3TWSA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human terf1 (chimeric peptide)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twsA00
5ENPD 2KBXA 4HQDA 4YDYA 1YCSB 4ZHBA 1QYMA 4OAVB 3B7BA 2NYJA 4U96D 2DZOA 4O1OA 5ENSD 4U8VD 3IXEA 2XZTG 5ENRD 2AJAA 5AQ9A 5HKPA 1MJ0A 3T9KA 1SW6A 3TWQA 5AN8A 1A5EA 4LNUD 4YDWA 4Z68A 2DZNA 5CBOA 4OAUC 3V2OA 2F8YA 5EILA 2RFAA 3DEOA 1UOHA 4K5AB 5ENOD 5EN5D 1N0QA 4QQIA 1OY3D 3JUEA 2ETBA 2ZGDA 4F1PA 4HI8A 4B93B 5CBNA 4HLLA 2RFMA 2DVWA 1BLXB 4O1PA 4DX2A 5KWDA 2DWZA 1YYHA 4HRLA 1WG0A 5CERB 2QC9A 2JABA 2MYOA 3TWRA 4DX7D 5BXUA 4DX5D 3UI2A 3V30A 3V79K 1S70B 5FINA 3ZUVB 4TUMA 1OT8A 4DRXE 4BSZB 5AQ7A 3ZNGA 3D9HA 2F37A 2ETAA 2B0OE 1BD8A 2ETCA 1YMPA 4F6RD 3ZU7B 3Q9NC 1IKND 3Q9UC 2XENA 4LSZE 1N11A 1MYOA 5KNGA 3SO8A 3NBNB 4K5CA 2KXPC 2BKGA 4BETA 3UTMA 2ZGGA 2P2CP 4DX1A 2VGEA 4JB8P 4BERA 1WDYA 2A5EA 4CYMD 3TWXA 1MX4A 2QYJA 1TR4A 2BKKB 5ENTD 5HRYA 4G8LA 1D9SA 4GMRA 1K3ZD 3TWTA 2Y0BG 3AAAC 4U8YD 1N0RA 5HS0A 5FIOA 3T8KA 3J5PA 3B95A 1AP7A 3JXIA 3TWVA 3TWUA 1K1AA 1DC2A 4J8YA 3JXJA 2Y1LE 2XEEA 2PNNA 5EYLA 1IHBA 4DX6D 1NFIE 4UUCA 2V4HC 4GPMA 3TWWA 3F6QA 5JMND 5ENQD 4BESA 1BU9A 2HE0A 1MX2A 3W9FA 3LJNA 5ITZF 4HRNA 3ZKJA 4HRMB 4ATZD 1SVXA 1IXVA 4N5QA 3NOCD 1BI8B 5D66A 1DCQA 3HRAA 5CEAA 1K1BA 4U95D 3W9GA 3EHRA 4HI9A 2XZDG 3DEPA 4HB5A 3AJIA 2F8XK 3C5RA 5JA4D 5BXOA 5EIBE 5KNHD 4CZ2D 4ZFHA 4BEPA 4NIKA 1MX6A 4DUIA 3EHQA 3HG0D 4HNAD 4HBDA 2XEHA 4K5BA 5AARA 3TWSA 5CECB 1BI7B 2J8SD 3NOGD 4O60A 3J5QB 2L6BA 3V2XA 5KBAA 5CEDB 4J7WA 5AQAA 1G3NB 5EIDA 4RLYA 2V5QC 3EU9A 3UXGA 4QFVA 4C48B 5AAOA 5AQBA 3V31A 4G8KA 3KEAA 5EYPF 4LG6A 4A63B 2FO1E 1AWCB
chains in the Genus database with same CATH superfamily
4PDXA 1HFAA 2XQ0A 3I4GA 3I5PA 3EHMA 4I6EA 4XKCA 3RO3A 5EN5D 2GW1A 4GZ5A 2WMNA 3MV3B 3SHFA 3RO2A 4WWOA 4Q94A 3QARA 4GTRA 1V54E 3V79K 2A5UA 5LCWC 2R03A 5E76A 3G2TA 2GRRB 2B0OE 4Y6CA 4MBGA 2GRNB 3CVPA 1JPLA 3AS5A 2WB2A 2RD0A 2XGSA 3TWTA 4U8YD 3L13A 1N0RA 2IF4A 3ZYLA 3FU0A 2IO2C 4FJYA 3PZDA 4FADA 4M3OA 2OVBA 3Q4AB 3FH7A 1DVPA 1BI8B 3T5XA 5CEAA 2F8XK 2P9KG 2XRYA 1E96B 3CQGB 3CIAA 4K5BA 1NL4A 4A3VA 2RG8A 5KBAA 1D8EA 3HIZA 2OVFA 2WMOA 1RZ4A 2IU1A 4H7YA 4EZKA 1WAO1 4AY6A 4U0SA 2WXPA 3IXEA 5HKPA 2J4DA 3BU8A 4YDWA 1TN6A 1N4QA 2L6JA 3ZYQA 4EHMA 3RIBA 4FC8A 3UM1A 3D9IA 3QWWA 1XNFA 3ASHA 3CVUA 3ZNGA 3QJZA 2ETAA 3K9IA 3D9MA 3NZUA 4V3IA 4F1SA 2BKGA 3ESLA 1PY1A 5ARGA 1PC2A 4CYMD 3L9TA 5J90A 2BKKB 1HG5A 3SF4A 2DBAA 2IJGX 2AXUA 5JJ7A 3FEXA 3FUJA 3JXIA 1IYGA 3CHMA 5G04C 5JMND 4GTSA 1MX2A 3UX4A 4ATZD 5LX8A 3NOCD 4U95D 4HI9A 2OEVA 1MX6A 3Q78A 4DUIA 3UMVA 4N3AA 3R9MA 3MZLB 3L82A 4JEHA 5EDSA 5BT1A 5FQ4A 3QNKA 1JCRA 5BNWA 2NYJA 4U96D 4MLPA 4XI9A 1H6PA 3Q7AA 4B89A 5AN8A 3JYSA 4J0UA 3FULA 5CBOA 5BUZA 2RFAA 4JD2G 2KZTB 2CFUA 3AS4A 4A1GA 2VGXB 1E90A 4HVBA 3TXNA 4J8DA 4CRWA 5CBNA 2BTDA 1YYHA 2QC9A 2WQ7A 3TL5A 1PAQA 2L0TB 1KPSB 2X6IA 5LCWJ 3Q75A 4WWPA 3SQVA 1JUQA 1V55E 3FUDA 2VTBB 2H6GA 2CG2A 3ONKA 3MKQA 2IEJA 4DX1A 3G2SA 3S7DA 1HZ4A 4ACLA 4CGWA 1E8YA 4G8LA 2XGOA 1OWMA 4L1BA 4WAFA 3ASFA 3T8KA 2HM8A 3G2WA 1QQEA 3TJPA 2GGFA 2XEEA 1EPUA 4YVOA 2OEWA 4IRUA 1U3DA 2R2LA 3UKRG 4GU5A 4HRMB 4A55A 3AS8A 1ZU2A 1TN8A 3ISMC 3W9GA 3KAEA 4HB5A 2PM6A 2IFUA 2XS8A 3UIOC 3L54A 2LAHA 3DSSA 2H6IA 4EQFA 2ZU6B 3HXCA 3SFZA 3V2XA 3ZW3A 4JHKA 4P29A 5CMWA 2VSYA 3AG4E 3PVLA 2YNQA 4AP2A 3TWQA 2OV8A 1SW6A 4U0UA 3LEWA 2WXQA 4ANWA 3X2QE 2PQRA 1UOHA 2Q7FA 4K5AB 5ENOD 5KJNA 2DYSE 3JUEA 2ETBA 4JHJA 3U64A 2DVWA 2QY7A 2R17C 5BV0A 1OCCE 2PL2A 3LYAA 4PH4B 3ZFWA 4BSZB 3SNXA 3UM2A 3R7QA 3QWPA 3P1UA 3EUVA 4RQIA 4PS3A 2LSVA 2FI7A 3CHSA 5EKQD 3Q9NC 4FHKA 4UI9J 1UJJA 5ANLA 3AU4A 4GYYA 4GMRA 4KYOB 2Y0BG 3ML9A 2J49A 2FULA 1HH8A 1AP7A 4Y6WA 4I43A 4UQZA 5A7DB 3TWUA 5EYLA 