5G05J

Cryo-em structure of combined apo phosphorylated apc
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 179
structure length 504
sequence length 532
chains with identical sequence K
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5g05J00
4GA1A 5M72A 1ZBPA 3Q15A 3GYZA 5BW8C 1PC2A 4XI9A 2LSUA 3NF1A 4J8DA 4A1SA 2KCLA 5ARGA 3S7BA 4N3BA 4LEUA 2E2EA 3TAXA 3TGOA 3CK7A 3ZHEA 4I17A 5FZQA 4H7YA 2NC9A 2C2LA 2FI7A 4GZ3A 3VTYA 3WXXA 2PZIA 3Q5MA 4RG9A 3UUXA 4AY5A 4YVQC 2Y4TA 4WNFA 3S7JA 2XEVA 5FTPA 3QWPA 3MV3B 2P58C 3JYSA 2BUGA 3QWVA 3S7FA 4GA0A 2UWJG 3PDNA 4WNGA 3GZ1A 3TG4A 4YVOA 1A17A 3KD7A 3LYAA 4NQ0A 2V5FA 2KATA 2R5SA 4ME2A 2VSYA 4GCOA 4GZ5A 1NA3A 2DBAA 2XPIA 1ZU2A 2OOEA 2I6HA 4U0SA 4CGWA 1KT0A 2XCCA 3QDNA 5G04J 1HXIA 4KBQA 4BWRA 2XCBA 4N2SA 4HOQA 5JJ7A 4GYYA 3ASGA 3Q49B 3ZGQA 3KAEA 4JHRA 1XNFA 3ZN3A 5LCWC 4GA2A 2FEZA 3U3WA 4BTAA 3RIBA 3SZ7A 4XIFA 5KJMA 4EQFA 2UY1A 5KJKA 3URZA 1TJCA 5CCMA 5BNWA 2WPVA 2Y4UA 3MV2B 4G26A 4J8FA 3OXLA 4U0ZA 2VGXB 4GYOA 3VTXA 3LY7A 3CK9A 4N2QA 2VSNA 3CVPA 3MEKA 4UI9J 5G05C 3CEQA 4BTBA 1KLXA 1P5QA 5A7DB 4N39A 5KJNA 2HR2A 4YNDA 1Y8MA 5KJLA 3UQ3A 3RO3A 3AS4A 4WNDA 5FZRA 4UI9K 5C1DA 3O48A 3CVQA 3R9AB 3N71A 3TG5A 2AVPA 3E4BA 3MA5A 1W3BA 4HOTA 3BEEA 4KYOB 4JA9A 4G24A 3FFLA 4KXKB 2HO1A 2FF4A 3LKUA 5HQ8A 2MHKA 3LY9A 1HZ4A 3MKRA 3CK8A 5LCWJ 4W9RA 2KCVA 4AY6A 4GCNA 3ZFWA 3QOUA 3CKBA 5EX3A 4Y6WA 3ESKA 3CVLA 3ASFA 5FZSA 4I1AA 2ONDA 2HYZA 1E96B 2KC7A 2KCKA 5FT9A 4N5CA 4XI0A 1IHGA 2QFCA 4I2ZA 3RO2A 4U04A 3GW4A 4G2VA 3RJVA 4B94A 3AS8A 4GZ6A 2XGMA 3CVNA 4CGVA 2WQHA 2Q7FA 3LCAA 5G04C 5DIZA 5CCLA 2FO7A 3IEGA 1KT1A 2C0LA 4UQYA 1FCHA 4BT8A 4BT9A 3UPVA 1NZNA 5AYWD 5EKQD 3AS5A 1ELWA 3ZPJA 3S7DA 2VGYA 2YHCA 1B89A 2IF4A 1WM5A 1HH8A 3Q4AB 4I9CA 2IFUA 4HORA 4HOSA 4I2WA 4GYWA 4AM9A 1OUVA 1NA0A 3LPZA 1QZ2A 5JJ6A 2YQ8A 3U4TA 2C0MA 2XGSA 4UI9C 4RG6A 2UY1B 3EDTB 2VGXA 4JL0A 4IN3B 4HOUA 4CDRA 2FBNA 4N3AA 5JJTA 4NRHB 3RU0A 3ASHA 4U07A 3ASDA 3HYMB 2GW1A 3K9IA 4F3VA 3LY8A 4GPKA 3RKVA 2JLBA 4WUYA 3QKYA 5HI7A 5ARFA 1YA0A 2PQNA 2LNIA 3CV0A 5G05J 4ABNA 5CHEE 4J8EA 3ZHEB 5D0QD 3Q47B 3OXGA 4JA7A 5A6CA 4AIFA 2VQ2A 1ELRA 4U0UA 4WNEA 2J9QA 4G25A 3QWWA 2PQRA 4APOA 3FWVA 2PL2A 3CKCA 4G1TA 4UQZA 4Y6CA 5DBKA 2L6JA 1QQEA 2XGOA 2VYIA 5FJYA 4O6FA 1IYGA 3PE3A 4I9EA 3FP3A 3KS2A 3PE4A 5D0OD 3ULQA 4UQXA 5EX0A 4G23A 5BT1A 3GZ2A 4H7XA 1WAO1 4J0UA 2LSVA 4N3CA 3SF4A 3OXFA
chains in the Genus database with same CATH superfamily
1TJFA 4GA1A 1BI8B 3CIAA 3QJZA 3Q15A 1S64A 2VJ8A 2CFZA 2LSUA 4YDYA 3L08A 4A1SA 2KCLA 4GTSA 3S7BA 3AG2E 5BPPA 3SBTB 4TXPA 3KEAA 3TAXA 3LS8A 3CK7A 5LFAA 1D8EA 2C2LA 3PH0C 3L17A 3VTYA 2WXMA 3R7RA 4CZ2D 4HRLA 2PZIA 3UUXA 3S7JA 1HS6A 3QWPA 4D10C 3E32A 1MZCA 4JEUA 4UWKA 2M63A 2DZOA 4CCAA 2YHEA 2WXKA 4K5BA 4YVOA 1SA4A 4ILIA 3KD7A 4M3OA 4ANVA 3J5QB 2V5FA 3OAWA 4QQIA 2OCCE 2R5SA 3L22A 5FWQA 4GZ5A 3HG0D 2XPIA 2OOEA 2I6HA 5ANLA 4A55A 1KT0A 1OWLA 4F6RD 3AG3E 3QDNA 3FUDA 3UM2A 5G04J 4L9PA 1H6KA 4KBQA 2B0OE 3V31A 4A1GA 3HVEA 4BWRA 1WY6A 4N2SA 3CVVA 2OV8A 3T9KA 5CEDB 3ZGQA 3KAEA 4JHJA 3SBSA 3V2XA 2GRMA 1N11A 3DSUA 3ZKJA 2PM7A 4J7WA 4EQFA 5C2YA 4B8CB 4ANUA 5CCMA 2WPVA 1S70B 2OEVA 3PEVB 3SNXA 4TRQA 2J09A 2IOLA 3OXLA 4BFRA 4DX7D 5FQ8A 3MEKA 2LAHA 1JCRA 2R17C 4BTBA 4F7AA 1KLXA 1INZA 5KJNA 2CG2A 4N39A 2HR2A 3LJ3A 3BU8A 3T5VA 1OWPA 5CECB 3RO3A 3HXEA 2WXOA 2I1JA 2WB2A 3CVQA 1KZPA 3APCA 2IU1A 4YDEA 3CHMA 2BEDA 4HI8A 3CLJA 2WMOA 3FH8A 1FT1A 1E8ZA 4DRXE 2FF4A 3LKUA 3AAAC 3L9TA 4I1OB 4W9RA 2KCVA 1OY3D 3E33A 4P29A 3PNLB 3CKBA 5AQ9A 3UINC 1DNPA 4LERA 3EU9A 1Z5SC 2KXPC 5AJDA 1E96B 2KC7A 2KCKA 3IV0A 4IYPA 4XI0A 3V79K 2GRNB 4I6EA 1E8YA 2X38A 5JHBA 3EHMA 4G2VA 3QNKA 4LUNU 3AS8A 3ABLE 1DCEA 1NP7A 2ETBA 2J4DA 2XGMA 1IHBA 3QAQA 1H6PA 5ENOD 2IJGX 2GRPB 2FO7A 1KT1A 2C0LA 5ENTD 4BT9A 3B13A 2XEEA 4JPSA 3TWUA 4HVBA 2GRLA 3D9LA 4GZDA 1NL4A 3B95A 4DI4A 2VGYA 2CHWA 2V0PA 2LXLA 2WXNA 3TXMA 1WM5A 4TUUA 1E7UA 3G2TA 4KZCA 5FIOA 3CSTA 3JQ0A 2PNNA 4I2WA 4GTPA 3D9IA 2H6IA 3D9NA 1MJ0A 2IY0C 2WMNA 3BQOA 3LPZA 4PS7A 3IHYA 3RSEG 3WG7E 3DSSA 4FLHA 1AWCB 2DWZA 3BG1B 3MJWA 3EDTB 4J8YA 2VGXA 1O1SA 5J90A 3EIQC 2MRIA 1SZ9A 1SW6A 4EPZA 4NRHB 5CBOA 4BSZB 1HFAA 3RU0A 3ASHA 1ZB1A 3TWWA 3ASDA 3K9IA 3W9FA 3G2VA 4DX1A 5ENPD 1H2TC 3RKVA 4FHJA 4QFVA 3B7RL 4ZFHA 4R7LA 2V4LA 1BD8A 4J6IA 5G05J 3CV0A 3UX4A 4ABNA 4JA7A 5FQ7A 4AIFA 3T8KA 3L16A 2NYJA 1DCQA 4WNEA 4G25A 5EN5D 3BUAA 1Z3YA 2L9BA 2PL2A 2VTBA 4XEIG 3ESLA 4WWPA 1TN8A 3PZ3A 3SFYA 3TWQA 1QQEA 4UWLA 5FJYA 4O6FA 2DZNA 3B7UX 4I9EA 3FP3A 3R9MA 2X3MA 3L82A 1YCSB 3GZ2A 3VLEA 4J0UA 3APDA 5ENNA 3DSVA 5M72A 1ZBPA 3GYZA 3NF1A 3EIJA 5ARGA 3JXIA 4N3BA 4HXIA 1HU3A 2E2EA 3EU5A 1H19A 4I17A 4DX5D 2NC9A 1O1TA 3Q5MA 4AY5A 4WWOA 1KZOA 2XEVA 4ILHB 4GMLA 4O1PA 3AG1E 5AQBA 3FU0A 3QWVA 3S7FA 3LDZA 3NOGD 4GA0A 2F8XK 2UWJG 4HRNA 5B3SE 4OAUC 4U7EB 1SQMA 2XENA 3TG4A 1A17A 3PZ2A 2ZGDA 4WWNA 4GCOA 1NA3A 1FT2A 1H0AA 4G8KA 3U66A 4U0SA 1N4RA 3C98A 1OT8A 2EIJE 4O60A 3DEOA 1HXIA 3DPYA 4XZ4A 2XCBA 3TWRA 4TXQA 4HOQA 2RFAA 4GYYA 1BI7B 3UM0A 3ASGA 4L23A 1EF1C 4UWFA 3FH7A 4JHRA 3ZN3A 5LCWC 4NACA 4GA2A 5KNHD 1N95A 2FEZA 3L6AA 3RIBA 2A5UA 1BLXB 2I1KA 1IKND 2R05A 4L2LA 3KSQA 1K8KG 3FTVA 1EDUA 5CBNA 3MV2B 4C9BB 3JCKC 3ZYMA 4AOFA 4U0ZA 3BG0B 1LD8A 4N2QA 4AJWA 2P9KG 3CVPA 3TWVA 4K5CA 4UI9J 5G55A 4B89A 4C0MA 1P5QA 4KZ0A 1DVPA 3DSXA 4YNDA 