3ESKA

Structure of hop tpr2a domain in complex with the non-cognate hsc70 peptide ligand
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
128
structure length
128
Chain Sequence
GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stress-induced-phosphoprotein 1
publication title Electrostatic interactions of Hsp-organizing protein tetratricopeptide domains with Hsp70 and Hsp90: computational analysis and protein engineering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 59
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eskA00
2YQ8A 3ZN3A 3RKVA 5JJ7A 2UY1B 2I6HA 4G23A 4I9CA 3MA5A 4N3CA 2PL2A 3MKRA 5G05C 4BT8A 3FWVA 3CKBA 2PZIA 1IHGA 4GA1A 4ME2A 3ASHA 3TG4A 1W3BA 2VGXB 2KATA 3O48A 3QWPA 4N2SA 4EQFA 3GZ2A 3CK8A 3LY9A 3K9IA 3CK9A 2UWJG 3KS2A 5DBKA 4KBQA 4CDRA 4N3BA 4N5CA 1KT0A 4JHRA 5HQ8A 4WNGA 4G25A 2MHKA 3QWVA 2XGSA 3OXFA 4Y6WA 2WPVA 3CEQA 4WNEA 4BTAA 2E2EA 4N39A 3S7BA 3PDNA 4AM9A 2Q7FA 3EDTB 4BTBA 1NA0A 3SF4A 3URZA 2P58C 4GZ5A 4GYOA 3S7DA 3IEGA 4CGVA 1ZU2A 2J9QA 4U04A 4J8FA 3Q15A 3JYSA 4UI9J 1XNFA 2AVPA 4NQ0A 3U4TA 2XEVA 1ELWA 1QZ2A 4I2WA 4I9EA 4JA7A 4RG9A 5LCWJ 3N71A 3TG5A 3E4BA 3QDNA 1TJCA 4F3VA 3ZPJA 2YHCA 2JLBA 1ZBPA 3Q5MA 4N2QA 3OXGA 5G05J 2XPIA 2XGOA 3OXLA 5KJKA 1KT1A 2OOEA 2C2LA 3QKYA 2Y4UA 2PQRA 5CCMA 5JJTA 2XGMA 2VQ2A 3ZHEA 1HZ4A 5HI7A 3HYMB 1NZNA 4GYYA 5BW8C 3MV2B 1P5QA 3AS4A 4GPKA 4UQXA 3LCAA 3S7FA 5BT1A 2KCKA 5KJMA 3ZGQA 5A6CA 2FO7A 3ZFWA 3VTYA 3CVPA 3LYAA 4UQYA 3BEEA 4WNDA 4GZ3A 4O6FA 5FJYA 5G04C 5A7DB 4W9RA 4BWRA 5KJLA 1QQEA 5KJNA 1OUVA 3CVNA 5ARFA 3PE4A 4YVOA 4U07A 4AY6A 4J8DA 3LKUA 3ESKA 3CK7A 3KD7A 2V5FA 3VTXA 4XIFA 1Y8MA 2LSVA 4G24A 4U0UA 4J0UA 3RJVA 5JJ6A 3R9AB 4U0ZA 4G2VA 3S7JA 2DBAA 2UY1A 4N3AA 1B89A 2LSUA 5EX0A 2WQHA 4GCNA 3Q4AB 3CVQA 2NC9A 4HOSA 1A17A 2IFUA 2Y4TA 3QWWA 4U0SA 3TAXA 4HORA 2VGXA 4H7XA 4UI9K 5DIZA 2XCBA 1NA3A 4I1AA 2HO1A 5C1DA 4G26A 2VYIA 4BT9A 5CHEE 4RG6A 2L6JA 2PQNA 4WNFA 5D0QD 1WAO1 3NF1A 3RO2A 3LPZA 1IYGA 4XI9A 3CVLA 2QFCA 3KAEA 4AY5A 2XCCA 3SZ7A 1KLXA 4GA2A 2GW1A 2VSYA 3CKCA 2LNIA 4I2ZA 2FI7A 3ULQA 1YA0A 5G04J 4JA9A 4GA0A 3LY8A 1FCHA 4HOUA 5AYWD 4J8EA 4KYOB 1HXIA 3AS8A 4GZ6A 3GYZA 1PC2A 4NRHB 5EX3A 4KXKB 5ARGA 3Q49B 2FEZA 3UPVA 2BUGA 3RO3A 2HYZA 3ASFA 3RIBA 4H7YA 4IN3B 2KCVA 2VSNA 1HH8A 2C0LA 2VGYA 4CGWA 3ZHEB 3ASDA 4G1TA 3RU0A 5FZRA 3U3WA 3CV0A 2FF4A 3FP3A 2KC7A 2FBNA 5M72A 4ABNA 3AS5A 4LEUA 3TGOA 5FZSA 3UQ3A 2ONDA 4JL0A 4B94A 5BNWA 5D0OD 2C0MA 2HR2A 4GCOA 4UQZA 4Y6CA 3GZ1A 3MEKA 1WM5A 3QOUA 5CCLA 5EKQD 4HOQA 5FZQA 4I17A 4A1SA 4UI9C 4APOA 4WUYA 5FTPA 4HOTA 4YNDA 5LCWC 1E96B 2KCLA 2R5SA 3PE3A 3FFLA 4AIFA 3GW4A 3MV3B 4GYWA 5FT9A 3UUXA 3LY7A 2IF4A 3WXXA 1ELRA 4XI0A 3Q47B 4YVQC 3ASGA
chains in the Genus database with same CATH superfamily
2B6CA 2ZXWE 2MYOA 3EU9A 2OEWA 2KZTA 3P1UA 4I9CA 1FPPA 4ACKA 4JEUA 3ZUVB 3B7SA 4GA1A 4ME2A 5G2NA 1OT8A 1OWPA 3TG4A 4DRXE 2R03A 4EBAA 2KATA 1BD8A 4N2SA 1HG5A 3SY2A 5CRVA 1EF1C 4X8QA 1PAQA 3LY9A 3SD5A 4P29A 2WXNA 3KS2A 3RRNB 4OAVB 4CDRA 4N3BA 5HS0A 4JHRA 5HQ8A 4FA6A 1DNPA 3B7RL 4PS8A 3OXFA 5EDSA 3CVUA 1OXJA 1L5JA 2RFAA 4WNEA 2LXMA 3LEWA 3IHYA 3CVXA 4BTAA 4B89A 2QY7A 2L0IA 3PDNA 4AM9A 3I4GA 1N94A 2WXJA 2NXPA 2P58C 3DPYA 1H6PA 2IO2C 3JQ0A 3SNXA 3NZUA 3IEGA 3PZ1A 4IULA 2PNNA 3UM1A 2IOSA 2VTBA 2AVPA 2X6JA 5IY5E 3NOCD 4JA7A 5FINA 4L23A 3FTUA 1QYMA 1OWNA 3S2AA 1X81A 3CGHA 3DSUA 4WWPA 1BPOA 5JHBA 5LX8A 1FT2A 3Q7AA 3UKUG 5AQAA 1N95A 4WAFA 2GRMA 3Q79A 1UJJA 1ZBPA 4MRUA 3T9KA 1DCEA 4N2QA 5C2YA 4GU5A 4F53A 5G05J 5AJDA 4HI8A 4XEIG 4APFA 2RKKA 2WXLA 3O4ZA 1KT1A 2JABA 5FQ6A 3JXJA 2HM8A 3CHQA 4DX2A 2CHWA 2P9LG 3IKOB 4ZFHA 3D3MA 3ZHEA 1HZ4A 3EHRA 4GYYA 3LJ3A 1HS6A 4NACA 3BUAA 3AS4A 3T8KA 3TXMA 2H6GA 4UQXA 2XRZA 1JPLA 3S7FA 4YDWA 2I2OA 2KCKA 3C5RA 1D9SA 1QNFA 3ABLE 4GZDA 2FO7A 5CMYA 3VTYA 5CRUA 4UQYA 3Q73A 4WNDA 4FU3A 1DVPA 3FH5A 4UWGA 3B7UX 3ONKA 3I3NA 3MX3A 3B95A 5B1AE 2QYUA 3TJPA 2A4ZA 2J49A 3CSFA 4DPRA 5CECB 2OVBA 2IEJA 1O1TA 5EYLA 3PE4A 2LO6A 4BFRA 4L2YA 3QB2A 4XIFA 2LSVA 2DCPA 4HLLA 4J0UA 4GAAA 5BPPA 3RJVA 5ENQD 2WXRA 4DJAA 4HQDA 4L2LA 5JMND 3PUKA 2IONA 4AEZC 4U0ZA 5J08A 2WQ6A 1E7VA 2DBAA 4LNBA 3ULYA 5KNGA 2DZNA 1V55E 3E37A 2BKGA 3X2QE 2ETCA 1S64A 5ENSD 4JW1A 5ENOD 3TAXA 4PS7A 4E6HA 3ESLA 3SBTB 2VGXA 3EHMA 4BSXA 3CHPA 5C1DA 2HO1A 2HE0A 2VYIA 4CZ2D 4BT9A 3D9LA 1TYQG 2PQNA 2WXKA 4TUMA 5AARA 4I6GA 5E76A 4FJYA 3CVLA 4FHJA 4ILHB 2ZU6B 4DI3A 3HHMA 1MX4A 3J5QB 2P9SG 1KLXA 4GA2A 4AJWA 3ZEFA 1K3ZD 1Z3YA 4WWOA 4I6JA 3GZSA 2XEEA 5G04J 4GA0A 1EYHA 1N4QA 5AYWD 4KYOB 5EX3A 1HE8A 1K8KG 2FEZA 3UPVA 3BG0B 3RIBA 4ATGA 3FULA 2VSNA 3LVQE 1EDUA 5G55A 5CBOA 1SVXA 1YYHA 4J7WA 1N9AA 2DIWA 3ZIMA 2YHEA 4EBAG 5CMWA 3LDZA 4TXRA 2X6IA 4MLPA 4ILIA 2FBNA 3TGOA 2MOWA 4JL0A 5BNWA 3AU5A 3TWSA 5D0OD 4UQZA 4ACLA 3D9KA 3GZ1A 3V2XA 4A1GA 4DLQA 5EKQD 2R02A 3HVEA 4HOQA 5FZQA 5ITZF 3UINC 3DXMG 5EN5D 2J07A 2BKKB 4JHJA 4R7LA 2KCLA 2GGFA 2R5SA 3DBSA 3PE3A 3FFLA 3FH7A 4L9PA 3GW4A 3L82A 4GYWA 4HRNA 3LY7A 1NL4A 3WXXA 1IQRA 1ELRA 3L22A 2I6HA 4KZ0A 4GTSA 4OYSA 4JD2G 3LS8A 2RD0A 3MA5A 4JC8A 3D9IA 3ULEG 4U95D 4BT8A 3FWVA 3CKBA 3PUJA 4TRQA 2CHXA 1NI1A 3SFYA 3C3QA 4GMRA 3O48A 1NP7A 3QWPA 1INZA 4A3VA 3ML9A 3GZ2A 3CK8A 4TXQA 3EUVA 3K9IA 4URKA 2QC9A 3FHEA 3Q78A 3E33A 2XS1A 4KBQA 5T8IA 4N5CA 1KT0A 3ZNGA 3U64A 3V30A 4B0ZA 3DXKG 4NIKA 1BI7B 2MHKA 1JCSA 4IRUA 3DWLG 3FTZA 3T8MA 3EHNA 4N39A 