3ESKA

Structure of hop tpr2a domain in complex with the non-cognate hsc70 peptide ligand
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
128
structure length
128
Chain Sequence
GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Stress-induced-phosphoprotein 1
publication title Electrostatic interactions of Hsp-organizing protein tetratricopeptide domains with Hsp70 and Hsp90: computational analysis and protein engineering.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eskA00
4IN3B 1HXIA 2C2LA 3Q47B 2XGMA 3KAEA 2UY1A 4N3AA 4GYOA 3EDTB 3QWWA 4NRHB 2KC7A 4GZ5A 4KBQA 3QOUA 2XEVA 2XCBA 4WNEA 4YVOA 5JJTA 3ZN3A 4U0ZA 3GZ2A 5G04C 1Y8MA 4Y6CA 4GCOA 5FZQA 3MA5A 4J8DA 3LY7A 3ESKA 4I17A 4I2WA 3QWVA 3GZ1A 4JA7A 5CCLA 4N3CA 4GZ6A 4G23A 3ZGQA 3ZHEA 2UWJG 3CK7A 4WNDA 5JJ6A 2IF4A 3OXGA 1E96B 5A6CA 4KXKB 5EKQD 4AM9A 3HYMB 3AS8A 3RO3A 3LCAA 2KATA 3AS4A 3WXXA 3PE4A 3S7BA 2Y4TA 4J0UA 3LY8A 1ELWA 3TG5A 3LY9A 4GYWA 3UPVA 2VGXB 3ULQA 5FJYA 3GW4A 5HI7A 3VTYA 4GA2A 1IHGA 4WNFA 2IFUA 4JHRA 4O6FA 3CK9A 3U3WA 4XI9A 4J8FA 4RG9A 3RO2A 4RG6A 5FZRA 4U0SA 2XGSA 3S7FA 4G24A 3KS2A 5ARGA 4HORA 2XPIA 3CVQA 2HR2A 1NZNA 1P5QA 2PQRA 3URZA 2L6JA 4W9RA 3SF4A 4JL0A 4B94A 1YA0A 3Q4AB 5G05C 3FFLA 5EX3A 4GA1A 1HH8A 4APOA 2P58C 2YQ8A 4ME2A 5D0OD 2WPVA 5EX0A 3MEKA 4WNGA 4Y6WA 4XI0A 4AIFA 4I9EA 4GYYA 3O48A 3BEEA 2GW1A 1WM5A 1XNFA 4UQZA 4JA9A 4U0UA 4UI9K 2HYZA 5BT1A 2WQHA 3FWVA 4N39A 3TAXA 3AS5A 2KCKA 3PDNA 3RJVA 4HOUA 5HQ8A 2R5SA 4GZ3A 3Q49B 5LCWC 3IEGA 5A7DB 2JLBA 4J8EA 4HOQA 2LSVA 4CDRA 4LEUA 4ABNA 2AVPA 1ZU2A 4UI9C 2FO7A 3Q15A 5D0QD 2LNIA 5FTPA 3LYAA 3ZHEB 2C0MA 5FZSA 1OUVA 4CGWA 2Q7FA 4HOSA 5DBKA 4G25A 3U4TA 3PE3A 3RKVA 1ELRA 4KYOB 5DIZA 4F3VA 4AY5A 2DBAA 3CKCA 5JJ7A 4I9CA 3RU0A 3CK8A 1A17A 2VYIA 3MV3B 1KLXA 5KJKA 4A1SA 2Y4UA 3ASGA 4XIFA 3K9IA 3UUXA 1HZ4A 5G04J 4G2VA 3QDNA 1WAO1 2KCLA 2VQ2A 5KJLA 2FBNA 4UQXA 2J9QA 2QFCA 2I6HA 3QWPA 2NC9A 3TGOA 4YNDA 3CKBA 4NQ0A 5BNWA 3CVLA 3OXFA 4N2SA 4BT8A 1TJCA 4YVQC 3RIBA 4BWRA 3OXLA 2MHKA 3JYSA 2HO1A 1KT0A 3E4BA 4G1TA 3KD7A 1IYGA 1NA3A 1W3BA 3CVNA 4N2QA 2VSNA 4AY6A 3TG4A 2VGYA 5KJNA 5ARFA 2ONDA 3CEQA 5M72A 3UQ3A 2UY1B 4GCNA 3NF1A 4GPKA 1KT1A 1ZBPA 3N71A 3ZFWA 4U07A 3MV2B 4CGVA 2PL2A 3ASHA 4H7YA 1QZ2A 1NA0A 3ZPJA 2VSYA 3CVPA 4UQYA 4WUYA 4EQFA 2LSUA 2FF4A 4H7XA 5FT9A 3SZ7A 5G05J 3ASFA 2E2EA 5BW8C 3GYZA 1B89A 2VGXA 4GA0A 2OOEA 4BT9A 4I1AA 2PZIA 3R9AB 3VTXA 2XCCA 3ASDA 4N5CA 3LPZA 3Q5MA 3CV0A 2KCVA 2FEZA 4BTAA 4HOTA 4I2ZA 3QKYA 1FCHA 1QQEA 2C0LA 5KJMA 3LKUA 3FP3A 2BUGA 2YHCA 4BTBA 5LCWJ 4N3BA 5CHEE 2V5FA 1PC2A 5AYWD 4U04A 5C1DA 2XGOA 5CCMA 3MKRA 4UI9J 2FI7A 3S7JA 2PQNA 3S7DA 4G26A
chains in the Genus database with same CATH superfamily
2Y0BG 4URKA 4CCAA 2EILE 2GRPB 3L82A 1HXIA 3C98A 2P9IG 3Q47B 2ETAA 3C3OA 4GYOA 3EDTB 3CSTA 4NRHB 2KC7A 5FINA 2XEVA 1RW2A 2XCBA 4WNEA 3MKQB 4UWKA 4GCOA 1U3CA 3AG4E 4RVBA 3NZUA 3LVQE 3PREA 3EHMA 2DZNA 2J07A 3AU4A 4GZ6A 3ZGQA 2P9PG 4WNDA 2PM6A 4RLYA 4RSYA 2J8SD 4ACLA 2A4ZA 2NSZA 3CHMA 1MX4A 3HYMB 1TNZA 4Q94A 3D3MA 1BLXB 4P29A 4KVMA 2WMNA 1LD7A 1UJKA 3LCAA 4NACA 2OEVA 2IQCA 1NL4A 3JQ1A 2KBXA 3PE4A 4CDNA 4TUMA 3CLJA 5ENPD 3PUKA 3TG5A 4PH4B 4GMLA 2WXLA 3T8KA 2V8SE 3L16A 1IHBA 3RSEG 5C2YA 2P2CP 3I3NA 3CIAA 3RAUA 2IFUA 4JHRA 2EIME 3CK9A 3U3WA 2P9KG 3ABKE 1ZB1A 2XGSA 5ENNA 4G24A 5JHBA 1UN8A 3NQPA 4HORA 4BEPA 2X6IA 3APFA 4I6JA 1OWLA 1P5QA 2BKKB 2PQRA 2MYOA 3PZ3A 4F1PA 2ZU6B 3HVEA 4BETA 3EU9A 2WXFA 3E33A 3APDA 3Q4AB 2AWIA 4GTTA 2CHXA 4K5AB 5AJLA 3FUKA 4FJYA 3PEUB 2XPYA 3UXGA 3LDZA 4I9EA 4DX7D 2J09A 3BEEA 4LG6A 4YDWA 2E0IA 3E37A 3FHEA 4JA9A 4L7TA 2WQHA 2WB2A 4IYPA 4XX5A 4N39A 3DPYA 4RQIA 1IXVA 3L9TA 4TXQA 3SFZA 1N4RA 2ZGDA 2HM8A 4FLHA 3U64A 1OXJA 3JCKC 1DCQA 2GRNB 3IBEA 1OWMA 5FQ6A 5LCWC 5A7DB 3PH0C 5ENTD 4HOQA 4CDRA 5CMYA 2AVPA 2FO1E 4U96D 3ZUVB 2EINE 3UX4A 3KSLA 3Q15A 4XKCA 3LYAA 5EN5D 3JUEA 3DBSA 2VTBA 2ZISA 5DBKA 3TWWA 3U4TA 3PE3A 1ELRA 5DIZA 2DBAA 4EZKA 5JJ7A 4Q96A 2WXJA 3ABME 2AW6A 1TN8A 3FDHA 3ASGA 2VSOE 5LP0A 2XS8A 2X6KA 3TWUA 3QDNA 1WAO1 3ZXPA 2XZTG 1EF1C 5CRUA 2V4LA 5EYLA 3UM1A 1SVXA 4GMJA 4FU3A 1H6OA 2LO6A 4XE0A 2GRLA 3CKBA 3PUJA 4B8CB 5BNWA 5CMWA 5EIDA 3RRNB 4JHKA 4YVQC 4BWRA 3OXLA 4L9PA 3CR3A 4U8YD 1DCEA 2LXLA 4BESA 2P9UG 1AWCB 1KT0A 4U8HA 3ASOE 1JCRA 3E30A 1OCZE 3JXIA 3FTVA 4N2QA 4AY6A 4PDXA 5KJNA 2WXQA 4KZ0A 4DJAA 4GCNA 4A63B 3PRZA 3QC1A 4U07A 2IO3C 2VGEA 3JUIA 4F7AA 3FTWA 3MV2B 1H6KA 1K3ZD 3ZYMA 4CGVA 4FLBA 3TWRA 1D9SA 2J08A 3ZPJA 2VSYA 4UQYA 3P2BA 3UI2A 2FF4A 4BSXA 1N9AA 4LRZA 4E85A 3SZ7A 3EJNA 5KCMA 5ENOD 3DXKG 2AXVA 3DSWA 4LSZE 2P9SG 2YNQA 4JW1A 5KNHD 3MCXA 4UWFA 5CEAA 2OOEA 4GZCA 4I1AA 3Q9NC 4BT9A 2PZIA 1UOHA 3VTXA 3ASDA 3LPZA 5J90A 2ZIRA 2KCVA 1KPSB 2RG8A 4FHJA 2FEZA 3G2VA 3QARA 4EHMA 3HDXA 4WWNA 4B0ZA 1HS6A 4WWOA 3CHQA 2BUGA 2YHCA 5AQAA 3D9MA 3PNLB 3SO8A 2DWZA 2XEEA 3SI5A 2XZDG 1EDUA 2H6GA 4BY6A 2NXPA 3D9JA 4UI9J 2FI7A 3B7BA 3ZW3A 3FUDA 4OVUA 2F0YA 3FUEA 2XPZA 3LS8A 2C2LA 3UMVA 2BF0X 3PEVB 2UY1A 3JXJA 4N3AA 4DX6D 3FU5A 3DSUA 2IOLA 3I4GA 2RFMA 2I2OA 5JJTA 4YDEA 3B13A 5G04C 5FZQA 3MA5A 4J8DA 3R7RA 3ZKJA 3HRAA 3PZ1A 3ESKA 1H2VC 2P9LG 2QC9A 4I1MA 4ANVA 3FU3A 4G8LA 4C0EA 3T5VA 2CHZA 4G23A 1H19A 4XZ4A 5JHAA 5JJ6A 4QQIA 1OY3D 2J4DA 3Q79A 5IY5E 4LERA 2IF4A 1JCQA 3RK6A 3OXGA 3L22A 3FTYA 3CGHA 5A6CA 4KXKB 4U8VD 2P9NG 3AS8A 4K5CA 1V55E 3SD5A 1MYOA 3ASNE 3RO3A 4HB5A 