1SA5A 2KZTB 5KJLA 3UQ3A 3ZEFA 5FZRA 1FVHA 5C1DA 3R9AB 3FU6A 3PUKA 4HLLA 2AVPA 4JC8A 5EILA 3MA5A 1EYHA 3HXCA 4HOTA 3BEEA 3RRMB 3UIPC 3EHNA 1S63A 3PRZA 4EZKA 4FHKA 3MKQB 4MS6A 4AVXA 4F1SA 2QYUA 1HZ4A 4TV3A 3TWTA 2MYOA 3DBSA 4DLOA 3DRAA 4GCNA 5AIJA 3ZFWA 3QOUA 2L0IA 5CEAA 3MZLB 5EX3A 4Y6WA 1TN6A 2IO3C 2AXVA 4OAVB 4ACKA 3FY4A 3CVLA 3JQ1A 5FZSA 4GTTA 2XS1A 4L7TA 1U2VG 3I3NA 1Q2ZA 2OEWA 5KNGA 5FT9A 4MKTA 3D9JA 1MHQA 1O1RA 3FUKA 1EPUA 3NZUA 2LAIA 5KWDA 3FTZA 3R7QA 4CEMA 4U04A 4L2YA 4E6HA 3GW4A 1JCSA 3RJVA 1JWFA 2Y3AA 5E75A 3PREA 4GMRA 3CR3A 4B94A 3PEUB 3NOCD 5BV1A 2J8SD 3NAWA 4K5AB 5AN8A 3B7BA 4CGVA 1K3ZD 4YDWA 2WXLA 2Q7FA 4DLQA 5G04C 3IEGA 5EYPF 4UQYA 1FCHA 2VSOE 3FULA 2R59A 1NZNA 3ONKA 5AYWD 5BXOA 1MYOA 3RRNB 4Q94A 3PZ1A 5CERB 1KPSB 2GRRB 3ZPJA 1AP7A 4B8AA 1TYQG 1B89A 4FADA 3HVEB 5D2MC 3SFZA 2BF0X 2ZIRA 2H6GA 4FULA 4HORA 4EECA 2BTDA 1IQUA 4HOSA 1K1AA 1TNZA 4LG6A 4KVMA 1OUVA 1NA0A 2RG8A 3CHRA 2YQ8A 4CT4A 4UWHA 3CVYA 3UT8A 3DWLG 2RFMA 4RG6A 4EBAG 4L1BA 4JL0A 4G11A 2XEHA 4IN3B 4N3AA 2Y69E 2L0TB 3FTYA 4GTQA 5CRVA 4U07A 1BPOA 3D3MA 1NFIE 3HYMB 2NSZA 4FU3A 2AJAA 3CVWA 2XZTG 5JA4D 2F8YA 2ILRA 1UW4B 3UT4A 3ABME 3QKYA 5AENA 2IOSA 3LEWA 1XGWA 1YA0A 2LNIA 3B7TA 3ZHEB 4HQDA 3Q47B 5AQAA 3TXNA 4MRUA 4JXTA 3IBEA 1ELRA 4B0ZA 4U0UA 3D9MA 2P9UG 3QWWA 2PQRA 5ANRA 4GTMA 3AU5A 4XX5A 4GTVA 1D9SA 2J4BA 3ZYQA 4BSXA 4G1TA 4Y6CA 5FQ4A 2XGOA 4EZJA 4B93B 4GB9A 1IYGA 4I6JA 3PE3A 2WVIA 4A3VA 1MX6A 4BESA 1FVFA 3C3OA 4HS2A 1QYMA 5CMWA 3HHMA 4I6GA 4DI3A 4H7XA 1WAO1 3CSFA 3AG4E 2OVBA 4RLYA 4N3CA 2DIWA 3UM1A 3KSLA 5T3RA 5BW8C 2ETAA 3CHPA 4XI9A 3SO8A 2AXZA 5E76A 4LEUA 3TGOA 2AW6A 3DSTA 4H7YA 3FUJA 1V55E 2LO6A 4RG9A 2R03A 4YVQC 1OWNA 4FJYA 1PY1A 2P58C 2ZU6B 2OVFA 3EJNA 2A5EA 1WDYA 3PDNA 3UXGA 4N5QA 4ACLA 2X6KA 3B7SA 2KATA 1V54E 3ZU7B 2XRZA 4ME2A 3CVXA 2X6JA 5KCMA 1ZU2A 3ZYLA 3FTWA 3D9HA 3IHVA 5HS0A 3Q78A 3SI5A 1MX4A 3C3QA 4HBDA 4FJZA 2FO1E 4EBAA 1WG0A 3Q49B 1JWGA 1FPPA 3U3WA 2DYRE 4BTAA 3CHQA 4XKBA 3E34A 3CQGB 2UY1A 5EDSA 3EUVA 3ONLA 5KJKA 3URZA 1N0RA 4ATZD 1H2VC 4G26A 2WM9A 3Q79A 4J8FA 3FTSA 3SD5A 1H2UA 4GAAA 2VGXB 3CVUA 4GYOA 2ZISA 3LY7A 2BKKB 2VSNA 1RZ4A 2R2LA 2VSXE 5G05C 2KM4A 1N4QA 2CG3A 1TNYA 3UIOC 4C48B 1A5EA 3J5PA 1Y8MA 3U9WA 2PM6A 4KT6B 3AS4A 3Q9UC 2J08A 3O48A 4X8QA 2WQ6A 1H6OA 1JCQA 2DVWA 3TG5A 4JD2G 4U8VD 3E4BA 4HB5A 1W3BA 4KYOB 4NURA 2YINA 4I43A 3FFLA 5T4YA 2HO1A 1UOHA 2EQXA 1X5BA 1UN8A 2VTBB 4ZHBA 5HQ8A 3ASOE 2MHKA 3SHFA 3LY9A 3HDXA 5IY5E 4DK5A 3MKRA 5KBAA 3CK8A 5LCWJ 3FH5A 5ENQD 5ENSD 4AY6A 1QNFA 4UWGA 2EILE 2FULA 4DX2A 3L54A 1HX8A 4LNBA 3GZSA 3ESKA 1TR4A 3ASFA 4IRUA 4I1AA 1L5JA 2ONDA 2WXIA 2HYZA 1OWMA 4J8SA 2VGEA 2Y1LE 3JXJA 3TJPA 2AXUA 2QZAA 2QFCA 3G2UA 5ITZF 3DXMG 4BEPA 1OCCE 4I2ZA 3ZUVB 4GTOA 3EHQA 5AAOA 3ULEG 5B1BE 5JMND 4U96D 3MKQA 2I9CA 3V30A 4JZYA 2H6HA 4GZ6A 4BX9A 3F6QA 2IQCA 1UG3A 2XS8A 3SY2A 3LCAA 2YNQA 3APFA 1D8DA 1OXJA 5DIZA 4U63A 2BKGA 1UJJA 2JABA 2CFUA 2WQ7A 2IEJA 3HIZA 4BT8A 4CRWA 2XRYA 3ZW3A 2V5QC 3AS5A 2P9SG 2WXFA 3FHEA 5AJLA 2YHCA 3NQPA 4GPMA 4YDOA 3VLDA 4Q69A 3HXDA 3Q75A 3FEXA 4HRMB 2IFUA 2Y0BG 4KMOA 3EHRA 4AM9A 2WXGA 3TWSA 1QZ2A 4CDNA 3PS6A 2C0MA 4UI9C 3HRAA 3FEYA 4HOUA 4CDRA 1N4SA 5JJTA 2HE0A 3OTNA 1E8WA 5H7PA 3ZYKA 1HG2A 5EIDA 2GW1A 2CHZA 4F3VA 1N4PA 3LY8A 2A4ZA 4DUIA 2JLBA 4BY6A 3SQVA 4CDMA 4PUCA 5FQ6A 3UM3A 1N94A 3V2OA 4EZLA 1MQSA 3DSWA 3VLFA 5D0QD 3LXUX 3MGBA 1TNUA 3PVLA 1SVXA 2J9QA 3AJIA 3JUIA 3QARA 3FWVA 3T8MA 3T5XA 3U64A 3D9KA 1N52A 4ILGA 3ISMC 4BX8A 2EINE 2KBXA 5DBKA 5HKPA 3FUFA 2VYIA 1Y6IA 3DXKG 1DC2A 5D0OD 3Q73A 1LD7A 4UQXA 5B1AE 5EX0A 2LXMA 5BT1A 4FLBA 4F1PA 4G8LA 4U8HA 3KEZA 3SF4A 3OXFA 3SFXA 4AEZC 1PC2A 4OVUA 4PH4B 3I5PA 4J8DA 1OWOA 3G2WA 4LRZA 4DPRA 2QC9A 5BV0A 2F0YA 4XKCA 1IQRA 3ZHEA 5FZQA 4LNUD 2FI7A 4GZ3A 4HFGA 3WXXA 1X81A 4K0RA 4NIKA 3UMVA 2Y4TA 4WNFA 4ATGA 3Q7AA 1TN7A 2P9PG 5FTPA 1N0QA 3MV3B 2NXPA 3JYSA 4GU5A 2BUGA 3HXFA 2XPZA 4C0EA 3TL5A 4WNGA 2EIME 4U8YD 3GZ1A 4JHKA 3LYAA 4NQ0A 4JB8P 1N54A 4LSZE 5J08A 2LUHA 2WXJA 1HF8A 4MBGA 2VSYA 3CQCB 4FA6A 2I2OA 2DBAA 2V8SE 3TWXA 3FUNA 3ZIMA 4CGWA 2WXHA 2QYJA 3QK0A 2XCCA 2RD0A 3PNTB 3C3RA 4XE0A 1MX2A 4A3TA 2GROB 2RKKA 3CGHA 5JJ7A 1XNFA 3LVQE 1U3DA 3PZ4A 3SZ7A 2P9IG 4XIFA 5KJMA 5LX8A 3HXBA 1E7VA 4AV7A 3NBNB 1NI1A 1YYHA 2DCPA 2X6FA 4DX6D 1RW2A 5EYLA 1TJCA 3FUHA 5BNWA 2Y4UA 5T8IA 5A23A 2DYSE 3MCXA 2IO2C 1N9AA 3VTXA 2B6CA 3CK9A 3CHSA 1HG5A 3ZNGA 4PS3A 3CEQA 3QC1A 2R02A 4GMJA 2P2CP 3C72A 3DPDA 2X6HA 5A7DB 3G2SA 1UJKA 4RVBA 2XHEA 4UUCA 4CYMD 4O1OA 4WNDA 2HM8A 1O5MA 4UI9K 1LF8A 1PAQA 4APFA 2P9NG 3N71A 4I1MA 5EIBE 5LOZA 4LNGA 4TUMA 3CHOA 3FUMA 4BERA 4JA9A 1LTXA 4G24A 5AARA 1E90A 3AU4A 4HI9A 4KVOA 5ENRD 4KXKB 4DJAA 3UTMA 4Z68A 5HRYA 4RSYA 3ZXSA 3X2QE 3UI2A 2WXPA 4K03A 1Z6TA 3MYVA 3DEPA 5CRUA 1ELKA 3RK6A 2QY7A 4ANWA 3P1UA 4N5CA 3FUIA 3FTXA 1IHGA 5JHAA 3IXEA 3ULYA 4EHMA 3IKOB 2ZXWE 1OCZE 3I4GA 3RO2A 2ETCA 4BETA 3D9PA 3I4RB 1BU9A 1OCOE 4JVSA 1U3CA 2J07A 5BXUA 3FTUA 3RAUA 1HO8A 3CVNA 4FP7A 4V3IA 3L13A 4JEHA 1S0PA 4OYSA 2WQHA 3C5RA 1JUQA 4RQIA 3ZXPA 3ML8A 5CCLA 5CMYA 4MLPA 3NZSA 3UPVA 4AP2A 4E85A 3ZVVA 4OVVA 3NB2A 5EKQD 4F53A 1ELWA 4FC8A 2L6BA 3S7DA 4TXRA 4PS8A 3SGHA 3Q9NC 2IF4A 1K1BA 2ZGGA 3ENEA 1HH8A 3Q4AB 2EIKE 4I9CA 4U95D 2XPYA 4AXHA 1SZAA 2CHXA 4GYWA 2V4HC 4HNAD 4PDXA 1OCRE 4GZCA 1UN9A 2JEKA 1IXVA 5JJ6A 3U4TA 3LVRE 3FUEA 3QB2A 2XGSA 2UY1B 5LP0A 3UT7A 1TNOA 5BUZA 2MOWA 2P9LG 2FBNA 3O4ZA 4GTRA 4A63B 4ANXA 3ASNE 1HE8A 2IONA 2XQ0A 1QBQA 2H6FA 3LJNA 1GW6A 3S2AA 2AWIA 4JW1A 2F37A 3UKRG 2KZTA 2J49A 4URKA 4GPKA 3FU5A 4WUYA 3E37A 5HI7A 5ARFA 4WAFA 2WXQA 3ZRHA 2E0IA 2X6IA 2PQNA 3JUEA 3FU3A 4CT0A 5CHEE 4J8EA 3OXGA 3D9OA 3PUJA 5A6CA 1TEZA 3FDHA 2VQ2A 4IULA 1YMPA 3P2BA 5FINA 4APOA 5D66A 3PZDA 3MX3A 1E8XA 3CKCA 4UQZA 4Q96A 3Q7FA 3ML9A 3RRUA 2L6JA 3UKUG 5AQ7A 1JPLA 3E30A 1Z3XA 3ABKE 1G3NB 4M7CA 3KS2A 1VDYA 2WXRA 3PE4A 2GGFA 4HLEA 3ULQA 4G23A 5G2NA 4LCTA 2XZDG 3W9GA 1TNBA 2LSVA 2GRQB
