5G05J

Cryo-em structure of combined apo phosphorylated apc
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 179
structure length 504
sequence length 532
chains with identical sequence K
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5g05J00
2PQRA 4CDRA 4J8DA 3S7FA 4JL0A 4GZ5A 4GYWA 2LSUA 3URZA 4XI9A 2WQHA 3OXLA 3UUXA 3ZGQA 3CVPA 3CK7A 3EDTB 3LPZA 5FT9A 3MKRA 4KXKB 4ME2A 4H7YA 4XIFA 5G05J 1IHGA 1P5QA 5LCWJ 1ELWA 4CGWA 5G04J 3IEGA 5JJTA 5A6CA 2XCCA 4CGVA 1KLXA 4UQYA 3Q15A 3FWVA 3U4TA 3QWPA 2LSVA 2HR2A 2BUGA 5EKQD 4I1AA 4J8FA 4HOTA 4BTBA 2Q7FA 3ASGA 5HI7A 4YVOA 1A17A 3S7DA 5A7DB 3QDNA 4I17A 4UI9J 3QWWA 4ABNA 4JA7A 5CHEE 3KS2A 2VYIA 5M72A 3LY7A 3N71A 3PE4A 5BW8C 2IF4A 4U0SA 3RIBA 3OXGA 4BT8A 2FBNA 3Q4AB 3PDNA 2LNIA 1ZBPA 3QOUA 4J0UA 3MV2B 4BWRA 3MV3B 4APOA 1WAO1 3KD7A 5D0OD 3LY8A 4J8EA 3VTXA 4U0ZA 4BT9A 3CK8A 5FZRA 4I9CA 2HO1A 2GW1A 5FTPA 2XPIA 3AS4A 4N3BA 4B94A 4G26A 2VSNA 4IN3B 2YQ8A 3TGOA 3TAXA 1B89A 5FJYA 3ZHEA 3RU0A 4G25A 3LCAA 3JYSA 4U07A 2VQ2A 4YVQC 4O6FA 2R5SA 3NF1A 2QFCA 4GCNA 2AVPA 1TJCA 2KCKA 4KBQA 2FI7A 3ASDA 4UI9K 2KCVA 4N5CA 2NC9A 2DBAA 4G2VA 3QKYA 4N3CA 3LKUA 4KYOB 3MEKA 5KJNA 2V5FA 3CVQA 4GA0A 3MA5A 5ARGA 3VTYA 4W9RA 3UQ3A 4GPKA 3CK9A 2I6HA 3RKVA 3RO3A 3TG5A 2VGYA 2VGXA 5AYWD 1PC2A 1HXIA 4GCOA 3ESKA 2FF4A 3ZHEB 4EQFA 5BNWA 3Q49B 3AS5A 2YHCA 3Q47B 2XEVA 5HQ8A 3LYAA 4WNEA 3FP3A 5KJMA 2XGOA 2JLBA 4N3AA 5DBKA 2Y4UA 3KAEA 1NZNA 3RO2A 3TG4A 3O48A 4I2WA 4NQ0A 2VSYA 4WNGA 2P58C 4JHRA 4XI0A 1QQEA 4UI9C 5FZQA 1HH8A 4AM9A 4U04A 3ZN3A 2PZIA 4GA2A 3S7JA 3CV0A 4AY5A 4N2QA 2UY1A 4GZ6A 4JA9A 3CVLA 1XNFA 4A1SA 4N2SA 4HOSA 2ONDA 2C0MA 2VGXB 1IYGA 3Q5MA 4AIFA 2KC7A 2PQNA 4GZ3A 4UQXA 1ELRA 1KT1A 3RJVA 5BT1A 2XGMA 4WNDA 3GZ1A 4AY6A 3ZFWA 5JJ6A 3S7BA 2IFUA 4G1TA 3FFLA 4U0UA 1NA3A 4I2ZA 2UWJG 4HOQA 4G24A 4Y6CA 4UQZA 3ASHA 3ASFA 4WUYA 5KJKA 4Y6WA 1YA0A 3CKCA 1FCHA 2PL2A 4HOUA 4F3VA 3ZPJA 2KATA 3GYZA 1OUVA 3CEQA 4GYOA 4H7XA 4RG6A 2UY1B 1ZU2A 2FO7A 2E2EA 5G05C 3SF4A 5DIZA 2XCBA 5LCWC 3HYMB 3WXXA 3PE3A 4I9EA 5G04C 1HZ4A 4HORA 2L6JA 4LEUA 3GW4A 2Y4TA 5JJ7A 4GA1A 1QZ2A 2C2LA 3OXFA 4N39A 2HYZA 5EX0A 5D0QD 1E96B 4YNDA 3SZ7A 3ULQA 3K9IA 3CKBA 5CCMA 2OOEA 5ARFA 3AS8A 3UPVA 3U3WA 1NA0A 4WNFA 2J9QA 5EX3A 1KT0A 3R9AB 2WPVA 4GYYA 4G23A 3BEEA 2XGSA 2FEZA 1WM5A 3GZ2A 4NRHB 5KJLA 2KCLA 3QWVA 3LY9A 4RG9A 1Y8MA 5C1DA 3E4BA 3CVNA 2C0LA 2MHKA 4BTAA 5FZSA 1W3BA 5CCLA
chains in the Genus database with same CATH superfamily
3ISMC 5B1BE 3L17A 3C3RA 2MRIA 4J8SA 4GAAA 3NZSA 3NOGD 2WQHA 5ENTD 2P9UG 4WWOA 5AJDA 1N95A 3UUXA 2ZISA 3QAQA 3ZGQA 4PH4B 3SFZA 2WXJA 4IULA 1IQUA 3CVPA 3CK7A 3MKRA 3IBEA 5FWQA 5J08A 4A1GA 4CGWA 3ASNE 3ZU7B 4CGVA 3FTVA 4I6JA 5CMYA 4UQYA 3PZ1A 2ZIRA 4AV7A 5ENRD 3FWVA 4YDWA 1SW6A 1E8WA 3JXIA 4I1AA 5AENA 3CSFA 2X6HA 3W9FA 5ANRA 1EF1C 1LTXA 2XEHA 4YVOA 3SFXA 5A7DB 3D9PA 4UI9J 3SNXA 4PS3A 4JXTA 5CHEE 2ZGGA 2VYIA 3PE4A 4Q94A 3T9KA 4NIKA 1A5EA 4BX8A 3OXGA 4U8YD 4BX9A 1ZBPA 2BKGA 2V4HC 3D9NA 3MV2B 3U9WA 3DEPA 3PEVB 3Q79A 3IV0A 3DBSA 1E8ZA 4HBDA 1MYOA 1E8YA 1LF8A 2XPIA 5D66A 2NXPA 3AS4A 4BERA 4I6EA 3LJ3A 4G26A 4UWLA 3FH7A 2YQ8A 5ENOD 4KT6B 2DZOA 3TGOA 3ZHEA 3RU0A 1GW6A 5CRVA 2VQ2A 1TNZA 2QFCA 4DRXE 4GTTA 3VLFA 3UT4A 1BD8A 3RK6A 3ZXSA 2KCVA 2KBXA 1MZCA 3L16A 2NC9A 2WXQA 3G2TA 5BV1A 4B8CB 2DCPA 2F37A 3ENEA 2AXVA 3KSQA 4GA0A 4U8VD 4K5AB 2XPZA 3VLEA 5D2MC 3VTYA 3Q7AA 4GTSA 4XEIG 4GPKA 4HQDA 2F8XK 3MKQB 3TG5A 5CEDB 3PH0C 1PC2A 3FULA 2J07A 3Q49B 2YINA 3D9KA 4F6RD 3ZEFA 5CMWA 3Q47B 3UT7A 5LOZA 5DBKA 3KAEA 2I1KA 3HXFA 4B0ZA 3O48A 4I2WA 2P58C 3EHQA 4XI0A 1HH8A 4GB9A 4FHKA 1UN9A 4U04A 3UKRG 2PZIA 4GA2A 1UG3A 3OTNA 5T4YA 2X6JA 4K5CA 3L13A 4FLHA 4GZ6A 3UTMA 4AEZC 4JA9A 5J90A 3CVLA 4G8KA 3FY4A 3B7TA 4C0MA 1Z5SC 3L6AA 4HOSA 2WVIA 2ONDA 2C0MA 2H6GA 2ZU6B 3V30A 4B8AA 1N94A 1IYGA 4MS6A 3CSTA 3G2VA 3ZW3A 4AY6A 4UWHA 2XGMA 3GZ1A 3ZFWA 3P2BA 4B89A 3CVUA 4TV3A 3FFLA 3C5RA 5FQ4A 1BI7B 1NA3A 1YMPA 2WXNA 2KZTA 3SD5A 1S64A 3L9TA 4CEMA 3ASFA 5KJKA 3CKCA 1FCHA 3JQ1A 2OEWA 3RRMB 4I1MA 4F3VA 3ZPJA 3UI2A 4FHJA 5BV0A 3FEXA 4GYOA 5CBOA 1SZ9A 2XRZA 2DZNA 4HLEA 4EPZA 2ETBA 4A3VA 2IOLA 3HXEA 2UY1B 1KPSB 2P9PG 3UXGA 1OWPA 5G05C 3EHMA 1TEZA 2XCBA 1U3CA 3ZRHA 3WXXA 5G04C 2X6KA 1BU9A 2L6JA 4LEUA 3VLDA 3D9JA 3B7UX 3ZKJA 3CQCB 2H6FA 3ABLE 4AJWA 4G11A 2A5UA 3K9IA 4C0EA 2OOEA 2V5QC 1AP7A 4KZ0A 4ILGA 3ULEG 3AG1E 4JD2G 3UPVA 5ENSD 1N0QA 2NYJA 5BPPA 3TWUA 2QYJA 1SA4A 4E6HA 2WMOA 3PZDA 3LVQE 1KT0A 3SHFA 1V54E 1WM5A 3SI5A 3PZ4A 3GZ2A 4YDYA 3LS8A 2KCLA 2X6IA 2WM9A 3B7BA 3UM1A 2MHKA 3APDA 4LRZA 4NURA 2PQRA 2WXOA 4CDRA 4J8DA 3HVEB 1Y6IA 2NSZA 4GYWA 1HS6A 3V2XA 4OVVA 3CVXA 4XI9A 4E85A 2QY7A 1K8KG 3FTUA 3L54A 4L2YA 1QYMA 3CHOA 3OXLA 1SQMA 1E8XA 1O1RA 4XE0A 4ATZD 4JEHA 1H0AA 3I4GA 4F1SA 2CG3A 1S0PA 4LUNU 5FT9A 4ME2A 4YDOA 4UWGA 4XIFA 5G05J 1XGWA 3KEZA 3TL5A 1P5QA 3ULYA 5G04J 3O4ZA 5A6CA 4GTOA 2BTDA 1S70B 2XCCA 4DUIA 3UM3A 3Q15A 5AARA 3QWPA 2L0IA 1RW2A 2LSVA 3TWSA 2HR2A 3V2OA 5AIJA 4L2LA 5T3RA 3AG3E 3ZVVA 5HI7A 3MYVA 3Q9NC 2CFUA 4I17A 4ABNA 4JA7A 1O1TA 4HRMB 5M72A 2XRYA 3LY7A 2DIWA 2P9NG 4HLLA 3DSWA 2L9BA 2IF4A 3RSEG 2LO6A 4GMRA 4U0SA 3ZYQA 1UOHA 4TXPA 4BT8A 2FBNA 4GTMA 3FUMA 3QOUA 4Q96A 3D9HA 3L22A 5HS0A 3CIAA 2H6HA 4J8EA 4BESA 2HE0A 4I9CA 5AN8A 5FTPA 2OV8A 1N0RA 1Z3XA 3EIQC 4B94A 1H2VC 5G2NA 2EQXA 2MOWA 2WXRA 1OWLA 4WWNA 3TAXA 3QB2A 2J8SD 