2Q7FA 2V0PA 2P9NG 1D8EA 5AENA 4ANUA 3ZYQA 5J90A 3URZA 2WVIA 3KEZA 3SF4A 2WMOA 1MHQA 4GZ5A 4GYOA 4JPSA 1D8DA 3UIOC 3CSTA 3UIPC 1AP7A 2EQXA 4LSZE 3L13A 4BY6A 3L08A 3MYVA 4U04A 4UI9J 1TEZA 3U4TA 2X6KA 2XEHA 4G11A 1DC2A 3UT4A 4I2WA 3CHMA 4I9EA 4RG9A 5LFAA 1YCSB 3N71A 4CRWA 3EIQC 3E4BA 5AJLA 4ANVA 3QDNA 3L9TA 4PH4B 4HFGA 3ZPJA 3WG7E 4XX5A 3FUDA 4I1OB 3PZDA 5AQBA 4J6IA 5FQ7A 3UT7A 2XGOA 3OXLA 4GTVA 3DSSA 2C2LA 3IBEA 4DX6D 2MRIA 2DZOA 5CCMA 2ZGGA 1DCQA 3KSLA 5HI7A 3HYMB 1NZNA 4U8HA 4B93B 1HU3A 3QNKA 2R2LA 1A5EA 3W9GA 3TWXA 4NURA 4FHKA 3BEEA 2AXZA 4O6FA 2KZTB 1MJ0A 4FC8A 4W9RA 1TJFA 1N54A 4AVXA 1Z6TA 2WQ7A 1IXVA 3T5XA 3FY4A 4JB8P 1MZCA 5ARFA 2WXGA 5D2MC 4U07A 2X38A 4AY6A 2IO3C 1N4PA 3LKUA 5B3SE 4GTOA 2GRLA 1NFIE 1X5BA 4I6EA 1JWGA 3D9PA 1Y8MA 4N5QA 1OCCE 1TN6A 2EIME 2P9KG 4JXTA 2ZIRA 5JJ6A 1N52A 3R9AB 3V2OA 2EIKE 2WM9A 3HDXA 4AXHA 3ASOE 4HVBA 2UY1A 2XPZA 1K1AA 1B89A 2LSUA 5EX0A 2P9UG 1BLXB 3FUIA 4MS6A 4GTPA 3Q4AB 2NC9A 1U3CA 1IKND 4U0SA 3PZ3A 3D9JA 3DSVA 2J8SD 3UTMA 5DIZA 2XCBA 3ZYLA 4RSYA 3ASNE 4G26A 4BSZB 3PREA 4F7AA 4RG6A 2PM6A 3Q9UC 4LNUD 4CDMA 2H6HA 3IV0A 2GRPB 2IQCA 1O1SA 3D9OA 2Y69E 4Z68A 2VTBB 3C98A 4I1MA 2CG3A 1IYGA 1HFAA 3G2SA 3B7BA 4RVBA 3KSQA 1SQMA 1AWCB 1FVHA 2VSYA 4GTTA 2LNIA 5LOZA 2FI7A 2P9IG 2V8SE 3Q9NC 3DSXA 1FT1A 3CVYA 2CFUA 3LY8A 5KCMA 4Q69A 3Q7FA 4LG6A 1HXIA 2F0YA 4NRHB 1PC2A 5ENNA 3Q49B 3ZVVA 3PNLB 2BUGA 1XGWA 3MCXA 2KCVA 1U3DA 4DLOA 4UUCA 4O60A 1HH8A 2C0LA 1UW4B 1HG2A 1K1BA 2NYJA 1TNUA 4A3TA 3FU0A 3ZHEB 4CGWA 2FO1E 5B1BE 3RU0A 2X6HA 1H19A 3OTNA 2H6IA 4A63B 3FP3A 2WXHA 5FQ8A 3CR3A 1ZB1A 4EZKA 4K5AB 4BX8A 4LEUA 4KVMA 3UQ3A 4B94A 3E32A 2HR2A 4GCOA 1OWLA 4FLBA 1WM5A 1JCQA 2XS8A 1SA4A 3JQ1A 3MJWA 4A1SA 4APOA 4LUNU 4GTMA 3U66A 4YDYA 4YNDA 4HOTA 1E96B 4ILGA 1H2TC 3SGHA 5FQ4A 3ZYKA 5FT9A 2IF4A 4EPZA 2YHCA 4CT4A 3RKVA 2QYJA 2EILE 3RAUA 3BQOA 2IY0C 3R7QA 2PL2A 5G05C 3QC1A 4CT0A 4F1SA 3C3OA 3HXFA 4L1BA 1W3BA 2VGXB 4EQFA 3ENEA 4GMJA 5DBKA 2WXQA 4F6RD 4FULA 2VJ8A 5H7PA 3QWVA 3FH8A 3LVRE 3TWWA 3QK0A 2WPVA 2ZISA 3VLDA 1H6KA 2E2EA 4BETA 4HI9A 1H2VC 2WB2A 3EDTB 4EHMA 1BU9A 1UN9A 1NA0A 3S7DA 4CGVA 2M63A 1ZU2A 2VSOE 1S63A 3FEXA 4Q94A 4PUCA 3AG4E 1FVFA 4YDEA 2AWIA 4J8FA 3FUEA 1EPUA 1XNFA 1WY6A 1N4RA 4K5CA 3R9MA 1QBQA 1ELWA 3BU8A 1TNOA 1E7UA 1IHBA 5LCWJ 4F1PA 2PM7A 3TG5A 2I1JA 4LNGA 1TJCA 3APFA 3PS6A 1OCRE 4ANXA 2ETBA 1TR4A 1MX2A 2JLBA 3FTVA 2KM4A 4HXIA 1TN7A 3Q5MA 4U7EB 4YDOA 2OEVA 3SHFA 2XPIA 5KJKA 1U2VG 3NAWA 5BV0A 1SA5A 2OOEA 2PQRA 4XZ4A 3MZLB 3FTSA 2V4HC 4GPMA 3HVEB 2L6BA 3ZW3A 5BW8C 3MV2B 4PDXA 3SO8A 3FTXA 2L0TB 3LCAA 4B8AA 3ZGQA 2OV8A 2RG8A 5A6CA 3ZFWA 3CVPA 1LD8A 2ETAA 4C9BB 1OWMA 3JXIA 3HIZA 3FUHA 4CYMD 5G04C 4BERA 5A7DB 3FUJA 4HLEA 1QQEA 3FEYA 5KJLA 3JCKC 5KJNA 3MKQA 3HXDA 5JHAA 1JWFA 2GRRB 3UKRG 3UT8A 2XRYA 1UN8A 4YVOA 5ENTD 4J8DA 1SZ9A 3TWTA 3G2TA 2QZAA 3KD7A 3D9MA 3VTXA 2J09A 5ENRD 3D9NA 4O1OA 1E8XA 3EU5A 4G24A 2DYSE 3RSEG 4BEPA 2X3MA 1MX6A 4UWKA 1OWOA 2IU1A 4O1PA 1E8YA 3S7JA 4G2VA 3B13A 2OCCE 4ANWA 4OAUC 4KVOA 2NSZA 3SBSA 3AG2E 2XQ0A 2LAIA 3CVQA 4HOSA 2IFUA 3FUFA 3QWWA 2H6FA 4UWLA 4H7XA 4UI9K 5CEAA 1TN8A 3FUNA 1RZ4A 3ZRHA 5KWDA 3B7TA 3F6QA 1NA3A 1HF8A 4I1AA 3UM0A 1Y6IA 3NBNB 2XHEA 4MBGA 2AXUA 2VGEA 4ATZD 4WNFA 3BG1B 5D0QD 1WG0A 4C48B 2IOLA 3QARA 1TNBA 3NZSA 2WXPA 2J4BA 5CERB 2QFCA 2L9BA 3KAEA 4AY5A 2WXFA 3OAWA 4DX1A 5KBAA 3E34A 3E30A 3CKCA 3ULQA 1H6OA 4AV7A 3CLJA 1YA0A 3FTWA 4XKCA 4JA9A 3DSTA 4J8EA 3PZ4A 3GYZA 3ABKE 2WXMA 2Y3AA 3AG1E 3ASFA 4XKBA 4RLYA 4H7YA 4JVSA 3SFZA 3AJIA 3G2WA 4CCAA 2LAHA 3ASDA 5A23A 3FUKA 3ZKJA 3CQCB 1N0QA 4DX7D 4EZLA 3U3WA 2R17C 3R7RA 5AQ9A 2P9PG 1IQUA 1N4SA 2KC7A 1GW6A 2LXLA 3AS5A 1OCOE 4U8VD 1E8WA 5FZSA 2WMNA 3AG3E 2B0OE 1ELKA 2GROB 4Y6CA 2VSXE 3MEKA 3RK6A 3QOUA 4JEHA 3UXGA 3ML8A 4I17A 4UI9C 3FTYA 5EIBE 1LD7A 3HXCA 5FTPA 3ISMC 4AIFA 3CQGB 3TWVA 4TXPA 2A5UA 3Q47B 4YVQC 2YQ8A 3ZN3A 5JJ7A 2UY1B 4G23A 3DRAA 4N3CA 5BXUA 2GRNB 3APDA 3MKRA 4IYPA 3V79K 4GB9A 1TNZA 2PZIA 1IHGA 1WDYA 3ASHA 4QFVA 5E75A 3RRUA 4DUIA 2XZTG 3DEPA 1KZOA 4J8YA 5LP0A 3HXEA 2F37A 3JUEA 2P2CP 2YINA 4HBDA 2BEDA 3CK9A 1KZPA 2UWJG 4ZHBA 3HRAA 3L16A 2DWZA 4Q96A 5JA4D 3HXBA 4WNGA 4G25A 1E8ZA 4LERA 3G2VA 2XGSA 1TNYA 4Y6WA 3CEQA 4RQIA 5BV1A 4MKTA 1H2UA 3TL5A 3IHVA 2YNQA 4HRMB 3MGBA 4KMOA 3S7BA 2EINE 3JUIA 1G3NB 4BTBA 2J08A 2DVWA 4HNAD 3ZXPA 3ONLA 4V3IA 5T4YA 2GRQB 1O5MA 4FJZA 2F8YA 5FIOA 4JHKA 2FULA 2J9QA 3ZYMA 4LRZA 3JYSA 4DI4A 4A55A 4NQ0A 2XEVA 4AOFA 1QZ2A 2XENA 3CHSA 1VDYA 3T5VA 3EJNA 1Z3XA 4QQIA 3UMVA 3FDHA 4B8CB 1PY1A 3NOGD 4F3VA 3NQPA 4K03A 3Q75A 5EILA 4GTRA 4J8SA 3OXGA 2AW6A 1S70B 4XE0A 4WWNA 3TXNA 3TWQA 4LCTA 3QKYA 5HRYA 4GZCA 2Y4UA 5JJTA 2XGMA 3AAAC 2VQ2A 5ENPD 2AJAA 2RFMA 4E85A 5AIJA 3VLFA 1MYOA 2R59A 2CG2A 1P5QA 4CEMA 4GPKA 3QJZA 3P2BA 2I1KA 5BT1A 4HS2A 5KJMA 2WXOA 2V4LA 3FUMA 4U63A 1JCRA 4FLHA 3LYAA 3DPDA 4HRLA 4KZCA 1N0RA 4GZ3A 5FJYA 4I43A 3FU5A 3IXEA 3CHRA 1E90A 2BTDA 3CHOA 4BWRA 1HO8A 3DSWA 3I4RB 4M3OA 4G8LA 3UI2A 1OUVA 3CVNA 3RRMB 3CIAA 5AAOA 2V5QC 5CEDB 5FWQA 4PS3A 1V54E 3KEAA 3ESKA 4OVUA 3SI5A 3CK7A 2V5FA 4U8YD 3APCA 4FP7A 3HG0D 3NB2A 1OCZE 1RW2A 4U96D 4U0UA 4JZYA 3I5PA 2AXVA 2XPYA 1UJKA 2KXPC 2A5EA 3UM2A 2KBXA 2I9CA 3CVVA 4N3AA 4OVVA 3ABME 2CHZA 4L7TA 2WQHA 4GCNA 1A17A 2R05A 2Y4TA 3SFXA 1Q2ZA 4UWFA 4HORA 2Y0BG 2OVFA 2J4DA 3TWUA 2JEKA 4K0RA 4BX9A 5BXOA 5CHEE 2L6JA 1WAO1 3NF1A 4GMLA 5EYPF 1Z5SC 3RO2A 4UWHA 