chains in the Genus database with same CATH topology
1TJFA 4GA1A 5ENNA 4AEZC 5M72A 3CIAA 3QJZA 1ZBPA 3Q15A 5T3RA 3GYZA 5BW8C 2VJ8A 1PC2A 4OVUA 3CHPA 4PH4B 4XI9A 2CFZA 2LSUA 3I5PA 3L08A 3NF1A 4CT0A 4J8DA 4A1SA 3EIJA 2AXZA 2KCLA 5ARGA 1OWOA 3S7BA 3G2WA 4LRZA 4N3BA 4DPRA 5BV0A 5E76A 5BPPA 3SBTB 4HXIA 4XKCA 4LEUA 1IQRA 1HU3A 2E2EA 3LS8A 3TAXA 2AW6A 3CK7A 3ZHEA 3TGOA 1H19A 4I17A 5FZQA 5LFAA 4H7YA 2NC9A 3FUJA 2C2LA 3PH0C 2FI7A 4GZ3A 4HFGA 3L17A 3VTYA 2WXMA 2LO6A 3WXXA 3R7RA 2PZIA 3Q5MA 4RG9A 3UUXA 4WWOA 4K0RA 4AY5A 3UMVA 4YVQC 1OWNA 2Y4TA 4WNFA 4ATGA 3S7JA 4FJYA 2XEVA 4ILHB 5FTPA 1HS6A 3QWPA 4D10C 4GMLA 3MV3B 2NXPA 1PY1A 3FU0A 2P58C 2ZU6B 2BUGA 3JYSA 4GU5A 3QWVA 3S7FA 3LDZA 4JEUA 2OVFA 4GA0A 2XPZA 3EJNA 4UWKA 2UWJG 4C0EA 3PDNA 3TL5A 1SQMA 2M63A 4WNGA 4CCAA 2YHEA 3GZ1A 3TG4A 2WXKA 4YVOA 4ILIA 1A17A 3KD7A 4JHKA 4M3OA 3LYAA 4NQ0A 4ACLA 4ANVA 2V5FA 2X6KA 3B7SA 3OAWA 1N54A 2KATA 5J08A 2WXJA 2R5SA 2XRZA 1HF8A 3L22A 4ME2A 4WWNA 2VSYA 3CVXA 5FWQA 3CQCB 4GCOA 2X6JA 4FA6A 4GZ5A 1NA3A 2DBAA 2I2OA 2V8SE 1H0AA 2XPIA 5KCMA 1ZU2A 2OOEA 3FTWA 3ZYLA 2I6HA 3FUNA 3U66A 5ANLA 4U0SA 3ZIMA 4CGWA 4A55A 3IHVA 1KT0A 2WXHA 1OWLA 3QK0A 2XCCA 3QDNA 3C98A 3SI5A 2RD0A 3PNTB 3FUDA 5G04J 4XE0A 1HXIA 1H6KA 4A3TA 4KBQA 4FJZA 4XZ4A 4A1GA 3CGHA 3HVEA 4BWRA 1WY6A 2XCBA 4EBAA 3CVVA 4N2SA 2OV8A 4HOQA 5JJ7A 4GYYA 3ASGA 3Q49B 4L23A 3ZGQA 1EF1C 3KAEA 1JWGA 4UWFA 3FH7A 4JHRA 4JHJA 3SBSA 1XNFA 3ZN3A 5LCWC 4NACA 4GA2A 3LVQE 2FEZA 3U3WA 2GRMA 1U3DA 3L6AA 4BTAA 3RIBA 2A5UA 3SZ7A 3CHQA 2I1KA 4XIFA 5KJMA 5LX8A 1E7VA 2PM7A 4L2LA 4XKBA 4AV7A 4EQFA 3CQGB 2UY1A 2DCPA 2X6FA 5EDSA 5C2YA 3ONLA 4B8CB 4ANUA 5KJKA 3URZA 1TJCA 3FTVA 3FUHA 5CCMA 5BNWA 1EDUA 2WPVA 2Y4UA 3MV2B 5T8IA 1H2VC 4G26A 4C9BB 3PEVB 3SNXA 2WM9A 3JCKC 4TRQA 5A23A 4J8FA 3ZYMA 4AOFA 3MCXA 2J09A 2IOLA 3FTSA 3OXLA 4U0ZA 1H2UA 3SD5A 4GAAA 4BFRA 2VGXB 3CVUA 3BG0B 4GYOA 3VTXA 3LY7A 3CK9A 3CHSA 1HG5A 4AJWA 4N2QA 2VSNA 5FQ8A 3CVPA 3MEKA 2LAHA 2VSXE 4PS3A 4UI9J 5G05C 3CEQA 5G55A 2R17C 3QC1A 4BTBA 4F7AA 1KLXA 4B89A 4GMJA 2KM4A 3DPDA 4C0MA 1INZA 1P5QA 2CG2A 2X6HA 4KZ0A 1DVPA 4N39A 5A7DB 5KJNA 3G2SA 2HR2A 2CG3A 3LJ3A 4YNDA 1UJKA 3T5VA 1Y8MA 1OWPA 4RVBA 2KZTB 4HLEA 5KJLA 3UQ3A 3U9WA 2PM6A 3RO3A 2XHEA 4KT6B 2WXOA 3AS4A 4WNDA 2HM8A 5FZRA 3ZEFA 4UI9K 1FVHA 1LF8A 2I1JA 2J08A 5C1DA 2WB2A 3O48A 3CVQA 1PAQA 3R9AB 2WQ6A 4APFA 3APCA 2IU1A 3FU6A 3N71A 3TG5A 3CHMA 3PUKA 4I1MA 5LOZA 2AVPA 4JC8A 3E4BA 3CLJA 3MA5A 1EYHA 2WMOA 1W3BA 4HOTA 3FH8A 3CHOA 3FUMA 3BEEA 4KYOB 3RRMB 4NURA 4JA9A 2YINA 3EHNA 4G24A 4I43A 1E90A 3PRZA 3AU4A 3FFLA 4KVOA 5T4YA 4KXKB 2HO1A 2EQXA 4FHKA 4DJAA 4EZKA 1X5BA 3MKQB 1E8ZA 1UN8A 2VTBB 2FF4A 3LKUA 5HQ8A 2MHKA 3SHFA 3LY9A 4MS6A 3HDXA 4AVXA 4F1SA 4DK5A 1HZ4A 3MKRA 4TV3A 3CK8A 4I1OB 5LCWJ 3DBSA 3FH5A 2KCVA 4W9RA 4DLOA 4AY6A 1QNFA 4GCNA 4UWGA 5AIJA 4RSYA 3ZFWA 3QOUA 4P29A 3PNLB 3ZXSA 2L0IA 3CKBA 2FULA 3MZLB 5EX3A 3L54A 1HX8A 2WXPA 4K03A 1Z6TA 3MYVA 4Y6WA 2AXVA 3GZSA 4ACKA 1DNPA 3ESKA 3FY4A 4LERA 3CVLA 3ASFA 4IRUA 3JQ1A 5FZSA 4I1AA 1ELKA 4L7TA 2QY7A 3RK6A 4ANWA 3P1UA 1L5JA 2ONDA 2WXIA 2HYZA 5AJDA 1E96B 3I3NA 1OWMA 4J8SA 2KC7A 2KCKA 5FT9A 4MKTA 4N5CA 3TJPA 3FUIA 3D9JA 3FTXA 3IV0A 4IYPA 2AXUA 4XI0A 1MHQA 1IHGA 4I6EA 1E8YA 5JHAA 2QFCA 3G2UA 3IKOB 2X38A 4I2ZA 3FUKA 1EPUA 5JHBA 3I4GA 3NZUA 3EHMA 2LAIA 3RO2A 3FTZA 3R7QA 4CEMA 4U04A 4L2YA 4E6HA 3GW4A 3D9PA 3I4RB 4G2VA 3RJVA 1JWFA 2Y3AA 3QNKA 5E75A 3PREA 3CR3A 3MKQA 2I9CA 4JVSA 1U3CA 2J07A 4B94A 3PEUB 3FTUA 4LUNU 5BV1A 3AS8A 4JZYA 4GZ6A 1NP7A 4BX9A 2J4DA 1HO8A 2XGMA 3CVNA 3QAQA 4FP7A 4V3IA 2IQCA 3L13A 1UG3A 4CGVA 4JEHA 1S0PA 2WXLA 4OYSA 2WQHA 2Q7FA 4DLQA 1JUQA 3LCAA 2YNQA 3ML8A 3APFA 5G04C 2IJGX 5DIZA 4U63A 5CMYA 5CCLA 2FO7A 4MLPA 3IEGA 1KT1A 1UJJA 2C0LA 4UQYA 2CFUA 1FCHA 2VSOE 3FULA 3NZSA 3HIZA 4BT8A 2WQ7A 4BT9A 3UPVA 4AP2A 2R59A 4E85A 4CRWA 3B13A 1NZNA 3ZVVA 3ONKA 5AYWD 2XRYA 3ZW3A 4OVVA 4JPSA 4HVBA 2GRLA 5EKQD 3RRNB 4Q94A 3AS5A 3D9LA 4GZDA 4F53A 1ELWA 4FC8A 2WXFA 3ZPJA 4DI4A 3S7DA 3FHEA 4B8AA 2VGYA 2CHWA 5AJLA 4PS8A 3SGHA 2V0PA 2YHCA 1B89A 2IF4A 3NQPA 2WXNA 4FADA 3ENEA 3HVEB 3TXMA 1WM5A 1HH8A 3VLDA 3Q4AB 3SFZA 4Q69A 2BF0X 3FEXA 4I9CA 2IFUA 4TUUA 4FULA 4HORA 4EECA 1E7UA 3G2TA 4KZCA 2BTDA 1IQUA 2XPYA 4AXHA 1SZAA 4HOSA 2CHXA 3CSTA 4KMOA 3JQ0A 4I2WA 4GYWA 4AM9A 3D9IA 3D9NA 4KVMA 1OUVA 2WXGA 4PDXA 1NA0A 2RG8A 2WMNA 3LPZA 4PS7A 4GZCA 1UN9A 2JEKA 1QZ2A 3IHYA 3CHRA 5JJ6A 2YQ8A 4CT4A 4UWHA 3U4TA 3LVRE 4CDNA 3FUEA 3PS6A 3UT8A 3CVYA 3QB2A 4FLHA 2C0MA 2XGSA 3BG1B 3MJWA 4UI9C 4RG6A 4EBAG 2UY1B 3EDTB 5LP0A 4L1BA 3UT7A 2VGXA 4JL0A 4G11A 3FEYA 5BUZA 5J90A 2MOWA 4IN3B 4HOUA 3EIQC 4CDRA 2FBNA 4N3AA 2MRIA 3O4ZA 5JJTA 1SZ9A 2L0TB 3OTNA 4EPZA 1E8WA 4NRHB 3FTYA 1HFAA 3RU0A 4ANXA 3ZYKA 1HG2A 1HE8A 3ASHA 2IONA 1BPOA 