3TWSA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human terf1 (chimeric peptide)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twsA00
2DVWA 3JUEA 1DCQA 3JXIA 2FO1E 1IHBA 3W9FA 5EIBE 2F8XK 3EU9A 1WDYA 4HNAD 3TWVA 1N0RA 2PNNA 5JA4D 2QYJA 1BI7B 1YCSB 3TWTA 1TR4A 5CECB 1N11A 3EHRA 4BESA 4G8KA 1DC2A 4DX7D 2KXPC 4YDYA 1IKND 2P2CP 2ZGDA 4GMRA 2J8SD 4BEPA 2QC9A 2BKKB 4K5CA 2ETCA 2F8YA 1YMPA 2NYJA 4J7WA 2RFAA 2JABA 1K3ZD 5EYLA 4U95D 1WG0A 4DUIA 4F1PA 4RLYA 2DZOA 3SO8A 4J8YA 4Z68A 5CBNA 1OT8A 2RFMA 1A5EA 3F6QA 4O1PA 5EN5D 4UUCA 4U8VD 4HRLA 2L6BA 4HRMB 5ENRD 3HRAA 4ZFHA 3V2XA 1K1AA 4O60A 1D9SA 2XENA 3IXEA 1K1BA 1IXVA 3UXGA 5BXUA 5KNGA 2XZTG 4YDWA 2Y1LE 4GPMA 5ENSD 3UI2A 1MJ0A 3NOGD 2XZDG 5EIDA 4CYMD 4F6RD 4K5BA 5ENPD 1BI8B 1G3NB 3V2OA 3NBNB 1SVXA 3ZU7B 4O1OA 4ATZD 4NIKA 5BXOA 4DX1A 4QFVA 5AQ9A 1MX2A 3B7BA 5AQ7A 5FIOA 3NOCD 3V31A 1BD8A 3B95A 3Q9NC 5HS0A 5AARA 4BERA 4BSZB 3EHQA 4DX5D 5CBOA 5ITZF 4HRNA 5CEDB 3JXJA 4U96D 4C48B 2V4HC 1BLXB 5EYPF 3HG0D 3TWQA 5CEAA 2B0OE 2ETAA 5D66A 4K5AB 4DX6D 2KBXA 1MX6A 4CZ2D 2AJAA 4BETA 2VGEA 3AJIA 3DEPA 4QQIA 5HKPA 1QYMA 2XEEA 3V79K 1SW6A 2BKGA 4A63B 3V30A 3AAAC 3D9HA 3J5PA 4TUMA 3TWSA 3ZUVB 1BU9A 3TWXA 1N0QA 2ZGGA 5HRYA 1NFIE 2DWZA 5ENOD 3T9KA 4N5QA 3C5RA 5AQBA 5KNHD 2Y0BG 4LSZE 4HQDA 1YYHA 4U8YD 4OAUC 4JB8P 3ZNGA 2ETBA 2MYOA 3J5QB 3W9GA 4LNUD 3TWRA 2F37A 3TWUA 3DEOA 5JMND 1S70B 3Q9UC 1OY3D 4HI8A 5AQAA 4OAVB 3KEAA 4HB5A 5CERB 2HE0A 2DZNA 4G8LA 2V5QC 4HLLA 5AN8A 2A5EA 1MYOA 2XEHA 4DRXE 4B93B 3LJNA 1UOHA 5FINA 1MX4A 5ENTD 3ZKJA 4ZHBA 4HBDA 4LG6A 5KWDA 4DX2A 3TWWA 1AWCB 4HI9A 5EILA 3UTMA 5KBAA 5ENQD 3T8KA 5AAOA 1AP7A
chains in the Genus database with same CATH superfamily
3FU6A 1UG3A 1MHQA 3ABKE 5EIBE 4GA2A 3JUIA 1E8XA 4LUNU 4N3BA 4GTQA 3E33A 2ZGDA 2LAHA 4A55A 2HR2A 4ATGA 2F8YA 2NYJA 3ML8A 4HFGA 4HOSA 2I9CA 4XX5A 4O1PA 3SD5A 5KJNA 3SF4A 3FUEA 1K1AA 3MYVA 3UQ3A 4G24A 3U9WA 5EIDA 1H6KA 4P29A 3UT8A 2FBNA 3HXFA 4NIKA 2P9SG 4KZ0A 2V8SE 3HXEA 2UWJG 3BG1B 1SA5A 3TWQA 1XGWA 4DPRA 3E30A 4EPZA 4NQ0A 3QJZA 2BKGA 3DSXA 3GZSA 5CCLA 2DYSE 3ONKA 2CG3A 3Q47B 3UT7A 3KEZA 5JMND 3KEAA 4CRWA 4G26A 5DBKA 5FINA 2KCVA 3FUFA 3UTMA 5EILA 4B94A 2IEJA 3ESLA 4J6IA 2KATA 4AEZC 4BX9A 2LSUA 3FWVA 3HDXA 3EHMA 5EX3A 4L2LA 4AJWA 4BESA 4F1SA 3BEEA 3RRNB 4DX7D 1V54E 4G2VA 1E7VA 3MX3A 3FH7A 3QC1A 3APFA 4UWLA 5EYLA 4KVMA 5FZQA 1A5EA 3P2BA 3D9IA 4MBGA 3FUMA 3L13A 1TNBA 3MKQB 3UM3A 2P9KG 4A1GA 1RZ4A 1BI8B 3NBNB 4U63A 5G55A 2J9QA 4HRNA 3I3NA 4G23A 5HQ8A 4U0ZA 3UKRG 4G11A 1BLXB 2CHZA 3X2QE 4MKTA 4BETA 2AXVA 1ELRA 1HZ4A 1QYMA 2EIME 3SZ7A 4GTPA 5ENNA 4IYPA 2Y3AA 4OAUC 2ZXWE 4PDXA 2I6HA 3MCXA 3NAWA 3W9GA 4XIFA 5FT9A 3ZXPA 1OY3D 5CERB 1TN8A 4BWRA 2VGYA 4LERA 5LOZA 3I5PA 2JLBA 3CVQA 3DSSA 2IOLA 2XPZA 2CHXA 4ZHBA 1QNFA 2GRQB 2DYRE 5G2NA 2LAIA 4IULA 2EQXA 3PEVB 3PZ2A 4APOA 4X8QA 2GRNB 2RD0A 1BI7B 4WNEA 4RG9A 3U4TA 1DC2A 1INZA 4A1SA 4GMLA 3R9AB 4WUYA 4BT9A 2HM8A 3L22A 4DUIA 4BFRA 4F1PA 3IEGA 4J8YA 3RKVA 2XS1A 3Q7FA 1XNFA 3FHEA 2I1KA 3ZXSA 3CSFA 1OWNA 4UWFA 2XPYA 2V0PA 3ZGQA 3PE4A 1H2TC 3ZW3A 3QKYA 3N71A 2X6KA 2WVIA 5A23A 1SVXA 2BUGA 4GTVA 3Q75A 2MHKA 4IN3B 2GRMA 2R2LA 4GU5A 4BSZB 1W3BA 5CBOA 2VSOE 3LY7A 4C48B 5EYPF 2ETAA 1UN8A 1QBQA 2AJAA 2WXMA 4EBAG 3ULQA 1TNZA 4A63B 3V30A 4ANXA 5KNHD 4L2YA 2ETBA 4U04A 2F37A 4CGVA 4TXQA 2E0IA 3Q9UC 4UQXA 3PE3A 4WWPA 3AS5A 2V4LA 1TNOA 1D8EA 3G2SA 2YINA 2WQHA 5AAOA 1AP7A 1DCQA 4L9PA 4MRUA 3Q5MA 2XQ0A 2VJ8A 3TWVA 4WWNA 5JA4D 3CHQA 4LCTA 3CHMA 4ILHB 2IO3C 3QWPA 4GYWA 4YDYA 2UY1B 2GGFA 2L6JA 3B7SA 5KJKA 4U95D 3PVLA 5BV1A 5T3RA 3T8MA 4AV7A 1BPOA 4HOTA 4HRLA 4I6GA 2IONA 1Y8MA 4RQIA 2Y1LE 4LEUA 2Y69E 4EECA 5EDSA 1LD8A 4JC8A 3ZHEB 4UQZA 5CMWA 3TAXA 2J4DA 4EHMA 3KSQA 4U96D 4NRHB 1Z3XA 