3LPZA 4K5BA 3EHQA 4XI9A 3AU4A 1HX8A 1BI8B 3FU6A 3UM3A 2XCCA 3SZ7A 4KT6B 4EECA 3DEOA 2GW1A 3UX4A 1SZAA 4I2ZA 4AP2A 2LUHA 5ANLA 2DYRE 3PVLA 4BESA 3L17A 5EIDA 1FCHA 3PEUB 1H0AA 3D9HA 4HOUA 3PNTB 3AS8A 4GZ6A 5ARGA 1S0PA 4KXKB 4CDNA 4DK5A 1KPSB 3RO3A 5CBNA 2HYZA 5BUZA 3L54A 4IN3B 1JUQA 3FU3A 3SQVA 2E0IA 3V31A 3W9FA 3PEVB 4FADA 4EZJA 5AN8A 1UG3A 3PZ2A 2BF0X 3LJNA 2VGYA 4TUUA 3L6AA 1LTXA 2Y1LE 1OY3D 5AQ7A 3VLEA 4G1TA 1MQSA 1YMPA 5FZRA 1N11A 2ZGDA 1O1RA 3PRZA 3TWRA 5D66A 3QAQA 3C3RA 2XZDG 3CV0A 2FF4A 2EIJE 2CFZA 2X6FA 2ILRA 2IJGX 4GTQA 4HB5A 5M72A 4ABNA 3EIJA 4C0EA 2ONDA 4TV3A 5ANRA 2C0MA 3J5PA 5T3RA 3MKQB 4DX5D 4C0MA 2WXIA 3G2UA 3LXUX 5CCLA 2F8XK 3CVWA 1SW6A 5KNHD 4M7CA 4WUYA 5HKPA 3PH0C 5LCWC 3ZXSA 3MV3B 3U9WA 1UOHA 3UUXA 4D10C 3C72A 4G8KA 4XI0A 3ZU7B 3Q15A 3ASGA 1LF8A
chains in the Genus database with same CATH topology
2YQ8A 3ZN3A 3RKVA 4CT4A 5JJ7A 2KZTA 2UY1B 2I6HA 4KZ0A 3P1UA 4OYSA 4G23A 3LS8A 4I9CA 2RD0A 3MA5A 3R7QA 4JC8A 4N3CA 2PL2A 4ACKA 3D9IA 3APDA 4JEUA 3B7SA 3MKRA 5G05C 4IYPA 4GB9A 3FWVA 3CKBA 3PUJA 3QC1A 4BT8A 2PZIA 1IHGA 4GA1A 4ME2A 5G2NA 1OWPA 3ASHA 4QFVA 4TRQA 5E75A 4CT0A 4F1SA 3TG4A 2CHXA 4L1BA 3RRUA 1W3BA 2VGXB 4EBAA 2KATA 3O48A 1NP7A 3QWPA 4N2SA 1HG5A 1INZA 4A3VA 3ML9A 1EF1C 4EQFA 3ENEA 3GZ2A 5LP0A 3CK8A 1PAQA 3LY9A 3K9IA 4URKA 3SD5A 2YINA 4GMJA 4P29A 3FHEA 2WXNA 3CK9A 2UWJG 3KS2A 5DBKA 3RRNB 2WXQA 4KBQA 4CDRA 5T8IA 3L16A 4N3BA 4N5CA 1KT0A 3U64A 4FULA 2VJ8A 4JHRA 4B0ZA 4Q96A 5HQ8A 4FA6A 1DNPA 4WNGA 4G25A 1E8ZA 3B7RL 2MHKA 3QWVA 4LERA 4PS8A 3G2VA 2XGSA 3FH8A 3LVRE 3OXFA 4Y6WA 5EDSA 3CVUA 1L5JA 3QK0A 2WPVA 3CEQA 4WNEA 5BV1A 4IRUA 3LEWA 3IHYA 4MKTA 3CVXA 3FTZA 3T8MA 3VLDA 4BTAA 1H2UA 1H6KA 3IHVA 2YNQA 2E2EA 3TL5A 3EHNA 4B89A 2QY7A 2L0IA 3MGBA 4N39A 4KMOA 3S7BA 3PDNA 4AM9A 3I4GA 3JUIA 2Q7FA 2V0PA 1H2VC 2WB2A 2WXJA 3EDTB 5AENA 4ANUA 1UN9A 3ZYQA 5J90A 2NXPA 4BTBA 1NA0A 2J08A 2WVIA 3KEZA 2P58C 3SF4A 3URZA 2WMOA 1MHQA 4GZ5A 4GYOA 3S7DA 3JQ0A 3ONLA 4JPSA 3SNXA 3NZUA 4V3IA 3IEGA 5T4YA 4IULA 4CGVA 2M63A 1ZU2A 2VSOE 4FJZA 3CSTA 2EQXA 3FEXA 4Q94A 4PUCA 4JHKA 2FULA 2J9QA 3L13A 4BY6A 1FVFA 3L08A 2IOSA 3MYVA 3ZYMA 2AWIA 4U04A 4LRZA 2VTBA 4J8FA 3FUEA 3JYSA 1EPUA 1XNFA 4UI9J 1WY6A 4DI4A 1TEZA 2AVPA 2X6JA 4NQ0A 3U4TA 2XEVA 4A55A 2X6KA 4AOFA 1ELWA 1QZ2A 4G11A 1E7UA 3UT4A 4I2WA 3CHMA 4I9EA 4JA7A 4RG9A 5LCWJ 4L23A 3FTUA 5LFAA 3CHSA 1VDYA 3T5VA 2PM7A 3EJNA 3N71A 3TG5A 1Z3XA 2I1JA 1OWNA 3E4BA 3EIQC 5AJLA 4ANVA 3QDNA 4CRWA 4PH4B 3S2AA 1TJCA 3UMVA 3CGHA 4HFGA 3FDHA 4B8CB 4WWPA 1BPOA 3APFA 5JHBA 1PY1A 5LX8A 3PS6A 4F3VA 3ZPJA 3NQPA 4K03A 4ANXA 4XX5A 2YHCA 4WAFA 3FUDA 2JLBA 3FTVA 4I1OB 2KM4A 2GRMA 4HXIA 1UJJA 1ZBPA 3Q5MA 4MRUA 3PZDA 4N2QA 5C2YA 3SHFA 4J6IA 4GU5A 3OXGA 4J8SA 4F53A 5G05J 2XPIA 5FQ7A 5AJDA 4APFA 2AW6A 3UT7A 2XGOA 3OXLA 5KJKA 2WXLA 3O4ZA 4XE0A 4WWNA 1KT1A 5BV0A 3TXNA 5FQ6A 2OOEA 2C2LA 4LCTA 2HM8A 3IBEA 3QKYA 4GZCA 2Y4UA 2PQRA 4XZ4A 2MRIA 3CHQA 3MZLB 3FTSA 5CCMA 2CHWA 5JJTA 2XGMA 3HVEB 2VQ2A 3IKOB 3D3MA 3ZW3A 3ZHEA 1HZ4A 4E85A 5HI7A 3HYMB 1NZNA 3VLFA 5AIJA 4GYYA 4U8HA 3LJ3A 2R59A 5BW8C 1HS6A 2CG2A 1P5QA 3MV2B 4NACA 4PDXA 4CEMA 3AS4A 3TXMA 3FTXA 3QJZA 4UQXA 2XRZA 4GPKA 2L0TB 1HU3A 1JPLA 3QNKA 3P2BA 2I1KA 3LCAA 3S7FA 5BT1A 4HS2A 2I2OA 2KCKA 5KJMA 2WXOA 4B8AA 1QNFA 2V4LA 3ZGQA 2OV8A 2RG8A 3FUMA 4U63A 5A6CA 4NURA 4GZDA 2FO7A 5CMYA 3ZFWA 3VTYA 3CVPA 4FLHA 3LYAA 4FHKA 3DPDA 4KZCA 4UQYA 3BEEA 4C9BB 1OWMA 2AXZA 4WNDA 4FU3A 4GZ3A 4O6FA 1DVPA 5FJYA 3FH5A 3HIZA 4UWGA 3B7UX 3FUHA 4I43A 2KZTB 3FU5A 3ONKA 3CHRA 5G04C 1E90A 3I3NA 3MX3A 4FC8A 4W9RA 1TJFA 1N54A 2BTDA 3CHOA 3FUJA 5A7DB 4BWRA 1HO8A 1QQEA 3FEYA 4HLEA 5KJLA 3I4RB 3JCKC 3TJPA 2A4ZA 2J49A 5KJNA 4M3OA 4AVXA 3MKQA 5JHAA 1Z6TA 1OUVA 3CSFA 2WQ7A 3CVNA 3RRMB 3CIAA 4DPRA 3T5XA 2OVBA 3FY4A 1JWFA 3UT8A 2XRYA 5ARFA 2WXGA 3PE4A 1UN8A 5FWQA 4PS3A 4YVOA 4U07A 2X38A 4AY6A 4J8DA 3LKUA 3ESKA 4OVUA 2GRLA 1SZ9A 3SI5A 2LO6A 3G2TA 3CK7A 4BFRA 3KD7A 1X5BA 2V5FA 3D9MA 4I6EA 4L2YA 1JWGA 3VTXA 3APCA 2J09A 3QB2A 4XIFA 3D9PA 4FP7A 1Y8MA 3D9NA 2LSVA 1E8XA 4G24A 4U0UA 4JZYA 2DCPA 2X3MA 4J0UA 4GAAA 5BPPA 4JXTA 4UWKA 3RJVA 3I5PA 2WXRA 5JJ6A 4DJAA 1OWOA 2AXVA 2IU1A 2XPYA 4L2LA 1N52A 1UJKA 1E8YA 3R9AB 3PUKA 2IONA 2WM9A 4AEZC 3HDXA 4U0ZA 4G2VA 3S7JA 1E7VA 2DBAA 3B13A 2UY1A 4AXHA 4HVBA 5J08A 2WQ6A 2XPZA 2I9CA 4ANWA 4KVOA 3CVVA 4N3AA 1B89A 2LSUA 2NSZA 4OVVA 5EX0A 2CHZA 3FUIA 4MS6A 2XQ0A 3SBSA 2LAIA 4L7TA 2WQHA 4GCNA 3Q4AB 3CVQA 2NC9A 4HOSA 1U3CA 1A17A 2IFUA 3FUFA 4JW1A 2Y4TA 3QWWA 4U0SA 3D9JA 3TAXA 4PS7A 4UWFA 4E6HA 3ESLA 3SBTB 4UWLA 4HORA 2VGXA 4H7XA 4UI9K 2OVFA 3FUNA 2J4DA 3ZRHA 2JEKA 5DIZA 3B7TA 2XCBA 3EHMA 1NA3A 3ZYLA 1HF8A 3CHPA 4I1AA 2HO1A 4K0RA 4RSYA 4BSXA 4G26A 2VYIA 4BX9A 4BT9A 5C1DA 5CHEE 1Y6IA 3PREA 4F7AA 3D9LA 4RG6A 2XHEA 2PM6A 2AXUA 2L6JA 2PQNA 4CDMA 2WXKA 4WNFA 3IV0A 3BG1B 2IQCA 5D0QD 3D9OA 1WAO1 4I6GA 5E76A 3NF1A 2VTBB 4GMLA 2IOLA 3QARA 3C98A 3RO2A 4UWHA 3NZSA 4I1MA 3LPZA 2WXPA 2CG3A 1IYGA 2J4BA 4XI9A 4FJYA 3CVLA 2QFCA 2L9BA 1HFAA 3G2SA 3KAEA 4AY5A 2WXFA 1HX8A 3AU4A 3OAWA 4RVBA 4FHJA 3FU6A 4ILHB 4YVQC 2ZU6B 2XCCA 3SZ7A 4KT6B 1SQMA 3HHMA 4DI3A 4EECA 1KLXA 4GA2A 1FVHA 2GW1A 3UX4A 2VSYA 4AJWA 3CKCA 1SZAA 2LNIA 5LOZA 4I2ZA 4AP2A 3ZEFA 2FI7A 3ULQA 2V8SE 5ANLA 1Z3YA 4WWOA 3CLJA 1YA0A 3FTWA 3GZSA 3PVLA 4I6JA 4XKCA 2CFUA 4AV7A 3CVYA 3L17A 5G04J 4JA9A 4GA0A 3LY8A 1FCHA 5KCMA 1EYHA 4Q69A 3PEUB 1H0AA 