3JYS A;  3UPV A;  3LKU A;  2VSN A;  3RO2 A;  5BNW A;  2V5F A;  5FJY A;  3MV3 B;  1QQE A;  3AS8 A;  2Y4T A;  2XGS A;  2FEZ A;  2PQR A;  4GA1 A;  2LNI A;  2KCK A;  2LSV A;  4AM9 A;  2XCC A;  4UI9 C;  4GZ3 A;  2PL2 A;  4JL0 A;  1ELR A;  2WPV A;  4HOU A;  2VGY A;  5G04 J;  3TGO A;  3Q49 B;  3S7F A;  3ZHE B;  3GW4 A;  5FTP A;  3WXX A;  1TJC A;  4WND A;  4UQY A;  2KCV A;  4CDR A;  4JHR A;  4AY5 A;  1ZU2 A;  4UI9 J;  3CV0 A;  3K9I A;  1HZ4 A;  4KBQ A;  4J8F A;  5JJ6 A;  2Y4U A;  5EX3 A;  4CGV A;  3ASF A;  4UQZ A;  4HOQ A;  3ASH A;  3Q4A B;  4GYO A;  2R5S A;  3CEQ A;  4HOR A;  2UY1 A;  4U0S A;  4KXK B;  3TG5 A;  2C0L A;  5C1D A;  3LY8 A;  2OOE A;  4I9E A;  3ASG A;  5FZQ A;  5CCL A;  3LY7 A;  4UI9 K;  2XGM A;  3RO3 A;  3RIB A;  3QDN A;  1NA0 A;  4LEU A;  3MKR A;  5M72 A;  2Q7F A;  2XGO A;  4I2W A;  4WNE A;  3MEK A;  2VYI A;  4G2V A;  2IFU A;  4YVO A;  2HYZ A;  2XCB A;  4Y6C A;  3SF4 A;  5DIZ A;  3LCA A;  2LSU A;  4J0U A;  1A17 A;  3U4T A;  3HYM B;  3QKY A;  5FZS A;  3PDN A;  4YVQ C;  3RU0 A;  4APO A;  3OXF A;  1WM5 A;  2P58 C;  4I1A A;  5BW8 C;  5G04 C;  1OUV A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  3JQ1 A;  4GB9 A;  4GTO A;  2CFZ A;  2XRY A;  3EHM A;  1LTX A;  1QBQ A;  3GZ1 A;  1TNB A;  4PUC A;  2L6B A;  3S2A A;  1H6K A;  4G23 A;  1UJK A;  3DST A;  4J8S A;  4W9R A;  2OV8 A;  5G05 J;  4L9P A;  4HOS A;  3BEE A;  4I6J A;  3GYZ A;  3JXI A;  4AJW A;  3Q7F A;  5JHB A;  5AAO A;  4EBA A;  3UUX A;  4N3C A;  4ZHB A;  4JD2 G;  3JUE A;  5EKQ D;  4WUY A;  1JCQ A;  3SI5 A;  4DX2 A;  2XPZ A;  3R9A B;  4EHM A;  2A5E A;  1KT1 A;  2VSX E;  2DZO A;  2L0I A;  1OWO A;  4GCO A;  1TJF A;  1PAQ A;  4EEC A;  2KXP C;  4IN3 B;  4HRM B;  3SBS A;  5LOZ A;  2WMN A;  4GZ6 A;  5EIB E;  2UWJ G;  4XKC A;  3FTS A;  3PNT B;  1YA0 A;  3KD7 A;  5B1B E;  3O48 A;  2Y1L E;  1O1T A;  3LYA A;  4ACL A;  3ZGQ A;  2IEJ A;  3D9P A;  5A7D B;  5EYP F;  1SQM A;  3HXD A;  4L1B A;  5J90 A;  1HXI A;  1JWF A;  2QY7 A;  3W9F A;  1H2T C;  3ZYL A;  3E30 A;  3QC1 A;  5CBO A;  4B8A A;  3N71 A;  5CED B;  4BSZ B;  4OAU C;  5CRV A;  2P9U G;  2VSY A;  2ETB A;  2WB2 A;  1OCZ E;  3HG0 D;  3TG4 A;  1Q2Z A;  4HRL A;  3LEW A;  4WWP A;  3AG4 E;  3RRM B;  2KBX A;  4N2Q A;  4B89 A;  4N5C A;  2BF0 X;  4AIF A;  1S70 B;  4G25 A;  2P9N G;  4J8D A;  1NZN A;  1E8X A;  2GGF A;  4GTT A;  4NQ0 A;  1S0P A;  4ILH B;  3R7R A;  2GRO B;  3FTV A;  1LD8 A;  4GTQ A;  3ULQ A;  2PZI A;  2L0T B;  2Y0B G;  4XI0 A;  3F6Q A;  1N11 A;  2FI7 A;  2E2E A;  2X6F A;  4O1O A;  1BI8 B;  1B89 A;  2I6H A;  1S64 A;  5HRY A;  4U0U A;  5AEN A;  1P5Q A;  1V55 E;  2YIN A;  5G2N A;  3FUE A;  2WXO A;  4C0E A;  1FPP A;  4PS8 A;  1E7V A;  5E76 A;  4JXT A;  2IOL A;  2NC9 A;  3BU8 A;  3QWP A;  5FIN A;  5BT1 A;  4LRZ A;  4Y6W A;  1IHG A;  4GML A;  5ANR A;  1MZC A;  3SD5 A;  1UJJ A;  1QYM A;  1N54 A;  3SFX A;  1HF8 A;  4I9C