3ABLE 3Q79A 4KBQA 2VTBA 4WNDA 3JYSA 2R59A 3DEPA 3E32A 3MKRA 4U0SA 1NFIE 1Z5SC 5AQBA 2XHEA 2FF4A 4UI9C 4Q96A 4FLBA 4HB5A 5CCMA 3L54A 3MA5A 5B1AE 3VTXA 2XRZA 4FP7A 5LCWC 2WM9A 3KSLA 4B8CB 3C3RA 4BSXA 2XS8A 3ZKJA 3G2TA 4XKBA 1SA4A 2V5FA 2EINE 1DCEA 3DXKG 2GROB 3FTUA 3JXIA 4R7LA 3JQ1A 3PEUB 2NSZA 4A3TA 4D10C 1K3ZD 5G04J 3Q73A 4HS2A 3HRAA 3D9PA 2X6HA 4YDWA 4GPMA 1IQUA 3HXBA 3ZFWA 5CHEE 4U7EB 3L16A 4M7CA 2PQRA 2IQCA 5AQ9A 1NA3A 1S0PA 3CK7A 4UI9K 3AG2E 5JJ6A 5ITZF 2XGSA 3CLJA 4KZCA 5A7DB 5ANRA 1BU9A 1WM5A 4YNDA 2ZGGA 4Q94A 2BEDA 3SI5A 4LSZE 3J5QB 3ASNE 2WXLA 3HVEA 2JEKA 4ME2A 3RK6A 4I9EA 4FHKA 4JHKA 1JCRA 3QARA 1OWOA 3FUJA 5KWDA 4I17A 1IHBA 5C1DA 3IHYA 3VLFA 3RSEG 4M3OA 4N2SA 3EU5A 3CQCB 4CT0A 4J7WA 1N95A 2WXJA 3CVUA 3CHSA 4GPKA 2HO1A 3O48A 4JVSA 3CEQA 4I1MA 1K1BA 1KZPA 2X6IA 3FY4A 3FTXA 5ENSD 2WB2A 2XZDG 4JXTA 2AWIA 4CYMD 4FADA 3B7RL 2WXQA 3EDTB 3R9MA 2WQ6A 3DSVA 5KJMA 3Q9NC 3APDA 3WXXA 3GW4A 3HG0D 4KYOB 1HG5A 3ULYA 4JHJA 4L23A 2AXUA 3AU5A 4JEHA 3AJIA 4QQIA 3V79K 3LYAA 2AVPA 4W9RA 3ONLA 1OCZE 3FU3A 2EIKE 5G05C 2FULA 3SHFA 4U8YD 4XE0A 3GZ1A 2WXOA 2WXHA 1S70B 4WWOA 3R7RA 2LXLA 1OCCE 1TEZA 3RJVA 4G8LA 3UUXA 1NP7A 4B93B 3ZYKA 1B89A 3TL5A 5FZSA 1MX4A 1HFAA 2YNQA 3VTYA 1AWCB 5A6CA 3PRZA 3LVRE 5BV0A 1OWLA 2DVWA 3EUVA 3TXNA 1N54A 1E96B 4C9BB 2CHWA 2L0TB 1N11A 5CECB 3EHRA 1TNYA 2J8SD 2QC9A 1YMPA 3UKUG 5EN5D 4U8VD 4EZKA 4N3AA 1PY1A 4FJZA 5ENRD 1HF8A 4XI0A 4EQFA 1G3NB 2X38A 3FUDA 2CFUA 1JUQA 3B95A 2KZTB 1N4RA 1ZU2A 3ULEG 3PZ1A 3U66A 4GZ5A 4GTRA 3O4ZA 4L7TA 3C72A 2H6HA 3TXMA 2CFZA 2VGEA 3KS2A 1N0QA 5ARFA 2X6FA 2YHEA 1GW6A 2PQNA 2J09A 1MZCA 2XEVA 4JW1A 3K9IA 2OOEA 1SZ9A 3UX4A 2OEWA 2VSNA 2XRYA 3SFZA 4UQYA 3HYMB 2A5EA 3IHVA 2PM7A 4ANWA 4FHJA 4DJAA 4I1OB 2A5UA 3ASOE 4PS7A 5ENTD 1N4QA 5LP0A 4OVVA 3R7QA 3TWXA 4CDRA 1TN6A 4JA7A 2WXKA 3T5XA 3TWTA 4I1AA 2I1JA 3CKBA 4TXPA 4JEUA 1KZOA 3E37A 3PH0C 5AENA 3D9JA 4ANUA 2R05A 1FT1A 2H6FA 3GYZA 1NA0A 1E8WA 3FDHA 4Y6CA 2IO2C 1IXVA 4AVXA 3NOGD 5M72A 2PZIA 4GCOA 1TN7A 3RAUA 2FI7A 4J0UA 2C0MA 4F7AA 2BF0X 4UI9J 3NOCD 3EHQA 5FQ7A 3QDNA 5BUZA 3PZDA 4U0UA 3UIPC 3FTYA 4PH4B 5LCWJ 3C98A 4EZLA 4JD2G 4Y6WA 3FUIA 4XI9A 4JPSA 2R02A 2J4BA 4CT4A 1N52A 3ZRHA 2P9IG 3MKQA 3QWWA 2DZNA 2IY0C 1NL4A 3UMVA 3ASGA 4GZ6A 4G25A 5ENQD 3T8KA 3TGOA 2XCBA 5AIJA 4CDNA 2P9UG 2IF4A 3ZVVA 4HVBA 1HH8A 2VQ2A 3SY2A 1OCOE 4XKCA 3PNLB 3CVXA 2JABA 4GZ3A 4KMOA 3DXMG 2OV8A 1OT8A 3NZUA 4L1BA 3NZSA 3D9OA 3F6QA 3PDNA 5BW8C 3FH8A 4PS8A 1U2VG 4HRMB 3L6AA 1UJJA 3UXGA 2OVFA 2VYIA 1E90A 3LY8A 4GZCA 5FWQA 5BNWA 4K5BA 4KT6B 1RW2A 1OCRE 3V2OA 1H2UA 3ZYQA 2FEZA 3CIAA 4GZDA 1KPSB 3ENEA 4BERA 4DX5D 3CVYA 4BTBA 5CEAA 3UM2A 4WNGA 3SBSA 3PNTB 3FP3A 3AG4E 4TUMA 1ZB1A 4ILIA 2DWZA 2C2LA 4DI3A 3ZIMA 4H7XA 5BPPA 2DIWA 1N4PA 2DBAA 4JB8P 2RKKA 3FUKA 3DEOA 5FQ4A 4DLQA 5DIZA 1N4SA 1UW4B 3TG4A 1FVHA 4DK5A 3RRMB 3EHNA 4E6HA 4DX2A 5KBAA 1S63A 5ANLA 4G1TA 4J8SA 3GZ2A 4O6FA 4AM9A 3CHOA 4FC8A 1Z6TA 2KXPC 3D9KA 3UM1A 3ABME 4UWGA 3PZ3A 1WG0A 4I6EA 3Q7AA 4RSYA 5CBNA 1HS6A 4HXIA 2L9BA 2OCCE 3OAWA 4CEMA 1S64A 1X81A 3TJPA 4O1OA 2EILE 4PUCA 3LJ3A 5AQ7A 3B13A 4FA6A 3C3QA 2FO7A 5E76A 3L9TA 3BU8A 3FFLA 3QAQA 4AY5A 5T4YA 1FVFA 3CGHA 2DCPA 5HRYA 5AYWD 4N5QA 5B3SE 2P9LG 3VLDA 3S7DA 2NC9A 2XCCA 3SFXA 4LNGA 4MS6A 1Y6IA 3ZYMA 1MYOA 2XEHA 1FCHA 3D3MA 3NQPA 4YDEA 4ILGA 4YVQC 4AY6A 3W9FA 3ZEFA 3PUJA 1O1RA 2PNNA 3CQGB 3OTNA 2LNIA 1UJKA 3SGHA 3TG5A 4BY6A 2M63A 4BEPA 5J08A 3B7TA 4F53A 2RFMA 3MV2B 3DRAA 3OXGA 4UUCA 4HOQA 4N2QA 2C0LA 2GRRB 2XENA 5KCMA 4XZ4A 2BTDA 3APCA 5J90A 2WPVA 1IHGA 1LF8A 3IBEA 2XGOA 4DX1A 2A4ZA 3L82A 4B89A 3DSWA 5CEDB 3JXJA 2J07A 3ASHA 3QK0A 4DX6D 2Y4TA 1NZNA 4H7YA 2R03A 3G2UA 3HIZA 4GTMA 4RG6A 2WXGA 3ZUVB 3DWLG 3OXLA 3CVWA 4N39A 4PS3A 3PS6A 2IJGX 2MYOA 