5FQ4A 4JD2G 1WDYA 4J0UA 3LY8A 3B7UX 3ESLA 2RKKA 3UIPC 3LY9A 4GYWA 3UPVA 3U66A 2VGXB 2R03A 3HXBA 5FJYA 3ZYQA 2IONA 2GRMA 3JQ0A 3V2OA 5AIJA 1IHGA 4WNFA 1OT8A 2DIWA 4V3IA 2XENA 3RO2A 1E8XA 5FZRA 1N4QA 3T5XA 1MX2A 3S7FA 2DCPA 3FEXA 4LUNU 3KS2A 2VSXE 2WXRA 3URZA 5LFAA 4W9RA 1AP7A 2ZGGA 1NI1A 1YA0A 4IULA 4EBAA 3FFLA 5EX3A 4APOA 5CBOA 1UG3A 2P58C 2YQ8A 1N52A 2IOSA 1YMPA 3SQVA 1FPPA 5E75A 3TXNA 3Q9UC 2WM9A 3MKQA 5EX0A 1DNPA 1LTXA 4GYYA 3O48A 2EIKE 3VLDA 1HO8A 3QB2A 3PZ2A 4UQZA 3D9NA 5BPPA 4U0UA 4LNBA 3FWVA 4BERA 1TNBA 2I1JA 3RJVA 3SBTB 2R17C 4GZ3A 3PNTB 3V79K 3SGHA 3HHMA 3J5PA 1IQUA 3IEGA 4UWGA 4EECA 3HXEA 4B89A 4LEUA 4IRUA 2LUHA 3DXMG 3UT7A 4U63A 4BFRA 4JEHA 1UW4B 1O1SA 2XRYA 5FTPA 5FZSA 4CGWA 4G25A 3ZVVA 4F3VA 3CHPA 1N11A 3CK8A 1A17A 2H6HA 4O60A 1UN9A 2VYIA 4AVXA 3C5RA 4A1SA 3W9FA 5D2MC 5ANRA 3K9IA 3SBSA 4G2VA 2J49A 1S63A 4NIKA 4ILHB 2AJAA 5KJLA 2FBNA 3LVRE 3FUMA 3D9IA 3AAAC 2QFCA 1Z6TA 2NC9A 4U95D 3TGOA 2KXPC 3ENEA 4TV3A 5HS0A 3DRAA 2X6HA 4KVOA 4EPZA 3CVLA 3OXFA 4TXRA 3EU5A 3RIBA 3PZ4A 4CEMA 3QJZA 2HO1A 4BX9A 3E4BA 5LX8A 3KD7A 4D10C 3HVEB 1IYGA 3ZYKA 4F6RD 3Q7AA 3LJ3A 2QYUA 3J5QB 2VSNA 3HIZA 3TG4A 2VGYA 2WXGA 5AQBA 2ONDA 2Y3AA 3IHVA 4Q69A 1Z5SC 2BTDA 2YHEA 4GPKA 3N71A 4TXPA 5BV0A 3FU0A 3IKOB 1OWPA 4CYMD 3W9GA 4J7WA 4GU5A 2LXMA 3ASHA 4ANWA 4H7YA 1S70B 5HKPA 3L08A 4GPMA 4K03A 4Z68A 3ABLE 3MZLB 1HU3A 3DSVA 4KZCA 4DLOA 5G05J 3F6QA 3AG3E 5BV1A 2RD0A 1PAQA 4K5BA 4CT4A 4UUCA 5T4YA 4C9BB 1RZ4A 3R9AB 3EHNA 4N5CA 1PY1A 3CV0A 1KZPA 1JPLA 2A5EA 4BTAA 2FULA 2X6JA 5EIBE 1FCHA 3C72A 4M3OA 1QQEA 3UINC 1INZA 4AP2A 1DVPA 1OCOE 1VDYA 1D8EA 1NP7A 3FU6A 3UKRG 5CHEE 3EUVA 1PC2A 1Q2ZA 4GTSA 5AYWD 1KZOA 2IO2C 4U04A 4L2YA 1WY6A 4JC8A 3L54A 5AQ9A 5CCMA 3S2AA 2IJGX 3S7DA 4G26A 3G2UA 2WVIA 2B6CA 3PVLA 1HG2A 3KAEA 3QWWA 3FTUA 4GZ5A 5AN8A 4KBQA 1QNFA 1N0QA 2ETBA 3IHYA 4U0ZA 3GZ2A 4HLLA 1Y8MA 4Y6CA 3CHRA 4DX1A 3MX3A 1E8WA 4M7CA 3ZRHA 4I17A 3QWVA 5CRVA 3ULYA 5ENQD 1S0PA 2X6FA 3ZHEA 3O4ZA 3RRMB 1UJJA 3FTXA 1MJ0A 3HXFA 2GGFA 4L2LA 3SY2A 4WAFA 2PM7A 5EKQD 4AM9A 2R2LA 4DI3A 2F37A 2R05A 4O1OA 4B8AA 2EIJE 3AS4A 4APFA 4FULA 1OWNA 4I6EA 1ELWA 3ZYLA 1A5EA 3ULQA 2EQXA 3GW4A 4GA2A 4F53A 3G2WA 1FVHA 4XI9A 1E90A 4RG9A 4FADA 4FA6A 1X5BA 5B1AE 3ML8A 5ARGA 4JXTA 3P1UA 3QK0A 1ELKA 1E8ZA 2DYRE 3TWQA 2WXPA 3KEAA 3CVQA 4O1PA 1O1RA 4GTQA 2HR2A 4PS8A 2H6IA 5ENRD 5ITZF 3SF4A 4JL0A 3SFYA 4MKTA 4XEIG 4GA1A 2BKGA 1LD8A 5JMND 4GMRA 1GW6A 4WNGA 4Y6WA 4XI0A 4AIFA 4UWHA 4HBDA 3KSQA 2CHWA 2KZTA 2GW1A 3FUNA 1WM5A 2WXMA 1XNFA 3MJWA 5CERB 1QBQA 4UI9K 1TYQG 2HYZA 3ISMC 5CBNA 4ILIA 1BI8B 4DX2A 3TAXA 4MBGA 2QY7A 2KCKA 3PDNA 1SA5A 3UT8A 3FUHA 5FIOA 4B93B 4HOUA 5HQ8A 4ZFHA 3HG0D 3DEPA 1K1AA 4GTPA 4XKBA 4ACKA 5T3RA 3Q49B 4A3TA 2JLBA 4J8EA 3B7SA 3FH8A 5KWDA 1N54A 3VLFA 1K8KG 4UI9C 3R7QA 1DC2A 2C0MA 2MOWA 1OUVA 1E8YA 3FUJA 1JWGA 4HOSA 4KYOB 1MZCA 4AY5A 3DPDA 4I9CA 2ILRA 2L0TB 3MV3B 3L6AA 3QAQA 5KJKA 4OAUC 4GB9A 3QNKA 2Y4UA 4JPSA 5BXOA 4XIFA 2CG3A 3FH7A 1HZ4A 2ETCA 3D9PA 2F8XK 2RFAA 2R59A 2XHEA 4HI9A 5BXUA 1BD8A 3V2XA 3ONKA 5G55A 4UQXA 2XQ0A 1LF8A 2DZOA 2R02A 4ANUA 1HFAA 4HFGA 3R9MA 4JEUA 3E32A 2H6FA 4HRNA 3ONLA 3D9KA 4HQDA 1TJCA 3C3RA 4ANXA 2XS1A 3DSSA 2MHKA 3JYSA 3CHOA 5B3SE 3HXCA 1TR4A 4J6IA 4G1TA 3B7RL 2HE0A 3B7TA 4FC8A 3FY4A 1NA3A 3VLEA 2WQ7A 5CEDB 3ZXSA 3HXDA 3PZDA 3CEQA 4PS3A 3BU8A 2QYJA 3BG1B 1BI7B 3BQOA 3UQ3A 3EHRA 2Y69E 3UM3A 3TWVA 3ZFWA 4A1GA 1O5MA 4C48B 2XRZA 3Q75A 1XGWA 4BX8A 1E7UA 2PL2A 3CVXA 4KMOA 1BU9A 3DSXA 1MQSA 3GZSA 1QZ2A 1D8DA 5AAOA 3CVPA 4JZYA 5ENSD 2CG2A 3IXEA 4EQFA 1NFIE 4H7XA 5FT9A 4PS7A 3UT4A 3CSFA 3ASFA 3L13A 2E2EA 3AJIA 1IQRA 4BSZB 5HRYA 1B89A 2V0PA 3IV0A 5LOZA 1U2VG 3CQCB 5A23A 2JABA 4U7EB 3B95A 3KEZA 3Q5MA 4HNAD 4I1OB 4HOTA 3QKYA 3EIQC 3FTZA 3SFXA 3AG1E 5KJMA 3CVWA 3L17A 4BTBA 4DLQA 3I5PA 4C0MA 2WQ6A 5LCWJ 3ML9A 2ZXWE 3OAWA 4LNGA 4TRQA 5C1DA 4HLEA 4J8SA 2X38A 2XGOA 2I9CA 1H6PA 2OEWA 3AU5A 3S7JA 3TL5A 4AOFA 2LAIA 4OYSA 3SNXA 4J8YA 4IN3B 3AG2E 1OCRE 5T8IA 1BPOA 2I1KA 2XGMA 3ZNGA 2V4HC 1H2TC 2VJ8A 4CRWA 5B1BE 1TNOA 2B0OE 4CT0A 3CVUA 3QOUA 2KM4A 5FQ8A 1H2UA 4YVOA 3U9WA 1JCSA 3ZN3A 2OV8A 4JHJA 4YDOA 3LY7A 2V5QC 1Y6IA 4MS6A 4I2WA 3GZ1A 4JA7A 5CCLA 2WXNA 3E34A 4N3CA 2L0IA 2NYJA 3EIJA 4YDYA 2BEDA 1OCCE 1E7VA 3LJNA 2UWJG 3CK7A 2MRIA 4I43A 4TUUA 1S64A 1U3DA 1E96B 4G8KA 4X8QA 2XEHA 1YCSB 4G11A 5EDSA 3Q78A 4HRMB 2WXIA 3G2SA 3WG7E 3NAWA 1N4PA 2KATA 3UM0A 2X3MA 5ANLA 3WXXA 4DUIA 2VTBB 3S7BA 2GRRB 2Y4TA 4WWPA 2F8YA 2JEKA 1EYHA 4FJZA 4MLPA 1N95A 5HI7A 1TJFA 2A5UA 4HXIA 4DPRA 3VTYA 1HG5A 4EZLA 3FUFA 2LAHA 4MRUA 4I6GA 4O6FA 5H7PA 2Y1LE 4J8FA 4RG6A 4U0SA 5CECB 2XPIA 1X81A 3ZEFA 1HE8A 5J08A 4GTRA 1NZNA 1N4SA 5BUZA 2L6JA 4B94A 3LEWA 4DI4A 3CHSA 2WMOA 5G05C 3BUAA 1HH8A 3Q7FA 3FEYA 4ME2A 5D0OD 4A55A 2WPVA 2WXOA 1MX6A 3MEKA 3D9HA 4ATGA 5FQ7A 2DYSE 5D66A 1TEZA 2IEJA 5BT1A 4OVVA 1Z3YA 3AS5A 3UKUG 3I4RB 2L6BA 1TN7A 2R5SA 3ZU7B 3UTMA 3FH5A 5EILA 3V30A 1Z3XA 2L9BA 3UIOC 3C3QA 2LSVA 4ABNA 3PS6A 1SZAA 4JVSA 4KT6B 3ULEG 1TN6A 1ZU2A 4GAAA 3MYVA 3V31A 1SW6A 4GTMA 2YINA 2AXZA 5EYPF 4HI8A 1IKND 1TNYA 2FO7A 3RRUA 2LNIA 5D0QD 5AQ7A 3ZHEB 2Q7FA 3DSTA 3RKVA 3CKCA 3RU0A 4GTVA 3NB2A 5AARA 1KLXA 3NBNB 1FT2A 2QZAA 5AJDA 4QFVA 4AXHA 4EZJA 3UUXA 1QYMA 5G04J 2KCLA 4K0RA 2VQ2A 1SQMA 3TWSA 1SA4A 3TWXA 1JUQA 2AXUA 2J9QA 2I6HA 3QWPA 1TNUA 5AENA 1N94A 4YNDA 4N5QA 4NQ0A 3MGBA 3FUIA 1WG0A 4N2SA 3APCA 4BT8A 4OAVB 3TJPA 4NURA 4PUCA 3BG0B 3FULA 2CFZA 4LNUD 1K1BA 1YYHA 3ZIMA 4DK5A 4DX5D 3DEOA 1JWFA 5FWQA 1W3BA 3CVNA 3FTSA 5KBAA 5ARFA 2IU1A 3D9OA 1N0RA 1HX8A 2DVWA 5M72A 2UY1B 1SZ9A 3NF1A 4AEZC 4CZ2D 1MHQA 1KT1A 1ZBPA 2GROB 4AV7A 2OCCE 3UM2A 2KZTB 5JA4D 4ILGA 4EBAG 1EPUA 4UWLA 1G3NB 2WXHA 2OVBA 3T8MA 4DRXE 1NA0A 5E76A 4AJWA 4WUYA 3D9LA 4FP7A 2IY0C 3G2TA 3NOCD 2LSUA 3SHFA 3TXMA 2OVFA 3LXUX 4R7LA 1FVFA 4HVBA 2WXKA 4LCTA 5BW8C 3GYZA 1OWOA 2J4BA 3T9KA 2VGXA 4FHKA 5KNGA 4GA0A 1V54E 3OTNA 4F1SA 1FT1A 3DWLG 2XCCA 2M63A 3NZSA 3TWTA 3CVVA 4I2ZA 3CVYA 4L1BA 2CFUA 1H0AA 4JB8P 4GZDA 4GTOA 2C0LA 3LKUA 3FP3A 5G2NA 2PNNA 4L23A 1L5JA 4HS2A 4E6HA 4N3BA 2V5FA 3Q73A 3NOGD 3EHQA 4HRLA 4CDMA 4ZHBA 1HF8A 3X2QE 4ATZD 2GRQB 3MKRA 3CQGB 2PQNA 1O1TA 4A3VA
