5G05J

Cryo-em structure of combined apo phosphorylated apc
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 179
structure length 504
sequence length 532
chains with identical sequence K
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5g05J00
5CCLA 2I6HA 3ASGA 2VYIA 4GZ6A 4WNFA 4GYOA 5DBKA 3KAEA 3KS2A 4APOA 1NZNA 3OXLA 1ZU2A 4G26A 3SF4A 4YVQC 5G05C 2R5SA 5CHEE 4N2SA 3MKRA 4O6FA 3ZFWA 4U0SA 5CCMA 3GZ2A 3NF1A 3KD7A 3N71A 3CK8A 3ASHA 4JA9A 2VQ2A 4RG6A 3ZHEB 3ASFA 1YA0A 3CEQA 3TAXA 3UQ3A 5C1DA 2Y4UA 4KBQA 2XGSA 3Q5MA 4BWRA 3RO2A 3OXFA 4GA2A 5EX3A 1HH8A 2JLBA 5G04J 2P58C 2HR2A 3UUXA 5KJKA 4KYOB 5JJTA 4GA1A 4WNEA 2WQHA 4ABNA 2IF4A 4CGWA 3CVNA 3U4TA 5FZSA 3TG5A 1E96B 5JJ7A 2UY1B 4HORA 2VGXA 1ELWA 4UI9C 5KJMA 3EDTB 3ULQA 4AIFA 4N5CA 4UQYA 5HQ8A 4IN3B 5M72A 5FZRA 3Q47B 5D0OD 4AY6A 5KJLA 4XIFA 4J8EA 1W3BA 3CVQA 3QWWA 5G05J 3MA5A 2DBAA 5BNWA 4BT8A 3PE4A 2KC7A 2XCCA 4J8FA 4BT9A 2UWJG 3ZN3A 3ZPJA 2C0LA 2PQNA 4KXKB 4JA7A 3ZHEA 2VGYA 2LSUA 5A7DB 2LNIA 2Y4TA 4HOSA 4N3CA 4UQZA 4I17A 3GW4A 2FEZA 3OXGA 4Y6WA 4H7YA 2KCLA 4AY5A 3GYZA 1KT0A 4GZ5A 2UY1A 5FZQA 3S7FA 2C0MA 4UI9J 2OOEA 2HO1A 5AYWD 4N2QA 4G2VA 3CK9A 5LCWJ 4G24A 2KCKA 4GYYA 4I9EA 3PDNA 3RKVA 3VTYA 1QQEA 5KJNA 1IYGA 2PZIA 4A1SA 3UPVA 4YVOA 4BTBA 3MV2B 1HXIA 2PL2A 5A6CA 4EQFA 3CKCA 4GA0A 3MEKA 1TJCA 5FT9A 3FP3A 2LSVA 3RJVA 3QKYA 2Q7FA 3QDNA 4W9RA 4I2WA 3K9IA 3URZA 2XEVA 3ASDA 4UI9K 3IEGA 2NC9A 3JYSA 3GZ1A 2YQ8A 2PQRA 2FF4A 2HYZA 4GCNA 1ZBPA 3CK7A 1B89A 3QOUA 3ESKA 3TG4A 3CVLA 4UQXA 1A17A 3QWPA 4J0UA 2YHCA 2KATA 2E2EA 4GPKA 3LY8A 2MHKA 4G23A 4YNDA 5ARFA 3QWVA 2XGOA 4XI9A 3E4BA 3Q4AB 4GZ3A 5DIZA 3R9AB 2GW1A 4G25A 3MV3B 3BEEA 5EKQD 2IFUA 5BW8C 4HOUA 4HOTA 5FJYA 2XGMA 3LKUA 3LCAA 1KLXA 4I9CA 3Q49B 1XNFA 4XI0A 2FI7A 4CDRA 4N3BA 3S7BA 3LY7A 2VSNA 5ARGA 3RU0A 2BUGA 3FWVA 4N39A 3ZGQA 3PE3A 1OUVA 4NRHB 3CV0A 5D0QD 5EX0A 2FO7A 4H7XA 2QFCA 4U0ZA 3FFLA 1NA0A 3U3WA 4U0UA 4NQ0A 3SZ7A 4GYWA 2FBNA 3LY9A 3CVPA 3AS4A 3VTXA 4I1AA 4B94A 1P5QA 2XCBA 1QZ2A 4HOQA 2C2LA 2L6JA 4WNDA 4F3VA 3AS5A 4ME2A 1ELRA 3AS8A 5HI7A 1Y8MA 1FCHA 3LYAA 3RIBA 1IHGA 1WAO1 1HZ4A 4WUYA 4CGVA 1KT1A 4N3AA 4GCOA 4U04A 2V5FA 4BTAA 3S7JA 3Q15A 2VSYA 4J8DA 1NA3A 4JL0A 5LCWC 2WPVA 3WXXA 3CKBA 4WNGA 2KCVA 3RO3A 4G1TA 4LEUA 3TGOA 2J9QA 3S7DA 2ONDA 1PC2A 2AVPA 2XPIA 5G04C 4I2ZA 5JJ6A 4Y6CA 4JHRA 4U07A 3O48A 4AM9A 3HYMB 4RG9A 3LPZA 1WM5A 5BT1A 5FTPA 2VGXB
chains in the Genus database with same CATH superfamily
3I3NA 4PS8A 1LD7A 4JW1A 2I6HA 3G2VA 2GRRB 4GYOA 1TR4A 5DBKA 4Q69A 3WG7E 4ANVA 4U7EB 1NZNA 3OXLA 1K1AA 3PEVB 2R5SA 2BTDA 5CHEE 3CVXA 1E8YA 2AWIA 3GZ2A 1UN9A 2XRZA 1ELKA 2AW6A 5BV1A 3TJPA 4JA9A 1JCRA 1KZPA 3C98A 3RRNB 4LCTA 1YA0A 4DX1A 3UQ3A 2XGSA 1S70B 2V8SE 3LJ3A 4EBAG 1SVXA 3D9NA 3OXFA 4JHKA 3UMVA 1H6KA 2F8XK 2JLBA 4ANXA 3UUXA 5KJKA 5JJTA 2BEDA 2WQHA 4ABNA 3CHPA 5FZSA 4ANWA 2BF0X 3TG5A 2UY1B 3I5PA 2IONA 3UM2A 1MX6A 4JB8P 1OCRE 5KWDA 1LF8A 3SI5A 5KJMA 3EDTB 3HRAA 3UX4A 4ZFHA 4EECA 1N0RA 3FULA 4RVBA 4UQYA 1MHQA 3FEXA 4XKBA 3T9KA 1H2VC 4CCAA 3KSLA 5AARA 4J8FA 1TNZA 2UWJG 2P9NG 3ZPJA 2C0LA 3FTSA 5C2YA 1FT1A 4KXKB 4JA7A 4DRXE 2ETBA 5G2NA 1N0QA 2DIWA 3JCKC 2Y4TA 4WWPA 2GRNB 1SW6A 4FADA 4I17A 5ANLA 3OXGA 4O1OA 3ZEFA 1L5JA 2Y69E 4BFRA 2B0OE 4AY5A 3UM1A 1OWOA 3S7FA 4FLBA 5ENOD 5AYWD 1D8EA 3BU8A 1TN8A 4GYYA 4N5QA 2IJGX 4HRMB 4I9EA 4OVVA 4XKCA 3PZ1A 2R17C 3UIOC 3FUFA 3ZIMA 4DUIA 4BTBA 5EYPF 2PL2A 1SA5A 5A6CA 4EQFA 3TL5A 3CKCA 3Q73A 3ZYKA 3UT8A 2LAIA 3FP3A 1HU3A 4CZ2D 1U3DA 2P9LG 4B8CB 3PNTB 1NP7A 4I2WA 4GZCA 3K9IA 3G2WA 4LNGA 3ASDA 4UI9K 2KXPC 2QZAA 5EYLA 2R02A 4BX9A 2E0IA 2EIKE 5AQAA 2KM4A 2VJ8A 2AXVA 2HYZA 5E76A 1A5EA 5D66A 3QOUA 1NFIE 4JEUA 4OAVB 1IXVA 3MKQB 4UQXA 5ENTD 1A17A 4HRNA 4U8YD 3OAWA 4KZ0A 3V79K 2KATA 3B7BA 2MHKA 3EHQA 4TRQA 5CBNA 4TXRA 2XGOA 3MZLB 1Q2ZA 3CQGB 2J08A 2OV8A 3B7TA 2GW1A 3SHFA 3DSXA 5BV0A 3APFA 5EKQD 2LO6A 5BW8C 4HOTA 2X6HA 5JA4D 3C72A 3LKUA 4G8KA 3LCAA 1KLXA 4FU3A 4XI0A 2F37A 2WMOA 3TWTA 4L7TA 4N3BA 4FULA 2F8YA 4TUUA 4M7CA 5ARGA 5EN5D 2BUGA 1OWNA 1FT2A 3PRZA 4XE0A 1K8KG 5EX0A 4U0ZA 3J5QB 4U0UA 4GTTA 1OT8A 3SZ7A 1N95A 2MYOA 4FJZA 1MJ0A 3L13A 5EILA 2FBNA 3CVPA 2XS1A 3C3QA 1TNBA 2V4HC 4ACLA 2C2LA 1UN8A 4F3VA 3AS5A 5BXOA 4OVUA 3CHMA 3AJIA 3AS8A 5FINA 3FTXA 2WVIA 1NL4A 2DZOA 3IKOB 1NI1A 2IEJA 4L2YA 1HZ4A 1KT1A 3FTVA 1N9AA 3E33A 1SZAA 4I6EA 3IBEA 4K5AB 4MKTA 4ATZD 1DCQA 4TXPA 2VSYA 1NA3A 1YYHA 2M63A 3DWLG 5CEAA 3PREA 3AG4E 3RSEG 5CMWA 3ULEG 3PEUB 2WXFA 1KZOA 4LEUA 4BX8A 4B8AA 2J9QA 2V4LA 2EINE 1E8ZA 2HM8A 1V54E 3UXGA 4CDNA 1YMPA 1PC2A 2YINA 3HXFA 3MX3A 4HS2A 2RFMA 2A5UA 3ZU7B 4AM9A 4Q94A 4RG9A 1WM5A 5BT1A 4GTSA 3ASGA 1N4SA 2IU1A 2VYIA 3HDXA 3CVUA 1EPUA 4GTOA 3NBNB 2XRYA 1N4QA 4A63B 3KAEA 3FUIA 2ZISA 5FWQA 4A3TA 4K03A 3SF4A 4LNUD 5G05C 4O6FA 4U0SA 5CCMA 4ILIA 4DX6D 2CHXA 3EHNA 1OCZE 1H19A 1KPSB 2OVBA 2LAHA 1OXJA 1E90A 3SBSA 2WXRA 4BY6A 2VQ2A 1UW4B 4PDXA 3TWQA 2WQ6A 2WXOA 3UM3A 1X5BA 2GGFA 4B89A 1YCSB 2Y4UA 5CMYA 4UWGA 1EDUA 5J08A 2CHZA 1HH8A 4BSZB 5G04J 4I1OB 4QFVA 2WXNA 3RRUA 4GA1A 3TWXA 4WNEA 2IF4A 2RD0A 3ZYQA 4XZ4A 4CGWA 2EQXA 3P2BA 3U4TA 2PNNA 4U95D 3KEZA 3PZ4A 3T8KA 5AQ7A 2CG3A 4V3IA 2WXPA 3VLEA 4G8LA 5FZRA 2DYRE 4AY6A 3Q79A 3C5RA 4J8EA 2J4DA 1N11A 1W3BA 4C0EA 2I2OA 5AQBA 3MA5A 3APDA 2DBAA 4O1PA 3CQCB 3PVLA 5BNWA 4BT8A 4AJWA 3PE4A 3B13A 3ZN3A 3ONLA 2XEEA 5CERB 