4G25A 2Y69E 3LCAA 4HI8A 4YVQC 3EU5A 1BLXB 2ZXWE 3LVRE 2PM7A 2GRRB 2M63A 2RFMA 1TJCA 3DRAA 3SFYA 2FI7A 3ASDA 4CCAA 4UI9K 1N54A 4KZCA 4G2VA 4L7TA 2BEDA 4B93B 3UMVA 3X2QE 3MEKA 1OXJA 5LX8A 2V5FA 3CVQA 3T8MA 3MA5A 5FQ6A 3PNTB 4OAUC 5E75A 4LSZE 4GZCA 2GROB 4RVBA 2H6IA 4LERA 3CK9A 2LXMA 3WG7E 4RSYA 3RKVA 2IY0C 2VGYA 3UKUG 5AYWD 2CHXA 4L23A 2XPYA 5ENNA 2EIJE 2WXIA 4JW1A 1K3ZD 1N11A 1H6OA 3AU4A 3W9GA 4UUCA 3G2SA 4FLBA 4WNEA 1DNPA 2Y4UA 4OAVB 1NZNA 2X38A 4BEPA 4I43A 2J49A 2Y0BG 4HXIA 1O5MA 3FH5A 4JHRA 1O1SA 4CRWA 4XKCA 1NL4A 5BXUA 4AM9A 1DVPA 1IKND 4F7AA 3AAAC 2AJAA 3JUEA 1SZAA 5JHBA 3U64A 4AY5A 4TXRA 1KZPA 3PS6A 2B0OE 4CDNA 4DLQA 4N2SA 2VJ8A 3S2AA 4CYMD 3FH8A 2VGXB 2GGFA 2VTBB 4AIFA 1H2UA 2PQNA 4GZ3A 1KZOA 2GRPB 2FO1E 3HXBA 1BPOA 5HKPA 2F0YA 4G1TA 4JPSA 3FUFA 1WG0A 1N52A 3DPYA 2P9SG 3G2UA 3ABME 3D9IA 4JEUA 3ASHA 3OAWA 4CT0A 1OWNA 4Y6WA 1YA0A 2MYOA 1OCOE 2PL2A 4MRUA 3DEOA 2ILRA 4TXQA 4ANXA 5KNHD 5KNGA 3CEQA 4RG6A 3F6QA 1HG2A 2RG8A 3EU9A 3LXUX 4GMJA 1X5BA 1PAQA 5LP0A 2WXHA 3SBTB 4APFA 4PS7A 3ZYKA 3D9OA 5LCWC 4HNAD 3PZ2A 4I9EA 1HZ4A 2XZDG 3GW4A 4WAFA 4BETA 1YYHA 4EZLA 2Y4TA 2WXMA 5JJ7A 3GZSA 3CLJA 1QZ2A 1U3DA 1UN8A 3JXJA 2ETAA 1HF8A 3QNKA 4ZHBA 5EX0A 5D0QD 3LEWA 3SZ7A 4DI3A 3QK0A 3T8KA 4XX5A 3UM2A 3CKBA 1HE8A 3HG0D 3ABKE 5ARFA 3TXNA 3AS8A 3U3WA 1NA0A 1WY6A 2ZGDA 2WQ7A 4O1OA 2YHEA 3T5VA 2XEEA 3DSXA 3CR3A 1E7VA 4G23A 2IJGX 2LAHA 4NRHB 2J4DA 1SA5A 4GTPA 1MX2A 5KJLA 3QWVA 3E4BA 1S63A 4DLOA 3NAWA 4FC8A 2CHWA 4GU5A 5CCLA 3UT8A 1NP7A 4YDEA 3S7FA 4JL0A 5AQBA 3CVWA 3DSVA 3ASOE 2IQCA 2X6FA 4P29A 2LSUA 3URZA 3TWTA 2J08A 4FULA 2CFZA 1TR4A 1L5JA 3E30A 3AU5A 4TUMA 3ONKA 5KWDA 5AQAA 3EDTB 3LPZA 4ANWA 4PS8A 3DSTA 4H7YA 1UJJA 3DXMG 1IHGA 1INZA 3ML8A 3Q73A 5LCWJ 1ELWA 3ONLA 1N9AA 4CDMA 5JJTA 5KBAA 2JEKA 4F53A 4AP2A 5H7PA 5ITZF 4HFGA 2GRLA 4G8LA 3T5XA 4IRUA 1HX8A 2WXKA 2XZTG 3BQOA 4IYPA 4OVUA 4ZFHA 1DC2A 2E0IA 1E90A 2Q7FA 3ASGA 2PM6A 3S7DA 1H2TC 4KMOA 3SQVA 3FDHA 3JQ0A 4ACKA 2LAIA 5B3SE 1MJ0A 1MX4A 5AQ7A 1G3NB 2LNIA 3MZLB 4J0UA 1DCQA 1QNFA 4EBAA 2OEVA 1Q2ZA 1OCZE 5D0OD 3LY8A 4U0ZA 5CRUA 1BI8B 4FJYA 2GW1A 1K1AA 4D10C 1OT8A 3NB2A 5ENPD 4I6GA 3FTXA 3V31A 3CHRA 4GTQA 4N3BA 3TWVA 3MKQA 4BSZB 1UW4B 4PDXA 5EIDA 3Q7FA 1B89A 3DXKG 4HRNA 3KSLA 3D9MA 2L6BA 2Y3AA 4U07A 4LNGA 3BG1B 2R5SA 3NF1A 4GCNA 1EPUA 2ETCA 4EZKA 3C98A 4J8YA 2KCKA 3DPDA 4KBQA 3AG2E 5AQ9A 3HHMA 3EUVA 2DBAA 4L1BA 2V4LA 4N3CA 5T8IA 5EDSA 4L9PA 3IHVA 3EHRA 3LKUA 1JWFA 4KYOB 1X81A 2R05A 4MLPA 1EDUA 3UX4A 3ZUVB 5JHAA 5A23A 4K03A 1HG5A 4A3TA 4W9RA 1AWCB 1N4PA 4HS2A 1Z3YA 4WWPA 2KXPC 3E33A 3CVVA 3E32A 2XS8A 4DX7D 4GMLA 1HXIA 3ESKA 3RRUA 3ZHEB 5BNWA 2DYRE 4I1OB 3AS5A 4JB8P 2AW6A 2YHCA 2EILE 2XEVA 3LYAA 3FP3A 2P9LG 5KJMA 4N3AA 3R9MA 2WQ6A 5JMND 3RO2A 4M7CA 3TG4A 3IHYA 3TWRA 5CECB 4UI9C 5FZQA 5C2YA 4RQIA 3ZN3A 3FTWA 5ENQD 4DJAA 3S7JA 3UIOC 2A4ZA 1K1BA 2UY1A 3PZ3A 4R7LA 3B7SA 2WXFA 2WXGA 4UWFA 3FU3A 2IU1A 1XNFA 2P2CP 4UWKA 3QJZA 4OYSA 3D3MA 1IHBA 3Q5MA 5FQ7A 3NZUA 1H6PA 2KC7A 4XKBA 4DX1A 1TNOA 3RJVA 4DK5A 5BT1A 5KCMA 2OCCE 3ZXPA 3NBNB 4BY6A 2P9IG 5JJ6A 3RRNB 3S7BA 2GRNB 2IFUA 1QBQA 2EINE 4I2ZA 2XQ0A 3CHQA 3Q75A 1DCEA 2UWJG 3BUAA 1WDYA 3DSSA 4Y6CA 1NFIE 4UQZA 4WUYA 2RFAA 1FVHA 4FJZA 2BKKB 4JC8A 3SY2A 3B95A 2KATA 2AWIA 1OUVA 3SO8A 2KM4A 2VGEA 4U8HA 3QARA 3HDXA 1ZU2A 2E2EA 3APFA 3SF4A 2R2LA 3HYMB 5JA4D 3PRZA 1ZB1A 1UJKA 5EYPF 3HVEA 4GZDA 1E7UA 3PNLB 3B7RL 2XS1A 3Q9UC 5FIOA 3FUJA 3CHSA 3FUIA 3OXFA 1HU3A 2HYZA 3JCKC 3BG0B 1E96B 5EN5D 4AVXA 1ELKA 3ULQA 1SVXA 4DX6D 5CCMA 2KZTB 3UINC 3E34A 2EIME 5G55A 1LD8A 1TNUA 3FUHA 3APCA 4CZ2D 2IEJA 4URKA 1TN6A 2WPVA 3G2WA 3FU6A 3BEEA 2CG2A 2XGSA 1PY1A 5E76A 1MX6A 3J5QB 1TN7A 4RG9A 5C1DA 2QZAA 5EIBE 2C0LA 5ANLA 4LCTA 2BF0X 5FZSA 2IO2C 4C48B 1W3BA 2RKKA 4ILIA 3LJNA 4FP7A 4LG6A 2P9KG 2VSOE 3L82A 4GTRA 4J7WA 4Q69A 1FT2A 4GZ5A 1OCRE 1VDYA 2AXZA 4O60A 4CT4A 1TJFA 2DWZA 3KEAA 3C3OA 5EILA 1LD7A 4U95D 2I9CA 5BXOA 3SGHA 1JCSA 3FEYA 4KXKB 4HVBA 1JUQA 2RD0A 3ZIMA 3IKOB 2J09A 3IEGA 5BUZA 4RLYA 1MQSA 2A5EA 4DI4A 1KLXA 1TNYA 3NOCD 4HRLA 1H19A 3U4TA 2I1JA 1YCSB 5AAOA 2BUGA 5EKQD 3EHNA 3UIPC 4J8FA 4HOTA 2WXPA 3HXCA 1V55E 3R7QA 4BTBA 1A17A 2IONA 4GPMA 4K0RA 3QDNA 2PNNA 3DWLG 3QWWA 4AOFA 3KS2A 3N71A 2HM8A 4ANVA 3MX3A 4FA6A 1N4SA 5BW8C 3ML9A 2AXUA 3RIBA 3Q4AB 5LFAA 3FUNA 3PDNA 1D8DA 4BWRA 3MV3B 4APOA 4Z68A 1WAO1 2EIKE 3KD7A 3VTXA 3CGHA 1N4RA 4BT9A 3CK8A 5FZRA 2HO1A 3J5PA 4KVMA 3AJIA 2DVWA 2JABA 2VSNA 2WMNA 4IN3B 4EECA 4QQIA 4FU3A 1D8EA 4MKTA 5FJYA 4EHMA 4XZ4A 2CHZA 3JYSA 1IXVA 4O6FA 2DYSE 1Z6TA 3PUKA 4C9BB 2YNQA 4HI9A 2AVPA 2XHEA 4MBGA 3HIZA 1N4QA 4PUCA 4V3IA 2QYUA 4LNUD 3CQGB 4N5CA 4NACA 3BU8A 3V79K 2IO3C 3TJPA 4BFRA 4X8QA 1MHQA 3QKYA 1TNBA 2XENA 4LNBA 2J4BA 2L0TB 5CBNA 2B6CA 5KJNA 1OY3D 2OVBA 5ARGA 4A55A 4U7EB 5CEAA 3UQ3A 4HB5A 2I6HA 4JZYA 3DSUA 3I5PA 3RO3A 5CERB 2VGXA 2WXLA 1EYHA 2VTBA 1FVFA 4M3OA 2QC9A 3FUDA 3ZYMA 3PREA 2VSXE 3I4RB 4GCOA 2FF4A 3IXEA 4EQFA 2R59A 4DPRA 3U66A 4TUUA 3FTYA 3LDZA 4JHKA 4A63B 4U96D 5HQ8A 2XGOA 1U2VG 2JLBA 4U63A 2F8YA 3JUIA 4NQ0A 2VSYA 4WNGA 1JPLA 4N5QA 3UM0A 3FTSA 5FINA 1QQEA 3QC1A 1H6KA 2V0PA 3PVLA 4AXHA 4F1PA 3CV0A 4JHJA 1D9SA 3E37A 4N2QA 3EIJA 3MGBA 1OWOA 3NQPA 2FULA 3HXDA 2I2OA 4A1SA 1NI1A 4ILHB 2X3MA 3TXMA 4EZJA 2Y1LE 3B13A 4QFVA 3TWWA 1TN8A 1OWMA 1JCRA 4UQXA 4ANUA 1ELRA 1KT1A 4WNDA 2IOSA 2LXLA 3L08A 3FU0A 4U0UA 3CVYA 3PUJA 4HOQA 4G24A 3MJWA 1FT1A 1JWGA 4FADA 4HOUA 3HRAA 4ATGA 3GYZA 3FUEA 1RZ4A 3CHMA 4H7XA 4KVOA 2GRMA 3RAUA 1TYQG 2OVFA 5IY5E 3C3QA 1IQRA 3MCXA 4O1PA 2FO7A 2LUHA 5DIZA 4DX2A 2R17C 2R02A 3Q78A 4DX5D 3PE3A 3ZYLA 1FPPA 4HORA 4JVSA 3FU5A 3PEUB 5B1AE 3ZNGA 3TWQA 3ESLA 3CHPA 4ACLA 5FQ8A 2GRQB 3FUKA 4K5BA 4GA1A 4J6IA 2V8SE 4GTVA 1OCCE 2C2LA 4EBAG 4N39A 3D9LA 3FHEA 4YNDA 1HO8A 3AG4E 1JCQA 3SBSA 5HRYA 3TWXA 2R03A 5EYLA 4WNFA 2J9QA 5EX3A 4BSXA 3R7RA 3FTZA 3R9AB 4GYYA 4TRQA 1HFAA 2FEZA 3C72A 5AJLA 3P1UA 3LY9A 2WB2A 1Y8MA 3CVNA 3I3NA 4BTAA 3EJNA