chains in the Genus database with same CATH topology
2WVIA 3SNXA 4URKA 4IN3B 3FUEA 2XPZA 5T8IA 3LS8A 4CCAA 1HXIA 3C98A 2C2LA 3PVLA 1BPOA 1HG2A 3Q47B 2I1KA 2XGMA 3KAEA 3UMVA 2BF0X 1H2TC 2VJ8A 3PEVB 2UY1A 4N3AA 4CRWA 4GYOA 3EDTB 3CSTA 3FTUA 3QWWA 4NRHB 2KC7A 4GZ5A 3FU5A 2IOLA 4KBQA 4CT0A 1QNFA 3CVUA 3QOUA 2KM4A 2XEVA 5FQ8A 1H2UA 2XCBA 3I4GA 4WNEA 4YVOA 2I2OA 3U9WA 5JJTA 3MKQB 3B13A 3ZN3A 3IHYA 4U0ZA 3GZ2A 5G04C 4UWKA 2OV8A 1Y8MA 4Y6CA 3CHRA 4GCOA 5FZQA 3MA5A 4JHJA 1U3CA 3MX3A 4J8DA 1E8WA 3R7RA 3LY7A 4RVBA 3ESKA 1H2VC 3ZRHA 1Y6IA 4MS6A 4I17A 4I2WA 3NZUA 3QWVA 3GZ1A 3LVQE 4ANVA 4I1MA 4JA7A 5CCLA 3FU3A 3PREA 2WXNA 3EHMA 4N3CA 2L0IA 3EIJA 4A3VA 4C0EA 1S0PA 3T5VA 2J07A 3AU4A 4GZ6A 2CHZA 4G23A 1E7VA 2X6FA 3ZGQA 3ZHEA 1H19A 2UWJG 3CK7A 3O4ZA 4XZ4A 2MRIA 5JHAA 4WNDA 5JJ6A 3RRMB 1UJJA 3FTXA 2J4DA 2PM6A 4LERA 4RSYA 2GGFA 4L2LA 4I43A 2IF4A 4TUUA 4WAFA 3RK6A 3OXGA 4ACLA 1U3DA 1E96B 2A4ZA 3FTYA 3CGHA 3L22A 5A6CA 2NSZA 2PM7A 3CHMA 4KXKB 5EKQD 4AM9A 3HYMB 3AS8A 4DI3A 4Q94A 3D3MA 4G11A 5EDSA 4P29A 3SD5A 4KVMA 2WMNA 3RO3A 2WXIA 3G2SA 4B8AA 1UJKA 3LCAA 2KATA 3AS4A 5FQ4A 4NACA 4APFA 2X3MA 2IQCA 3JQ1A 5ANLA 3WXXA 3PE4A 4CDNA 2VTBB 3S7BA 3CLJA 4FULA 1OWNA 2Y4TA 4I6EA 4J0UA 3LY8A 1ELWA 3ZYLA 3PUKA 3B7UX 3TG5A 3ESLA 4PH4B 4GMLA 2WXLA 4WWPA 2V8SE 3L16A 3LY9A 4GYWA 3UPVA 3U66A 2VGXB 2JEKA 3ULQA 1EYHA 5FJYA 5C2YA 4FJZA 2EQXA 2IONA 3GW4A 3I3NA 4MLPA 5HI7A 3ZYQA 1TJFA 2A5UA 4HXIA 4DPRA 2GRMA 3VTYA 3CIAA 4GA2A 4F53A 1HG5A 3JQ0A 4EZLA 3G2WA 5AIJA 1IHGA 3FUFA 4WNFA 2IFUA 1FVHA 2DIWA 2LAHA 4JHRA 4MRUA 4V3IA 4I6GA 4O6FA 3CK9A 3U3WA 4XI9A 1E90A 4J8FA 4RG9A 3RO2A 1E8XA 4RG6A 5FZRA 4U0SA 3T5XA 2XGSA 3S7FA 4FADA 2DCPA 3FEXA 5ENNA 1X5BA 4FA6A 4G24A 3KS2A 4LUNU 5JHBA 3ML8A 5ARGA 1UN8A 4JXTA 3NQPA 4HORA 2VSXE 2XPIA 3P1UA 2X6IA 3QK0A 1ELKA 1E8ZA 2WXRA 3APFA 2WXPA 4I6JA 3ZEFA 1HE8A 3CVQA 1OWLA 5J08A 2HR2A 4PS8A 1NZNA 1P5QA 2PQRA 3URZA 5BUZA 5LFAA 2ZU6B 2L6JA 3HVEA 4W9RA 4JL0A 3SF4A 4B94A 3LEWA 2WXFA 4DI4A 1YA0A 3CHSA 4IULA 4MKTA 2WMOA 3APDA 3Q4AB 5G05C 4EBAA 2AWIA 3FFLA 5EX3A 4GA1A 1HH8A 4APOA 2CHXA 1UG3A 2P58C 2YQ8A 3FEYA 5AJLA 4ME2A 3FUKA 5D0OD 1N52A 4A55A 2IOSA 2WPVA 2WXOA 5E75A 4FJYA 3TXNA 3PEUB 2WM9A 2XPYA 3MKQA 5EX0A 1GW6A 1DNPA 3MEKA 4WNGA 3LDZA 4Y6WA 4XI0A 4AIFA 4I9EA 4GYYA 4ATGA 2J09A 3O48A 4UWHA 5FQ7A 3BEEA 2CHWA 2KZTA 2GW1A 3VLDA 1TEZA 3FUNA 1HO8A 1WM5A 2E0IA 2WXMA 3QB2A 1XNFA 3MJWA 4UQZA 3D9NA 3FHEA 4JA9A 4U0UA 4UI9K 5BPPA 2HYZA 4L7TA 5BT1A 2WQHA 4ILIA 2WB2A 3FWVA 4IYPA 4OVVA 4XX5A 4N39A 3TAXA 2QY7A 1Z3YA 3AS5A 2KCKA 3SFZA 3PDNA 3UT8A 2I1JA 3FUHA 3I4RB 3RJVA 2HM8A 4FLHA 4HOUA 5HQ8A 3SBTB 2R17C 2R5SA 3U64A 4GZ3A 3JCKC 3PNTB 4XKBA 4ACKA 3FH5A 3IBEA 3SGHA 1OWMA 5FQ6A 5T3RA 3HHMA 1Z3XA 3Q49B 1IQUA 3IEGA 5LCWC 5A7DB 4UWGA 4A3TA 2JLBA 4J8EA 3PH0C 4EECA 4B89A 2L9BA 4HOQA 2LSVA 4CDRA 5CMYA 3B7SA 4LEUA 4IRUA 4ABNA 3PS6A 1SZAA 4JVSA 4KT6B 3FH8A 2AVPA 1ZU2A 1N54A 4GAAA 3VLFA 3MYVA 3UT7A 4UI9C 4U63A 4BFRA 3R7QA 2YINA 4JEHA 2AXZA 1UW4B 2XRYA 2FO7A 3UX4A 3RRUA 2LNIA 3Q15A 4XKCA 5D0QD 5FTPA 3LYAA 3ZHEB 2C0MA 5FZSA 2MOWA 3DBSA 2VTBA 1OUVA 1E8YA 3FUJA 1JWGA 2Q7FA 5DBKA 4G25A 4CGWA 3ZVVA 3U4TA 3PE3A 3RKVA 1ELRA 4KYOB 5DIZA 4F3VA 4AY5A 3DPDA 3CHPA 2DBAA 4EZKA 3CKCA 5JJ7A 4Q96A 4I9CA 3RU0A 3CK8A 1A17A 2WXJA 1UN9A 2AW6A 2ILRA 2L0TB 2VYIA 3MV3B 3L6AA 3QAQA 1KLXA 4AVXA 5KJKA 4GB9A 3FDHA 4A1SA 3QNKA 2Y4UA 4JPSA 3ASGA 4XIFA 2CG3A 5ANRA 3K9IA 3SBSA 5AJDA 4QFVA 4AXHA 4EZJA 3FH7A 3UUXA 1HZ4A 5G04J 2VSOE 5LP0A 2X6KA 3D9PA 4G2VA 2J49A 3QDNA 1WAO1 2R59A 1EF1C 4ILHB 2XHEA 2KCLA 4K0RA 2VQ2A 2V4LA 5KJLA 1SQMA 2FBNA 3LVRE 3FUMA 3ONKA 5G55A 3D9IA 4GMJA 1JUQA 2AXUA 2XQ0A 1LF8A 2J9QA 2QFCA 4FU3A 2I6HA 4UQXA 3QWPA 4ANUA 1HFAA 4HFGA 1Z6TA 2NC9A 5AENA 3TGOA 2LO6A 4YNDA 4XE0A 3ENEA 4TV3A 2GRLA 4JEUA 3CKBA 3MGBA 2X6HA 3FUIA 3PUJA 4NQ0A 4B8CB 5BNWA 5CMWA 4KVOA 3ONLA 4EPZA 3CVLA 3OXFA 4N2SA 3APCA 3D9KA 3RRNB 4JHKA 4BT8A 1TJCA 4YVQC 3TJPA 4NURA 4PUCA 3RIBA 4ANXA 4BWRA 3BG0B 3FULA 3OXLA 2CFZA 4CEMA 2MHKA 3CR3A 3JYSA 3QJZA 3CHOA 2HO1A 4J6IA 1KT0A 4BX9A 3E4BA 4U8HA 4G1TA 3ZIMA 5LX8A 3B7RL 3KD7A 4DK5A 4D10C 3B7TA 4FC8A 3HVEB 3FY4A 1NA3A 1JWFA 3VLEA 3ZYKA 2WQ7A 5FWQA 1IYGA 3ZXSA 1W3BA 3CVNA 3FTVA 3FTSA 3LJ3A 4N2QA 2VSNA 3HIZA 3PZDA 3TG4A 4PDXA 4AY6A 2VGYA 5KJNA 5ARFA 2IU1A 2WXGA 3D9OA 2ONDA 3CEQA 2WXQA 1HX8A 2Y3AA 3IHVA 4KZ0A 4PS3A 4Q69A 5M72A 3BG1B 4DJAA 3UQ3A 2UY1B 1SZ9A 4GCNA 3NF1A 4AEZC 2BTDA 1MHQA 2YHEA 4GPKA 1KT1A 1ZBPA 3N71A 4AV7A 3PRZA 5BV0A 3FU0A 3QC1A 3ZFWA 4A1GA 4U07A 3IKOB 2KZTB 3JUIA 4ILGA 4F7AA 1OWPA 4EBAG 3FTWA 1EPUA 2XRZA 4UWLA 3MV2B 1H6KA 1XGWA 4BX8A 