3TWSA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human terf1 (chimeric peptide)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twsA00
1WDYA 3TWUA 3ZUVB 2ETBA 4LG6A 4LNUD 2J8SD 4DX1A 4F1PA 4YDYA 1K3ZD 3TWSA 4DRXE 2ZGDA 4UUCA 3Q9NC 3ZNGA 2RFMA 3C5RA 1BD8A 2MYOA 2DZOA 3UXGA 4G8KA 4B93B 1D9SA 5CBNA 2VGEA 4YDWA 3V2OA 2F37A 4U8YD 1DCQA 4ATZD 4BESA 1WG0A 2PNNA 2QC9A 5EYPF 5FINA 2XEHA 2HE0A 5EYLA 1AWCB 2XENA 3JXIA 3DEOA 5EIBE 1NFIE 3T8KA 1OT8A 3V30A 1SVXA 4N5QA 4ZFHA 2JABA 4OAVB 4LSZE 5D66A 4HBDA 3D9HA 1N11A 3UTMA 4G8LA 2KBXA 4CYMD 5BXOA 1MX4A 5KWDA 2F8YA 3LJNA 3KEAA 3TWWA 4O1OA 1OY3D 4DX7D 2AJAA 2DVWA 3ZKJA 3IXEA 1BI8B 3J5QB 4O1PA 4QFVA 4DUIA 2F8XK 2XZDG 5CERB 5ITZF 4HRLA 5EN5D 3AAAC 4Z68A 3W9GA 4TUMA 4U8VD 2Y1LE 3W9FA 5AQAA 5CECB 5JMND 3B7BA 1IXVA 1TR4A 4BEPA 2FO1E 4HB5A 2A5EA 3JXJA 1BI7B 5FIOA 5ENSD 4HI8A 5ENRD 5CEDB 4JB8P 2L6BA 4HNAD 3TWVA 1UOHA 4HQDA 4DX6D 2ETAA 5KNGA 5ENTD 4HI9A 5HKPA 2QYJA 2DWZA 2XEEA 3EHRA 3DEPA 1YYHA 1IHBA 4DX2A 5KNHD 1IKND 1DC2A 3EU9A 4HRMB 1N0RA 4U95D 3V31A 5EILA 4K5AB 5KBAA 3EHQA 1BLXB 1K1BA 1YMPA 3HRAA 3JUEA 3V2XA 1MX6A 5AAOA 1YCSB 2V4HC 3AJIA 4BETA 4HRNA 4BSZB 2KXPC 3UI2A 5CEAA 3F6QA 3NOCD 2NYJA 3SO8A 3TWXA 4C48B 5JA4D 4OAUC 1S70B 1QYMA 1K1AA 5AQ7A 5AQBA 4DX5D 1AP7A 4O60A 5AN8A 1MX2A 5ENOD 5ENPD 3TWRA 4K5CA 2BKGA 1N0QA 1G3NB 4GMRA 5AQ9A 5HRYA 5ENQD 2Y0BG 4BERA 4U96D 1A5EA 4ZHBA 5EIDA 4QQIA 2ETCA 3T9KA 5BXUA 3V79K 4J7WA 4CZ2D 1SW6A 4F6RD 2ZGGA 5CBOA 4J8YA 5HS0A 3B95A 3NOGD 2BKKB 3Q9UC 3ZU7B 1MYOA 2V5QC 3HG0D 3J5PA 3TWTA 3NBNB 1MJ0A 2RFAA 4NIKA 2DZNA 4HLLA 2XZTG 3TWQA 4RLYA 4A63B 4GPMA 5AARA 2P2CP 1BU9A 2B0OE 4K5BA
chains in the Genus database with same CATH superfamily
3TAXA 1KPSB 4DX1A 4F1PA 1Z5SC 4GZCA 4IYPA 2CHXA 2WXJA 2X38A 3RJVA 1U3DA 3PE4A 1AWCB 4G26A 5T8IA 1JUQA 3LS8A 2HO1A 4A3VA 3D9HA 3ZW3A 3I4RB 4GCOA 3Q47B 4FLHA 5BUZA 3I4GA 3PZ1A 4JL0A 4FU3A 4PS3A 3AS5A 4G23A 4MKTA 2HYZA 5JMND 3CVUA 4BEPA 3DWLG 2A5EA 2X6IA 4XEIG 2PQNA 2C0MA 4E6HA 1H6KA 2XEVA 3SI5A 3QB2A 3ASFA 2DWZA 2LUHA 1JPLA 4JZYA 5BNWA 3ASHA 3QC1A 1DC2A 4U7EB 2BF0X 4U0SA 2GRRB 3VLDA 4F3VA 1NL4A 3FEYA 2P9NG 1S70B 2FF4A 5AQ7A 4AVXA 2XQ0A 2IFUA 3D9PA 5CMYA 3TWRA 5A6CA 3D9LA 3ONLA 5JHBA 2XRZA 1HH8A 4CZ2D 4F6RD 4J8YA 2PZIA 3NOGD 1OUVA 2KATA 3HXDA 5LP0A 3FH5A 4URKA 3QNKA 4XI0A 4J8DA 2QZAA 4GTQA 3CHOA 4NACA 2CFZA 3O4ZA 1X81A 3OXGA 2XEHA 3V30A 4HVBA 2WXFA 4LSZE 2EINE 5A23A 1FVHA 3ZKJA 2FBNA 3CK8A 3NZSA 3SZ7A 1N94A 5G04C 3FU3A 1L5JA 1RZ4A 3JYSA 1IQUA 4UI9K 3JXJA 1BI7B 4EZKA 5FQ4A 3ULYA 2WXRA 2J07A 5HKPA 5FJYA 3ZFWA 1YYHA 3FUDA 1IKND 4BFRA 5EILA 3FEXA 4I6JA 3R9AB 3DSSA 4J8SA 4R7LA 5B1BE 1Y8MA 3BQOA 2KXPC 5JA4D 2VTBA 1K1AA 1QQEA 1HU3A 2KCLA 3I5PA 4A1GA 3ZRHA 3CVQA 1SZ9A 2GW1A 2NC9A 5HQ8A 5M72A 4U96D 3SGHA 5CMWA 3UT7A 1SQMA 3TG4A 5BV0A 3FH8A 3Q9UC 2X6HA 2V5QC 4N3BA 4OVVA 4GMLA 3UKRG 3CVXA 1S0PA 4OVUA 5BW8C 3CKCA 3U4TA 1K3ZD 3FTWA 4G11A 3L16A 4UQZA 2XCBA 3OTNA 4RG9A 3AU5A 4J6IA 2F37A 1UN9A 1WG0A 1TNOA 4LNGA 3MV3B 4ZFHA 1SVXA 3CV0A 2H6HA 5DBKA 2VYIA 5ANRA 4JA9A 3RKVA 4KBQA 2AJAA 2DVWA 5CCMA 4EPZA 4DUIA 4H7XA 4BT8A 4L2YA 2IO2C 3GZ2A 1IXVA 3MJWA 2CFUA 4HNAD 3G2TA 2PM7A 3CQCB 1P5QA 2J4BA 4RSYA 3C3RA 3LPZA 5KNHD 4ANVA 3E37A 3TXMA 1IQRA 2CG2A 3QJZA 2OV8A 4D10C 2OEVA 2A4ZA 4HRNA 3F6QA 3RRMB 2XGSA 4EQFA 4L2LA 3ZXPA 4G24A 1DVPA 1A5EA 4ILHB 2PQRA 3CKBA 3FUHA 1N4PA 4PH4B 3QDNA 1MYOA 2I6HA 4KZ0A 2AWIA 4RLYA 2ETBA 4LNUD 4ATGA 2WQHA 1DNPA 1H2TC 3CQGB 4X8QA 4IULA 1MHQA 2XPZA 2EILE 4EZJA 3ZYQA 5LFAA 4BY6A 1V54E 4PS8A 2PNNA 3ABKE 3DXMG 2ZXWE 4KMOA 1HO8A 2WPVA 3HXBA 3UMVA 2F8YA 1JWFA 2E0IA 4O1PA 3MZLB 5IY5E 4B89A 4AIFA 2LXMA 3R7QA 3W9FA 2MOWA 4WNFA 3ML9A 2FEZA 3FDHA 4KZCA 4J8EA 1E8ZA 3X2QE 1LF8A 2QYJA 3FTXA 1XNFA 1NP7A 3QARA 