2XQ0A 4U07A 3D3MA 3ASDA 3HYMB 2GW1A 3K9IA 1GW6A 3S2AA 2AWIA 2CHZA 3G2VA 4JW1A 2NSZA 4F3VA 4FU3A 3LY8A 2KZTA 2J49A 3CVWA 2A4ZA 4URKA 4GPKA 1H2TC 3FU5A 3RKVA 2JLBA 2ILRA 4BY6A 4WUYA 1UW4B 3UT4A 4FHJA 4QFVA 4CDMA 3B7RL 4PUCA 5FQ6A 3QKYA 5AENA 5HI7A 5ARFA 4R7LA 4WAFA 2IOSA 3LEWA 1XGWA 2WXQA 2V4LA 4EZLA 3ZRHA 1YA0A 2E0IA 2X6IA 1MQSA 2PQNA 4J6IA 2LNIA 3CV0A 3FU3A 5G05J 5CHEE 4J8EA 3B7TA 3UX4A 3VLFA 3ZHEB 4ABNA 5D0QD 3Q47B 3OXGA 4JA7A 3TXNA 3D9OA 3PUJA 4MRUA 5A6CA 3LXUX 5FQ7A 3FDHA 4AIFA 1TEZA 2VQ2A 3MGBA 3L16A 3PVLA 3IBEA 4JXTA 1ELRA 4B0ZA 4U0UA 4IULA 3D9MA 2J9QA 4WNEA 3P2BA 4G25A 3QWWA 2PQRA 5ANRA 4APOA 1Z3YA 3PZDA 3MX3A 3JUIA 3QARA 2L9BA 3FWVA 2PL2A 3T8MA 2VTBA 3T5XA 3U64A 3AU5A 4XX5A 3ESLA 1E8XA 3CKCA 2J4BA 3ZYQA 4BSXA 4G1TA 4UQZA 4WWPA 3D9KA 1N52A 4ILGA 4Q96A 4Y6CA 4BX8A 3ML9A 5DBKA 3RRUA 2L6JA 3FUFA 1QQEA 5FQ4A 2XGOA 2VYIA 4EZJA 1Y6IA 1JPLA 4UWLA 5FJYA 4O6FA 4GB9A 1IYGA 1Z3XA 3PE3A 3B7UX 4I9EA 4I6JA 2WVIA 3FP3A 1VDYA 2WXRA 3KS2A 2GGFA 3PE4A 5D0OD 3ULQA 4A3VA 2X3MA 1FVFA 4UQXA 5EX0A 4G23A 4HS2A 5G2NA 5BT1A 4FLBA 5CMWA 3GZ2A 3HHMA 4I6GA 4LCTA 4DI3A 4H7XA 1WAO1 3CSFA 3VLEA 4J0UA 2OVBA 3APDA 4U8HA 3KEZA 2LSVA 4N3CA 3SF4A 2DIWA 3OXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GA1 A;  5M72 A;  1ZBP A;  3Q15 A;  3GYZ A;  5BW8 C;  1PC2 A;  4XI9 A;  2LSU A;  3NF1 A;  4J8D A;  4A1S A;  2KCL A;  5ARG A;  3S7B A;  4N3B A;  4LEU A;  2E2E A;  3TAX A;  3TGO A;  3CK7 A;  3ZHE A;  4I17 A;  5FZQ A;  4H7Y A;  2NC9 A;  2C2L A;  2FI7 A;  4GZ3 A;  3VTY A;  3WXX A;  2PZI A;  3Q5M A;  4RG9 A;  3UUX A;  4AY5 A;  4YVQ C;  2Y4T A;  4WNF A;  3S7J A;  2XEV A;  5FTP A;  3QWP A;  3MV3 B;  2P58 C;  3JYS A;  2BUG A;  3QWV A;  3S7F A;  4GA0 A;  2UWJ G;  3PDN A;  4WNG A;  3GZ1 A;  3TG4 A;  4YVO A;  1A17 A;  3KD7 A;  3LYA A;  4NQ0 A;  2V5F A;  2KAT A;  2R5S A;  4ME2 A;  2VSY A;  4GCO A;  4GZ5 A;  1NA3 A;  2DBA A;  2XPI A;  1ZU2 A;  2OOE A;  2I6H A;  4U0S A;  4CGW A;  1KT0 A;  2XCC A;  3QDN A;  5G04 J;  1HXI A;  4KBQ A;  4BWR A;  2XCB A;  4N2S A;  4HOQ A;  5JJ7 A;  4GYY A;  3ASG A;  3Q49 B;  3ZGQ A;  3KAE A;  4JHR A;  1XNF A;  3ZN3 A;  5LCW C;  4GA2 A;  2FEZ A;  3U3W A;  4BTA A;  3RIB A;  3SZ7 A;  4XIF A;  5KJM A;  4EQF A;  2UY1 A;  5KJK A;  3URZ A;  1TJC A;  5CCM A;  5BNW A;  2WPV A;  2Y4U A;  3MV2 B;  4G26 A;  4J8F A;  3OXL A;  4U0Z A;  2VGX B;  4GYO A;  3VTX A;  3LY7 A;  3CK9 A;  4N2Q A;  2VSN A;  3CVP A;  3MEK A;  4UI9 J;  5G05 C;  3CEQ A;  4BTB A;  1KLX A;  1P5Q A;  5A7D B;  4N39 A;  5KJN A;  2HR2 A;  4YND A;  1Y8M A;  5KJL A;  3UQ3 A;  3RO3 A;  3AS4 A;  4WND A;  5FZR A;  4UI9 K;  5C1D A;  3O48 A;  3CVQ A;  3R9A B;  3N71 A;  3TG5 A;  2AVP A;  3E4B A;  3MA5 A;  1W3B A;  4HOT A;  3BEE A;  4KYO B;  4JA9 A;  4G24 A;  3FFL A;  4KXK B;  2HO1 A;  2FF4 A;  3LKU A;  5HQ8 A;  2MHK A;  3LY9 A;  1HZ4 A;  3MKR A;  3CK8 A;  5LCW J;  4W9R A;  2KCV A;  4AY6 A;  4GCN A;  3ZFW A;  3QOU A;  3CKB A;  5EX3 A;  4Y6W A;  3ESK A;  3CVL A;  3ASF A;  5FZS A;  4I1A A;  2OND A;  2HYZ A;  1E96 B;  2KC7 A;  2KCK A;  5FT9 A;  4N5C A;  4XI0 A;  1IHG A;  2QFC A;  4I2Z A;  3RO2 A;  4U04 A;  3GW4 A;  4G2V A;  3RJV A;  4B94 A;  3AS8 A;  4GZ6 A;  2XGM A;  3CVN A;  4CGV A;  2WQH A;  2Q7F A;  3LCA A;  5G04 C;  5DIZ A;  5CCL A;  2FO7 A;  3IEG A;  1KT1 A;  2C0L A;  4UQY A;  1FCH A;  4BT8 A;  4BT9 A;  3UPV A;  1NZN A;  5AYW D;  5EKQ D;  3AS5 A;  1ELW A;  3ZPJ A;  3S7D A;  2VGY A;  2YHC A;  1B89 A;  2IF4 A;  1WM5 A;  1HH8 A;  3Q4A B;  4I9C A;  2IFU A;  4HOR A;  4HOS A;  4I2W A;  4GYW A;  4AM9 A;  1OUV A;  1NA0 A;  3LPZ A;  1QZ2 A;  5JJ6 A;  2YQ8 A;  3U4T A;  2C0M A;  2XGS A;  4UI9 C;  4RG6 A;  2UY1 B;  3EDT B;  2VGX A;  4JL0 A;  4IN3 B;  4HOU A;  4CDR A;  2FBN A;  4N3A A;  5JJT A;  4NRH B;  3RU0 A;  3ASH A;  4U07 A;  3ASD A;  3HYM B;  2GW1 A;  3K9I A;  4F3V A;  3LY8 A;  4GPK A;  3RKV A;  2JLB A;  4WUY A;  3QKY A;  5HI7 A;  5ARF A;  1YA0 A;  2PQN A;  2LNI A;  3CV0 A;  5G05 J;  4ABN A;  5CHE E;  4J8E A;  3ZHE B;  5D0Q D;  3Q47 B;  3OXG A;  4JA7 A;  5A6C A;  4AIF A;  2VQ2 A;  1ELR A;  4U0U A;  4WNE A;  2J9Q A;  4G25 A;  3QWW A;  2PQR A;  4APO A;  3FWV A;  2PL2 A;  3CKC A;  4G1T A;  4UQZ A;  4Y6C A;  5DBK A;  2L6J A;  1QQE A;  2XGO A;  2VYI A;  5FJY A;  4O6F A;  1IYG A;  3PE3 A;  4I9E A;  3FP3 A;  3KS2 A;  3PE4 A;  5D0O D;  3ULQ A;  4UQX A;  5EX0 A;  4G23 A;  5BT1 A;  3GZ2 A;  4H7X A;  1WAO 1;  4J0U A;  2LSV A;  4N3C A;  3SF4 A;  3OXF A; 
#chains in the Genus database with same CATH topology
 1TJF A;  4GA1 A;  1BI8 B;  3CIA A;  3QJZ A;  3Q15 A;  1S64 A;  2VJ8 A;  2CFZ A;  2LSU A;  4YDY A;  3L08 A;  4A1S A;  2KCL A;  4GTS A;  3S7B A;  3AG2 E;  5BPP A;  3SBT B;  4TXP A;  3KEA A;  3TAX A;  3LS8 A;  3CK7 A;  5LFA A;  1D8E A;  2C2L A;  3PH0 C;  3L17 A;  3VTY A;  2WXM A;  3R7R A;  4CZ2 D;  4HRL A;  2PZI A;  3UUX A;  3S7J A;  1HS6 A;  3QWP A;  4D10 C;  3E32 A;  1MZC A;  4JEU A;  4UWK A;  2M63 A;  2DZO A;  4CCA A;  2YHE A;  2WXK A;  4K5B A;  4YVO A;  1SA4 A;  4ILI A;  3KD7 A;  4M3O A;  4ANV A;  3J5Q B;  2V5F A;  3OAW A;  4QQI A;  2OCC E;  2R5S A;  3L22 A;  5FWQ A;  4GZ5 A;  3HG0 D;  2XPI A;  2OOE A;  2I6H A;  5ANL A;  4A55 A;  1KT0 A;  1OWL A;  4F6R D;  3AG3 E;  3QDN A;  3FUD A;  3UM2 A;  5G04 J;  4L9P A;  1H6K A;  4KBQ A;  2B0O E;  3V31 A;  4A1G A;  