4HOSA 1E7UA 3ZYMA 2WXHA 4CGVA 2OVBA 4GU5A 2PL2A 3T8MA 3ASHA 3CVXA 4KMOA 4ANWA 4FLBA 4H7YA 1MQSA 3GZSA 1QZ2A 1NA0A 2J08A 5E76A 3L08A 3ZPJA 2VSYA 3CVPA 4UQYA 4AJWA 4WUYA 4JZYA 3D9LA 4FP7A 4K03A 3P2BA 2CG2A 3G2TA 4EQFA 2LSUA 3SHFA 2FF4A 4BSXA 3MZLB 1HU3A 3TXMA 2OVFA 3LXUX 4H7XA 4KZCA 5FT9A 4PS7A 4DLOA 4R7LA 1FVFA 4HVBA 4LRZA 3UT4A 3CSFA 3SZ7A 4E85A 5G05J 3ASFA 3EJNA 3L13A 2E2EA 2WXKA 5KCMA 4LCTA 1IQRA 5BW8C 3GYZA 1B89A 2V0PA 1OWOA 2J4BA 2AXVA 3IV0A 5LOZA 5BV1A 2RD0A 2VGXA 2YNQA 3CQCB 4FHKA 4GA0A 4JW1A 5A23A 1PAQA 3MCXA 4UWFA 4CT4A 2OOEA 5T4YA 3OTNA 4C9BB 4GZCA 4I1AA 4BT9A 4F1SA 2PZIA 3R9AB 3VTXA 2XCCA 3ASDA 3EHNA 1PY1A 2M63A 4N5CA 3KEZA 3LPZA 3Q5MA 5J90A 3NZSA 3CV0A 2KCVA 3CVVA 2RG8A 4FHJA 2FEZA 3G2VA 3QARA 4I1OB 1JPLA 3HDXA 4WWNA 4BTAA 2FULA 4HOTA 4I2ZA 3CVYA 4B0ZA 3QKYA 1HS6A 2X6JA 3EIQC 4L1BA 2CFUA 1FCHA 1H0AA 4M3OA 1QQEA 3FTZA 4WWOA 4GZDA 1INZA 2C0LA 5KJMA 3CVWA 4AP2A 1DVPA 3CHQA 2BUGA 2YHCA 3FP3A 3D9MA 3LKUA 3L17A 4BTBA 5G2NA 4DLQA 4L23A 1L5JA 3I5PA 4C0MA 2WQ6A 5LCWJ 3ML9A 1VDYA 3PNLB 4HS2A 3OAWA 4N3BA 4E6HA 1NP7A 3FU6A 5CHEE 2V5FA 1PC2A 5AYWD 4TRQA 4U04A 5C1DA 4L2YA 3SI5A 4HLEA 4CDMA 4J8SA 2X38A 1EDUA 1WY6A 2XGOA 3L54A 2NXPA 2I9CA 1HF8A 4JC8A 4BY6A 5CCMA 3S2AA 3D9JA 2IJGX 3MKRA 4UI9J 2FI7A 3AU5A 3CQGB 3ZW3A 3FUDA 3S7JA 2PQNA 3S7DA 4G26A 4OVUA 3TL5A 4AOFA 2LAIA 4OYSA 3G2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IN3 B;  1HXI A;  2C2L A;  3Q47 B;  2XGM A;  3KAE A;  2UY1 A;  4N3A A;  4GYO A;  3EDT B;  3QWW A;  4NRH B;  2KC7 A;  4GZ5 A;  4KBQ A;  3QOU A;  2XEV A;  2XCB A;  4WNE A;  4YVO A;  5JJT A;  3ZN3 A;  4U0Z A;  3GZ2 A;  5G04 C;  1Y8M A;  4Y6C A;  4GCO A;  5FZQ A;  3MA5 A;  4J8D A;  3LY7 A;  3ESK A;  4I17 A;  4I2W A;  3QWV A;  3GZ1 A;  4JA7 A;  5CCL A;  4N3C A;  4GZ6 A;  4G23 A;  3ZGQ A;  3ZHE A;  2UWJ G;  3CK7 A;  4WND A;  5JJ6 A;  2IF4 A;  3OXG A;  1E96 B;  5A6C A;  4KXK B;  5EKQ D;  4AM9 A;  3HYM B;  3AS8 A;  3RO3 A;  3LCA A;  2KAT A;  3AS4 A;  3WXX A;  3PE4 A;  3S7B A;  2Y4T A;  4J0U A;  3LY8 A;  1ELW A;  3TG5 A;  3LY9 A;  4GYW A;  3UPV A;  2VGX B;  3ULQ A;  5FJY A;  3GW4 A;  5HI7 A;  3VTY A;  4GA2 A;  1IHG A;  4WNF A;  2IFU A;  4JHR A;  4O6F A;  3CK9 A;  3U3W A;  4XI9 A;  4J8F A;  4RG9 A;  3RO2 A;  4RG6 A;  5FZR A;  4U0S A;  2XGS A;  3S7F A;  4G24 A;  3KS2 A;  5ARG A;  4HOR A;  2XPI A;  3CVQ A;  2HR2 A;  1NZN A;  1P5Q A;  2PQR A;  3URZ A;  2L6J A;  4W9R A;  3SF4 A;  4JL0 A;  4B94 A;  1YA0 A;  3Q4A B;  5G05 C;  3FFL A;  5EX3 A;  4GA1 A;  1HH8 A;  4APO A;  2P58 C;  2YQ8 A;  4ME2 A;  5D0O D;  2WPV A;  5EX0 A;  3MEK A;  4WNG A;  4Y6W A;  4XI0 A;  4AIF A;  4I9E A;  4GYY A;  3O48 A;  3BEE A;  2GW1 A;  1WM5 A;  1XNF A;  4UQZ A;  4JA9 A;  4U0U A;  4UI9 K;  2HYZ A;  5BT1 A;  2WQH A;  3FWV A;  4N39 A;  3TAX A;  3AS5 A;  2KCK A;  3PDN A;  3RJV A;  4HOU A;  5HQ8 A;  2R5S A;  4GZ3 A;  3Q49 B;  5LCW C;  3IEG A;  5A7D B;  2JLB A;  4J8E A;  4HOQ A;  2LSV A;  4CDR A;  4LEU A;  4ABN A;  2AVP A;  1ZU2 A;  4UI9 C;  2FO7 A;  3Q15 A;  5D0Q D;  2LNI A;  5FTP A;  3LYA A;  3ZHE B;  2C0M A;  5FZS A;  1OUV A;  4CGW A;  2Q7F A;  4HOS A;  5DBK A;  4G25 A;  3U4T A;  3PE3 A;  3RKV A;  1ELR A;  4KYO B;  5DIZ A;  4F3V A;  4AY5 A;  2DBA A;  3CKC A;  5JJ7 A;  4I9C A;  3RU0 A;  3CK8 A;  1A17 A;  2VYI A;  3MV3 B;  1KLX A;  5KJK A;  4A1S A;  2Y4U A;  3ASG A;  4XIF A;  3K9I A;  3UUX A;  1HZ4 A;  5G04 J;  4G2V A;  3QDN A;  1WAO 1;  2KCL A;  2VQ2 A;  5KJL A;  2FBN A;  4UQX A;  2J9Q A;  2QFC A;  2I6H A;  3QWP A;  2NC9 A;  3TGO A;  4YND A;  3CKB A;  4NQ0 A;  5BNW A;  3CVL A;  3OXF A;  4N2S A;  4BT8 A;  1TJC A;  4YVQ C;  3RIB A;  4BWR A;  3OXL A;  2MHK A;  3JYS A;  2HO1 A;  1KT0 A;  3E4B A;  4G1T A;  3KD7 A;  1IYG A;  1NA3 A;  1W3B A;  3CVN A;  4N2Q A;  2VSN A;  4AY6 A;  3TG4 A;  2VGY A;  5KJN A;  5ARF A;  2OND A;  3CEQ A;  5M72 A;  3UQ3 A;  2UY1 B;  4GCN A;  3NF1 A;  4GPK A;  1KT1 A;  1ZBP A;  3N71 A;  3ZFW A;  4U07 A;  3MV2 B;  4CGV A;  2PL2 A;  3ASH A;  4H7Y A;  1QZ2 A;  1NA0 A;  3ZPJ A;  2VSY A;  3CVP A;  4UQY A;  4WUY A;  4EQF A;  2LSU A;  2FF4 A;  4H7X A;  5FT9 A;  3SZ7 A;  5G05 J;  3ASF A;  2E2E A;  5BW8 C;  3GYZ A;  1B89 A;  2VGX A;  4GA0 A;  2OOE A;  4BT9 A;  4I1A A;  2PZI A;  3R9A B;  3VTX A;  2XCC A;  3ASD A;  4N5C A;  3LPZ A;  3Q5M A;  3CV0 A;  2KCV A;  2FEZ A;  4BTA A;  4HOT A;  4I2Z A;  3QKY A;  1FCH A;  1QQE A;  2C0L A;  5KJM A;  3LKU A;  3FP3 A;  2BUG A;  2YHC A;  4BTB A;  5LCW J;  4N3B A;  5CHE E;  2V5F A;  1PC2 A;  5AYW D;  4U04 A;  5C1D A;  2XGO A;  5CCM A;  3MKR A;  4UI9 J;  2FI7 A;  3S7J A;  2PQN A;  3S7D A;  4G26 A; 
#chains in the Genus database with same CATH topology