chains in the Genus database with same CATH topology
3UT8A 4ILIA 4NURA 2PQRA 4FP7A 2WXOA 4CDRA 1NP7A 4J8DA 2VSOE 3S7FA 3L17A 4JL0A 3HVEB 3CVWA 2MRIA 4Q69A 4J8SA 4GAAA 1Y6IA 2IQCA 2NSZA 4GZ5A 3NZSA 4GYWA 1VDYA 1HS6A 2X6FA 2AXZA 4OVVA 3CVXA 4P29A 2LSUA 3URZA 4XI9A 4E85A 2QY7A 4CT4A 1TJFA 2WQHA 3FTUA 3L54A 4WWOA 5AJDA 4L2YA 3CHOA 3OXLA 1SQMA 2J08A 3UUXA 1E8XA 4FULA 2CFZA 3QAQA 4XE0A 4PH4B 3ZGQA 1L5JA 4JEHA 3SFZA 1H0AA 2WXJA 3AU5A 2I9CA 3I4GA 4IULA 3SGHA 1IQUA 4F1SA 2CG3A 3ONKA 3CVPA 3FEYA 3CK7A 3EDTB 1S0PA 3LPZA 4LUNU 5FT9A 3MKRA 4KXKB 4ME2A 4ANWA 4HVBA 4PS8A 1JUQA 4UWGA 2RD0A 3ZIMA 3IBEA 3IKOB 4H7YA 4XIFA 5G05J 5FWQA 1UJJA 1XGWA 3KEZA 1IHGA 1INZA 3ML8A 3TL5A 1P5QA 5LCWJ 1ELWA 5J08A 4A1GA 4CGWA 2J09A 3ONLA 5G04J 3IEGA 3O4ZA 4CDMA 5A6CA 5JJTA 5BUZA 2BTDA 2JEKA 2XCCA 4CGVA 4F53A 4AP2A 3R9AB 3FTVA 4I6JA 1MQSA 5CMYA 4HFGA 4DI4A 2GRLA 1KLXA 4UQYA 3Q15A 3T5XA 4AV7A 4IRUA 1HX8A 2WXKA 3FWVA 1H19A 3U4TA 2I1JA 2L0IA 3QWPA 4IYPA 2LSVA 4OVUA 2HR2A 2BUGA 5EKQD 1E8WA 2E0IA 3EHNA 4I1AA 5AIJA 4J8FA 4HOTA 5AENA 2WXPA 1E90A 3CSFA 4L2LA 3R7QA 2X6HA 5T3RA 5ANRA 4BTBA 1EF1C 2Q7FA 3ZVVA 3ASGA 5HI7A 2PM6A 3MYVA 4YVOA 1A17A 2IONA 3S7DA 5A7DB 2CFUA 4K0RA 3QDNA 4I17A 1H2TC 3D9PA 4UI9J 4KMOA 3SNXA 3QWWA 4JXTA 4PS3A 4ABNA 4JA7A 5CHEE 4AOFA 3FDHA 3KS2A 2VYIA 3JQ0A 5M72A 2XRYA 3LY7A 2DIWA 3N71A 2HM8A 3PE4A 4Q94A 4ACKA 4ANVA 2L9BA 3MX3A 4FA6A 5BW8C 2IF4A 3ML9A 2LO6A 2AXUA 4U0SA 3ZYQA 2LAIA 3RIBA 4BX8A 3OXGA 4BT8A 2FBNA 3Q4AB 5LFAA 3FUMA 3FUNA 3PDNA 2LNIA 1ZBPA 4BX9A 3MZLB 3QOUA 4Q96A 4J0UA 3D9NA 3MV2B 3U9WA 4BWRA 3MV3B 1QNFA 4APOA 4EBAA 3PEVB 1WAO1 3L22A 3KD7A 3CIAA 5D0OD 3IV0A 3LY8A 4J8EA 3VTXA 4U0ZA 3CGHA 4BT9A 3DBSA 3CK8A 5FZRA 4I9CA 2HO1A 4FJYA 4KVMA 1E8ZA 2GW1A 5FTPA 2OV8A 4D10C 1E8YA 1LF8A 4I6GA 3FTXA 3CHRA 2XPIA 2NXPA 3AS4A 4I6EA 4N3BA 1Z3XA 3LJ3A 3EIQC 4B94A 4G26A 1H2VC 3MKQA 4UWLA 2VSNA 5G2NA 2WMNA 4IN3B 2EQXA 3FH7A 1UW4B 4EECA 4PDXA 2YQ8A 4FU3A 2MOWA 2WXRA 1OWLA 4MKTA 4KT6B 3TGOA 4WWNA 1B89A 3TAXA 5FJYA 3QB2A 3ZHEA 3RU0A 1GW6A 4XZ4A 4G25A 3D9MA 3LCAA 2Y3AA 2CHZA 3JYSA 2VQ2A 4U07A 4YVQC 4O6FA 3BG1B 2R5SA 3NF1A 2QFCA 3LVRE 1Z6TA 2PM7A 3PUKA 4GCNA 4C9BB 1EPUA 2YNQA 4EZKA 3C98A 2M63A 2AVPA 2XHEA 3HIZA 3VLFA 1TJCA 2KCKA 3UT4A 4PUCA 3DPDA 4KBQA 4V3IA 2FI7A 3ASDA 3RK6A 4CCAA 3ZXSA 4UI9K 2KCVA 3CQGB 4N5CA 1N54A 3HHMA 4NACA 3L16A 2NC9A 2DBAA 4L1BA 2WXQA 3G2TA 3TJPA 2V4LA 5BV1A 4KZCA 4BFRA 4B8CB 4G2VA 1MHQA 2DCPA 3QKYA 4N3CA 4L7TA 5T8IA 5EDSA 2J4BA 2L0TB 3IHVA 3UMVA 3LKUA 1JWFA 3MEKA 4KYOB 5KJNA 5LX8A 3ENEA 2V5FA 2AXVA 4MLPA 3CVQA 1EDUA 3T8MA 3UX4A 4GA0A 3MA5A 2XPZA 2OVBA 5FQ6A 3PNTB 5JHAA 5ARGA 4K03A 1HG5A 3VLEA 5E75A 4A3TA 5A23A 4A55A 4GZCA 3VTYA 4W9RA 3EJNA 4RVBA 4HS2A 3UQ3A 4GPKA 1Z3YA 4LERA 3CK9A 4WWPA 2I6HA 4JZYA 3I5PA 4RSYA 3RKVA 3CVVA 3RO3A 2VGYA 3MKQB 3TG5A 2VGXA 2WXLA 5AYWD 1EYHA 2VTBA 3PH0C 2CHXA 1FVFA 4M3OA 1PC2A 3FULA 3FUDA 4GMLA 4L23A 2XPYA 3PREA 1HXIA 2VSXE 3ZYMA 3I4RB 4GCOA 3ESKA 2FF4A 5ENNA 3RRUA 3ZHEB 2WXIA 4EQFA 4JW1A 5BNWA 2J07A 2R59A 4DPRA 3Q49B 3U66A 4I1OB 2YINA 3AS5A 1IYGA 4GU5A 3AU4A 4TUUA 2AW6A 3FTYA 3D9KA 2YHCA 3LDZA 4JHKA 3ZEFA 5CMWA 3G2SA 3Q47B 2XEVA 5HQ8A 3LYAA 4FLBA 4WNEA 3FP3A 5LOZA 3UT7A 5KJMA 2XGOA 2JLBA 4N3AA 4U63A 5DBKA 1DNPA 2Y4UA 3KAEA 2WQ6A 1NZNA 2I1KA 2X38A 3RO2A 3TG4A 4I43A 2J49A 4B0ZA 3O48A 4I2WA 3JUIA 4NQ0A 2VSYA 4HXIA 4WNGA 1JPLA 2P58C 3FH5A 4JHRA 3IHYA 3FTSA 4CRWA 4XI0A 1QQEA 4UI9C 3QC1A 1H6KA 2V0PA 4XKCA 5FZQA 1HH8A 4GB9A 4AM9A 4FHKA 5C2YA 1UN9A 1DVPA 4U04A 3ZN3A 4F7AA 3FTWA 2PZIA 3PVLA 4GA2A 4AXHA 1UG3A 3OTNA 1SZAA 4DJAA 3S7JA 3CV0A 4JHJA 5T4YA 3U64A 5JHBA 2A4ZA 2X6JA 4AY5A 4N2QA 2UY1A 3EIJA 4R7LA 3L13A 4FLHA 4GZ6A 4AEZC 3B7SA 4JA9A 3MGBA 2WXFA 1OWOA 2WXGA 4UWFA 3NQPA 3FU3A 2FULA 2IU1A 1XNFA 3CVLA 5J90A 3PS6A 3FY4A 2I2OA 3B7TA 4A1SA 4CDNA 4DLQA 4N2SA 4UWKA 2VJ8A 4C0MA 3L6AA 3QJZA 4HOSA 4OYSA 2WVIA 3D3MA 3S2AA 2ONDA 2C0MA 3FH8A 4ILHB 2VGXB 2ZU6B 2X3MA 3TXMA 2GGFA 3Q5MA 4B8AA 5FQ7A 4EZJA 3NZUA 4AIFA 1H2UA 4MS6A 2KC7A 2PQNA 3B13A 4QFVA 4GZ3A 3CSTA 1OWMA 4XKBA 3G2VA 3ZW3A 4UQXA 4ANUA 1ELRA 1KT1A 3RJVA 4UWHA 2XGMA 3GZ1A 4WNDA 2IOSA 5KCMA 4DK5A 4AY6A 1BPOA 2VTBB 3L08A 3ZFWA 3P2BA 4BY6A 5JJ6A 4B89A 3RRNB 3S7BA 2IFUA 3FU0A 3CVUA 4TV3A 4G1TA 4JPSA 3FFLA 4U0UA 5FQ4A 1NA3A 3CVYA 3FUFA 4I2ZA 2XQ0A 3CHQA 2WXNA 2KZTA 3G2UA 3SD5A 2UWJG 3PUJA 4HOQA 4G24A 3MJWA 4Y6CA 3D9IA 4CEMA 4JEUA 1JWGA 4UQZA 3ASHA 3ASFA 3OAWA 1OWNA 4WUYA 4Y6WA 1YA0A 3CKCA 4CT0A 5KJKA 1FCHA 3JQ1A 4FADA 2PL2A 1FVHA 4I1MA 4HOUA 4MRUA 3RRMB 4FJZA 4JC8A 4F3VA 3ZPJA 4FHJA 2ILRA 2KATA 5BV0A 4ATGA 4ANXA 3GYZA 2AWIA 1OUVA 3FUEA 3CHMA 3FEXA 3CEQA 4GYOA 1SZ9A 4H7XA 4RG6A 2KM4A 1HG2A 2RG8A 2XRZA 3LXUX 4GMJA 4KVOA 4HLEA 4EPZA 2GRMA 4A3VA 4U8HA 2IOLA 1X5BA 3HDXA 3QARA 1PAQA 2OVFA 