3ZHEB 5CHEE 5AJLA 5ENQD 1BU9A 1OWPA 4J8EA 2UWJG 5EX0A 1IXVA 5D66A 3MX3A 3EHNA 1QZ2A 4OVUA 4XZ4A 2GRLA 3J5QB 2P9UG 2AXVA 3LY9A 2EINE 2FO1E 2KBXA 4HQDA 3ZVVA 3UM0A 3DSUA 4LRZA 3V2OA 4MRUA 4OVVA 3ASGA 4G24A 2RFMA 4RG9A 1OCOE 4O1PA 4ILGA 2IOSA 3FUHA 4GAAA 1S70B 2LNIA 3E32A 2WXFA 2CHZA 3E37A 5DIZA 3OXLA 1H19A 4F6RD 4WNFA 3PS6A 3MKQB 1OWOA 5T4YA 4PUCA 2ZGGA 4JA7A 2NXPA 3UM3A 1U2VG 3CK7A 3B7UX 1S0PA 4L7TA 1MX4A 4KBQA 3FTSA 4C0EA 2V5FA 3ZYKA 1S63A 5HS0A 3J5PA 1TNZA 4DLOA 4U8HA 4F53A 1DC2A 3FTYA 4YVQC 2PNNA 1NFIE 4UUCA 4EZLA 4UWFA 2RKKA 3CEQA 4PS7A 5CMYA 2VQ2A 1U3CA 3DXKG 1BPOA 4XI0A 4C0MA 5EIBE 5AARA 3FUNA 1O1SA 2P58C 1OCZE 3B13A 5AQBA 4F3VA 1IQRA 3ASOE 3CVVA 4FU3A 2XCCA 2X3MA 3CK9A 3IBEA 4JVSA 3ULEG 5FWQA 1KLXA 4GZCA 3AG1E 3MGBA 1SZAA 4DX2A 4U0ZA 3IHVA 4HRLA 5BV1A 4N2QA 3SZ7A 3HVEB 4KMOA 4DX5D 3T5VA 1TJCA 1OXJA 3C3RA 3RAUA 4UWGA 4U7EB 1YMPA 5ENNA 3ASDA 2L0IA 1MYOA 1Z5SC 4TRQA 2Y3AA 1D8DA 4M7CA 1NP7A 4FLHA 3BUAA 2FBNA 3QC1A 4GMJA 3ZN3A 2I9CA 4DK5A 3NF1A 2VYIA 3CQCB 4UQYA 1KZOA 2P9NG 4DI3A 5B1AE 3FFLA 3RKVA 3Q73A 4ACKA 3APDA 2BF0X 4OYSA 4DLQA 2H6FA 3Q79A 3RRMB 3EHQA 5CCMA 1O5MA 4HBDA 2WPVA 5CCLA 2V4LA 5CEDB 5AQAA 3TG4A 2YINA 4Q69A 4CDRA 1UN9A 3CHRA 2VTBA 2X6HA 1X81A 2DIWA 3C72A 4BTAA 2WXJA 4I1AA 3HXDA 4KZCA 3QDNA 5G55A 3JQ0A 3L17A 2CHXA 5CERB 3AG2E 1LTXA 3UI2A 4YDOA 3ZUVB 1OT8A 3R7RA 3FY4A 3D9HA 1INZA 2Y4TA 5D0OD 3QOUA 4NRHB 2KCLA 2V8SE 3FUKA 3UT7A 3C3QA 2VGEA 4WNGA 2MHKA 2WXRA 2L9BA 2IQCA 4HFGA 4FHJA 4XX5A 4I6GA 3ABLE 3ABME 1HX8A 3LVRE 1KZPA 4FA6A 3HRAA 2CG3A 4N39A 4K03A 3DEPA 3Q7FA 3L6AA 5HQ8A 5JA4D 3QB2A 4KVMA 3FTUA 4I9CA 4RG6A 3FTXA 3TWSA 1FT2A 4UWLA 4JW1A 1MQSA 4J7WA 1S64A 3UXGA 2I2OA 3HXBA 4BFRA 4N5CA 3L08A 4CT0A 1HG2A 4YDYA 4OAVB 3DPYA 1TNUA 4UQXA 4EECA 4U8VD 2XZTG 5AQ9A 5ENRD 1NI1A 1TN7A 3T9KA 2F8YA 3TXMA 2FEZA 1E8XA 3PH0C 1RW2A 4B93B 2C0LA 5KWDA 4BT9A 2VSOE 4A1SA 3CVYA 4LNGA 4HS2A 4KXKB 1N94A 3NB2A 3OTNA 1N52A 4G25A 5JJTA 4N3CA 5EX3A 3UT8A 3PEUB 2LUHA 3UTMA 4GCNA 4AOFA 2QYJA 1K3ZD 4B0ZA 3G2UA 2KC7A 1SZ9A 4AXHA 2R59A 2OCCE 3FUIA 2GRMA 2HE0A 2IY0C 3SBTB 3VLFA 3OAWA 3JUIA 2WXIA 5KJMA 3AJIA 4IULA 2YHCA 4LCTA 5FZSA 3E30A 2XS1A 2AW6A 2X38A 5FQ6A 1Q2ZA 4XIFA 4G26A 3BG0B 3N71A 2P9SG 1ELRA 5AAOA 4G8KA 2CFZA 2JLBA 3I4RB 1JCQA 3S7JA 3ESKA 3HVEA 2XHEA 4UI9C 4LNUD 2WVIA 5EILA 5DBKA 4B8CB 2VGYA 3LDZA 3PDNA 5KCMA 3L22A 1UJKA 1N4SA 2EQXA 2YQ8A 2DWZA 3FTVA 1WG0A 2IONA 3PE4A 3MV2B 2R05A 3QKYA 2WM9A 3D9OA 1K8KG 4L23A 1H6OA 4EZJA 1EF1C 4N3BA 3LPZA 2ETCA 1QBQA 2LSUA 2P9IG 3CK8A 3AG3E 2XENA 4G1TA 2KXPC 3FTWA 4BETA 2A4ZA 3CVWA 4W9RA 4UWHA 3SGHA 3D9JA 3EIQC 3CV0A 1E7VA 5FIOA 4JHRA 4R7LA 4HOUA 3KSLA 1QNFA 3PREA 4BESA 1A17A 2KCVA 1OCRE 3W9FA 5A23A 3E33A 3LJNA 3CHOA 2FF4A 4I2ZA 5AJDA 3VTXA 2X6KA 1FCHA 3U66A 5JJ6A 3DXMG 1ELKA 1LD7A 2XEHA 1BI7B 2GROB 3WG7E 3R9AB 1YA0A 1NA0A 3CGHA 3PNTB 4A63B 3UPVA 1O1TA 1YCSB 3KSQA 2X6JA 3B7BA 1O1RA 3QAQA 4LUNU 4JPSA 1KT1A 2OOEA 2DZNA 3Q49B 2Y4UA 1SA5A 1FVHA 5ANRA 3DEOA 2EIME 3ONLA 4HI8A 4U63A 5G05C 4BT8A 4FJZA 2WXLA 3FH5A 4RSYA 4NACA 4DRXE 3VLEA 3RJVA 3ULYA 3ZIMA 4BSXA 3PZ3A 3UUXA 3ZU7B 2PM7A 3QK0A 3UINC 2R02A 3E34A 2Y69E 3SO8A 1N95A 2AXZA 4APOA 2V0PA 3PZ4A 3TWXA 2LAIA 4TXQA 3URZA 3FUEA 3D9LA 3GYZA 4AV7A 5HI7A 2WXOA 1HXIA 2CHWA 2WQHA 1DCEA 1WM5A 2M63A 3ZHEA 2KZTA 4GYWA 3O4ZA 2WXKA 3P2BA 3VLDA 5AENA 1Y6IA 3C5RA 2PZIA 4G11A 4GTMA 4MS6A 3U3WA 3HG0D 2EIKE 2J9QA 3FUMA 5EIDA 2NC9A 2C0MA 4C48B 4QFVA 3KEAA 5LP0A 2KATA 2WXNA 3DPDA 2HO1A 1QYMA 2P9LG 2FO7A 3G2VA 4AVXA 3EJNA 4NURA 3PEVB 1MHQA 3CKBA 2HR2A 3APFA 1BLXB 1ZB1A 2MYOA 4J8SA 4DX7D 4TUMA 3FDHA 3MKRA 5G05J 3MJWA 3D9PA 4I1MA 1N54A 3UKUG 1TNYA 5LFAA 3FTZA 4EBAG 1SA4A 5ENTD 1TR4A 1H0AA 2KCKA 5LOZA 3AAAC 5KJKA 2XPZA 3FEYA 3FWVA 4CT4A 5KJLA 1HU3A 