3HVE A;  4BWR A;  1WY6 A;  4N2S A;  3CVV A;  2OV8 A;  3T9K A;  5CED B;  3ZGQ A;  3KAE A;  4JHJ A;  3SBS A;  3V2X A;  2GRM A;  1N11 A;  3DSU A;  3ZKJ A;  2PM7 A;  4J7W A;  4EQF A;  5C2Y A;  4B8C B;  4ANU A;  5CCM A;  2WPV A;  1S70 B;  2OEV A;  3PEV B;  3SNX A;  4TRQ A;  2J09 A;  2IOL A;  3OXL A;  4BFR A;  4DX7 D;  5FQ8 A;  3MEK A;  2LAH A;  1JCR A;  2R17 C;  4BTB A;  4F7A A;  1KLX A;  1INZ A;  5KJN A;  2CG2 A;  4N39 A;  2HR2 A;  3LJ3 A;  3BU8 A;  3T5V A;  1OWP A;  5CEC B;  3RO3 A;  3HXE A;  2WXO A;  2I1J A;  2WB2 A;  3CVQ A;  1KZP A;  3APC A;  2IU1 A;  4YDE A;  3CHM A;  2BED A;  4HI8 A;  3CLJ A;  2WMO A;  3FH8 A;  1FT1 A;  1E8Z A;  4DRX E;  2FF4 A;  3LKU A;  3AAA C;  3L9T A;  4I1O B;  4W9R A;  2KCV A;  1OY3 D;  3E33 A;  4P29 A;  3PNL B;  3CKB A;  5AQ9 A;  3UIN C;  1DNP A;  4LER A;  3EU9 A;  1Z5S C;  2KXP C;  5AJD A;  1E96 B;  2KC7 A;  2KCK A;  3IV0 A;  4IYP A;  4XI0 A;  3V79 K;  2GRN B;  4I6E A;  1E8Y A;  2X38 A;  5JHB A;  3EHM A;  4G2V A;  3QNK A;  4LUN U;  3AS8 A;  3ABL E;  1DCE A;  1NP7 A;  2ETB A;  2J4D A;  2XGM A;  1IHB A;  3QAQ A;  1H6P A;  5ENO D;  2IJG X;  2GRP B;  2FO7 A;  1KT1 A;  2C0L A;  5ENT D;  4BT9 A;  3B13 A;  2XEE A;  4JPS A;  3TWU A;  4HVB A;  2GRL A;  3D9L A;  4GZD A;  1NL4 A;  3B95 A;  4DI4 A;  2VGY A;  2CHW A;  2V0P A;  2LXL A;  2WXN A;  3TXM A;  1WM5 A;  4TUU A;  1E7U A;  3G2T A;  4KZC A;  5FIO A;  3CST A;  3JQ0 A;  2PNN A;  4I2W A;  4GTP A;  3D9I A;  2H6I A;  3D9N A;  1MJ0 A;  2IY0 C;  2WMN A;  3BQO A;  3LPZ A;  4PS7 A;  3IHY A;  3RSE G;  3WG7 E;  3DSS A;  4FLH A;  1AWC B;  2DWZ A;  3BG1 B;  3MJW A;  3EDT B;  4J8Y A;  2VGX A;  1O1S A;  5J90 A;  3EIQ C;  2MRI A;  1SZ9 A;  1SW6 A;  4EPZ A;  4NRH B;  5CBO A;  4BSZ B;  1HFA A;  3RU0 A;  3ASH A;  1ZB1 A;  3TWW A;  3ASD A;  3K9I A;  3W9F A;  3G2V A;  4DX1 A;  5ENP D;  1H2T C;  3RKV A;  4FHJ A;  4QFV A;  3B7R L;  4ZFH A;  4R7L A;  2V4L A;  1BD8 A;  4J6I A;  5G05 J;  3CV0 A;  3UX4 A;  4ABN A;  4JA7 A;  5FQ7 A;  4AIF A;  3T8K A;  3L16 A;  2NYJ A;  1DCQ A;  4WNE A;  4G25 A;  5EN5 D;  3BUA A;  1Z3Y A;  2L9B A;  2PL2 A;  2VTB A;  4XEI G;  3ESL A;  4WWP A;  1TN8 A;  3PZ3 A;  3SFY A;  3TWQ A;  1QQE A;  4UWL A;  5FJY A;  4O6F A;  2DZN A;  3B7U X;  4I9E A;  3FP3 A;  3R9M A;  2X3M A;  3L82 A;  1YCS B;  3GZ2 A;  3VLE A;  4J0U A;  3APD A;  5ENN A;  3DSV A;  5M72 A;  1ZBP A;  3GYZ A;  3NF1 A;  3EIJ A;  5ARG A;  3JXI A;  4N3B A;  4HXI A;  1HU3 A;  2E2E A;  3EU5 A;  1H19 A;  4I17 A;  4DX5 D;  2NC9 A;  1O1T A;  3Q5M A;  4AY5 A;  4WWO A;  1KZO A;  2XEV A;  4ILH B;  4GML A;  4O1P A;  3AG1 E;  5AQB A;  3FU0 A;  3QWV A;  3S7F A;  3LDZ A;  3NOG D;  4GA0 A;  2F8X K;  2UWJ G;  4HRN A;  5B3S E;  4OAU C;  4U7E B;  1SQM A;  2XEN A;  3TG4 A;  1A17 A;  3PZ2 A;  2ZGD A;  4WWN A;  4GCO A;  1NA3 A;  1FT2 A;  1H0A A;  4G8K A;  3U66 A;  4U0S A;  1N4R A;  3C98 A;  1OT8 A;  2EIJ E;  4O60 A;  3DEO A;  1HXI A;  3DPY A;  4XZ4 A;  2XCB A;  3TWR A;  4TXQ A;  4HOQ A;  2RFA A;  4GYY A;  1BI7 B;  3UM0 A;  3ASG A;  4L23 A;  1EF1 C;  4UWF A;  3FH7 A;  4JHR A;  3ZN3 A;  5LCW C;  4NAC A;  4GA2 A;  5KNH D;  1N95 A;  2FEZ A;  3L6A A;  3RIB A;  2A5U A;  1BLX B;  2I1K A;  1IKN D;  2R05 A;  4L2L A;  3KSQ A;  1K8K G;  3FTV A;  1EDU A;  5CBN A;  3MV2 B;  4C9B B;  3JCK C;  3ZYM A;  4AOF A;  4U0Z A;  3BG0 B;  1LD8 A;  4N2Q A;  4AJW A;  2P9K G;  3CVP A;  3TWV A;  4K5C A;  4UI9 J;  5G55 A;  4B89 A;  4C0M A;  1P5Q A;  4KZ0 A;  1DVP A;  3DSX A;  4YND A;  1SA5 A;  2KZT B;  5KJL A;  3UQ3 A;  3ZEF A;  5FZR A;  1FVH A;  5C1D A;  3R9A B;  3FU6 A;  3PUK A;  4HLL A;  2AVP A;  4JC8 A;  5EIL A;  3MA5 A;  1EYH A;  3HXC A;  4HOT A;  3BEE A;  3RRM B;  3UIP C;  3EHN A;  1S63 A;  3PRZ A;  4EZK A;  4FHK A;  3MKQ B;  4MS6 A;  4AVX A;  4F1S A;  2QYU A;  1HZ4 A;  4TV3 A;  3TWT A;  2MYO A;  3DBS A;  4DLO A;  3DRA A;  4GCN A;  5AIJ A;  3ZFW A;  3QOU A;  2L0I A;  5CEA A;  3MZL B;  5EX3 A;  4Y6W A;  1TN6 A;  2IO3 C;  2AXV A;  4OAV B;  4ACK A;  3FY4 A;  3CVL A;  3JQ1 A;  5FZS A;  4GTT A;  2XS1 A;  4L7T A;  1U2V G;  3I3N A;  1Q2Z A;  2OEW A;  5KNG A;  5FT9 A;  4MKT A;  3D9J A;  1MHQ A;  1O1R A;  3FUK A;  1EPU A;  3NZU A;  2LAI A;  5KWD A;  3FTZ A;  3R7Q A;  4CEM A;  4U04 A;  4L2Y A;  4E6H A;  3GW4 A;  1JCS A;  3RJV A;  1JWF A;  2Y3A A;  5E75 A;  3PRE A;  4GMR A;  3CR3 A;  4B94 A;  3PEU B;  3NOC D;  5BV1 A;  2J8S D;  3NAW A;  4K5A B;  5AN8 A;  3B7B A;  4CGV A;  1K3Z D;  4YDW A;  2WXL A;  2Q7F A;  4DLQ A;  5G04 C;  3IEG A;  5EYP F;  4UQY A;  1FCH A;  2VSO E;  3FUL A;  2R59 A;  1NZN A;  3ONK A;  5AYW D;  5BXO A;  1MYO A;  3RRN B;  4Q94 A;  3PZ1 A;  5CER B;  1KPS B;  2GRR B;  3ZPJ A;  1AP7 A;  4B8A A;  1TYQ G;  1B89 A;  4FAD A;  3HVE B;  5D2M C;  3SFZ A;  2BF0 X;  2ZIR A;  2H6G A;  4FUL A;  4HOR A;  4EEC A;  2BTD A;  1IQU A;  4HOS A;  1K1A A;  1TNZ A;  4LG6 A;  4KVM A;  1OUV A;  1NA0 A;  2RG8 A;  3CHR A;  2YQ8 A;  4CT4 A;  4UWH A;  3CVY A;  3UT8 A;  3DWL G;  2RFM A;  4RG6 A;  4EBA G;  4L1B A;  4JL0 A;  4G11 A;  2XEH A;  4IN3 B;  4N3A A;  2Y69 E;  2L0T B;  3FTY A;  4GTQ A;  5CRV A;  4U07 A;  1BPO A;  3D3M A;  1NFI E;  3HYM B;  2NSZ A;  4FU3 A;  2AJA A;  3CVW A;  2XZT G;  5JA4 D;  2F8Y A;  2ILR A;  1UW4 B;  3UT4 A;  3ABM E;  3QKY A;  5AEN A;  2IOS A;  3LEW A;  1XGW A;  1YA0 A;  2LNI A;  3B7T A;  