3TWSA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human terf1 (chimeric peptide)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
b'SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twsA00
2BKKB 2ZGDA 3ZKJA 4ZHBA 1S70B 1N0QA 3B95A 4JB8P 3V2XA 2XENA 4CYMD 4DUIA 5AAOA 5CBOA 3AJIA 1MX6A 4HQDA 5ENSD 3ZU7B 3F6QA 2HE0A 3Q9NC 5HRYA 4UUCA 4DRXE 5CEDB 4RLYA 5JMND 2RFMA 2KBXA 1UOHA 1D9SA 5ITZF 5AARA 4LG6A 4YDWA 5FINA 1BD8A 1QYMA 5EIBE 5CEAA 1N11A 5EILA 1YCSB 1A5EA 2VGEA 2XEHA 2A5EA 1DC2A 3DEOA 3TWSA 1MX4A 5EYLA 2F8XK 1IXVA 1BLXB 3V30A 3W9GA 4G8KA 4ATZD 3NBNB 1G3NB 5CBNA 4A63B 2DZNA 5AQ9A 5ENPD 4DX1A 2FO1E 4C48B 5FIOA 3J5PA 3V31A 4HNAD 4K5CA 5CERB 1WDYA 2J8SD 3DEPA 4CZ2D 2Y0BG 2DVWA 4BETA 1BU9A 4U95D 3TWWA 1MX2A 4J8YA 1IKND 4G8LA 5EIDA 1MJ0A 2MYOA 4U8VD 1YYHA 5HS0A 2P2CP 4LSZE 4YDYA 4BEPA 4DX2A 4BERA 3ZUVB 4HI9A 3T9KA 3UI2A 5KWDA 4O1OA 4J7WA 2NYJA 5EN5D 3T8KA 2KXPC 4OAUC 4DX7D 1NFIE 2ETCA 3NOCD 5EYPF 4GPMA 3EU9A 1K1AA 2RFAA 1DCQA 3TWUA 1BI7B 2ETBA 4BSZB 5AQBA 2F8YA 4U8YD 4O60A 5HKPA 3AAAC 3TWTA 1SW6A 3JXIA 1N0RA 3HG0D 5ENTD 4U96D 3JUEA 4BESA 1TR4A 5BXOA 3V79K 4LNUD 4GMRA 5AN8A 5KBAA 2XEEA 1SVXA 5D66A 2DZOA 1BI8B 4K5BA 2F37A 4HBDA 4TUMA 4DX6D 5ENQD 2ETAA 2XZDG 4HB5A 4O1PA 2L6BA 5ENOD 5KNHD 5AQAA 4Z68A 3UXGA 1MYOA 2DWZA 1IHBA 1YMPA 3D9HA 2QYJA 4F6RD 3ZNGA 1AP7A 3IXEA 3KEAA 1WG0A 2XZTG 3J5QB 1OT8A 3UTMA 4DX5D 4F1PA 4ZFHA 1OY3D 4QQIA 3V2OA 2JABA 4HRNA 3TWXA 4HRLA 4NIKA 2V5QC 3HRAA 5JA4D 5BXUA 2QC9A 3LJNA 2ZGGA 3B7BA 4HLLA 4OAVB 4K5AB 3Q9UC 3SO8A 1AWCB 4B93B 3EHRA 4N5QA 4QFVA 3EHQA 3TWQA 2PNNA 4HRMB 3W9FA 3JXJA 2Y1LE 1K1BA 5ENRD 3C5RA 3TWVA 2AJAA 4HI8A 3NOGD 5KNGA 5CECB 2B0OE 1K3ZD 3TWRA 2BKGA 2V4HC 5AQ7A
chains in the Genus database with same CATH superfamily
3CHMA 3ZKJA 1S70B 3Q47B 1RZ4A 3JQ0A 1MX6A 4HQDA 5ENSD 1ELRA 3Q9NC 4YDEA 5CEDB 3CVYA 4GA2A 3B7SA 1TJCA 3MA5A 3RRUA 1UJKA 5CEAA 3RIBA 2R02A 1D8DA 2V8SE 4Q96A 5AQ9A 2DYRE 2Q7FA 4BT8A 4N2SA 4PDXA 2GRRB 3GZ2A 3PZ1A 1TN6A 4GZ5A 3FFLA 3FHEA 4JW1A 2P9NG 3PE4A 1HG5A 3DSXA 4GPMA 2WXKA 3BEEA 1U3DA 4GZCA 3FUFA 1HF8A 1FVFA 2XZDG 1TNOA 4UI9C 3Q73A 4KXKB 2R2LA 3CVPA 2CHZA 5FZRA 3E4BA 2LXLA 1D8EA 2WQ7A 3I4GA 3CVVA 5ANRA 4FC8A 4K5AB 2HM8A 3FUMA 4N5QA 3ZRHA 4PUCA 1W3BA 2HO1A 3RRMB 3HXEA 3OAWA 2UWJG 3V2XA 3RSEG 3SF4A 3AS8A 5AAOA 1O1TA 4UUCA 2RD0A 2RFMA 5AARA 3E30A 3EJNA 3ZHEB 4WAFA 4WWPA 2OVFA 4W9RA 2F8XK 2YNQA 5FWQA 2P9KG 2OEWA 3TG4A 4ATZD 3NBNB 5ENPD 1EF1C 3PUJA 1TN7A 4K5CA 5CERB 2WQHA 3C72A 3RU0A 4DPRA 5FQ7A 4TV3A 3EIJA 4UWFA 1O1RA 1H2UA 4ANXA 2VSYA 4H7XA 4R7LA 1N9AA 5EYPF 3S7JA 2IO2C 4JHRA 4K03A 2R5SA 4UI9K 3V79K 3B7UX 4LNUD 4U0ZA 2AWIA 4HBDA 4U0UA 2WMOA 2DWZA 3D9HA 4BTAA 2V0PA 4I1MA 2XGOA 3FEXA 2HR2A 2JABA 1OWPA 3OXFA 1N4SA 3ASHA 4OAVB 2Y69E 4B93B 4I1OB 2OOEA 4QFVA 3C3OA 3EHQA 4BY6A 5FZQA 3L9TA 4LUNU 3G2WA 4YDOA 1WM5A 2X6KA 3L54A 2BKKB 2X38A 3CEQA 1Z3XA 1Y8MA 1TNUA 4F1SA 4ACLA 3L16A 3CSTA 1QYMA 1N11A 5B3SE 3P1UA 3DSUA 1INZA 1NZNA 1DC2A 1BLXB 5IY5E 2VTBB 4GTVA 5CBNA 4GB9A 4WNGA 4UWLA 4RVBA 1FPPA 5C1DA 1VDYA 3HIZA 2L0IA 1O5MA 3U66A 3L6AA 3ABLE 3CVXA 3LEWA 3SBSA 4RG6A 2EQXA 3UI2A 2F0YA 5AENA 1GW6A 1MZCA 3PE3A 4ILIA 1N94A 1HE8A 3AAAC 4GTTA 3DBSA 2XEEA 4J0UA 4K5BA 4TRQA 4HB5A 5ENOD 5J90A 3DSWA 1HH8A 3ULYA 4EBAG 4GCOA 1OT8A 2OCCE 2C2LA 4NIKA 2KC7A 3DWLG 3JQ1A 3AU5A 5E76A 4G24A 3FUJA 3HXBA 3PREA 2PL2A 3HDXA 2IFUA 1HU3A 2IEJA 1N54A 2LAIA 2Y4TA 3ASGA 3CLJA 4DUIA 4U0SA 2QZAA 1B89A 3SFZA 4AXHA 4U04A 1WAO1 2AXUA 1ELWA 4YDWA 5EIBE 3ENEA 1H6PA 3QWPA 4LNGA 4EQFA 1JCSA 3BG1B 3V30A 4IRUA 5B1BE 3CVLA 3NB2A 5AJDA 2JLBA 2PM7A 2CHWA 1HFAA 2RKKA 1NI1A 2WPVA 4CZ2D 1SZAA 1BU9A 2MOWA 1OUVA 4N3AA 1K8KG 2ZISA 3QKYA 5LCWC 5EIDA 4FU3A 4Q94A 4YNDA 3EDTB 4AEZC 4HOUA 4B89A 3T8KA 1BPOA 