3ZRHA 3JQ1A 1TJFA 1IHBA 3CR3A 3LKUA 2ZIRA 3PZ1A 2JEKA 3LS8A 4HRNA 4RVBA 3VTYA 3HDXA 3FU5A 2EILE 3GZSA 4I6JA 3KEZA 2QYUA 3RU0A 3HXFA 4WWNA 3CSFA 5ENPD 3UIPC 4ILHB 4XKBA 3RSEG 1B89A 2YHEA 1NZNA 3OXGA 3JCKC 3ABKE 2H6HA 1OY3D 2I1JA 3SFYA 4CGVA 2X6FA 2E2EA 4ABNA 4MKTA 4L9PA 3B7TA 4J8FA 2QFCA 3V30A 4XEIG 4TV3A 3U9WA 4BTBA 4E85A 5T8IA 2J09A 3GZ2A 1EYHA 4GB9A 3WXXA 3MA5A 4CDMA 4HORA 5JHBA 3IKOB 1FPPA 2P2CP 4JB8P 1JCSA 3OXFA 1WDYA 3ZXPA 3EU5A 2WQ6A 1N4PA 1NA3A 2IO3C 5G2NA 3ML8A 1WY6A 3TWVA 4I17A 3LJ3A 1SQMA 3JXJA 3TWWA 2KM4A 4KT6B 3LY7A 1N9AA 3IV0A 1IQUA 4AEZC 2XCBA 4B8AA 3EHRA 3C3OA 4GTTA 5A6CA 2F0YA 4ANUA 4ZFHA 4CZ2D 3DBSA 1XGWA 5FZQA 2J8SD 2VJ8A 2XGMA 3DSXA 1GW6A 4HOTA 2V5QC 1ZBPA 3V31A 3DSVA 3FHEA 4ZHBA 5FQ7A 3CVQA 4O1OA 5ENSD 2DYRE 3CHPA 4GA0A 2GRPB 5B3SE 2BEDA 1TEZA 3B7SA 3ENEA 2VGXA 3PE3A 1N0QA 4XE0A 3BQOA 4CEMA 3DSWA 3MYVA 2MOWA 1OWNA 3TWRA 4BX9A 2WXHA 3MEKA 2F37A 5JHAA 1BD8A 4BWRA 3ASNE 3S2AA 2XRZA 4CDNA 4URKA 2VSXE 3AU5A 1HS6A 3Q9UC 4LNBA 4LSZE 4K5CA 3HYMB 1ELWA 3DWLG 4GPKA 3E4BA 1UN8A 4ANXA 3CVNA 3UT4A 3O48A 3HHMA 3U4TA 2V4HC 3CLJA 3RK6A 3S7BA 4ME2A 3QWVA 4E6HA 2XPYA 1H2UA 4EBAA 3PRZA 2DCPA 2LO6A 3B7RL 3FU3A 2XZDG 5M72A 4LERA 3RRUA 3TG5A 4PS8A 4NIKA 1Z3YA 4I2WA 5CECB 4C9BB 3NOGD 3LY8A 3IEGA 1E7UA 3SI5A 4F7AA 1G3NB 4RLYA 5FJYA 2IOLA 1HF8A 3S7FA 4LG6A 5BW8C 2I6HA 5C2YA 3FH8A 3SFXA 2AVPA 3SY2A 3TGOA 2MRIA 5ARFA 1HO8A 4GMLA 1MJ0A 3FU6A 4ILIA 5E75A 4JL0A 4Z68A 4OAUC 4DI4A 4IN3B 3BEEA 3APCA 2ZGDA 1W3BA 3TAXA 3HXEA 3FP3A 4K0RA 1LF8A 4APFA 3D3MA 4KVOA 2E0IA 2JABA 3LXUX 4A3TA 2ONDA 4D10C 1OWLA 2UY1B 4G23A 2XEVA 3NBNB 2LXLA 1VDYA 4NQ0A 5HRYA 4GTOA 2GRQB 4GTVA 3KD7A 4B94A 4U04A 4J8YA 4LEUA 1OUVA 5BPPA 1Z6TA 4H7XA 5ITZF 4N5QA 3NAWA 4JA9A 4WNDA 1X5BA 3SBSA 2B6CA 3CVLA 2XPIA 4HNAD 5D2MC 3GW4A 4YNDA 1IHGA 3RRNB 4GA1A 2ILRA 2C2LA 3L16A 4HOQA 3PUKA 1P5QA 2PQNA 4HOSA 3DSTA 4TXRA 1A5EA 1H2VC 4QQIA 3D9KA 5FQ8A 4Q96A 2EIJE 1H2TC 3Q47B 2R5SA 1JWGA 5BXUA 3C98A 5FINA 4TUUA 5AQ7A 4GTQA 2VSNA 1KT0A 5IY5E 1E8WA 2BUGA 2UY1A 4JEUA 1N11A 3CKCA 5D0QD 3CSTA 3IHYA 2J4BA 5FZRA 4BERA 4UI9K 2A5EA 1LD8A 4L2LA 5J08A 1D9SA 3FUFA 2HYZA 4BY6A 1FT1A 4FP7A 3B95A 5B1BE 1K1AA 2Y1LE 1UW4B 2J07A 4N2SA 3GZ1A 3F6QA 3Q5MA 1JWFA 4GZ6A 5CRVA 1SVXA 4ATGA 1Y8MA 1DCQA 4GA2A 4GYOA 4AY5A 3EDTB 5FTPA 5KNHD 3ULQA 3CHQA 1TNBA 4CCAA 2P9PG 3UQ3A 4HLEA 4O60A 1N4RA 3PUJA 1E8ZA 2NSZA 3T8MA 3ZPJA 4AIFA 3I3NA 1L5JA 5AIJA 4AJWA 3PNLB 4I9EA 4JXTA 1Z3XA 2DZOA 4UWKA 4U07A 2AJAA 2AWIA 1DNPA 3EIJA 3Q15A 4AM9A 4YDEA 2WXGA 5T3RA 4JC8A 3PZ2A 3DRAA 4GTPA 4BX8A 3KS2A 5CRUA 4F1PA 4FULA 4HLLA 1TNOA 3LVQE 4KZ0A 4ANVA 4GZ3A 3ZEFA 1FVFA 1H6KA 4JZYA 5G04J 3NZSA 4L2YA 3ZYMA 2ZXWE 4X8QA 1IKND 3ZXSA 5KNGA 5AYWD 3ZGQA 4GCOA 3MCXA 4DJAA 2WXMA 4I1OB 2ZISA 4WUYA 4HXIA 2J08A 3LCAA 2I1KA 1TYQG 3NQPA 4DX6D 5C1DA 4GPMA 1HE8A 1MZCA 3D9NA 1UG3A 3ZKJA 4O6FA 4DPRA 3BG1B 1K1BA 4TXPA 5FT9A 2LXMA 4GZDA 5BXOA 4BEPA 4WNEA 2QZAA 3CVXA 3SD5A 2L6BA 1EDUA 4FLBA 4G2VA 4EPZA 3EU9A 4IYPA 5EYPF 4J6IA 5H7PA 1AWCB
chains in the Genus database with same CATH topology
5ENPD 2KBXA 4HQDA 4YDYA 1YCSB 4ZHBA 1QYMA 4OAVB 3B7BA 2NYJA 4U96D 2DZOA 4O1OA 5ENSD 4U8VD 3IXEA 2XZTG 5ENRD 2AJAA 5AQ9A 5HKPA 1MJ0A 3T9KA 1SW6A 3TWQA 5AN8A 1A5EA 4LNUD 4YDWA 4Z68A 2DZNA 5CBOA 4OAUC 3V2OA 2F8YA 5EILA 2RFAA 3DEOA 1UOHA 4K5AB 5ENOD 5EN5D 1N0QA 4QQIA 1OY3D 3JUEA 2ETBA 2ZGDA 4F1PA 4HI8A 4B93B 5CBNA 4HLLA 2RFMA 2DVWA 1BLXB 4O1PA 4DX2A 5KWDA 2DWZA 1YYHA 4HRLA 1WG0A 5CERB 2QC9A 2JABA 2MYOA 3TWRA 4DX7D 5BXUA 4DX5D 3UI2A 3V30A 3V79K 1S70B 5FINA 3ZUVB 4TUMA 1OT8A 4DRXE 4BSZB 5AQ7A 3ZNGA 3D9HA 2F37A 2ETAA 2B0OE 1BD8A 2ETCA 1YMPA 4F6RD 3ZU7B 3Q9NC 1IKND 3Q9UC 2XENA 4LSZE 1N11A 1MYOA 5KNGA 3SO8A 3NBNB 4K5CA 2KXPC 2BKGA 4BETA 3UTMA 2ZGGA 