A;  5KJK A;  3CK7 A;  1EPU A;  4Q96 A;  2YHE A;  1WAO 1;  4BER A;  3ZFW A;  4NIK A;  5CHE E;  4DLO A;  1MYO A;  3NBN B;  5CEA A;  5EIL A;  4CGW A;  3EIQ C;  2BKG A;  3AAA C;  2RD0 A;  3KS2 A;  5CBN A;  1BLX B;  4L2Y A;  4A1S A;  5A23 A;  3ESL A;  5ENO D;  3V2O A;  4Q94 A;  3DSX A;  2XEN A;  3P1U A;  2X3M A;  3BQO A;  5D0O D;  4CEM A;  4EQF A;  5FWQ A;  2DIW A;  5AJD A;  5T3R A;  2XPI A;  1H6P A;  2VTB A;  3UPV A;  3JQ0 A;  4EBA G;  1E8Y A;  1TYQ G;  2LO6 A;  3ENE A;  4I6E A;  3G2W A;  2V5F A;  5AQB A;  4U8H A;  3UMV A;  1UN8 A;  2XGS A;  3L22 A;  2FEZ A;  4CZ2 D;  4TUM A;  2GRR B;  4HNA D;  2KCK A;  4GAA A;  2LSV A;  3L08 A;  3C3R A;  3SFY A;  4GZ3 A;  2WVI A;  2WXF A;  4ILI A;  1ELR A;  2WPV A;  3TGO A;  2P9I G;  2OVF A;  1MJ0 A;  3D9O A;  2B0O E;  4KZC A;  3FUI A;  3GW4 A;  3B7T A;  3HVE A;  3L17 A;  2X6J A;  2V4L A;  4G8L A;  2EIM E;  2VGE A;  3C5R A;  2BED A;  3LJN A;  2CHZ A;  1HZ4 A;  2MYO A;  3Q7A A;  3DSU A;  2Y4U A;  5EX3 A;  4NAC A;  2X6I A;  2NSZ A;  1NFI E;  1Z5S C;  2GRQ B;  1ZB1 A;  4JHK A;  2LXL A;  3PVL A;  5C1D A;  5FZQ A;  1N52 A;  1WDY A;  3RO3 A;  3QDN A;  3CVY A;  3MKR A;  2Q7F A;  2XS1 A;  3HXB A;  3MEK A;  3ONL A;  2WXH A;  1N4P A;  4OVU A;  2HYZ A;  2XCB A;  4HLE A;  4MKT A;  3AU5 A;  3FDH A;  1KPS B;  5AJL A;  2VTB B;  1K1B A;  2IO2 C;  5BXU A;  4I6G A;  3MX3 A;  3HXE A;  3QKY A;  4K5C A;  1OY3 D;  5FZS A;  4DK5 A;  3Q79 A;  1AWC B;  3OXF A;  1N0Q A;  2H6I A;  5FIO A;  2HO1 A;  2GRP B;  2MOW A;  3MGB A;  3AG1 E;  3EUV A;  4WNF A;  3UX4 A;  3VLE A;  3D9N A;  1OWN A;  3HVE B;  3PUJ A;  3IEG A;  3OTN A;  3DSS A;  3UM2 A;  3IBE A;  3UKR G;  3S7J A;  1QNF A;  3QK0 A;  5D2M C;  3PEV B;  4U8V D;  4GTM A;  4HS2 A;  3NF1 A;  4YDW A;  2H6F A;  2F8X K;  5FZR A;  3RK6 A;  3O4Z A;  1ZBP A;  4KVO A;  2OCC E;  2DZN A;  2R05 A;  4EZL A;  4KYO B;  4I17 A;  3Q47 B;  3V30 A;  2P2C P;  2IY0 C;  1LF8 A;  2XQ0 A;  3LDZ A;  3MA5 A;  2CHX A;  2CG2 A;  2BUG A;  4BFR A;  4I43 A;  2WXK A;  3CQG B;  2DYR E;  2KC7 A;  2XEV A;  3T5V A;  2X6H A;  2ZXW E;  5EN5 D;  4PS3 A;  3TWV A;  3LVR E;  3B13 A;  2J08 A;  4BTA A;  2RFA A;  4O1P A;  5HQ8 A;  2XZD G;  4ILG A;  5HKP A;  2FBN A;  3I5P A;  2HR2 A;  3ZEF A;  2E0I A;  5LCW J;  4RG6 A;  3DEP A;  1UN9 A;  2R59 A;  4XZ4 A;  4LG6 A;  3FH7 A;  2HE0 A;  3URZ A;  5KNH D;  4ATZ D;  4U95 D;  4BES A;  2J4B A;  4OYS A;  3PZ3 A;  3QWW A;  4DX1 A;  2JLB A;  3CVQ A;  3DXM G;  2H6G A;  3SBT B;  4N3A A;  2FF4 A;  1IQR A;  3APF A;  4P29 A;  4YDO A;  2LAI A;  5FT9 A;  4BET A;  4ABN A;  3EJN A;  3SGH A;  1BPO A;  1QZ2 A;  3DBS A;  2BTD A;  4FLH A;  5DBK A;  5BV1 A;  5EX0 A;  5G05 C;  1HS6 A;  2X6K A;  2IO3 C;  4FJZ A;  4UUC A;  4CT4 A;  1HU3 A;  1K8K G;  2AWI A;  3KSL A;  4CDM A;  3MJW A;  3V79 K;  4EPZ A;  1E8Z A;  1N4R A;  4WNG A;  3T5X A;  1MQS A;  4F3V A;  3NAW A;  5JHA A;  4JZY A;  3LVQ E;  2AJA