1TNZA 5CMWA 4MLPA 1N52A 4CDNA 5A6CA 3E37A 3TWUA 1JCRA 4APFA 1QNFA 1SW6A 1N0RA 4GA0A 3LYAA 3EHNA 4EPZA 3AS5A 4TUMA 4DX6D 2UY1B 4Z68A 2ZXWE 3LY9A 3IXEA 1WG0A 2MRIA 2WXIA 5KJKA 2IO3C 4JC8A 3SO8A 5G05C 4G23A 3TWQA 4ILHB 3MEKA 3CHQA 2GROB 1UJJA 3ZXPA 3LXUX 4UWGA 2DYSE 2P9PG 1KPSB 3B13A 3D9MA 3CKBA 2ILRA 3QWWA 5ITZF 4DLQA 2J9QA 3BUAA 4L9PA 5D2MC 2WM9A 3KD7A 3IKOB 1OCRE 4JD2G 4UWKA 3URZA 4G8KA 2KZTB 5DIZA 2FO1E 4AM9A 3CR3A 3FULA 2Y3AA 2LAHA 1MHQA 3VLDA 4XE0A 3NAWA 1KZOA 2FEZA 2LSUA 4BETA 4J8YA 3FTYA 3NF1A 2KM4A 3U9WA 2P2CP 4YDYA 2L0TB 4OAUC 2KXPC 4DX7D 3AU4A 4GTOA 3R7RA 5AQBA 2IJGX 3Q75A 1UN8A 3IHYA 3MZLB 3EIQC 4AOFA 2QYUA 4HVBA 4U7EB 2IU1A 3DXKG 2XCCA 1JUQA 3S7DA 5FQ6A 1Z6TA 5EKQD 2WXOA 3ZYLA 4GTMA 1V54E 5LOZA 3E34A 2ZGDA 3QDNA 3FH5A 3D9PA 4CYMD 3UPVA 1FT2A 4L2LA 4GYYA 1ZU2A 5EILA 2IOSA 3APFA 3FU3A 3TWSA 4G11A 5BV1A 2XRZA 3RJVA 3AG4E 1Y6IA 4KBQA 4JVSA 3LDZA 4JHKA 3ML8A 3PZDA 1ZBPA 3NQPA 4WWNA 1HG2A 3PEUB 3FTWA 3OXLA 2FO7A 3CHSA 3NOCD 4I17A 1K1AA 3QNKA 4XKBA 3Q7AA 4BESA 3D9KA 4ME2A 2GRPB 3JXIA 4P29A 3JUEA 5EX0A 4TUUA 3CQCB 3TJPA 4GU5A 3CK7A 4GTPA 1UW4B 5AQAA 4UI9J 3O48A 4M7CA 3UIOC 3UTMA 1E90A 3UM2A 4F1PA 4JEUA 4QQIA 4HRNA 4DJAA 3B7BA 3D3MA 4UQYA 4LERA 1JWGA 5ARFA 2XQ0A 4FHKA 4GA1A 3B95A 4G25A 3AS4A 3SNXA 2HYZA 5FINA 4LNBA 5AYWD 4BFRA 4GMLA 3DEOA 2IQCA 3MJWA 1IXVA 1OXJA 2WXHA 5KCMA 3CIAA 5CRVA 5HQ8A 1IQUA 4HNAD 4PH4B 4WUYA 2Y0BG 3ZFWA 2CFUA 3EUVA 4MKTA 4YVOA 2R05A 3QB2A 3D9IA 3ZUVB 4A3VA 3TXMA 3MYVA 4G1TA 3Q78A 5BV0A 4I9EA 4FLHA 1BI7B 2WXFA 2P9IG 1QQEA 4EZJA 3CK9A 5BXOA 5HI7A 2YQ8A 3KAEA 5CHEE 2ETAA 2XPYA 3QK0A 5FQ4A 4C0MA 4BT9A 4V3IA 2DIWA 2CG3A 1ELKA 2H6IA 2WXRA 3MV3B 3FTZA 3EHMA 4J8SA 3U3WA 4NQ0A 4JA9A 5C2YA 3Q9UC 4KVOA 2WXLA 4FJZA 4LCTA 1E8YA 2PQRA 2I1KA 1V55E 3ZN3A 5KNGA 4G26A 1KLXA 3CHRA 3DSTA 2BKGA 5A23A 4ZHBA 4AVXA 3ZIMA 2P58C 3ULEG 1FT1A 3ONLA 3L22A 5JJ6A 3T5XA 5JMND 3OTNA 2X6IA 3LVRE 4LG6A 1BD8A 1SQMA 3ONKA 5FJYA 2VGEA 5H7PA 3CV0A 1EPUA 2WXPA 2DBAA 4EZLA 3LY7A 2KATA 3GZ1A 4GAAA 2XGMA 3ZEFA 3V31A 1OWMA 3N71A 3ZVVA 3FUIA 4CEMA 1IKND 4G8LA 1Q2ZA 2VGYA 3DRAA 3ZYMA 3DSVA 5HS0A 4A1SA 3ESLA 3LVQE 4HI9A 1N4QA 2A4ZA 2LXMA 3SBTB 4KZ0A 3L17A 5BPPA 2R03A 5M72A 3EU9A 3UT7A 4X8QA 2IOLA 2WXMA 4U96D 3GYZA 1TR4A 4BX8A 5KBAA 3R7QA 3RO2A 2PZIA 2R17C 3OXGA 3UXGA 2XS8A 1MYOA 4N3BA 2H6FA 4DI3A 3ABME 4IULA 3TGOA 1OY3D 3ZXSA 4HOQA 4APOA 1UN9A 5LX8A 4HFGA 4PS8A 1SZ9A 4N2QA 3W9FA 3JXJA 4GZ6A 3HXFA 3IBEA 2AJAA 1H0AA 3CHOA 3FY4A 3FH8A 2XHEA 4DRXE 4HOTA 2AXZA 3TL5A 4O6FA 3C98A 4XI0A 2A5EA 3MGBA 5JJTA 5CMYA 3FUDA 2BTDA 3AG3E 1KT1A 3ZGQA 5J08A 2DCPA 3PUKA 3CKCA 3CSFA 2XGSA 3UT8A 1MX2A 3D9JA 4CDRA 3MKQA 4XI9A 1P5QA 1QZ2A 5LCWJ 4U8VD 4GTSA 4BERA 3T9KA 4MBGA 2VGXA 4AY5A 4F3VA 2AVPA 1OCZE 4LRZA 1HZ4A 2DZOA 3L13A 2AW6A 3PVLA 4B8AA 3PZ4A 1PY1A 2QYJA 1AP7A 4TXRA 3HXDA 4NURA 4A1GA 3Q49B 3Q79A 4TXQA 2MHKA 3BG0B 3UM0A 1L5JA 2EILE 5G05J 5BW8C 1K1BA 5CECB 2EIJE 1N0QA 5CBOA 4NACA 5HRYA 4WNFA 2B6CA 3QARA 1UOHA 4BTBA 1U3CA 1LD8A 5AIJA 2LSVA 1YA0A 4KYOB 1MX4A 4HXIA 2A5UA 4AV7A 4MRUA 3UM3A 2JEKA 3VLEA 1JCQA 2CFZA 2R59A 2PM6A 4GZDA 2GW1A 3DEPA 5ANLA 3Q5MA 2FF4A 2DVWA 4JEHA 1PC2A 1S63A 4DLOA 5KWDA 3FWVA 5EN5D 4I2WA 2XEVA 4IN3B 2F8YA 5HKPA 5ENTD 5A7DB 1OCCE 2VSNA 2WB2A 3AG2E 2EINE 2I1JA 3D9NA 2BEDA 5BT1A 2GRMA 4UQZA 2P9LG 1YMPA 3D9LA 1SA4A 3KEAA 2L6JA 4FULA 4MS6A 2WQ6A 3E32A 4EECA 1H6KA 2QC9A 2FBNA 5KJNA 3T8MA 1AWCB 3UINC 3CVQA 1H19A 4EHMA 2LNIA 4HI8A 1N4RA 1E8WA 4FLBA 4I2ZA 3ESKA 1LF8A 1TN8A 3MCXA 2XENA 2C0MA 4OVUA 3ZU7B 2HE0A 5AJLA 4GTQA 4Y6WA 3PNLB 4DI4A 1Z5SC 1EDUA 5DBKA 3FUNA 1YCSB 1A5EA 1U2VG 2VSOE 1G3NB 2FULA 4I9CA 4LEUA 2YHCA 3CVNA 3PH0C 3UM1A 3RKVA 4A3TA 2WXGA 3MV2B 1S0PA 3T5VA 4UQXA 3CQGB 4E85A 4ABNA 3U4TA 3FEYA 3QWVA 1OWLA 1N95A 4N3CA 