 2Y0B G;  4URK A;  4CCA A;  2EIL E;  2GRP B;  3L82 A;  1HXI A;  3C98 A;  2P9I G;  3Q47 B;  2ETA A;  3C3O A;  4GYO A;  3EDT B;  3CST A;  4NRH B;  2KC7 A;  5FIN A;  2XEV A;  1RW2 A;  2XCB A;  4WNE A;  3MKQ B;  4UWK A;  4GCO A;  1U3C A;  3AG4 E;  4RVB A;  3NZU A;  3LVQ E;  3PRE A;  3EHM A;  2DZN A;  2J07 A;  3AU4 A;  4GZ6 A;  3ZGQ A;  2P9P G;  4WND A;  2PM6 A;  4RLY A;  4RSY A;  2J8S D;  4ACL A;  2A4Z A;  2NSZ A;  3CHM A;  1MX4 A;  3HYM B;  1TNZ A;  4Q94 A;  3D3M A;  1BLX B;  4P29 A;  4KVM A;  2WMN A;  1LD7 A;  1UJK A;  3LCA A;  4NAC A;  2OEV A;  2IQC A;  1NL4 A;  3JQ1 A;  2KBX A;  3PE4 A;  4CDN A;  4TUM A;  3CLJ A;  5ENP D;  3PUK A;  3TG5 A;  4PH4 B;  4GML A;  2WXL A;  3T8K A;  2V8S E;  3L16 A;  1IHB A;  3RSE G;  5C2Y A;  2P2C P;  3I3N A;  3CIA A;  3RAU A;  2IFU A;  4JHR A;  2EIM E;  3CK9 A;  3U3W A;  2P9K G;  3ABK E;  1ZB1 A;  2XGS A;  5ENN A;  4G24 A;  5JHB A;  1UN8 A;  3NQP A;  4HOR A;  4BEP A;  2X6I A;  3APF A;  4I6J A;  1OWL A;  1P5Q A;  2BKK B;  2PQR A;  2MYO A;  3PZ3 A;  4F1P A;  2ZU6 B;  3HVE A;  4BET A;  3EU9 A;  2WXF A;  3E33 A;  3APD A;  3Q4A B;  2AWI A;  4GTT A;  2CHX A;  4K5A B;  5AJL A;  3FUK A;  4FJY A;  3PEU B;  2XPY A;  3UXG A;  3LDZ A;  4I9E A;  4DX7 D;  2J09 A;  3BEE A;  4LG6 A;  4YDW A;  2E0I A;  3E37 A;  3FHE A;  4JA9 A;  4L7T A;  2WQH A;  2WB2 A;  4IYP A;  4XX5 A;  4N39 A;  3DPY A;  4RQI A;  1IXV A;  3L9T A;  4TXQ A;  3SFZ A;  1N4R A;  2ZGD A;  2HM8 A;  4FLH A;  3U64 A;  1OXJ A;  3JCK C;  1DCQ A;  2GRN B;  3IBE A;  1OWM A;  5FQ6 A;  5LCW C;  5A7D B;  3PH0 C;  5ENT D;  4HOQ A;  4CDR A;  5CMY A;  2AVP A;  2FO1 E;  4U96 D;  3ZUV B;  2EIN E;  3UX4 A;  3KSL A;  3Q15 A;  4XKC A;  3LYA A;  5EN5 D;  3JUE A;  3DBS A;  2VTB A;  2ZIS A;  5DBK A;  3TWW A;  3U4T A;  3PE3 A;  1ELR A;  5DIZ A;  2DBA A;  4EZK A;  5JJ7 A;  4Q96 A;  2WXJ A;  3ABM E;  2AW6 A;  1TN8 A;  3FDH A;  3ASG A;  2VSO E;  5LP0 A;  2XS8 A;  2X6K A;  3TWU A;  3QDN A;  1WAO 1;  3ZXP A;  2XZT G;  1EF1 C;  5CRU A;  2V4L A;  5EYL A;  3UM1 A;  1SVX A;  4GMJ A;  4FU3 A;  1H6O A;  2LO6 A;  4XE0 A;  2GRL A;  3CKB A;  3PUJ A;  4B8C B;  5BNW A;  5CMW A;  5EID A;  3RRN B;  4JHK A;  4YVQ C;  4BWR A;  3OXL A;  4L9P A;  3CR3 A;  4U8Y D;  1DCE A;  2LXL A;  4BES A;  2P9U G;  1AWC B;  1KT0 A;  4U8H A;  3ASO E;  1JCR A;  3E30 A;  1OCZ E;  3JXI A;  3FTV A;  4N2Q A;  4AY6 A;  4PDX A;  5KJN A;  2WXQ A;  4KZ0 A;  4DJA A;  4GCN A;  4A63 B;  3PRZ A;  3QC1 A;  4U07 A;  2IO3 C;  2VGE A;  3JUI A;  4F7A A;  3FTW A;  3MV2 B;  1H6K A;  1K3Z D;  3ZYM A;  4CGV A;  4FLB A;  3TWR A;  1D9S A;  2J08 A;  3ZPJ A;  2VSY A;  4UQY A;  3P2B A;  3UI2 A;  2FF4 A;  4BSX A;  1N9A A;  4LRZ A;  4E85 A;  3SZ7 A;  3EJN A;  5KCM A;  5ENO D;  3DXK G;  2AXV A;  3DSW A;  4LSZ E;  2P9S G;  2YNQ A;  4JW1 A;  5KNH D;  3MCX A;  4UWF A;  5CEA A;  2OOE A;  4GZC A;  4I1A A;  3Q9N C;  4BT9 A;  2PZI A;  1UOH A;  3VTX A;  3ASD A;  3LPZ A;  5J90 A;  2ZIR A;  2KCV A;  1KPS B;  2RG8 A;  4FHJ A;  2FEZ A;  3G2V A;  3QAR A;  4EHM A;  3HDX A;  4WWN A;  4B0Z A;  1HS6 A;  4WWO A;  3CHQ A;  2BUG A;  2YHC A;  5AQA A;  3D9M A;  3PNL B;  3SO8 A;  2DWZ A;  2XEE A;  3SI5 A;  2XZD G;  1EDU A;  2H6G A;  4BY6 A;  2NXP A;  3D9J A;  4UI9 J;  2FI7 A;  3B7B A;  3ZW3 A;  3FUD A;  4OVU A;  2F0Y A;  3FUE A;  2XPZ A;  3LS8 A;  2C2L A;  3UMV A;  2BF0 X;  3PEV B;  2UY1 A;  3JXJ A;  4N3A A;  4DX6 D;  3FU5 A;  3DSU A;  2IOL A;  3I4G A;  2RFM A;  2I2O A;  5JJT A;  4YDE A;  3B13 A;  5G04 C;  5FZQ A;  3MA5 A;  4J8D A;  3R7R A;  3ZKJ A;  3HRA A;  3PZ1 A;  3ESK A;  1H2V C;  2P9L G;  2QC9 A;  4I1M A;  4ANV A;  3FU3 A;  4G8L A;  4C0E A;  3T5V A;  2CHZ A;  4G23 A;  1H19 A;  4XZ4 A;  5JHA A;  5JJ6 A;  4QQI A;  1OY3 D;  2J4D A;  3Q79 A;  5IY5 E;  4LER A;  2IF4 A;  1JCQ A;  3RK6 A;  3OXG A;  3L22 A;  3FTY A;  3CGH A;  5A6C A;  4KXK B;  4U8V D;  2P9N G;  3AS8 A;  4K5C A;  1V55 E;  3SD5 A;  1MYO A;  3ASN E;  3RO3 A;  4HB5 A;  5FQ4 A;  4JD2 G;  1WDY A;  4J0U A;  3LY8 A;  3B7U X;  3ESL A;  2RKK A;  3UIP C;  3LY9 A;  4GYW A;  3UPV A;  3U66 A;  2VGX B;  2R03 A;  3HXB A;  5FJY A;  3ZYQ A;  2ION A;  2GRM A;  3JQ0 A;  3V2O A;  5AIJ A;  1IHG A;  4WNF A;  1OT8 A;  2DIW A;  4V3I A;  2XEN A;  3RO2 A;  1E8X A;  5FZR A;  1N4Q A;  3T5X A;  1MX2 A;  3S7F A;  2DCP A;  3FEX A;  4LUN U;  3KS2 A;  2VSX E;  2WXR A;  3URZ A;  5LFA A;  4W9R A;  1AP7 A;  2ZGG A;  1NI1 A;  1YA0 A;  4IUL A;  4EBA A;  3FFL A;  5EX3 A;  4APO A;  5CBO A;  1UG3 A;  2P58 C;  2YQ8 A;  1N52 A;  2IOS A;  1YMP A;  3SQV A;  1FPP A;  5E75 A;  3TXN A;  3Q9U C;  2WM9 A;  3MKQ A;  5EX0 A;  1DNP A;  1LTX A;  4GYY A;  3O48 A;  2EIK E;  3VLD A;  1HO8 A;  3QB2 A;  3PZ2 A;  4UQZ A;  3D9N A;  5BPP A;  4U0U A;  4LNB A;  3FWV A;  4BER A;  1TNB A;  2I1J A;  3RJV A;  3SBT B;  2R17 C;  4GZ3 A;  3PNT B;  3V79 K;  3SGH A;  3HHM A;  3J5P A;  1IQU A;  3IEG A;  4UWG A;  4EEC A;  3HXE A;  4B89 A;  4LEU A;  4IRU A;  2LUH A;  3DXM G;  3UT7 A;  4U63 A;  4BFR A;  4JEH A;  1UW4 B;  1O1S A;  2XRY A;  5FTP A;  5FZS A;  4CGW A;  4G25 A;  3ZVV A;  4F3V A;  3CHP A;  1N11 A;  3CK8 A;  1A17 A;  2H6H A;  4O60 A;  1UN9 A;  2VYI A;  4AVX A;  3C5R A;  4A1S A;  3W9F A;  5D2M C;  5ANR A;  3K9I A;  3SBS A;  4G2V A;  2J49 A;  1S63 A;  4NIK A;  4ILH B;  2AJA A;  5KJL A;  2FBN A;  3LVR E;  3FUM A;  3D9I A;  3AAA C;  2QFC A;  1Z6T A;  2NC9 A;  4U95 D;  3TGO A;  2KXP C;  3ENE A;  4TV3 A;  5HS0 A;  3DRA A;  2X6H A;  4KVO A;  4EPZ A;  3CVL A;  3OXF A;  4TXR A;  3EU5 A;  3RIB A;  3PZ4 A;  4CEM A;  3QJZ A;  2HO1 A;  4BX9 A;  3E4B A;  5LX8 A;  3KD7 A;  4D10 C;  3HVE B;  1IYG A;  3ZYK A;  4F6R D;  3Q7A A;  3LJ3 A;  2QYU A;  3J5Q B;  2VSN A;  3HIZ A;  3TG4 A;  2VGY A;  2WXG A;  5AQB A;  2OND A;  2Y3A A;  3IHV A;  4Q69 A;  1Z5S C;  2BTD A;  2YHE A;  4GPK A;  3N71 A;  4TXP A;  5BV0 A;  3FU0 A;  3IKO B;  1OWP A;  4CYM D;  3W9G A;  4J7W A;  4GU5 A;  2LXM A;  3ASH A;  4ANW A;  4H7Y A;  1S70 B;  5HKP A;  3L08 A;  4GPM A;  4K03 A;  4Z68 A;  3ABL E;  3MZL B;  1HU3 A;  3DSV