2Y1LE 3ZHEA 5HRYA 4QQIA 3VLFA 1N54A 4JC8A 2LNIA 1OY3D 1OWLA 4HOSA 4N3CA 2WMNA 3JUIA 2FEZA 4GMLA 4J7WA 2ZXWE 4H7YA 4ATGA 4KT6B 3DEOA 1KT0A 3L16A 4GZ5A 5FQ4A 2WB2A 1HFAA 2CFZA 1MX4A 2C0MA 4UI9J 4N2QA 4I43A 5ENSD 2X6KA 2F0YA 3G2TA 3PDNA 3VTYA 1QQEA 5KJNA 1IYGA 3ONKA 5H7PA 1BI7B 2EIME 4DJAA 5JMND 4LSZE 3CHRA 2LUHA 4CEMA 2EIJE 3FUDA 2FO1E 1WG0A 3RK6A 5B3SE 2Y3AA 3CHSA 3HG0D 2PM6A 2Y0BG 2Q7FA 3QDNA 4FA6A 2L6BA 3SFXA 1SA4A 3TWRA 4DPRA 3NQPA 5JHAA 2X3MA 4AV7A 4BEPA 3JYSA 5ENNA 2XS8A 4GTVA 1ZBPA 3CK7A 5FQ6A 1UOHA 3R9MA 2R05A 4DX2A 3D9LA 1Z3YA 1HE8A 3LJNA 2E2EA 4L1BA 3ZRHA 3B7UX 3QWVA 4TXQA 1Y6IA 3U64A 5AQ9A 3E4BA 2OEVA 3R9AB 2A5EA 2WXKA 3FUMA 4AP2A 3PS6A 2WXIA 3PZ3A 2ETAA 4HLEA 5LP0A 4HFGA 4UWFA 3E37A 5FQ7A 1RW2A 3P1UA 1TNOA 1UJJA 3L82A 2FI7A 2QYJA 3ESLA 4DI4A 2KZTA 2RFAA 4NACA 4OAUC 4A1GA 3SBTB 3FTUA 3FUJA 3D9PA 3SFYA 3FWVA 4N39A 3E34A 1WY6A 3T8MA 4I1MA 4YDYA 5D0QD 2FO7A 3BUAA 1EYHA 3AG2E 4H7XA 3FFLA 2NXPA 3C3RA 2L0IA 1H0AA 1MX2A 2V5QC 1MQSA 2I1KA 4HI8A 3ZXPA 1OCOE 5EDSA 2AXUA 4K5CA 4I1AA 4B94A 1P5QA 1QZ2A 4HOQA 4F53A 1IQRA 2IY0C 4L9PA 2BKGA 2R59A 2OVFA 4L2LA 2GROB 4EZKA 3FH8A 3GZSA 4C48B 3CLJA 3LYAA 4WUYA 5KCMA 3UKUG 4KVOA 4N3AA 4GCOA 3FHEA 3EUVA 4BTAA 3S7JA 3Q15A 2X6FA 2YNQA 4APFA 3WXXA 3NOGD 4DX5D 2XZTG 4IRUA 2ZU6B 3ZYLA 4OYSA 1JPLA 3SGHA 1WDYA 2WQ7A 3BG1B 3NAWA 4AOFA 1O1TA 3FU5A 3S7DA 3E30A 3CR3A 3SNXA 4FHJA 2XPIA 4Y6CA 3EU5A 4LUNU 5LX8A 3O48A 1N4PA 3LPZA 3EHRA 4CRWA 3DSUA 4F6RD 3MCXA 3IHYA 3SY2A 3FEYA 2X6IA 4WNFA 4IYPA 1UJKA 4APOA 4FHKA 4U8VD 4GPMA 4DK5A 3UTMA 4HNAD 5CECB 4YVQC 4N2SA 3MKRA 3ZFWA 3NF1A 3L22A 3DSWA 4JD2G 1SZ9A 3N71A 4F1PA 2IO2C 3ZNGA 3HVEA 3IXEA 5ENRD 2DVWA 5G55A 1IQUA 2J49A 2FULA 3TWWA 5CRUA 2QYUA 3ASFA 3SD5A 1FPPA 3CEQA 5C1DA 3MJWA 1BI8B 1QBQA 3RO2A 3V30A 2ZGDA 2JEKA 2H6FA 2P58C 1FVHA 4KYOB 2A4ZA 4U63A 3ENEA 2WM9A 5AENA 1E96B 3UIPC 3Q75A 2BKKB 5JJ7A 4HORA 1HF8A 3NZSA 4GMRA 2VGXA 4MS6A 1XGWA 4FP7A 2ETCA 3ULQA 3U66A 4AIFA 5BXUA 3Q47B 5D0OD 5LOZA 2GRPB 4XIFA 3CVQA 4AVXA 3PUKA 3QWWA 3BG0B 4DI3A 1MZCA 3JXJA 4JHJA 2R03A 5T8IA 4BT9A 3DEPA 2J4BA 4HI9A 1U2VG 4LERA 4RSYA 5ENQD 3QNKA 2LSUA 3DXMG 1BU9A 4GAAA 1TN6A 1TNUA 3GW4A 1BPOA 4HLLA 5B1AE 1FVFA 2KCLA 4F1SA 3T5XA 3CVWA 3Q7FA 2UY1A 3UM0A 5FZQA 5AJDA 4PH4B 2HO1A 4UUCA 4G2VA 1OWPA 2WXGA 3DSVA 3RKVA 3QAQA 3B7SA 4CYMD 1U3CA 4YVOA 2CG2A 3MV2B 1O5MA 3CGHA 3ABME 4GA0A 4TV3A 4Q96A 3MEKA 2ZIRA 3SO8A 2XPZA 1TJCA 5FT9A 3ZXSA 3CHOA 2LSVA 3RJVA 2IOSA 1E7VA 3EJNA 4U8HA 3PZ2A 4NURA 1TEZA 5AAOA 2XEVA 3QC1A 3APCA 2PM7A 4GZDA 5EIDA 2GRMA 2XPYA 2YQ8A 2PQRA 3GZ1A 5ITZF 1IHBA 2FF4A 3R7RA 3U9WA 4CT4A 4GCNA 5IY5E 2P9KG 1B89A 3TWUA 3ESKA 3ZW3A 1JCQA 4FLHA 3TG4A 3CVLA 3ZUVB 4XX5A 5BUZA 5T3RA 3FH5A 2WXLA 3NB2A 4P29A 2YHEA 3B95A 3FH7A 3MGBA 4J0UA 3UT4A 3PUJA 2XZDG 4GPKA 4G23A 5CEDB 1TYQG 4XI9A 3LVQE 4B0ZA 3Q4AB 2VTBA 4LG6A 1X81A 3QK0A 3KEAA 4G25A 3MV3B 2B6CA 5FQ8A 1LTXA 1TJFA 5FJYA 2MRIA 2XGMA 2ZGGA 4I9CA 3Q49B 2OEWA 2KBXA 2WXHA 4I6GA 3DXKG 4JPSA 4EPZA 4EBAA 2RG8A 3S7BA 3LVRE 3TWVA 2VSNA 5EIBE 3EU9A 4AEZC 1JCSA 3PE3A 3D9KA 1QNFA 1S63A 3MKQA 3CVYA 3FUEA 1VDYA 1D8DA 2QY7A 3IV0A 1V55E 3O4ZA 3AG3E 2P9IG 2VSXE 5A23A 4K0RA 3VTXA 2V0PA 2WXQA 4B93B 3W9FA 4DX7D 4URKA 2WXMA 1E8XA 4ME2A 1ELRA 3L17A 1AWCB 3DPDA 2XEHA 4YDOA 5HI7A 1Y8MA 3E32A 4A3VA 4ACKA 3AU5A 1DC2A 3FU0A 1FCHA 2JABA 5JHBA 5AJLA 1IHGA 4CGVA 1N4RA 4J6IA 5KNHD 3D9JA 4AXHA 3LDZA 4JL0A 4PS7A 4GTMA 1GW6A 3DRAA 1QYMA 4X8QA 3PZDA 1JUQA 4RQIA 3R7QA 1N94A 5ENPD 3Q78A 2VSOE 3TGOA 3X2QE 3TWSA 1D9SA 1S64A 3ASNE 5G04C 4PUCA 5D2MC 2L0TB 3L08A 4JHRA 2CHWA 4U07A 3L9TA 5T4YA 4Y6WA 5FTPA 3J5PA 3QJZA 3QARA 2I9CA 5CCLA 3V2XA 2QC9A 4HB5A 4GZ6A 2EILE 3KS2A 1ZU2A 3FUKA 1OCCE 4J8YA 4WAFA 4G26A 3ZVVA 2OCCE 1K1BA 1E8WA 3HXDA 1LD8A 4DLOA 3ML8A 5B1BE 3L54A 3KD7A 1N52A 3CK8A 3CSTA 3ASHA 4LNBA 3KSQA 3V31A 1HS6A 4RG6A 3ZHEB 5BPPA 3FTYA 3TXMA 2P9SG 3TAXA 1JWFA 4KBQA 3Q5MA 4BWRA 3AG1E 2J8SD 3DPYA 2VTBB 4GA2A 5EX3A 2HR2A 4KMOA 3V2OA 5HKPA 3CVNA 3AAAC 2H6HA 2DYSE 3FU3A 3I4RB 1ELWA 4UI9C 5LFAA 5CBOA 4GU5A 3T5VA 3HIZA 1DVPA 4N5CA 3TXNA 5HQ8A 3B7RL 4IN3B 4JXTA 5M72A 5KJLA 2NSZA 3HHMA 1H2UA 2XENA 5G05J 3CSFA 3ASOE 3RAUA 5J90A 5ANRA 3Q9NC 5E75A 4D10C 3HXBA 2KC7A 2XCCA 1Z5SC 2P9PG 3DBSA 1UG3A 3JUEA 1PAQA 4BESA 4A55A 4WWOA 3AU4A 1IKND 4MRUA 2PQNA 3UT7A 3UI2A 3OTNA 1JWGA 2NYJA 2VGYA 4JVSA 1AP7A 5A7DB 3Q7AA 4YDWA 2L9BA 2CFUA 4KZCA 4JZYA 5AN8A 4UQZA 5KNGA 4O60A 1H2TC 4DLQA 3I4GA 5FIOA 4GTRA 1H6OA 3GYZA 4M3OA 2IOLA 2H6IA 3LEWA 4J8SA 2H6GA 4E85A 2OOEA 3D9OA 2HE0A 3CK9A 3PNLB 3SFZA 4G24A 5LCWJ 2DWZA 2KCKA 2AXZA 1BLXB 4L23A 4UWLA 3CVVA 3UKRG 5AIJA 2PZIA 4A1SA 1Z3XA 4ZHBA 3UPVA 3FY4A 2ILRA 2AJAA 2RKKA 4LRZA 1TNYA 3D9HA 1HXIA 1Z6TA 3CHQA 4K5BA 1OWMA 3HXEA 1H6PA 3EIJA 4CT0A 3FDHA 4JEHA 1MYOA 2XHEA 4HVBA 3ABKE 3DSTA 3QKYA 4W9RA 1INZA 3JQ1A 3FUNA 3Q9UC 3URZA 3IHVA 3IEGA 2NC9A 2KZTB 1HG2A 3S2AA 4BERA 4NIKA 4YDEA 2VGEA 1HX8A 3ZKJA 3W9GA 3L6AA 2GRLA 4GTPA 3D9MA 4GTQA 1DNPA 1TN7A 4EZLA 3QWPA 3HXCA 2YHCA 1HO8A 4GMJA 4HQDA 4EZJA 4CDMA 1PY1A 3LY8A 4HRLA 4YNDA 5ARFA 2P9UG 3DSSA 3C3OA 1S0PA 3BQOA 4GZ3A 5DIZA 2J07A 2LXMA 2WXJA 3BEEA 3D3MA 2IFUA 2IO3C 3LS8A 4HOUA 1HG5A 2R2LA 4KVMA 1DCEA 3UINC 4HXIA 1XNFA 4UWHA 3RRMB 1O1SA 4CDRA 3PH0C 3LY7A 1K3ZD 4F7AA 3RU0A 3G2UA 3NOCD 3ZGQA 2X6JA 4NRHB 1OUVA 3QB2A 3CV0A 2GRQB 3ISMC 3CIAA 4TUMA 4EHMA 2QFCA 4C0MA 1NA0A 3U3WA 4E6HA 4BETA 4NQ0A 3D9IA 4GYWA 4IULA 4ANUA 2IQCA 2P2CP 4HBDA 1G3NB 3SQVA 3ABLE 3LXUX 3LY9A 2X38A 4G11A 3ZYMA 3AS4A 3FTZA 4ILHB 3MYVA 2XCBA 2I1JA 2DCPA 1ZB1A 4MBGA 2L6JA 2LXLA 4WWNA 4WNDA 4XEIG 4FJYA 1SQMA 4UWKA 3FUHA 3EHMA 3RIBA 3EIQC 4R7LA 1BD8A 3JXIA 1WAO1 4PS3A 3FTWA 4MLPA 4Z68A 4BSXA 2DZNA 4U04A 3VLDA 1E7UA 2V5FA 3NZUA 5KBAA 4C9BB 3ML9A 4J8DA 1O1RA 5LCWC 4ILGA 2WPVA 4GB9A 3ULYA 3CKBA 4WNGA 3HVEB 2KCVA 3RO3A 4G1TA 4RLYA 1RZ4A 4U96D 3JQ0A 3F6QA 4FC8A 2ONDA 2XQ0A 5CRVA 2AVPA 3FU6A 2J09A 4I2ZA 5JJ6A 2MOWA 3G2SA 4I6JA 3HYMB 5HS0A 1EF1C 2VGXB