1TNBA 1DCQA 2WVIA 3PEVB 4BSZB 3TWTA 4U8YD 1HO8A 4RSYA 3G2TA 4EBAA 4GMRA 5D66A 3PZ3A 5BNWA 2GGFA 3B7RL 5KNHD 2WMNA 5KJMA 2XZTG 3ASOE 1X81A 2NXPA 4ATGA 3C3QA 2XCBA 2VJ8A 5JA4D 3HRAA 3ASDA 4HLEA 4B94A 3G2UA 5T3RA 4IYPA 5G04J 3S7FA 3I4RB 3QOUA 4DK5A 3FTXA 3FTUA 3I3NA 4BWRA 1KT0A 4XZ4A 4FA6A 3FU5A 2V4HC 5G2NA 3QJZA 2BUGA 4XKCA 5FQ8A 4Q69A 1D9SA 4BX9A 5G04C 5LFAA 1IQRA 1UG3A 3HHMA 3PDNA 1NL4A 3HVEA 2XRYA 4EZKA 2V5FA 3UQ3A 5T4YA 4XIFA 3D9OA 4U95D 3KSQA 4KMOA 3BU8A 2LUHA 2ONDA 4KZCA 4D10C 4LSZE 4JHJA 3FH7A 4L2YA 5FZSA 3RAUA 1X5BA 5JJ7A 5B1AE 2J4DA 4I6GA 3EU5A 3IHVA 4O60A 1MQSA 3CGHA 4RQIA 4WNEA 5BUZA 2OEVA 4C0EA 3UUXA 2WXQA 4AY6A 2VYIA 3S7BA 1HX8A 3FTSA 4TXPA 3R9MA 5JHBA 3K9IA 3S2AA 3U64A 4CCAA 4AIFA 3J5QB 3LKUA 2KCVA 4HRLA 2EIKE 1XNFA 1TJFA 3ISMC 2ZGGA 3PRZA 4B0ZA 5E75A 3CHPA 4CGVA 2Y1LE 2VSXE 3TWVA 1HS6A 2WXJA 4UWHA 2KCLA 3LS8A 3L82A 1E7VA 2E2EA 4RLYA 2KBXA 4E6HA 2ZIRA 3BQOA 4GZ3A 4M3OA 4F53A 4ANWA 3UIPC 2X6HA 1NA0A 3B7TA 1NP7A 4CT0A 5KJLA 3SFYA 3J5PA 1SA5A 4OYSA 1H6OA 1H2TC 5LP0A 4J6IA 4L7TA 3LY8A 2J49A 1DVPA 3TAXA 4ILGA 4GYWA 2RG8A 3FP3A 4O1OA 5D0OD 3KEZA 3O4ZA 2J4BA 3MKRA 3KS2A 2H6GA 3UKRG 3FU0A 3TG5A 4L1BA 2NSZA 1XGWA 1SVXA 3Q15A 2F37A 3FU6A 5ENQD 3ZPJA 3ZW3A 1TYQG 1IHGA 5EDSA 4F6RD 2OVBA 4FP7A 3MKQB 2IY0C 4DX5D 4YVQC 3ZHEA 4AP2A 4RG9A 1LTXA 4HLLA 1S64A 2VGXB 3UMVA 4J8FA 3E33A 2C0LA 2PNNA 2KCKA 2P9UG 5ENRD 3C5RA 3ASNE 4FADA 3PZ2A 5FTPA 3TWRA 5AQ7A 3FDHA 2X6FA 4WNDA 3F6QA 4ANVA 2CHXA 2GRNB 4I1AA 3LCAA 3UKUG 4I43A 3FTVA 3W9GA 2X3MA 4GPKA 1E96B 4A63B 2DZNA 4DX1A 4C48B 4JZYA 4K0RA 5FT9A 1IYGA 1WDYA 3JYSA 1NA3A 4N5CA 4CT4A 1N4PA 4PS7A 3SZ7A 1A17A 4DX2A 1H2VC 3TXNA 3QC1A 2V4LA 1FCHA 3MX3A 3JCKC 2IF4A 5G55A 3ASFA 1QBQA 3LPZA 4XEIG 4AJWA 4O1PA 2WXNA 2J08A 3ZNGA 3SHFA 2BF0X 3WXXA 5JHAA 3V2OA 3ZYQA 3DPYA 2V5QC 3CK8A 3FUKA 4I6EA 4ACKA 5BXUA 2I6HA 2VTBA 3VTXA 4GYOA 3G2VA 3FUEA 2GRQB 2J09A 4C9BB 2Y4UA 3NOGD 3IEGA 3L08A 2LO6A 4JB8P 3APDA 3WG7E 3AJIA 2YINA 3NZUA 4OVVA 1DNPA 1E8ZA 3X2QE 4URKA 1FVHA 2OV8A 5ARGA 1LD7A 3LJ3A 3VTYA 1Z3YA 4H7YA 2E0IA 3UX4A 5FIOA 1E8XA 4GTRA 2I9CA 2P9SG 2J8SD 3R9AB 3TWWA 1JPLA 3P2BA 3PS6A 4I6JA 1MJ0A 2MYOA 3HXCA 4BEPA 4Y6CA 2L9BA 1NFIE 2ETCA 4L23A 3SQVA 4CGWA 5CCLA 2H6HA 4U07A 3ULQA 3SGHA 3VLFA 2EIME 5AN8A 1BI8B 1OWOA 3Q7FA 2L6BA 3KSLA 3PNTB 3SFXA 1TNYA 1PAQA 2PQNA 4ZFHA 3IV0A 3TWXA 4A55A 4JXTA 1RW2A 2YHEA 3LJNA 1WY6A 4HOSA 3NZSA 1E7UA 4WWOA 3EHRA 4NRHB 4J8DA 4ANUA 2B0OE 3QAQA 4CDMA 2GRLA 5EX3A 4GCNA 2ZU6B 3JUIA 2XS1A 3Q4AB 4GMJA 1ZB1A 4JPSA 2X6JA 1HXIA 3I5PA 2NC9A 2XEHA 3DXMG 3ML9A 3RK6A 5EYLA 4FJYA 2VQ2A 5CRUA 3HYMB 4KT6B 1OWNA 3ZYKA 4HORA 2UY1A 3GW4A 4PS3A 3C3RA 1YYHA 4B8CB 3SI5A 2M63A 4J7WA 2NYJA 3SY2A 3DSSA 1JWFA 1O1SA 2RFAA 4FHJA 3UT4A 2ETBA 3HG0D 3HVEB 4N39A 3RRNB 3CVUA 2XPIA 3ABKE 2FI7A 4BSXA 5D0QD 4JA7A 3CVWA 3APCA 2QY7A 4U63A 4HS2A 2J07A 4F7AA 1KZPA 1OCOE 4JL0A 4U8HA 2I2OA 1IHBA 3GZSA 4KVMA 1TEZA 2CG2A 3FUHA 3AG1E 4XX5A 2KZTA 4G2VA 2XPZA 1DCEA 2QFCA 4CRWA 3SD5A 5CCMA 3G2SA 2AXVA 5T8IA 4HRMB 2IONA 5ENNA 3DPDA 4J8EA 1EYHA 3RO3A 1K3ZD
chains in the Genus database with same CATH topology
2BKKB 2ZGDA 3ZKJA 4ZHBA 1S70B 1N0QA 3B95A 4JB8P 3V2XA 2XENA 4CYMD 4DUIA 5AAOA 5CBOA 3AJIA 1MX6A 4HQDA 5ENSD 3ZU7B 3F6QA 2HE0A 3Q9NC 5HRYA 4UUCA 4DRXE 5CEDB 4RLYA 5JMND 2RFMA 2KBXA 1UOHA 1D9SA 5ITZF 5AARA 4LG6A 4YDWA 5FINA 1BD8A 1QYMA 5EIBE 5CEAA 1N11A 5EILA 1YCSB 1A5EA 2VGEA 2XEHA 2A5EA 1DC2A 3DEOA 3TWSA 1MX4A 5EYLA 2F8XK 1IXVA 1BLXB 3V30A 3W9GA 4G8KA 4ATZD 3NBNB 1G3NB 5CBNA 4A63B 2DZNA 5AQ9A 5ENPD 4DX1A 2FO1E 4C48B 5FIOA 3J5PA 3V31A 4HNAD 4K5CA 5CERB 1WDYA 2J8SD 3DEPA 4CZ2D 2Y0BG 2DVWA 4BETA 1BU9A 4U95D 3TWWA 1MX2A 4J8YA 1IKND 4G8LA 5EIDA 1MJ0A 2MYOA 4U8VD 1YYHA 5HS0A 2P2CP 4LSZE 4YDYA 4BEPA 4DX2A 4BERA 