2P2CP 4DX1A 2VGEA 4JB8P 4BERA 1WDYA 2A5EA 4CYMD 3TWXA 1MX4A 2QYJA 1TR4A 2BKKB 5ENTD 5HRYA 4G8LA 1D9SA 4GMRA 1K3ZD 3TWTA 2Y0BG 3AAAC 4U8YD 1N0RA 5HS0A 5FIOA 3T8KA 3J5PA 3B95A 1AP7A 3JXIA 3TWVA 3TWUA 1K1AA 1DC2A 4J8YA 3JXJA 2Y1LE 2XEEA 2PNNA 5EYLA 1IHBA 4DX6D 1NFIE 4UUCA 2V4HC 4GPMA 3TWWA 3F6QA 5JMND 5ENQD 4BESA 1BU9A 2HE0A 1MX2A 3W9FA 3LJNA 5ITZF 4HRNA 3ZKJA 4HRMB 4ATZD 1SVXA 1IXVA 4N5QA 3NOCD 1BI8B 5D66A 1DCQA 3HRAA 5CEAA 1K1BA 4U95D 3W9GA 3EHRA 4HI9A 2XZDG 3DEPA 4HB5A 3AJIA 2F8XK 3C5RA 5JA4D 5BXOA 5EIBE 5KNHD 4CZ2D 4ZFHA 4BEPA 4NIKA 1MX6A 4DUIA 3EHQA 3HG0D 4HNAD 4HBDA 2XEHA 4K5BA 5AARA 3TWSA 5CECB 1BI7B 2J8SD 3NOGD 4O60A 3J5QB 2L6BA 3V2XA 5KBAA 5CEDB 4J7WA 5AQAA 1G3NB 5EIDA 4RLYA 2V5QC 3EU9A 3UXGA 4QFVA 4C48B 5AAOA 5AQBA 3V31A 4G8KA 3KEAA 5EYPF 4LG6A 4A63B 2FO1E 1AWCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENP D;  2KBX A;  4HQD A;  4YDY A;  1YCS B;  4ZHB A;  1QYM A;  4OAV B;  3B7B A;  2NYJ A;  4U96 D;  2DZO A;  4O1O A;  5ENS D;  4U8V D;  3IXE A;  2XZT G;  5ENR D;  2AJA A;  5AQ9 A;  5HKP A;  1MJ0 A;  3T9K A;  1SW6 A;  3TWQ A;  5AN8 A;  1A5E A;  4LNU D;  4YDW A;  4Z68 A;  2DZN A;  5CBO A;  4OAU C;  3V2O A;  2F8Y A;  5EIL A;  2RFA A;  3DEO A;  1UOH A;  4K5A B;  5ENO D;  5EN5 D;  1N0Q A;  4QQI A;  1OY3 D;  3JUE A;  2ETB A;  2ZGD A;  4F1P A;  4HI8 A;  4B93 B;  5CBN A;  4HLL A;  2RFM A;  2DVW A;  1BLX B;  4O1P A;  4DX2 A;  5KWD A;  2DWZ A;  1YYH A;  4HRL A;  1WG0 A;  5CER B;  2QC9 A;  2JAB A;  2MYO A;  3TWR A;  4DX7 D;  5BXU A;  4DX5 D;  3UI2 A;  3V30 A;  3V79 K;  1S70 B;  5FIN A;  3ZUV B;  4TUM A;  1OT8 A;  4DRX E;  4BSZ B;  5AQ7 A;  3ZNG A;  3D9H A;  2F37 A;  2ETA A;  2B0O E;  1BD8 A;  2ETC A;  1YMP A;  4F6R D;  3ZU7 B;  3Q9N C;  1IKN D;  3Q9U C;  2XEN A;  4LSZ E;  1N11 A;  1MYO A;  5KNG A;  3SO8 A;  3NBN B;  4K5C A;  2KXP C;  2BKG A;  4BET A;  3UTM A;  2ZGG A;  2P2C P;  4DX1 A;  2VGE A;  4JB8 P;  4BER A;  1WDY A;  2A5E A;  4CYM D;  3TWX A;  1MX4 A;  2QYJ A;  1TR4 A;  2BKK B;  5ENT D;  5HRY A;  4G8L A;  1D9S A;  4GMR A;  1K3Z D;  3TWT A;  2Y0B G;  3AAA C;  4U8Y D;  1N0R A;  5HS0 A;  5FIO A;  3T8K A;  3J5P A;  3B95 A;  1AP7 A;  3JXI A;  3TWV A;  3TWU A;  1K1A A;  1DC2 A;  4J8Y A;  3JXJ A;  2Y1L E;  2XEE A;  2PNN A;  5EYL A;  1IHB A;  4DX6 D;  1NFI E;  4UUC A;  2V4H C;  4GPM A;  3TWW A;  3F6Q A;  5JMN D;  5ENQ D;  4BES A;  1BU9 A;  2HE0 A;  1MX2 A;  3W9F A;  3LJN A;  5ITZ F;  4HRN A;  3ZKJ A;  4HRM B;  4ATZ D;  1SVX A;  1IXV A;  4N5Q A;  3NOC D;  1BI8 B;  5D66 A;  1DCQ A;  3HRA A;  5CEA A;  1K1B A;  4U95 D;  3W9G A;  3EHR A;  4HI9 A;  2XZD G;  3DEP A;  4HB5 A;  3AJI A;  2F8X K;  3C5R A;  5JA4 D;  5BXO A;  5EIB E;  5KNH D;  4CZ2 D;  4ZFH A;  4BEP A;  4NIK A;  1MX6 A;  4DUI A;  3EHQ A;  3HG0 D;  4HNA D;  4HBD A;  2XEH A;  4K5B A;  5AAR A;  3TWS A;  5CEC B;  1BI7 B;  2J8S D;  3NOG D;  4O60 A;  3J5Q B;  2L6B A;  3V2X A;  5KBA A;  5CED B;  4J7W A;  5AQA A;  1G3N B;  5EID A;  4RLY A;  2V5Q C;  3EU9 A;  3UXG A;  4QFV A;  4C48 B;  5AAO A;  5AQB A;  3V31 A;  4G8K A;  3KEA A;  5EYP F;  4LG6 A;  4A63 B;  2FO1 E;  1AWC B; 
#chains in the Genus database with same CATH topology