2UY1B 2WXHA 5LP0A 1IQRA 3MCXA 3SBTB 1ZU2A 2FO7A 2E2EA 4PS7A 4APFA 3ZYKA 3APFA 1OWPA 5G05C 5DIZA 3SF4A 3EHMA 1TEZA 2XCBA 1U3CA 3D9OA 3HYMB 5LCWC 2R17C 3PRZA 3ZRHA 3WXXA 1UJKA 3PE3A 4I9EA 5G04C 2X6KA 3ZYLA 1HZ4A 4HORA 2L6JA 4JVSA 3FU5A 3PEUB 3HVEA 4LEUA 4GZDA 1E7UA 3VLDA 3ESLA 3PNLB 3CHPA 3GW4A 4ACLA 3D9JA 4WAFA 3B7RL 3B7UX 5FQ8A 4EZLA 2Y4TA 2WXMA 3CQCB 5JJ7A 3FUJA 3FUKA 3CLJA 3GZSA 4GA1A 4J6IA 1QZ2A 1U3DA 2V8SE 2C2LA 4EBAG 3CHSA 1UN8A 3FUIA 3OXFA 1HU3A 1HF8A 3QNKA 4N39A 2HYZA 3JCKC 5EX0A 5D0QD 3BG0B 1E96B 3D9LA 3LEWA 3FHEA 4YNDA 4AVXA 4AJWA 1ELKA 1HO8A 4G11A 2A5UA 3SZ7A 3QK0A 3ULQA 4DI3A 4XX5A 3K9IA 3CKBA 1HE8A 4C0EA 5CCMA 2OOEA 2KZTB 4KZ0A 4ILGA 5ARFA 5G55A 3SBSA 3TXNA 3FUHA 3AS8A 3UPVA 3U3WA 3APCA 1NA0A 4WNFA 1WY6A 2J9QA 5BPPA 5EX3A 2WQ7A 4E6HA 4URKA 4BSXA 3R7RA 2YHEA 3T5VA 2WMOA 3PZDA 3CR3A 3FTZA 3LVQE 1E7VA 1KT0A 3SHFA 2WPVA 3G2WA 3FU6A 2IJGX 4G23A 4GYYA 3BEEA 4TRQA 1HFAA 2CG2A 1PY1A 1WM5A 2FEZA 2XGSA 5AJLA 3SI5A 5BT1A 3GZ2A 2LAHA 4NRHB 2J4DA 3LS8A 3P1UA 5E76A 5KJLA 2KCLA 2X6IA 3QWVA 3LY9A 2WM9A 4RG9A 1Y8MA 2WB2A 5C1DA 3E4BA 3CVNA 2C0LA 2MHKA 5ANLA 3I3NA 4DLOA 4BTAA 4LCTA 2BF0X 3APDA 4LRZA 5FZSA 4FC8A 2CHWA 1N52A 1W3BA 5CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQR A;  4CDR A;  4J8D A;  3S7F A;  4JL0 A;  4GZ5 A;  4GYW A;  2LSU A;  3URZ A;  4XI9 A;  2WQH A;  3OXL A;  3UUX A;  3ZGQ A;  3CVP A;  3CK7 A;  3EDT B;  3LPZ A;  5FT9 A;  3MKR A;  4KXK B;  4ME2 A;  4H7Y A;  4XIF A;  5G05 J;  1IHG A;  1P5Q A;  5LCW J;  1ELW A;  4CGW A;  5G04 J;  3IEG A;  5JJT A;  5A6C A;  2XCC A;  4CGV A;  1KLX A;  4UQY A;  3Q15 A;  3FWV A;  3U4T A;  3QWP A;  2LSV A;  2HR2 A;  2BUG A;  5EKQ D;  4I1A A;  4J8F A;  4HOT A;  4BTB A;  2Q7F A;  3ASG A;  5HI7 A;  4YVO A;  1A17 A;  3S7D A;  5A7D B;  3QDN A;  4I17 A;  4UI9 J;  3QWW A;  4ABN A;  4JA7 A;  5CHE E;  3KS2 A;  2VYI A;  5M72 A;  3LY7 A;  3N71 A;  3PE4 A;  5BW8 C;  2IF4 A;  4U0S A;  3RIB A;  3OXG A;  4BT8 A;  2FBN A;  3Q4A B;  3PDN A;  2LNI A;  1ZBP A;  3QOU A;  4J0U A;  3MV2 B;  4BWR A;  3MV3 B;  4APO A;  1WAO 1;  3KD7 A;  5D0O D;  3LY8 A;  4J8E A;  3VTX A;  4U0Z A;  4BT9 A;  3CK8 A;  5FZR A;  4I9C A;  2HO1 A;  2GW1 A;  5FTP A;  2XPI A;  3AS4 A;  4N3B A;  4B94 A;  4G26 A;  2VSN A;  4IN3 B;  2YQ8 A;  3TGO A;  3TAX A;  1B89 A;  5FJY A;  3ZHE A;  3RU0 A;  4G25 A;  3LCA A;  3JYS A;  4U07 A;  2VQ2 A;  4YVQ C;  4O6F A;  2R5S A;  3NF1 A;  2QFC A;  4GCN A;  2AVP A;  1TJC A;  2KCK A;  4KBQ A;  2FI7 A;  3ASD A;  4UI9 K;  2KCV A;  4N5C A;  2NC9 A;  2DBA A;  4G2V A;  3QKY A;  4N3C A;  3LKU A;  4KYO B;  3MEK A;  5KJN A;  2V5F A;  3CVQ A;  4GA0 A;  3MA5 A;  5ARG A;  3VTY A;  4W9R A;  3UQ3 A;  4GPK A;  3CK9 A;  2I6H A;  3RKV A;  3RO3 A;  3TG5 A;  2VGY A;  2VGX A;  5AYW D;  1PC2 A;  1HXI A;  4GCO A;  3ESK A;  2FF4 A;  3ZHE B;  4EQF A;  5BNW A;  3Q49 B;  3AS5 A;  2YHC A;  3Q47 B;  2XEV A;  5HQ8 A;  3LYA A;  4WNE A;  3FP3 A;  5KJM A;  2XGO A;  2JLB A;  4N3A A;  5DBK A;  2Y4U A;  3KAE A;  1NZN A;  3RO2 A;  3TG4 A;  3O48 A;  4I2W A;  4NQ0 A;  2VSY A;  4WNG A;  2P58 C;  4JHR A;  4XI0 A;  1QQE A;  4UI9 C;  5FZQ A;  1HH8 A;  4AM9 A;  4U04 A;  3ZN3 A;  2PZI A;  4GA2 A;  3S7J A;  3CV0 A;  4AY5 A;  4N2Q A;  2UY1 A;  4GZ6 A;  4JA9 A;  3CVL A;  1XNF A;  4A1S A;  4N2S A;  4HOS A;  2OND A;  2C0M A;  2VGX B;  1IYG A;  3Q5M A;  4AIF A;  2KC7 A;  2PQN A;  4GZ3 A;  4UQX A;  1ELR A;  1KT1 A;  3RJV A;  5BT1 A;  2XGM A;  4WND A;  3GZ1 A;  4AY6 A;  3ZFW A;  5JJ6 A;  3S7B A;  2IFU A;  4G1T A;  3FFL A;  4U0U A;  1NA3 A;  4I2Z A;  2UWJ G;  4HOQ A;  4G24 A;  4Y6C A;  4UQZ A;  3ASH A;  3ASF A;  4WUY A;  5KJK A;  4Y6W A;  1YA0 A;  3CKC A;  1FCH A;  2PL2 A;  4HOU A;  4F3V A;  3ZPJ A;  2KAT A;  3GYZ A;  1OUV A;  3CEQ A;  4GYO A;  4H7X A;  4RG6 A;  2UY1 B;  1ZU2 A;  2FO7 A;  2E2E A;  5G05 C;  3SF4 A;  5DIZ A;  2XCB A;  5LCW C;  3HYM B;  3WXX A;  3PE3 A;  4I9E A;  5G04 C;  1HZ4 A;  4HOR A;  2L6J A;  4LEU A;  3GW4 A;  2Y4T A;  5JJ7 A;  4GA1 A;  1QZ2 A;  2C2L A;  3OXF A;  4N39 A;  2HYZ A;  5EX0 A;  5D0Q D;  1E96 B;  4YND A;  3SZ7 A;  3ULQ A;  3K9I A;  3CKB A;  5CCM A;  2OOE A;  5ARF A;  3AS8 A;  3UPV A;  3U3W A;  1NA0 A;  4WNF A;  2J9Q A;  5EX3 A;  1KT0 A;  3R9A B;  2WPV A;  4GYY A;  4G23 A;  3BEE A;  2XGS A;  2FEZ A;  1WM5 A;  3GZ2 A;  4NRH B;  5KJL A;  2KCL A;  3QWV A;  3LY9 A;  4RG9 A;  1Y8M A;  5C1D A;  3E4B A;  3CVN A;  2C0L A;  2MHK A;  4BTA A;  5FZS A;  1W3B A;  5CCL A; 
#chains in the Genus database with same CATH topology
 3ISM C;  5B1B E;  3L17 A;  3C3R A;  2MRI A;  4J8S A;  4GAA A;  3NZS A;  3NOG D;  2WQH A;  5ENT D;  2P9U G;  4WWO A;  5AJD A;  1N95 A;  3UUX A;  2ZIS A;  3QAQ A;  3ZGQ A;  4PH4 B;  3SFZ A;  2WXJ A;  4IUL A;  1IQU A;  3CVP A;  3CK7 A;  3MKR A;  3IBE A;  5FWQ A;  5J08 A;  4A1G A;  4CGW A;  3ASN E;  3ZU7 B;  4CGV A;  3FTV A;  4I6J A;  5CMY A;  4UQY A;  3PZ1 A;  2ZIR A;  4AV7 A;  5ENR D;  3FWV A;  4YDW A;  1SW6 A;  1E8W A;  3JXI A;  4I1A A;  5AEN A;  3CSF A;  2X6H A;  3W9F A;  5ANR A;  1EF1 C;  1LTX A;  2XEH A;  4YVO A;  3SFX A;  5A7D B;  3D9P A;  4UI9 J;  3SNX A;  4PS3 A;  4JXT A;  5CHE E;  2ZGG A;  2VYI A;  3PE4 A;  4Q94 A;  3T9K A;  4NIK A;  1A5E A;  4BX8 A;  3OXG A;  4U8Y D;  4BX9 A;  1ZBP A;  2BKG A;  2V4H C;  3D9N A;  3MV2 B;  3U9W A;  3DEP A;  3PEV B;  