3ZHE B;  4HQD A;  3Q47 B;  5AQA A;  3TXN A;  4MRU A;  4JXT A;  3IBE A;  1ELR A;  4B0Z A;  4U0U A;  3D9M A;  2P9U G;  3QWW A;  2PQR A;  5ANR A;  4GTM A;  3AU5 A;  4XX5 A;  4GTV A;  1D9S A;  2J4B A;  3ZYQ A;  4BSX A;  4G1T A;  4Y6C A;  5FQ4 A;  2XGO A;  4EZJ A;  4B93 B;  4GB9 A;  1IYG A;  4I6J A;  3PE3 A;  2WVI A;  4A3V A;  1MX6 A;  4BES A;  1FVF A;  3C3O A;  4HS2 A;  1QYM A;  5CMW A;  3HHM A;  4I6G A;  4DI3 A;  4H7X A;  1WAO 1;  3CSF A;  3AG4 E;  2OVB A;  4RLY A;  4N3C A;  2DIW A;  3UM1 A;  3KSL A;  5T3R A;  5BW8 C;  2ETA A;  3CHP A;  4XI9 A;  3SO8 A;  2AXZ A;  5E76 A;  4LEU A;  3TGO A;  2AW6 A;  3DST A;  4H7Y A;  3FUJ A;  1V55 E;  2LO6 A;  4RG9 A;  2R03 A;  4YVQ C;  1OWN A;  4FJY A;  1PY1 A;  2P58 C;  2ZU6 B;  2OVF A;  3EJN A;  2A5E A;  1WDY A;  3PDN A;  3UXG A;  4N5Q A;  4ACL A;  2X6K A;  3B7S A;  2KAT A;  1V54 E;  3ZU7 B;  2XRZ A;  4ME2 A;  3CVX A;  2X6J A;  5KCM A;  1ZU2 A;  3ZYL A;  3FTW A;  3D9H A;  3IHV A;  5HS0 A;  3Q78 A;  3SI5 A;  1MX4 A;  3C3Q A;  4HBD A;  4FJZ A;  2FO1 E;  4EBA A;  1WG0 A;  3Q49 B;  1JWG A;  1FPP A;  3U3W A;  2DYR E;  4BTA A;  3CHQ A;  4XKB A;  3E34 A;  3CQG B;  2UY1 A;  5EDS A;  3EUV A;  3ONL A;  5KJK A;  3URZ A;  1N0R A;  4ATZ D;  1H2V C;  4G26 A;  2WM9 A;  3Q79 A;  4J8F A;  3FTS A;  3SD5 A;  1H2U A;  4GAA A;  2VGX B;  3CVU A;  4GYO A;  2ZIS A;  3LY7 A;  2BKK B;  2VSN A;  1RZ4 A;  2R2L A;  2VSX E;  5G05 C;  2KM4 A;  1N4Q A;  2CG3 A;  1TNY A;  3UIO C;  4C48 B;  1A5E A;  3J5P A;  1Y8M A;  3U9W A;  2PM6 A;  4KT6 B;  3AS4 A;  3Q9U C;  2J08 A;  3O48 A;  4X8Q A;  2WQ6 A;  1H6O A;  1JCQ A;  2DVW A;  3TG5 A;  4JD2 G;  4U8V D;  3E4B A;  4HB5 A;  1W3B A;  4KYO B;  4NUR A;  2YIN A;  4I43 A;  3FFL A;  5T4Y A;  2HO1 A;  1UOH A;  2EQX A;  1X5B A;  1UN8 A;  2VTB B;  4ZHB A;  5HQ8 A;  3ASO E;  2MHK A;  3SHF A;  3LY9 A;  3HDX A;  5IY5 E;  4DK5 A;  3MKR A;  5KBA A;  3CK8 A;  5LCW J;  3FH5 A;  5ENQ D;  5ENS D;  4AY6 A;  1QNF A;  4UWG A;  2EIL E;  2FUL A;  4DX2 A;  3L54 A;  1HX8 A;  4LNB A;  3GZS A;  3ESK A;  1TR4 A;  3ASF A;  4IRU A;  4I1A A;  1L5J A;  2OND A;  2WXI A;  2HYZ A;  1OWM A;  4J8S A;  2VGE A;  2Y1L E;  3JXJ A;  3TJP A;  2AXU A;  2QZA A;  2QFC A;  3G2U A;  5ITZ F;  3DXM G;  4BEP A;  1OCC E;  4I2Z A;  3ZUV B;  4GTO A;  3EHQ A;  5AAO A;  3ULE G;  5B1B E;  5JMN D;  4U96 D;  3MKQ A;  2I9C A;  3V30 A;  4JZY A;  2H6H A;  4GZ6 A;  4BX9 A;  3F6Q A;  2IQC A;  1UG3 A;  2XS8 A;  3SY2 A;  3LCA A;  2YNQ A;  3APF A;  1D8D A;  1OXJ A;  5DIZ A;  4U63 A;  2BKG A;  1UJJ A;  2JAB A;  2CFU A;  2WQ7 A;  2IEJ A;  3HIZ A;  4BT8 A;  4CRW A;  2XRY A;  3ZW3 A;  2V5Q C;  3AS5 A;  2P9S G;  2WXF A;  3FHE A;  5AJL A;  2YHC A;  3NQP A;  4GPM A;  4YDO A;  3VLD A;  4Q69 A;  3HXD A;  3Q75 A;  3FEX A;  4HRM B;  2IFU A;  2Y0B G;  4KMO A;  3EHR A;  4AM9 A;  2WXG A;  3TWS A;  1QZ2 A;  4CDN A;  3PS6 A;  2C0M A;  4UI9 C;  3HRA A;  3FEY A;  4HOU A;  4CDR A;  1N4S A;  5JJT A;  2HE0 A;  3OTN A;  1E8W A;  5H7P A;  3ZYK A;  1HG2 A;  5EID A;  2GW1 A;  2CHZ A;  4F3V A;  1N4P A;  3LY8 A;  2A4Z A;  4DUI A;  2JLB A;  4BY6 A;  3SQV A;  4CDM A;  4PUC A;  5FQ6 A;  3UM3 A;  1N94 A;  3V2O A;  4EZL A;  1MQS A;  3DSW A;  3VLF A;  5D0Q D;  3LXU X;  3MGB A;  1TNU A;  3PVL A;  1SVX A;  2J9Q A;  3AJI A;  3JUI A;  3QAR A;  3FWV A;  3T8M A;  3T5X A;  3U64 A;  3D9K A;  1N52 A;  4ILG A;  3ISM C;  4BX8 A;  2EIN E;  2KBX A;  5DBK A;  5HKP A;  3FUF A;  2VYI A;  1Y6I A;  3DXK G;  1DC2 A;  5D0O D;  3Q73 A;  1LD7 A;  4UQX A;  5B1A E;  5EX0 A;  2LXM A;  5BT1 A;  4FLB A;  4F1P A;  4G8L A;  4U8H A;  3KEZ A;  3SF4 A;  3OXF A;  3SFX A;  4AEZ C;  1PC2 A;  4OVU A;  4PH4 B;  3I5P A;  4J8D A;  1OWO A;  3G2W A;  4LRZ A;  4DPR A;  2QC9 A;  5BV0 A;  2F0Y A;  4XKC A;  1IQR A;  3ZHE A;  5FZQ A;  4LNU D;  2FI7 A;  4GZ3 A;  4HFG A;  3WXX A;  1X81 A;  4K0R A;  4NIK A;  3UMV A;  2Y4T A;  4WNF A;  4ATG A;  3Q7A A;  1TN7 A;  2P9P G;  5FTP A;  1N0Q A;  3MV3 B;  2NXP A;  3JYS A;  4GU5 A;  2BUG A;  3HXF A;  2XPZ A;  4C0E A;  3TL5 A;  4WNG A;  2EIM E;  4U8Y D;  3GZ1 A;  4JHK A;  3LYA A;  4NQ0 A;  4JB8 P;  1N54 A;  4LSZ E;  5J08 A;  2LUH A;  2WXJ A;  1HF8 A;  4MBG A;  2VSY A;  3CQC B;  4FA6 A;  2I2O A;  2DBA A;  2V8S E;  3TWX A;  3FUN A;  3ZIM A;  4CGW A;  2WXH A;  2QYJ A;  3QK0 A;  2XCC A;  2RD0 A;  3PNT B;  3C3R A;  4XE0 A;  1MX2 A;  4A3T A;  2GRO B;  2RKK A;  3CGH A;  5JJ7 A;  1XNF A;  3LVQ E;  1U3D A;  3PZ4 A;  3SZ7 A;  2P9I G;  4XIF A;  5KJM A;  5LX8 A;  3HXB A;  1E7V A;  4AV7 A;  3NBN B;  1NI1 A;  1YYH A;  2DCP A;  2X6F A;  4DX6 D;  1RW2 A;  5EYL A;  1TJC A;  3FUH A;  5BNW A;  2Y4U A;  5T8I A;  5A23 A;  2DYS E;  3MCX A;  2IO2 C;  1N9A A;  3VTX A;  2B6C A;  3CK9 A;  3CHS A;  1HG5 A;  3ZNG A;  4PS3 A;  3CEQ A;  3QC1 A;  2R02 A;  4GMJ A;  2P2C P;  3C72 A;  3DPD A;  2X6H A;  5A7D B;  3G2S A;  1UJK A;  4RVB A;  2XHE A;  4UUC A;  4CYM D;  4O1O A;  4WND A;  2HM8 A;  1O5M A;  4UI9 K;  1LF8 A;  1PAQ A;  4APF A;  2P9N G;  3N71 A;  4I1M A;  5EIB E;  5LOZ A;  4LNG A;  4TUM A;  3CHO A;  3FUM A;  4BER A;  4JA9 A;  1LTX A;  4G24 A;  5AAR A;  1E90 A;  3AU4 A;  4HI9 A;  4KVO A;  5ENR D;  4KXK B;  4DJA A;  3UTM A;  4Z68 A;  5HRY A;  4RSY A;  3ZXS A;  3X2Q E;  3UI2 A;  2WXP A;  4K03 A;  1Z6T A;  3MYV A;  3DEP A;  5CRU A;  1ELK A;  3RK6 A;  2QY7 A;  4ANW A;  