 4PDX A;  1HFA A;  2XQ0 A;  3I4G A;  3I5P A;  3EHM A;  4I6E A;  4XKC A;  3RO3 A;  5EN5 D;  2GW1 A;  4GZ5 A;  2WMN A;  3MV3 B;  3SHF A;  3RO2 A;  4WWO A;  4Q94 A;  3QAR A;  4GTR A;  1V54 E;  3V79 K;  2A5U A;  5LCW C;  2R03 A;  5E76 A;  3G2T A;  2GRR B;  2B0O E;  4Y6C A;  4MBG A;  2GRN B;  3CVP A;  1JPL A;  3AS5 A;  2WB2 A;  2RD0 A;  2XGS A;  3TWT A;  4U8Y D;  3L13 A;  1N0R A;  2IF4 A;  3ZYL A;  3FU0 A;  2IO2 C;  4FJY A;  3PZD A;  4FAD A;  4M3O A;  2OVB A;  3Q4A B;  3FH7 A;  1DVP A;  1BI8 B;  3T5X A;  5CEA A;  2F8X K;  2P9K G;  2XRY A;  1E96 B;  3CQG B;  3CIA A;  4K5B A;  1NL4 A;  4A3V A;  2RG8 A;  5KBA A;  1D8E A;  3HIZ A;  2OVF A;  2WMO A;  1RZ4 A;  2IU1 A;  4H7Y A;  4EZK A;  1WAO 1;  4AY6 A;  4U0S A;  2WXP A;  3IXE A;  5HKP A;  2J4D A;  3BU8 A;  4YDW A;  1TN6 A;  1N4Q A;  2L6J A;  3ZYQ A;  4EHM A;  3RIB A;  4FC8 A;  3UM1 A;  3D9I A;  3QWW A;  1XNF A;  3ASH A;  3CVU A;  3ZNG A;  3QJZ A;  2ETA A;  3K9I A;  3D9M A;  3NZU A;  4V3I A;  4F1S A;  2BKG A;  3ESL A;  1PY1 A;  5ARG A;  1PC2 A;  4CYM D;  3L9T A;  5J90 A;  2BKK B;  1HG5 A;  3SF4 A;  2DBA A;  2IJG X;  2AXU A;  5JJ7 A;  3FEX A;  3FUJ A;  3JXI A;  1IYG A;  3CHM A;  5G04 C;  5JMN D;  4GTS A;  1MX2 A;  3UX4 A;  4ATZ D;  5LX8 A;  3NOC D;  4U95 D;  4HI9 A;  2OEV A;  1MX6 A;  3Q78 A;  4DUI A;  3UMV A;  4N3A A;  3R9M A;  3MZL B;  3L82 A;  4JEH A;  5EDS A;  5BT1 A;  5FQ4 A;  3QNK A;  1JCR A;  5BNW A;  2NYJ A;  4U96 D;  4MLP A;  4XI9 A;  1H6P A;  3Q7A A;  4B89 A;  5AN8 A;  3JYS A;  4J0U A;  3FUL A;  5CBO A;  5BUZ A;  2RFA A;  4JD2 G;  2KZT B;  2CFU A;  3AS4 A;  4A1G A;  2VGX B;  1E90 A;  4HVB A;  3TXN A;  4J8D A;  4CRW A;  5CBN A;  2BTD A;  1YYH A;  2QC9 A;  2WQ7 A;  3TL5 A;  1PAQ A;  2L0T B;  1KPS B;  2X6I A;  5LCW J;  3Q75 A;  4WWP A;  3SQV A;  1JUQ A;  1V55 E;  3FUD A;  2VTB B;  2H6G A;  2CG2 A;  3ONK A;  3MKQ A;  2IEJ A;  4DX1 A;  3G2S A;  3S7D A;  1HZ4 A;  4ACL A;  4CGW A;  1E8Y A;  4G8L A;  2XGO A;  1OWM A;  4L1B A;  4WAF A;  3ASF A;  3T8K A;  2HM8 A;  3G2W A;  1QQE A;  3TJP A;  2GGF A;  2XEE A;  1EPU A;  4YVO A;  2OEW A;  4IRU A;  1U3D A;  2R2L A;  3UKR G;  4GU5 A;  4HRM B;  4A55 A;  3AS8 A;  1ZU2 A;  1TN8 A;  3ISM C;  3W9G A;  3KAE A;  4HB5 A;  2PM6 A;  2IFU A;  2XS8 A;  3UIO C;  3L54 A;  2LAH A;  3DSS A;  2H6I A;  4EQF A;  2ZU6 B;  3HXC A;  3SFZ A;  3V2X A;  3ZW3 A;  4JHK A;  4P29 A;  5CMW A;  2VSY A;  3AG4 E;  3PVL A;  2YNQ A;  4AP2 A;  3TWQ A;  2OV8 A;  1SW6 A;  4U0U A;  3LEW A;  2WXQ A;  4ANW A;  3X2Q E;  2PQR A;  1UOH A;  2Q7F A;  4K5A B;  5ENO D;  5KJN A;  2DYS E;  3JUE A;  2ETB A;  4JHJ A;  3U64 A;  2DVW A;  2QY7 A;  2R17 C;  5BV0 A;  1OCC E;  2PL2 A;  3LYA A;  4PH4 B;  3ZFW A;  4BSZ B;  3SNX A;  3UM2 A;  3R7Q A;  3QWP A;  3P1U A;  3EUV A;  4RQI A;  4PS3 A;  2LSV A;  2FI7 A;  3CHS A;  5EKQ D;  3Q9N C;  4FHK A;  4UI9 J;  1UJJ A;  5ANL A;  3AU4 A;  4GYY A;  4GMR A;  4KYO B;  2Y0B G;  3ML9 A;  2J49 A;  2FUL A;  1HH8 A;  1AP7 A;  4Y6W A;  4I43 A;  4UQZ A;  5A7D B;  3TWU A;  5EYL A;  3ZHE B;  5CHE E;  5AJL A;  5ENQ D;  1BU9 A;  1OWP A;  4J8E A;  2UWJ G;  5EX0 A;  1IXV A;  5D66 A;  3MX3 A;  3EHN A;  1QZ2 A;  4OVU A;  4XZ4 A;  2GRL A;  3J5Q B;  2P9U G;  2AXV A;  3LY9 A;  2EIN E;  2FO1 E;  2KBX A;  4HQD A;  3ZVV A;  3UM0 A;  3DSU A;  4LRZ A;  3V2O A;  4MRU A;  4OVV A;  3ASG A;  4G24 A;  2RFM A;  4RG9 A;  1OCO E;  4O1P A;  4ILG A;  2IOS A;  3FUH A;  4GAA A;  1S70 B;  2LNI A;  3E32 A;  2WXF A;  2CHZ A;  3E37 A;  5DIZ A;  3OXL A;  1H19 A;  4F6R D;  4WNF A;  3PS6 A;  3MKQ B;  1OWO A;  5T4Y A;  4PUC A;  2ZGG A;  4JA7 A;  2NXP A;  3UM3 A;  1U2V G;  3CK7 A;  3B7U X;  1S0P A;  4L7T A;  1MX4 A;  4KBQ A;  3FTS A;  4C0E A;  2V5F A;  3ZYK A;  1S63 A;  5HS0 A;  3J5P A;  1TNZ A;  4DLO A;  4U8H A;  4F53 A;  1DC2 A;  3FTY A;  4YVQ C;  2PNN A;  1NFI E;  4UUC A;  4EZL A;  4UWF A;  2RKK A;  3CEQ A;  4PS7 A;  5CMY A;  2VQ2 A;  1U3C A;  3DXK G;  1BPO A;  4XI0 A;  4C0M A;  5EIB E;  5AAR A;  3FUN A;  1O1S A;  2P58 C;  1OCZ E;  3B13 A;  5AQB A;  4F3V A;  1IQR A;  3ASO E;  3CVV A;  4FU3 A;  2XCC A;  2X3M A;  3CK9 A;  3IBE A;  4JVS A;  3ULE G;  5FWQ A;  1KLX A;  4GZC A;  3AG1 E;  3MGB A;  1SZA A;  4DX2 A;  4U0Z A;  3IHV A;  4HRL A;  5BV1 A;  4N2Q A;  3SZ7 A;  3HVE B;  4KMO A;  4DX5 D;  