3Q79 A;  3IV0 A;  3DBS A;  1E8Z A;  4HBD A;  1MYO A;  1E8Y A;  1LF8 A;  2XPI A;  5D66 A;  2NXP A;  3AS4 A;  4BER A;  4I6E A;  3LJ3 A;  4G26 A;  4UWL A;  3FH7 A;  2YQ8 A;  5ENO D;  4KT6 B;  2DZO A;  3TGO A;  3ZHE A;  3RU0 A;  1GW6 A;  5CRV A;  2VQ2 A;  1TNZ A;  2QFC A;  4DRX E;  4GTT A;  3VLF A;  3UT4 A;  1BD8 A;  3RK6 A;  3ZXS A;  2KCV A;  2KBX A;  1MZC A;  3L16 A;  2NC9 A;  2WXQ A;  3G2T A;  5BV1 A;  4B8C B;  2DCP A;  2F37 A;  3ENE A;  2AXV A;  3KSQ A;  4GA0 A;  4U8V D;  4K5A B;  2XPZ A;  3VLE A;  5D2M C;  3VTY A;  3Q7A A;  4GTS A;  4XEI G;  4GPK A;  4HQD A;  2F8X K;  3MKQ B;  3TG5 A;  5CED B;  3PH0 C;  1PC2 A;  3FUL A;  2J07 A;  3Q49 B;  2YIN A;  3D9K A;  4F6R D;  3ZEF A;  5CMW A;  3Q47 B;  3UT7 A;  5LOZ A;  5DBK A;  3KAE A;  2I1K A;  3HXF A;  4B0Z A;  3O48 A;  4I2W A;  2P58 C;  3EHQ A;  4XI0 A;  1HH8 A;  4GB9 A;  4FHK A;  1UN9 A;  4U04 A;  3UKR G;  2PZI A;  4GA2 A;  1UG3 A;  3OTN A;  5T4Y A;  2X6J A;  4K5C A;  3L13 A;  4FLH A;  4GZ6 A;  3UTM A;  4AEZ C;  4JA9 A;  5J90 A;  3CVL A;  4G8K A;  3FY4 A;  3B7T A;  4C0M A;  1Z5S C;  3L6A A;  4HOS A;  2WVI A;  2OND A;  2C0M A;  2H6G A;  2ZU6 B;  3V30 A;  4B8A A;  1N94 A;  1IYG A;  4MS6 A;  3CST A;  3G2V A;  3ZW3 A;  4AY6 A;  4UWH A;  2XGM A;  3GZ1 A;  3ZFW A;  3P2B A;  4B89 A;  3CVU A;  4TV3 A;  3FFL A;  3C5R A;  5FQ4 A;  1BI7 B;  1NA3 A;  1YMP A;  2WXN A;  2KZT A;  3SD5 A;  1S64 A;  3L9T A;  4CEM A;  3ASF A;  5KJK A;  3CKC A;  1FCH A;  3JQ1 A;  2OEW A;  3RRM B;  4I1M A;  4F3V A;  3ZPJ A;  3UI2 A;  4FHJ A;  5BV0 A;  3FEX A;  4GYO A;  5CBO A;  1SZ9 A;  2XRZ A;  2DZN A;  4HLE A;  4EPZ A;  2ETB A;  4A3V A;  2IOL A;  3HXE A;  2UY1 B;  1KPS B;  2P9P G;  3UXG A;  1OWP A;  5G05 C;  3EHM A;  1TEZ A;  2XCB A;  1U3C A;  3ZRH A;  3WXX A;  5G04 C;  2X6K A;  1BU9 A;  2L6J A;  4LEU A;  3VLD A;  3D9J A;  3B7U X;  3ZKJ A;  3CQC B;  2H6F A;  3ABL E;  4AJW A;  4G11 A;  2A5U A;  3K9I A;  4C0E A;  2OOE A;  2V5Q C;  1AP7 A;  4KZ0 A;  4ILG A;  3ULE G;  3AG1 E;  4JD2 G;  3UPV A;  5ENS D;  1N0Q A;  2NYJ A;  5BPP A;  3TWU A;  2QYJ A;  1SA4 A;  4E6H A;  2WMO A;  3PZD A;  3LVQ E;  1KT0 A;  3SHF A;  1V54 E;  1WM5 A;  3SI5 A;  3PZ4 A;  3GZ2 A;  4YDY A;  3LS8 A;  2KCL A;  2X6I A;  2WM9 A;  3B7B A;  3UM1 A;  2MHK A;  3APD A;  4LRZ A;  4NUR A;  2PQR A;  2WXO A;  4CDR A;  4J8D A;  3HVE B;  1Y6I A;  2NSZ A;  4GYW A;  1HS6 A;  3V2X A;  4OVV A;  3CVX A;  4XI9 A;  4E85 A;  2QY7 A;  1K8K G;  3FTU A;  3L54 A;  4L2Y A;  1QYM A;  3CHO A;  3OXL A;  1SQM A;  1E8X A;  1O1R A;  4XE0 A;  4ATZ D;  4JEH A;  1H0A A;  3I4G A;  4F1S A;  2CG3 A;  1S0P A;  4LUN U;  5FT9 A;  4ME2 A;  4YDO A;  4UWG A;  4XIF A;  5G05 J;  1XGW A;  3KEZ A;  3TL5 A;  1P5Q A;  3ULY A;  5G04 J;  3O4Z A;  5A6C A;  4GTO A;  2BTD A;  1S70 B;  2XCC A;  4DUI A;  3UM3 A;  3Q15 A;  5AAR A;  3QWP A;  2L0I A;  1RW2 A;  2LSV A;  3TWS A;  2HR2 A;  3V2O A;  5AIJ A;  4L2L A;  5T3R A;  3AG3 E;  3ZVV A;  5HI7 A;  3MYV A;  3Q9N C;  2CFU A;  4I17 A;  4ABN A;  4JA7 A;  1O1T A;  4HRM B;  5M72 A;  2XRY A;  3LY7 A;  2DIW A;  2P9N G;  4HLL A;  3DSW A;  2L9B A;  2IF4 A;  3RSE G;  2LO6 A;  4GMR A;  4U0S A;  3ZYQ A;  1UOH A;  4TXP A;  4BT8 A;  2FBN A;  4GTM A;  3FUM A;  3QOU A;  4Q96 A;  3D9H A;  3L22 A;  5HS0 A;  3CIA A;  2H6H A;  4J8E A;  4BES A;  2HE0 A;  4I9C A;  5AN8 A;  5FTP A;  2OV8 A;  1N0R A;  1Z3X A;  3EIQ C;  4B94 A;  1H2V C;  5G2N A;  2EQX A;  2MOW A;  2WXR A;  1OWL A;  4WWN A;  3TAX A;  3QB2 A;  2J8S D;  4G25 A;  2Y69 E;  3LCA A;  4HI8 A;  4YVQ C;  3EU5 A;  1BLX B;  2ZXW E;  3LVR E;  2PM7 A;  2GRR B;  2M63 A;  2RFM A;  1TJC A;  3DRA A;  3SFY A;  2FI7 A;  3ASD A;  4CCA A;  4UI9 K;  1N54 A;  4KZC A;  4G2V A;  4L7T A;  2BED A;  4B93 B;  3UMV A;  3X2Q E;  3MEK A;  1OXJ A;  5LX8 A;  2V5F A;  3CVQ A;  3T8M A;  3MA5 A;  5FQ6 A;  3PNT B;  4OAU C;  5E75 A;  4LSZ E;  4GZC A;  2GRO B;  4RVB A;  2H6I A;  4LER A;  3CK9 A;  2LXM A;  3WG7 E;  4RSY A;  3RKV A;  2IY0 C;  2VGY A;  3UKU G;  5AYW D;  2CHX A;  4L23 A;  2XPY A;  5ENN A;  2EIJ E;  2WXI A;  4JW1 A;  1K3Z D;  1N11 A;  1H6O A;  3AU4 A;  3W9G A;  4UUC A;  3G2S A;  4FLB A;  4WNE A;  1DNP A;  2Y4U A;  4OAV B;  1NZN A;  2X38 A;  4BEP A;  4I43 A;  2J49 A;  2Y0B G;  4HXI A;  1O5M A;  3FH5 A;  4JHR A;  1O1S A;  4CRW A;  4XKC A;  1NL4 A;  5BXU A;  4AM9 A;  1DVP A;  1IKN D;  4F7A A;  3AAA C;  2AJA A;  3JUE A;  1SZA A;  5JHB A;  3U64 A;  4AY5 A;  4TXR A;  1KZP A;  3PS6 A;  2B0O E;  4CDN A;  4DLQ A;  4N2S A;  2VJ8 A;  3S2A A;  4CYM D;  3FH8 A;  2VGX B;  2GGF A;  2VTB B;  4AIF A;  1H2U A;  2PQN A;  4GZ3 A;  1KZO A;  2GRP B;  2FO1 E;  3HXB A;  1BPO A;  5HKP A;  2F0Y A;  4G1T A;  4JPS A;  3FUF A;  1WG0 A;  1N52 A;  3DPY A;  2P9S G;  3G2U A;  3ABM E;  3D9I A;  4JEU A;  3ASH A;  3OAW A;  4CT0 A;  1OWN A;  4Y6W A;  1YA0 A;  2MYO A;  1OCO E;  2PL2 A;  4MRU A;  3DEO A;  2ILR A;  4TXQ A;  4ANX A;  5KNH D;  5KNG A;  3CEQ A;  4RG6 A;  3F6Q A;  1HG2 A;  2RG8 A;  3EU9 A;  3LXU X;  4GMJ A;  1X5B A;  1PAQ A;  5LP0 A;  2WXH A;  3SBT B;  4APF A;  4PS7 A;  3ZYK A;  3D9O A;  5LCW C;  4HNA D;  3PZ2 A;  4I9E A;  1HZ4 A;  2XZD G;  3GW4 A;  4WAF A;  4BET A;  1YYH A;  4EZL A;  2Y4T A;  2WXM A;  5JJ7 A;  3GZS A;  3CLJ A;  1QZ2 A;  1U3D A;  1UN8 A;  3JXJ A;  2ETA A;  1HF8 A;  3QNK A;  4ZHB A;  5EX0 A;  5D0Q D;  