3ZUVB 4HI9A 3T9KA 3UI2A 5KWDA 4O1OA 4J7WA 2NYJA 5EN5D 3T8KA 2KXPC 4OAUC 4DX7D 1NFIE 2ETCA 3NOCD 5EYPF 4GPMA 3EU9A 1K1AA 2RFAA 1DCQA 3TWUA 1BI7B 2ETBA 4BSZB 5AQBA 2F8YA 4U8YD 4O60A 5HKPA 3AAAC 3TWTA 1SW6A 3JXIA 1N0RA 3HG0D 5ENTD 4U96D 3JUEA 4BESA 1TR4A 5BXOA 3V79K 4LNUD 4GMRA 5AN8A 5KBAA 2XEEA 1SVXA 5D66A 2DZOA 1BI8B 4K5BA 2F37A 4HBDA 4TUMA 4DX6D 5ENQD 2ETAA 2XZDG 4HB5A 4O1PA 2L6BA 5ENOD 5KNHD 5AQAA 4Z68A 3UXGA 1MYOA 2DWZA 1IHBA 1YMPA 3D9HA 2QYJA 4F6RD 3ZNGA 1AP7A 3IXEA 3KEAA 1WG0A 2XZTG 3J5QB 1OT8A 3UTMA 4DX5D 4F1PA 4ZFHA 1OY3D 4QQIA 3V2OA 2JABA 4HRNA 3TWXA 4HRLA 4NIKA 2V5QC 3HRAA 5JA4D 5BXUA 2QC9A 3LJNA 2ZGGA 3B7BA 4HLLA 4OAVB 4K5AB 3Q9UC 3SO8A 1AWCB 4B93B 3EHRA 4N5QA 4QFVA 3EHQA 3TWQA 2PNNA 4HRMB 3W9FA 3JXJA 2Y1LE 1K1BA 5ENRD 3C5RA 3TWVA 2AJAA 4HI8A 3NOGD 5KNGA 5CECB 2B0OE 1K3ZD 3TWRA 2BKGA 2V4HC 5AQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKK B;  2ZGD A;  3ZKJ A;  4ZHB A;  1S70 B;  1N0Q A;  3B95 A;  4JB8 P;  3V2X A;  2XEN A;  4CYM D;  4DUI A;  5AAO A;  5CBO A;  3AJI A;  1MX6 A;  4HQD A;  5ENS D;  3ZU7 B;  3F6Q A;  2HE0 A;  3Q9N C;  5HRY A;  4UUC A;  4DRX E;  5CED B;  4RLY A;  5JMN D;  2RFM A;  2KBX A;  1UOH A;  1D9S A;  5ITZ F;  5AAR A;  4LG6 A;  4YDW A;  5FIN A;  1BD8 A;  1QYM A;  5EIB E;  5CEA A;  1N11 A;  5EIL A;  1YCS B;  1A5E A;  2VGE A;  2XEH A;  2A5E A;  1DC2 A;  3DEO A;  3TWS A;  1MX4 A;  5EYL A;  2F8X K;  1IXV A;  1BLX B;  3V30 A;  3W9G A;  4G8K A;  4ATZ D;  3NBN B;  1G3N B;  5CBN A;  4A63 B;  2DZN A;  5AQ9 A;  5ENP D;  4DX1 A;  2FO1 E;  4C48 B;  5FIO A;  3J5P A;  3V31 A;  4HNA D;  4K5C A;  5CER B;  1WDY A;  2J8S D;  3DEP A;  4CZ2 D;  2Y0B G;  2DVW A;  4BET A;  1BU9 A;  4U95 D;  3TWW A;  1MX2 A;  4J8Y A;  1IKN D;  4G8L A;  5EID A;  1MJ0 A;  2MYO A;  4U8V D;  1YYH A;  5HS0 A;  2P2C P;  4LSZ E;  4YDY A;  4BEP A;  4DX2 A;  4BER A;  3ZUV B;  4HI9 A;  3T9K A;  3UI2 A;  5KWD A;  4O1O A;  4J7W A;  2NYJ A;  5EN5 D;  3T8K A;  2KXP C;  4OAU C;  4DX7 D;  1NFI E;  2ETC A;  3NOC D;  5EYP F;  4GPM A;  3EU9 A;  1K1A A;  2RFA A;  1DCQ A;  3TWU A;  1BI7 B;  2ETB A;  4BSZ B;  5AQB A;  2F8Y A;  4U8Y D;  4O60 A;  5HKP A;  3AAA C;  3TWT A;  1SW6 A;  3JXI A;  1N0R A;  3HG0 D;  5ENT D;  4U96 D;  3JUE A;  4BES A;  1TR4 A;  5BXO A;  3V79 K;  4LNU D;  4GMR A;  5AN8 A;  5KBA A;  2XEE A;  1SVX A;  5D66 A;  2DZO A;  1BI8 B;  4K5B A;  2F37 A;  4HBD A;  4TUM A;  4DX6 D;  5ENQ D;  2ETA A;  2XZD G;  4HB5 A;  4O1P A;  2L6B A;  5ENO D;  5KNH D;  5AQA A;  4Z68 A;  3UXG A;  1MYO A;  2DWZ A;  1IHB A;  1YMP A;  3D9H A;  2QYJ A;  4F6R D;  3ZNG A;  1AP7 A;  3IXE A;  3KEA A;  1WG0 A;  2XZT G;  3J5Q B;  1OT8 A;  3UTM A;  4DX5 D;  4F1P A;  4ZFH A;  1OY3 D;  4QQI A;  3V2O A;  2JAB A;  4HRN A;  3TWX A;  4HRL A;  4NIK A;  2V5Q C;  3HRA A;  5JA4 D;  5BXU A;  2QC9 A;  3LJN A;  2ZGG A;  3B7B A;  4HLL A;  4OAV B;  4K5A B;  3Q9U C;  3SO8 A;  1AWC B;  4B93 B;  3EHR A;  4N5Q A;  4QFV A;  3EHQ A;  3TWQ A;  2PNN A;  4HRM B;  3W9F A;  3JXJ A;  2Y1L E;  1K1B A;  5ENR D;  3C5R A;  3TWV A;  2AJA A;  4HI8 A;  3NOG D;  5KNG A;  5CEC B;  2B0O E;  1K3Z D;  3TWR A;  2BKG A;  2V4H C;  5AQ7 A; 
#chains in the Genus database with same CATH topology