4LNUD 3TWRA 3DPYA 4FULA 4HI8A 5LX8A 5KJLA 2NXPA 1ELWA 3AU4A 3BQOA 2R5SA 2QYUA 3I4GA 3Q15A 3LKUA 2OVBA 4DRXE 1JPLA 2H6GA 2WXFA 5JHAA 3MEKA 1TYQG 5EX0A 4I43A 1WY6A 3FTWA 1V55E 2CG2A 2XGMA 1X5BA 3D9NA 2F8XK 5BT1A 2VGXA 4ANVA 3MV3B 2LXMA 4WNFA 1IKND 1H19A 3CV0A 2ETCA 4KXKB 1JWFA 2RFAA 4C0MA 3SO8A 4RLYA 1Z3YA 2DZOA 3FTZA 4Z68A 2KCKA 3FEXA 5G04C 3RRUA 4AP2A 1VDYA 5JHBA 2XPIA 3IXEA 3UPVA 3CVPA 3UI2A 5FQ8A 5FTPA 4A3VA 2QZAA 1L5JA 2ZU6B 3I4RB 1EPUA 3HXCA 3V31A 1LTXA 5HS0A 1MQSA 4JL0A 5AJLA 3RIBA 3FEYA 1HXIA 2I2OA 4K5AB 2KBXA 4GA0A 3RO2A 2KM4A 3MJWA 5H7PA 3C5RA 2Y0BG 1H0AA 1OUVA 3ZPJA 3FULA 2P58C 4B0ZA 3UINC 4LNBA 2HE0A 4K0RA 3HHMA 5AN8A 1WAO1 3JCKC 2WMOA 1JCQA 1EDUA 2IFUA 3L17A 2MOWA 3UIOC 1HG2A 3PREA 2PL2A 2FO1E 3E34A 4GTSA 1N0RA 3S7FA 2QYJA 4G8KA 2EIJE 3FUNA 3SNXA 3RU0A 2BKKB 3Q4AB 3LEWA 3U3WA 3DPDA 2AXZA 4KVOA 3ISMC 1N94A 2YHCA 1MJ0A 4F6RD 4DLOA 2QY7A 3PUKA 2GRPB 2AW6A 1MX2A 1BD8A 4AOFA 4J8FA 2V4HC 1O1TA 4ACKA 2X3MA 3SFYA 1SW6A 4J8DA 3TWSA 2P9NG 4HQDA 5FZRA 3CVLA 5AQAA 1D8DA 2MRIA 3CSTA 2V5QC 1JCSA 1NI1A 1KT1A 5D2MC 5CRVA 3FU5A 5D0OD 3LVQE 3FU0A 2KZTA 5IY5E 2X6JA 3ASDA 4HI9A 4TV3A 4GAAA 4I2WA 3EU9A 1WDYA 3CK9A 4F3VA 1TR4A 3T5VA 2VTBB 2P2CP 1Q2ZA 2R17C 1TNUA 4UWHA 3ESKA 2GW1A 4RVBA 4V3IA 3BUAA 4JA9A 4BT8A 2L6BA 4GA1A 4FU3A 4ZFHA 4FLHA 3Q49B 3CHPA 1N9AA 4B8AA 3NB2A 3PZ4A 5BXOA 3UM0A 1OWPA 5JJ7A 2ZIRA 3MZLB 5EKQD 4IRUA 1FT2A 1A17A 4GTOA 5D66A 2LSVA 2QFCA 4K03A 4CGWA 2HYZA 1SZAA 2WXPA 5HKPA 2RG8A 3HXDA 1FPPA 2ZISA 3U64A 1IQRA 3DSUA 1OWMA 3LY9A 4MLPA 3EIQC 3SQVA 3T9KA 2E2EA 5ARGA 1YYHA 2ILRA 4U8HA 5C2YA 4BTAA 4JHRA 1DVPA 3QB2A 4OAVB 4DI4A 4I6JA 2KCLA 1HX8A 4U07A 1HU3A 1H6PA 4ABNA 1QQEA 5FJYA 4OYSA 3EIJA 3OXFA 3LXUX 4FJYA 4AXHA 3CK8A 4TXRA 3IV0A 3TWWA 5JJTA 4APFA 4TRQA 2WXIA 3JUEA 4BX8A 3FTSA 3E4BA 1KLXA 1YCSB 4ACLA 1H2VC 2P9PG 1OXJA 2YQ8A 2KC7A 4XEIG 4K5CA 4EZJA 2J08A 2LO6A 3CKCA 5LFAA 1EYHA 1U3CA 4I2ZA 3CHRA 1DNPA 3CVNA 2GRLA 3HVEB 2WQ7A 1SQMA 4O60A 1D9SA 3CR3A 5BXUA 5KNGA 1PAQA 2PM6A 1LD7A 3G2VA 5AJDA 3D9LA 2ONDA 3L08A 3ZU7B 4ATZD 2IU1A 4YDOA 4GCNA 1O1SA 3B7BA 1P5QA 1K8KG 1E7UA 5FIOA 3C3OA 4HLEA 1E8ZA 2B0OE 1EF1C 3LCAA 4NURA 1KT0A 3AAAC 3D9HA 3J5PA 3LS8A 3KD7A 5G05J 3Q78A 5ENOD 3WG7E 3ML9A 3QWVA 2J49A 4LRZA 3G2WA 2VSYA 4NACA 2F0YA 3TWUA 4N5CA 3IKOB 3BG0B 4N3CA 4OVUA 2WMNA 3D9MA 4C0EA 1HO8A 2UY1A 2OEVA 3JQ0A 5D0QD 3CVVA 3LJNA 1UOHA 1ZBPA 4EBAA 3B7UX 1YA0A 4HBDA 4LG6A 3S2AA 2Q7FA 2LUHA 3LPZA 4URKA 4Q69A 4HNAD 4WAFA 3RO3A 4CDMA 3URZA 5CRUA 4E85A 4J8EA 4GMRA 4UWKA 4AIFA 3LDZA 1QZ2A 1TJFA 3ZHEA 1E8YA 3FUHA 2WXRA 2WXNA 5FQ6A 3DBSA 3P1UA 3FH5A 3V2XA 4YVOA 3AS8A 2XZTG 4GYOA 2VGXB 3S7BA 5ENPD 4HOUA 1UN9A 4HORA 4I9CA 5E75A 4GYYA 4QFVA 4GTTA 4CCAA 4JZYA 5AARA 3QOUA 2L0IA 1TJCA 3NF1A 3AS4A 3S7JA 1JWGA 1MX6A 3EJNA 5B1BE 4CZ2D 3DSTA 2XEEA 3ZYLA 4TUUA 3SBTB 3AG3E 2VSXE 3ZN3A 5CMYA 1O5MA 3UT4A 1HE8A 5T8IA 2IOSA 3FTVA 2Y4UA 3ZNGA 4GMJA 3AG1E 1ELKA 1PC2A 1IYGA 4GB9A 2B6CA 4HLLA 1U3DA 3KAEA 1H6OA 3QNKA 3VLEA 5HI7A 2H6IA 3ASFA 3MGBA
chains in the Genus database with same CATH topology
2DVWA 3JUEA 1DCQA 3JXIA 2FO1E 1IHBA 3W9FA 5EIBE 2F8XK 3EU9A 1WDYA 4HNAD 3TWVA 1N0RA 2PNNA 5JA4D 2QYJA 1BI7B 1YCSB 3TWTA 1TR4A 5CECB 1N11A 3EHRA 4BESA 4G8KA 1DC2A 4DX7D 2KXPC 4YDYA 1IKND 2P2CP 2ZGDA 4GMRA 2J8SD 4BEPA 2QC9A 2BKKB 4K5CA 2ETCA 2F8YA 1YMPA 2NYJA 4J7WA 2RFAA 2JABA 1K3ZD 5EYLA 4U95D 1WG0A 4DUIA 4F1PA 4RLYA 2DZOA 3SO8A 4J8YA 4Z68A 5CBNA 1OT8A 2RFMA 1A5EA 3F6QA 4O1PA 5EN5D 4UUCA 4U8VD 4HRLA 2L6BA 4HRMB 5ENRD 3HRAA 4ZFHA 3V2XA 1K1AA 4O60A 1D9SA 2XENA 3IXEA 1K1BA 1IXVA 3UXGA 5BXUA 5KNGA 2XZTG 4YDWA 2Y1LE 4GPMA 5ENSD 3UI2A 1MJ0A 3NOGD 2XZDG 5EIDA 4CYMD 4F6RD 4K5BA 5ENPD 1BI8B 1G3NB 3V2OA 3NBNB 1SVXA 3ZU7B 4O1OA 4ATZD 4NIKA 5BXOA 4DX1A 