3LEW A;  3SZ7 A;  4DI3 A;  3QK0 A;  3T8K A;  4XX5 A;  3UM2 A;  3CKB A;  1HE8 A;  3HG0 D;  3ABK E;  5ARF A;  3TXN A;  3AS8 A;  3U3W A;  1NA0 A;  1WY6 A;  2ZGD A;  2WQ7 A;  4O1O A;  2YHE A;  3T5V A;  2XEE A;  3DSX A;  3CR3 A;  1E7V A;  4G23 A;  2IJG X;  2LAH A;  4NRH B;  2J4D A;  1SA5 A;  4GTP A;  1MX2 A;  5KJL A;  3QWV A;  3E4B A;  1S63 A;  4DLO A;  3NAW A;  4FC8 A;  2CHW A;  4GU5 A;  5CCL A;  3UT8 A;  1NP7 A;  4YDE A;  3S7F A;  4JL0 A;  5AQB A;  3CVW A;  3DSV A;  3ASO E;  2IQC A;  2X6F A;  4P29 A;  2LSU A;  3URZ A;  3TWT A;  2J08 A;  4FUL A;  2CFZ A;  1TR4 A;  1L5J A;  3E30 A;  3AU5 A;  4TUM A;  3ONK A;  5KWD A;  5AQA A;  3EDT B;  3LPZ A;  4ANW A;  4PS8 A;  3DST A;  4H7Y A;  1UJJ A;  3DXM G;  1IHG A;  1INZ A;  3ML8 A;  3Q73 A;  5LCW J;  1ELW A;  3ONL A;  1N9A A;  4CDM A;  5JJT A;  5KBA A;  2JEK A;  4F53 A;  4AP2 A;  5H7P A;  5ITZ F;  4HFG A;  2GRL A;  4G8L A;  3T5X A;  4IRU A;  1HX8 A;  2WXK A;  2XZT G;  3BQO A;  4IYP A;  4OVU A;  4ZFH A;  1DC2 A;  2E0I A;  1E90 A;  2Q7F A;  3ASG A;  2PM6 A;  3S7D A;  1H2T C;  4KMO A;  3SQV A;  3FDH A;  3JQ0 A;  4ACK A;  2LAI A;  5B3S E;  1MJ0 A;  1MX4 A;  5AQ7 A;  1G3N B;  2LNI A;  3MZL B;  4J0U A;  1DCQ A;  1QNF A;  4EBA A;  2OEV A;  1Q2Z A;  1OCZ E;  5D0O D;  3LY8 A;  4U0Z A;  5CRU A;  1BI8 B;  4FJY A;  2GW1 A;  1K1A A;  4D10 C;  1OT8 A;  3NB2 A;  5ENP D;  4I6G A;  3FTX A;  3V31 A;  3CHR A;  4GTQ A;  4N3B A;  3TWV A;  3MKQ A;  4BSZ B;  1UW4 B;  4PDX A;  5EID A;  3Q7F A;  1B89 A;  3DXK G;  4HRN A;  3KSL A;  3D9M A;  2L6B A;  2Y3A A;  4U07 A;  4LNG A;  3BG1 B;  2R5S A;  3NF1 A;  4GCN A;  1EPU A;  2ETC A;  4EZK A;  3C98 A;  4J8Y A;  2KCK A;  3DPD A;  4KBQ A;  3AG2 E;  5AQ9 A;  3HHM A;  3EUV A;  2DBA A;  4L1B A;  2V4L A;  4N3C A;  5T8I A;  5EDS A;  4L9P A;  3IHV A;  3EHR A;  3LKU A;  1JWF A;  4KYO B;  1X81 A;  2R05 A;  4MLP A;  1EDU A;  3UX4 A;  3ZUV B;  5JHA A;  5A23 A;  4K03 A;  1HG5 A;  4A3T A;  4W9R A;  1AWC B;  1N4P A;  4HS2 A;  1Z3Y A;  4WWP A;  2KXP C;  3E33 A;  3CVV A;  3E32 A;  2XS8 A;  4DX7 D;  4GML A;  1HXI A;  3ESK A;  3RRU A;  3ZHE B;  5BNW A;  2DYR E;  4I1O B;  3AS5 A;  4JB8 P;  2AW6 A;  2YHC A;  2EIL E;  2XEV A;  3LYA A;  3FP3 A;  2P9L G;  5KJM A;  4N3A A;  3R9M A;  2WQ6 A;  5JMN D;  3RO2 A;  4M7C A;  3TG4 A;  3IHY A;  3TWR A;  5CEC B;  4UI9 C;  5FZQ A;  5C2Y A;  4RQI A;  3ZN3 A;  3FTW A;  5ENQ D;  4DJA A;  3S7J A;  3UIO C;  2A4Z A;  1K1B A;  2UY1 A;  3PZ3 A;  4R7L A;  3B7S A;  2WXF A;  2WXG A;  4UWF A;  3FU3 A;  2IU1 A;  1XNF A;  2P2C P;  4UWK A;  3QJZ A;  4OYS A;  3D3M A;  1IHB A;  3Q5M A;  5FQ7 A;  3NZU A;  1H6P A;  2KC7 A;  4XKB A;  4DX1 A;  1TNO A;  3RJV A;  4DK5 A;  5BT1 A;  5KCM A;  2OCC E;  3ZXP A;  3NBN B;  4BY6 A;  2P9I G;  5JJ6 A;  3RRN B;  3S7B A;  2GRN B;  2IFU A;  1QBQ A;  2EIN E;  4I2Z A;  2XQ0 A;  3CHQ A;  3Q75 A;  1DCE A;  2UWJ G;  3BUA A;  1WDY A;  3DSS A;  4Y6C A;  1NFI E;  4UQZ A;  4WUY A;  2RFA A;  1FVH A;  4FJZ A;  2BKK B;  4JC8 A;  3SY2 A;  3B95 A;  2KAT A;  2AWI A;  1OUV A;  3SO8 A;  2KM4 A;  2VGE A;  4U8H A;  3QAR A;  3HDX A;  1ZU2 A;  2E2E A;  3APF A;  3SF4 A;  2R2L A;  3HYM B;  5JA4 D;  3PRZ A;  1ZB1 A;  1UJK A;  5EYP F;  3HVE A;  4GZD A;  1E7U A;  3PNL B;  3B7R L;  2XS1 A;  3Q9U C;  5FIO A;  3FUJ A;  3CHS A;  3FUI A;  3OXF A;  1HU3 A;  2HYZ A;  3JCK C;  3BG0 B;  1E96 B;  5EN5 D;  4AVX A;  1ELK A;  3ULQ A;  1SVX A;  4DX6 D;  5CCM A;  2KZT B;  3UIN C;  3E34 A;  2EIM E;  5G55 A;  1LD8 A;  1TNU A;  3FUH A;  3APC A;  4CZ2 D;  2IEJ A;  4URK A;  1TN6 A;  2WPV A;  3G2W A;  3FU6 A;  3BEE A;  2CG2 A;  2XGS A;  1PY1 A;  5E76 A;  1MX6 A;  3J5Q B;  1TN7 A;  4RG9 A;  5C1D A;  2QZA A;  5EIB E;  2C0L A;  5ANL A;  4LCT A;  2BF0 X;  5FZS A;  2IO2 C;  4C48 B;  1W3B A;  2RKK A;  4ILI A;  3LJN A;  4FP7 A;  4LG6 A;  2P9K G;  2VSO E;  3L82 A;  4GTR A;  4J7W A;  4Q69 A;  1FT2 A;  4GZ5 A;  1OCR E;  1VDY A;  2AXZ A;  4O60 A;  4CT4 A;  1TJF A;  2DWZ A;  3KEA A;  3C3O A;  5EIL A;  1LD7 A;  4U95 D;  2I9C A;  5BXO A;  3SGH A;  1JCS A;  3FEY A;  4KXK B;  4HVB A;  1JUQ A;  2RD0 A;  3ZIM A;  3IKO B;  2J09 A;  3IEG A;  5BUZ A;  4RLY A;  1MQS A;  2A5E A;  4DI4 A;  1KLX A;  1TNY A;  3NOC D;  4HRL A;  1H19 A;  3U4T A;  2I1J A;  1YCS B;  5AAO A;  2BUG A;  5EKQ D;  3EHN A;  3UIP C;  4J8F A;  4HOT A;  2WXP A;  3HXC A;  1V55 E;  3R7Q A;  4BTB A;  1A17 A;  2ION A;  4GPM A;  4K0R A;  3QDN A;  2PNN A;  3DWL G;  3QWW A;  4AOF A;  3KS2 A;  3N71 A;  2HM8 A;  4ANV A;  3MX3 A;  4FA6 A;  1N4S A;  5BW8 C;  3ML9 A;  2AXU A;  3RIB A;  3Q4A B;  5LFA A;  3FUN A;  3PDN A;  1D8D A;  4BWR A;  3MV3 B;  4APO A;  4Z68 A;  1WAO 1;  2EIK E;  3KD7 A;  3VTX A;  3CGH A;  1N4R A;  4BT9 A;  3CK8 A;  5FZR A;  2HO1 A;  3J5P A;  4KVM A;  3AJI A;  2DVW A;  2JAB A;  2VSN A;  2WMN A;  4IN3 B;  4EEC A;  4QQI A;  4FU3 A;  1D8E A;  4MKT A;  5FJY A;  4EHM A;  4XZ4 A;  2CHZ A;  3JYS A;  1IXV A;  4O6F A;  2DYS E;  1Z6T A;  3PUK A;  4C9B B;  2YNQ A;  4HI9 A;  2AVP A;  2XHE A;  4MBG A;  3HIZ A;  1N4Q A;  4PUC A;  4V3I A;  2QYU A;  4LNU D;  3CQG B;  4N5C A;  4NAC A;  3BU8 A;  3V79 K;  2IO3 C;  3TJP A;  4BFR A;  4X8Q A;  1MHQ A;  3QKY A;  1TNB A;  2XEN A;  4LNB A;  2J4B A;  2L0T B;  5CBN A;  2B6C A;  5KJN A;  1OY3 D;  2OVB A;  5ARG A;  4A55 A;  4U7E B;  5CEA A;  3UQ3 A;  4HB5 