chains in the Genus database with same CATH topology
3I3NA 4PS8A 3QARA 2I9CA 4JW1A 5CCLA 2I6HA 3MCXA 3ASGA 3IHYA 2IU1A 2VYIA 3G2VA 3HDXA 3FEYA 2X6IA 3CVUA 4GZ6A 1EPUA 4WNFA 2XRYA 4GYOA 4IYPA 5DBKA 4Q69A 3KAEA 1UJKA 3KS2A 4ANVA 4APOA 4FHKA 3FUIA 1NZNA 3OXLA 1ZU2A 4DK5A 3FUKA 5FWQA 4A3TA 4K03A 4WAFA 3PEVB 4G26A 3ZVVA 3SF4A 4YVQC 5G05C 2R5SA 2BTDA 5CHEE 3CVXA 4N2SA 1E8YA 3MKRA 4O6FA 3ZFWA 2AWIA 4U0SA 3GZ2A 1E8WA 4ILIA 4DLOA 5CCMA 2CHXA 3EHNA 3L22A 3L54A 3ML8A 3NF1A 1SZ9A 1N52A 1H19A 3CK8A 3KD7A 3N71A 1UN9A 2OVBA 3CSTA 2XRZA 1ELKA 2AW6A 2LAHA 5BV1A 3ASHA 3TJPA 3HVEA 4JA9A 1E90A 5G55A 3SBSA 1IQUA 3C98A 2J49A 2WXRA 1HS6A 3RRNB 2VQ2A 4BY6A 1UW4B 2FULA 4PDXA 4RG6A 3ZHEB 2WQ6A 2WXOA 5BPPA 3ASFA 1X5BA 3FTYA 3TXMA 4LCTA 3SD5A 1YA0A 2GGFA 3CEQA 4B89A 3TAXA 3UQ3A 1JWFA 5C1DA 2Y4UA 3MJWA 5CMYA 4KBQA 2XGSA 3Q5MA 4UWGA 1EDUA 2V8SE 3LJ3A 4EBAG 4BWRA 5J08A 3RO2A 3D9NA 3OXFA 4JHKA 3UMVA 1H6KA 2VTBB 2JEKA 4GA2A 5EX3A 2CHZA 1HH8A 2JLBA 5G04J 2P58C 1FVHA 2HR2A 4I1OB 4KMOA 4QFVA 3UUXA 4ANXA 2WXNA 4KYOB 3RRUA 4GA1A 5JJTA 5KJKA 2A4ZA 4WNEA 2WQHA 4ABNA 2IF4A 2RD0A 3ZYQA 4U63A 4XZ4A 3CHPA 4CGWA 3ENEA 3CVNA 2EQXA 3P2BA 3U4TA 5FZSA 4ANWA 2BF0X 2WM9A 3TG5A 1E96B 5AENA 3KEZA 5JJ7A 2UY1B 4HORA 1HF8A 3I5PA 2IONA 3NZSA 2VGXA 3FU3A 3I4RB 1ELWA 4MS6A 2CG3A 1LF8A 4UI9C 3SI5A 5LFAA 1XGWA 5KJMA 4FP7A 3EDTB 3ULQA 3U66A 3UX4A 4GU5A 4V3IA 3HIZA 4EECA 3T5VA 2WXPA 4AIFA 1DVPA 3FULA 3VLEA 4N5CA 4RVBA 4UQYA 3TXNA 5HQ8A 3B7RL 4IN3B 4JXTA 5M72A 1MHQA 3Q47B 5D0OD 3FEXA 5FZRA 4AY6A 4XKBA 5LOZA 5KJLA 4XIFA 2NSZA 4J8EA 3HHMA 4CGVA 2J4DA 1W3BA 3CVQA 3RIBA 4AVXA 4C0EA 3PUKA 2I2OA 1H2UA 3QWWA 5G05J 3CSFA 1H2VC 3APDA 3BG0B 3MA5A 4CCAA 4DI3A 2DBAA 3CQCB 5J90A 4JHJA 5ANRA 3PVLA 5T8IA 5BNWA 4BT8A 5E75A 4AJWA 4D10C 3PE4A 3B13A 2KC7A 2XCCA 4J8FA 4BT9A 2UWJG 1UG3A 2J4BA 1PAQA 3DBSA 3ZN3A 4WWOA 4A55A 3AU4A 4MRUA 3ONLA 3ZPJA 2C0LA 3FTSA 4LERA 2PQNA 5C2YA 3UT7A 4KXKB 4RSYA 4JA7A 3OTNA 3ZHEA 1JWGA 2VGYA 4JVSA 3VLFA 3QNKA 5G2NA 2LSUA 1N54A 2DIWA 3JCKC 5A7DB 4JC8A 2LNIA 4GAAA 2L9BA 1OWLA 2Y4TA 2CFUA 4HOSA 4KZCA 4WWPA 4JZYA 4N3CA 2WMNA 4UQZA 4FADA 4I17A 1H2TC 3GW4A 2FEZA 3JUIA 5ANLA 3OXGA 1BPOA 3ZEFA 1L5JA 4GMLA 4DLQA 4H7YA 4ATGA 4KT6B 4BFRA 3I4GA 1FVFA 2KCLA 4F1SA 3T5XA 4AY5A 3CVWA 3GYZA 1KT0A 4M3OA 3L16A 4GZ5A 5FQ4A 2IOLA 2UY1A 3LEWA 4J8SA 2WB2A 1HFAA 1OWOA 2CFZA 5FZQA 4FLBA 3S7FA 5AJDA 4E85A 2C0MA 4UI9J 2OOEA 3D9OA 4PH4B 2HO1A 5AYWD 4N2QA 4I43A 4G2VA 3CK9A 2X6KA 3PNLB 1OWPA 4G24A 3SFZA 5LCWJ 2KCKA 4GYYA 2WXGA 2AXZA 2IJGX 3G2TA 4L23A 4UWLA 4I9EA 3CVVA 3PDNA 4OVVA 4XKCA 1QQEA 3RKVA 3VTYA 5AIJA 3QAQA 5KJNA 2PZIA 4A1SA 1IYGA 1Z3XA 3ONKA 3UPVA 2R17C 2ILRA 3FY4A 3B7SA 4DJAA 3FUFA 1U3CA 3ZIMA 4YVOA 4BTBA 2CG2A 3MV2B 4LRZA 3CHRA 1HXIA 2PL2A 3CGHA 4CEMA 5A6CA 3FUDA 1Z6TA 4EQFA 3TL5A 3CKCA 3CHQA 4GA0A 4TV3A 4Q96A 3MEKA 1OWMA 2XPZA 3EIJA 3ZYKA 4CT0A 3FDHA 3RK6A 1TJCA 4JEHA 2Y3AA 3CHSA 3UT8A 2LAIA 5FT9A 3FP3A 3ZXSA 3CHOA 2LSVA 2PM6A 2XHEA 3RJVA 1HU3A 2IOSA 4HVBA 1E7VA 3QKYA 1U3DA 2Q7FA 3QDNA 4W9RA 1INZA 4FA6A 4B8CB 3PNTB 1NP7A 3EJNA 4I2WA 4U8HA 3JQ1A 4NURA 3FUNA 1TEZA 4GZCA 4DPRA 3K9IA 3NQPA 3URZA 3IHVA 3G2WA 2XEVA 3ASDA 4UI9K 3QC1A 3IEGA 5JHAA 3APCA 2X3MA 2NC9A 2PM7A 4AV7A 4GZDA 4BX9A 2E0IA 3JYSA 2KZTB 5ENNA 1HG2A 2GRMA 2XPYA 2YQ8A 2PQRA 3GZ1A 2KM4A 2FF4A 2VJ8A 2AXVA 3R7RA 3S2AA 2HYZA 5E76A 3U9WA 4CT4A 4GCNA 1HX8A 1ZBPA 3CK7A 1B89A 3QOUA 3L6AA 2GRLA 3ESKA 4JEUA 3ZW3A 5FQ6A 3MKQB 3D9MA 4FLHA 3TG4A 3CVLA 4UQXA 4XX5A 3D9LA 5BUZA 5T3RA 1A17A 1Z3YA 1DNPA 3FH5A 2WXLA 4P29A 4EZLA 2YHEA 3QWPA 1HE8A 3OAWA 4KZ0A 3FH7A 3MGBA 4J0UA 2YHCA 3UT4A 1HO8A 4GMJA 2KATA 4EZJA 4CDMA 2E2EA 1PY1A 3PUJA 4L1BA 3LY8A 4GPKA 2MHKA 3ZRHA 4TRQA 4G23A 4YNDA 5ARFA 3B7UX 3QWVA 2XGOA 3MZLB 1Y6IA 1S0PA 4XI9A 3U64A 3LVQE 3E4BA 3CQGB 4B0ZA 3Q4AB 2J08A 2OV8A 4GZ3A 2VTBA 5DIZA 2J07A 3B7TA 3QK0A 3R9AB 2GW1A 2WXKA 2WXJA 4G25A 3SHFA 3FUMA 3MV3B 5FQ8A 4AP2A 5BV0A 3BEEA 3APFA 5EKQD 2LO6A 3D3MA 2WXIA 3PS6A 2IFUA 3LS8A 5BW8C 4HOUA 4HOTA 1HG5A 1TJFA 2X6HA 4KVMA 4HLEA 5FJYA 2MRIA 5LP0A 2XGMA 3LKUA 4HFGA 3LCAA 4UWFA 1KLXA 5FQ7A 4FU3A 4HXIA 4I9CA 3Q49B 1XNFA 4UWHA 4XI0A 3RRMB 2WXHA 3P1UA 1UJJA 2FI7A 4I6GA 4JPSA 3ESLA 4CDRA 4EPZA 2WMOA 5FTPA 4EBAA 2RG8A 4DI4A 2KZTA 4NACA 4L7TA 4A1GA 4N3BA 4FULA 3LVRE 3S7BA 3SBTB 3FTUA 4TUUA 3FUJA 3PH0C 3LY7A 2VSNA 5ARGA 3D9PA 4F7AA 3RU0A 4AEZC 2BUGA 3FWVA 1OWNA 4N39A 3G2UA 1WY6A 3ZGQA 2X6JA 3PE3A 1OUVA 3PRZA 4NRHB 3QB2A 3T8MA 4I1MA 3CV0A 4XE0A 5D0QD 3D9KA 1QNFA 5EX0A 2FO7A 3CIAA 1EYHA 4H7XA 2QFCA 3MKQA 3FFLA 4U0ZA 4C0MA 3CVYA 2NXPA 2L0IA 1NA0A 3FUEA 4E6HA 1H0AA 1VDYA 4U0UA 3U3WA 4NQ0A 3SZ7A 2QY7A 3D9IA 3IV0A 4GYWA 4IULA 4ANUA 4FJZA 3O4ZA 2IQCA 1MQSA 2I1KA 3L13A 3LXUX 2FBNA 2VSXE 3LY9A 5A23A 2X38A 4G11A 3CVPA 2AXUA 3ZYMA 3AS4A 