A;  4KZC A;  4DLO A;  5G05 J;  3F6Q A;  3AG3 E;  5BV1 A;  2RD0 A;  1PAQ A;  4K5B A;  4CT4 A;  4UUC A;  5T4Y A;  4C9B B;  1RZ4 A;  3R9A B;  3EHN A;  4N5C A;  1PY1 A;  3CV0 A;  1KZP A;  1JPL A;  2A5E A;  4BTA A;  2FUL A;  2X6J A;  5EIB E;  1FCH A;  3C72 A;  4M3O A;  1QQE A;  3UIN C;  1INZ A;  4AP2 A;  1DVP A;  1OCO E;  1VDY A;  1D8E A;  1NP7 A;  3FU6 A;  3UKR G;  5CHE E;  3EUV A;  1PC2 A;  1Q2Z A;  4GTS A;  5AYW D;  1KZO A;  2IO2 C;  4U04 A;  4L2Y A;  1WY6 A;  4JC8 A;  3L54 A;  5AQ9 A;  5CCM A;  3S2A A;  2IJG X;  3S7D A;  4G26 A;  3G2U A;  2WVI A;  2B6C A;  3PVL A;  1HG2 A;  3KAE A;  3QWW A;  3FTU A;  4GZ5 A;  5AN8 A;  4KBQ A;  1QNF A;  1N0Q A;  2ETB A;  3IHY A;  4U0Z A;  3GZ2 A;  4HLL A;  1Y8M A;  4Y6C A;  3CHR A;  4DX1 A;  3MX3 A;  1E8W A;  4M7C A;  3ZRH A;  4I17 A;  3QWV A;  5CRV A;  3ULY A;  5ENQ D;  1S0P A;  2X6F A;  3ZHE A;  3O4Z A;  3RRM B;  1UJJ A;  3FTX A;  1MJ0 A;  3HXF A;  2GGF A;  4L2L A;  3SY2 A;  4WAF A;  2PM7 A;  5EKQ D;  4AM9 A;  2R2L A;  4DI3 A;  2F37 A;  2R05 A;  4O1O A;  4B8A A;  2EIJ E;  3AS4 A;  4APF A;  4FUL A;  1OWN A;  4I6E A;  1ELW A;  3ZYL A;  1A5E A;  3ULQ A;  2EQX A;  3GW4 A;  4GA2 A;  4F53 A;  3G2W A;  1FVH A;  4XI9 A;  1E90 A;  4RG9 A;  4FAD A;  4FA6 A;  1X5B A;  5B1A E;  3ML8 A;  5ARG A;  4JXT A;  3P1U A;  3QK0 A;  1ELK A;  1E8Z A;  2DYR E;  3TWQ A;  2WXP A;  3KEA A;  3CVQ A;  4O1P A;  1O1R A;  4GTQ A;  2HR2 A;  4PS8 A;  2H6I A;  5ENR D;  5ITZ F;  3SF4 A;  4JL0 A;  3SFY A;  4MKT A;  4XEI G;  4GA1 A;  2BKG A;  1LD8 A;  5JMN D;  4GMR A;  1GW6 A;  4WNG A;  4Y6W A;  4XI0 A;  4AIF A;  4UWH A;  4HBD A;  3KSQ A;  2CHW A;  2KZT A;  2GW1 A;  3FUN A;  1WM5 A;  2WXM A;  1XNF A;  3MJW A;  5CER B;  1QBQ A;  4UI9 K;  1TYQ G;  2HYZ A;  3ISM C;  5CBN A;  4ILI A;  1BI8 B;  4DX2 A;  3TAX A;  4MBG A;  2QY7 A;  2KCK A;  3PDN A;  1SA5 A;  3UT8 A;  3FUH A;  5FIO A;  4B93 B;  4HOU A;  5HQ8 A;  4ZFH A;  3HG0 D;  3DEP A;  1K1A A;  4GTP A;  4XKB A;  4ACK A;  5T3R A;  3Q49 B;  4A3T A;  2JLB A;  4J8E A;  3B7S A;  3FH8 A;  5KWD A;  1N54 A;  3VLF A;  1K8K G;  4UI9 C;  3R7Q A;  1DC2 A;  2C0M A;  2MOW A;  1OUV A;  1E8Y A;  3FUJ A;  1JWG A;  4HOS A;  4KYO B;  1MZC A;  4AY5 A;  3DPD A;  4I9C A;  2ILR A;  2L0T B;  3MV3 B;  3L6A A;  3QAQ A;  5KJK A;  4OAU C;  4GB9 A;  3QNK A;  2Y4U A;  4JPS A;  5BXO A;  4XIF A;  2CG3 A;  3FH7 A;  1HZ4 A;  2ETC A;  3D9P A;  2F8X K;  2RFA A;  2R59 A;  2XHE A;  4HI9 A;  5BXU A;  1BD8 A;  3V2X A;  3ONK A;  5G55 A;  4UQX A;  2XQ0 A;  1LF8 A;  2DZO A;  2R02 A;  4ANU A;  1HFA A;  4HFG A;  3R9M A;  4JEU A;  3E32 A;  2H6F A;  4HRN A;  3ONL A;  3D9K A;  4HQD A;  1TJC A;  3C3R A;  4ANX A;  2XS1 A;  3DSS A;  2MHK A;  3JYS A;  3CHO A;  5B3S E;  3HXC A;  1TR4 A;  4J6I A;  4G1T A;  3B7R L;  2HE0 A;  3B7T A;  4FC8 A;  3FY4 A;  1NA3 A;  3VLE A;  2WQ7 A;  5CED B;  3ZXS A;  3HXD A;  3PZD A;  3CEQ A;  4PS3 A;  3BU8 A;  2QYJ A;  3BG1 B;  1BI7 B;  3BQO A;  3UQ3 A;  3EHR A;  2Y69 E;  3UM3 A;  3TWV A;  3ZFW A;  4A1G A;  1O5M A;  4C48 B;  2XRZ A;  3Q75 A;  1XGW A;  4BX8 A;  1E7U A;  2PL2 A;  3CVX A;  4KMO A;  1BU9 A;  3DSX A;  1MQS A;  3GZS A;  1QZ2 A;  1D8D A;  5AAO A;  3CVP A;  4JZY A;  5ENS D;  2CG2 A;  3IXE A;  4EQF A;  1NFI E;  4H7X A;  5FT9 A;  4PS7 A;  3UT4 A;  3CSF A;  3ASF A;  3L13 A;  2E2E A;  3AJI A;  1IQR A;  4BSZ B;  5HRY A;  1B89 A;  2V0P A;  3IV0 A;  5LOZ A;  1U2V G;  3CQC B;  5A23 A;  2JAB A;  4U7E B;  3B95 A;  3KEZ A;  3Q5M A;  4HNA D;  4I1O B;  4HOT A;  3QKY A;  3EIQ C;  3FTZ A;  3SFX A;  3AG1 E;  5KJM A;  3CVW A;  3L17 A;  4BTB A;  4DLQ A;  3I5P A;  4C0M A;  2WQ6 A;  5LCW J;  3ML9 A;  2ZXW E;  3OAW A;  4LNG A;  4TRQ A;  5C1D A;  4HLE A;  4J8S A;  2X38 A;  2XGO A;  2I9C A;  1H6P A;  2OEW A;  3AU5 A;  3S7J A;  3TL5 A;  4AOF A;  2LAI A;  4OYS A;  3SNX A;  4J8Y A;  4IN3 B;  3AG2 E;  1OCR E;  5T8I A;  1BPO A;  2I1K A;  2XGM A;  3ZNG A;  2V4H C;  1H2T C;  2VJ8 A;  4CRW A;  5B1B E;  1TNO A;  2B0O E;  4CT0 A;  3CVU A;  3QOU A;  2KM4 A;  5FQ8 A;  1H2U A;  4YVO A;  3U9W A;  1JCS A;  3ZN3 A;  2OV8 A;  4JHJ A;  4YDO A;  3LY7 A;  2V5Q C;  1Y6I A;  4MS6 A;  4I2W A;  3GZ1 A;  4JA7 A;  5CCL A;  2WXN A;  3E34 A;  4N3C A;  2L0I A;  2NYJ A;  3EIJ A;  4YDY A;  2BED A;  1OCC E;  1E7V A;  3LJN A;  2UWJ G;  3CK7 A;  2MRI A;  4I43 A;  4TUU A;  1S64 A;  1U3D A;  1E96 B;  4G8K A;  4X8Q A;  2XEH A;  1YCS B;  4G11 A;  5EDS A;  3Q78 A;  4HRM B;  2WXI A;  3G2S A;  3WG7 E;  3NAW A;  1N4P A;  2KAT A;  3UM0 A;  2X3M A;  5ANL A;  3WXX A;  4DUI A;  2VTB B;  3S7B A;  2GRR B;  2Y4T A;  4WWP A;  2F8Y A;  2JEK A;  1EYH A;  4FJZ A;  4MLP A;  1N95 A;  5HI7 A;  1TJF A;  2A5U A;  4HXI A;  4DPR A;  3VTY A;  1HG5 A;  4EZL A;  3FUF A;  2LAH A;  4MRU A;  4I6G A;  4O6F A;  5H7P A;  2Y1L E;  4J8F A;  4RG6 A;  4U0S A;  5CEC B;  2XPI A;  1X81 A;  3ZEF A;  1HE8 A;  5J08 A;  4GTR A;  1NZN A;  1N4S A;  5BUZ A;  2L6J A;  4B94 A;  3LEW A;  4DI4 A;  3CHS A;  2WMO A;  5G05 C;  3BUA A;  1HH8 A;  3Q7F A;  3FEY A;  4ME2 A;  5D0O D;  4A55 A;  2WPV A;  2WXO A;  1MX6 A;  3MEK A;  3D9H A;  4ATG A;  5FQ7 A;  2DYS E;  5D66 A;  1TEZ A;  2IEJ A;  5BT1 A;  4OVV A;  1Z3Y A;  3AS5 A;  3UKU G;  3I4R B;  2L6B A;  1TN7 A;  2R5S A;  3ZU7 B;  3UTM A;  3FH5 A;  5EIL A;  3V30 A;  1Z3X A;  2L9B A;  3UIO C;  3C3Q A;  2LSV A;  4ABN A;  3PS6 A;  1SZA A;  4JVS A;  