A;  2I6H A;  4JZY A;  3DSU A;  3I5P A;  3RO3 A;  5CER B;  2VGX A;  2WXL A;  1EYH A;  2VTB A;  1FVF A;  4M3O A;  2QC9 A;  3FUD A;  3ZYM A;  3PRE A;  2VSX E;  3I4R B;  4GCO A;  2FF4 A;  3IXE A;  4EQF A;  2R59 A;  4DPR A;  3U66 A;  4TUU A;  3FTY A;  3LDZ A;  4JHK A;  4A63 B;  4U96 D;  5HQ8 A;  2XGO A;  1U2V G;  2JLB A;  4U63 A;  2F8Y A;  3JUI A;  4NQ0 A;  2VSY A;  4WNG A;  1JPL A;  4N5Q A;  3UM0 A;  3FTS A;  5FIN A;  1QQE A;  3QC1 A;  1H6K A;  2V0P A;  3PVL A;  4AXH A;  4F1P A;  3CV0 A;  4JHJ A;  1D9S A;  3E37 A;  4N2Q A;  3EIJ A;  3MGB A;  1OWO A;  3NQP A;  2FUL A;  3HXD A;  2I2O A;  4A1S A;  1NI1 A;  4ILH B;  2X3M A;  3TXM A;  4EZJ A;  2Y1L E;  3B13 A;  4QFV A;  3TWW A;  1TN8 A;  1OWM A;  1JCR A;  4UQX A;  4ANU A;  1ELR A;  1KT1 A;  4WND A;  2IOS A;  2LXL A;  3L08 A;  3FU0 A;  4U0U A;  3CVY A;  3PUJ A;  4HOQ A;  4G24 A;  3MJW A;  1FT1 A;  1JWG A;  4FAD A;  4HOU A;  3HRA A;  4ATG A;  3GYZ A;  3FUE A;  1RZ4 A;  3CHM A;  4H7X A;  4KVO A;  2GRM A;  3RAU A;  1TYQ G;  2OVF A;  5IY5 E;  3C3Q A;  1IQR A;  3MCX A;  4O1P A;  2FO7 A;  2LUH A;  5DIZ A;  4DX2 A;  2R17 C;  2R02 A;  3Q78 A;  4DX5 D;  3PE3 A;  3ZYL A;  1FPP A;  4HOR A;  4JVS A;  3FU5 A;  3PEU B;  5B1A E;  3ZNG A;  3TWQ A;  3ESL A;  3CHP A;  4ACL A;  5FQ8 A;  2GRQ B;  3FUK A;  4K5B A;  4GA1 A;  4J6I A;  2V8S E;  4GTV A;  1OCC E;  2C2L A;  4EBA G;  4N39 A;  3D9L A;  3FHE A;  4YND A;  1HO8 A;  3AG4 E;  1JCQ A;  3SBS A;  5HRY A;  3TWX A;  2R03 A;  5EYL A;  4WNF A;  2J9Q A;  5EX3 A;  4BSX A;  3R7R A;  3FTZ A;  3R9A B;  4GYY A;  4TRQ A;  1HFA A;  2FEZ A;  3C72 A;  5AJL A;  3P1U A;  3LY9 A;  2WB2 A;  1Y8M A;  3CVN A;  3I3N A;  4BTA A;  3EJN A; 
#chains in the Genus database with same CATH homology
 3UT8 A;  4ILI A;  4NUR A;  2PQR A;  4FP7 A;  2WXO A;  4CDR A;  1NP7 A;  4J8D A;  2VSO E;  3S7F A;  3L17 A;  4JL0 A;  3HVE B;  3CVW A;  2MRI A;  4Q69 A;  4J8S A;  4GAA A;  1Y6I A;  2IQC A;  2NSZ A;  4GZ5 A;  3NZS A;  4GYW A;  1VDY A;  1HS6 A;  2X6F A;  2AXZ A;  4OVV A;  3CVX A;  4P29 A;  2LSU A;  3URZ A;  4XI9 A;  4E85 A;  2QY7 A;  4CT4 A;  1TJF A;  2WQH A;  3FTU A;  3L54 A;  4WWO A;  5AJD A;  4L2Y A;  3CHO A;  3OXL A;  1SQM A;  2J08 A;  3UUX A;  1E8X A;  4FUL A;  2CFZ A;  3QAQ A;  4XE0 A;  4PH4 B;  3ZGQ A;  1L5J A;  4JEH A;  3SFZ A;  1H0A A;  2WXJ A;  3AU5 A;  2I9C A;  3I4G A;  4IUL A;  3SGH A;  1IQU A;  4F1S A;  2CG3 A;  3ONK A;  3CVP A;  3FEY A;  3CK7 A;  3EDT B;  1S0P A;  3LPZ A;  4LUN U;  5FT9 A;  3MKR A;  4KXK B;  4ME2 A;  4ANW A;  4HVB A;  4PS8 A;  1JUQ A;  4UWG A;  2RD0 A;  3ZIM A;  3IBE A;  3IKO B;  4H7Y A;  4XIF A;  5G05 J;  5FWQ A;  1UJJ A;  1XGW A;  3KEZ A;  1IHG A;  1INZ A;  3ML8 A;  3TL5 A;  1P5Q A;  5LCW J;  1ELW A;  5J08 A;  4A1G A;  4CGW A;  2J09 A;  3ONL A;  5G04 J;  3IEG A;  3O4Z A;  4CDM A;  5A6C A;  5JJT A;  5BUZ A;  2BTD A;  2JEK A;  2XCC A;  4CGV A;  4F53 A;  4AP2 A;  3R9A B;  3FTV A;  4I6J A;  1MQS A;  5CMY A;  4HFG A;  4DI4 A;  2GRL A;  1KLX A;  4UQY A;  3Q15 A;  3T5X A;  4AV7 A;  4IRU A;  1HX8 A;  2WXK A;  3FWV A;  1H19 A;  3U4T A;  2I1J A;  2L0I A;  3QWP A;  4IYP A;  2LSV A;  4OVU A;  2HR2 A;  2BUG A;  5EKQ D;  1E8W A;  2E0I A;  3EHN A;  4I1A A;  5AIJ A;  4J8F A;  4HOT A;  5AEN A;  2WXP A;  1E90 A;  3CSF A;  4L2L A;  3R7Q A;  2X6H A;  5T3R A;  5ANR A;  4BTB A;  1EF1 C;  2Q7F A;  3ZVV A;  3ASG A;  5HI7 A;  2PM6 A;  3MYV A;  4YVO A;  1A17 A;  2ION A;  3S7D A;  5A7D B;  2CFU A;  4K0R A;  3QDN A;  4I17 A;  1H2T C;  3D9P A;  4UI9 J;  4KMO A;  3SNX A;  3QWW A;  4JXT A;  4PS3 A;  4ABN A;  4JA7 A;  5CHE E;  4AOF A;  3FDH A;  3KS2 A;  2VYI A;  3JQ0 A;  5M72 A;  2XRY A;  3LY7 A;  2DIW A;  3N71 A;  2HM8 A;  3PE4 A;  4Q94 A;  4ACK A;  4ANV A;  2L9B A;  3MX3 A;  4FA6 A;  5BW8 C;  2IF4 A;  3ML9 A;  2LO6 A;  2AXU A;  4U0S A;  3ZYQ A;  2LAI A;  3RIB A;  4BX8 A;  3OXG A;  4BT8 A;  2FBN A;  3Q4A B;  5LFA A;  3FUM A;  3FUN A;  3PDN A;  2LNI A;  1ZBP A;  4BX9 A;  3MZL B;  3QOU A;  4Q96 A;  4J0U A;  3D9N A;  3MV2 B;  3U9W A;  4BWR A;  3MV3 B;  1QNF A;  4APO A;  4EBA A;  3PEV B;  1WAO 1;  3L22 A;  3KD7 A;  3CIA A;  5D0O D;  3IV0 A;  3LY8 A;  4J8E A;  3VTX A;  4U0Z A;  3CGH A;  4BT9 A;  3DBS A;  3CK8 A;  5FZR A;  4I9C A;  2HO1 A;  4FJY A;  4KVM A;  1E8Z A;  2GW1 A;  5FTP A;  2OV8 A;  4D10 C;  1E8Y A;  1LF8 A;  4I6G A;  3FTX A;  3CHR A;  2XPI A;  2NXP A;  3AS4 A;  4I6E A;  4N3B A;  1Z3X A;  3LJ3 A;  3EIQ C;  4B94 A;  4G26 A;  1H2V C;  3MKQ A;  4UWL A;  2VSN A;  5G2N A;  2WMN A;  4IN3 B;  2EQX A;  3FH7 A;  1UW4 B;  4EEC A;  4PDX A;  2YQ8 A;  4FU3 A;  2MOW A;  2WXR A;  1OWL A;  4MKT A;  4KT6 B;  3TGO A;  4WWN A;  1B89 A;  3TAX A;  5FJY A;  3QB2 A;  3ZHE A;  3RU0 A;  1GW6 A;  4XZ4 A;  4G25 A;  3D9M A;  3LCA A;  2Y3A A;  2CHZ A;  3JYS A;  2VQ2 A;  4U07 A;  4YVQ C;  4O6F A;  3BG1 B;  2R5S A;  3NF1 A;  2QFC A;  3LVR E;  1Z6T A;  2PM7 A;  3PUK A;  4GCN A;  4C9B B;  1EPU A;  2YNQ A;  4EZK A;  3C98 A;  2M63 A;  2AVP A;  2XHE A;  3HIZ A;  3VLF A;  1TJC A;  2KCK A;  3UT4 A;  4PUC A;  3DPD A;  4KBQ A;  4V3I A;  2FI7 A;  3ASD A;  3RK6 A;  4CCA A;  3ZXS A;  4UI9 K;  2KCV A;  3CQG B;  4N5C A;  1N54 A;  3HHM A;  4NAC A;  3L16 A;  2NC9 A;  2DBA A;  4L1B A;  2WXQ A;  3G2T A;  3TJP A;  2V4L A;  5BV1 A;  4KZC A;  4BFR A;  4B8C B;  4G2V A;  1MHQ A;  2DCP