3P1U A;  4N5C A;  3FUI A;  3FTX A;  1IHG A;  5JHA A;  3IXE A;  3ULY A;  4EHM A;  3IKO B;  2ZXW E;  1OCZ E;  3I4G A;  3RO2 A;  2ETC A;  4BET A;  3D9P A;  3I4R B;  1BU9 A;  1OCO E;  4JVS A;  1U3C A;  2J07 A;  5BXU A;  3FTU A;  3RAU A;  1HO8 A;  3CVN A;  4FP7 A;  4V3I A;  3L13 A;  4JEH A;  1S0P A;  4OYS A;  2WQH A;  3C5R A;  1JUQ A;  4RQI A;  3ZXP A;  3ML8 A;  5CCL A;  5CMY A;  4MLP A;  3NZS A;  3UPV A;  4AP2 A;  4E85 A;  3ZVV A;  4OVV A;  3NB2 A;  5EKQ D;  4F53 A;  1ELW A;  4FC8 A;  2L6B A;  3S7D A;  4TXR A;  4PS8 A;  3SGH A;  3Q9N C;  2IF4 A;  1K1B A;  2ZGG A;  3ENE A;  1HH8 A;  3Q4A B;  2EIK E;  4I9C A;  4U95 D;  2XPY A;  4AXH A;  1SZA A;  2CHX A;  4GYW A;  2V4H C;  4HNA D;  4PDX A;  1OCR E;  4GZC A;  1UN9 A;  2JEK A;  1IXV A;  5JJ6 A;  3U4T A;  3LVR E;  3FUE A;  3QB2 A;  2XGS A;  2UY1 B;  5LP0 A;  3UT7 A;  1TNO A;  5BUZ A;  2MOW A;  2P9L G;  2FBN A;  3O4Z A;  4GTR A;  4A63 B;  4ANX A;  3ASN E;  1HE8 A;  2ION A;  2XQ0 A;  1QBQ A;  2H6F A;  3LJN A;  1GW6 A;  3S2A A;  2AWI A;  4JW1 A;  2F37 A;  3UKR G;  2KZT A;  2J49 A;  4URK A;  4GPK A;  3FU5 A;  4WUY A;  3E37 A;  5HI7 A;  5ARF A;  4WAF A;  2WXQ A;  3ZRH A;  2E0I A;  2X6I A;  2PQN A;  3JUE A;  3FU3 A;  4CT0 A;  5CHE E;  4J8E A;  3OXG A;  3D9O A;  3PUJ A;  5A6C A;  1TEZ A;  3FDH A;  2VQ2 A;  4IUL A;  1YMP A;  3P2B A;  5FIN A;  4APO A;  5D66 A;  3PZD A;  3MX3 A;  1E8X A;  3CKC A;  4UQZ A;  4Q96 A;  3Q7F A;  3ML9 A;  3RRU A;  2L6J A;  3UKU G;  5AQ7 A;  1JPL A;  3E30 A;  1Z3X A;  3ABK E;  1G3N B;  4M7C A;  3KS2 A;  1VDY A;  2WXR A;  3PE4 A;  2GGF A;  4HLE A;  3ULQ A;  4G23 A;  5G2N A;  4LCT A;  2XZD G;  3W9G A;  1TNB A;  2LSV A;  2GRQ B; 
#chains in the Genus database with same CATH homology
 1TJF A;  4GA1 A;  5ENN A;  4AEZ C;  5M72 A;  3CIA A;  3QJZ A;  1ZBP A;  3Q15 A;  5T3R A;  3GYZ A;  5BW8 C;  2VJ8 A;  1PC2 A;  4OVU A;  3CHP A;  4PH4 B;  4XI9 A;  2CFZ A;  2LSU A;  3I5P A;  3L08 A;  3NF1 A;  4CT0 A;  4J8D A;  4A1S A;  3EIJ A;  2AXZ A;  2KCL A;  5ARG A;  1OWO A;  3S7B A;  3G2W A;  4LRZ A;  4N3B A;  4DPR A;  5BV0 A;  5E76 A;  5BPP A;  3SBT B;  4HXI A;  4XKC A;  4LEU A;  1IQR A;  1HU3 A;  2E2E A;  3LS8 A;  3TAX A;  2AW6 A;  3CK7 A;  3ZHE A;  3TGO A;  1H19 A;  4I17 A;  5FZQ A;  5LFA A;  4H7Y A;  2NC9 A;  3FUJ A;  2C2L A;  3PH0 C;  2FI7 A;  4GZ3 A;  4HFG A;  3L17 A;  3VTY A;  2WXM A;  2LO6 A;  3WXX A;  3R7R A;  2PZI A;  3Q5M A;  4RG9 A;  3UUX A;  4WWO A;  4K0R A;  4AY5 A;  3UMV A;  4YVQ C;  1OWN A;  2Y4T A;  4WNF A;  4ATG A;  3S7J A;  4FJY A;  2XEV A;  4ILH B;  5FTP A;  1HS6 A;  3QWP A;  4D10 C;  4GML A;  3MV3 B;  2NXP A;  1PY1 A;  3FU0 A;  2P58 C;  2ZU6 B;  2BUG A;  3JYS A;  4GU5 A;  3QWV A;  3S7F A;  3LDZ A;  4JEU A;  2OVF A;  4GA0 A;  2XPZ A;  3EJN A;  4UWK A;  2UWJ G;  4C0E A;  3PDN A;  3TL5 A;  1SQM A;  2M63 A;  4WNG A;  4CCA A;  2YHE A;  3GZ1 A;  3TG4 A;  2WXK A;  4YVO A;  4ILI A;  1A17 A;  3KD7 A;  4JHK A;  4M3O A;  3LYA A;  4NQ0 A;  4ACL A;  4ANV A;  2V5F A;  2X6K A;  3B7S A;  3OAW A;  1N54 A;  2KAT A;  5J08 A;  2WXJ A;  2R5S A;  2XRZ A;  1HF8 A;  3L22 A;  4ME2 A;  4WWN A;  2VSY A;  3CVX A;  5FWQ A;  3CQC B;  4GCO A;  2X6J A;  4FA6 A;  4GZ5 A;  1NA3 A;  2DBA A;  2I2O A;  2V8S E;  1H0A A;  2XPI A;  5KCM A;  1ZU2 A;  2OOE A;  3FTW A;  3ZYL A;  2I6H A;  3FUN A;  3U66 A;  5ANL A;  4U0S A;  3ZIM A;  4CGW A;  4A55 A;  3IHV A;  1KT0 A;  2WXH A;  1OWL A;  3QK0 A;  2XCC A;  3QDN A;  3C98 A;  3SI5 A;  2RD0 A;  3PNT B;  3FUD A;  5G04 J;  4XE0 A;  1HXI A;  1H6K A;  4A3T A;  4KBQ A;  4FJZ A;  4XZ4 A;  4A1G A;  3CGH A;  3HVE A;  4BWR A;  1WY6 A;  2XCB A;  4EBA A;  3CVV A;  4N2S A;  2OV8 A;  4HOQ A;  5JJ7 A;  4GYY A;  3ASG A;  3Q49 B;  4L23 A;  3ZGQ A;  1EF1 C;  3KAE A;  1JWG A;  4UWF A;  3FH7 A;  4JHR A;  4JHJ A;  3SBS A;  1XNF A;  3ZN3 A;  5LCW C;  4NAC A;  4GA2 A;  3LVQ E;  2FEZ A;  3U3W A;  2GRM A;  1U3D A;  3L6A A;  4BTA A;  3RIB A;  2A5U A;  3SZ7 A;  3CHQ A;  2I1K A;  4XIF A;  5KJM A;  5LX8 A;  1E7V A;  2PM7 A;  4L2L A;  4XKB A;  4AV7 A;  4EQF A;  3CQG B;  2UY1 A;  2DCP A;  2X6F A;  5EDS A;  5C2Y A;  3ONL A;  4B8C B;  4ANU A;  5KJK A;  3URZ A;  1TJC A;  3FTV A;  3FUH A;  5CCM A;  5BNW A;  1EDU A;  2WPV A;  2Y4U A;  3MV2 B;  5T8I A;  1H2V C;  4G26 A;  4C9B B;  3PEV B;  3SNX A;  2WM9 A;  3JCK C;  4TRQ A;  5A23 A;  4J8F A;  3ZYM A;  4AOF A;  3MCX A;  2J09 A;  2IOL A;  3FTS A;  3OXL A;  4U0Z A;  1H2U A;  3SD5 A;  4GAA A;  4BFR A;  2VGX B;  3CVU A;  3BG0 B;  4GYO A;  3VTX A;  3LY7 A;  3CK9 A;  3CHS A;  1HG5 A;  4AJW A;  4N2Q A;  2VSN A;  5FQ8 A;  3CVP A;  3MEK A;  2LAH A;  2VSX E;  4PS3 A;  4UI9 J;  5G05 C;  3CEQ A;  5G55 A;  2R17 C;  3QC1 A;  4BTB A;  4F7A A;  1KLX A;  4B89 A;  4GMJ A;  2KM4 A;  3DPD A;  4C0M A;  1INZ A;  1P5Q A;  2CG2 A;  2X6H A;  4KZ0 A;  1DVP A;  4N39 A;  5A7D B;  5KJN A;  3G2S A;  2HR2 A;  2CG3 A;  3LJ3 A;  4YND A;  1UJK A;  3T5V A;  1Y8M A;  1OWP A;  4RVB A;  2KZT B;  4HLE A;  5KJL A;  3UQ3 A;  3U9W A;  2PM6 A;  3RO3 A;  2XHE A;  4KT6 B;  2WXO A;  3AS4 A;  4WND A;  2HM8 A;  5FZR A;  3ZEF A;  4UI9 K;  1FVH A;  1LF8 A;  2I1J A;  2J08 A;  5C1D A;  2WB2 A;  3O48 A;  3CVQ A;  1PAQ A;  3R9A B;  2WQ6 A;  4APF A;  3APC A;  2IU1 A;  3FU6 A;  3N71 A;  3TG5 A;  3CHM A;  3PUK A;  4I1M A;  5LOZ A;  2AVP A;  4JC8 A;  3E4B