4K0RA 5EDSA 3VTXA 3FTZA 4I1AA 4ILHB 4B94A 1P5QA 2V0PA 3MYVA 2XCBA 1QZ2A 2WXQA 4HOQA 2I1JA 4F53A 2DCPA 1IQRA 2C2LA 4ACLA 4URKA 1UN8A 2L6JA 2WXMA 1E8XA 4WWNA 4WNDA 4F3VA 3AS5A 4ME2A 1ELRA 2R59A 4OVUA 3CHMA 3L17A 3AS8A 2OVFA 3DPDA 4L2LA 4EZKA 5HI7A 1Y8MA 4FJYA 1SQMA 4A3VA 4UWKA 4ACKA 3AU5A 3FTXA 3FUHA 3FU0A 3FH8A 3GZSA 1FCHA 2WVIA 3CLJA 5JHBA 3EHMA 3IKOB 3EIQC 3LYAA 1IHGA 4R7LA 4L2YA 1WAO1 4PS3A 3FTWA 1HZ4A 4MLPA 4WUYA 5AJLA 1KT1A 5KCMA 3FTVA 4KVOA 4N3AA 1SZAA 4BSXA 4I6EA 3IBEA 4GCOA 4J6IA 4U04A 3FHEA 3VLDA 1E7UA 2V5FA 4MKTA 3D9JA 3NZUA 4AXHA 4BTAA 3S7JA 4C9BB 3Q15A 2VSYA 3LDZA 3ML9A 1NA3A 4J8DA 4JL0A 5LCWC 4ILGA 2M63A 2X6FA 2WPVA 2YNQA 4GB9A 4PS7A 3WXXA 1GW6A 3CKBA 4APFA 4WNGA 4IRUA 3PREA 3HVEB 2ZU6B 2KCVA 3RO3A 3ZYLA 4OYSA 4G1TA 1JPLA 5CMWA 3PZDA 3SGHA 1JUQA 3PEUB 2WXFA 2WQ7A 3R7QA 4LEUA 3JQ0A 4BX8A 3BG1B 4AOFA 2VSOE 3TGOA 4B8AA 2J9QA 3FU5A 4FC8A 2V4LA 3S7DA 1E8ZA 2HM8A 3CR3A 2ONDA 4CDNA 3SNXA 2XQ0A 1PC2A 2AVPA 2YINA 2XPIA 3MX3A 4FHJA 3FU6A 5G04C 2J09A 4HS2A 4PUCA 4I2ZA 5JJ6A 2MOWA 2L0TB 4Y6CA 3L08A 4LUNU 3G2SA 4JHRA 2A5UA 2CHWA 4U07A 4I6JA 5LX8A 3O48A 4AM9A 5T4YA 4Q94A 3HYMB 4RG9A 3LPZA 1WM5A 4CRWA 5BT1A 1EF1C 4Y6WA 3QJZA 2VGXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCL A;  2I6H A;  3ASG A;  2VYI A;  4GZ6 A;  4WNF A;  4GYO A;  5DBK A;  3KAE A;  3KS2 A;  4APO A;  1NZN A;  3OXL A;  1ZU2 A;  4G26 A;  3SF4 A;  4YVQ C;  5G05 C;  2R5S A;  5CHE E;  4N2S A;  3MKR A;  4O6F A;  3ZFW A;  4U0S A;  5CCM A;  3GZ2 A;  3NF1 A;  3KD7 A;  3N71 A;  3CK8 A;  3ASH A;  4JA9 A;  2VQ2 A;  4RG6 A;  3ZHE B;  3ASF A;  1YA0 A;  3CEQ A;  3TAX A;  3UQ3 A;  5C1D A;  2Y4U A;  4KBQ A;  2XGS A;  3Q5M A;  4BWR A;  3RO2 A;  3OXF A;  4GA2 A;  5EX3 A;  1HH8 A;  2JLB A;  5G04 J;  2P58 C;  2HR2 A;  3UUX A;  5KJK A;  4KYO B;  5JJT A;  4GA1 A;  4WNE A;  2WQH A;  4ABN A;  2IF4 A;  4CGW A;  3CVN A;  3U4T A;  5FZS A;  3TG5 A;  1E96 B;  5JJ7 A;  2UY1 B;  4HOR A;  2VGX A;  1ELW A;  4UI9 C;  5KJM A;  3EDT B;  3ULQ A;  4AIF A;  4N5C A;  4UQY A;  5HQ8 A;  4IN3 B;  5M72 A;  5FZR A;  3Q47 B;  5D0O D;  4AY6 A;  5KJL A;  4XIF A;  4J8E A;  1W3B A;  3CVQ A;  3QWW A;  5G05 J;  3MA5 A;  2DBA A;  5BNW A;  4BT8 A;  3PE4 A;  2KC7 A;  2XCC A;  4J8F A;  4BT9 A;  2UWJ G;  3ZN3 A;  3ZPJ A;  2C0L A;  2PQN A;  4KXK B;  4JA7 A;  3ZHE A;  2VGY A;  2LSU A;  5A7D B;  2LNI A;  2Y4T A;  4HOS A;  4N3C A;  4UQZ A;  4I17 A;  3GW4 A;  2FEZ A;  3OXG A;  4Y6W A;  4H7Y A;  2KCL A;  4AY5 A;  3GYZ A;  1KT0 A;  4GZ5 A;  2UY1 A;  5FZQ A;  3S7F A;  2C0M A;  4UI9 J;  2OOE A;  2HO1 A;  5AYW D;  4N2Q A;  4G2V A;  3CK9 A;  5LCW J;  4G24 A;  2KCK A;  4GYY A;  4I9E A;  3PDN A;  3RKV A;  3VTY A;  1QQE A;  5KJN A;  1IYG A;  2PZI A;  4A1S A;  3UPV A;  4YVO A;  4BTB A;  3MV2 B;  1HXI A;  2PL2 A;  5A6C A;  4EQF A;  3CKC A;  4GA0 A;  3MEK A;  1TJC A;  5FT9 A;  3FP3 A;  2LSV A;  3RJV A;  3QKY A;  2Q7F A;  3QDN A;  4W9R A;  4I2W A;  3K9I A;  3URZ A;  2XEV A;  3ASD A;  4UI9 K;  3IEG A;  2NC9 A;  3JYS A;  3GZ1 A;  2YQ8 A;  2PQR A;  2FF4 A;  2HYZ A;  4GCN A;  1ZBP A;  3CK7 A;  1B89 A;  3QOU A;  3ESK A;  3TG4 A;  3CVL A;  4UQX A;  1A17 A;  3QWP A;  4J0U A;  2YHC A;  2KAT A;  2E2E A;  4GPK A;  3LY8 A;  2MHK A;  4G23 A;  4YND A;  5ARF A;  3QWV A;  2XGO A;  4XI9 A;  3E4B A;  3Q4A B;  4GZ3 A;  5DIZ A;  3R9A B;  2GW1 A;  4G25 A;  3MV3 B;  3BEE A;  5EKQ D;  2IFU A;  5BW8 C;  4HOU A;  4HOT A;  5FJY A;  2XGM A;  3LKU A;  3LCA A;  1KLX A;  4I9C A;  3Q49 B;  1XNF A;  4XI0 A;  2FI7 A;  4CDR A;  4N3B A;  3S7B A;  3LY7 A;  2VSN A;  5ARG A;  3RU0 A;  2BUG A;  3FWV A;  4N39 A;  3ZGQ A;  3PE3 A;  1OUV A;  4NRH B;  3CV0 A;  5D0Q D;  5EX0 A;  2FO7 A;  4H7X A;  2QFC A;  4U0Z A;  3FFL A;  1NA0 A;  3U3W A;  4U0U A;  4NQ0 A;  3SZ7 A;  4GYW A;  2FBN A;  3LY9 A;  3CVP A;  3AS4 A;  3VTX A;  4I1A A;  4B94 A;  1P5Q A;  2XCB A;  1QZ2 A;  4HOQ A;  2C2L A;  2L6J A;  4WND A;  4F3V A;  3AS5 A;  4ME2 A;  1ELR A;  3AS8 A;  5HI7 A;  1Y8M A;  1FCH A;  3LYA A;  3RIB A;  1IHG A;  1WAO 1;  1HZ4 A;  4WUY A;  4CGV A;  1KT1 A;  4N3A A;  4GCO A;  4U04 A;  2V5F A;  4BTA A;  3S7J A;  3Q15 A;  2VSY A;  4J8D A;  1NA3 A;  4JL0 A;  5LCW C;  2WPV A;  3WXX A;  3CKB A;  4WNG A;  2KCV A;  3RO3 A;  4G1T A;  4LEU A;  3TGO A;  2J9Q A;  3S7D A;  2OND A;  1PC2 A;  2AVP A;  2XPI A;  5G04 C;  4I2Z A;  5JJ6 A;  4Y6C A;  4JHR A;  4U07 A;  3O48 A;  4AM9 A;  3HYM B;  4RG9 A;  3LPZ A;  1WM5 A;  5BT1 A;  5FTP A;  2VGX B; 
#chains in the Genus database with same CATH topology
 3I3N A;  4PS8 A;  1LD7 A;  4JW1 A;  2I6H A;  3G2V A;  2GRR B;  4GYO A;  1TR4 A;  5DBK A;  4Q69 A;  3WG7 E;  4ANV A;  4U7E B;  1NZN A;  3OXL A;  1K1A A;  3PEV B;  2R5S A;  2BTD A;  5CHE E;  3CVX A;  1E8Y A;  2AWI A;  3GZ2 A;  1UN9 A;  2XRZ A;  1ELK A;  2AW6 A;  5BV1 A;  3TJP A;  4JA9 A;  1JCR A;  1KZP A;  3C98 A;  3RRN B;  4LCT A;  1YA0 A;  4DX1 A;  3UQ3 A;  2XGS A;  1S70 B;  2V8S E;  3LJ3 A;  4EBA G;  1SVX A;  3D9N A;  3OXF A;  4JHK A;  3UMV A;  1H6K A;  2F8X K;  2JLB A;  4ANX A;  3UUX A;  5KJK A;  5JJT A;  2BED A;  2WQH A;  4ABN A;  3CHP A;  5FZS A;  4ANW A;  2BF0 X;  3TG5 A;  2UY1 B;  3I5P A;  2ION A;  3UM2 A;  1MX6 A;  4JB8 P;  1OCR E;  5KWD A;  1LF8 A;  3SI5 A;  5KJM A;  3EDT B;  3HRA A;  3UX4 A;  4ZFH A;  4EEC A;  1N0R A;  3FUL A;  4RVB A;  4UQY A;  