A;  3QKY A;  4N3C A;  4L7T A;  5T8I A;  5EDS A;  2J4B A;  2L0T B;  3IHV A;  3UMV A;  3LKU A;  1JWF A;  3MEK A;  4KYO B;  5KJN A;  5LX8 A;  3ENE A;  2V5F A;  2AXV A;  4MLP A;  3CVQ A;  1EDU A;  3T8M A;  3UX4 A;  4GA0 A;  3MA5 A;  2XPZ A;  2OVB A;  5FQ6 A;  3PNT B;  5JHA A;  5ARG A;  4K03 A;  1HG5 A;  3VLE A;  5E75 A;  4A3T A;  5A23 A;  4A55 A;  4GZC A;  3VTY A;  4W9R A;  3EJN A;  4RVB A;  4HS2 A;  3UQ3 A;  4GPK A;  1Z3Y A;  4LER A;  3CK9 A;  4WWP A;  2I6H A;  4JZY A;  3I5P A;  4RSY A;  3RKV A;  3CVV A;  3RO3 A;  2VGY A;  3MKQ B;  3TG5 A;  2VGX A;  2WXL A;  5AYW D;  1EYH A;  2VTB A;  3PH0 C;  2CHX A;  1FVF A;  4M3O A;  1PC2 A;  3FUL A;  3FUD A;  4GML A;  4L23 A;  2XPY A;  3PRE A;  1HXI A;  2VSX E;  3ZYM A;  3I4R B;  4GCO A;  3ESK A;  2FF4 A;  5ENN A;  3RRU A;  3ZHE B;  2WXI A;  4EQF A;  4JW1 A;  5BNW A;  2J07 A;  2R59 A;  4DPR A;  3Q49 B;  3U66 A;  4I1O B;  2YIN A;  3AS5 A;  1IYG A;  4GU5 A;  3AU4 A;  4TUU A;  2AW6 A;  3FTY A;  3D9K A;  2YHC A;  3LDZ A;  4JHK A;  3ZEF A;  5CMW A;  3G2S A;  3Q47 B;  2XEV A;  5HQ8 A;  3LYA A;  4FLB A;  4WNE A;  3FP3 A;  5LOZ A;  3UT7 A;  5KJM A;  2XGO A;  2JLB A;  4N3A A;  4U63 A;  5DBK A;  1DNP A;  2Y4U A;  3KAE A;  2WQ6 A;  1NZN A;  2I1K A;  2X38 A;  3RO2 A;  3TG4 A;  4I43 A;  2J49 A;  4B0Z A;  3O48 A;  4I2W A;  3JUI A;  4NQ0 A;  2VSY A;  4HXI A;  4WNG A;  1JPL A;  2P58 C;  3FH5 A;  4JHR A;  3IHY A;  3FTS A;  4CRW A;  4XI0 A;  1QQE A;  4UI9 C;  3QC1 A;  1H6K A;  2V0P A;  4XKC A;  5FZQ A;  1HH8 A;  4GB9 A;  4AM9 A;  4FHK A;  5C2Y A;  1UN9 A;  1DVP A;  4U04 A;  3ZN3 A;  4F7A A;  3FTW A;  2PZI A;  3PVL A;  4GA2 A;  4AXH A;  1UG3 A;  3OTN A;  1SZA A;  4DJA A;  3S7J A;  3CV0 A;  4JHJ A;  5T4Y A;  3U64 A;  5JHB A;  2A4Z A;  2X6J A;  4AY5 A;  4N2Q A;  2UY1 A;  3EIJ A;  4R7L A;  3L13 A;  4FLH A;  4GZ6 A;  4AEZ C;  3B7S A;  4JA9 A;  3MGB A;  2WXF A;  1OWO A;  2WXG A;  4UWF A;  3NQP A;  3FU3 A;  2FUL A;  2IU1 A;  1XNF A;  3CVL A;  5J90 A;  3PS6 A;  3FY4 A;  2I2O A;  3B7T A;  4A1S A;  4CDN A;  4DLQ A;  4N2S A;  4UWK A;  2VJ8 A;  4C0M A;  3L6A A;  3QJZ A;  4HOS A;  4OYS A;  2WVI A;  3D3M A;  3S2A A;  2OND A;  2C0M A;  3FH8 A;  4ILH B;  2VGX B;  2ZU6 B;  2X3M A;  3TXM A;  2GGF A;  3Q5M A;  4B8A A;  5FQ7 A;  4EZJ A;  3NZU A;  4AIF A;  1H2U A;  4MS6 A;  2KC7 A;  2PQN A;  3B13 A;  4QFV A;  4GZ3 A;  3CST A;  1OWM A;  4XKB A;  3G2V A;  3ZW3 A;  4UQX A;  4ANU A;  1ELR A;  1KT1 A;  3RJV A;  4UWH A;  2XGM A;  3GZ1 A;  4WND A;  2IOS A;  5KCM A;  4DK5 A;  4AY6 A;  1BPO A;  2VTB B;  3L08 A;  3ZFW A;  3P2B A;  4BY6 A;  5JJ6 A;  4B89 A;  3RRN B;  3S7B A;  2IFU A;  3FU0 A;  3CVU A;  4TV3 A;  4G1T A;  4JPS A;  3FFL A;  4U0U A;  5FQ4 A;  1NA3 A;  3CVY A;  3FUF A;  4I2Z A;  2XQ0 A;  3CHQ A;  2WXN A;  2KZT A;  3G2U A;  3SD5 A;  2UWJ G;  3PUJ A;  4HOQ A;  4G24 A;  3MJW A;  4Y6C A;  3D9I A;  4CEM A;  4JEU A;  1JWG A;  4UQZ A;  3ASH A;  3ASF A;  3OAW A;  1OWN A;  4WUY A;  4Y6W A;  1YA0 A;  3CKC A;  4CT0 A;  5KJK A;  1FCH A;  3JQ1 A;  4FAD A;  2PL2 A;  1FVH A;  4I1M A;  4HOU A;  4MRU A;  3RRM B;  4FJZ A;  4JC8 A;  4F3V A;  3ZPJ A;  4FHJ A;  2ILR A;  2KAT A;  5BV0 A;  4ATG A;  4ANX A;  3GYZ A;  2AWI A;  1OUV A;  3FUE A;  3CHM A;  3FEX A;  3CEQ A;  4GYO A;  1SZ9 A;  4H7X A;  4RG6 A;  2KM4 A;  1HG2 A;  2RG8 A;  2XRZ A;  3LXU X;  4GMJ A;  4KVO A;  4HLE A;  4EPZ A;  2GRM A;  4A3V A;  4U8H A;  2IOL A;  1X5B A;  3HDX A;  3QAR A;  1PAQ A;  2OVF A;  2UY1 B;  2WXH A;  5LP0 A;  1IQR A;  3MCX A;  3SBT B;  1ZU2 A;  2FO7 A;  2E2E A;  4PS7 A;  4APF A;  3ZYK A;  3APF A;  1OWP A;  5G05 C;  5DIZ A;  3SF4 A;  3EHM A;  1TEZ A;  2XCB A;  1U3C A;  3D9O A;  3HYM B;  5LCW C;  2R17 C;  3PRZ A;  3ZRH A;  3WXX A;  1UJK A;  3PE3 A;  4I9E A;  5G04 C;  2X6K A;  3ZYL A;  1HZ4 A;  4HOR A;  2L6J A;  4JVS A;  3FU5 A;  3PEU B;  3HVE A;  4LEU A;  4GZD A;  1E7U A;  3VLD A;  3ESL A;  3PNL B;  3CHP A;  3GW4 A;  4ACL A;  3D9J A;  4WAF A;  3B7R L;  3B7U X;  5FQ8 A;  4EZL A;  2Y4T A;  2WXM A;  3CQC B;  5JJ7 A;  3FUJ A;  3FUK A;  3CLJ A;  3GZS A;  4GA1 A;  4J6I A;  1QZ2 A;  1U3D A;  2V8S E;  2C2L A;  4EBA G;  3CHS A;  1UN8 A;  3FUI A;  3OXF A;  1HU3 A;  1HF8 A;  3QNK A;  4N39 A;  2HYZ A;  3JCK C;  5EX0 A;  5D0Q D;  3BG0 B;  1E96 B;  3D9L A;  3LEW A;  3FHE A;  4YND A;  4AVX A;  4AJW A;  1ELK A;  1HO8 A;  4G11 A;  2A5U A;  3SZ7 A;  3QK0 A;  3ULQ A;  4DI3 A;  4XX5 A;  3K9I A;  3CKB A;  1HE8 A;  4C0E A;  5CCM A;  2OOE A;  2KZT B;  4KZ0 A;  4ILG A;  5ARF A;  5G55 A;  3SBS A;  3TXN A;  3FUH A;  3AS8 A;  3UPV A;  3U3W A;  3APC A;  1NA0 A;  4WNF A;  1WY6 A;  2J9Q A;  5BPP A;  5EX3 A;  2WQ7 A;  4E6H A;  4URK A;  4BSX A;  3R7R A;  2YHE A;  3T5V A;  2WMO A;  3PZD A;  3CR3 A;  3FTZ A;  3LVQ E;  1E7V A;  1KT0 A;  3SHF A;  2WPV A;  3G2W A;  3FU6 A;  2IJG X;  4G23 A;  4GYY A;  3BEE A;  4TRQ A;  1HFA A;  2CG2 A;  1PY1 A;  1WM5 A;  2FEZ A;  2XGS A;  5AJL A;  3SI5 A;  5BT1 A;  3GZ2 A;  2LAH A;  4NRH B;  2J4D A;  3LS8 A;  3P1U A;  5E76 A;  5KJL A;  2KCL A;  2X6I A;  3QWV A;  3LY9 A;  2WM9 A;  4RG9 A;  1Y8M A;  2WB2 A;  5C1D A;  3E4B A;  3CVN A;  2C0L A;  2MHK A;  5ANL A;  3I3N A;  4DLO A;  4BTA A;  4LCT A;  2BF0 X;  3APD A;  4LRZ A;  5FZS A;  4FC8 A;  2CHW A;  1N52 A;  1W3B A;  5CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...