4HOUA 3PNTB 5AYWD 4J8EA 4KYOB 1HXIA 3AS8A 4GZ6A 3GYZA 1PC2A 4NRHB 1S0PA 1HE8A 4KXKB 5ENNA 5EX3A 5ARGA 3Q49B 4CDNA 3ZVVA 2WXMA 2FEZA 2Y3AA 3PNLB 3UPVA 2BUGA 4DK5A 3RO3A 2HYZA 3ASFA 3BG0B 5BUZA 4XKBA 3L54A 3RIBA 1XGWA 4H7YA 4IN3B 1JUQA 3FU3A 3MCXA 4ATGA 2E0IA 3FULA 2KCVA 4JVSA 2VSNA 3PEVB 4FADA 4EZJA 1U3DA 3SFZA 4DLOA 3LVQE 1HH8A 2C0LA 1UG3A 1UW4B 2BF0X 1EDUA 5G55A 2VGYA 4TUUA 1HG2A 3G2WA 3L6AA 4CCAA 4A3TA 3FU0A 2LAHA 3ZHEB 4CGWA 3ASDA 3VLEA 5A23A 3FUKA 4G1TA 1MQSA 3RU0A 2X6HA 5FZRA 2DIWA 3ZIMA 3PRZA 3CQCB 1H19A 4EZLA 2YHEA 3OTNA 3U3WA 4EBAG 2R17C 3R7RA 3QAQA 5CMWA 3LDZA 3CV0A 2FF4A 1IQUA 3FP3A 2X6IA 2WXHA 2CFZA 4MLPA 2X6FA 4ILIA 2ILRA 5FQ8A 2IJGX 2KC7A 3CR3A 2FBNA 5M72A 1GW6A 4EZKA 4ABNA 3AS5A 3EIJA 4LEUA 4KVMA 4C0EA 4BX8A 3TGOA 1E8WA 5FZSA 2WMNA 3UQ3A 2ONDA 2MOWA 4JL0A 4TV3A 5ANRA 1ELKA 4B94A 5BNWA 3AU5A 5D0OD 2C0MA 2HR2A 4GCOA 1OWLA 4UQZA 4Y6CA 4ACLA 3D9KA 3GZ1A 5T3RA 4FLBA 2VSXE 3MKQB 3MEKA 1WM5A 3RK6A 3QOUA 2WXIA 4C0MA 3G2UA 3LXUX 4A1GA 5EKQD 4JEHA 3JQ1A 4DLQA 5CCLA 3ML8A 3HVEA 4HOQA 5FZQA 3CVWA 3MJWA 4I17A 4A1SA 4UI9C 4APOA 4LUNU 3FTYA 2J07A 3U66A 4WUYA 5FTPA 4HOTA 4YNDA 4JHJA 3PH0C 4R7LA 5LCWC 1E96B 2KCLA 1H2TC 2GGFA 2R5SA 3DBSA 4ILGA 3PE3A 3FFLA 3FH7A 5FQ4A 3SGHA 3ZXSA 3GW4A 3MV3B 3CQGB 3ZYKA 4AIFA 3U9WA 4GYWA 5FT9A 3UUXA 3LY7A 2IF4A 3WXXA 1IQRA 1ELRA 4D10C 4EPZA 3L22A 2A5UA 4XI0A 3Q47B 3Q15A 3ASGA 1LF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQ8 A;  3ZN3 A;  3RKV A;  5JJ7 A;  2UY1 B;  2I6H A;  4G23 A;  4I9C A;  3MA5 A;  4N3C A;  2PL2 A;  3MKR A;  5G05 C;  4BT8 A;  3FWV A;  3CKB A;  2PZI A;  1IHG A;  4GA1 A;  4ME2 A;  3ASH A;  3TG4 A;  1W3B A;  2VGX B;  2KAT A;  3O48 A;  3QWP A;  4N2S A;  4EQF A;  3GZ2 A;  3CK8 A;  3LY9 A;  3K9I A;  3CK9 A;  2UWJ G;  3KS2 A;  5DBK A;  4KBQ A;  4CDR A;  4N3B A;  4N5C A;  1KT0 A;  4JHR A;  5HQ8 A;  4WNG A;  4G25 A;  2MHK A;  3QWV A;  2XGS A;  3OXF A;  4Y6W A;  2WPV A;  3CEQ A;  4WNE A;  4BTA A;  2E2E A;  4N39 A;  3S7B A;  3PDN A;  4AM9 A;  2Q7F A;  3EDT B;  4BTB A;  1NA0 A;  3SF4 A;  3URZ A;  2P58 C;  4GZ5 A;  4GYO A;  3S7D A;  3IEG A;  4CGV A;  1ZU2 A;  2J9Q A;  4U04 A;  4J8F A;  3Q15 A;  3JYS A;  4UI9 J;  1XNF A;  2AVP A;  4NQ0 A;  3U4T A;  2XEV A;  1ELW A;  1QZ2 A;  4I2W A;  4I9E A;  4JA7 A;  4RG9 A;  5LCW J;  3N71 A;  3TG5 A;  3E4B A;  3QDN A;  1TJC A;  4F3V A;  3ZPJ A;  2YHC A;  2JLB A;  1ZBP A;  3Q5M A;  4N2Q A;  3OXG A;  5G05 J;  2XPI A;  2XGO A;  3OXL A;  5KJK A;  1KT1 A;  2OOE A;  2C2L A;  3QKY A;  2Y4U A;  2PQR A;  5CCM A;  5JJT A;  2XGM A;  2VQ2 A;  3ZHE A;  1HZ4 A;  5HI7 A;  3HYM B;  1NZN A;  4GYY A;  5BW8 C;  3MV2 B;  1P5Q A;  3AS4 A;  4GPK A;  4UQX A;  3LCA A;  3S7F A;  5BT1 A;  2KCK A;  5KJM A;  3ZGQ A;  5A6C A;  2FO7 A;  3ZFW A;  3VTY A;  3CVP A;  3LYA A;  4UQY A;  3BEE A;  4WND A;  4GZ3 A;  4O6F A;  5FJY A;  5G04 C;  5A7D B;  4W9R A;  4BWR A;  5KJL A;  1QQE A;  5KJN A;  1OUV A;  3CVN A;  5ARF A;  3PE4 A;  4YVO A;  4U07 A;  4AY6 A;  4J8D A;  3LKU A;  3ESK A;  3CK7 A;  3KD7 A;  2V5F A;  3VTX A;  4XIF A;  1Y8M A;  2LSV A;  4G24 A;  4U0U A;  4J0U A;  3RJV A;  5JJ6 A;  3R9A B;  4U0Z A;  4G2V A;  3S7J A;  2DBA A;  2UY1 A;  4N3A A;  1B89 A;  2LSU A;  5EX0 A;  2WQH A;  4GCN A;  3Q4A B;  3CVQ A;  2NC9 A;  4HOS A;  1A17 A;  2IFU A;  2Y4T A;  3QWW A;  4U0S A;  3TAX A;  4HOR A;  2VGX A;  4H7X A;  4UI9 K;  5DIZ A;  2XCB A;  1NA3 A;  4I1A A;  2HO1 A;  5C1D A;  4G26 A;  2VYI A;  4BT9 A;  5CHE E;  4RG6 A;  2L6J A;  2PQN A;  4WNF A;  5D0Q D;  1WAO 1;  3NF1 A;  3RO2 A;  3LPZ A;  1IYG A;  4XI9 A;  3CVL A;  2QFC A;  3KAE A;  4AY5 A;  2XCC A;  3SZ7 A;  1KLX A;  4GA2 A;  2GW1 A;  2VSY A;  3CKC A;  2LNI A;  4I2Z A;  2FI7 A;  3ULQ A;  1YA0 A;  5G04 J;  4JA9 A;  4GA0 A;  3LY8 A;  1FCH A;  4HOU A;  5AYW D;  4J8E A;  4KYO B;  1HXI A;  3AS8 A;  4GZ6 A;  3GYZ A;  1PC2 A;  4NRH B;  5EX3 A;  4KXK B;  5ARG A;  3Q49 B;  2FEZ A;  3UPV A;  2BUG A;  3RO3 A;  2HYZ A;  3ASF A;  3RIB A;  4H7Y A;  4IN3 B;  2KCV A;  2VSN A;  1HH8 A;  2C0L A;  2VGY A;  4CGW A;  3ZHE B;  3ASD A;  4G1T A;  3RU0 A;  5FZR A;  3U3W A;  3CV0 A;  2FF4 A;  3FP3 A;  2KC7 A;  2FBN A;  5M72 A;  4ABN A;  3AS5 A;  4LEU A;  3TGO A;  5FZS A;  3UQ3 A;  2OND A;  4JL0 A;  4B94 A;  5BNW A;  5D0O D;  2C0M A;  2HR2 A;  4GCO A;  4UQZ A;  4Y6C A;  3GZ1 A;  3MEK A;  1WM5 A;  3QOU A;  5CCL A;  5EKQ D;  4HOQ A;  5FZQ A;  4I17 A;  4A1S A;  4UI9 C;  4APO A;  4WUY A;  5FTP A;  4HOT A;  4YND A;  5LCW C;  1E96 B;  2KCL A;  2R5S A;  3PE3 A;  3FFL A;  4AIF A;  3GW4 A;  3MV3 B;  4GYW A;  5FT9 A;  3UUX A;  3LY7 A;  2IF4 A;  3WXX A;  1ELR A;  4XI0 A;  3Q47 B;  4YVQ C;  3ASG A; 
#chains in the Genus database with same CATH topology