4QFVA 5AQ9A 1MX2A 3B7BA 5AQ7A 5FIOA 3NOCD 3V31A 1BD8A 3B95A 3Q9NC 5HS0A 5AARA 4BERA 4BSZB 3EHQA 4DX5D 5CBOA 5ITZF 4HRNA 5CEDB 3JXJA 4U96D 4C48B 2V4HC 1BLXB 5EYPF 3HG0D 3TWQA 5CEAA 2B0OE 2ETAA 5D66A 4K5AB 4DX6D 2KBXA 1MX6A 4CZ2D 2AJAA 4BETA 2VGEA 3AJIA 3DEPA 4QQIA 5HKPA 1QYMA 2XEEA 3V79K 1SW6A 2BKGA 4A63B 3V30A 3AAAC 3D9HA 3J5PA 4TUMA 3TWSA 3ZUVB 1BU9A 3TWXA 1N0QA 2ZGGA 5HRYA 1NFIE 2DWZA 5ENOD 3T9KA 4N5QA 3C5RA 5AQBA 5KNHD 2Y0BG 4LSZE 4HQDA 1YYHA 4U8YD 4OAUC 4JB8P 3ZNGA 2ETBA 2MYOA 3J5QB 3W9GA 4LNUD 3TWRA 2F37A 3TWUA 3DEOA 5JMND 1S70B 3Q9UC 1OY3D 4HI8A 5AQAA 4OAVB 3KEAA 4HB5A 5CERB 2HE0A 2DZNA 4G8LA 2V5QC 4HLLA 5AN8A 2A5EA 1MYOA 2XEHA 4DRXE 4B93B 3LJNA 1UOHA 5FINA 1MX4A 5ENTD 3ZKJA 4ZHBA 4HBDA 4LG6A 5KWDA 4DX2A 3TWWA 1AWCB 4HI9A 5EILA 3UTMA 5KBAA 5ENQD 3T8KA 5AAOA 1AP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVW A;  3JUE A;  1DCQ A;  3JXI A;  2FO1 E;  1IHB A;  3W9F A;  5EIB E;  2F8X K;  3EU9 A;  1WDY A;  4HNA D;  3TWV A;  1N0R A;  2PNN A;  5JA4 D;  2QYJ A;  1BI7 B;  1YCS B;  3TWT A;  1TR4 A;  5CEC B;  1N11 A;  3EHR A;  4BES A;  4G8K A;  1DC2 A;  4DX7 D;  2KXP C;  4YDY A;  1IKN D;  2P2C P;  2ZGD A;  4GMR A;  2J8S D;  4BEP A;  2QC9 A;  2BKK B;  4K5C A;  2ETC A;  2F8Y A;  1YMP A;  2NYJ A;  4J7W A;  2RFA A;  2JAB A;  1K3Z D;  5EYL A;  4U95 D;  1WG0 A;  4DUI A;  4F1P A;  4RLY A;  2DZO A;  3SO8 A;  4J8Y A;  4Z68 A;  5CBN A;  1OT8 A;  2RFM A;  1A5E A;  3F6Q A;  4O1P A;  5EN5 D;  4UUC A;  4U8V D;  4HRL A;  2L6B A;  4HRM B;  5ENR D;  3HRA A;  4ZFH A;  3V2X A;  1K1A A;  4O60 A;  1D9S A;  2XEN A;  3IXE A;  1K1B A;  1IXV A;  3UXG A;  5BXU A;  5KNG A;  2XZT G;  4YDW A;  2Y1L E;  4GPM A;  5ENS D;  3UI2 A;  1MJ0 A;  3NOG D;  2XZD G;  5EID A;  4CYM D;  4F6R D;  4K5B A;  5ENP D;  1BI8 B;  1G3N B;  3V2O A;  3NBN B;  1SVX A;  3ZU7 B;  4O1O A;  4ATZ D;  4NIK A;  5BXO A;  4DX1 A;  4QFV A;  5AQ9 A;  1MX2 A;  3B7B A;  5AQ7 A;  5FIO A;  3NOC D;  3V31 A;  1BD8 A;  3B95 A;  3Q9N C;  5HS0 A;  5AAR A;  4BER A;  4BSZ B;  3EHQ A;  4DX5 D;  5CBO A;  5ITZ F;  4HRN A;  5CED B;  3JXJ A;  4U96 D;  4C48 B;  2V4H C;  1BLX B;  5EYP F;  3HG0 D;  3TWQ A;  5CEA A;  2B0O E;  2ETA A;  5D66 A;  4K5A B;  4DX6 D;  2KBX A;  1MX6 A;  4CZ2 D;  2AJA A;  4BET A;  2VGE A;  3AJI A;  3DEP A;  4QQI A;  5HKP A;  1QYM A;  2XEE A;  3V79 K;  1SW6 A;  2BKG A;  4A63 B;  3V30 A;  3AAA C;  3D9H A;  3J5P A;  4TUM A;  3TWS A;  3ZUV B;  1BU9 A;  3TWX A;  1N0Q A;  2ZGG A;  5HRY A;  1NFI E;  2DWZ A;  5ENO D;  3T9K A;  4N5Q A;  3C5R A;  5AQB A;  5KNH D;  2Y0B G;  4LSZ E;  4HQD A;  1YYH A;  4U8Y D;  4OAU C;  4JB8 P;  3ZNG A;  2ETB A;  2MYO A;  3J5Q B;  3W9G A;  4LNU D;  3TWR A;  2F37 A;  3TWU A;  3DEO A;  5JMN D;  1S70 B;  3Q9U C;  1OY3 D;  4HI8 A;  5AQA A;  4OAV B;  3KEA A;  4HB5 A;  5CER B;  2HE0 A;  2DZN A;  4G8L A;  2V5Q C;  4HLL A;  5AN8 A;  2A5E A;  1MYO A;  2XEH A;  4DRX E;  4B93 B;  3LJN A;  1UOH A;  5FIN A;  1MX4 A;  5ENT D;  3ZKJ A;  4ZHB A;  4HBD A;  4LG6 A;  5KWD A;  4DX2 A;  3TWW A;  1AWC B;  4HI9 A;  5EIL A;  3UTM A;  5KBA A;  5ENQ D;  3T8K A;  5AAO A;  1AP7 A; 
#chains in the Genus database with same CATH topology