5AJDA 3MKRA 2R03A 3JCKC 3V31A 3LY8A 2R02A 1BPOA 4CT4A 2IO3C 1FPPA 3AJIA 3D9NA 3UI2A 3LYAA 1N4QA 2P9KG 3UKUG 4JEUA 3GZSA 3UT8A 1TNUA 2AXZA 5HRYA 4ZHBA 2BTDA 2XPIA 4GZDA 1SW6A 2C2LA 3ABLE 5LOZA 4DPRA 5FWQA 2ZISA 3FHEA 5G05C 4UQYA 1MJ0A 4HLLA 4U63A 3DRAA 3G2VA 4UUCA 1OCCE 5E76A 2AXVA 2WXOA 3Q9NC 3ZNGA 3TGOA 2GRQB 3C5RA 1BD8A 3UIOC 5CBNA 1UN8A 4GCNA 3EIJA 5G2NA 4M7CA 3RAUA 5ANLA 3D9JA 3QAQA 5AIJA 4HS2A 3AG1E 2X6JA 2V5FA 3GZ1A 2DIWA 3B7TA 3EHNA 4TXRA 2XS8A 4N5QA 4AJWA 1E7VA 4OAVB 2V0PA 3QWVA 4KVOA 5BPPA 1WY6A 2GROB 3APDA 3PDNA 4KVMA 3WXXA 2PM6A 1S64A 3PS6A 3UM2A 2IY0C 2LAHA 1U3CA 3TWVA 4H7YA 1NA0A 3AG4E 3FTUA 1Z3XA 3T5XA 5CRUA 1JCQA 4FJZA 2OCCE 2WVIA 1GW6A 4I1MA 3P2BA 4OAUC 3ABME 3WG7E 1Q2ZA 3P1UA 2ILRA 3T9KA 2UY1A 2LXLA 4Q69A 4RQIA 3SFYA 2P2CP 3ZYMA 3MKQB 4PDXA 2NXPA 3SHFA 5EX0A 2KCVA 4JHJA 2LSUA 1IYGA 4DJAA 3OAWA 3UINC 2BEDA 3SD5A 4DI4A 3C3OA 1LD8A 1NFIE 2VSXE 3G2SA 3CK7A 1H6PA 4G8LA 3QK0A 5T4YA 1SZAA 3NF1A 1PY1A 3EHMA 3HXCA 3PEVB 4FULA 1TR4A 4OYSA 1TN8A 2RD0A 4JA7A 4HQDA 1H2UA 1QBQA 5KCMA 1S63A 5C1DA 4DX2A 2MHKA 2DYRE 4U95D 2NSZA 1X5BA 2OEWA 2L0TB 3V2XA 1N95A 4JXTA 2C0LA 4GYWA 5CEAA 4XIFA 2YINA 5ENQD 3SBSA 3JUIA 3HDXA 3L08A 3CHMA 5D0OD 5B1AE 3ZU7B 3ZVVA 4NIKA 4JVSA 3VLFA 2KM4A 5AARA 2B0OE 3C3QA 4JPSA 2LAIA 4DRXE 4GZ6A 3B13A 5ENNA 3CVLA 2JEKA 3RK6A 5ARFA 3QWWA 4U8YD 3L54A 5EYLA 4U0ZA 3IV0A 4N3CA 4GTOA 3T8KA 3U66A 2AXUA 5BXOA 3UPVA 3D3MA 5KWDA 2I2OA 1INZA 3FU6A 5FZSA 3J5QB 3GW4A 4MLPA 1HE8A 2QFCA 3CHRA 3FUEA 4L7TA 4U07A 4DX6D 2ETAA 1TNYA 3UM1A 3FY4A 4L9PA 2EIME 3R7RA 1ZBPA 4K5AB 2I9CA 4Y6CA 4GPKA 3KSLA 1KLXA 4FP7A 1K8KG 4KXKB 4U0UA 3BUAA 1LD7A 4ME2A 2XS1A 1N52A 4LCTA 2ETCA 3UM3A 5G04J 4EHMA 3B95A 2OOEA 2BKKB 4HOQA 3FU5A 4BWRA 3BU8A 1MQSA 3ZHEA 4DLOA 3DBSA 2DZNA 3DPYA 2XZTG 5J08A 1BU9A 1WDYA 3ESLA 4G1TA 4YDYA 1A17A 2KZTB 2OVFA 2YQ8A 4HOUA 2F0YA 4B93B 3RRUA 4G25A 2VSYA 5E75A 3R9MA 2VSNA 1TJCA 4U04A 4UWKA 4I9EA 3FFLA 3ZYLA 3KD7A 3UX4A 2V4LA 4KT6B 4L1BA 1HXIA 4I6EA 1D8DA 2P9IG 2LSVA 3L17A 3LXUX 4DX7D 3APFA 2MRIA 4K0RA 5AENA 3ZEFA 3HVEB 2YNQA 3TG5A 5CEDB 2L0IA 2X3MA 3RRNB 2H6FA 3EHRA 4F1SA 1W3BA 1PC2A 3HXFA 3FUJA 1MZCA 1NI1A 4UI9C 1OCRE 3PNTB 4BETA 3CVYA 3EJNA 4GMRA 3URZA 3EUVA 3MX3A 3V79K 3QWPA 4APOA 3NAWA 5CBOA 3PRZA 3CSTA 4XE0A 3ULQA 2V8SE 4C9BB 3S7FA 3DSVA 2IU1A 1EPUA 1E96B 4EZLA 4HOTA 3B7SA 2GGFA 4GPMA 3APCA 3UIPC 2J8SD 1O5MA 1O1TA 3FUIA 2JLBA 3ASGA 3CK9A 2XGOA 3CSFA 4AP2A 4N39A 3LY9A 5J90A 3MGBA 3LVRE 5LCWC 5EYPF 5BV1A 4I2WA 3FP3A 2VJ8A 3ENEA 3TXNA 4CDMA 3CVVA 4GU5A 3PZ2A 3ASNE 3TWWA 4QFVA 4NRHB 1IHGA 5ITZF 4HRLA 5EN5D 5FQ7A 4GTMA 4HFGA 3W9GA 1E8XA 5T3RA 5CECB 4YDEA 1KT1A 3B7BA 3L13A 5FIOA 4YDOA 4HI8A 3FWVA 1UOHA 1H0AA 3CGHA 3S7JA 4I1OB 3ZXSA 4B8AA 1N0RA 1UJJA 3FUMA 2HR2A 5B3SE 1BLXB 3JUEA 3ASDA 4Y6WA 1Z6TA 4CT0A 4GZ5A 4UQXA 3SO8A 3PH0C 4CRWA 2P58C 1N0QA 3RU0A 2Y0BG 3FH7A 4MRUA 3SNXA 3S7DA 4FADA 3T5VA 5HS0A 2RKKA 4NURA 2J9QA 3U3WA 3CVNA 3NBNB 3NZUA 2RFAA 4B94A 2P9UG 2XCCA 1Y6IA 3KAEA 3AG2E 3TWUA 2BUGA 3FTYA 2KZTA 2RFMA 4BX8A 3IBEA 4YDWA 4APFA 1FT2A 2J09A 4ATZD 2OVBA 4BX9A 1HZ4A 3AG3E 4ANUA 3SF4A 1DCEA 4C0EA 5CRVA 3SY2A 1KZPA 5BT1A 3VTYA 3LJNA 3GYZA 3IXEA 2WXLA 4GYOA 2F8XK 3AAAC 5G05J 4WNGA 2Q7FA 2WQ6A 2WMNA 3B7UX 4WNDA 4Q96A 2L6BA 2Y4TA 4MS6A 4N2QA 4GA2A 5D0QD 1EYHA 3C98A 3DEPA 3EU9A 3UQ3A 2ONDA 4U8HA 3Q7AA 3KEZA 1JWGA 2XHEA 4B0ZA 4HOSA 3E4BA 3AS4A 4RVBA 4C48B 4DI3A 3LDZA 3EIQC 4DX5D 3QKYA 4LUNU 1ZB1A 1MX2A 3DSTA 3MA5A 5AQ9A 3KS2A 1O1SA 2VQ2A 3C72A 5EIDA 4XI9A 2YHCA 4F7AA 1HG5A 2J08A 1QZ2A 4RG6A 4WUYA 1E90A 3D9IA 2R5SA 1JCRA 4FA6A 1TYQG 1NZNA 1YA0A 3HIZA 4WWNA 3TWSA 2PL2A 2DZOA 1NA3A 2VGEA 4GTTA 3S2AA 2GRLA 4TV3A 4BESA 3E32A 1OWNA 2WXGA 3JQ0A 4UWFA 4C0MA 5EIBE 2FI7A 1HF8A 2JABA 3QOUA 3UTMA 1EDUA 