4KT6 B;  3ULE G;  1TN6 A;  1ZU2 A;  4GAA A;  3MYV A;  3V31 A;  1SW6 A;  4GTM A;  2YIN A;  2AXZ A;  5EYP F;  4HI8 A;  1IKN D;  1TNY A;  2FO7 A;  3RRU A;  2LNI A;  5D0Q D;  5AQ7 A;  3ZHE B;  2Q7F A;  3DST A;  3RKV A;  3CKC A;  3RU0 A;  4GTV A;  3NB2 A;  5AAR A;  1KLX A;  3NBN B;  1FT2 A;  2QZA A;  5AJD A;  4QFV A;  4AXH A;  4EZJ A;  3UUX A;  1QYM A;  5G04 J;  2KCL A;  4K0R A;  2VQ2 A;  1SQM A;  3TWS A;  1SA4 A;  3TWX A;  1JUQ A;  2AXU A;  2J9Q A;  2I6H A;  3QWP A;  1TNU A;  5AEN A;  1N94 A;  4YND A;  4N5Q A;  4NQ0 A;  3MGB A;  3FUI A;  1WG0 A;  4N2S A;  3APC A;  4BT8 A;  4OAV B;  3TJP A;  4NUR A;  4PUC A;  3BG0 B;  3FUL A;  2CFZ A;  4LNU D;  1K1B A;  1YYH A;  3ZIM A;  4DK5 A;  4DX5 D;  3DEO A;  1JWF A;  5FWQ A;  1W3B A;  3CVN A;  3FTS A;  5KBA A;  5ARF A;  2IU1 A;  3D9O A;  1N0R A;  1HX8 A;  2DVW A;  5M72 A;  2UY1 B;  1SZ9 A;  3NF1 A;  4AEZ C;  4CZ2 D;  1MHQ A;  1KT1 A;  1ZBP A;  2GRO B;  4AV7 A;  2OCC E;  3UM2 A;  2KZT B;  5JA4 D;  4ILG A;  4EBA G;  1EPU A;  4UWL A;  1G3N B;  2WXH A;  2OVB A;  3T8M A;  4DRX E;  1NA0 A;  5E76 A;  4AJW A;  4WUY A;  3D9L A;  4FP7 A;  2IY0 C;  3G2T A;  3NOC D;  2LSU A;  3SHF A;  3TXM A;  2OVF A;  3LXU X;  4R7L A;  1FVF A;  4HVB A;  2WXK A;  4LCT A;  5BW8 C;  3GYZ A;  1OWO A;  2J4B A;  3T9K A;  2VGX A;  4FHK A;  5KNG A;  4GA0 A;  1V54 E;  3OTN A;  4F1S A;  1FT1 A;  3DWL G;  2XCC A;  2M63 A;  3NZS A;  3TWT A;  3CVV A;  4I2Z A;  3CVY A;  4L1B A;  2CFU A;  1H0A A;  4JB8 P;  4GZD A;  4GTO A;  2C0L A;  3LKU A;  3FP3 A;  5G2N A;  2PNN A;  4L23 A;  1L5J A;  4HS2 A;  4E6H A;  4N3B A;  2V5F A;  3Q73 A;  3NOG D;  3EHQ A;  4HRL A;  4CDM A;  4ZHB A;  1HF8 A;  3X2Q E;  4ATZ D;  2GRQ B;  3MKR A;  3CQG B;  2PQN A;  1O1T A;  4A3V A; 
#chains in the Genus database with same CATH homology
 2WVI A;  3SNX A;  4URK A;  4IN3 B;  3FUE A;  2XPZ A;  5T8I A;  3LS8 A;  4CCA A;  1HXI A;  3C98 A;  2C2L A;  3PVL A;  1BPO A;  1HG2 A;  3Q47 B;  2I1K A;  2XGM A;  3KAE A;  3UMV A;  2BF0 X;  1H2T C;  2VJ8 A;  3PEV B;  2UY1 A;  4N3A A;  4CRW A;  4GYO A;  3EDT B;  3CST A;  3FTU A;  3QWW A;  4NRH B;  2KC7 A;  4GZ5 A;  3FU5 A;  2IOL A;  4KBQ A;  4CT0 A;  1QNF A;  3CVU A;  3QOU A;  2KM4 A;  2XEV A;  5FQ8 A;  1H2U A;  2XCB A;  3I4G A;  4WNE A;  4YVO A;  2I2O A;  3U9W A;  5JJT A;  3MKQ B;  3B13 A;  3ZN3 A;  3IHY A;  4U0Z A;  3GZ2 A;  5G04 C;  4UWK A;  2OV8 A;  1Y8M A;  4Y6C A;  3CHR A;  4GCO A;  5FZQ A;  3MA5 A;  4JHJ A;  1U3C A;  3MX3 A;  4J8D A;  1E8W A;  3R7R A;  3LY7 A;  4RVB A;  3ESK A;  1H2V C;  3ZRH A;  1Y6I A;  4MS6 A;  4I17 A;  4I2W A;  3NZU A;  3QWV A;  3GZ1 A;  3LVQ E;  4ANV A;  4I1M A;  4JA7 A;  5CCL A;  3FU3 A;  3PRE A;  2WXN A;  3EHM A;  4N3C A;  2L0I A;  3EIJ A;  4A3V A;  4C0E A;  1S0P A;  3T5V A;  2J07 A;  3AU4 A;  4GZ6 A;  2CHZ A;  4G23 A;  1E7V A;  2X6F A;  3ZGQ A;  3ZHE A;  1H19 A;  2UWJ G;  3CK7 A;  3O4Z A;  4XZ4 A;  2MRI A;  5JHA A;  4WND A;  5JJ6 A;  3RRM B;  1UJJ A;  3FTX A;  2J4D A;  2PM6 A;  4LER A;  4RSY A;  2GGF A;  4L2L A;  4I43 A;  2IF4 A;  4TUU A;  4WAF A;  3RK6 A;  3OXG A;  4ACL A;  1U3D A;  1E96 B;  2A4Z A;  3FTY A;  3CGH A;  3L22 A;  5A6C A;  2NSZ A;  2PM7 A;  3CHM A;  4KXK B;  5EKQ D;  4AM9 A;  3HYM B;  3AS8 A;  4DI3 A;  4Q94 A;  3D3M A;  4G11 A;  5EDS A;  4P29 A;  3SD5 A;  4KVM A;  2WMN A;  3RO3 A;  2WXI A;  3G2S A;  4B8A A;  1UJK A;  3LCA A;  2KAT A;  3AS4 A;  5FQ4 A;  4NAC A;  4APF A;  2X3M A;  2IQC A;  3JQ1 A;  5ANL A;  3WXX A;  3PE4 A;  4CDN A;  2VTB B;  3S7B A;  3CLJ A;  4FUL A;  1OWN A;  2Y4T A;  4I6E A;  4J0U A;  3LY8 A;  1ELW A;  3ZYL A;  3PUK A;  3B7U X;  3TG5 A;  3ESL A;  4PH4 B;  4GML A;  2WXL A;  4WWP A;  2V8S E;  3L16 A;  3LY9 A;  4GYW A;  3UPV A;  3U66 A;  2VGX B;  2JEK A;  3ULQ A;  1EYH A;  5FJY A;  5C2Y A;  4FJZ A;  2EQX A;  2ION A;  3GW4 A;  3I3N A;  4MLP A;  5HI7 A;  3ZYQ A;  1TJF A;  2A5U A;  4HXI A;  4DPR A;  2GRM A;  3VTY A;  3CIA A;  4GA2 A;  4F53 A;  1HG5 A;  3JQ0 A;  4EZL A;  3G2W A;  5AIJ A;  1IHG A;  3FUF A;  4WNF A;  2IFU A;  1FVH A;  2DIW A;  2LAH A;  4JHR A;  4MRU A;  4V3I A;  4I6G A;  4O6F A;  3CK9 A;  3U3W A;  4XI9 A;  1E90 A;  4J8F A;  4RG9 A;  3RO2 A;  1E8X A;  4RG6 A;  5FZR A;  4U0S A;  3T5X A;  2XGS A;  3S7F A;  4FAD A;  2DCP A;  3FEX A;  5ENN A;  1X5B A;  4FA6 A;  4G24 A;  3KS2 A;  4LUN U;  5JHB A;  3ML8 A;  5ARG A;  1UN8 A;  4JXT A;  3NQP A;  4HOR A;  2VSX E;  2XPI A;  3P1U A;  2X6I A;  3QK0 A;  1ELK A;  1E8Z A;  2WXR A;  3APF A;  2WXP A;  4I6J A;  3ZEF A;  1HE8 A;  3CVQ A;  1OWL A;  5J08 A;  2HR2 A;  4PS8 A;  1NZN A;  1P5Q A;  2PQR A;  3URZ A;  5BUZ A;  5LFA A;  2ZU6 B;  2L6J A;  3HVE A;  4W9R A;  4JL0 A;  3SF4 A;  4B94 A;  3LEW A;  2WXF A;  4DI4 A;  1YA0 A;  3CHS A;  4IUL A;  4MKT A;  2WMO A;  3APD A;  3Q4A B;  5G05 C;  4EBA A;  2AWI A;  3FFL A;  5EX3 A;  4GA1 A;  1HH8 A;  4APO A;  2CHX A;  1UG3 A;  2P58 C;  2YQ8 A;  3FEY A;  5AJL A;  4ME2 A;  3FUK A;  5D0O D;  1N52 A;  4A55 A;  2IOS A;  2WPV A;  2WXO A;  5E75 A;  4FJY A;  3TXN A;  3PEU B;  2WM9 A;  2XPY A;  3MKQ A;  5EX0 A;  1GW6 A;  1DNP A;  3MEK A;  4WNG A;  3LDZ A;  4Y6W A;  4XI0 A;  4AIF A;  4I9E A;  4GYY A;  4ATG A;  2J09 A;  3O48 A;  4UWH A;  5FQ7 A;  3BEE A;  2CHW A;  2KZT A;  2GW1 A;  3VLD A;  1TEZ A;  3FUN A;  1HO8 A;  1WM5 A;  2E0I A;  2WXM A;  3QB2 A;  1XNF A;  3MJW A;  4UQZ A;  