 3CHM A;  3ZKJ A;  1S70 B;  3Q47 B;  1RZ4 A;  3JQ0 A;  1MX6 A;  4HQD A;  5ENS D;  1ELR A;  3Q9N C;  4YDE A;  5CED B;  3CVY A;  4GA2 A;  3B7S A;  1TJC A;  3MA5 A;  3RRU A;  1UJK A;  5CEA A;  3RIB A;  2R02 A;  1D8D A;  2V8S E;  4Q96 A;  5AQ9 A;  2DYR E;  2Q7F A;  4BT8 A;  4N2S A;  4PDX A;  2GRR B;  3GZ2 A;  3PZ1 A;  1TN6 A;  4GZ5 A;  3FFL A;  3FHE A;  4JW1 A;  2P9N G;  3PE4 A;  1HG5 A;  3DSX A;  4GPM A;  2WXK A;  3BEE A;  1U3D A;  4GZC A;  3FUF A;  1HF8 A;  1FVF A;  2XZD G;  1TNO A;  4UI9 C;  3Q73 A;  4KXK B;  2R2L A;  3CVP A;  2CHZ A;  5FZR A;  3E4B A;  2LXL A;  1D8E A;  2WQ7 A;  3I4G A;  3CVV A;  5ANR A;  4FC8 A;  4K5A B;  2HM8 A;  3FUM A;  4N5Q A;  3ZRH A;  4PUC A;  1W3B A;  2HO1 A;  3RRM B;  3HXE A;  3OAW A;  2UWJ G;  3V2X A;  3RSE G;  3SF4 A;  3AS8 A;  5AAO A;  1O1T A;  4UUC A;  2RD0 A;  2RFM A;  5AAR A;  3E30 A;  3EJN A;  3ZHE B;  4WAF A;  4WWP A;  2OVF A;  4W9R A;  2F8X K;  2YNQ A;  5FWQ A;  2P9K G;  2OEW A;  3TG4 A;  4ATZ D;  3NBN B;  5ENP D;  1EF1 C;  3PUJ A;  1TN7 A;  4K5C A;  5CER B;  2WQH A;  3C72 A;  3RU0 A;  4DPR A;  5FQ7 A;  4TV3 A;  3EIJ A;  4UWF A;  1O1R A;  1H2U A;  4ANX A;  2VSY A;  4H7X A;  4R7L A;  1N9A A;  5EYP F;  3S7J A;  2IO2 C;  4JHR A;  4K03 A;  2R5S A;  4UI9 K;  3V79 K;  3B7U X;  4LNU D;  4U0Z A;  2AWI A;  4HBD A;  4U0U A;  2WMO A;  2DWZ A;  3D9H A;  4BTA A;  2V0P A;  4I1M A;  2XGO A;  3FEX A;  2HR2 A;  2JAB A;  1OWP A;  3OXF A;  1N4S A;  3ASH A;  4OAV B;  2Y69 E;  4B93 B;  4I1O B;  2OOE A;  4QFV A;  3C3O A;  3EHQ A;  4BY6 A;  5FZQ A;  3L9T A;  4LUN U;  3G2W A;  4YDO A;  1WM5 A;  2X6K A;  3L54 A;  2BKK B;  2X38 A;  3CEQ A;  1Z3X A;  1Y8M A;  1TNU A;  4F1S A;  4ACL A;  3L16 A;  3CST A;  1QYM A;  1N11 A;  5B3S E;  3P1U A;  3DSU A;  1INZ A;  1NZN A;  1DC2 A;  1BLX B;  5IY5 E;  2VTB B;  4GTV A;  5CBN A;  4GB9 A;  4WNG A;  4UWL A;  4RVB A;  1FPP A;  5C1D A;  1VDY A;  3HIZ A;  2L0I A;  1O5M A;  3U66 A;  3L6A A;  3ABL E;  3CVX A;  3LEW A;  3SBS A;  4RG6 A;  2EQX A;  3UI2 A;  2F0Y A;  5AEN A;  1GW6 A;  1MZC A;  3PE3 A;  4ILI A;  1N94 A;  1HE8 A;  3AAA C;  4GTT A;  3DBS A;  2XEE A;  4J0U A;  4K5B A;  4TRQ A;  4HB5 A;  5ENO D;  5J90 A;  3DSW A;  1HH8 A;  3ULY A;  4EBA G;  4GCO A;  1OT8 A;  2OCC E;  2C2L A;  4NIK A;  2KC7 A;  3DWL G;  3JQ1 A;  3AU5 A;  5E76 A;  4G24 A;  3FUJ A;  3HXB A;  3PRE A;  2PL2 A;  3HDX A;  2IFU A;  1HU3 A;  2IEJ A;  1N54 A;  2LAI A;  2Y4T A;  3ASG A;  3CLJ A;  4DUI A;  4U0S A;  2QZA A;  1B89 A;  3SFZ A;  4AXH A;  4U04 A;  1WAO 1;  2AXU A;  1ELW A;  4YDW A;  5EIB E;  3ENE A;  1H6P A;  3QWP A;  4LNG A;  4EQF A;  1JCS A;  3BG1 B;  3V30 A;  4IRU A;  5B1B E;  3CVL A;  3NB2 A;  5AJD A;  2JLB A;  2PM7 A;  2CHW A;  1HFA A;  2RKK A;  1NI1 A;  2WPV A;  4CZ2 D;  1SZA A;  1BU9 A;  2MOW A;  1OUV A;  4N3A A;  1K8K G;  2ZIS A;  3QKY A;  5LCW C;  5EID A;  4FU3 A;  4Q94 A;  4YND A;  3EDT B;  4AEZ C;  4HOU A;  4B89 A;  3T8K A;  1BPO A;  1TNZ A;  5CMW A;  4MLP A;  1N52 A;  4CDN A;  5A6C A;  3E37 A;  3TWU A;  1JCR A;  4APF A;  1QNF A;  1SW6 A;  1N0R A;  4GA0 A;  3LYA A;  3EHN A;  4EPZ A;  3AS5 A;  4TUM A;  4DX6 D;  2UY1 B;  4Z68 A;  2ZXW E;  3LY9 A;  3IXE A;  1WG0 A;  2MRI A;  2WXI A;  5KJK A;  2IO3 C;  4JC8 A;  3SO8 A;  5G05 C;  4G23 A;  3TWQ A;  4ILH B;  3MEK A;  3CHQ A;  2GRO B;  1UJJ A;  3ZXP A;  3LXU X;  4UWG A;  2DYS E;  2P9P G;  1KPS B;  3B13 A;  3D9M A;  3CKB A;  2ILR A;  3QWW A;  5ITZ F;  4DLQ A;  2J9Q A;  3BUA A;  4L9P A;  5D2M C;  2WM9 A;  3KD7 A;  3IKO B;  1OCR E;  4JD2 G;  4UWK A;  3URZ A;  4G8K A;  2KZT B;  5DIZ A;  2FO1 E;  4AM9 A;  3CR3 A;  3FUL A;  2Y3A A;  2LAH A;  1MHQ A;  3VLD A;  4XE0 A;  3NAW A;  1KZO A;  2FEZ A;  2LSU A;  4BET A;  4J8Y A;  3FTY A;  3NF1 A;  2KM4 A;  3U9W A;  2P2C P;  4YDY A;  2L0T B;  4OAU C;  2KXP C;  4DX7 D;  3AU4 A;  4GTO A;  3R7R A;  5AQB A;  2IJG X;  3Q75 A;  1UN8 A;  3IHY A;  3MZL B;  3EIQ C;  4AOF A;  2QYU A;  4HVB A;  4U7E B;  2IU1 A;  3DXK G;  2XCC A;  1JUQ A;  3S7D A;  5FQ6 A;  1Z6T A;  5EKQ D;  2WXO A;  3ZYL A;  4GTM A;  1V54 E;  5LOZ A;  3E34 A;  2ZGD A;  3QDN A;  3FH5 A;  3D9P A;  4CYM D;  3UPV A;  1FT2 A;  4L2L A;  4GYY A;  1ZU2 A;  5EIL A;  2IOS A;  3APF A;  3FU3 A;  3TWS A;  4G11 A;  5BV1 A;  2XRZ A;  3RJV A;  3AG4 