1MHQ A;  3FEX A;  4XKB A;  3T9K A;  1H2V C;  4CCA A;  3KSL A;  5AAR A;  4J8F A;  1TNZ A;  2UWJ G;  2P9N G;  3ZPJ A;  2C0L A;  3FTS A;  5C2Y A;  1FT1 A;  4KXK B;  4JA7 A;  4DRX E;  2ETB A;  5G2N A;  1N0Q A;  2DIW A;  3JCK C;  2Y4T A;  4WWP A;  2GRN B;  1SW6 A;  4FAD A;  4I17 A;  5ANL A;  3OXG A;  4O1O A;  3ZEF A;  1L5J A;  2Y69 E;  4BFR A;  2B0O E;  4AY5 A;  3UM1 A;  1OWO A;  3S7F A;  4FLB A;  5ENO D;  5AYW D;  1D8E A;  3BU8 A;  1TN8 A;  4GYY A;  4N5Q A;  2IJG X;  4HRM B;  4I9E A;  4OVV A;  4XKC A;  3PZ1 A;  2R17 C;  3UIO C;  3FUF A;  3ZIM A;  4DUI A;  4BTB A;  5EYP F;  2PL2 A;  1SA5 A;  5A6C A;  4EQF A;  3TL5 A;  3CKC A;  3Q73 A;  3ZYK A;  3UT8 A;  2LAI A;  3FP3 A;  1HU3 A;  4CZ2 D;  1U3D A;  2P9L G;  4B8C B;  3PNT B;  1NP7 A;  4I2W A;  4GZC A;  3K9I A;  3G2W A;  4LNG A;  3ASD A;  4UI9 K;  2KXP C;  2QZA A;  5EYL A;  2R02 A;  4BX9 A;  2E0I A;  2EIK E;  5AQA A;  2KM4 A;  2VJ8 A;  2AXV A;  2HYZ A;  5E76 A;  1A5E A;  5D66 A;  3QOU A;  1NFI E;  4JEU A;  4OAV B;  1IXV A;  3MKQ B;  4UQX A;  5ENT D;  1A17 A;  4HRN A;  4U8Y D;  3OAW A;  4KZ0 A;  3V79 K;  2KAT A;  3B7B A;  2MHK A;  3EHQ A;  4TRQ A;  5CBN A;  4TXR A;  2XGO A;  3MZL B;  1Q2Z A;  3CQG B;  2J08 A;  2OV8 A;  3B7T A;  2GW1 A;  3SHF A;  3DSX A;  5BV0 A;  3APF A;  5EKQ D;  2LO6 A;  5BW8 C;  4HOT A;  2X6H A;  5JA4 D;  3C72 A;  3LKU A;  4G8K A;  3LCA A;  1KLX A;  4FU3 A;  4XI0 A;  2F37 A;  2WMO A;  3TWT A;  4L7T A;  4N3B A;  4FUL A;  2F8Y A;  4TUU A;  4M7C A;  5ARG A;  5EN5 D;  2BUG A;  1OWN A;  1FT2 A;  3PRZ A;  4XE0 A;  1K8K G;  5EX0 A;  4U0Z A;  3J5Q B;  4U0U A;  4GTT A;  1OT8 A;  3SZ7 A;  1N95 A;  2MYO A;  4FJZ A;  1MJ0 A;  3L13 A;  5EIL A;  2FBN A;  3CVP A;  2XS1 A;  3C3Q A;  1TNB A;  2V4H C;  4ACL A;  2C2L A;  1UN8 A;  4F3V A;  3AS5 A;  5BXO A;  4OVU A;  3CHM A;  3AJI A;  3AS8 A;  5FIN A;  3FTX A;  2WVI A;  1NL4 A;  2DZO A;  3IKO B;  1NI1 A;  2IEJ A;  4L2Y A;  1HZ4 A;  1KT1 A;  3FTV A;  1N9A A;  3E33 A;  1SZA A;  4I6E A;  3IBE A;  4K5A B;  4MKT A;  4ATZ D;  1DCQ A;  4TXP A;  2VSY A;  1NA3 A;  1YYH A;  2M63 A;  3DWL G;  5CEA A;  3PRE A;  3AG4 E;  3RSE G;  5CMW A;  3ULE G;  3PEU B;  2WXF A;  1KZO A;  4LEU A;  4BX8 A;  4B8A A;  2J9Q A;  2V4L A;  2EIN E;  1E8Z A;  2HM8 A;  1V54 E;  3UXG A;  4CDN A;  1YMP A;  1PC2 A;  2YIN A;  3HXF A;  3MX3 A;  4HS2 A;  2RFM A;  2A5U A;  3ZU7 B;  4AM9 A;  4Q94 A;  4RG9 A;  1WM5 A;  5BT1 A;  4GTS A;  3ASG A;  1N4S A;  2IU1 A;  2VYI A;  3HDX A;  3CVU A;  1EPU A;  4GTO A;  3NBN B;  2XRY A;  1N4Q A;  4A63 B;  3KAE A;  3FUI A;  2ZIS A;  5FWQ A;  4A3T A;  4K03 A;  3SF4 A;  4LNU D;  5G05 C;  4O6F A;  4U0S A;  5CCM A;  4ILI A;  4DX6 D;  2CHX A;  3EHN A;  1OCZ E;  1H19 A;  1KPS B;  2OVB A;  2LAH A;  1OXJ A;  1E90 A;  3SBS A;  2WXR A;  4BY6 A;  2VQ2 A;  1UW4 B;  4PDX A;  3TWQ A;  2WQ6 A;  2WXO A;  3UM3 A;  1X5B A;  2GGF A;  4B89 A;  1YCS B;  2Y4U A;  5CMY A;  4UWG A;  1EDU A;  5J08 A;  2CHZ A;  1HH8 A;  4BSZ B;  5G04 J;  4I1O B;  4QFV A;  2WXN A;  3RRU A;  4GA1 A;  3TWX A;  4WNE A;  2IF4 A;  2RD0 A;  3ZYQ A;  4XZ4 A;  4CGW A;  2EQX A;  3P2B A;  3U4T A;  2PNN A;  4U95 D;  3KEZ A;  3PZ4 A;  3T8K A;  5AQ7 A;  2CG3 A;  4V3I A;  2WXP A;  3VLE A;  4G8L A;  5FZR A;  2DYR E;  4AY6 A;  3Q79 A;  3C5R A;  4J8E A;  2J4D A;  1N11 A;  1W3B A;  4C0E A;  2I2O A;  5AQB A;  3MA5 A;  3APD A;  2DBA A;  4O1P A;  3CQC B;  3PVL A;  5BNW A;  4BT8 A;  4AJW A;  3PE4 A;  3B13 A;  3ZN3 A;  3ONL A;  2XEE A;  5CER B;  2Y1L E;  3ZHE A;  5HRY A;  4QQI A;  3VLF A;  1N54 A;  4JC8 A;  2LNI A;  1OY3 D;  1OWL A;  4HOS A;  4N3C A;  2WMN A;  3JUI A;  2FEZ A;  4GML A;  4J7W A;  2ZXW E;  4H7Y A;  4ATG A;  4KT6 B;  3DEO A;  1KT0 A;  3L16 A;  4GZ5 A;  5FQ4 A;  2WB2 A;  1HFA A;  2CFZ A;  1MX4 A;  2C0M A;  4UI9 J;  4N2Q A;  4I43 A;  5ENS D;  2X6K A;  2F0Y A;  3G2T A;  3PDN A;  3VTY A;  1QQE A;  5KJN A;  1IYG A;  3ONK A;  5H7P A;  1BI7 B;  2EIM E;  4DJA A;  5JMN D;  4LSZ E;  3CHR A;  2LUH A;  4CEM A;  2EIJ E;  3FUD A;  2FO1 E;  1WG0 A;  3RK6 A;  5B3S E;  2Y3A A;  3CHS A;  3HG0 D;  2PM6 A;  2Y0B G;  2Q7F A;  3QDN A;  4FA6 A;  2L6B A;  3SFX A;  1SA4 A;  3TWR A;  4DPR A;  3NQP A;  5JHA A;  2X3M A;  4AV7 A;  4BEP A;  3JYS A;  5ENN A;  2XS8 A;  4GTV A;  1ZBP A;  3CK7 A;  5FQ6 A;  1UOH A;  3R9M A;  2R05 A;  4DX2 A;  3D9L A;  1Z3Y A;  1HE8 A;  3LJN A;  2E2E A;  4L1B A;  3ZRH A;  3B7U X;  3QWV A;  4TXQ A;  1Y6I A;  3U64 A;  5AQ9 A;  3E4B A;  2OEV A;  3R9A B;  2A5E A;  2WXK A;  3FUM A;  4AP2 A;  3PS6 A;  2WXI A;  3PZ3 A;  2ETA A;  4HLE A;  5LP0 A;  4HFG A;  4UWF A;  3E37 A;  5FQ7 A;  1RW2 A;  3P1U A;  1TNO A;  1UJJ A;  3L82 A;  2FI7 A;  2QYJ A;  3ESL A;  4DI4 A;  2KZT A;  2RFA A;  4NAC A;  4OAU C;  4A1G A;  3SBT B;  3FTU A;  3FUJ A;  3D9P A;  3SFY A;  3FWV A;  4N39 A;  3E34 A;  1WY6 A;  3T8M A;  4I1M A;  4YDY A;  5D0Q D;  2FO7 A;  3BUA A;  1EYH A;  3AG2 E;  4H7X A;  3FFL A;  2NXP A;  3C3R A;  2L0I A;  1H0A A;  1MX2 A;  2V5Q C;  1MQS A;  2I1K A;  4HI8 A;  3ZXP A;  1OCO E;  5EDS A;  2AXU A;  4K5C A;  4I1A A;  4B94 A;  1P5Q A;  1QZ2 A;  4HOQ A;  4F53 A;  1IQR A;  2IY0 C;  4L9P A;  2BKG A;  2R59 A;  2OVF A;  4L2L A;  2GRO B;  4EZK A;  3FH8 A;  3GZS A;  4C48 B;  3CLJ A;  3LYA A;  4WUY A;  5KCM A;  3UKU G;  4KVO A;  4N3A A;  4GCO A;  3FHE A;  3EUV A;  4BTA A;  