A;  4DX7 D;  4RQI A;  4GZ5 A;  1O1S A;  1NL4 A;  3VLF A;  5KJM A;  3RKV A;  1U3C A;  5B3S E;  2L6J A;  2NXP A;  5B1A E;  4FC8 A;  3APC A;  3T9K A;  1DVP A;  4UWK A;  3ASD A;  2IQC A;  4HXI A;  3DPY A;  4FAD A;  4UWF A;  2YHC A;  4QQI A;  4URK A;  1HFA A;  4GZD A;  4N39 A;  1HH8 A;  3G2S A;  1TNY A;  5T8I A;  3CVU A;  2L9B A;  1ELK A;  1TN7 A;  4TXR A;  3ZYM A;  3UXG A;  5H7P A;  3NZU A;  3B95 A;  1OCR E;  4GZC A;  3CHP A;  2R17 C;  2EIL E;  1SA5 A;  3SY2 A;  1PC2 A;  1WG0 A;  1Y8M A;  3FHE A;  1D9S A;  2BKK B;  2ION A;  4U96 D;  4KMO A;  4I1O B;  3AS5 A;  4BT9 A;  3HXC A;  1XNF A;  1BU9 A;  2LXM A;  4G11 A;  4CYM D;  3VTY A;  4YND A;  4H7X A;  4C9B B;  3FU5 A;  4D10 C;  3NZS A;  4QFV A;  4DJA A;  1IHB A;  1E8W A;  3ASO E;  4ACK A;  2I9C A;  3FWV A;  1UW4 B;  3AS4 A;  3R9M A;  2XRZ A;  3V31 A;  4GPK A;  3UI2 A;  3RRN B;  3JYS A;  4U7E B;  4JB8 P;  3LKU A;  2VSN A;  5FQ7 A;  5FJY A;  1QQE A;  3IXE A;  3C3Q A;  3HDX A;  4AM9 A;  4DRX E;  2PL2 A;  1SVX A;  3FUD A;  4HOU A;  2VGY A;  3PH0 C;  3EHR A;  1FVH A;  2Y69 E;  3RSE G;  4C48 B;  3IKO B;  2XHE A;  3D9H A;  3ABK E;  1TJC A;  4YDE A;  3FU0 A;  4DI4 A;  2QZA A;  4UQY A;  4JHR A;  4AY5 A;  2EIK E;  3K9I A;  4KBQ A;  1HX8 A;  1RW2 A;  4J8F A;  4DUI A;  5FQ6 A;  4CGV A;  2CFU A;  3RRU A;  3D9K A;  4HOQ A;  3ASH A;  4JHJ A;  3Q4A B;  3FH8 A;  4HOR A;  3CEQ A;  5AQA A;  4CT0 A;  3TXM A;  4KXK B;  3E37 A;  5D66 A;  2OOE A;  4I9E A;  2OEW A;  3LY7 A;  1YCS B;  3KEZ A;  2HM8 A;  1DCE A;  4U8Y D;  4ANU A;  1N0R A;  3RIB A;  3U64 A;  3FUH A;  4HRN A;  1SZA A;  4I2W A;  4EZJ A;  3R7Q A;  4OAV B;  2VYI A;  3ZXP A;  1TN6 A;  3EU9 A;  3LCA A;  1A17 A;  4M7C A;  4LER A;  4APF A;  2FUL A;  3CHM A;  4CDN A;  4YVQ C;  2M63 A;  2FO1 E;  1Z3X A;  2P58 C;  5BW8 C;  1OUV A;  2I2O A;  4OVV A;  5FQ8 A;  2LUH A;  4HOT A;  2EIN E;  3WG7 E;  1IYG A;  2AW6 A;  2WXL A;  5AQ7 A;  4LCT A;  3UQ3 A;  2MRI A;  1BI7 B;  4TXQ A;  2J8S D;  5ENT D;  5AN8 A;  3AU4 A;  3ZU7 B;  4FHJ A;  1H6O A;  2H6H A;  4C0M A;  4HVB A;  3PE4 A;  2J07 A;  4ANW A;  5CRU A;  3CVP A;  5CCM A;  1OWP A;  1FCH A;  1N4Q A;  2OND A;  1Y6I A;  5KJL A;  1O1R A;  3BG1 B;  3I4G A;  3RAU A;  2J9Q A;  4NRH B;  5JJ7 A;  3SNX A;  4UWH A;  3GZS A;  3E32 A;  3HIZ A;  1XGW A;  2AXU A;  1YMP A;  4G24 A;  3LY9 A;  3S7B A;  3CKC A;  3L13 A;  4HB5 A;  2KZT A;  3NQP A;  3ULY A;  3JCK C;  3FFL A;  3OXL A;  3T8M A;  3IV0 A;  3CKB A;  3V2X A;  2IJG X;  4GYW A;  4K5B A;  4G26 A;  3BG0 B;  3CK8 A;  4GU5 A;  1S63 A;  4GTR A;  4GMJ A;  4MBG A;  1NP7 A;  4M3O A;  3D3M A;  4V3I A;  3EHQ A;  3PEU B;  2C2L A;  2JAB A;  1HG2 A;  3HRA A;  3APD A;  4JA7 A;  4CRW A;  4WWN A;  5JA4 D;  5A6C A;  3TWQ A;  3UTM A;  4N5Q A;  5KCM A;  3E33 A;  1MHQ A;  3CVN A;  4MLP A;  1D8D A;  4PDX A;  2WXM A;  3Q9N C;  3U3W A;  1G3N B;  2I1J A;  4HI8 A;  4K5A B;  1NA3 A;  5KBA A;  