E;  1Y6I A;  4KBQ A;  4JVS A;  3LDZ A;  4JHK A;  3ML8 A;  3PZD A;  1ZBP A;  3NQP A;  4WWN A;  1HG2 A;  3PEU B;  3FTW A;  3OXL A;  2FO7 A;  3CHS A;  3NOC D;  4I17 A;  1K1A A;  3QNK A;  4XKB A;  3Q7A A;  4BES A;  3D9K A;  4ME2 A;  2GRP B;  3JXI A;  4P29 A;  3JUE A;  5EX0 A;  4TUU A;  3CQC B;  3TJP A;  4GU5 A;  3CK7 A;  4GTP A;  1UW4 B;  5AQA A;  4UI9 J;  3O48 A;  4M7C A;  3UIO C;  3UTM A;  1E90 A;  3UM2 A;  4F1P A;  4JEU A;  4QQI A;  4HRN A;  4DJA A;  3B7B A;  3D3M A;  4UQY A;  4LER A;  1JWG A;  5ARF A;  2XQ0 A;  4FHK A;  4GA1 A;  3B95 A;  4G25 A;  3AS4 A;  3SNX A;  2HYZ A;  5FIN A;  4LNB A;  5AYW D;  4BFR A;  4GML A;  3DEO A;  2IQC A;  3MJW A;  1IXV A;  1OXJ A;  2WXH A;  5KCM A;  3CIA A;  5CRV A;  5HQ8 A;  1IQU A;  4HNA D;  4PH4 B;  4WUY A;  2Y0B G;  3ZFW A;  2CFU A;  3EUV A;  4MKT A;  4YVO A;  2R05 A;  3QB2 A;  3D9I A;  3ZUV B;  4A3V A;  3TXM A;  3MYV A;  4G1T A;  3Q78 A;  5BV0 A;  4I9E A;  4FLH A;  1BI7 B;  2WXF A;  2P9I G;  1QQE A;  4EZJ A;  3CK9 A;  5BXO A;  5HI7 A;  2YQ8 A;  3KAE A;  5CHE E;  2ETA A;  2XPY A;  3QK0 A;  5FQ4 A;  4C0M A;  4BT9 A;  4V3I A;  2DIW A;  2CG3 A;  1ELK A;  2H6I A;  2WXR A;  3MV3 B;  3FTZ A;  3EHM A;  4J8S A;  3U3W A;  4NQ0 A;  4JA9 A;  5C2Y A;  3Q9U C;  4KVO A;  2WXL A;  4FJZ A;  4LCT A;  1E8Y A;  2PQR A;  2I1K A;  1V55 E;  3ZN3 A;  5KNG A;  4G26 A;  1KLX A;  3CHR A;  3DST A;  2BKG A;  5A23 A;  4ZHB A;  4AVX A;  3ZIM A;  2P58 C;  3ULE G;  1FT1 A;  3ONL A;  3L22 A;  5JJ6 A;  3T5X A;  5JMN D;  3OTN A;  2X6I A;  3LVR E;  4LG6 A;  1BD8 A;  1SQM A;  3ONK A;  5FJY A;  2VGE A;  5H7P A;  3CV0 A;  1EPU A;  2WXP A;  2DBA A;  4EZL A;  3LY7 A;  2KAT A;  3GZ1 A;  4GAA A;  2XGM A;  3ZEF A;  3V31 A;  1OWM A;  3N71 A;  3ZVV A;  3FUI A;  4CEM A;  1IKN D;  4G8L A;  1Q2Z A;  2VGY A;  3DRA A;  3ZYM A;  3DSV A;  5HS0 A;  4A1S A;  3ESL A;  3LVQ E;  4HI9 A;  1N4Q A;  2A4Z A;  2LXM A;  3SBT B;  4KZ0 A;  3L17 A;  5BPP A;  2R03 A;  5M72 A;  3EU9 A;  3UT7 A;  4X8Q A;  2IOL A;  2WXM A;  4U96 D;  3GYZ A;  1TR4 A;  4BX8 A;  5KBA A;  3R7Q A;  3RO2 A;  2PZI A;  2R17 C;  3OXG A;  3UXG A;  2XS8 A;  1MYO A;  4N3B A;  2H6F A;  4DI3 A;  3ABM E;  4IUL A;  3TGO A;  1OY3 D;  3ZXS A;  4HOQ A;  4APO A;  1UN9 A;  5LX8 A;  4HFG A;  4PS8 A;  1SZ9 A;  4N2Q A;  3W9F A;  3JXJ A;  4GZ6 A;  3HXF A;  3IBE A;  2AJA A;  1H0A A;  3CHO A;  3FY4 A;  3FH8 A;  2XHE A;  4DRX E;  4HOT A;  2AXZ A;  3TL5 A;  4O6F A;  3C98 A;  4XI0 A;  2A5E A;  3MGB A;  5JJT A;  5CMY A;  3FUD A;  2BTD A;  3AG3 E;  1KT1 A;  3ZGQ A;  5J08 A;  2DCP A;  3PUK A;  3CKC A;  3CSF A;  2XGS A;  3UT8 A;  1MX2 A;  3D9J A;  4CDR A;  3MKQ A;  4XI9 A;  1P5Q A;  1QZ2 A;  5LCW J;  4U8V D;  4GTS A;  4BER A;  3T9K A;  4MBG A;  2VGX A;  4AY5 A;  4F3V A;  2AVP A;  1OCZ E;  4LRZ A;  1HZ4 A;  2DZO A;  3L13 A;  2AW6 A;  3PVL A;  4B8A A;  3PZ4 A;  1PY1 A;  2QYJ A;  1AP7 A;  4TXR A;  3HXD A;  4NUR A;  4A1G A;  3Q49 B;  3Q79 A;  4TXQ A;  2MHK A;  3BG0 B;  3UM0 A;  1L5J A;  2EIL E;  5G05 J;  5BW8 C;  1K1B A;  5CEC B;  2EIJ E;  1N0Q A;  5CBO A;  4NAC A;  5HRY A;  4WNF A;  2B6C A;  3QAR A;  1UOH A;  4BTB A;  1U3C A;  1LD8 A;  5AIJ A;  2LSV A;  1YA0 A;  4KYO B;  1MX4 A;  4HXI A;  2A5U A;  4AV7 A;  4MRU A;  3UM3 A;  2JEK A;  3VLE A;  1JCQ A;  2CFZ A;  2R59 A;  2PM6 A;  4GZD A;  2GW1 A;  3DEP A;  5ANL A;  3Q5M A;  2FF4 A;  2DVW A;  4JEH A;  1PC2 A;  1S63 A;  4DLO A;  5KWD A;  3FWV A;  5EN5 D;  4I2W A;  2XEV A;  4IN3 B;  2F8Y A;  5HKP A;  5ENT D;  5A7D B;  1OCC E;  2VSN A;  2WB2 A;  3AG2 E;  2EIN E;  2I1J A;  3D9N A;  2BED A;  5BT1 A;  2GRM A;  4UQZ A;  2P9L G;  1YMP A;  3D9L A;  1SA4 A;  3KEA A;  2L6J A;  4FUL A;  4MS6 A;  2WQ6 A;  3E32 A;  4EEC A;  1H6K A;  2QC9 A;  2FBN A;  5KJN