3S7J A;  3Q15 A;  2X6F A;  2YNQ A;  4APF A;  3WXX A;  3NOG D;  4DX5 D;  2XZT G;  4IRU A;  2ZU6 B;  3ZYL A;  4OYS A;  1JPL A;  3SGH A;  1WDY A;  2WQ7 A;  3BG1 B;  3NAW A;  4AOF A;  1O1T A;  3FU5 A;  3S7D A;  3E30 A;  3CR3 A;  3SNX A;  4FHJ A;  2XPI A;  4Y6C A;  3EU5 A;  4LUN U;  5LX8 A;  3O48 A;  1N4P A;  3LPZ A;  3EHR A;  4CRW A;  3DSU A;  4F6R D;  3MCX A;  3IHY A;  3SY2 A;  3FEY A;  2X6I A;  4WNF A;  4IYP A;  1UJK A;  4APO A;  4FHK A;  4U8V D;  4GPM A;  4DK5 A;  3UTM A;  4HNA D;  5CEC B;  4YVQ C;  4N2S A;  3MKR A;  3ZFW A;  3NF1 A;  3L22 A;  3DSW A;  4JD2 G;  1SZ9 A;  3N71 A;  4F1P A;  2IO2 C;  3ZNG A;  3HVE A;  3IXE A;  5ENR D;  2DVW A;  5G55 A;  1IQU A;  2J49 A;  2FUL A;  3TWW A;  5CRU A;  2QYU A;  3ASF A;  3SD5 A;  1FPP A;  3CEQ A;  5C1D A;  3MJW A;  1BI8 B;  1QBQ A;  3RO2 A;  3V30 A;  2ZGD A;  2JEK A;  2H6F A;  2P58 C;  1FVH A;  4KYO B;  2A4Z A;  4U63 A;  3ENE A;  2WM9 A;  5AEN A;  1E96 B;  3UIP C;  3Q75 A;  2BKK B;  5JJ7 A;  4HOR A;  1HF8 A;  3NZS A;  4GMR A;  2VGX A;  4MS6 A;  1XGW A;  4FP7 A;  2ETC A;  3ULQ A;  3U66 A;  4AIF A;  5BXU A;  3Q47 B;  5D0O D;  5LOZ A;  2GRP B;  4XIF A;  3CVQ A;  4AVX A;  3PUK A;  3QWW A;  3BG0 B;  4DI3 A;  1MZC A;  3JXJ A;  4JHJ A;  2R03 A;  5T8I A;  4BT9 A;  3DEP A;  2J4B A;  4HI9 A;  1U2V G;  4LER A;  4RSY A;  5ENQ D;  3QNK A;  2LSU A;  3DXM G;  1BU9 A;  4GAA A;  1TN6 A;  1TNU A;  3GW4 A;  1BPO A;  4HLL A;  5B1A E;  1FVF A;  2KCL A;  4F1S A;  3T5X A;  3CVW A;  3Q7F A;  2UY1 A;  3UM0 A;  5FZQ A;  5AJD A;  4PH4 B;  2HO1 A;  4UUC A;  4G2V A;  1OWP A;  2WXG A;  3DSV A;  3RKV A;  3QAQ A;  3B7S A;  4CYM D;  1U3C A;  4YVO A;  2CG2 A;  3MV2 B;  1O5M A;  3CGH A;  3ABM E;  4GA0 A;  4TV3 A;  4Q96 A;  3MEK A;  2ZIR A;  3SO8 A;  2XPZ A;  1TJC A;  5FT9 A;  3ZXS A;  3CHO A;  2LSV A;  3RJV A;  2IOS A;  1E7V A;  3EJN A;  4U8H A;  3PZ2 A;  4NUR A;  1TEZ A;  5AAO A;  2XEV A;  3QC1 A;  3APC A;  2PM7 A;  4GZD A;  5EID A;  2GRM A;  2XPY A;  2YQ8 A;  2PQR A;  3GZ1 A;  5ITZ F;  1IHB A;  2FF4 A;  3R7R A;  3U9W A;  4CT4 A;  4GCN A;  5IY5 E;  2P9K G;  1B89 A;  3TWU A;  3ESK A;  3ZW3 A;  1JCQ A;  4FLH A;  3TG4 A;  3CVL A;  3ZUV B;  4XX5 A;  5BUZ A;  5T3R A;  3FH5 A;  2WXL A;  3NB2 A;  4P29 A;  2YHE A;  3B95 A;  3FH7 A;  3MGB A;  4J0U A;  3UT4 A;  3PUJ A;  2XZD G;  4GPK A;  4G23 A;  5CED B;  1TYQ G;  4XI9 A;  3LVQ E;  4B0Z A;  3Q4A B;  2VTB A;  4LG6 A;  1X81 A;  3QK0 A;  3KEA A;  4G25 A;  3MV3 B;  2B6C A;  5FQ8 A;  1LTX A;  1TJF A;  5FJY A;  2MRI A;  2XGM A;  2ZGG A;  4I9C A;  3Q49 B;  2OEW A;  2KBX A;  2WXH A;  4I6G A;  3DXK G;  4JPS A;  4EPZ A;  4EBA A;  2RG8 A;  3S7B A;  3LVR E;  3TWV A;  2VSN A;  5EIB E;  3EU9 A;  4AEZ C;  1JCS A;  3PE3 A;  3D9K A;  1QNF A;  1S63 A;  3MKQ A;  3CVY A;  3FUE A;  1VDY A;  1D8D A;  2QY7 A;  3IV0 A;  1V55 E;  3O4Z A;  3AG3 E;  2P9I G;  2VSX E;  5A23 A;  4K0R A;  3VTX A;  2V0P A;  2WXQ A;  4B93 B;  3W9F A;  4DX7 D;  4URK A;  2WXM A;  1E8X A;  4ME2 A;  1ELR A;  3L17 A;  1AWC B;  3DPD A;  2XEH A;  4YDO A;  5HI7 A;  1Y8M A;  3E32 A;  4A3V A;  4ACK A;  3AU5 A;  1DC2 A;  3FU0 A;  1FCH A;  2JAB A;  5JHB A;  5AJL A;  1IHG A;  4CGV A;  1N4R A;  4J6I A;  5KNH D;  3D9J A;  4AXH A;  3LDZ A;  4JL0 A;  4PS7 A;  4GTM A;  1GW6 A;  3DRA A;  1QYM A;  4X8Q A;  3PZD A;  1JUQ A;  4RQI A;  3R7Q A;  1N94 A;  5ENP D;  3Q78 A;  2VSO E;  3TGO A;  3X2Q E;  3TWS A;  1D9S A;  1S64 A;  3ASN E;  5G04 C;  4PUC A;  5D2M C;  2L0T B;  3L08 A;  4JHR A;  2CHW A;  4U07 A;  3L9T A;  5T4Y A;  4Y6W A;  5FTP A;  3J5P A;  3QJZ A;  3QAR A;  2I9C A;  5CCL A;  3V2X A;  2QC9 A;  4HB5 A;  4GZ6 A;  2EIL E;  3KS2 A;  1ZU2 A;  3FUK A;  1OCC E;  4J8Y A;  4WAF A;  4G26 A;  3ZVV A;  2OCC E;  1K1B A;  1E8W A;  3HXD A;  1LD8 A;  4DLO A;  3ML8 A;  5B1B E;  3L54 A;  3KD7 A;  1N52 A;  3CK8 A;  3CST A;  3ASH A;  4LNB A;  3KSQ A;  3V31 A;  1HS6 A;  4RG6 A;  3ZHE B;  5BPP A;  3FTY A;  3TXM A;  2P9S G;  3TAX A;  1JWF A;  4KBQ A;  3Q5M A;  4BWR A;  3AG1 E;  2J8S D;  3DPY A;  2VTB B;  4GA2 A;  5EX3 A;  2HR2 A;  4KMO A;  3V2O A;  5HKP A;  3CVN A;  3AAA C;  2H6H A;  2DYS E;  3FU3 A;  3I4R B;  1ELW A;  4UI9 C;  5LFA A;  5CBO A;  4GU5 A;  3T5V A;  3HIZ A;  1DVP A;  4N5C A;  3TXN A;  5HQ8 A;  3B7R L;  4IN3 B;  4JXT A;  5M72 A;  5KJL A;  2NSZ A;  3HHM A;  1H2U A;  2XEN A;  5G05 J;  3CSF A;  3ASO E;  3RAU A;  5J90 A;  5ANR A;  3Q9N C;  5E75 A;  4D10 C;  3HXB A;  2KC7 A;  2XCC A;  1Z5S C;  2P9P G;  3DBS A;  1UG3 A;  3JUE A;  1PAQ A;  4BES A;  4A55 A;  4WWO A;  3AU4 A;  1IKN D;  4MRU A;  2PQN A;  3UT7 A;  3UI2 A;  3OTN A;  1JWG A;  2NYJ A;  2VGY A;  4JVS A;  1AP7 A;  5A7D B;  3Q7A A;  4YDW A;  2L9B A;  2CFU A;  4KZC A;  4JZY A;  5AN8 A;  4UQZ A;  5KNG A;  4O60 A;  1H2T C;  4DLQ A;  3I4G A;  5FIO A;  4GTR A;  1H6O A;  3GYZ A;  4M3O A;  2IOL A;  2H6I A;  3LEW A;  4J8S A;  2H6G A;  4E85 A;  2OOE A;  3D9O A;  2HE0 A;  3CK9 A;  3PNL B;  3SFZ A;  4G24 A;  5LCW J;  2DWZ A;  2KCK A;  2AXZ A;  1BLX B;  4L23 A;  4UWL A;  3CVV A;  3UKR G;  5AIJ A;  2PZI A;  4A1S A;  1Z3X A;  4ZHB A;  3UPV A;  3FY4 A;  2ILR A;  2AJA A;  2RKK A;  4LRZ A;  1TNY A;  3D9H A;  1HXI A;  1Z6T A;  3CHQ A;  4K5B A;  1OWM A;  3HXE A;  1H6P A;  3EIJ A;  4CT0 A;  3FDH A;  4JEH A;  1MYO A;  2XHE A;  4HVB A;  3ABK E;  3DST A;  3QKY A;  4W9R A;  