 2B6C A;  2ZXW E;  2MYO A;  3EU9 A;  2OEW A;  2KZT A;  3P1U A;  4I9C A;  1FPP A;  4ACK A;  4JEU A;  3ZUV B;  3B7S A;  4GA1 A;  4ME2 A;  5G2N A;  1OT8 A;  1OWP A;  3TG4 A;  4DRX E;  2R03 A;  4EBA A;  2KAT A;  1BD8 A;  4N2S A;  1HG5 A;  3SY2 A;  5CRV A;  1EF1 C;  4X8Q A;  1PAQ A;  3LY9 A;  3SD5 A;  4P29 A;  2WXN A;  3KS2 A;  3RRN B;  4OAV B;  4CDR A;  4N3B A;  5HS0 A;  4JHR A;  5HQ8 A;  4FA6 A;  1DNP A;  3B7R L;  4PS8 A;  3OXF A;  5EDS A;  3CVU A;  1OXJ A;  1L5J A;  2RFA A;  4WNE A;  2LXM A;  3LEW A;  3IHY A;  3CVX A;  4BTA A;  4B89 A;  2QY7 A;  2L0I A;  3PDN A;  4AM9 A;  3I4G A;  1N94 A;  2WXJ A;  2NXP A;  2P58 C;  3DPY A;  1H6P A;  2IO2 C;  3JQ0 A;  3SNX A;  3NZU A;  3IEG A;  3PZ1 A;  4IUL A;  2PNN A;  3UM1 A;  2IOS A;  2VTB A;  2AVP A;  2X6J A;  5IY5 E;  3NOC D;  4JA7 A;  5FIN A;  4L23 A;  3FTU A;  1QYM A;  1OWN A;  3S2A A;  1X81 A;  3CGH A;  3DSU A;  4WWP A;  1BPO A;  5JHB A;  5LX8 A;  1FT2 A;  3Q7A A;  3UKU G;  5AQA A;  1N95 A;  4WAF A;  2GRM A;  3Q79 A;  1UJJ A;  1ZBP A;  4MRU A;  3T9K A;  1DCE A;  4N2Q A;  5C2Y A;  4GU5 A;  4F53 A;  5G05 J;  5AJD A;  4HI8 A;  4XEI G;  4APF A;  2RKK A;  2WXL A;  3O4Z A;  1KT1 A;  2JAB A;  5FQ6 A;  3JXJ A;  2HM8 A;  3CHQ A;  4DX2 A;  2CHW A;  2P9L G;  3IKO B;  4ZFH A;  3D3M A;  3ZHE A;  1HZ4 A;  3EHR A;  4GYY A;  3LJ3 A;  1HS6 A;  4NAC A;  3BUA A;  3AS4 A;  3T8K A;  3TXM A;  2H6G A;  4UQX A;  2XRZ A;  1JPL A;  3S7F A;  4YDW A;  2I2O A;  2KCK A;  3C5R A;  1D9S A;  1QNF A;  3ABL E;  4GZD A;  2FO7 A;  5CMY A;  3VTY A;  5CRU A;  4UQY A;  3Q73 A;  4WND A;  4FU3 A;  1DVP A;  3FH5 A;  4UWG A;  3B7U X;  3ONK A;  3I3N A;  3MX3 A;  3B95 A;  5B1A E;  2QYU A;  3TJP A;  2A4Z A;  2J49 A;  3CSF A;  4DPR A;  5CEC B;  2OVB A;  2IEJ A;  1O1T A;  5EYL A;  3PE4 A;  2LO6 A;  4BFR A;  4L2Y A;  3QB2 A;  4XIF A;  2LSV A;  2DCP A;  4HLL A;  4J0U A;  4GAA A;  5BPP A;  3RJV A;  5ENQ D;  2WXR A;  4DJA A;  4HQD A;  4L2L A;  5JMN D;  3PUK A;  2ION A;  4AEZ C;  4U0Z A;  5J08 A;  2WQ6 A;  1E7V A;  2DBA A;  4LNB A;  3ULY A;  5KNG A;  2DZN A;  1V55 E;  3E37 A;  2BKG A;  3X2Q E;  2ETC A;  1S64 A;  5ENS D;  4JW1 A;  5ENO D;  3TAX A;  4PS7 A;  4E6H A;  3ESL A;  3SBT B;  2VGX A;  3EHM A;  4BSX A;  3CHP A;  5C1D A;  2HO1 A;  2HE0 A;  2VYI A;  4CZ2 D;  4BT9 A;  3D9L A;  1TYQ G;  2PQN A;  2WXK A;  4TUM A;  5AAR A;  4I6G A;  5E76 A;  4FJY A;  3CVL A;  4FHJ A;  4ILH B;  2ZU6 B;  4DI3 A;  3HHM A;  1MX4 A;  3J5Q B;  2P9S G;  1KLX A;  4GA2 A;  4AJW A;  3ZEF A;  1K3Z D;  1Z3Y A;  4WWO A;  4I6J A;  3GZS A;  2XEE A;  5G04 J;  4GA0 A;  1EYH A;  1N4Q A;  5AYW D;  4KYO B;  5EX3 A;  1HE8 A;  1K8K G;  2FEZ A;  3UPV A;  3BG0 B;  3RIB A;  4ATG A;  3FUL A;  2VSN A;  3LVQ E;  1EDU A;  5G55 A;  5CBO A;  1SVX A;  1YYH A;  4J7W A;  1N9A A;  2DIW A;  3ZIM A;  2YHE A;  4EBA G;  5CMW A;  3LDZ A;  4TXR A;  2X6I A;  4MLP A;  4ILI A;  2FBN A;  3TGO A;  2MOW A;  4JL0 A;  5BNW A;  3AU5 A;  3TWS A;  5D0O D;  4UQZ A;  4ACL A;  3D9K A;  3GZ1 A;  3V2X A;  4A1G A;  4DLQ A;  5EKQ D;  2R02 A;  3HVE A;  4HOQ A;  5FZQ A;  5ITZ F;  3UIN C;  3DXM G;  5EN5 D;  2J07 A;  2BKK B;  4JHJ A;  4R7L A;  2KCL A;  2GGF A;  2R5S A;  3DBS A;  3PE3 A;  3FFL A;  3FH7 A;  4L9P A;  3GW4 A;  3L82 A;  4GYW A;  4HRN A;  3LY7 A;  1NL4 A;  3WXX A;  1IQR A;  1ELR A;  3L22 A;  2I6H A;  4KZ0 A;  4GTS A;  4OYS A;  4JD2 G;  3LS8 A;  2RD0 A;  3MA5 A;  4JC8 A;  3D9I A;  3ULE G;  4U95 D;  4BT8 A;  3FWV A;  3CKB A;  3PUJ A;  4TRQ A;  2CHX A;  1NI1 A;  3SFY A;  3C3Q A;  4GMR A;  3O48 A;  1NP7 A;  3QWP A;  1INZ A;  4A3V A;  3ML9 A;  3GZ2 A;  3CK8 A;  4TXQ A;  3EUV A;  3K9I A;  4URK A;  2QC9 A;  3FHE A;  3Q78 A;  3E33 A;  2XS1 A;  4KBQ A;  5T8I A;  4N5C A;  1KT0 A;  3ZNG A;  3U64 A;  3V30 A;  4B0Z A;  3DXK G;  4NIK A;  1BI7 B;  2MHK A;  1JCS A;  4IRU A;  3DWL G;  3FTZ A;  3T8M A;  3EHN A;  4N39 A;  2Q7F A;  2V0P A;  2P9N G;  1D8E A;  5AEN A;  4ANU A;  3ZYQ A;  5J90 A;  3URZ A;  2WVI A;  3KEZ A;  3SF4 A;  2WMO A;  1MHQ A;  4GZ5 A;  4GYO A;  4JPS A;  1D8D A;  3UIO C;  3CST A;  3UIP C;  1AP7 A;  2EQX A;  4LSZ E;  3L13 A;  4BY6 A;  3L08 A;  3MYV A;  4U04 A;  4UI9 J;  1TEZ A;  3U4T A;  2X6K A;  2XEH A;  4G11 A;  1DC2 A;  3UT4 A;  4I2W A;  3CHM A;  4I9E A;  4RG9 A;  5LFA A;  1YCS B;  3N71 A;  4CRW A;  3EIQ C;  3E4B A;  5AJL A;  4ANV A;  3QDN A;  3L9T A;  4PH4 B;  4HFG A;  3ZPJ A;  3WG7 E;  4XX5 A;  3FUD A;  4I1O B;  3PZD A;  5AQB A;  4J6I A;  5FQ7 A;  3UT7 A;  2XGO A;  3OXL A;  4GTV A;  3DSS A;  2C2L A;  3IBE A;  4DX6 D;  2MRI A;  2DZO A;  5CCM A;  2ZGG A;  1DCQ A;  3KSL A;  5HI7 A;  3HYM B;  1NZN A;  4U8H A;  4B93 B;  1HU3 A;  3QNK A;  2R2L A;  1A5E A;  3W9G A;  3TWX A;  4NUR A;  4FHK A;  3BEE A;  2AXZ A;  4O6F A;  2KZT B;  1MJ0 A;  4FC8 A;  4W9R A;  1TJF A;  1N54 A;  4AVX A;  1Z6T A;  2WQ7 A;  1IXV A;  3T5X A;  3FY4 A;  4JB8 P;  1MZC A;  5ARF A;  2WXG A;  5D2M C;  4U07 A;  2X38 A;  4AY6 A;  2IO3 C;  1N4P A;  3LKU A;  5B3S E;  4GTO A;  2GRL A;  1NFI E;  1X5B A;  4I6E A;  1JWG A;  3D9P A;  1Y8M A;  4N5Q A;  1OCC E;  1TN6 A;  2EIM E;  2P9K G;  4JXT A;  2ZIR A;  5JJ6 A;  1N52 A;  3R9A B;  3V2O A;  2EIK E;  2WM9 A;  3HDX A;  4AXH A;  3ASO E;  4HVB A;  2UY1 A;  2XPZ A;  1K1A A;  1B89 A;  2LSU A;  5EX0 A;  2P9U G;  1BLX B;  3FUI A;  4MS6 A;  4GTP A;  3Q4A B;  2NC9 A;  1U3C A;  1IKN D;  4U0S A;  3PZ3 A;  3D9J A;  3DSV A;  2J8S D;  3UTM A;  5DIZ A;  2XCB A;  3ZYL A;  4RSY A;  3ASN E;  4G26 A;  4BSZ B;  3PRE A;  4F7A A;  4RG6 A;  2PM6 A;  3Q9U C;  4LNU D;  4CDM A;  2H6H A;  3IV0 A;  2GRP B;  2IQC A;  1O1S A;  3D9O A;  2Y69 E;  4Z68 A;  2VTB B;  3C98 A;  4I1M A;  2CG3 A;  1IYG A;  1HFA A;  3G2S A;  3B7B A;  4RVB A;  3KSQ A;  1SQM A;  1AWC B;  1FVH A;  2VSY A;  4GTT A;  2LNI A;  5LOZ A;  2FI7 A;  2P9I G;  2V8S E;  3Q9N C;  3DSX A;  1FT1 A;  3CVY A;  2CFU A;  3LY8 A;  5KCM A;  4Q69 A;  3Q7F A;  4LG6 A;  1HXI A;  2F0Y A;  4NRH B;  1PC2 A;  5ENN A;  3Q49 B;  3ZVV A;  3PNL B;  2BUG A;  1XGW A;  3MCX A;  2KCV