1E7UA 4DK5A 2GRPB 4BTBA 2LNIA 3I3NA 3Q15A 1BI8B 3MEKA 5CERB 2DYSE 3U64A 3ZYKA 4GMJA 3VLEA 2FO1E 3LCAA 3ISMC 3Q49B 4HI9A 2J49A 3HYMB 3HXEA 5FZRA 3EHQA 3HRAA 1YMPA 3PNLB 4WNEA 5AAOA 1YCSB 5CCLA 2X6FA 1N4RA 4LNBA 4V3IA 4GA0A 2BKGA 4BERA 2R59A 4J7WA 4LRZA 3FULA 4GYYA 2QY7A 2UWJG 2IONA 3ZIMA 3LY7A 4K5BA 3IHYA 4FC8A 5JJ6A 4UWGA 4ILGA 2H6GA 5FT9A 3FU0A 3MV2B 3DSWA 2CHWA 3CR3A 2EQXA 4AM9A 4AY6A 5FTPA 5FINA 4I6GA 2XENA 2HM8A 5A7DB 2FO7A 2VGXB 3BG0B 3ZGQA 1N11A 1ELRA 4CYMD 1MX4A 1WAO1 3OXLA 4AV7A 1OY3D 4LEUA 5H7PA 2P9LG 4Z68A 3IHVA 5AQAA 2WXNA 3IEGA 2J4DA 5FZQA 3JQ1A 1O1RA 3N71A 2WXPA 3G2WA 1FVFA 2ZIRA 4A55A 3EDTB 4DLQA 3UUXA 2DCPA 4TRQA 2DBAA 3CVWA 5CHEE 5KBAA 2ZU6B 1UW4B 2H6IA 1OWMA 3PVLA 2EIJE 4XKCA 2XGMA 3FUNA 4ACKA 3PZDA 4O60A 2Y3AA 4I9CA 2ZGGA 2CG3A 3L22A 1HFAA 1QNFA 4A3TA 4CGWA 2WM9A 2WQ7A 3VTXA 4TUUA 2IOSA 1OCOE 2E2EA 1SA4A 4PS7A 1AP7A 4LG6A 1WM5A 3T8MA 2ZGDA 3EU5A 2MYOA 3UXGA 4G8KA 3FTSA 4G2VA 3AU4A 4HORA 2XPYA 2Y69E 1OWOA 5HI7A 3UM0A 1TJFA 2L9BA 3RO2A 5D66A 3CHQA 2X6KA 3MKQA 4HBDA 4HXIA 2KBXA 3SQVA 2YHEA 3PUKA 1E8YA 4WAFA 3NB2A 4WWOA 3CLJA 1Z3YA 1PAQA 2Y1LE 4GA1A 3Q7FA 2L6JA 3E30A 4JB8P 5DIZA 5KJLA 5ENTD 2A5UA 4E85A 2Y4UA 2WXMA 4A1SA 3TL5A 3DXKG 3BEEA 2R05A 5KJMA 2KC7A 1EF1C 4L23A 2V4HC 5LX8A 2IOLA 2WXKA 5AN8A 5ENPD 3PEUB 4HLEA 4I17A 3ZN3A 4AY5A 3SFZA 4J8FA 4CCAA 1D8EA 2LO6A 4W9RA 3O48A 5EDSA 1D9SA 3CHPA 1OWPA 2GRNB 4UI9J 2VSOE 1U2VG 2WXQA 3OXFA 2QC9A 2HE0A 3L82A 4GZ3A 1OT8A 2VGXA 3G2UA 3LEWA 3KEAA 1TN6A 1VDYA 2VGYA 4ACLA 1FCHA 2XZDG 1ELWA 2KCKA 4EECA 1UG3A 4UWHA 3FTZA 4TXPA 2XRYA 2P9PG 5ENSD 1H2VC 5KNGA 4ABNA 3LVQE 2XEEA 3K9IA 4FJYA 5FQ6A 5JHAA 5AYWD 4Q94A 2UY1B 4JD2G 4B8CB 4HRMB 3ONKA 5LCWJ 1KT0A 2WMOA 5JJTA 3NOCD 3IKOB 3LJ3A 3Q5MA 4AXHA 4PUCA 3TWQA 3BG1B 1KZOA 3E34A 3ULEG 2WB2A 2AW6A 1ZU2A 3D9KA 4J0UA 3J5PA 3HG0D 4LERA 4P29A 2FULA 2WXIA 3MCXA 3ZUVB 1N54A 3FUFA 2CHZA 2AVPA 3DPDA 4XKBA 4MBGA 2IQCA 3LKUA 2I1KA 2R17C 4YVOA 1H6OA 4CEMA 4FLBA 2QYUA 3JXIA 4N3AA 1LTXA 5KJKA 4AOFA 2R2LA 4JHKA 3AS8A 1FT1A 1TEZA 5EX3A 4ANXA 4EBAA 1SA5A 3CIAA 5EKQD 3L9TA 3TJPA 4XX5A 3CVPA 3HHMA 2GRMA 4GTVA 3MYVA 5ENRD 1HX8A 4IN3B 4JC8A 1OXJA 3CHSA 5G55A 1HG2A 3Q4AB 4I43A 1IHBA 4BSXA 3D9OA 3DSUA 1RW2A 3SFXA 1K1BA 3Q79A 5FQ8A 5C2YA 1MX6A 3HVEA 4IRUA 2IJGX 3PUJA 3D9MA 4FHJA 3ASOE 4TXQA 3TWXA 2B6CA 4JHRA 1UJKA 4GB9A 3RSEG 5AQBA 3PREA 1V55E 5ENOD 4K5CA 1TN7A 3Q75A 4EBAG 3UT4A 4I2ZA 5AJLA 3TWTA 3RIBA 3PZ3A 1HS6A 1N9AA 1OWLA 4ANWA 4F53A 5ARGA 4GTPA 3Q78A 2RG8A 5D2MC 4I1AA 3FUKA 3V2OA 3PE3A 1DCQA 4UWLA 3ML8A 4N2SA 4GTRA 3DSXA 4K03A 4CGVA 3Q73A 4CDNA 1E8WA 3KSQA 3DEOA 3FTVA 4NQ0A 4YNDA 2I1JA 4CDRA 4O1OA 1OCZE 1B89A 4KYOB 1TNZA 4JW1A 4TUMA 4U8VD 4GAAA 4BTAA 3E33A 1H19A 3B7RL 4M3OA 3CEQA 2P9SG 3U9WA 2IEJA 3SBTB 4ILIA 2IF4A 4YVQC 3ESKA 3S7BA 3ZHEB 1TNBA 1XGWA 4XZ4A 4BSZB 4WWPA 2WXHA 4FHKA 2NYJA 1ELKA 1QYMA 2VTBB 2M63A 2EIKE 1G3NB 3ZPJA 3L6AA 4QQIA 5BXUA 4O6FA 4AEZC 1N4SA 4JEHA 3RO3A 5JJ7A 1JCSA 4BT9A 3NQPA 5KJNA 4GTSA 3PZ4A 4N5CA 4A63B 4HB5A
chains in the Genus database with same CATH topology
1WDYA 3TWUA 3ZUVB 2ETBA 4LG6A 4LNUD 2J8SD 4DX1A 4F1PA 4YDYA 1K3ZD 3TWSA 4DRXE 2ZGDA 4UUCA 3Q9NC 3ZNGA 2RFMA 3C5RA 1BD8A 2MYOA 2DZOA 3UXGA 4G8KA 4B93B 1D9SA 5CBNA 2VGEA 4YDWA 3V2OA 2F37A 4U8YD 1DCQA 4ATZD 4BESA 1WG0A 2PNNA 2QC9A 5EYPF 5FINA 2XEHA 2HE0A 5EYLA 1AWCB 2XENA 3JXIA 3DEOA 5EIBE 1NFIE 3T8KA 1OT8A 3V30A 1SVXA 4N5QA 4ZFHA 2JABA 4OAVB 4LSZE 5D66A 4HBDA 3D9HA 1N11A 3UTMA 4G8LA 2KBXA 4CYMD 5BXOA 1MX4A 5KWDA 2F8YA 3LJNA 3KEAA 3TWWA 4O1OA 1OY3D 4DX7D 2AJAA 2DVWA 3ZKJA 3IXEA 1BI8B 3J5QB 4O1PA 4QFVA 4DUIA 2F8XK 2XZDG 5CERB 5ITZF 4HRLA 5EN5D 3AAAC 4Z68A 3W9GA 4TUMA 4U8VD 2Y1LE 3W9FA 5AQAA 5CECB 5JMND 3B7BA 1IXVA 1TR4A 4BEPA 2FO1E 4HB5A 2A5EA 