2C0M A;  3X2Q E;  3QB2 A;  4AV7 A;  2DBA A;  2ZGG A;  2XEE A;  3IHY A;  3ESK A;  1EDU A;  1TN8 A;  4RG9 A;  1YYH A;  2ZU6 B;  4UWG A;  1N9A A;  2DYS E;  1SZ9 A;  3G2T A;  1DCQ A;  4IRU A;  4L23 A;  4F1P A;  3PRE A;  4HI9 A;  5EID A;  5KWD A;  1Z6T A;  3C72 A;  2KZT B;  1IKN D;  3TWX A;  2R03 A;  5HI7 A;  1FVF A;  3FUK A;  5HS0 A;  3ASN E;  5ARG A;  4I2Z A;  2P9L G;  2PNN A;  3MYV A;  4A3T A;  2J4D A;  5JJT A;  4N3B A;  1TNZ A;  4IYP A;  3ZPJ A;  4GCN A;  4ANV A;  4AP2 A;  4DPR A;  5CER B;  1GW6 A;  2V4H C;  2PM6 A;  3FU3 A;  2ETA A;  2J49 A;  3L9T A;  3PZ4 A;  5LCW C;  1JPL A;  2KCL A;  3FU6 A;  4TRQ A;  2V0P A;  3B7S A;  4FJY A;  1E90 A;  3P2B A;  4H7Y A;  2GRN B;  3CIA A;  4WWO A;  2XPY A;  5IY5 E;  3UT7 A;  4LUN U;  2CHW A;  1TR4 A;  1UG3 A;  1Z3Y A;  2DWZ A;  2NYJ A;  2MHK A;  3TJP A;  1E7U A;  3FEY A;  4PS7 A;  3EDT B;  4IUL A;  3CST A;  5ANL A;  4G1T A;  4BSX A;  1OWL A;  3FY4 A;  1JWG A;  3PZD A;  4B94 A;  3QWV A;  3ZYQ A;  3G2U A;  4K03 A;  3ZW3 A;  3DWL G;  4KT6 B;  2QYU A;  1MX4 A;  3ZN3 A;  3CVX A;  5EYL A;  1BD8 A;  5JMN D;  1UOH A;  3LPZ A;  3TWU A;  2KAT A;  2EQX A;  5ARF A;  2RFM A;  2FO7 A;  4J6I A;  2ZGD A;  3ZXS A;  2WXQ A;  2F37 A;  4B93 B;  2A4Z A;  2V8S E;  4O60 A;  2CG3 A;  3MV3 B;  3AS8 A;  1OCO E;  2V5Q C;  3LJ3 A;  1KZO A;  3BUA A;  4Q69 A;  5ITZ F;  5KNG A;  2WQ6 A;  5FQ4 A;  2DVW A;  3B7R L;  4B0Z A;  1EF1 C;  5G04 J;  3MZL B;  3ML9 A;  3Q49 B;  3S7F A;  3LXU X;  4TV3 A;  5CMY A;  3FTZ A;  1PY1 A;  2ILR A;  3Q73 A;  3FUF A;  4JVS A;  4WND A;  2KCV A;  4CDR A;  1O5M A;  3AJI A;  3PRZ A;  3CR3 A;  3FTX A;  3CLJ A;  3CGH A;  3FUL A;  1H2U A;  3FUN A;  4GYO A;  2IOS A;  2R02 A;  2R5S A;  5AQ9 A;  2UY1 A;  3ZYK A;  3TG5 A;  2C0L A;  1L5J A;  3OAW A;  1H0A A;  3LY8 A;  3HHM A;  3ONK A;  5CCL A;  4GMR A;  4UI9 K;  4BX8 A;  3DXK G;  4LEU A;  5M72 A;  3PZ1 A;  3DPD A;  2F0Y A;  4YVO A;  4E85 A;  3SF4 A;  1U3D A;  3PUK A;  5DIZ A;  3ML8 A;  3NB2 A;  4GTS A;  2RKK A;  2LSU A;  3QNK A;  1H2V C;  1OT8 A;  4L7T A;  4DI3 A;  3J5Q B;  4J8Y A;  1KZP A;  3VLD A;  5LP0 A;  3L54 A;  4A1G A;  4R7L A;  3RU0 A;  4APO A;  3Q78 A;  4I1M A;  1WM5 A;  2WXN A;  4JEH A;  2WM9 A;  2PQN A;  4J8E A;  4U63 A;  2AXV A;  4AY6 A;  2GW1 A;  3ABM E;  2WXI A;  1DNP A;  4JEU A;  3UT4 A;  5AIJ A;  2WXJ A;  3ZRH A;  3B7B A;  3SQV A;  3ZKJ A;  4BTB A;  3CK9 A;  1VDY A;  2YQ8 A;  4E6H A;  1MX2 A;  1A5E A;  2B6C A;  2GRL A;  3ZNG A;  2VJ8 A;  3UT8 A;  2ZIR A;  3FEX A;  1TNO A;  1OWM A;  4F1S A;  4LNB A;  2UY1 B;  3TWR A;  4XIF A;  4B8C B;  2F8Y A;  2WQH A;  3Q9U C;  3CVW A;  3MV2 B;  3KSQ A;  4JA9 A;  2WQ7 A;  2ZIS A;  5D0Q D;  4U07 A;  4UQX A;  3CQC B;  4BX9 A;  3FTW A;  1SW6 A;  4BWR A;  3ZVV A;  4LNG A;  3EHN A;  4JPS A;  4U0Z A;  2XEH A;  4GYY A;  4HQD A;  1OCC E;  3C98 A;  3D9I A;  4GTV A;  3UIN C;  3FP3 A;  1KLX A;  4XEI G;  4RVB