 3FU6 A;  1UG3 A;  1MHQ A;  3ABK E;  5EIB E;  4GA2 A;  3JUI A;  1E8X A;  4LUN U;  4N3B A;  4GTQ A;  3E33 A;  2ZGD A;  2LAH A;  4A55 A;  2HR2 A;  4ATG A;  2F8Y A;  2NYJ A;  3ML8 A;  4HFG A;  4HOS A;  2I9C A;  4XX5 A;  4O1P A;  3SD5 A;  5KJN A;  3SF4 A;  3FUE A;  1K1A A;  3MYV A;  3UQ3 A;  4G24 A;  3U9W A;  5EID A;  1H6K A;  4P29 A;  3UT8 A;  2FBN A;  3HXF A;  4NIK A;  2P9S G;  4KZ0 A;  2V8S E;  3HXE A;  2UWJ G;  3BG1 B;  1SA5 A;  3TWQ A;  1XGW A;  4DPR A;  3E30 A;  4EPZ A;  4NQ0 A;  3QJZ A;  2BKG A;  3DSX A;  3GZS A;  5CCL A;  2DYS E;  3ONK A;  2CG3 A;  3Q47 B;  3UT7 A;  3KEZ A;  5JMN D;  3KEA A;  4CRW A;  4G26 A;  5DBK A;  5FIN A;  2KCV A;  3FUF A;  3UTM A;  5EIL A;  4B94 A;  2IEJ A;  3ESL A;  4J6I A;  2KAT A;  4AEZ C;  4BX9 A;  2LSU A;  3FWV A;  3HDX A;  3EHM A;  5EX3 A;  4L2L A;  4AJW A;  4BES A;  4F1S A;  3BEE A;  3RRN B;  4DX7 D;  1V54 E;  4G2V A;  1E7V A;  3MX3 A;  3FH7 A;  3QC1 A;  3APF A;  4UWL A;  5EYL A;  4KVM A;  5FZQ A;  1A5E A;  3P2B A;  3D9I A;  4MBG A;  3FUM A;  3L13 A;  1TNB A;  3MKQ B;  3UM3 A;  2P9K G;  4A1G A;  1RZ4 A;  1BI8 B;  3NBN B;  4U63 A;  5G55 A;  2J9Q A;  4HRN A;  3I3N A;  4G23 A;  5HQ8 A;  4U0Z A;  3UKR G;  4G11 A;  1BLX B;  2CHZ A;  3X2Q E;  4MKT A;  4BET A;  2AXV A;  1ELR A;  1HZ4 A;  1QYM A;  2EIM E;  3SZ7 A;  4GTP A;  5ENN A;  4IYP A;  2Y3A A;  4OAU C;  2ZXW E;  4PDX A;  2I6H A;  3MCX A;  3NAW A;  3W9G A;  4XIF A;  5FT9 A;  3ZXP A;  1OY3 D;  5CER B;  1TN8 A;  4BWR A;  2VGY A;  4LER A;  5LOZ A;  3I5P A;  2JLB A;  3CVQ A;  3DSS A;  2IOL A;  2XPZ A;  2CHX A;  4ZHB A;  1QNF A;  2GRQ B;  2DYR E;  5G2N A;  2LAI A;  4IUL A;  2EQX A;  3PEV B;  3PZ2 A;  4APO A;  4X8Q A;  2GRN B;  2RD0 A;  1BI7 B;  4WNE A;  4RG9 A;  3U4T A;  1DC2 A;  1INZ A;  4A1S A;  4GML A;  3R9A B;  4WUY A;  4BT9 A;  2HM8 A;  3L22 A;  4DUI A;  4BFR A;  4F1P A;  3IEG A;  4J8Y A;  3RKV A;  2XS1 A;  3Q7F A;  1XNF A;  3FHE A;  2I1K A;  3ZXS A;  3CSF A;  1OWN A;  4UWF A;  2XPY A;  2V0P A;  3ZGQ A;  3PE4 A;  1H2T C;  3ZW3 A;  3QKY A;  3N71 A;  2X6K A;  2WVI A;  5A23 A;  1SVX A;  2BUG A;  4GTV A;  3Q75 A;  2MHK A;  4IN3 B;  2GRM A;  2R2L A;  4GU5 A;  4BSZ B;  1W3B A;  5CBO A;  2VSO E;  3LY7 A;  4C48 B;  5EYP F;  2ETA A;  1UN8 A;  1QBQ A;  2AJA A;  2WXM A;  4EBA G;  3ULQ A;  1TNZ A;  4A63 B;  3V30 A;  4ANX A;  5KNH D;  4L2Y A;  2ETB A;  4U04 A;  2F37 A;  4CGV A;  4TXQ A;  2E0I A;  3Q9U C;  4UQX A;  3PE3 A;  4WWP A;  3AS5 A;  2V4L A;  1TNO A;  1D8E A;  3G2S A;  2YIN A;  2WQH A;  5AAO A;  1AP7 A;  1DCQ A;  4L9P A;  4MRU A;  3Q5M A;  2XQ0 A;  2VJ8 A;  3TWV A;  4WWN A;  5JA4 D;  3CHQ A;  4LCT A;  3CHM A;  4ILH B;  2IO3 C;  3QWP A;  4GYW A;  4YDY A;  2UY1 B;  2GGF A;  2L6J A;  3B7S A;  5KJK A;  4U95 D;  3PVL A;  5BV1 A;  5T3R A;  3T8M A;  4AV7 A;  1BPO A;  4HOT A;  4HRL A;  4I6G A;  2ION A;  1Y8M A;  4RQI A;  2Y1L E;  4LEU A;  2Y69 E;  4EEC A;  5EDS A;  1LD8 A;  4JC8 A;  3ZHE B;  4UQZ A;  5CMW A;  3TAX A;  2J4D A;  4EHM A;  3KSQ A;  4U96 D;  4NRH B;  1Z3X A;  3ABL E;  3Q79 A;  4KBQ A;  2VTB A;  4WND A;  3JYS A;  2R59 A;  3DEP A;  3E32 A;  3MKR A;  4U0S A;  1NFI E;  1Z5S C;  5AQB A;  2XHE A;  2FF4 A;  4UI9 C;  4Q96 A;  4FLB A;  4HB5 A;  5CCM A;  3L54 A;  3MA5 A;  5B1A E;  3VTX A;  2XRZ A;  4FP7 A;  5LCW C;  2WM9 A;  3KSL A;  4B8C B;  3C3R A;  4BSX A;  2XS8 A;  3ZKJ A;  3G2T A;  4XKB A;  1SA4 A;  2V5F A;  2EIN E;  1DCE A;  3DXK G;  2GRO B;  3FTU A;  3JXI A;  4R7L A;  3JQ1 A;  3PEU B;  2NSZ A;  4A3T A;  4D10 C;  1K3Z D;  5G04 J;  3Q73 A;  4HS2 A;  3HRA A;  3D9P A;  2X6H A;  4YDW A;  4GPM A;  1IQU A;  3HXB A;  3ZFW A;  5CHE E;  4U7E B;  3L16 A;  4M7C A;  2PQR A;  2IQC A;  5AQ9 A;  1NA3 A;  1S0P A;  3CK7 A;  4UI9 K;  3AG2 E;  5JJ6 A;  5ITZ F;  2XGS A;  3CLJ A;  4KZC A;  5A7D B;  5ANR A;  1BU9 A;  1WM5 A;  4YND A;  2ZGG A;  4Q94 A;  2BED A;  3SI5 A;  4LSZ E;  3J5Q B;  3ASN E;  2WXL A;  3HVE A;  2JEK A;  4ME2 A;  3RK6 A;  4I9E A;  4FHK A;  4JHK A;  1JCR A;  3QAR A;  1OWO A;  3FUJ A;  5KWD A;  4I17 A;  1IHB A;  5C1D A;  3IHY A;  3VLF A;  3RSE G;  4M3O A;  4N2S A;  3EU5 A;  3CQC B;  4CT0 A;  4J7W A;  1N95 A;  2WXJ A;  3CVU A;  3CHS A;  4GPK A;  2HO1 A;  3O48 A;  4JVS A;  3CEQ A;  4I1M A;  1K1B A;  1KZP A;  2X6I A;  3FY4 A;  3FTX A;  5ENS D;  