3JXJA 1BI7B 5FIOA 5ENSD 4HI8A 5ENRD 5CEDB 4JB8P 2L6BA 4HNAD 3TWVA 1UOHA 4HQDA 4DX6D 2ETAA 5KNGA 5ENTD 4HI9A 5HKPA 2QYJA 2DWZA 2XEEA 3EHRA 3DEPA 1YYHA 1IHBA 4DX2A 5KNHD 1IKND 1DC2A 3EU9A 4HRMB 1N0RA 4U95D 3V31A 5EILA 4K5AB 5KBAA 3EHQA 1BLXB 1K1BA 1YMPA 3HRAA 3JUEA 3V2XA 1MX6A 5AAOA 1YCSB 2V4HC 3AJIA 4BETA 4HRNA 4BSZB 2KXPC 3UI2A 5CEAA 3F6QA 3NOCD 2NYJA 3SO8A 3TWXA 4C48B 5JA4D 4OAUC 1S70B 1QYMA 1K1AA 5AQ7A 5AQBA 4DX5D 1AP7A 4O60A 5AN8A 1MX2A 5ENOD 5ENPD 3TWRA 4K5CA 2BKGA 1N0QA 1G3NB 4GMRA 5AQ9A 5HRYA 5ENQD 2Y0BG 4BERA 4U96D 1A5EA 4ZHBA 5EIDA 4QQIA 2ETCA 3T9KA 5BXUA 3V79K 4J7WA 4CZ2D 1SW6A 4F6RD 2ZGGA 5CBOA 4J8YA 5HS0A 3B95A 3NOGD 2BKKB 3Q9UC 3ZU7B 1MYOA 2V5QC 3HG0D 3J5PA 3TWTA 3NBNB 1MJ0A 2RFAA 4NIKA 2DZNA 4HLLA 2XZTG 3TWQA 4RLYA 4A63B 4GPMA 5AARA 2P2CP 1BU9A 2B0OE 4K5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDY A;  3TWU A;  3ZUV B;  2ETB A;  4LG6 A;  4LNU D;  2J8S D;  4DX1 A;  4F1P A;  4YDY A;  1K3Z D;  3TWS A;  4DRX E;  2ZGD A;  4UUC A;  3Q9N C;  3ZNG A;  2RFM A;  3C5R A;  1BD8 A;  2MYO A;  2DZO A;  3UXG A;  4G8K A;  4B93 B;  1D9S A;  5CBN A;  2VGE A;  4YDW A;  3V2O A;  2F37 A;  4U8Y D;  1DCQ A;  4ATZ D;  4BES A;  1WG0 A;  2PNN A;  2QC9 A;  5EYP F;  5FIN A;  2XEH A;  2HE0 A;  5EYL A;  1AWC B;  2XEN A;  3JXI A;  3DEO A;  5EIB E;  1NFI E;  3T8K A;  1OT8 A;  3V30 A;  1SVX A;  4N5Q A;  4ZFH A;  2JAB A;  4OAV B;  4LSZ E;  5D66 A;  4HBD A;  3D9H A;  1N11 A;  3UTM A;  4G8L A;  2KBX A;  4CYM D;  5BXO A;  1MX4 A;  5KWD A;  2F8Y A;  3LJN A;  3KEA A;  3TWW A;  4O1O A;  1OY3 D;  4DX7 D;  2AJA A;  2DVW A;  3ZKJ A;  3IXE A;  1BI8 B;  3J5Q B;  4O1P A;  4QFV A;  4DUI A;  2F8X K;  2XZD G;  5CER B;  5ITZ F;  4HRL A;  5EN5 D;  3AAA C;  4Z68 A;  3W9G A;  4TUM A;  4U8V D;  2Y1L E;  3W9F A;  5AQA A;  5CEC B;  5JMN D;  3B7B A;  1IXV A;  1TR4 A;  4BEP A;  2FO1 E;  4HB5 A;  2A5E A;  3JXJ A;  1BI7 B;  5FIO A;  5ENS D;  4HI8 A;  5ENR D;  5CED B;  4JB8 P;  2L6B A;  4HNA D;  3TWV A;  1UOH A;  4HQD A;  4DX6 D;  2ETA A;  5KNG A;  5ENT D;  4HI9 A;  5HKP A;  2QYJ A;  2DWZ A;  2XEE A;  3EHR A;  3DEP A;  1YYH A;  1IHB A;  4DX2 A;  5KNH D;  1IKN D;  1DC2 A;  3EU9 A;  4HRM B;  1N0R A;  4U95 D;  3V31 A;  5EIL A;  4K5A B;  5KBA A;  3EHQ A;  1BLX B;  1K1B A;  1YMP A;  3HRA A;  3JUE A;  3V2X A;  1MX6 A;  5AAO A;  1YCS B;  2V4H C;  3AJI A;  4BET A;  4HRN A;  4BSZ B;  2KXP C;  3UI2 A;  5CEA A;  3F6Q A;  3NOC D;  2NYJ A;  3SO8 A;  3TWX A;  4C48 B;  5JA4 D;  4OAU C;  1S70 B;  1QYM A;  1K1A A;  5AQ7 A;  5AQB A;  4DX5 D;  1AP7 A;  4O60 A;  5AN8 A;  1MX2 A;  5ENO D;  5ENP D;  3TWR A;  4K5C A;  2BKG A;  1N0Q A;  1G3N B;  4GMR A;  5AQ9 A;  5HRY A;  5ENQ D;  2Y0B G;  4BER A;  4U96 D;  1A5E A;  4ZHB A;  5EID A;  4QQI A;  2ETC A;  3T9K A;  5BXU A;  3V79 K;  4J7W A;  4CZ2 D;  1SW6 A;  4F6R D;  2ZGG A;  5CBO A;  4J8Y A;  5HS0 A;  3B95 A;  3NOG D;  2BKK B;  3Q9U C;  3ZU7 B;  1MYO A;  2V5Q C;  3HG0 D;  3J5P A;  3TWT A;  3NBN B;  1MJ0 A;  2RFA A;  4NIK A;  2DZN A;  4HLL A;  2XZT G;  3TWQ A;  4RLY A;  4A63 B;  4GPM A;  5AAR A;  2P2C P;  1BU9 A;  2B0O E;  4K5B A; 
#chains in the Genus database with same CATH topology