A;  3IHV A;  3L82 A;  3C3O A;  4HLL A;  5CMW A;  1OXJ A;  4KZ0 A;  2XZT G;  1JCR A;  4LSZ E;  4XE0 A;  3VTX A;  3TWT A;  2P9S G;  2A5U A;  4F53 A;  2JEK A;  3J5P A;  3FTU A;  2DCP A;  3SZ7 A;  3QAR A;  3ULE G;  5C2Y A;  1X5B A;  2PM7 A;  1RZ4 A;  3FTY A;  3CHQ A;  3D9J A;  4JC8 A;  3CVL A;  1TNU A;  2VGX A;  4YDY A;  3HXF A;  4AEZ C;  1IQU A;  3QAQ A;  3SHF A;  4A63 B;  4XI9 A;  4F7A A;  3Q15 A;  3PZ2 A;  4XKB A;  3TAX A;  4BT8 A;  3I3N A;  5LFA A;  4FU3 A;  3UIO C;  2QFC A;  5BV0 A;  4WAF A;  3GZ2 A;  4LNU D;  4GTP A;  1V54 E;  4MRU A;  2R2L A;  2AXZ A;  3G2V A;  3ABL E;  2VQ2 A;  4UWL A;  1LD7 A;  1N94 A;  1NI1 A;  5BPP A;  1HO8 A;  4JW1 A;  4CCA A;  3UM0 A;  3Q5M A;  1N95 A;  3JXJ A;  3UKU G;  3PS6 A;  2Y3A A;  4GA0 A;  3S7D A;  4DLQ A;  5BXO A;  4TXP A;  4N2S A;  1TEZ A;  3KAE A;  3CSF A;  3ZHE A;  2WMO A;  3T8K A;  2LAH A;  3NOG D;  3ISM C;  3B7U X;  1D8E A;  2EIJ E;  1HE8 A;  4GA2 A;  5AYW D;  4DX5 D;  1N4S A;  3E4B A;  3FUM A;  5J08 A;  2IF4 A;  1X81 A;  3D9L A;  2X38 A;  3PE3 A;  2OVB A;  1U2V G;  2OEV A;  4O6F A;  2VGX B;  3TXN A;  4ANX A;  2QYJ A;  1JCS A;  3E34 A;  1KT0 A;  3DEO A;  5KJN A;  3U9W A;  4U04 A;  5G55 A;  4HFG A;  1E96 B;  2AVP A;  3RJV A;  3AG3 E;  3DSV A;  2IU1 A;  5ENS D;  4PH4 B;  3TWS A;  3CHS A;  2J09 A;  1ELW A;  2WXR A;  3QOU A;  4ME2 A;  2GRM A;  4G8K A;  1DC2 A;  3OXG A;  1W3B A;  5ENP D;  3MKQ A;  4L2L A;  3DRA A;  4GPM A;  1IXV A;  3EIJ A;  3RO2 A;  4J7W A;  5BUZ A;  5BNW A;  1K1A A;  3JUI A;  5AAR A;  3FUJ A;  3QJZ A;  2Y4T A;  4ZFH A;  1EYH A;  2PQR A;  4GA1 A;  3L16 A;  2LNI A;  3D9M A;  2KM4 A;  4AVX A;  5EDS A;  2XCC A;  4UI9 C;  5CEC B;  4JL0 A;  3U66 A;  4KVM A;  4X8Q A;  4F6R D;  1FT1 A;  4DX6 D;  2VSO E;  4Z68 A;  4A55 A;  3ZHE B;  3TL5 A;  5FTP A;  3PNL B;  1K3Z D;  3WXX A;  1INZ A;  3NOC D;  3SO8 A;  4RLY A;  3ZUV B;  3FH5 A;  1ZU2 A;  2QC9 A;  4UI9 J;  3CV0 A;  2RG8 A;  5ENQ D;  3W9G A;  1H19 A;  5T4Y A;  3I4R B;  4FLB A;  3EU5 A;  4MS6 A;  5JJ6 A;  1SA4 A;  4BY6 A;  3ASF A;  1FT2 A;  2P9K G;  4UQZ A;  4K0R A;  3UM3 A;  4AXH A;  3CHO A;  4EZK A;  4U0S A;  3ASG A;  2I1K A;  3Q75 A;  5LX8 A;  1HG5 A;  2XGM A;  4RSY A;  4FHK A;  1NA0 A;  2XS8 A;  5ENN A;  4A3V A;  2P9P G;  2XGO A;  3DSW A;  3TWW A;  2ETC A;  2YNQ A;  4WNE A;  4XX5 A;  4G2V A;  3CVV A;  2IFU A;  4HBD A;  1AP7 A;  4AOF A;  4Y6C A;  4ATG A;  3LS8 A;  1JUQ A;  2WXG A;  3MKQ B;  4J0U A;  3CHR A;  3UIP C;  1WY6 A;  4BEP A;  4FUL A;  3U4T A;  4TUU A;  4FP7 A;  4NUR A;  3KEA A;  3HYM B;  3MCX A;  3PDN A;  4FA6 A;  3UM1 A;  5E75 A;  5ENR D;  3AG2 E;  3L6A A;  1MX6 A;  4I1A A;  2WXP A;  5G04 C;  3ZIM A; 
#chains in the Genus database with same CATH homology