2WB2 A;  2XZD G;  4JXT A;  2AWI A;  4CYM D;  4FAD A;  3B7R L;  2WXQ A;  3EDT B;  3R9M A;  2WQ6 A;  3DSV A;  5KJM A;  3Q9N C;  3APD A;  3WXX A;  3GW4 A;  3HG0 D;  4KYO B;  1HG5 A;  3ULY A;  4JHJ A;  4L23 A;  2AXU A;  3AU5 A;  4JEH A;  3AJI A;  4QQI A;  3V79 K;  3LYA A;  2AVP A;  4W9R A;  3ONL A;  1OCZ E;  3FU3 A;  2EIK E;  5G05 C;  2FUL A;  3SHF A;  4U8Y D;  4XE0 A;  3GZ1 A;  2WXO A;  2WXH A;  1S70 B;  4WWO A;  3R7R A;  2LXL A;  1OCC E;  1TEZ A;  3RJV A;  4G8L A;  3UUX A;  1NP7 A;  4B93 B;  3ZYK A;  1B89 A;  3TL5 A;  5FZS A;  1MX4 A;  1HFA A;  2YNQ A;  3VTY A;  1AWC B;  5A6C A;  3PRZ A;  3LVR E;  5BV0 A;  1OWL A;  2DVW A;  3EUV A;  3TXN A;  1N54 A;  1E96 B;  4C9B B;  2CHW A;  2L0T B;  1N11 A;  5CEC B;  3EHR A;  1TNY A;  2J8S D;  2QC9 A;  1YMP A;  3UKU G;  5EN5 D;  4U8V D;  4EZK A;  4N3A A;  1PY1 A;  4FJZ A;  5ENR D;  1HF8 A;  4XI0 A;  4EQF A;  1G3N B;  2X38 A;  3FUD A;  2CFU A;  1JUQ A;  3B95 A;  2KZT B;  1N4R A;  1ZU2 A;  3ULE G;  3PZ1 A;  3U66 A;  4GZ5 A;  4GTR A;  3O4Z A;  4L7T A;  3C72 A;  2H6H A;  3TXM A;  2CFZ A;  2VGE A;  3KS2 A;  1N0Q A;  5ARF A;  2X6F A;  2YHE A;  1GW6 A;  2PQN A;  2J09 A;  1MZC A;  2XEV A;  4JW1 A;  3K9I A;  2OOE A;  1SZ9 A;  3UX4 A;  2OEW A;  2VSN A;  2XRY A;  3SFZ A;  4UQY A;  3HYM B;  2A5E A;  3IHV A;  2PM7 A;  4ANW A;  4FHJ A;  4DJA A;  4I1O B;  2A5U A;  3ASO E;  4PS7 A;  5ENT D;  1N4Q A;  5LP0 A;  4OVV A;  3R7Q A;  3TWX A;  4CDR A;  1TN6 A;  4JA7 A;  2WXK A;  3T5X A;  3TWT A;  4I1A A;  2I1J A;  3CKB A;  4TXP A;  4JEU A;  1KZO A;  3E37 A;  3PH0 C;  5AEN A;  3D9J A;  4ANU A;  2R05 A;  1FT1 A;  2H6F A;  3GYZ A;  1NA0 A;  1E8W A;  3FDH A;  4Y6C A;  2IO2 C;  1IXV A;  4AVX A;  3NOG D;  5M72 A;  2PZI A;  4GCO A;  1TN7 A;  3RAU A;  2FI7 A;  4J0U A;  2C0M A;  4F7A A;  2BF0 X;  4UI9 J;  3NOC D;  3EHQ A;  5FQ7 A;  3QDN A;  5BUZ A;  3PZD A;  4U0U A;  3UIP C;  3FTY A;  4PH4 B;  5LCW J;  3C98 A;  4EZL A;  4JD2 G;  4Y6W A;  3FUI A;  4XI9 A;  4JPS A;  2R02 A;  2J4B A;  4CT4 A;  1N52 A;  3ZRH A;  2P9I G;  3MKQ A;  3QWW A;  2DZN A;  2IY0 C;  1NL4 A;  3UMV A;  3ASG A;  4GZ6 A;  4G25 A;  5ENQ D;  3T8K A;  3TGO A;  2XCB A;  5AIJ A;  4CDN A;  2P9U G;  2IF4 A;  3ZVV A;  4HVB A;  1HH8 A;  2VQ2 A;  3SY2 A;  1OCO E;  4XKC A;  3PNL B;  3CVX A;  2JAB A;  4GZ3 A;  4KMO A;  3DXM G;  2OV8 A;  1OT8 A;  3NZU A;  4L1B A;  3NZS A;  3D9O A;  3F6Q A;  3PDN A;  5BW8 C;  3FH8 A;  4PS8 A;  1U2V G;  4HRM B;  3L6A A;  1UJJ A;  3UXG A;  2OVF A;  2VYI A;  1E90 A;  3LY8 A;  4GZC A;  5FWQ A;  5BNW A;  4K5B A;  4KT6 B;  1RW2 A;  1OCR E;  3V2O A;  1H2U A;  3ZYQ A;  2FEZ A;  3CIA A;  4GZD A;  1KPS B;  3ENE A;  4BER A;  4DX5 D;  3CVY A;  4BTB A;  5CEA A;  3UM2 A;  4WNG A;  3SBS A;  3PNT B;  3FP3 A;  3AG4 E;  4TUM A;  1ZB1 A;  4ILI A;  2DWZ A;  2C2L A;  4DI3 A;  3ZIM A;  4H7X A;  5BPP A;  2DIW A;  1N4P A;  2DBA A;  4JB8 P;  2RKK A;  3FUK A;  3DEO A;  5FQ4 A;  4DLQ A;  5DIZ A;  1N4S A;  1UW4 B;  3TG4 A;  1FVH A;  4DK5 A;  3RRM B;  3EHN A;  4E6H A;  4DX2 A;  5KBA A;  1S63 A;  5ANL A;  4G1T A;  4J8S A;  3GZ2 A;  4O6F A;  4AM9 A;  3CHO A;  4FC8 A;  1Z6T A;  2KXP C;  3D9K A;  3UM1 A;  3ABM E;  4UWG A;  3PZ3 A;  1WG0 A;  4I6E A;  3Q7A A;  4RSY A;  5CBN A;  1HS6 A;  4HXI A;  2L9B A;  2OCC E;  3OAW A;  4CEM A;  1S64 A;  1X81 A;  3TJP A;  4O1O A;  2EIL E;  4PUC A;  3LJ3 A;  5AQ7 A;  3B13 A;  4FA6 A;  3C3Q A;  2FO7 A;  5E76 A;  3L9T A;  3BU8 A;  3FFL A;  3QAQ A;  4AY5 A;  5T4Y A;  1FVF A;  3CGH A;  2DCP A;  5HRY A;  5AYW D;  4N5Q A;  5B3S E;  2P9L G;  3VLD A;  3S7D A;  2NC9 A;  2XCC A;  3SFX A;  4LNG A;  4MS6 A;  1Y6I A;  3ZYM A;  1MYO A;  2XEH A;  1FCH A;  3D3M A;  3NQP A;  4YDE A;  4ILG A;  4YVQ C;  4AY6 A;  3W9F A;  