A;  3CLJ A;  3MA5 A;  1EYH A;  2WMO A;  1W3B A;  4HOT A;  3FH8 A;  3CHO A;  3FUM A;  3BEE A;  4KYO B;  3RRM B;  4NUR A;  4JA9 A;  2YIN A;  3EHN A;  4G24 A;  4I43 A;  1E90 A;  3PRZ A;  3AU4 A;  3FFL A;  4KVO A;  5T4Y A;  4KXK B;  2HO1 A;  2EQX A;  4FHK A;  4DJA A;  4EZK A;  1X5B A;  3MKQ B;  1E8Z A;  1UN8 A;  2VTB B;  2FF4 A;  3LKU A;  5HQ8 A;  2MHK A;  3SHF A;  3LY9 A;  4MS6 A;  3HDX A;  4AVX A;  4F1S A;  4DK5 A;  1HZ4 A;  3MKR A;  4TV3 A;  3CK8 A;  4I1O B;  5LCW J;  3DBS A;  3FH5 A;  2KCV A;  4W9R A;  4DLO A;  4AY6 A;  1QNF A;  4GCN A;  4UWG A;  5AIJ A;  4RSY A;  3ZFW A;  3QOU A;  4P29 A;  3PNL B;  3ZXS A;  2L0I A;  3CKB A;  2FUL A;  3MZL B;  5EX3 A;  3L54 A;  1HX8 A;  2WXP A;  4K03 A;  1Z6T A;  3MYV A;  4Y6W A;  2AXV A;  3GZS A;  4ACK A;  1DNP A;  3ESK A;  3FY4 A;  4LER A;  3CVL A;  3ASF A;  4IRU A;  3JQ1 A;  5FZS A;  4I1A A;  1ELK A;  4L7T A;  2QY7 A;  3RK6 A;  4ANW A;  3P1U A;  1L5J A;  2OND A;  2WXI A;  2HYZ A;  5AJD A;  1E96 B;  3I3N A;  1OWM A;  4J8S A;  2KC7 A;  2KCK A;  5FT9 A;  4MKT A;  4N5C A;  3TJP A;  3FUI A;  3D9J A;  3FTX A;  3IV0 A;  4IYP A;  2AXU A;  4XI0 A;  1MHQ A;  1IHG A;  4I6E A;  1E8Y A;  5JHA A;  2QFC A;  3G2U A;  3IKO B;  2X38 A;  4I2Z A;  3FUK A;  1EPU A;  5JHB A;  3I4G A;  3NZU A;  3EHM A;  2LAI A;  3RO2 A;  3FTZ A;  3R7Q A;  4CEM A;  4U04 A;  4L2Y A;  4E6H A;  3GW4 A;  3D9P A;  3I4R B;  4G2V A;  3RJV A;  1JWF A;  2Y3A A;  3QNK A;  5E75 A;  3PRE A;  3CR3 A;  3MKQ A;  2I9C A;  4JVS A;  1U3C A;  2J07 A;  4B94 A;  3PEU B;  3FTU A;  4LUN U;  5BV1 A;  3AS8 A;  4JZY A;  4GZ6 A;  1NP7 A;  4BX9 A;  2J4D A;  1HO8 A;  2XGM A;  3CVN A;  3QAQ A;  4FP7 A;  4V3I A;  2IQC A;  3L13 A;  1UG3 A;  4CGV A;  4JEH A;  1S0P A;  2WXL A;  4OYS A;  2WQH A;  2Q7F A;  4DLQ A;  1JUQ A;  3LCA A;  2YNQ A;  3ML8 A;  3APF A;  5G04 C;  2IJG X;  5DIZ A;  4U63 A;  5CMY A;  5CCL A;  2FO7 A;  4MLP A;  3IEG A;  1KT1 A;  1UJJ A;  2C0L A;  4UQY A;  2CFU A;  1FCH A;  2VSO E;  3FUL A;  3NZS A;  3HIZ A;  4BT8 A;  2WQ7 A;  4BT9 A;  3UPV A;  4AP2 A;  2R59 A;  4E85 A;  4CRW A;  3B13 A;  1NZN A;  3ZVV A;  3ONK A;  5AYW D;  2XRY A;  3ZW3 A;  4OVV A;  4JPS A;  4HVB A;  2GRL A;  5EKQ D;  3RRN B;  4Q94 A;  3AS5 A;  3D9L A;  4GZD A;  4F53 A;  1ELW A;  4FC8 A;  2WXF A;  3ZPJ A;  4DI4 A;  3S7D A;  3FHE A;  4B8A A;  2VGY A;  2CHW A;  5AJL A;  4PS8 A;  3SGH A;  2V0P A;  2YHC A;  1B89 A;  2IF4 A;  3NQP A;  2WXN A;  4FAD A;  3ENE A;  3HVE B;  3TXM A;  1WM5 A;  1HH8 A;  3VLD A;  3Q4A B;  3SFZ A;  4Q69 A;  2BF0 X;  3FEX A;  4I9C A;  2IFU A;  4TUU A;  4FUL A;  4HOR A;  4EEC A;  1E7U A;  3G2T A;  4KZC A;  2BTD A;  1IQU A;  2XPY A;  4AXH A;  1SZA A;  4HOS A;  2CHX A;  3CST A;  4KMO A;  3JQ0 A;  4I2W A;  4GYW A;  4AM9 A;  3D9I A;  3D9N A;  4KVM A;  1OUV A;  2WXG A;  4PDX A;  1NA0 A;  2RG8 A;  2WMN A;  3LPZ A;  4PS7 A;  4GZC A;  1UN9 A;  2JEK A;  1QZ2 A;  3IHY A;  3CHR A;  5JJ6 A;  2YQ8 A;  4CT4 A;  4UWH A;  3U4T A;  3LVR E;  4CDN A;  3FUE A;  3PS6 A;  3UT8 A;  3CVY A;  3QB2 A;  4FLH A;  2C0M A;  2XGS A;  3BG1 B;  3MJW A;  4UI9 C;  4RG6 A;  4EBA G;  2UY1 B;  3EDT B;  5LP0 A;  4L1B A;  3UT7 A;  2VGX A;  4JL0 A;  4G11 A;  3FEY A;  5BUZ A;  5J90 A;  2MOW A;  4IN3 B;  4HOU A;  3EIQ C;  4CDR A;  2FBN A;  4N3A A;  2MRI A;  3O4Z A;  5JJT A;  1SZ9 A;  2L0T B;  3OTN A;  4EPZ A;  1E8W A;  4NRH B;  3FTY A;  1HFA A;  3RU0 A;  4ANX A;  3ZYK A;  1HG2 A;  1HE8 A;  3ASH A;  2ION A;  1BPO A;  2XQ0 A;  4U07 A;  3D3M A;  3ASD A;  3HYM B;  2GW1 A;  3K9I A;  1GW6 A;  3S2A A;  2AWI A;  2CHZ A;  3G2V A;  4JW1 A;  2NSZ A;  4F3V A;  4FU3 A;  3LY8 A;  2KZT A;  2J49 A;  3CVW A;  2A4Z A;  4URK A;  4GPK A;  1H2T C;  3FU5 A;  3RKV A;  2JLB A;  2ILR A;  4BY6 A;  4WUY A;  1UW4 B;  3UT4 A;  4FHJ A;  4QFV A;  4CDM A;  3B7R L;  4PUC A;  5FQ6 A;  3QKY A;  5AEN A;  5HI7 A;  5ARF A;  4R7L A;  4WAF A;  2IOS A;  3LEW A;  1XGW A;  2WXQ A;  2V4L A;  4EZL A;  3ZRH A;  1YA0 A;  2E0I A;  2X6I A;  1MQS A;  2PQN A;  4J6I A;  2LNI A;  3CV0 A;  3FU3 A;  5G05 J;  5CHE E;  4J8E A;  3B7T A;  3UX4 A;  3VLF A;  3ZHE B;  4ABN A;  5D0Q D;  3Q47 B;  3OXG A;  4JA7 A;  3TXN A;  3D9O A;  3PUJ A;  4MRU A;  5A6C A;  3LXU X;  5FQ7 A;  3FDH A;  4AIF A;  1TEZ A;  2VQ2 A;  3MGB A;  3L16 A;  3PVL A;  3IBE A;  4JXT A;  1ELR A;  4B0Z A;  4U0U A;  4IUL A;  3D9M A;  2J9Q A;  4WNE A;  3P2B A;  4G25 A;  3QWW A;  2PQR A;  5ANR A;  4APO A;  1Z3Y A;  3PZD A;  3MX3 A;  3JUI A;  3QAR A;  2L9B A;  3FWV A;  2PL2 A;  3T8M A;  2VTB A;  3T5X A;  3U64 A;  3AU5 A;  4XX5 A;  3ESL A;  1E8X A;  3CKC A;  2J4B A;  3ZYQ A;  4BSX A;  4G1T A;  4UQZ A;  4WWP A;  3D9K A;  1N52 A;  4ILG A;  4Q96 A;  4Y6C A;  4BX8 A;  3ML9 A;  5DBK A;  3RRU A;  2L6J A;  3FUF A;  1QQE A;  5FQ4 A;  2XGO A;  2VYI A;  4EZJ A;  1Y6I A;  1JPL A;  4UWL A;  5FJY A;  4O6F A;  4GB9 A;  1IYG A;  1Z3X A;  3PE3 A;  3B7U X;  4I9E A;  4I6J A;  2WVI A;  3FP3 A;  1VDY A;  2WXR A;  3KS2 A;  2GGF A;  3PE4 A;  5D0O D;  3ULQ A;  4A3V A;  2X3M A;  1FVF A;  4UQX A;  5EX0 A;  4G23 A;  4HS2 A;  5G2N A;  5BT1 A;  4FLB A;  5CMW A;  3GZ2 A;  3HHM A;  4I6G A;  4LCT A;  4DI3 A;  4H7X A;  1WAO 1;  3CSF A;  3VLE A;  4J0U A;  2OVB A;  3APD A;  4U8H A;  3KEZ A;  2LSV A;  4N3C A;  3SF4 A;  2DIW A;  3OXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...