3T5V A;  1TJC A;  1OXJ A;  3C3R A;  3RAU A;  4UWG A;  4U7E B;  1YMP A;  5ENN A;  3ASD A;  2L0I A;  1MYO A;  1Z5S C;  4TRQ A;  2Y3A A;  1D8D A;  4M7C A;  1NP7 A;  4FLH A;  3BUA A;  2FBN A;  3QC1 A;  4GMJ A;  3ZN3 A;  2I9C A;  4DK5 A;  3NF1 A;  2VYI A;  3CQC B;  4UQY A;  1KZO A;  2P9N G;  4DI3 A;  5B1A E;  3FFL A;  3RKV A;  3Q73 A;  4ACK A;  3APD A;  2BF0 X;  4OYS A;  4DLQ A;  2H6F A;  3Q79 A;  3RRM B;  3EHQ A;  5CCM A;  1O5M A;  4HBD A;  2WPV A;  5CCL A;  2V4L A;  5CED B;  5AQA A;  3TG4 A;  2YIN A;  4Q69 A;  4CDR A;  1UN9 A;  3CHR A;  2VTB A;  2X6H A;  1X81 A;  2DIW A;  3C72 A;  4BTA A;  2WXJ A;  4I1A A;  3HXD A;  4KZC A;  3QDN A;  5G55 A;  3JQ0 A;  3L17 A;  2CHX A;  5CER B;  3AG2 E;  1LTX A;  3UI2 A;  4YDO A;  3ZUV B;  1OT8 A;  3R7R A;  3FY4 A;  3D9H A;  1INZ A;  2Y4T A;  5D0O D;  3QOU A;  4NRH B;  2KCL A;  2V8S E;  3FUK A;  3UT7 A;  3C3Q A;  2VGE A;  4WNG A;  2MHK A;  2WXR A;  2L9B A;  2IQC A;  4HFG A;  4FHJ A;  4XX5 A;  4I6G A;  3ABL E;  3ABM E;  1HX8 A;  3LVR E;  1KZP A;  4FA6 A;  3HRA A;  2CG3 A;  4N39 A;  4K03 A;  3DEP A;  3Q7F A;  3L6A A;  5HQ8 A;  5JA4 D;  3QB2 A;  4KVM A;  3FTU A;  4I9C A;  4RG6 A;  3FTX A;  3TWS A;  1FT2 A;  4UWL A;  4JW1 A;  1MQS A;  4J7W A;  1S64 A;  3UXG A;  2I2O A;  3HXB A;  4BFR A;  4N5C A;  3L08 A;  4CT0 A;  1HG2 A;  4YDY A;  4OAV B;  3DPY A;  1TNU A;  4UQX A;  4EEC A;  4U8V D;  2XZT G;  5AQ9 A;  5ENR D;  1NI1 A;  1TN7 A;  3T9K A;  2F8Y A;  3TXM A;  2FEZ A;  1E8X A;  3PH0 C;  1RW2 A;  4B93 B;  2C0L A;  5KWD A;  4BT9 A;  2VSO E;  4A1S A;  3CVY A;  4LNG A;  4HS2 A;  4KXK B;  1N94 A;  3NB2 A;  3OTN A;  1N52 A;  4G25 A;  5JJT A;  4N3C A;  5EX3 A;  3UT8 A;  3PEU B;  2LUH A;  3UTM A;  4GCN A;  4AOF A;  2QYJ A;  1K3Z D;  4B0Z A;  3G2U A;  2KC7 A;  1SZ9 A;  4AXH A;  2R59 A;  2OCC E;  3FUI A;  2GRM A;  2HE0 A;  2IY0 C;  3SBT B;  3VLF A;  3OAW A;  3JUI A;  2WXI A;  5KJM A;  3AJI A;  4IUL A;  2YHC A;  4LCT A;  5FZS A;  3E30 A;  2XS1 A;  2AW6 A;  2X38 A;  5FQ6 A;  1Q2Z A;  4XIF A;  4G26 A;  3BG0 B;  3N71 A;  2P9S G;  1ELR A;  5AAO A;  4G8K A;  2CFZ A;  2JLB A;  3I4R B;  1JCQ A;  3S7J A;  3ESK A;  3HVE A;  2XHE A;  4UI9 C;  4LNU D;  2WVI A;  5EIL A;  5DBK A;  4B8C B;  2VGY A;  3LDZ A;  3PDN A;  5KCM A;  3L22 A;  1UJK A;  1N4S A;  2EQX A;  2YQ8 A;  2DWZ A;  3FTV A;  1WG0 A;  2ION A;  3PE4 A;  3MV2 B;  2R05 A;  3QKY A;  2WM9 A;  3D9O A;  1K8K G;  4L23 A;  1H6O A;  4EZJ A;  1EF1 C;  4N3B A;  3LPZ A;  2ETC A;  1QBQ A;  2LSU A;  2P9I G;  3CK8 A;  3AG3 E;  2XEN A;  4G1T A;  2KXP C;  3FTW A;  4BET A;  2A4Z A;  3CVW A;  4W9R A;  4UWH A;  3SGH A;  3D9J A;  3EIQ C;  3CV0 A;  1E7V A;  5FIO A;  4JHR A;  4R7L A;  4HOU A;  3KSL A;  1QNF A;  3PRE A;  4BES A;  1A17 A;  2KCV A;  1OCR E;  3W9F A;  5A23 A;  3E33 A;  3LJN A;  3CHO A;  2FF4 A;  4I2Z A;  5AJD A;  3VTX A;  2X6K A;  1FCH A;  3U66 A;  5JJ6 A;  3DXM G;  1ELK A;  1LD7 A;  2XEH A;  1BI7 B;  2GRO B;  3WG7 E;  3R9A B;  1YA0 A;  1NA0 A;  3CGH A;  3PNT B;  4A63 B;  3UPV A;  1O1T A;  1YCS B;  3KSQ A;  2X6J A;  3B7B A;  1O1R A;  3QAQ A;  4LUN U;  4JPS A;  1KT1 A;  2OOE A;  2DZN A;  3Q49 B;  2Y4U A;  1SA5 A;  1FVH A;  5ANR A;  3DEO A;  2EIM E;  3ONL A;  4HI8 A;  4U63 A;  5G05 C;  4BT8 A;  4FJZ A;  2WXL A;  3FH5 A;  4RSY A;  4NAC A;  4DRX E;  3VLE A;  3RJV A;  3ULY A;  3ZIM A;  4BSX A;  3PZ3 A;  3UUX A;  3ZU7 B;  2PM7 A;  3QK0 A;  3UIN C;  2R02 A;  3E34 A;  2Y69 E;  3SO8 A;  1N95 A;  2AXZ A;  4APO A;  2V0P A;  3PZ4 A;  3TWX A;  2LAI A;  4TXQ A;  3URZ A;  3FUE A;  3D9L A;  3GYZ A;  4AV7 A;  5HI7 A;  2WXO A;  1HXI A;  2CHW A;  2WQH A;  1DCE A;  1WM5 A;  2M63 A;  3ZHE A;  2KZT A;  4GYW A;  3O4Z A;  2WXK A;  3P2B A;  3VLD A;  5AEN A;  1Y6I A;  