3ZEF A;  3PUJ A;  1O1R A;  2PNN A;  3CQG B;  3OTN A;  2LNI A;  1UJK A;  3SGH A;  3TG5 A;  4BY6 A;  2M63 A;  4BEP A;  5J08 A;  3B7T A;  4F53 A;  2RFM A;  3MV2 B;  3DRA A;  3OXG A;  4UUC A;  4HOQ A;  4N2Q A;  2C0L A;  2GRR B;  2XEN A;  5KCM A;  4XZ4 A;  2BTD A;  3APC A;  5J90 A;  2WPV A;  1IHG A;  1LF8 A;  3IBE A;  2XGO A;  4DX1 A;  2A4Z A;  3L82 A;  4B89 A;  3DSW A;  5CED B;  3JXJ A;  2J07 A;  3ASH A;  3QK0 A;  4DX6 D;  2Y4T A;  1NZN A;  4H7Y A;  2R03 A;  3G2U A;  3HIZ A;  4GTM A;  4RG6 A;  2WXG A;  3ZUV B;  3DWL G;  3OXL A;  3CVW A;  4N39 A;  4PS3 A;  3PS6 A;  2IJG X;  2MYO A;  4LNU D;  3TWR A;  3DPY A;  4FUL A;  4HI8 A;  5LX8 A;  5KJL A;  2NXP A;  1ELW A;  3AU4 A;  3BQO A;  2R5S A;  2QYU A;  3I4G A;  3Q15 A;  3LKU A;  2OVB A;  4DRX E;  1JPL A;  2H6G A;  2WXF A;  5JHA A;  3MEK A;  1TYQ G;  5EX0 A;  4I43 A;  1WY6 A;  3FTW A;  1V55 E;  2CG2 A;  2XGM A;  1X5B A;  3D9N A;  2F8X K;  5BT1 A;  2VGX A;  4ANV A;  3MV3 B;  2LXM A;  4WNF A;  1IKN D;  1H19 A;  3CV0 A;  2ETC A;  4KXK B;  1JWF A;  2RFA A;  4C0M A;  3SO8 A;  4RLY A;  1Z3Y A;  2DZO A;  3FTZ A;  4Z68 A;  2KCK A;  3FEX A;  5G04 C;  3RRU A;  4AP2 A;  1VDY A;  5JHB A;  2XPI A;  3IXE A;  3UPV A;  3CVP A;  3UI2 A;  5FQ8 A;  5FTP A;  4A3V A;  2QZA A;  1L5J A;  2ZU6 B;  3I4R B;  1EPU A;  3HXC A;  3V31 A;  1LTX A;  5HS0 A;  1MQS A;  4JL0 A;  5AJL A;  3RIB A;  3FEY A;  1HXI A;  2I2O A;  4K5A B;  2KBX A;  4GA0 A;  3RO2 A;  2KM4 A;  3MJW A;  5H7P A;  3C5R A;  2Y0B G;  1H0A A;  1OUV A;  3ZPJ A;  3FUL A;  2P58 C;  4B0Z A;  3UIN C;  4LNB A;  2HE0 A;  4K0R A;  3HHM A;  5AN8 A;  1WAO 1;  3JCK C;  2WMO A;  1JCQ A;  1EDU A;  2IFU A;  3L17 A;  2MOW A;  3UIO C;  1HG2 A;  3PRE A;  2PL2 A;  2FO1 E;  3E34 A;  4GTS A;  1N0R A;  3S7F A;  2QYJ A;  4G8K A;  2EIJ E;  3FUN A;  3SNX A;  3RU0 A;  2BKK B;  3Q4A B;  3LEW A;  3U3W A;  3DPD A;  2AXZ A;  4KVO A;  3ISM C;  1N94 A;  2YHC A;  1MJ0 A;  4F6R D;  4DLO A;  2QY7 A;  3PUK A;  2GRP B;  2AW6 A;  1MX2 A;  1BD8 A;  4AOF A;  4J8F A;  2V4H C;  1O1T A;  4ACK A;  2X3M A;  3SFY A;  1SW6 A;  4J8D A;  3TWS A;  2P9N G;  4HQD A;  5FZR A;  3CVL A;  5AQA A;  1D8D A;  2MRI A;  3CST A;  2V5Q C;  1JCS A;  1NI1 A;  1KT1 A;  5D2M C;  5CRV A;  3FU5 A;  5D0O D;  3LVQ E;  3FU0 A;  2KZT A;  5IY5 E;  2X6J A;  3ASD A;  4HI9 A;  4TV3 A;  4GAA A;  4I2W A;  3EU9 A;  1WDY A;  3CK9 A;  4F3V A;  1TR4 A;  3T5V A;  2VTB B;  2P2C P;  1Q2Z A;  2R17 C;  1TNU A;  4UWH A;  3ESK A;  2GW1 A;  4RVB A;  4V3I A;  3BUA A;  4JA9 A;  4BT8 A;  2L6B A;  4GA1 A;  4FU3 A;  4ZFH A;  4FLH A;  3Q49 B;  3CHP A;  1N9A A;  4B8A A;  3NB2 A;  3PZ4 A;  5BXO A;  3UM0 A;  1OWP A;  5JJ7 A;  2ZIR A;  3MZL B;  5EKQ D;  4IRU A;  1FT2 A;  1A17 A;  4GTO A;  5D66 A;  2LSV A;  2QFC A;  4K03 A;  4CGW A;  2HYZ A;  1SZA A;  2WXP A;  5HKP A;  2RG8 A;  3HXD A;  1FPP A;  2ZIS A;  3U64 A;  1IQR A;  3DSU A;  1OWM A;  3LY9 A;  4MLP A;  3EIQ C;  3SQV A;  3T9K A;  2E2E A;  5ARG A;  1YYH A;  2ILR A;  4U8H A;  5C2Y A;  4BTA A;  4JHR A;  1DVP A;  3QB2 A;  4OAV B;  4DI4 A;  4I6J A;  2KCL A;  1HX8 A;  4U07 A;  1HU3 A;  1H6P A;  4ABN A;  1QQE A;  5FJY A;  4OYS A;  3EIJ A;  3OXF A;  3LXU X;  4FJY A;  4AXH A;  3CK8 A;  4TXR A;  3IV0 A;  3TWW A;  5JJT A;  4APF A;  4TRQ A;  2WXI A;  3JUE A;  4BX8 A;  3FTS A;  3E4B A;  1KLX A;  1YCS B;  4ACL A;  1H2V C;  2P9P G;  1OXJ A;  2YQ8 A;  2KC7 A;  4XEI G;  4K5C A;  4EZJ A;  2J08 A;  2LO6 A;  3CKC A;  5LFA A;  1EYH A;  1U3C A;  4I2Z A;  3CHR A;  1DNP A;  3CVN A;  2GRL A;  3HVE B;  2WQ7 A;  1SQM A;  4O60 A;  1D9S A;  3CR3 A;  5BXU A;  5KNG A;  1PAQ A;  2PM6 A;  1LD7 A;  3G2V A;  5AJD A;  3D9L A;  2OND A;  3L08 A;  3ZU7 B;  4ATZ D;  2IU1 A;  4YDO A;  4GCN A;  1O1S A;  3B7B