A;  1U3D A;  4DLO A;  4UUC A;  4O60 A;  1HH8 A;  2C0L A;  1UW4 B;  1HG2 A;  1K1B A;  2NYJ A;  1TNU A;  4A3T A;  3FU0 A;  3ZHE B;  4CGW A;  2FO1 E;  5B1B E;  3RU0 A;  2X6H A;  1H19 A;  3OTN A;  2H6I A;  4A63 B;  3FP3 A;  2WXH A;  5FQ8 A;  3CR3 A;  1ZB1 A;  4EZK A;  4K5A B;  4BX8 A;  4LEU A;  4KVM A;  3UQ3 A;  4B94 A;  3E32 A;  2HR2 A;  4GCO A;  1OWL A;  4FLB A;  1WM5 A;  1JCQ A;  2XS8 A;  1SA4 A;  3JQ1 A;  3MJW A;  4A1S A;  4APO A;  4LUN U;  4GTM A;  3U66 A;  4YDY A;  4YND A;  4HOT A;  1E96 B;  4ILG A;  1H2T C;  3SGH A;  5FQ4 A;  3ZYK A;  5FT9 A;  2IF4 A;  4EPZ A;  2YHC A;  4CT4 A;  3RKV A;  2QYJ A;  2EIL E;  3RAU A;  3BQO A;  2IY0 C;  3R7Q A;  2PL2 A;  5G05 C;  3QC1 A;  4CT0 A;  4F1S A;  3C3O A;  3HXF A;  4L1B A;  1W3B A;  2VGX B;  4EQF A;  3ENE A;  4GMJ A;  5DBK A;  2WXQ A;  4F6R D;  4FUL A;  2VJ8 A;  5H7P A;  3QWV A;  3FH8 A;  3LVR E;  3TWW A;  3QK0 A;  2WPV A;  2ZIS A;  3VLD A;  1H6K A;  2E2E A;  4BET A;  4HI9 A;  1H2V C;  2WB2 A;  3EDT B;  4EHM A;  1BU9 A;  1UN9 A;  1NA0 A;  3S7D A;  4CGV A;  2M63 A;  1ZU2 A;  2VSO E;  1S63 A;  3FEX A;  4Q94 A;  4PUC A;  3AG4 E;  1FVF A;  4YDE A;  2AWI A;  4J8F A;  3FUE A;  1EPU A;  1XNF A;  1WY6 A;  1N4R A;  4K5C A;  3R9M A;  1QBQ A;  1ELW A;  3BU8 A;  1TNO A;  1E7U A;  1IHB A;  5LCW J;  4F1P A;  2PM7 A;  3TG5 A;  2I1J A;  4LNG A;  1TJC A;  3APF A;  3PS6 A;  1OCR E;  4ANX A;  2ETB A;  1TR4 A;  1MX2 A;  2JLB A;  3FTV A;  2KM4 A;  4HXI A;  1TN7 A;  3Q5M A;  4U7E B;  4YDO A;  2OEV A;  3SHF A;  2XPI A;  5KJK A;  1U2V G;  3NAW A;  5BV0 A;  1SA5 A;  2OOE A;  2PQR A;  4XZ4 A;  3MZL B;  3FTS A;  2V4H C;  4GPM A;  3HVE B;  2L6B A;  3ZW3 A;  5BW8 C;  3MV2 B;  4PDX A;  3SO8 A;  3FTX A;  2L0T B;  3LCA A;  4B8A A;  3ZGQ A;  2OV8 A;  2RG8 A;  5A6C A;  3ZFW A;  3CVP A;  1LD8 A;  2ETA A;  4C9B B;  1OWM A;  3JXI A;  3HIZ A;  3FUH A;  4CYM D;  5G04 C;  4BER A;  5A7D B;  3FUJ A;  4HLE A;  1QQE A;  3FEY A;  5KJL A;  3JCK C;  5KJN A;  3MKQ A;  3HXD A;  5JHA A;  1JWF A;  2GRR B;  3UKR G;  3UT8 A;  2XRY A;  1UN8 A;  4YVO A;  5ENT D;  4J8D A;  1SZ9 A;  3TWT A;  3G2T A;  2QZA A;  3KD7 A;  3D9M A;  3VTX A;  2J09 A;  5ENR D;  3D9N A;  4O1O A;  1E8X A;  3EU5 A;  4G24 A;  2DYS E;  3RSE G;  4BEP A;  2X3M A;  1MX6 A;  4UWK A;  1OWO A;  2IU1 A;  4O1P A;  1E8Y A;  3S7J A;  4G2V A;  3B13 A;  2OCC E;  4ANW A;  4OAU C;  4KVO A;  2NSZ A;  3SBS A;  3AG2 E;  2XQ0 A;  2LAI A;  3CVQ A;  4HOS A;  2IFU A;  3FUF A;  3QWW A;  2H6F A;  4UWL A;  4H7X A;  4UI9 K;  5CEA A;  1TN8 A;  3FUN A;  1RZ4 A;  3ZRH A;  5KWD A;  3B7T A;  3F6Q A;  1NA3 A;  1HF8 A;  4I1A A;  3UM0 A;  1Y6I A;  3NBN B;  2XHE A;  4MBG A;  2AXU A;  2VGE A;  4ATZ D;  4WNF A;  3BG1 B;  5D0Q D;  1WG0 A;  4C48 B;  2IOL A;  3QAR A;  1TNB A;  3NZS A;  2WXP A;  2J4B A;  5CER B;  2QFC A;  2L9B A;  3KAE A;  4AY5 A;  2WXF A;  3OAW A;  4DX1 A;  5KBA A;  3E34 A;  3E30 A;  3CKC A;  3ULQ A;  1H6O A;  4AV7 A;  3CLJ A;  1YA0 A;  3FTW A;  4XKC A;  4JA9 A;  3DST A;  4J8E A;  3PZ4 A;  3GYZ A;  3ABK E;  2WXM A;  2Y3A A;  3AG1 E;  3ASF A;  4XKB A;  4RLY A;  4H7Y A;  4JVS A;  3SFZ A;  3AJI A;  3G2W A;  4CCA A;  2LAH A;  3ASD A;  5A23 A;  3FUK A;  3ZKJ A;  3CQC B;  1N0Q A;  4DX7 D;  4EZL A;  3U3W A;  2R17 C;  3R7R A;  5AQ9 A;  2P9P G;  1IQU A;  1N4S A;  2KC7 A;  1GW6 A;  2LXL A;  3AS5 A;  1OCO E;  4U8V D;  1E8W A;  5FZS A;  2WMN A;  3AG3 E;  2B0O E;  1ELK A;  2GRO B;  4Y6C A;  2VSX E;  3MEK A;  3RK6 A;  3QOU A;  4JEH A;  3UXG A;  3ML8 A;  4I17 A;  4UI9 C;  3FTY A;  5EIB E;  1LD7 A;  3HXC A;  5FTP A;  3ISM C;  4AIF A;  3CQG B;  3TWV A;  4TXP A;  2A5U A;  3Q47 B;  4YVQ C;  2YQ8 A;  3ZN3 A;  5JJ7 A;  2UY1 B;  4G23 A;  3DRA A;  4N3C A;  5BXU A;  2GRN B;  3APD A;  3MKR A;  4IYP A;  3V79 K;  4GB9 A;  1TNZ A;  2PZI A;  1IHG A;  1WDY A;  3ASH A;  4QFV A;  5E75 A;  3RRU A;  4DUI A;  2XZT G;  3DEP A;  1KZO A;  4J8Y A;  5LP0 A;  3HXE A;  2F37 A;  3JUE A;  2P2C P;  2YIN A;  4HBD A;  2BED A;  3CK9 A;  1KZP A;  2UWJ G;  4ZHB A;  3HRA A;  3L16 A;  2DWZ A;  4Q96 A;  5JA4 D;  3HXB A;  4WNG A;  4G25 A;  1E8Z A;  4LER A;  3G2V A;  2XGS A;  1TNY A;  4Y6W A;  3CEQ A;  4RQI A;  5BV1 A;  4MKT A;  1H2U A;  3TL5 A;  3IHV A;  2YNQ A;  4HRM B;  3MGB A;  4KMO A;  3S7B A;  2EIN E;  3JUI A;  1G3N B;  4BTB A;  2J08 A;  2DVW A;  4HNA D;  3ZXP A;  3ONL A;  4V3I A;  5T4Y A;  2GRQ B;  1O5M A;  4FJZ A;  2F8Y A;  5FIO A;  4JHK A;  2FUL A;  2J9Q A;  3ZYM A;  4LRZ A;  3JYS A;  4DI4 A;  4A55 A;  4NQ0 A;  2XEV A;  4AOF A;  1QZ2 A;  2XEN A;  3CHS A;  1VDY A;  3T5V A;  3EJN A;  1Z3X A;  4QQI A;  3UMV A;  3FDH A;  4B8C B;  1PY1 A;  3NOG D;  4F3V A;  3NQP A;  4K03 A;  3Q75 A;  5EIL A;  4GTR A;  4J8S A;  3OXG A;  2AW6 A;  1S70 B;  4XE0 A;  4WWN A;  3TXN A;  3TWQ A;  4LCT A;  3QKY A;  5HRY A;  4GZC A;  2Y4U A;  5JJT A;  2XGM A;  3AAA C;  2VQ2 A;  5ENP D;  2AJA A;  2RFM A;  4E85 A;  5AIJ A;  3VLF A;  1MYO A;  2R59 A;  2CG2 A;  1P5Q A;  4CEM A;  4GPK A;  3QJZ A;  3P2B A;  2I1K A;  5BT1 A;  4HS2 A;  5KJM A;  2WXO A;  2V4L A;  3FUM A;  4U63 A;  1JCR A;  4FLH A;  3LYA A;  3DPD A;  4HRL A;  4KZC A;  1N0R A;  4GZ3 A;  5FJY A;  4I43 A;  3FU5 A;  3IXE A;  3CHR A;  1E90 A;  2BTD A;  3CHO A;  4BWR A;  1HO8 A;  3DSW A;  3I4R B;  4M3O A;  4G8L A;  3UI2 A;  1OUV A;  3CVN A;  3RRM B;  3CIA A;  5AAO A;  2V5Q C;  5CED B;  5FWQ A;  4PS3 