A;  3T8M A;  1AWC B;  3UIN C;  3CVQ A;  1H19 A;  4EHM A;  2LNI A;  4HI8 A;  1N4R A;  1E8W A;  4FLB A;  4I2Z A;  3ESK A;  1LF8 A;  1TN8 A;  3MCX A;  2XEN A;  2C0M A;  4OVU A;  3ZU7 B;  2HE0 A;  5AJL A;  4GTQ A;  4Y6W A;  3PNL B;  4DI4 A;  1Z5S C;  1EDU A;  5DBK A;  3FUN A;  1YCS B;  1A5E A;  1U2V G;  2VSO E;  1G3N B;  2FUL A;  4I9C A;  4LEU A;  2YHC A;  3CVN A;  3PH0 C;  3UM1 A;  3RKV A;  4A3T A;  2WXG A;  3MV2 B;  1S0P A;  3T5V A;  4UQX A;  3CQG B;  4E85 A;  4ABN A;  3U4T A;  3FEY A;  3QWV A;  1OWL A;  1N95 A;  4N3C A;  1TNB A;  1DCQ A;  2WVI A;  3PEV B;  4BSZ B;  3TWT A;  4U8Y D;  1HO8 A;  4RSY A;  3G2T A;  4EBA A;  4GMR A;  5D66 A;  3PZ3 A;  5BNW A;  2GGF A;  3B7R L;  5KNH D;  2WMN A;  5KJM A;  2XZT G;  3ASO E;  1X81 A;  2NXP A;  4ATG A;  3C3Q A;  2XCB A;  2VJ8 A;  5JA4 D;  3HRA A;  3ASD A;  4HLE A;  4B94 A;  3G2U A;  5T3R A;  4IYP A;  5G04 J;  3S7F A;  3I4R B;  3QOU A;  4DK5 A;  3FTX A;  3FTU A;  3I3N A;  4BWR A;  1KT0 A;  4XZ4 A;  4FA6 A;  3FU5 A;  2V4H C;  5G2N A;  3QJZ A;  2BUG A;  4XKC A;  5FQ8 A;  4Q69 A;  1D9S A;  4BX9 A;  5G04 C;  5LFA A;  1IQR A;  1UG3 A;  3HHM A;  3PDN A;  1NL4 A;  3HVE A;  2XRY A;  4EZK A;  2V5F A;  3UQ3 A;  5T4Y A;  4XIF A;  3D9O A;  4U95 D;  3KSQ A;  4KMO A;  3BU8 A;  2LUH A;  2OND A;  4KZC A;  4D10 C;  4LSZ E;  4JHJ A;  3FH7 A;  4L2Y A;  5FZS A;  3RAU A;  1X5B A;  5JJ7 A;  5B1A E;  2J4D A;  4I6G A;  3EU5 A;  3IHV A;  4O60 A;  1MQS A;  3CGH A;  4RQI A;  4WNE A;  5BUZ A;  2OEV A;  4C0E A;  3UUX A;  2WXQ A;  4AY6 A;  2VYI A;  3S7B A;  1HX8 A;  3FTS A;  4TXP A;  3R9M A;  5JHB A;  3K9I A;  3S2A A;  3U64 A;  4CCA A;  4AIF A;  3J5Q B;  3LKU A;  2KCV A;  4HRL A;  2EIK E;  1XNF A;  1TJF A;  3ISM C;  2ZGG A;  3PRZ A;  4B0Z A;  5E75 A;  3CHP A;  4CGV A;  2Y1L E;  2VSX E;  3TWV A;  1HS6 A;  2WXJ A;  4UWH A;  2KCL A;  3LS8 A;  3L82 A;  1E7V A;  2E2E A;  4RLY A;  2KBX A;  4E6H A;  2ZIR A;  3BQO A;  4GZ3 A;  4M3O A;  4F53 A;  4ANW A;  3UIP C;  2X6H A;  1NA0 A;  3B7T A;  1NP7 A;  4CT0 A;  5KJL A;  3SFY A;  3J5P A;  1SA5 A;  4OYS A;  1H6O A;  1H2T C;  5LP0 A;  4J6I A;  4L7T A;  3LY8 A;  2J49 A;  1DVP A;  3TAX A;  4ILG A;  4GYW A;  2RG8 A;  3FP3 A;  4O1O A;  5D0O D;  3KEZ A;  3O4Z A;  2J4B A;  3MKR A;  3KS2 A;  2H6G A;  3UKR G;  3FU0 A;  3TG5 A;  4L1B A;  2NSZ A;  1XGW A;  1SVX A;  3Q15 A;  2F37 A;  3FU6 A;  5ENQ D;  3ZPJ A;  3ZW3 A;  1TYQ G;  1IHG A;  5EDS A;  4F6R D;  2OVB A;  4FP7 A;  3MKQ B;  2IY0 C;  4DX5 D;  4YVQ C;  3ZHE A;  4AP2 A;  4RG9 A;  1LTX A;  4HLL A;  1S64 A;  2VGX B;  3UMV A;  4J8F A;  3E33 A;  2C0L A;  2PNN A;  2KCK A;  2P9U G;  5ENR D;  3C5R A;  3ASN E;  4FAD A;  3PZ2 A;  5FTP A;  3TWR A;  5AQ7 A;  3FDH A;  2X6F A;  4WND A;  3F6Q A;  4ANV A;  2CHX A;  2GRN B;  4I1A A;  3LCA A;  3UKU G;  4I43 A;  3FTV A;  3W9G A;  2X3M A;  4GPK A;  1E96 B;  4A63 B;  2DZN A;  4DX1 A;  4C48 B;  4JZY A;  4K0R A;  5FT9 A;  1IYG A;  1WDY A;  3JYS A;  1NA3 A;  4N5C A;  4CT4 A;  1N4P A;  4PS7 A;  3SZ7 A;  1A17 A;  4DX2 A;  1H2V C;  3TXN A;  3QC1 A;  2V4L A;  1FCH A;  3MX3 A;  3JCK C;  2IF4 A;  5G55 A;  3ASF A;  1QBQ A;  3LPZ A;  4XEI G;  4AJW A;  4O1P A;  2WXN A;  2J08 A;  3ZNG A;  3SHF A;  2BF0 X;  3WXX A;  5JHA A;  3V2O A;  3ZYQ A;  3DPY A;  2V5Q C;  3CK8 A;  3FUK A;  4I6E A;  4ACK A;  5BXU A;  2I6H A;  2VTB A;  3VTX A;  4GYO A;  3G2V A;  3FUE A;  2GRQ B;  2J09 A;  4C9B B;  2Y4U A;  3NOG D;  3IEG A;  3L08 A;  2LO6 A;  4JB8 P;  3APD A;  3WG7 E;  3AJI A;  2YIN A;  3NZU A;  4OVV A;  1DNP A;  1E8Z A;  3X2Q E;  4URK A;  1FVH A;  2OV8 A;  5ARG A;  1LD7 A;  3LJ3 A;  3VTY A;  1Z3Y A;  4H7Y A;  2E0I A;  3UX4 A;  5FIO A;  1E8X A;  4GTR A;  2I9C A;  2P9S G;  2J8S D;  3R9A B;  3TWW A;  1JPL A;  3P2B