3D9N A;  3FHE A;  4JA9 A;  4U0U A;  4UI9 K;  5BPP A;  2HYZ A;  4L7T A;  5BT1 A;  2WQH A;  4ILI A;  2WB2 A;  3FWV A;  4IYP A;  4OVV A;  4XX5 A;  4N39 A;  3TAX A;  2QY7 A;  1Z3Y A;  3AS5 A;  2KCK A;  3SFZ A;  3PDN A;  3UT8 A;  2I1J A;  3FUH A;  3I4R B;  3RJV A;  2HM8 A;  4FLH A;  4HOU A;  5HQ8 A;  3SBT B;  2R17 C;  2R5S A;  3U64 A;  4GZ3 A;  3JCK C;  3PNT B;  4XKB A;  4ACK A;  3FH5 A;  3IBE A;  3SGH A;  1OWM A;  5FQ6 A;  5T3R A;  3HHM A;  1Z3X A;  3Q49 B;  1IQU A;  3IEG A;  5LCW C;  5A7D B;  4UWG A;  4A3T A;  2JLB A;  4J8E A;  3PH0 C;  4EEC A;  4B89 A;  2L9B A;  4HOQ A;  2LSV A;  4CDR A;  5CMY A;  3B7S A;  4LEU A;  4IRU A;  4ABN A;  3PS6 A;  1SZA A;  4JVS A;  4KT6 B;  3FH8 A;  2AVP A;  1ZU2 A;  1N54 A;  4GAA A;  3VLF A;  3MYV A;  3UT7 A;  4UI9 C;  4U63 A;  4BFR A;  3R7Q A;  2YIN A;  4JEH A;  2AXZ A;  1UW4 B;  2XRY A;  2FO7 A;  3UX4 A;  3RRU A;  2LNI A;  3Q15 A;  4XKC A;  5D0Q D;  5FTP A;  3LYA A;  3ZHE B;  2C0M A;  5FZS A;  2MOW A;  3DBS A;  2VTB A;  1OUV A;  1E8Y A;  3FUJ A;  1JWG A;  2Q7F A;  5DBK A;  4G25 A;  4CGW A;  3ZVV A;  3U4T A;  3PE3 A;  3RKV A;  1ELR A;  4KYO B;  5DIZ A;  4F3V A;  4AY5 A;  3DPD A;  3CHP A;  2DBA A;  4EZK A;  3CKC A;  5JJ7 A;  4Q96 A;  4I9C A;  3RU0 A;  3CK8 A;  1A17 A;  2WXJ A;  1UN9 A;  2AW6 A;  2ILR A;  2L0T B;  2VYI A;  3MV3 B;  3L6A A;  3QAQ A;  1KLX A;  4AVX A;  5KJK A;  4GB9 A;  3FDH A;  4A1S A;  3QNK A;  2Y4U A;  4JPS A;  3ASG A;  4XIF A;  2CG3 A;  5ANR A;  3K9I A;  3SBS A;  5AJD A;  4QFV A;  4AXH A;  4EZJ A;  3FH7 A;  3UUX A;  1HZ4 A;  5G04 J;  2VSO E;  5LP0 A;  2X6K A;  3D9P A;  4G2V A;  2J49 A;  3QDN A;  1WAO 1;  2R59 A;  1EF1 C;  4ILH B;  2XHE A;  2KCL A;  4K0R A;  2VQ2 A;  2V4L A;  5KJL A;  1SQM A;  2FBN A;  3LVR E;  3FUM A;  3ONK A;  5G55 A;  3D9I A;  4GMJ A;  1JUQ A;  2AXU A;  2XQ0 A;  1LF8 A;  2J9Q A;  2QFC A;  4FU3 A;  2I6H A;  4UQX A;  3QWP A;  4ANU A;  1HFA A;  4HFG A;  1Z6T A;  2NC9 A;  5AEN A;  3TGO A;  2LO6 A;  4YND A;  4XE0 A;  3ENE A;  4TV3 A;  2GRL A;  4JEU A;  3CKB A;  3MGB A;  2X6H A;  3FUI A;  3PUJ A;  4NQ0 A;  4B8C B;  5BNW A;  5CMW A;  4KVO A;  3ONL A;  4EPZ A;  3CVL A;  3OXF A;  4N2S A;  3APC A;  3D9K A;  3RRN B;  4JHK A;  4BT8 A;  1TJC A;  4YVQ C;  3TJP A;  4NUR A;  4PUC A;  3RIB A;  4ANX A;  4BWR A;  3BG0 B;  3FUL A;  3OXL A;  2CFZ A;  4CEM A;  2MHK A;  3CR3 A;  3JYS A;  3QJZ A;  3CHO A;  2HO1 A;  4J6I A;  1KT0 A;  4BX9 A;  3E4B A;  4U8H A;  4G1T A;  3ZIM A;  5LX8 A;  3B7R L;  3KD7 A;  4DK5 A;  4D10 C;  3B7T A;  4FC8 A;  3HVE B;  3FY4 A;  1NA3 A;  1JWF A;  3VLE A;  3ZYK A;  2WQ7 A;  5FWQ A;  1IYG A;  3ZXS A;  1W3B A;  3CVN A;  3FTV A;  3FTS A;  3LJ3 A;  4N2Q A;  2VSN A;  3HIZ A;  3PZD A;  3TG4 A;  4PDX A;  4AY6 A;  2VGY A;  5KJN A;  5ARF A;  2IU1 A;  2WXG A;  3D9O A;  2OND A;  3CEQ A;  2WXQ A;  1HX8 A;  2Y3A A;  3IHV A;  4KZ0 A;  4PS3 A;  4Q69 A;  5M72 A;  3BG1 B;  4DJA A;  3UQ3 A;  2UY1 B;  1SZ9 A;  4GCN A;  3NF1 A;  4AEZ C;  2BTD A;  1MHQ A;  2YHE A;  4GPK A;  1KT1 A;  1ZBP A;  3N71 A;  4AV7 A;  3PRZ A;  5BV0 A;  3FU0 A;  3QC1 A;  3ZFW A;  4A1G A;  4U07 A;  3IKO B;  2KZT B;  3JUI A;  4ILG A;  4F7A A;  1OWP A;  4EBA G;  3FTW A;  1EPU A;  2XRZ A;  4UWL A;  3MV2 B;  1H6K A;  1XGW A;  4BX8 A;  4HOS A;  1E7U A;  3ZYM A;  2WXH A;  4CGV A;  2OVB A;  4GU5 A;  2PL2 A;  3T8M A;  3ASH A;  3CVX A;  4KMO A;  4ANW A;  4FLB A;  4H7Y A;  1MQS A;  3GZS A;  1QZ2 A;  1NA0 A;  2J08 A;  5E76 A;  3L08 A;  3ZPJ A;  2VSY A;  3CVP A;  4UQY A;  4AJW A;  4WUY A;  4JZY A;  3D9L A;  4FP7 A;  4K03 A;  3P2B A;  2CG2 A;  3G2T A;  4EQF A;  2LSU A;  3SHF A;  2FF4 A;  4BSX A;  3MZL B;  1HU3 A;  3TXM A;  2OVF A;  3LXU X;  4H7X A;  4KZC A;  5FT9 A;  4PS7 A;  4DLO A;  4R7L A;  1FVF A;  4HVB A;  4LRZ A;  3UT4 A;  3CSF A;  3SZ7 A;  4E85 A;  5G05 J;  3ASF A;  3EJN A;  3L13 A;  2E2E A;  2WXK A;  5KCM A;  4LCT A;  1IQR A;  5BW8 C;  3GYZ A;  1B89 A;  2V0P A;  1OWO A;  2J4B A;  2AXV A;  3IV0 A;  5LOZ A;  5BV1 A;  2RD0 A;  2VGX A;  2YNQ A;  3CQC B;  4FHK A;  4GA0 A;  4JW1 A;  5A23 A;  1PAQ A;  3MCX A;  4UWF A;  4CT4 A;  2OOE A;  5T4Y A;  3OTN A;  4C9B B;  4GZC A;  4I1A A;  4BT9 A;  4F1S A;  2PZI A;  3R9A B;  3VTX A;  2XCC A;  3ASD A;  3EHN A;  1PY1 A;  2M63 A;  4N5C A;  3KEZ A;  3LPZ A;  3Q5M A;  5J90 A;  3NZS A;  3CV0 A;  2KCV A;  3CVV A;  2RG8 A;  4FHJ A;  2FEZ A;  3G2V A;  3QAR A;  4I1O B;  1JPL A;  3HDX A;  4WWN A;  4BTA A;  2FUL A;  4HOT A;  4I2Z A;  3CVY A;  4B0Z A;  3QKY A;  1HS6 A;  2X6J A;  3EIQ C;  4L1B A;  2CFU A;  1FCH A;  1H0A A;  4M3O A;  1QQE A;  3FTZ A;  4WWO A;  4GZD A;  1INZ A;  2C0L A;  5KJM A;  3CVW A;  4AP2 A;  1DVP A;  3CHQ A;  2BUG A;  2YHC A;  3FP3 A;  3D9M A;  3LKU A;  3L17 A;  4BTB A;  5G2N A;  4DLQ A;  4L23 A;  1L5J A;  3I5P A;  4C0M A;  2WQ6 A;  5LCW J;  3ML9 A;  1VDY A;  3PNL B;  4HS2 A;  3OAW A;  4N3B A;  4E6H A;  1NP7 A;  3FU6 A;  5CHE E;  2V5F A;  1PC2 A;  5AYW D;  4TRQ A;  4U04 A;  5C1D A;  4L2Y A;  3SI5 A;  4HLE A;  4CDM A;  4J8S A;  2X38 A;  1EDU A;  1WY6 A;  2XGO A;  3L54 A;  2NXP A;  2I9C A;  1HF8 A;  4JC8 A;  4BY6 A;  5CCM A;  3S2A A;  3D9J A;  2IJG X;  3MKR A;  4UI9 J;  2FI7 A;  3AU5 A;  3CQG B;  3ZW3 A;  3FUD A;  3S7J A;  2PQN A;  3S7D A;  4G26 A;  4OVU A;  3TL5 A;  4AOF A;  2LAI A;  4OYS A;  3G2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...