 3TAX A;  1KPS B;  4DX1 A;  4F1P A;  1Z5S C;  4GZC A;  4IYP A;  2CHX A;  2WXJ A;  2X38 A;  3RJV A;  1U3D A;  3PE4 A;  1AWC B;  4G26 A;  5T8I A;  1JUQ A;  3LS8 A;  2HO1 A;  4A3V A;  3D9H A;  3ZW3 A;  3I4R B;  4GCO A;  3Q47 B;  4FLH A;  5BUZ A;  3I4G A;  3PZ1 A;  4JL0 A;  4FU3 A;  4PS3 A;  3AS5 A;  4G23 A;  4MKT A;  2HYZ A;  5JMN D;  3CVU A;  4BEP A;  3DWL G;  2A5E A;  2X6I A;  4XEI G;  2PQN A;  2C0M A;  4E6H A;  1H6K A;  2XEV A;  3SI5 A;  3QB2 A;  3ASF A;  2DWZ A;  2LUH A;  1JPL A;  4JZY A;  5BNW A;  3ASH A;  3QC1 A;  1DC2 A;  4U7E B;  2BF0 X;  4U0S A;  2GRR B;  3VLD A;  4F3V A;  1NL4 A;  3FEY A;  2P9N G;  1S70 B;  2FF4 A;  5AQ7 A;  4AVX A;  2XQ0 A;  2IFU A;  3D9P A;  5CMY A;  3TWR A;  5A6C A;  3D9L A;  3ONL A;  5JHB A;  2XRZ A;  1HH8 A;  4CZ2 D;  4F6R D;  4J8Y A;  2PZI A;  3NOG D;  1OUV A;  2KAT A;  3HXD A;  5LP0 A;  3FH5 A;  4URK A;  3QNK A;  4XI0 A;  4J8D A;  2QZA A;  4GTQ A;  3CHO A;  4NAC A;  2CFZ A;  3O4Z A;  1X81 A;  3OXG A;  2XEH A;  3V30 A;  4HVB A;  2WXF A;  4LSZ E;  2EIN E;  5A23 A;  1FVH A;  3ZKJ A;  2FBN A;  3CK8 A;  3NZS A;  3SZ7 A;  1N94 A;  5G04 C;  3FU3 A;  1L5J A;  1RZ4 A;  3JYS A;  1IQU A;  4UI9 K;  3JXJ A;  1BI7 B;  4EZK A;  5FQ4 A;  3ULY A;  2WXR A;  2J07 A;  5HKP A;  5FJY A;  3ZFW A;  1YYH A;  3FUD A;  1IKN D;  4BFR A;  5EIL A;  3FEX A;  4I6J A;  3R9A B;  3DSS A;  4J8S A;  4R7L A;  5B1B E;  1Y8M A;  3BQO A;  2KXP C;  5JA4 D;  2VTB A;  1K1A A;  1QQE A;  1HU3 A;  2KCL A;  3I5P A;  4A1G A;  3ZRH A;  3CVQ A;  1SZ9 A;  2GW1 A;  2NC9 A;  5HQ8 A;  5M72 A;  4U96 D;  3SGH A;  5CMW A;  3UT7 A;  1SQM A;  3TG4 A;  5BV0 A;  3FH8 A;  3Q9U C;  2X6H A;  2V5Q C;  4N3B A;  4OVV A;  4GML A;  3UKR G;  3CVX A;  1S0P A;  4OVU A;  5BW8 C;  3CKC A;  3U4T A;  1K3Z D;  3FTW A;  4G11 A;  3L16 A;  4UQZ A;  2XCB A;  3OTN A;  4RG9 A;  3AU5 A;  4J6I A;  2F37 A;  1UN9 A;  1WG0 A;  1TNO A;  4LNG A;  3MV3 B;  4ZFH A;  1SVX A;  3CV0 A;  2H6H A;  5DBK A;  2VYI A;  5ANR A;  4JA9 A;  3RKV A;  4KBQ A;  2AJA A;  2DVW A;  5CCM A;  4EPZ A;  4DUI A;  4H7X A;  4BT8 A;  4L2Y A;  2IO2 C;  3GZ2 A;  1IXV A;  3MJW A;  2CFU A;  4HNA D;  3G2T A;  2PM7 A;  3CQC B;  1P5Q A;  2J4B A;  4RSY A;  3C3R A;  3LPZ A;  5KNH D;  4ANV A;  3E37 A;  3TXM A;  1IQR A;  2CG2 A;  3QJZ A;  2OV8 A;  4D10 C;  2OEV A;  2A4Z A;  4HRN A;  3F6Q A;  3RRM B;  2XGS A;  4EQF A;  4L2L A;  3ZXP A;  4G24 A;  1DVP A;  1A5E A;  4ILH B;  2PQR A;  3CKB A;  3FUH A;  1N4P A;  4PH4 B;  3QDN A;  1MYO A;  2I6H A;  4KZ0 A;  2AWI A;  4RLY A;  2ETB A;  4LNU D;  4ATG A;  2WQH A;  1DNP A;  1H2T C;  3CQG B;  4X8Q A;  4IUL A;  1MHQ A;  2XPZ A;  2EIL E;  4EZJ A;  3ZYQ A;  5LFA A;  4BY6 A;  1V54 E;  4PS8 A;  2PNN A;  3ABK E;  3DXM G;  2ZXW E;  4KMO A;  1HO8 A;  2WPV A;  3HXB A;  3UMV A;  2F8Y A;  1JWF A;  2E0I A;  4O1P A;  3MZL B;  5IY5 E;  4B89 A;  4AIF A;  2LXM A;  3R7Q A;  3W9F A;  2MOW A;  4WNF A;  3ML9 A;  2FEZ A;  3FDH A;  4KZC A;  4J8E A;  1E8Z A;  3X2Q E;  1LF8 A;  2QYJ A;  3FTX A;  1XNF A;  1NP7 A;  3QAR A;  5AJD A;  3MKR A;  2R03 A;  3JCK C;  3V31 A;  3LY8 A;  2R02 A;  1BPO A;  4CT4 A;  2IO3 C;  1FPP A;  3AJI A;  3D9N A;  3UI2 A;  3LYA A;  1N4Q A;  2P9K G;  3UKU G;  4JEU A;  3GZS A;  3UT8 A;  1TNU A;  2AXZ A;  5HRY A;  4ZHB A;  2BTD A;  2XPI A;  4GZD A;  1SW6 A;  2C2L A;  3ABL E;  5LOZ A;  4DPR A;  5FWQ A;  2ZIS A;  3FHE A;  5G05 C;  4UQY A;  1MJ0 A;  4HLL A;  4U63 A;  3DRA A;  3G2V A;  4UUC A;  1OCC E;  5E76 A;  2AXV A;  2WXO A;  3Q9N C;  3ZNG A;  3TGO A;  2GRQ B;  3C5R A;  1BD8 A;  3UIO C;  5CBN A;  1UN8 A;  4GCN A;  3EIJ A;  5G2N A;  4M7C A;  3RAU A;  5ANL A;  3D9J A;  3QAQ A;  5AIJ A;  4HS2 A;  3AG1 E;  2X6J A;  2V5F A;  3GZ1 A;  2DIW A;  3B7T A;  3EHN A;  4TXR A;  2XS8 A;  4N5Q A;  4AJW A;  1E7V A;  4OAV B;  2V0P A;  3QWV A;  4KVO A;  5BPP A;  1WY6 A;  2GRO B;  3APD A;  3PDN A;  4KVM A;  3WXX A;  2PM6 A;  1S64 A;  3PS6 A;  3UM2 A;  2IY0 C;  2LAH A;  1U3C A;  3TWV A;  4H7Y A;  1NA0 A;  3AG4 E;  3FTU A;  1Z3X A;  3T5X A;  5CRU A;  1JCQ A;  4FJZ A;  2OCC E;  2WVI A;  1GW6 A;  4I1M A;  3P2B A;  4OAU C;  3ABM E;  3WG7 E;  1Q2Z A;  3P1U A;  2ILR A;  3T9K A;  2UY1 A;  2LXL A;  4Q69 A;  4RQI A;  3SFY A;  2P2C P;  3ZYM A;  3MKQ B;  4PDX A;  2NXP A;  3SHF A;  5EX0 A;  2KCV A;  4JHJ A;  