 2HO1 A;  4OVV A;  4JEH A;  5FQ8 A;  2WM9 A;  2PQN A;  4J8E A;  2MOW A;  3MGB A;  4U63 A;  4HOT A;  1IYG A;  2AW6 A;  2AXV A;  3SFZ A;  2WXL A;  3JQ1 A;  4GB9 A;  4WNF A;  3UX4 A;  3VLE A;  4LCT A;  4AY6 A;  3UQ3 A;  3D9N A;  1OWN A;  2CFZ A;  2GW1 A;  3HVE B;  3PUJ A;  2XRY A;  2MRI A;  3EHM A;  2WXI A;  3IEG A;  3GZ1 A;  1DNP A;  3OTN A;  3IBE A;  4JEU A;  3UT4 A;  5AIJ A;  2WXJ A;  3AU4 A;  4PUC A;  3S7J A;  1QNF A;  3S2A A;  3ZRH A;  4FHJ A;  3QK0 A;  4BTB A;  1H6K A;  3PEV B;  3CK9 A;  4C0M A;  1VDY A;  2YQ8 A;  4G23 A;  4HVB A;  3PE4 A;  2J07 A;  4HS2 A;  4ANW A;  1UJK A;  3CVP A;  4J8S A;  1OWP A;  3NF1 A;  4E6H A;  5CCM A;  2GRL A;  1FCH A;  2VJ8 A;  2OND A;  1Y6I A;  4W9R A;  5FZR A;  3UT8 A;  5KJL A;  2OV8 A;  5G05 J;  3FEX A;  4HOS A;  3BEE A;  4I6J A;  3GYZ A;  1OWM A;  3BG1 B;  4F1S A;  3RK6 A;  3I4G A;  2UY1 B;  3O4Z A;  4XIF A;  4B8C B;  2J9Q A;  4NRH B;  2WQH A;  5JJ7 A;  3SNX A;  1ZBP A;  4KVO A;  4UWH A;  3GZS A;  3CVW A;  4AJW A;  3HIZ A;  1XGW A;  5JHB A;  2AXU A;  4EZL A;  4KYO B;  3MV2 B;  4I17 A;  4EBA A;  4JA9 A;  2WQ7 A;  3Q47 B;  4G24 A;  3UUX A;  5D0Q D;  3LY9 A;  4U07 A;  4UQX A;  4N3C A;  3CQC B;  3S7B A;  1LF8 A;  2XQ0 A;  3CKC A;  3LDZ A;  3L13 A;  3MA5 A;  4BX9 A;  2KZT A;  2CHX A;  2CG2 A;  3FTW A;  3NQP A;  5EKQ D;  2BUG A;  3JCK C;  4BWR A;  3FFL A;  3OXL A;  3T8M A;  3ZVV A;  4BFR A;  4WUY A;  3SI5 A;  4I43 A;  3IV0 A;  2WXK A;  3CKB A;  3EHN A;  2XPZ A;  4JPS A;  2IJG X;  3CQG B;  4U0Z A;  3R9A B;  2KC7 A;  2XEV A;  4GYW A;  4GYY A;  3T5V A;  2X6H A;  3C98 A;  1KT1 A;  3D9I A;  4PS3 A;  2VSX E;  3FP3 A;  3LVR E;  4G26 A;  1KLX A;  3BG0 B;  2L0I A;  3B13 A;  1OWO A;  2J08 A;  3CK8 A;  3IHV A;  4GCO A;  4GU5 A;  4RVB A;  1TJF A;  4GMJ A;  1NP7 A;  1PAQ A;  4M3O A;  4BTA A;  4EEC A;  3D3M A;  4V3I A;  5HQ8 A;  5CMW A;  4ILG A;  4KZ0 A;  4IN3 B;  2FBN A;  3I5P A;  2HR2 A;  3SBS A;  5LOZ A;  2WMN A;  3PEU B;  4GZ6 A;  3ZEF A;  2C2L A;  4XE0 A;  1HG2 A;  3VTX A;  2UWJ G;  2E0I A;  5LCW J;  3APD A;  4JA7 A;  4RG6 A;  4XKC A;  4CRW A;  4WWN A;  3FTS A;  2A5U A;  4F53 A;  5A6C A;  3PNT B;  2JEK A;  1UN9 A;  1YA0 A;  2R59 A;  2DCP A;  3FTU A;  3SZ7 A;  4XZ4 A;  3FH7 A;  5KCM A;  3QAR A;  3URZ A;  3KD7 A;  2J4B A;  4OYS A;  1X5B A;  5C2Y A;  3QWW A;  1MHQ A;  3O48 A;  2PM7 A;  3CVN A;  2JLB A;  3CVQ A;  4MLP A;  3FTY A;  3LYA A;  4N3A A;  3SBT B;  4PDX A;  3ZGQ A;  2FF4 A;  3CHQ A;  3D9J A;  4ACL A;  1IQR A;  4JC8 A;  2WXM A;  3CVL A;  3APF A;  3D9P A;  2VGX A;  4P29 A;  5A7D B;  1SQM A;  2LAI A;  4L1B A;  5FT9 A;  3U3W A;  4AEZ C;  1IQU A;  2I1J A;  1HXI A;  5J90 A;  3QAQ A;  3SHF A;  4F7A A;  1JWF A;  2QY7 A;  4XI9 A;  4ABN A;  1H2T C;  3EJN A;  3SGH A;  3ZYL A;  1BPO A;  3QC1 A;  3Q15 A;  1QZ2 A;  4XKB A;  3DBS A;  2BTD A;  4B8A A;  3N71 A;  3TAX A;  1NA3 A;  4FLH A;  5DBK A;  5BV1 A;  4BT8 A;  2C0M A;  3I3N A;  5EX0 A;  5G05 C;  1HS6 A;  5LFA A;  2X6K A;  2VSY A;  3QB2 A;  4AV7 A;  2WB2 A;  4FU3 A;  4FJZ A;  2DBA A;  4CT4 A;  3IHY A;  3ESK A;  3TG4 