A;  1V54 E;  3KEA A;  3ESK A;  4OVU A;  3SI5 A;  3CK7 A;  2V5F A;  4U8Y D;  3APC A;  4FP7 A;  3HG0 D;  3NB2 A;  1OCZ E;  1RW2 A;  4U96 D;  4U0U A;  4JZY A;  3I5P A;  2AXV A;  2XPY A;  1UJK A;  2KXP C;  2A5E A;  3UM2 A;  2KBX A;  2I9C A;  3CVV A;  4N3A A;  4OVV A;  3ABM E;  2CHZ A;  4L7T A;  2WQH A;  4GCN A;  1A17 A;  2R05 A;  2Y4T A;  3SFX A;  1Q2Z A;  4UWF A;  4HOR A;  2Y0B G;  2OVF A;  2J4D A;  3TWU A;  2JEK A;  4K0R A;  4BX9 A;  5BXO A;  5CHE E;  2L6J A;  1WAO 1;  3NF1 A;  4GML A;  5EYP F;  1Z5S C;  3RO2 A;  4UWH A;  3LPZ A;  4K5B A;  3EHQ A;  4XI9 A;  3AU4 A;  1HX8 A;  1BI8 B;  3FU6 A;  3UM3 A;  2XCC A;  3SZ7 A;  4KT6 B;  4EEC A;  3DEO A;  2GW1 A;  3UX4 A;  1SZA A;  4I2Z A;  4AP2 A;  2LUH A;  5ANL A;  2DYR E;  3PVL A;  4BES A;  3L17 A;  5EID A;  1FCH A;  3PEU B;  1H0A A;  3D9H A;  4HOU A;  3PNT B;  3AS8 A;  4GZ6 A;  5ARG A;  1S0P A;  4KXK B;  4CDN A;  4DK5 A;  1KPS B;  3RO3 A;  5CBN A;  2HYZ A;  5BUZ A;  3L54 A;  4IN3 B;  1JUQ A;  3FU3 A;  3SQV A;  2E0I A;  3V31 A;  3W9F A;  3PEV B;  4FAD A;  4EZJ A;  5AN8 A;  1UG3 A;  3PZ2 A;  2BF0 X;  3LJN A;  2VGY A;  4TUU A;  3L6A A;  1LTX A;  2Y1L E;  1OY3 D;  5AQ7 A;  3VLE A;  4G1T A;  1MQS A;  1YMP A;  5FZR A;  1N11 A;  2ZGD A;  1O1R A;  3PRZ A;  3TWR A;  5D66 A;  3QAQ A;  3C3R A;  2XZD G;  3CV0 A;  2FF4 A;  2EIJ E;  2CFZ A;  2X6F A;  2ILR A;  2IJG X;  4GTQ A;  4HB5 A;  5M72 A;  4ABN A;  3EIJ A;  4C0E A;  2OND A;  4TV3 A;  5ANR A;  2C0M A;  3J5P A;  5T3R A;  3MKQ B;  4DX5 D;  4C0M A;  2WXI A;  3G2U A;  3LXU X;  5CCL A;  2F8X K;  3CVW A;  1SW6 A;  5KNH D;  4M7C A;  4WUY A;  5HKP A;  3PH0 C;  5LCW C;  3ZXS A;  3MV3 B;  3U9W A;  1UOH A;  3UUX A;  4D10 C;  3C72 A;  4G8K A;  4XI0 A;  3ZU7 B;  3Q15 A;  3ASG A;  1LF8 A; 
#chains in the Genus database with same CATH homology
 2YQ8 A;  3ZN3 A;  3RKV A;  4CT4 A;  5JJ7 A;  2KZT A;  2UY1 B;  2I6H A;  4KZ0 A;  3P1U A;  4OYS A;  4G23 A;  3LS8 A;  4I9C A;  2RD0 A;  3MA5 A;  3R7Q A;  4JC8 A;  4N3C A;  2PL2 A;  4ACK A;  3D9I A;  3APD A;  4JEU A;  3B7S A;  3MKR A;  5G05 C;  4IYP A;  4GB9 A;  3FWV A;  3CKB A;  3PUJ A;  3QC1 A;  4BT8 A;  2PZI A;  1IHG A;  4GA1 A;  4ME2 A;  5G2N A;  1OWP A;  3ASH A;  4QFV A;  4TRQ A;  5E75 A;  4CT0 A;  4F1S A;  3TG4 A;  2CHX A;  4L1B A;  3RRU A;  1W3B A;  2VGX B;  4EBA A;  2KAT A;  3O48 A;  1NP7 A;  3QWP A;  4N2S A;  1HG5 A;  1INZ A;  4A3V A;  3ML9 A;  1EF1 C;  4EQF A;  3ENE A;  3GZ2 A;  5LP0 A;  3CK8 A;  1PAQ A;  3LY9 A;  3K9I A;  4URK A;  3SD5 A;  2YIN A;  4GMJ A;  4P29 A;  3FHE A;  2WXN A;  3CK9 A;  2UWJ G;  3KS2 A;  5DBK A;  3RRN B;  2WXQ A;  4KBQ A;  4CDR A;  5T8I A;  3L16 A;  4N3B A;  4N5C A;  1KT0 A;  3U64 A;  4FUL A;  2VJ8 A;  4JHR A;  4B0Z A;  4Q96 A;  5HQ8 A;  4FA6 A;  1DNP A;  4WNG A;  4G25 A;  1E8Z A;  3B7R L;  2MHK A;  3QWV A;  4LER A;  4PS8 A;  3G2V A;  2XGS A;  3FH8 A;  3LVR E;  3OXF A;  4Y6W A;  5EDS A;  3CVU A;  1L5J A;  3QK0 A;  2WPV A;  3CEQ A;  4WNE A;  5BV1 A;  4IRU A;  3LEW A;  3IHY A;  4MKT A;  3CVX A;  3FTZ A;  3T8M A;  3VLD A;  4BTA A;  1H2U A;  1H6K A;  3IHV A;  2YNQ A;  2E2E A;  3TL5 A;  3EHN A;  4B89 A;  2QY7 A;  2L0I A;  3MGB A;  4N39 A;  4KMO A;  3S7B A;  3PDN A;  4AM9 A;  3I4G A;  3JUI A;  2Q7F A;  2V0P A;  1H2V C;  2WB2 A;  2WXJ A;  3EDT B;  5AEN A;  4ANU A;  1UN9 A;  3ZYQ A;  5J90 A;  2NXP A;  4BTB A;  1NA0 A;  2J08 A;  2WVI A;  3KEZ A;  2P58 C;  3SF4 A;  3URZ A;  2WMO A;  1MHQ A;  4GZ5 A;  4GYO A;  3S7D A;  3JQ0 A;  3ONL A;  4JPS A;  3SNX A;  3NZU A;  4V3I A;  3IEG A;  5T4Y A;  4IUL A;  4CGV A;  2M63 A;  1ZU2 A;  2VSO E;  4FJZ A;  3CST A;  2EQX A;  3FEX A;  4Q94 A;  4PUC A;  4JHK A;  2FUL A;  2J9Q A;  3L13 A;  4BY6 A;  1FVF A;  3L08 A;  2IOS A;  3MYV A;  3ZYM A;  2AWI A;  4U04 A;  4LRZ A;  2VTB A;  4J8F A;  3FUE A;  3JYS A;  1EPU A;  1XNF A;  4UI9 J;  1WY6 A;  4DI4 A;  1TEZ A;  2AVP A;  2X6J A;  4NQ0 A;  3U4T A;  2XEV A;  4A55 A;  2X6K A;  4AOF A;  1ELW A;  1QZ2 A;  4G11 A;  1E7U A;  3UT4 A;  4I2W A;  3CHM A;  4I9E A;  4JA7 A;  4RG9 A;  5LCW J;  4L23 A;  3FTU A;  5LFA A;  3CHS A;  1VDY A;  3T5V A;  2PM7 A;  3EJN A;  3N71 A;  3TG5 A;  1Z3X A;  2I1J A;  1OWN A;  3E4B A;  3EIQ C;  5AJL A;  4ANV A;  3QDN A;  4CRW A;  4PH4 B;  3S2A A;  1TJC A;  3UMV A;  3CGH A;  4HFG A;  3FDH A;  4B8C B;  4WWP A;  1BPO A;  3APF A;  5JHB A;  1PY1 A;  5LX8 A;  3PS6 A;  4F3V A;  3ZPJ A;  3NQP A;  4K03 A;  4ANX A;  4XX5 A;  2YHC A;  4WAF A;  3FUD A;  2JLB A;  3FTV A;  4I1O B;  2KM4 A;  2GRM A;  4HXI A;  1UJJ A;  1ZBP A;  3Q5M A;  4MRU A;  3PZD A;  4N2Q A;  5C2Y A;  3SHF A;  4J6I A;  4GU5 A;  3OXG A;  4J8S A;  4F53 A;  5G05 J;  2XPI A;  5FQ7 A;  5AJD A;  4APF A;  2AW6 A;  3UT7 A;  2XGO A;  3OXL A;  5KJK A;  2WXL A;  3O4Z A;  4XE0 A;  4WWN A;  1KT1 A;  5BV0 A;  3TXN A;  5FQ6 A;  2OOE A;  2C2L A;  4LCT A;  2HM8 A;  3IBE A;  3QKY A;  4GZC A;  2Y4U A;  2PQR A;  4XZ4 A;  2MRI A;  3CHQ A;  3MZL B;  3FTS A;  5CCM A;  2CHW A;  5JJT A;  2XGM A;  3HVE B;  2VQ2 A;  3IKO B;  3D3M A;  3ZW3 A;  3ZHE A;  1HZ4 A;  4E85 A;  5HI7 A;  3HYM B;  1NZN A;  3VLF A;  5AIJ A;  4GYY A;  4U8H A;  3LJ3 A;  2R59 A;  5BW8 C;  1HS6 A;  2CG2 A;  1P5Q A;  3MV2 B;  4NAC A;  4PDX A;  4CEM A;  3AS4 A;  3TXM A;  3FTX A;  3QJZ A;  4UQX A;  2XRZ A;  4GPK A;  2L0T B;  1HU3 A;  1JPL A;  3QNK A;  3P2B A;  2I1K A;  3LCA A;  3S7F A;  5BT1 