1INZ A;  3JQ1 A;  3FUN A;  3Q9U C;  3URZ A;  3IHV A;  3IEG A;  2NC9 A;  2KZT B;  1HG2 A;  3S2A A;  4BER A;  4NIK A;  4YDE A;  2VGE A;  1HX8 A;  3ZKJ A;  3W9G A;  3L6A A;  2GRL A;  4GTP A;  3D9M A;  4GTQ A;  1DNP A;  1TN7 A;  4EZL A;  3QWP A;  3HXC A;  2YHC A;  1HO8 A;  4GMJ A;  4HQD A;  4EZJ A;  4CDM A;  1PY1 A;  3LY8 A;  4HRL A;  4YND A;  5ARF A;  2P9U G;  3DSS A;  3C3O A;  1S0P A;  3BQO A;  4GZ3 A;  5DIZ A;  2J07 A;  2LXM A;  2WXJ A;  3BEE A;  3D3M A;  2IFU A;  2IO3 C;  3LS8 A;  4HOU A;  1HG5 A;  2R2L A;  4KVM A;  1DCE A;  3UIN C;  4HXI A;  1XNF A;  4UWH A;  3RRM B;  1O1S A;  4CDR A;  3PH0 C;  3LY7 A;  1K3Z D;  4F7A A;  3RU0 A;  3G2U A;  3NOC D;  3ZGQ A;  2X6J A;  4NRH B;  1OUV A;  3QB2 A;  3CV0 A;  2GRQ B;  3ISM C;  3CIA A;  4TUM A;  4EHM A;  2QFC A;  4C0M A;  1NA0 A;  3U3W A;  4E6H A;  4BET A;  4NQ0 A;  3D9I A;  4GYW A;  4IUL A;  4ANU A;  2IQC A;  2P2C P;  4HBD A;  1G3N B;  3SQV A;  3ABL E;  3LXU X;  3LY9 A;  2X38 A;  4G11 A;  3ZYM A;  3AS4 A;  3FTZ A;  4ILH B;  3MYV A;  2XCB A;  2I1J A;  2DCP A;  1ZB1 A;  4MBG A;  2L6J A;  2LXL A;  4WWN A;  4WND A;  4XEI G;  4FJY A;  1SQM A;  4UWK A;  3FUH A;  3EHM A;  3RIB A;  3EIQ C;  4R7L A;  1BD8 A;  3JXI A;  1WAO 1;  4PS3 A;  3FTW A;  4MLP A;  4Z68 A;  4BSX A;  2DZN A;  4U04 A;  3VLD A;  1E7U A;  2V5F A;  3NZU A;  5KBA A;  4C9B B;  3ML9 A;  4J8D A;  1O1R A;  5LCW C;  4ILG A;  2WPV A;  4GB9 A;  3ULY A;  3CKB A;  4WNG A;  3HVE B;  2KCV A;  3RO3 A;  4G1T A;  4RLY A;  1RZ4 A;  4U96 D;  3JQ0 A;  3F6Q A;  4FC8 A;  2OND A;  2XQ0 A;  5CRV A;  2AVP A;  3FU6 A;  2J09 A;  4I2Z A;  5JJ6 A;  2MOW A;  3G2S A;  4I6J A;  3HYM B;  5HS0 A;  1EF1 C;  2VGX B; 
#chains in the Genus database with same CATH homology
 3I3N A;  4PS8 A;  3QAR A;  2I9C A;  4JW1 A;  5CCL A;  2I6H A;  3MCX A;  3ASG A;  3IHY A;  2IU1 A;  2VYI A;  3G2V A;  3HDX A;  3FEY A;  2X6I A;  3CVU A;  4GZ6 A;  1EPU A;  4WNF A;  2XRY A;  4GYO A;  4IYP A;  5DBK A;  4Q69 A;  3KAE A;  1UJK A;  3KS2 A;  4ANV A;  4APO A;  4FHK A;  3FUI A;  1NZN A;  3OXL A;  1ZU2 A;  4DK5 A;  3FUK A;  5FWQ A;  4A3T A;  4K03 A;  4WAF A;  3PEV B;  4G26 A;  3ZVV A;  3SF4 A;  4YVQ C;  5G05 C;  2R5S A;  2BTD A;  5CHE E;  3CVX A;  4N2S A;  1E8Y A;  3MKR A;  4O6F A;  3ZFW A;  2AWI A;  4U0S A;  3GZ2 A;  1E8W A;  4ILI A;  4DLO A;  5CCM A;  2CHX A;  3EHN A;  3L22 A;  3L54 A;  3ML8 A;  3NF1 A;  1SZ9 A;  1N52 A;  1H19 A;  3CK8 A;  3KD7 A;  3N71 A;  1UN9 A;  2OVB A;  3CST A;  2XRZ A;  1ELK A;  2AW6 A;  2LAH A;  5BV1 A;  3ASH A;  3TJP A;  3HVE A;  4JA9 A;  1E90 A;  5G55 A;  3SBS A;  1IQU A;  3C98 A;  2J49 A;  2WXR A;  1HS6 A;  3RRN B;  2VQ2 A;  4BY6 A;  1UW4 B;  2FUL A;  4PDX A;  4RG6 A;  3ZHE B;  2WQ6 A;  2WXO A;  5BPP A;  3ASF A;  1X5B A;  3FTY A;  3TXM A;  4LCT A;  3SD5 A;  1YA0 A;  2GGF A;  3CEQ A;  4B89 A;  3TAX A;  3UQ3 A;  1JWF A;  5C1D A;  2Y4U A;  3MJW A;  5CMY A;  4KBQ A;  2XGS A;  3Q5M A;  4UWG A;  1EDU A;  2V8S E;  3LJ3 A;  4EBA G;  4BWR A;  5J08 A;  3RO2 A;  3D9N A;  3OXF A;  4JHK A;  3UMV A;  1H6K A;  2VTB B;  2JEK A;  4GA2 A;  5EX3 A;  2CHZ A;  1HH8 A;  2JLB A;  5G04 J;  2P58 C;  1FVH A;  2HR2 A;  4I1O B;  4KMO A;  4QFV A;  3UUX A;  4ANX A;  2WXN A;  4KYO B;  3RRU A;  4GA1 A;  5JJT A;  5KJK A;  2A4Z A;  4WNE A;  2WQH A;  4ABN A;  2IF4 A;  2RD0 A;  3ZYQ A;  4U63 A;  4XZ4 A;  3CHP A;  4CGW A;  3ENE A;  3CVN A;  2EQX A;  3P2B A;  3U4T A;  5FZS A;  4ANW A;  2BF0 X;  2WM9 A;  3TG5 A;  1E96 B;  5AEN A;  3KEZ A;  5JJ7 A;  2UY1 B;  4HOR A;  1HF8 A;  3I5P A;  2ION A;  3NZS A;  2VGX A;  3FU3 A;  3I4R B;  1ELW A;  4MS6 A;  2CG3 A;  1LF8 A;  4UI9 C;  3SI5 A;  5LFA A;  1XGW A;  5KJM A;  4FP7 A;  3EDT B;  3ULQ A;  3U66 A;  3UX4 A;  4GU5 A;  4V3I A;  3HIZ A;  4EEC A;  3T5V A;  2WXP A;  4AIF A;  1DVP A;  3FUL A;  3VLE A;  4N5C A;  4RVB A;  4UQY A;  3TXN A;  5HQ8 A;  3B7R L;  4IN3 B;  4JXT A;  5M72 A;  1MHQ A;  3Q47 B;  5D0O D;  3FEX A;  5FZR A;  4AY6 A;  4XKB A;  5LOZ A;  5KJL A;  4XIF A;  2NSZ A;  4J8E A;  3HHM A;  4CGV A;  2J4D A;  1W3B A;  3CVQ A;  3RIB A;  4AVX A;  4C0E A;  3PUK A;  2I2O A;  1H2U A;  3QWW A;  5G05 J;  3CSF A;  1H2V C;  3APD A;  3BG0 B;  3MA5 A;  4CCA A;  4DI3 A;  2DBA A;  3CQC B;  5J90 A;  4JHJ A;  5ANR A;  3PVL A;  5T8I A;  5BNW A;  4BT8 A;  5E75 A;  4AJW A;  4D10 C;  3PE4 A;  3B13 A;  2KC7 A;  2XCC A;  4J8F A;  4BT9 A;  2UWJ G;  1UG3 A;  2J4B A;  1PAQ A;  3DBS A;  3ZN3 A;  4WWO A;  4A55 A;  3AU4 A;  4MRU A;  3ONL A;  3ZPJ A;  2C0L A;  3FTS A;  4LER A;  2PQN A;  5C2Y A;  3UT7 A;  4KXK B;  4RSY A;  4JA7 A;  3OTN A;  3ZHE A;  1JWG A;  2VGY A;  4JVS A;  3VLF A;  3QNK A;  5G2N A;  2LSU A;  1N54 A;  2DIW A;  3JCK C;  5A7D B;  4JC8 A;  2LNI A;  4GAA A;  2L9B A;  1OWL A;  2Y4T A;  2CFU A;  4HOS A;  4KZC A;  4WWP A;  4JZY A;  4N3C A;  2WMN A;  4UQZ A;  4FAD A;  4I17 A;  1H2T C;  3GW4 A;  2FEZ A;  3JUI A;  5ANL A;  3OXG A;  1BPO A;  3ZEF A;  1L5J A;  4GML A;  4DLQ A;  4H7Y A;  4ATG A;  4KT6 B;  4BFR A;  3I4G A;  1FVF A;  2KCL A;  4F1S A;  3T5X A;  4AY5 A;  3CVW A;  3GYZ A;  1KT0 A;  4M3O A;  3L16 A;  4GZ5 A;  5FQ4 A;  2IOL A;  2UY1 A;  3LEW A;  4J8S A;  2WB2 A;  1HFA A;  1OWO A;  2CFZ A;  5FZQ A;  4FLB A;  3S7F A;  5AJD A;  4E85 A;  2C0M A;  4UI9 J;  2OOE A;  3D9O A;  4PH4 B;  2HO1 A;  5AYW D;  4N2Q A;  4I43 