3C5R A;  2PZI A;  4G11 A;  4GTM A;  4MS6 A;  3U3W A;  3HG0 D;  2EIK E;  2J9Q A;  3FUM A;  5EID A;  2NC9 A;  2C0M A;  4C48 B;  4QFV A;  3KEA A;  5LP0 A;  2KAT A;  2WXN A;  3DPD A;  2HO1 A;  1QYM A;  2P9L G;  2FO7 A;  3G2V A;  4AVX A;  3EJN A;  4NUR A;  3PEV B;  1MHQ A;  3CKB A;  2HR2 A;  3APF A;  1BLX B;  1ZB1 A;  2MYO A;  4J8S A;  4DX7 D;  4TUM A;  3FDH A;  3MKR A;  5G05 J;  3MJW A;  3D9P A;  4I1M A;  1N54 A;  3UKU G;  1TNY A;  5LFA A;  3FTZ A;  4EBA G;  1SA4 A;  5ENT D;  1TR4 A;  1H0A A;  2KCK A;  5LOZ A;  3AAA C;  5KJK A;  2XPZ A;  3FEY A;  3FWV A;  4CT4 A;  5KJL A;  1HU3 A;  3ZRH A;  3JQ1 A;  1TJF A;  1IHB A;  3CR3 A;  3LKU A;  2ZIR A;  3PZ1 A;  2JEK A;  3LS8 A;  4HRN A;  4RVB A;  3VTY A;  3HDX A;  3FU5 A;  2EIL E;  3GZS A;  4I6J A;  3KEZ A;  2QYU A;  3RU0 A;  3HXF A;  4WWN A;  3CSF A;  5ENP D;  3UIP C;  4ILH B;  4XKB A;  3RSE G;  1B89 A;  2YHE A;  1NZN A;  3OXG A;  3JCK C;  3ABK E;  2H6H A;  1OY3 D;  2I1J A;  3SFY A;  4CGV A;  2X6F A;  2E2E A;  4ABN A;  4MKT A;  4L9P A;  3B7T A;  4J8F A;  2QFC A;  3V30 A;  4XEI G;  4TV3 A;  3U9W A;  4BTB A;  4E85 A;  5T8I A;  2J09 A;  3GZ2 A;  1EYH A;  4GB9 A;  3WXX A;  3MA5 A;  4CDM A;  4HOR A;  5JHB A;  3IKO B;  1FPP A;  2P2C P;  4JB8 P;  1JCS A;  3OXF A;  1WDY A;  3ZXP A;  3EU5 A;  2WQ6 A;  1N4P A;  1NA3 A;  2IO3 C;  5G2N A;  3ML8 A;  1WY6 A;  3TWV A;  4I17 A;  3LJ3 A;  1SQM A;  3JXJ A;  3TWW A;  2KM4 A;  4KT6 B;  3LY7 A;  1N9A A;  3IV0 A;  1IQU A;  4AEZ C;  2XCB A;  4B8A A;  3EHR A;  3C3O A;  4GTT A;  5A6C A;  2F0Y A;  4ANU A;  4ZFH A;  4CZ2 D;  3DBS A;  1XGW A;  5FZQ A;  2J8S D;  2VJ8 A;  2XGM A;  3DSX A;  1GW6 A;  4HOT A;  2V5Q C;  1ZBP A;  3V31 A;  3DSV A;  3FHE A;  4ZHB A;  5FQ7 A;  3CVQ A;  4O1O A;  5ENS D;  2DYR E;  3CHP A;  4GA0 A;  2GRP B;  5B3S E;  2BED A;  1TEZ A;  3B7S A;  3ENE A;  2VGX A;  3PE3 A;  1N0Q A;  4XE0 A;  3BQO A;  4CEM A;  3DSW A;  3MYV A;  2MOW A;  1OWN A;  3TWR A;  4BX9 A;  2WXH A;  3MEK A;  2F37 A;  5JHA A;  1BD8 A;  4BWR A;  3ASN E;  3S2A A;  2XRZ A;  4CDN A;  4URK A;  2VSX E;  3AU5 A;  1HS6 A;  3Q9U C;  4LNB A;  4LSZ E;  4K5C A;  3HYM B;  1ELW A;  3DWL G;  4GPK A;  3E4B A;  1UN8 A;  4ANX A;  3CVN A;  3UT4 A;  3O48 A;  3HHM A;  3U4T A;  2V4H C;  3CLJ A;  3RK6 A;  3S7B A;  4ME2 A;  3QWV A;  4E6H A;  2XPY A;  1H2U A;  4EBA A;  3PRZ A;  2DCP A;  2LO6 A;  3B7R L;  3FU3 A;  2XZD G;  5M72 A;  4LER A;  3RRU A;  3TG5 A;  4PS8 A;  4NIK A;  1Z3Y A;  4I2W A;  5CEC B;  4C9B B;  3NOG D;  3LY8 A;  3IEG A;  1E7U A;  3SI5 A;  4F7A A;  1G3N B;  4RLY A;  5FJY A;  2IOL A;  1HF8 A;  3S7F A;  4LG6 A;  5BW8 C;  2I6H A;  5C2Y A;  3FH8 A;  3SFX A;  2AVP A;  3SY2 A;  3TGO A;  2MRI A;  5ARF A;  1HO8 A;  4GML A;  1MJ0 A;  3FU6 A;  4ILI A;  5E75 A;  4JL0 A;  4Z68 A;  4OAU C;  4DI4 A;  4IN3 B;  3BEE A;  3APC A;  2ZGD A;  1W3B A;  3TAX A;  3HXE A;  3FP3 A;  4K0R A;  1LF8 A;  4APF A;  3D3M A;  4KVO A;  2E0I A;  2JAB A;  3LXU X;  4A3T A;  2OND A;  4D10 C;  1OWL A;  2UY1 B;  4G23 A;  2XEV A;  3NBN B;  2LXL A;  1VDY A;  4NQ0 A;  5HRY A;  4GTO A;  2GRQ B;  4GTV A;  3KD7 A;  4B94 A;  4U04 A;  4J8Y A;  4LEU A;  1OUV A;  5BPP A;  1Z6T A;  4H7X A;  5ITZ F;  4N5Q A;  3NAW A;  4JA9 A;  4WND A;  1X5B A;  3SBS A;  2B6C A;  3CVL A;  2XPI A;  4HNA D;  5D2M C;  3GW4 A;  4YND A;  1IHG A;  3RRN B;  4GA1 A;  2ILR A;  2C2L A;  3L16 A;  4HOQ A;  3PUK A;  1P5Q A;  2PQN A;  4HOS A;  3DST A;  4TXR A;  1A5E A;  1H2V C;  4QQI A;  3D9K A;  5FQ8 A;  4Q96 A;  2EIJ E;  1H2T C;  3Q47 B;  2R5S A;  1JWG A;  5BXU A;  3C98 A;  5FIN A;  4TUU A;  5AQ7 A;  4GTQ A;  2VSN A;  1KT0 A;  5IY5 E;  1E8W A;  2BUG A;  2UY1 A;  4JEU A;  1N11 A;  3CKC A;  5D0Q D;  3CST A;  3IHY A;  2J4B A;  5FZR A;  4BER