A;  3PS6 A;  4I6J A;  1MJ0 A;  2MYO A;  3HXC A;  4BEP A;  4Y6C A;  2L9B A;  1NFI E;  2ETC A;  4L23 A;  3SQV A;  4CGW A;  5CCL A;  2H6H A;  4U07 A;  3ULQ A;  3SGH A;  3VLF A;  2EIM E;  5AN8 A;  1BI8 B;  1OWO A;  3Q7F A;  2L6B A;  3KSL A;  3PNT B;  3SFX A;  1TNY A;  1PAQ A;  2PQN A;  4ZFH A;  3IV0 A;  3TWX A;  4A55 A;  4JXT A;  1RW2 A;  2YHE A;  3LJN A;  1WY6 A;  4HOS A;  3NZS A;  1E7U A;  4WWO A;  3EHR A;  4NRH B;  4J8D A;  4ANU A;  2B0O E;  3QAQ A;  4CDM A;  2GRL A;  5EX3 A;  4GCN A;  2ZU6 B;  3JUI A;  2XS1 A;  3Q4A B;  4GMJ A;  1ZB1 A;  4JPS A;  2X6J A;  1HXI A;  3I5P A;  2NC9 A;  2XEH A;  3DXM G;  3ML9 A;  3RK6 A;  5EYL A;  4FJY A;  2VQ2 A;  5CRU A;  3HYM B;  4KT6 B;  1OWN A;  3ZYK A;  4HOR A;  2UY1 A;  3GW4 A;  4PS3 A;  3C3R A;  1YYH A;  4B8C B;  3SI5 A;  2M63 A;  4J7W A;  2NYJ A;  3SY2 A;  3DSS A;  1JWF A;  1O1S A;  2RFA A;  4FHJ A;  3UT4 A;  2ETB A;  3HG0 D;  3HVE B;  4N39 A;  3RRN B;  3CVU A;  2XPI A;  3ABK E;  2FI7 A;  4BSX A;  5D0Q D;  4JA7 A;  3CVW A;  3APC A;  2QY7 A;  4U63 A;  4HS2 A;  2J07 A;  4F7A A;  1KZP A;  1OCO E;  4JL0 A;  4U8H A;  2I2O A;  1IHB A;  3GZS A;  4KVM A;  1TEZ A;  2CG2 A;  3FUH A;  3AG1 E;  4XX5 A;  2KZT A;  4G2V A;  2XPZ A;  1DCE A;  2QFC A;  4CRW A;  3SD5 A;  5CCM A;  3G2S A;  2AXV A;  5T8I A;  4HRM B;  2ION A;  5ENN A;  3DPD A;  4J8E A;  1EYH A;  3RO3 A;  1K3Z D; 
#chains in the Genus database with same CATH homology
 2BKK B;  2ZGD A;  3ZKJ A;  4ZHB A;  1S70 B;  1N0Q A;  3B95 A;  4JB8 P;  3V2X A;  2XEN A;  4CYM D;  4DUI A;  5AAO A;  5CBO A;  3AJI A;  1MX6 A;  4HQD A;  5ENS D;  3ZU7 B;  3F6Q A;  2HE0 A;  3Q9N C;  5HRY A;  4UUC A;  4DRX E;  5CED B;  4RLY A;  5JMN D;  2RFM A;  2KBX A;  1UOH A;  1D9S A;  5ITZ F;  5AAR A;  4LG6 A;  4YDW A;  5FIN A;  1BD8 A;  1QYM A;  5EIB E;  5CEA A;  1N11 A;  5EIL A;  1YCS B;  1A5E A;  2VGE A;  2XEH A;  2A5E A;  1DC2 A;  3DEO A;  3TWS A;  1MX4 A;  5EYL A;  2F8X K;  1IXV A;  1BLX B;  3V30 A;  3W9G A;  4G8K A;  4ATZ D;  3NBN B;  1G3N B;  5CBN A;  4A63 B;  2DZN A;  5AQ9 A;  5ENP D;  4DX1 A;  2FO1 E;  4C48 B;  5FIO A;  3J5P A;  3V31 A;  4HNA D;  4K5C A;  5CER B;  1WDY A;  2J8S D;  3DEP A;  4CZ2 D;  2Y0B G;  2DVW A;  4BET A;  1BU9 A;  4U95 D;  3TWW A;  1MX2 A;  4J8Y A;  1IKN D;  4G8L A;  5EID A;  1MJ0 A;  2MYO A;  4U8V D;  1YYH A;  5HS0 A;  2P2C P;  4LSZ E;  4YDY A;  4BEP A;  4DX2 A;  4BER A;  3ZUV B;  4HI9 A;  3T9K A;  3UI2 A;  5KWD A;  4O1O A;  4J7W A;  2NYJ A;  5EN5 D;  3T8K A;  2KXP C;  4OAU C;  4DX7 D;  1NFI E;  2ETC A;  3NOC D;  5EYP F;  4GPM A;  3EU9 A;  1K1A A;  2RFA A;  1DCQ A;  3TWU A;  1BI7 B;  2ETB A;  4BSZ B;  5AQB A;  2F8Y A;  4U8Y D;  4O60 A;  5HKP A;  3AAA C;  3TWT A;  1SW6 A;  3JXI A;  1N0R A;  3HG0 D;  5ENT D;  4U96 D;  3JUE A;  4BES A;  1TR4 A;  5BXO A;  3V79 K;  4LNU D;  4GMR A;  5AN8 A;  5KBA A;  2XEE A;  1SVX A;  5D66 A;  2DZO A;  1BI8 B;  4K5B A;  2F37 A;  4HBD A;  4TUM A;  4DX6 D;  5ENQ D;  2ETA A;  2XZD G;  4HB5 A;  4O1P A;  2L6B A;  5ENO D;  5KNH D;  5AQA A;  4Z68 A;  3UXG A;  1MYO A;  2DWZ A;  1IHB A;  1YMP A;  3D9H A;  2QYJ A;  4F6R D;  3ZNG A;  1AP7 A;  3IXE A;  3KEA A;  1WG0 A;  2XZT G;  3J5Q B;  1OT8 A;  3UTM A;  4DX5 D;  4F1P A;  4ZFH A;  1OY3 D;  4QQI A;  3V2O A;  2JAB A;  4HRN A;  3TWX A;  4HRL A;  4NIK A;  2V5Q C;  3HRA A;  5JA4 D;  5BXU A;  2QC9 A;  3LJN A;  2ZGG A;  3B7B A;  4HLL A;  4OAV B;  4K5A B;  3Q9U C;  3SO8 A;  1AWC B;  4B93 B;  3EHR A;  4N5Q A;  4QFV A;  3EHQ A;  3TWQ A;  2PNN A;  4HRM B;  3W9F A;  3JXJ A;  2Y1L E;  1K1B A;  5ENR D;  3C5R A;  3TWV A;  2AJA A;  4HI8 A;  3NOG D;  5KNG A;  5CEC B;  2B0O E;  1K3Z D;  3TWR A;  2BKG A;  2V4H C;  5AQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...