2LSU A;  1IYG A;  4DJA A;  3OAW A;  3UIN C;  2BED A;  3SD5 A;  4DI4 A;  3C3O A;  1LD8 A;  1NFI E;  2VSX E;  3G2S A;  3CK7 A;  1H6P A;  4G8L A;  3QK0 A;  5T4Y A;  1SZA A;  3NF1 A;  1PY1 A;  3EHM A;  3HXC A;  3PEV B;  4FUL A;  1TR4 A;  4OYS A;  1TN8 A;  2RD0 A;  4JA7 A;  4HQD A;  1H2U A;  1QBQ A;  5KCM A;  1S63 A;  5C1D A;  4DX2 A;  2MHK A;  2DYR E;  4U95 D;  2NSZ A;  1X5B A;  2OEW A;  2L0T B;  3V2X A;  1N95 A;  4JXT A;  2C0L A;  4GYW A;  5CEA A;  4XIF A;  2YIN A;  5ENQ D;  3SBS A;  3JUI A;  3HDX A;  3L08 A;  3CHM A;  5D0O D;  5B1A E;  3ZU7 B;  3ZVV A;  4NIK A;  4JVS A;  3VLF A;  2KM4 A;  5AAR A;  2B0O E;  3C3Q A;  4JPS A;  2LAI A;  4DRX E;  4GZ6 A;  3B13 A;  5ENN A;  3CVL A;  2JEK A;  3RK6 A;  5ARF A;  3QWW A;  4U8Y D;  3L54 A;  5EYL A;  4U0Z A;  3IV0 A;  4N3C A;  4GTO A;  3T8K A;  3U66 A;  2AXU A;  5BXO A;  3UPV A;  3D3M A;  5KWD A;  2I2O A;  1INZ A;  3FU6 A;  5FZS A;  3J5Q B;  3GW4 A;  4MLP A;  1HE8 A;  2QFC A;  3CHR A;  3FUE A;  4L7T A;  4U07 A;  4DX6 D;  2ETA A;  1TNY A;  3UM1 A;  3FY4 A;  4L9P A;  2EIM E;  3R7R A;  1ZBP A;  4K5A B;  2I9C A;  4Y6C A;  4GPK A;  3KSL A;  1KLX A;  4FP7 A;  1K8K G;  4KXK B;  4U0U A;  3BUA A;  1LD7 A;  4ME2 A;  2XS1 A;  1N52 A;  4LCT A;  2ETC A;  3UM3 A;  5G04 J;  4EHM A;  3B95 A;  2OOE A;  2BKK B;  4HOQ A;  3FU5 A;  4BWR A;  3BU8 A;  1MQS A;  3ZHE A;  4DLO A;  3DBS A;  2DZN A;  3DPY A;  2XZT G;  5J08 A;  1BU9 A;  1WDY A;  3ESL A;  4G1T A;  4YDY A;  1A17 A;  2KZT B;  2OVF A;  2YQ8 A;  4HOU A;  2F0Y A;  4B93 B;  3RRU A;  4G25 A;  2VSY A;  5E75 A;  3R9M A;  2VSN A;  1TJC A;  4U04 A;  4UWK A;  4I9E A;  3FFL A;  3ZYL A;  3KD7 A;  3UX4 A;  2V4L A;  4KT6 B;  4L1B A;  1HXI A;  4I6E A;  1D8D A;  2P9I G;  2LSV A;  3L17 A;  3LXU X;  4DX7 D;  3APF A;  2MRI A;  4K0R A;  5AEN A;  3ZEF A;  3HVE B;  2YNQ A;  3TG5 A;  5CED B;  2L0I A;  2X3M A;  3RRN B;  2H6F A;  3EHR A;  4F1S A;  1W3B A;  1PC2 A;  3HXF A;  3FUJ A;  1MZC A;  1NI1 A;  4UI9 C;  1OCR E;  3PNT B;  4BET A;  3CVY A;  3EJN A;  4GMR A;  3URZ A;  3EUV A;  3MX3 A;  3V79 K;  3QWP A;  4APO A;  3NAW A;  5CBO A;  3PRZ A;  3CST A;  4XE0 A;  3ULQ A;  2V8S E;  4C9B B;  3S7F A;  3DSV A;  2IU1 A;  1EPU A;  1E96 B;  4EZL A;  4HOT A;  3B7S A;  2GGF A;  4GPM A;  3APC A;  3UIP C;  2J8S D;  1O5M A;  1O1T A;  3FUI A;  2JLB A;  3ASG A;  3CK9 A;  2XGO A;  3CSF A;  4AP2 A;  4N39 A;  3LY9 A;  5J90 A;  3MGB A;  3LVR E;  5LCW C;  5EYP F;  5BV1 A;  4I2W A;  3FP3 A;  2VJ8 A;  3ENE A;  3TXN A;  4CDM A;  3CVV A;  4GU5 A;  3PZ2 A;  3ASN E;  3TWW A;  4QFV A;  4NRH B;  1IHG A;  5ITZ F;  4HRL A;  5EN5 D;  5FQ7 A;  4GTM A;  4HFG A;  3W9G A;  1E8X A;  5T3R A;  5CEC B;  4YDE A;  1KT1 A;  3B7B A;  3L13 A;  5FIO A;  4YDO A;  4HI8 A;  3FWV A;  1UOH A;  1H0A A;  3CGH A;  3S7J A;  4I1O B;  3ZXS A;  4B8A A;  1N0R A;  1UJJ A;  3FUM A;  2HR2 A;  5B3S E;  1BLX B;  3JUE A;  3ASD A;  4Y6W A;  1Z6T A;  4CT0 A;  4GZ5 A;  4UQX A;  3SO8 A;  3PH0 C;  4CRW A;  2P58 C;  1N0Q A;  3RU0 A;  2Y0B G;  3FH7 A;  4MRU A;  3SNX A;  3S7D A;  4FAD A;  3T5V A;  5HS0 A;  2RKK A;  4NUR A;  2J9Q A;  3U3W A;  3CVN A;  3NBN B;  3NZU A;  2RFA A;  4B94 A;  2P9U G;  2XCC A;  1Y6I A;  3KAE A;  3AG2 E;  3TWU A;  2BUG A;  3FTY A;  2KZT A;  2RFM A;  4BX8 A;  3IBE A;  4YDW A;  4APF A;  1FT2 A;  2J09 A;  4ATZ D;  2OVB A;  4BX9 A;  1HZ4 A;  3AG3 E;  4ANU A;  3SF4 A;  1DCE A;  4C0E A;  5CRV A;  3SY2 A;  1KZP A;  5BT1 A;  3VTY A;  3LJN A;  3GYZ A;  3IXE A;  2WXL A;  4GYO A;  2F8X K;  3AAA C;  5G05 J;  4WNG A;  2Q7F A;  2WQ6 A;  2WMN A;  3B7U X;  4WND A;  4Q96 A;  2L6B A;  2Y4T A;  4MS6 A;  4N2Q A;  4GA2 A;  5D0Q D;  1EYH A;  3C98 A;  3DEP A;  3EU9 A;  3UQ3 A;  2OND A;  4U8H A;  3Q7A A;  3KEZ A;  