A;  4UI9 K;  2A5E A;  1LD8 A;  4L2L A;  5J08 A;  1D9S A;  3FUF A;  2HYZ A;  4BY6 A;  1FT1 A;  4FP7 A;  3B95 A;  5B1B E;  1K1A A;  2Y1L E;  1UW4 B;  2J07 A;  4N2S A;  3GZ1 A;  3F6Q A;  3Q5M A;  1JWF A;  4GZ6 A;  5CRV A;  1SVX A;  4ATG A;  1Y8M A;  1DCQ A;  4GA2 A;  4GYO A;  4AY5 A;  3EDT B;  5FTP A;  5KNH D;  3ULQ A;  3CHQ A;  1TNB A;  4CCA A;  2P9P G;  3UQ3 A;  4HLE A;  4O60 A;  1N4R A;  3PUJ A;  1E8Z A;  2NSZ A;  3T8M A;  3ZPJ A;  4AIF A;  3I3N A;  1L5J A;  5AIJ A;  4AJW A;  3PNL B;  4I9E A;  4JXT A;  1Z3X A;  2DZO A;  4UWK A;  4U07 A;  2AJA A;  2AWI A;  1DNP A;  3EIJ A;  3Q15 A;  4AM9 A;  4YDE A;  2WXG A;  5T3R A;  4JC8 A;  3PZ2 A;  3DRA A;  4GTP A;  4BX8 A;  3KS2 A;  5CRU A;  4F1P A;  4FUL A;  4HLL A;  1TNO A;  3LVQ E;  4KZ0 A;  4ANV A;  4GZ3 A;  3ZEF A;  1FVF A;  1H6K A;  4JZY A;  5G04 J;  3NZS A;  4L2Y A;  3ZYM A;  2ZXW E;  4X8Q A;  1IKN D;  3ZXS A;  5KNG A;  5AYW D;  3ZGQ A;  4GCO A;  3MCX A;  4DJA A;  2WXM A;  4I1O B;  2ZIS A;  4WUY A;  4HXI A;  2J08 A;  3LCA A;  2I1K A;  1TYQ G;  3NQP A;  4DX6 D;  5C1D A;  4GPM A;  1HE8 A;  1MZC A;  3D9N A;  1UG3 A;  3ZKJ A;  4O6F A;  4DPR A;  3BG1 B;  1K1B A;  4TXP A;  5FT9 A;  2LXM A;  4GZD A;  5BXO A;  4BEP A;  4WNE A;  2QZA A;  3CVX A;  3SD5 A;  2L6B A;  1EDU A;  4FLB A;  4G2V A;  4EPZ A;  3EU9 A;  4IYP A;  5EYP F;  4J6I A;  5H7P A;  1AWC B; 
#chains in the Genus database with same CATH homology
 5ENP D;  2KBX A;  4HQD A;  4YDY A;  1YCS B;  4ZHB A;  1QYM A;  4OAV B;  3B7B A;  2NYJ A;  4U96 D;  2DZO A;  4O1O A;  5ENS D;  4U8V D;  3IXE A;  2XZT G;  5ENR D;  2AJA A;  5AQ9 A;  5HKP A;  1MJ0 A;  3T9K A;  1SW6 A;  3TWQ A;  5AN8 A;  1A5E A;  4LNU D;  4YDW A;  4Z68 A;  2DZN A;  5CBO A;  4OAU C;  3V2O A;  2F8Y A;  5EIL A;  2RFA A;  3DEO A;  1UOH A;  4K5A B;  5ENO D;  5EN5 D;  1N0Q A;  4QQI A;  1OY3 D;  3JUE A;  2ETB A;  2ZGD A;  4F1P A;  4HI8 A;  4B93 B;  5CBN A;  4HLL A;  2RFM A;  2DVW A;  1BLX B;  4O1P A;  4DX2 A;  5KWD A;  2DWZ A;  1YYH A;  4HRL A;  1WG0 A;  5CER B;  2QC9 A;  2JAB A;  2MYO A;  3TWR A;  4DX7 D;  5BXU A;  4DX5 D;  3UI2 A;  3V30 A;  3V79 K;  1S70 B;  5FIN A;  3ZUV B;  4TUM A;  1OT8 A;  4DRX E;  4BSZ B;  5AQ7 A;  3ZNG A;  3D9H A;  2F37 A;  2ETA A;  2B0O E;  1BD8 A;  2ETC A;  1YMP A;  4F6R D;  3ZU7 B;  3Q9N C;  1IKN D;  3Q9U C;  2XEN A;  4LSZ E;  1N11 A;  1MYO A;  5KNG A;  3SO8 A;  3NBN B;  4K5C A;  2KXP C;  2BKG A;  4BET A;  3UTM A;  2ZGG A;  2P2C P;  4DX1 A;  2VGE A;  4JB8 P;  4BER A;  1WDY A;  2A5E A;  4CYM D;  3TWX A;  1MX4 A;  2QYJ A;  1TR4 A;  2BKK B;  5ENT D;  5HRY A;  4G8L A;  1D9S A;  4GMR A;  1K3Z D;  3TWT A;  2Y0B G;  3AAA C;  4U8Y D;  1N0R A;  5HS0 A;  5FIO A;  3T8K A;  3J5P A;  3B95 A;  1AP7 A;  3JXI A;  3TWV A;  3TWU A;  1K1A A;  1DC2 A;  4J8Y A;  3JXJ A;  2Y1L E;  2XEE A;  2PNN A;  5EYL A;  1IHB A;  4DX6 D;  1NFI E;  4UUC A;  2V4H C;  4GPM A;  3TWW A;  3F6Q A;  5JMN D;  5ENQ D;  4BES A;  1BU9 A;  2HE0 A;  1MX2 A;  3W9F A;  3LJN A;  5ITZ F;  4HRN A;  3ZKJ A;  4HRM B;  4ATZ D;  1SVX A;  1IXV A;  4N5Q A;  3NOC D;  1BI8 B;  5D66 A;  1DCQ A;  3HRA A;  5CEA A;  1K1B A;  4U95 D;  3W9G A;  3EHR A;  4HI9 A;  2XZD G;  3DEP A;  4HB5 A;  3AJI A;  2F8X K;  3C5R A;  5JA4 D;  5BXO A;  5EIB E;  5KNH D;  4CZ2 D;  4ZFH A;  4BEP A;  4NIK A;  1MX6 A;  4DUI A;  3EHQ A;  3HG0 D;  4HNA D;  4HBD A;  2XEH A;  4K5B A;  5AAR A;  3TWS A;  5CEC B;  1BI7 B;  2J8S D;  3NOG D;  4O60 A;  3J5Q B;  2L6B A;  3V2X A;  5KBA A;  5CED B;  4J7W A;  5AQA A;  1G3N B;  5EID A;  4RLY A;  2V5Q C;  3EU9 A;  3UXG A;  4QFV A;  4C48 B;  5AAO A;  5AQB A;  3V31 A;  4G8K A;  3KEA A;  5EYP F;  4LG6 A;  4A63 B;  2FO1 E;  1AWC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...