A;  4HS2 A;  2I2O A;  2KCK A;  5KJM A;  2WXO A;  4B8A A;  1QNF A;  2V4L A;  3ZGQ A;  2OV8 A;  2RG8 A;  3FUM A;  4U63 A;  5A6C A;  4NUR A;  4GZD A;  2FO7 A;  5CMY A;  3ZFW A;  3VTY A;  3CVP A;  4FLH A;  3LYA A;  4FHK A;  3DPD A;  4KZC A;  4UQY A;  3BEE A;  4C9B B;  1OWM A;  2AXZ A;  4WND A;  4FU3 A;  4GZ3 A;  4O6F A;  1DVP A;  5FJY A;  3FH5 A;  3HIZ A;  4UWG A;  3B7U X;  3FUH A;  4I43 A;  2KZT B;  3FU5 A;  3ONK A;  3CHR A;  5G04 C;  1E90 A;  3I3N A;  3MX3 A;  4FC8 A;  4W9R A;  1TJF A;  1N54 A;  2BTD A;  3CHO A;  3FUJ A;  5A7D B;  4BWR A;  1HO8 A;  1QQE A;  3FEY A;  4HLE A;  5KJL A;  3I4R B;  3JCK C;  3TJP A;  2A4Z A;  2J49 A;  5KJN A;  4M3O A;  4AVX A;  3MKQ A;  5JHA A;  1Z6T A;  1OUV A;  3CSF A;  2WQ7 A;  3CVN A;  3RRM B;  3CIA A;  4DPR A;  3T5X A;  2OVB A;  3FY4 A;  1JWF A;  3UT8 A;  2XRY A;  5ARF A;  2WXG A;  3PE4 A;  1UN8 A;  5FWQ A;  4PS3 A;  4YVO A;  4U07 A;  2X38 A;  4AY6 A;  4J8D A;  3LKU A;  3ESK A;  4OVU A;  2GRL A;  1SZ9 A;  3SI5 A;  2LO6 A;  3G2T A;  3CK7 A;  4BFR A;  3KD7 A;  1X5B A;  2V5F A;  3D9M A;  4I6E A;  4L2Y A;  1JWG A;  3VTX A;  3APC A;  2J09 A;  3QB2 A;  4XIF A;  3D9P A;  4FP7 A;  1Y8M A;  3D9N A;  2LSV A;  1E8X A;  4G24 A;  4U0U A;  4JZY A;  2DCP A;  2X3M A;  4J0U A;  4GAA A;  5BPP A;  4JXT A;  4UWK A;  3RJV A;  3I5P A;  2WXR A;  5JJ6 A;  4DJA A;  1OWO A;  2AXV A;  2IU1 A;  2XPY A;  4L2L A;  1N52 A;  1UJK A;  1E8Y A;  3R9A B;  3PUK A;  2ION A;  2WM9 A;  4AEZ C;  3HDX A;  4U0Z A;  4G2V A;  3S7J A;  1E7V A;  2DBA A;  3B13 A;  2UY1 A;  4AXH A;  4HVB A;  5J08 A;  2WQ6 A;  2XPZ A;  2I9C A;  4ANW A;  4KVO A;  3CVV A;  4N3A A;  1B89 A;  2LSU A;  2NSZ A;  4OVV A;  5EX0 A;  2CHZ A;  3FUI A;  4MS6 A;  2XQ0 A;  3SBS A;  2LAI A;  4L7T A;  2WQH A;  4GCN A;  3Q4A B;  3CVQ A;  2NC9 A;  4HOS A;  1U3C A;  1A17 A;  2IFU A;  3FUF A;  4JW1 A;  2Y4T A;  3QWW A;  4U0S A;  3D9J A;  3TAX A;  4PS7 A;  4UWF A;  4E6H A;  3ESL A;  3SBT B;  4UWL A;  4HOR A;  2VGX A;  4H7X A;  4UI9 K;  2OVF A;  3FUN A;  2J4D A;  3ZRH A;  2JEK A;  5DIZ A;  3B7T A;  2XCB A;  3EHM A;  1NA3 A;  3ZYL A;  1HF8 A;  3CHP A;  4I1A A;  2HO1 A;  4K0R A;  4RSY A;  4BSX A;  4G26 A;  2VYI A;  4BX9 A;  4BT9 A;  5C1D A;  5CHE E;  1Y6I A;  3PRE A;  4F7A A;  3D9L A;  4RG6 A;  2XHE A;  2PM6 A;  2AXU A;  2L6J A;  2PQN A;  4CDM A;  2WXK A;  4WNF A;  3IV0 A;  3BG1 B;  2IQC A;  5D0Q D;  3D9O A;  1WAO 1;  4I6G A;  5E76 A;  3NF1 A;  2VTB B;  4GML A;  2IOL A;  3QAR A;  3C98 A;  3RO2 A;  4UWH A;  3NZS A;  4I1M A;  3LPZ A;  2WXP A;  2CG3 A;  1IYG A;  2J4B A;  4XI9 A;  4FJY A;  3CVL A;  2QFC A;  2L9B A;  1HFA A;  3G2S A;  3KAE A;  4AY5 A;  2WXF A;  1HX8 A;  3AU4 A;  3OAW A;  4RVB A;  4FHJ A;  3FU6 A;  4ILH B;  4YVQ C;  2ZU6 B;  2XCC A;  3SZ7 A;  4KT6 B;  1SQM A;  3HHM A;  4DI3 A;  4EEC A;  1KLX A;  4GA2 A;  1FVH A;  2GW1 A;  3UX4 A;  2VSY A;  4AJW A;  3CKC A;  1SZA A;  2LNI A;  5LOZ A;  4I2Z A;  4AP2 A;  3ZEF A;  2FI7 A;  3ULQ A;  2V8S E;  5ANL A;  1Z3Y A;  4WWO A;  3CLJ A;  1YA0 A;  3FTW A;  3GZS A;  3PVL A;  4I6J A;  4XKC A;  2CFU A;  4AV7 A;  3CVY A;  3L17 A;  5G04 J;  4JA9 A;  4GA0 A;  3LY8 A;  1FCH A;  5KCM A;  1EYH A;  4Q69 A;  3PEU B;  1H0A A;  4HOU A;  3PNT B;  5AYW D;  4J8E A;  4KYO B;  1HXI A;  3AS8 A;  4GZ6 A;  3GYZ A;  1PC2 A;  4NRH B;  1S0P A;  1HE8 A;  4KXK B;  5ENN A;  5EX3 A;  5ARG A;  3Q49 B;  4CDN A;  3ZVV A;  2WXM A;  2FEZ A;  2Y3A A;  3PNL B;  3UPV A;  2BUG A;  4DK5 A;  3RO3 A;  2HYZ A;  3ASF A;  3BG0 B;  5BUZ A;  4XKB A;  3L54 A;  3RIB A;  1XGW A;  4H7Y A;  4IN3 B;  1JUQ A;  3FU3 A;  3MCX A;  4ATG A;  2E0I A;  3FUL A;  2KCV A;  4JVS A;  2VSN A;  3PEV B;  4FAD A;  4EZJ A;  1U3D A;  3SFZ A;  4DLO A;  3LVQ E;  1HH8 A;  2C0L A;  1UG3 A;  1UW4 B;  2BF0 X;  1EDU A;  5G55 A;  2VGY A;  4TUU A;  1HG2 A;  3G2W A;  3L6A A;  4CCA A;  4A3T A;  3FU0 A;  2LAH A;  3ZHE B;  4CGW A;  3ASD A;  3VLE A;  5A23 A;  3FUK A;  4G1T A;  1MQS A;  3RU0 A;  2X6H A;  5FZR A;  2DIW A;  3ZIM A;  3PRZ A;  3CQC B;  1H19 A;  4EZL A;  2YHE A;  3OTN A;  3U3W A;  4EBA G;  2R17 C;  3R7R A;  3QAQ A;  5CMW A;  3LDZ A;  3CV0 A;  2FF4 A;  1IQU A;  3FP3 A;  2X6I A;  2WXH A;  2CFZ A;  4MLP A;  2X6F A;  4ILI A;  2ILR A;  5FQ8 A;  2IJG X;  2KC7 A;  3CR3 A;  2FBN A;  5M72 A;  1GW6 A;  4EZK A;  4ABN A;  3AS5 A;  3EIJ A;  4LEU A;  4KVM A;  4C0E A;  4BX8 A;  3TGO A;  1E8W A;  5FZS A;  2WMN A;  3UQ3 A;  2OND A;  2MOW A;  4JL0 A;  4TV3 A;  5ANR A;  1ELK A;  4B94 A;  5BNW A;  3AU5 A;  5D0O D;  2C0M A;  2HR2 A;  4GCO A;  1OWL A;  4UQZ A;  4Y6C A;  4ACL A;  3D9K A;  3GZ1 A;  5T3R A;  4FLB A;  2VSX E;  3MKQ B;  3MEK A;  1WM5 A;  3RK6 A;  3QOU A;  2WXI A;  4C0M A;  3G2U A;  3LXU X;  4A1G A;  5EKQ D;  4JEH A;  3JQ1 A;  4DLQ A;  5CCL A;  3ML8 A;  3HVE A;  4HOQ A;  5FZQ A;  3CVW A;  3MJW A;  4I17 A;  4A1S A;  4UI9 C;  4APO A;  4LUN U;  3FTY A;  2J07 A;  3U66 A;  4WUY A;  5FTP A;  4HOT A;  4YND A;  4JHJ A;  3PH0 C;  4R7L A;  5LCW C;  1E96 B;  2KCL A;  1H2T C;  2GGF A;  2R5S A;  3DBS A;  4ILG A;  3PE3 A;  3FFL A;  3FH7 A;  5FQ4 A;  3SGH A;  3ZXS A;  3GW4 A;  3MV3 B;  3CQG B;  3ZYK A;  4AIF A;  3U9W A;  4GYW A;  5FT9 A;  3UUX A;  3LY7 A;  2IF4 A;  3WXX A;  1IQR A;  1ELR A;  4D10 C;  4EPZ A;  3L22 A;  2A5U A;  4XI0 A;  3Q47 B;  3Q15 A;  3ASG A;  1LF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...