1JWG A;  2XHE A;  4B0Z A;  4HOS A;  3E4B A;  3AS4 A;  4RVB A;  4C48 B;  4DI3 A;  3LDZ A;  3EIQ C;  4DX5 D;  3QKY A;  4LUN U;  1ZB1 A;  1MX2 A;  3DST A;  3MA5 A;  5AQ9 A;  3KS2 A;  1O1S A;  2VQ2 A;  3C72 A;  5EID A;  4XI9 A;  2YHC A;  4F7A A;  1HG5 A;  2J08 A;  1QZ2 A;  4RG6 A;  4WUY A;  1E90 A;  3D9I A;  2R5S A;  1JCR A;  4FA6 A;  1TYQ G;  1NZN A;  1YA0 A;  3HIZ A;  4WWN A;  3TWS A;  2PL2 A;  2DZO A;  1NA3 A;  2VGE A;  4GTT A;  3S2A A;  2GRL A;  4TV3 A;  4BES A;  3E32 A;  1OWN A;  2WXG A;  3JQ0 A;  4UWF A;  4C0M A;  5EIB E;  2FI7 A;  1HF8 A;  2JAB A;  3QOU A;  3UTM A;  1EDU A;  1E7U A;  4DK5 A;  2GRP B;  4BTB A;  2LNI A;  3I3N A;  3Q15 A;  1BI8 B;  3MEK A;  5CER B;  2DYS E;  3U64 A;  3ZYK A;  4GMJ A;  3VLE A;  2FO1 E;  3LCA A;  3ISM C;  3Q49 B;  4HI9 A;  2J49 A;  3HYM B;  3HXE A;  5FZR A;  3EHQ A;  3HRA A;  1YMP A;  3PNL B;  4WNE A;  5AAO A;  1YCS B;  5CCL A;  2X6F A;  1N4R A;  4LNB A;  4V3I A;  4GA0 A;  2BKG A;  4BER A;  2R59 A;  4J7W A;  4LRZ A;  3FUL A;  4GYY A;  2QY7 A;  2UWJ G;  2ION A;  3ZIM A;  3LY7 A;  4K5B A;  3IHY A;  4FC8 A;  5JJ6 A;  4UWG A;  4ILG A;  2H6G A;  5FT9 A;  3FU0 A;  3MV2 B;  3DSW A;  2CHW A;  3CR3 A;  2EQX A;  4AM9 A;  4AY6 A;  5FTP A;  5FIN A;  4I6G A;  2XEN A;  2HM8 A;  5A7D B;  2FO7 A;  2VGX B;  3BG0 B;  3ZGQ A;  1N11 A;  1ELR A;  4CYM D;  1MX4 A;  1WAO 1;  3OXL A;  4AV7 A;  1OY3 D;  4LEU A;  5H7P A;  2P9L G;  4Z68 A;  3IHV A;  5AQA A;  2WXN A;  3IEG A;  2J4D A;  5FZQ A;  3JQ1 A;  1O1R A;  3N71 A;  2WXP A;  3G2W A;  1FVF A;  2ZIR A;  4A55 A;  3EDT B;  4DLQ A;  3UUX A;  2DCP A;  4TRQ A;  2DBA A;  3CVW A;  5CHE E;  5KBA A;  2ZU6 B;  1UW4 B;  2H6I A;  1OWM A;  3PVL A;  2EIJ E;  4XKC A;  2XGM A;  3FUN A;  4ACK A;  3PZD A;  4O60 A;  2Y3A A;  4I9C A;  2ZGG A;  2CG3 A;  3L22 A;  1HFA A;  1QNF A;  4A3T A;  4CGW A;  2WM9 A;  2WQ7 A;  3VTX A;  4TUU A;  2IOS A;  1OCO E;  2E2E A;  1SA4 A;  4PS7 A;  1AP7 A;  4LG6 A;  1WM5 A;  3T8M A;  2ZGD A;  3EU5 A;  2MYO A;  3UXG A;  4G8K A;  3FTS A;  4G2V A;  3AU4 A;  4HOR A;  2XPY A;  2Y69 E;  1OWO A;  5HI7 A;  3UM0 A;  1TJF A;  2L9B A;  3RO2 A;  5D66 A;  3CHQ A;  2X6K A;  3MKQ A;  4HBD A;  4HXI A;  2KBX A;  3SQV A;  2YHE A;  3PUK A;  1E8Y A;  4WAF A;  3NB2 A;  4WWO A;  3CLJ A;  1Z3Y A;  1PAQ A;  2Y1L E;  4GA1 A;  3Q7F A;  2L6J A;  3E30 A;  4JB8 P;  5DIZ A;  5KJL A;  5ENT D;  2A5U A;  4E85 A;  2Y4U A;  2WXM A;  4A1S A;  3TL5 A;  3DXK G;  3BEE A;  2R05 A;  5KJM A;  2KC7 A;  1EF1 C;  4L23 A;  2V4H C;  5LX8 A;  2IOL A;  2WXK A;  5AN8 A;  5ENP D;  3PEU B;  4HLE A;  4I17 A;  3ZN3 A;  4AY5 A;  3SFZ A;  4J8F A;  4CCA A;  1D8E A;  2LO6 A;  4W9R A;  3O48 A;  5EDS A;  1D9S A;  3CHP A;  1OWP A;  2GRN B;  4UI9 J;  2VSO E;  1U2V G;  2WXQ A;  3OXF A;  2QC9 A;  2HE0 A;  3L82 A;  4GZ3 A;  1OT8 A;  2VGX A;  3G2U A;  3LEW A;  3KEA A;  1TN6 A;  1VDY A;  2VGY A;  4ACL A;  1FCH A;  2XZD G;  1ELW A;  2KCK A;  4EEC A;  1UG3 A;  4UWH A;  3FTZ A;  4TXP A;  2XRY A;  2P9P G;  5ENS D;  1H2V C;  5KNG A;  4ABN A;  3LVQ E;  2XEE A;  3K9I A;  4FJY A;  5FQ6 A;  5JHA A;  5AYW D;  4Q94 A;  2UY1 B;  4JD2 G;  4B8C B;  4HRM B;  3ONK A;  5LCW J;  1KT0 A;  2WMO A;  5JJT A;  3NOC D;  3IKO B;  3LJ3 A;  3Q5M A;  4AXH A;  4PUC A;  3TWQ A;  3BG1 B;  1KZO A;  3E34 A;  3ULE G;  2WB2 A;  2AW6 A;  1ZU2 A;  3D9K A;  4J0U A;  3J5P A;  3HG0 D;  4LER A;  4P29 A;  2FUL A;  2WXI A;  3MCX A;  3ZUV B;  1N54 A;  3FUF A;  2CHZ A;  2AVP A;  3DPD A;  4XKB A;  4MBG A;  2IQC A;  3LKU A;  2I1K A;  2R17 C;  4YVO A;  1H6O A;  4CEM A;  4FLB A;  2QYU A;  3JXI A;  4N3A A;  1LTX A;  5KJK A;  4AOF A;  2R2L A;  4JHK A;  3AS8 A;  1FT1 A;  1TEZ A;  5EX3 A;  4ANX A;  4EBA A;  1SA5 A;  3CIA A;  5EKQ D;  3L9T A;  3TJP