A;  1EDU A;  1HU3 A;  2QFC A;  3LEW A;  4WWP A;  5BV0 A;  4WAF A;  3GZ2 A;  2AWI A;  4CDM A;  3RRM B;  4RG9 A;  4N2Q A;  4B89 A;  3MJW A;  4N5C A;  2ZU6 B;  4UWG A;  2BF0 X;  4MRU A;  4EPZ A;  1E8Z A;  4AIF A;  4G25 A;  4WNG A;  3G2T A;  1SZ9 A;  4IRU A;  4J8D A;  1NZN A;  4L23 A;  2AXZ A;  3PRE A;  3T5X A;  1MQS A;  3G2V A;  1E8X A;  4F3V A;  1Z6T A;  2GGF A;  2VQ2 A;  4NQ0 A;  4UWL A;  5JHA A;  4JZY A;  1S0P A;  3LVQ E;  2KZT B;  4ILH B;  5HI7 A;  1FVF A;  3FUK A;  4GZ5 A;  5ARG A;  3R7R A;  5BPP A;  1HO8 A;  3FTV A;  3MYV A;  4JW1 A;  4I2Z A;  4A3T A;  5KJM A;  3VLF A;  2J4D A;  3RKV A;  4CCA A;  5JJT A;  3ULQ A;  4N3B A;  3Q5M A;  1U3C A;  2PZI A;  4IYP A;  2L0T B;  4XI0 A;  2FI7 A;  2E2E A;  2X6F A;  2L6J A;  3PS6 A;  2NXP A;  3ZPJ A;  1B89 A;  2I6H A;  2Y3A A;  4GA0 A;  4GCN A;  4ANV A;  4U0U A;  5AEN A;  1P5Q A;  4FC8 A;  3S7D A;  3APC A;  4AP2 A;  2YIN A;  4DPR A;  5G2N A;  4DLQ A;  1GW6 A;  1DVP A;  3FUE A;  4UWK A;  2PM6 A;  3ASD A;  2IQC A;  4HXI A;  2WXO A;  3FU3 A;  4FAD A;  1TEZ A;  4N2S A;  4C0E A;  3KAE A;  4PS8 A;  2J49 A;  3CSF A;  4UWF A;  1E7V A;  3ZHE A;  2WMO A;  5E76 A;  5LCW C;  2YHC A;  2LAH A;  4URK A;  4JXT A;  1JPL A;  2IOL A;  1HFA A;  4GZD A;  2NC9 A;  4N39 A;  3B7U X;  3QWP A;  2KCL A;  1HH8 A;  3FU6 A;  4TRQ A;  2V0P A;  1HE8 A;  4GA2 A;  5BT1 A;  4LRZ A;  4Y6W A;  1IHG A;  4GML A;  5ANR A;  3G2S A;  5AYW D;  3B7S A;  4FJY A;  3SD5 A;  1E90 A;  5T8I A;  3CVU A;  2L9B A;  1UJJ A;  1ELK A;  3P2B A;  4H7Y A;  3ZYM A;  3NZU A;  3CIA A;  4WWO A;  1N54 A;  2XPY A;  1HF8 A;  3UT7 A;  4LUN U;  3E4B A;  4I9C A;  2CHW A;  5KJK A;  4GZC A;  3FUM A;  5J08 A;  2IF4 A;  3CHP A;  3D9L A;  2R17 C;  2X38 A;  3CK7 A;  3PE3 A;  1UG3 A;  1Z3Y A;  2OVB A;  1EPU A;  4Q96 A;  2YHE A;  1PC2 A;  4O6F A;  1Y8M A;  1WAO 1;  2VGX B;  3FHE A;  2MHK A;  3ZFW A;  3TXN A;  5CHE E;  3TJP A;  1E7U A;  2ION A;  4ANX A;  4DLO A;  3FEY A;  4KMO A;  4PS7 A;  4I1O B;  3AS5 A;  3EDT B;  4IUL A;  4BT9 A;  1XNF A;  1KT0 A;  3CST A;  5ANL A;  5KJN A;  4G1T A;  4BSX A;  3U9W A;  3EIQ C;  4CGW A;  1OWL A;  4G11 A;  2RD0 A;  3FY4 A;  1JWG A;  3KS2 A;  4U04 A;  3PZD A;  5G55 A;  4B94 A;  4HFG A;  4L2Y A;  1E96 B;  3VTY A;  4YND A;  3QWV A;  3ZYQ A;  4A1S A;  2AVP A;  5A23 A;  3RJV A;  3ESL A;  4H7X A;  4C9B B;  3FU5 A;  3G2U A;  4D10 C;  4Q94 A;  2IU1 A;  3NZS A;  4K03 A;  3ZW3 A;  4PH4 B;  3P1U A;  4KT6 B;  4QFV A;  4DJA A;  2X3M A;  1E8W A;  3CHS A;  5D0O D;  2J09 A;  1ELW A;  2WXR A;  3QOU A;  4ME2 A;  3ZN3 A;  2GRM A;  4CEM A;  3CVX A;  4ACK A;  4EQF A;  2I9C A;  3FWV A;  3LPZ A;  3OXG A;  1W3B A;  1UW4 B;  2KAT A;  3AS4 A;  2EQX A;  5FWQ A;  5ARF A;  2DIW A;  2XRZ A;  5AJD A;  3MKQ A;  5T3R A;  4GPK A;  2XPI A;  4L2L A;  2FO7 A;  2VTB A;  3RRN B;  3JYS A;  3UPV A;  3JQ0 A;  4J6I A;  3LKU A;  4EBA G;  3ZXS A;  1E8Y A;  2LO6 A;  