A;  1P5Q A;  1K8K G;  1E7U A;  5FIO A;  3C3O A;  4HLE A;  1E8Z A;  2B0O E;  1EF1 C;  3LCA A;  4NUR A;  1KT0 A;  3AAA C;  3D9H A;  3J5P A;  3LS8 A;  3KD7 A;  5G05 J;  3Q78 A;  5ENO D;  3WG7 E;  3ML9 A;  3QWV A;  2J49 A;  4LRZ A;  3G2W A;  2VSY A;  4NAC A;  2F0Y A;  3TWU A;  4N5C A;  3IKO B;  3BG0 B;  4N3C A;  4OVU A;  2WMN A;  3D9M A;  4C0E A;  1HO8 A;  2UY1 A;  2OEV A;  3JQ0 A;  5D0Q D;  3CVV A;  3LJN A;  1UOH A;  1ZBP A;  4EBA A;  3B7U X;  1YA0 A;  4HBD A;  4LG6 A;  3S2A A;  2Q7F A;  2LUH A;  3LPZ A;  4URK A;  4Q69 A;  4HNA D;  4WAF A;  3RO3 A;  4CDM A;  3URZ A;  5CRU A;  4E85 A;  4J8E A;  4GMR A;  4UWK A;  4AIF A;  3LDZ A;  1QZ2 A;  1TJF A;  3ZHE A;  1E8Y A;  3FUH A;  2WXR A;  2WXN A;  5FQ6 A;  3DBS A;  3P1U A;  3FH5 A;  3V2X A;  4YVO A;  3AS8 A;  2XZT G;  4GYO A;  2VGX B;  3S7B A;  5ENP D;  4HOU A;  1UN9 A;  4HOR A;  4I9C A;  5E75 A;  4GYY A;  4QFV A;  4GTT A;  4CCA A;  4JZY A;  5AAR A;  3QOU A;  2L0I A;  1TJC A;  3NF1 A;  3AS4 A;  3S7J A;  1JWG A;  1MX6 A;  3EJN A;  5B1B E;  4CZ2 D;  3DST A;  2XEE A;  3ZYL A;  4TUU A;  3SBT B;  3AG3 E;  2VSX E;  3ZN3 A;  5CMY A;  1O5M A;  3UT4 A;  1HE8 A;  5T8I A;  2IOS A;  3FTV A;  2Y4U A;  3ZNG A;  4GMJ A;  3AG1 E;  1ELK A;  1PC2 A;  1IYG A;  4GB9 A;  2B6C A;  4HLL A;  1U3D A;  3KAE A;  1H6O A;  3QNK A;  3VLE A;  5HI7 A;  2H6I A;  3ASF A;  3MGB A; 
#chains in the Genus database with same CATH homology
 2DVW A;  3JUE A;  1DCQ A;  3JXI A;  2FO1 E;  1IHB A;  3W9F A;  5EIB E;  2F8X K;  3EU9 A;  1WDY A;  4HNA D;  3TWV A;  1N0R A;  2PNN A;  5JA4 D;  2QYJ A;  1BI7 B;  1YCS B;  3TWT A;  1TR4 A;  5CEC B;  1N11 A;  3EHR A;  4BES A;  4G8K A;  1DC2 A;  4DX7 D;  2KXP C;  4YDY A;  1IKN D;  2P2C P;  2ZGD A;  4GMR A;  2J8S D;  4BEP A;  2QC9 A;  2BKK B;  4K5C A;  2ETC A;  2F8Y A;  1YMP A;  2NYJ A;  4J7W A;  2RFA A;  2JAB A;  1K3Z D;  5EYL A;  4U95 D;  1WG0 A;  4DUI A;  4F1P A;  4RLY A;  2DZO A;  3SO8 A;  4J8Y A;  4Z68 A;  5CBN A;  1OT8 A;  2RFM A;  1A5E A;  3F6Q A;  4O1P A;  5EN5 D;  4UUC A;  4U8V D;  4HRL A;  2L6B A;  4HRM B;  5ENR D;  3HRA A;  4ZFH A;  3V2X A;  1K1A A;  4O60 A;  1D9S A;  2XEN A;  3IXE A;  1K1B A;  1IXV A;  3UXG A;  5BXU A;  5KNG A;  2XZT G;  4YDW A;  2Y1L E;  4GPM A;  5ENS D;  3UI2 A;  1MJ0 A;  3NOG D;  2XZD G;  5EID A;  4CYM D;  4F6R D;  4K5B A;  5ENP D;  1BI8 B;  1G3N B;  3V2O A;  3NBN B;  1SVX A;  3ZU7 B;  4O1O A;  4ATZ D;  4NIK A;  5BXO A;  4DX1 A;  4QFV A;  5AQ9 A;  1MX2 A;  3B7B A;  5AQ7 A;  5FIO A;  3NOC D;  3V31 A;  1BD8 A;  3B95 A;  3Q9N C;  5HS0 A;  5AAR A;  4BER A;  4BSZ B;  3EHQ A;  4DX5 D;  5CBO A;  5ITZ F;  4HRN A;  5CED B;  3JXJ A;  4U96 D;  4C48 B;  2V4H C;  1BLX B;  5EYP F;  3HG0 D;  3TWQ A;  5CEA A;  2B0O E;  2ETA A;  5D66 A;  4K5A B;  4DX6 D;  2KBX A;  1MX6 A;  4CZ2 D;  2AJA A;  4BET A;  2VGE A;  3AJI A;  3DEP A;  4QQI A;  5HKP A;  1QYM A;  2XEE A;  3V79 K;  1SW6 A;  2BKG A;  4A63 B;  3V30 A;  3AAA C;  3D9H A;  3J5P A;  4TUM A;  3TWS A;  3ZUV B;  1BU9 A;  3TWX A;  1N0Q A;  2ZGG A;  5HRY A;  1NFI E;  2DWZ A;  5ENO D;  3T9K A;  4N5Q A;  3C5R A;  5AQB A;  5KNH D;  2Y0B G;  4LSZ E;  4HQD A;  1YYH A;  4U8Y D;  4OAU C;  4JB8 P;  3ZNG A;  2ETB A;  2MYO A;  3J5Q B;  3W9G A;  4LNU D;  3TWR A;  2F37 A;  3TWU A;  3DEO A;  5JMN D;  1S70 B;  3Q9U C;  1OY3 D;  4HI8 A;  5AQA A;  4OAV B;  3KEA A;  4HB5 A;  5CER B;  2HE0 A;  2DZN A;  4G8L A;  2V5Q C;  4HLL A;  5AN8 A;  2A5E A;  1MYO A;  2XEH A;  4DRX E;  4B93 B;  3LJN A;  1UOH A;  5FIN A;  1MX4 A;  5ENT D;  3ZKJ A;  4ZHB A;  4HBD A;  4LG6 A;  5KWD A;  4DX2 A;  3TWW A;  1AWC B;  4HI9 A;  5EIL A;  3UTM A;  5KBA A;  5ENQ D;  3T8K A;  5AAO A;  1AP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...