A;  4XX5 A;  3CVP A;  3HHM A;  2GRM A;  4GTV A;  3MYV A;  5ENR D;  1HX8 A;  4IN3 B;  4JC8 A;  1OXJ A;  3CHS A;  5G55 A;  1HG2 A;  3Q4A B;  4I43 A;  1IHB A;  4BSX A;  3D9O A;  3DSU A;  1RW2 A;  3SFX A;  1K1B A;  3Q79 A;  5FQ8 A;  5C2Y A;  1MX6 A;  3HVE A;  4IRU A;  2IJG X;  3PUJ A;  3D9M A;  4FHJ A;  3ASO E;  4TXQ A;  3TWX A;  2B6C A;  4JHR A;  1UJK A;  4GB9 A;  3RSE G;  5AQB A;  3PRE A;  1V55 E;  5ENO D;  4K5C A;  1TN7 A;  3Q75 A;  4EBA G;  3UT4 A;  4I2Z A;  5AJL A;  3TWT A;  3RIB A;  3PZ3 A;  1HS6 A;  1N9A A;  1OWL A;  4ANW A;  4F53 A;  5ARG A;  4GTP A;  3Q78 A;  2RG8 A;  5D2M C;  4I1A A;  3FUK A;  3V2O A;  3PE3 A;  1DCQ A;  4UWL A;  3ML8 A;  4N2S A;  4GTR A;  3DSX A;  4K03 A;  4CGV A;  3Q73 A;  4CDN A;  1E8W A;  3KSQ A;  3DEO A;  3FTV A;  4NQ0 A;  4YND A;  2I1J A;  4CDR A;  4O1O A;  1OCZ E;  1B89 A;  4KYO B;  1TNZ A;  4JW1 A;  4TUM A;  4U8V D;  4GAA A;  4BTA A;  3E33 A;  1H19 A;  3B7R L;  4M3O A;  3CEQ A;  2P9S G;  3U9W A;  2IEJ A;  3SBT B;  4ILI A;  2IF4 A;  4YVQ C;  3ESK A;  3S7B A;  3ZHE B;  1TNB A;  1XGW A;  4XZ4 A;  4BSZ B;  4WWP A;  2WXH A;  4FHK A;  2NYJ A;  1ELK A;  1QYM A;  2VTB B;  2M63 A;  2EIK E;  1G3N B;  3ZPJ A;  3L6A A;  4QQI A;  5BXU A;  4O6F A;  4AEZ C;  1N4S A;  4JEH A;  3RO3 A;  5JJ7 A;  1JCS A;  4BT9 A;  3NQP A;  5KJN A;  4GTS A;  3PZ4 A;  4N5C A;  4A63 B;  4HB5 A; 
#chains in the Genus database with same CATH homology
 1WDY A;  3TWU A;  3ZUV B;  2ETB A;  4LG6 A;  4LNU D;  2J8S D;  4DX1 A;  4F1P A;  4YDY A;  1K3Z D;  3TWS A;  4DRX E;  2ZGD A;  4UUC A;  3Q9N C;  3ZNG A;  2RFM A;  3C5R A;  1BD8 A;  2MYO A;  2DZO A;  3UXG A;  4G8K A;  4B93 B;  1D9S A;  5CBN A;  2VGE A;  4YDW A;  3V2O A;  2F37 A;  4U8Y D;  1DCQ A;  4ATZ D;  4BES A;  1WG0 A;  2PNN A;  2QC9 A;  5EYP F;  5FIN A;  2XEH A;  2HE0 A;  5EYL A;  1AWC B;  2XEN A;  3JXI A;  3DEO A;  5EIB E;  1NFI E;  3T8K A;  1OT8 A;  3V30 A;  1SVX A;  4N5Q A;  4ZFH A;  2JAB A;  4OAV B;  4LSZ E;  5D66 A;  4HBD A;  3D9H A;  1N11 A;  3UTM A;  4G8L A;  2KBX A;  4CYM D;  5BXO A;  1MX4 A;  5KWD A;  2F8Y A;  3LJN A;  3KEA A;  3TWW A;  4O1O A;  1OY3 D;  4DX7 D;  2AJA A;  2DVW A;  3ZKJ A;  3IXE A;  1BI8 B;  3J5Q B;  4O1P A;  4QFV A;  4DUI A;  2F8X K;  2XZD G;  5CER B;  5ITZ F;  4HRL A;  5EN5 D;  3AAA C;  4Z68 A;  3W9G A;  4TUM A;  4U8V D;  2Y1L E;  3W9F A;  5AQA A;  5CEC B;  5JMN D;  3B7B A;  1IXV A;  1TR4 A;  4BEP A;  2FO1 E;  4HB5 A;  2A5E A;  3JXJ A;  1BI7 B;  5FIO A;  5ENS D;  4HI8 A;  5ENR D;  5CED B;  4JB8 P;  2L6B A;  4HNA D;  3TWV A;  1UOH A;  4HQD A;  4DX6 D;  2ETA A;  5KNG A;  5ENT D;  4HI9 A;  5HKP A;  2QYJ A;  2DWZ A;  2XEE A;  3EHR A;  3DEP A;  1YYH A;  1IHB A;  4DX2 A;  5KNH D;  1IKN D;  1DC2 A;  3EU9 A;  4HRM B;  1N0R A;  4U95 D;  3V31 A;  5EIL A;  4K5A B;  5KBA A;  3EHQ A;  1BLX B;  1K1B A;  1YMP A;  3HRA A;  3JUE A;  3V2X A;  1MX6 A;  5AAO A;  1YCS B;  2V4H C;  3AJI A;  4BET A;  4HRN A;  4BSZ B;  2KXP C;  3UI2 A;  5CEA A;  3F6Q A;  3NOC D;  2NYJ A;  3SO8 A;  3TWX A;  4C48 B;  5JA4 D;  4OAU C;  1S70 B;  1QYM A;  1K1A A;  5AQ7 A;  5AQB A;  4DX5 D;  1AP7 A;  4O60 A;  5AN8 A;  1MX2 A;  5ENO D;  5ENP D;  3TWR A;  4K5C A;  2BKG A;  1N0Q A;  1G3N B;  4GMR A;  5AQ9 A;  5HRY A;  5ENQ D;  2Y0B G;  4BER A;  4U96 D;  1A5E A;  4ZHB A;  5EID A;  4QQI A;  2ETC A;  3T9K A;  5BXU A;  3V79 K;  4J7W A;  4CZ2 D;  1SW6 A;  4F6R D;  2ZGG A;  5CBO A;  4J8Y A;  5HS0 A;  3B95 A;  3NOG D;  2BKK B;  3Q9U C;  3ZU7 B;  1MYO A;  2V5Q C;  3HG0 D;  3J5P A;  3TWT A;  3NBN B;  1MJ0 A;  2RFA A;  4NIK A;  2DZN A;  4HLL A;  2XZT G;  3TWQ A;  4RLY A;  4A63 B;  4GPM A;  5AAR A;  2P2C P;  1BU9 A;  2B0O E;  4K5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...