2VSN A;  3EIJ A;  3ENE A;  3RO2 A;  5BNW A;  2WXQ A;  5BUZ A;  4I6E A;  3G2W A;  2V5F A;  3JUI A;  4U8H A;  5FJY A;  5FQ7 A;  2A4Z A;  2V8S E;  3FUJ A;  3UMV A;  2CG3 A;  3MV3 B;  1QQE A;  3AS8 A;  1UN8 A;  3QJZ A;  2Y4T A;  2XGS A;  3L22 A;  3LJ3 A;  2FEZ A;  3HDX A;  1EYH A;  4Q69 A;  2PQR A;  4GA1 A;  3L16 A;  2LNI A;  2KCK A;  3D9M A;  4GAA A;  2KM4 A;  2WQ6 A;  2LSV A;  3L08 A;  5FQ4 A;  4AM9 A;  4AVX A;  5EDS A;  2XCC A;  4UI9 C;  4GZ3 A;  2PL2 A;  3B7R L;  4JL0 A;  3U66 A;  2WVI A;  2WXF A;  4ILI A;  4B0Z A;  1ELR A;  4KVM A;  2WPV A;  3FUD A;  4HOU A;  1EF1 C;  2VGY A;  5G04 J;  3TGO A;  2OVF A;  3MZL B;  3PH0 C;  3D9O A;  3ML9 A;  2VSO E;  4KZC A;  3Q49 B;  1FVH A;  3IKO B;  3S7F A;  3ZHE B;  3FUI A;  3GW4 A;  3LXU X;  2XHE A;  3B7T A;  3HVE A;  4A55 A;  4TV3 A;  3TL5 A;  3L17 A;  2X6J A;  3PNL B;  5FTP A;  3WXX A;  5CMY A;  1INZ A;  2V4L A;  3FTZ A;  1TJC A;  3FU0 A;  4DI4 A;  1PY1 A;  2ILR A;  4WND A;  3FUF A;  4JVS A;  4UQY A;  2KCV A;  4CDR A;  4JHR A;  3FH5 A;  4AY5 A;  1ZU2 A;  3PRZ A;  2CHZ A;  4UI9 J;  3CV0 A;  3CR3 A;  3K9I A;  1HZ4 A;  2RG8 A;  3FTX A;  1H19 A;  3CLJ A;  4KBQ A;  5T4Y A;  1HX8 A;  4J8F A;  3CGH A;  3I4R B;  4FLB A;  4MS6 A;  5JJ6 A;  5FQ6 A;  3FUL A;  2Y4U A;  5EX3 A;  1H2U A;  4BY6 A;  3ASF A;  4CGV A;  2CFU A;  3FUN A;  2X6I A;  4NAC A;  3RRU A;  3D9K A;  2NSZ A;  4HOQ A;  4K0R A;  4UQZ A;  3ASH A;  4JHJ A;  3Q4A B;  3FH8 A;  4GYO A;  4AXH A;  2IOS A;  2R5S A;  3CEQ A;  4HOR A;  4CT0 A;  2UY1 A;  3CHO A;  3TXM A;  3ZYK A;  4EZK A;  4U0S A;  4JHK A;  4KXK B;  3TG5 A;  2C0L A;  1L5J A;  3OAW A;  1H0A A;  3PVL A;  5C1D A;  3LY8 A;  2OOE A;  4I9E A;  3ASG A;  3HHM A;  1N52 A;  2I1K A;  5FZQ A;  3ONK A;  5CCL A;  3LY7 A;  5LX8 A;  1HG5 A;  3KEZ A;  4UI9 K;  2XGM A;  4RSY A;  2HM8 A;  4FHK A;  3RO3 A;  4ANU A;  4BX8 A;  3RIB A;  3QDN A;  1NA0 A;  3U64 A;  3FUH A;  4LEU A;  5ENN A;  3CVY A;  4A3V A;  3MKR A;  5M72 A;  2Q7F A;  2XGO A;  1SZA A;  4I2W A;  4EZJ A;  2YNQ A;  4WNE A;  3R7Q A;  4XX5 A;  3DPD A;  3MEK A;  2VYI A;  4G2V A;  3ONL A;  2WXH A;  3CVV A;  2IFU A;  4YVO A;  4OVU A;  2HYZ A;  4E85 A;  2XCB A;  4HLE A;  4AOF A;  4Y6C A;  4ATG A;  3SF4 A;  3LS8 A;  4MKT A;  1U3D A;  3PUK A;  5DIZ A;  1JUQ A;  2WXG A;  3ML8 A;  3LCA A;  3AU5 A;  3MKQ B;  2LSU A;  3QNK A;  3FDH A;  5AJL A;  4J0U A;  1A17 A;  3CHR A;  2VTB B;  1H2V C;  1WY6 A;  4L7T A;  4LER A;  4FUL A;  3U4T A;  4APF A;  4DI3 A;  4TUU A;  2FUL A;  4FP7 A;  4I6G A;  3CHM A;  3MX3 A;  4NUR A;  3HYM B;  3MCX A;  3QKY A;  3VLD A;  4CDN A;  5LP0 A;  3L54 A;  5FZS A;  3PDN A;  4FA6 A;  4A1G A;  4DK5 A;  4YVQ C;  4R7L A;  2M63 A;  5E75 A;  3RU0 A;  4APO A;  3OXF A;  1Z3X A;  4I1M A;  1WM5 A;  3L6A A;  2P58 C;  4I1A A;  5BW8 C;  2WXP A;  5G04 C;  3ZIM A;  1OUV A;  2WXN A;  2I2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...