A;  4G2V A;  3CK9 A;  2X6K A;  3PNL B;  1OWP A;  4G24 A;  3SFZ A;  5LCW J;  2KCK A;  4GYY A;  2WXG A;  2AXZ A;  2IJG X;  3G2T A;  4L23 A;  4UWL A;  4I9E A;  3CVV A;  3PDN A;  4OVV A;  4XKC A;  1QQE A;  3RKV A;  3VTY A;  5AIJ A;  3QAQ A;  5KJN A;  2PZI A;  4A1S A;  1IYG A;  1Z3X A;  3ONK A;  3UPV A;  2R17 C;  2ILR A;  3FY4 A;  3B7S A;  4DJA A;  3FUF A;  1U3C A;  3ZIM A;  4YVO A;  4BTB A;  2CG2 A;  3MV2 B;  4LRZ A;  3CHR A;  1HXI A;  2PL2 A;  3CGH A;  4CEM A;  5A6C A;  3FUD A;  1Z6T A;  4EQF A;  3TL5 A;  3CKC A;  3CHQ A;  4GA0 A;  4TV3 A;  4Q96 A;  3MEK A;  1OWM A;  2XPZ A;  3EIJ A;  3ZYK A;  4CT0 A;  3FDH A;  3RK6 A;  1TJC A;  4JEH A;  2Y3A A;  3CHS A;  3UT8 A;  2LAI A;  5FT9 A;  3FP3 A;  3ZXS A;  3CHO A;  2LSV A;  2PM6 A;  2XHE A;  3RJV A;  1HU3 A;  2IOS A;  4HVB A;  1E7V A;  3QKY A;  1U3D A;  2Q7F A;  3QDN A;  4W9R A;  1INZ A;  4FA6 A;  4B8C B;  3PNT B;  1NP7 A;  3EJN A;  4I2W A;  4U8H A;  3JQ1 A;  4NUR A;  3FUN A;  1TEZ A;  4GZC A;  4DPR A;  3K9I A;  3NQP A;  3URZ A;  3IHV A;  3G2W A;  2XEV A;  3ASD A;  4UI9 K;  3QC1 A;  3IEG A;  5JHA A;  3APC A;  2X3M A;  2NC9 A;  2PM7 A;  4AV7 A;  4GZD A;  4BX9 A;  2E0I A;  3JYS A;  2KZT B;  5ENN A;  1HG2 A;  2GRM A;  2XPY A;  2YQ8 A;  2PQR A;  3GZ1 A;  2KM4 A;  2FF4 A;  2VJ8 A;  2AXV A;  3R7R A;  3S2A A;  2HYZ A;  5E76 A;  3U9W A;  4CT4 A;  4GCN A;  1HX8 A;  1ZBP A;  3CK7 A;  1B89 A;  3QOU A;  3L6A A;  2GRL A;  3ESK A;  4JEU A;  3ZW3 A;  5FQ6 A;  3MKQ B;  3D9M A;  4FLH A;  3TG4 A;  3CVL A;  4UQX A;  4XX5 A;  3D9L A;  5BUZ A;  5T3R A;  1A17 A;  1Z3Y A;  1DNP A;  3FH5 A;  2WXL A;  4P29 A;  4EZL A;  2YHE A;  3QWP A;  1HE8 A;  3OAW A;  4KZ0 A;  3FH7 A;  3MGB A;  4J0U A;  2YHC A;  3UT4 A;  1HO8 A;  4GMJ A;  2KAT A;  4EZJ A;  4CDM A;  2E2E A;  1PY1 A;  3PUJ A;  4L1B A;  3LY8 A;  4GPK A;  2MHK A;  3ZRH A;  4TRQ A;  4G23 A;  4YND A;  5ARF A;  3B7U X;  3QWV A;  2XGO A;  3MZL B;  1Y6I A;  1S0P A;  4XI9 A;  3U64 A;  3LVQ E;  3E4B A;  3CQG B;  4B0Z A;  3Q4A B;  2J08 A;  2OV8 A;  4GZ3 A;  2VTB A;  5DIZ A;  2J07 A;  3B7T A;  3QK0 A;  3R9A B;  2GW1 A;  2WXK A;  2WXJ A;  4G25 A;  3SHF A;  3FUM A;  3MV3 B;  5FQ8 A;  4AP2 A;  5BV0 A;  3BEE A;  3APF A;  5EKQ D;  2LO6 A;  3D3M A;  2WXI A;  3PS6 A;  2IFU A;  3LS8 A;  5BW8 C;  4HOU A;  4HOT A;  1HG5 A;  1TJF A;  2X6H A;  4KVM A;  4HLE A;  5FJY A;  2MRI A;  5LP0 A;  2XGM A;  3LKU A;  4HFG A;  3LCA A;  4UWF A;  1KLX A;  5FQ7 A;  4FU3 A;  4HXI A;  4I9C A;  3Q49 B;  1XNF A;  4UWH A;  4XI0 A;  3RRM B;  2WXH A;  3P1U A;  1UJJ A;  2FI7 A;  4I6G A;  4JPS A;  3ESL A;  4CDR A;  4EPZ A;  2WMO A;  5FTP A;  4EBA A;  2RG8 A;  4DI4 A;  2KZT A;  4NAC A;  4L7T A;  4A1G A;  4N3B A;  4FUL A;  3LVR E;  3S7B A;  3SBT B;  3FTU A;  4TUU A;  3FUJ A;  3PH0 C;  3LY7 A;  2VSN A;  5ARG A;  3D9P A;  4F7A A;  3RU0 A;  4AEZ C;  2BUG A;  3FWV A;  1OWN A;  4N39 A;  3G2U A;  1WY6 A;  3ZGQ A;  2X6J A;  3PE3 A;  1OUV A;  3PRZ A;  4NRH B;  3QB2 A;  3T8M A;  4I1M A;  3CV0 A;  4XE0 A;  5D0Q D;  3D9K A;  1QNF A;  5EX0 A;  2FO7 A;  3CIA A;  1EYH A;  4H7X A;  2QFC A;  3MKQ A;  3FFL A;  4U0Z A;  4C0M A;  3CVY A;  2NXP A;  2L0I A;  1NA0 A;  3FUE A;  4E6H A;  1H0A A;  1VDY A;  4U0U A;  3U3W A;  4NQ0 A;  3SZ7 A;  2QY7 A;  3D9I A;  3IV0 A;  4GYW A;  4IUL A;  4ANU A;  4FJZ A;  3O4Z A;  2IQC A;  1MQS A;  2I1K A;  3L13 A;  3LXU X;  2FBN A;  2VSX E;  3LY9 A;  5A23 A;  2X38 A;  4G11 A;  3CVP A;  2AXU A;  3ZYM A;  3AS4 A;  4K0R A;  5EDS A;  3VTX A;  3FTZ A;  4I1A A;  4ILH B;  4B94 A;  1P5Q A;  2V0P A;  3MYV A;  2XCB A;  1QZ2 A;  2WXQ A;  4HOQ A;  2I1J A;  4F53 A;  2DCP A;  1IQR A;  2C2L A;  4ACL A;  4URK A;  1UN8 A;  2L6J A;  2WXM A;  1E8X A;  4WWN A;  4WND A;  4F3V A;  3AS5 A;  4ME2 A;  1ELR A;  2R59 A;  4OVU A;  3CHM A;  3L17 A;  3AS8 A;  2OVF A;  3DPD A;  4L2L A;  4EZK A;  5HI7 A;  1Y8M A;  4FJY A;  1SQM A;  4A3V A;  4UWK A;  4ACK A;  3AU5 A;  3FTX A;  3FUH A;  3FU0 A;  3FH8 A;  3GZS A;  1FCH A;  2WVI A;  3CLJ A;  5JHB A;  3EHM A;  3IKO B;  3EIQ C;  3LYA A;  1IHG A;  4R7L A;  4L2Y A;  1WAO 1;  4PS3 A;  3FTW A;  1HZ4 A;  4MLP A;  4WUY A;  5AJL A;  1KT1 A;  5KCM A;  3FTV A;  4KVO A;  4N3A A;  1SZA A;  4BSX A;  4I6E A;  3IBE A;  4GCO A;  4J6I A;  4U04 A;  3FHE A;  3VLD A;  1E7U A;  2V5F A;  4MKT A;  3D9J A;  3NZU A;  4AXH A;  4BTA A;  3S7J A;  4C9B B;  3Q15 A;  2VSY A;  3LDZ A;  3ML9 A;  1NA3 A;  4J8D A;  4JL0 A;  5LCW C;  4ILG A;  2M63 A;  2X6F A;  2WPV A;  2YNQ A;  4GB9 A;  4PS7 A;  3WXX A;  1GW6 A;  3CKB A;  4APF A;  4WNG A;  4IRU A;  3PRE A;  3HVE B;  2ZU6 B;  2KCV A;  3RO3 A;  3ZYL A;  4OYS A;  4G1T A;  1JPL A;  5CMW A;  3PZD A;  3SGH A;  1JUQ A;  3PEU B;  2WXF A;  2WQ7 A;  3R7Q A;  4LEU A;  3JQ0 A;  4BX8 A;  3BG1 B;  4AOF A;  2VSO E;  3TGO A;  4B8A A;  2J9Q A;  3FU5 A;  4FC8 A;  2V4L A;  3S7D A;  1E8Z A;  2HM8 A;  3CR3 A;  2OND A;  4CDN A;  3SNX A;  2XQ0 A;  1PC2 A;  2AVP A;  2YIN A;  2XPI A;  3MX3 A;  4FHJ A;  3FU6 A;  5G04 C;  2J09 A;  4HS2 A;  4PUC A;  4I2Z A;  5JJ6 A;  2MOW A;  2L0T B;  4Y6C A;  3L08 A;  4LUN U;  3G2S A;  4JHR A;  2A5U A;  2CHW A;  4U07 A;  4I6J A;  5LX8 A;  3O48 A;  4AM9 A;  5T4Y A;  4Q94 A;  3HYM B;  4RG9 A;  3LPZ A;  1WM5 A;  4CRW A;  5BT1 A;  1EF1 C;  4Y6W A;  3QJZ A;  2VGX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...