3ESKA

Structure of hop tpr2a domain in complex with the non-cognate hsc70 peptide ligand
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
128
structure length
128
Chain Sequence
b'GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stress-induced-phosphoprotein 1
molecule tags Chaperone
source organism Homo sapiens
publication title Electrostatic interactions of Hsp-organizing protein tetratricopeptide domains with Hsp70 and Hsp90: computational analysis and protein engineering.
pubmed doi rcsb
total genus 59
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eskA00
5FJYA 3AS8A 4GA2A 4GZ3A 3ASFA 3KD7A 4G24A 4HOSA 2XPIA 2GW1A 3S7FA 3SF4A 3OXGA 4U04A 3UUXA 5BT1A 4WUYA 5KJLA 3RU0A 2XCCA 3LY7A 3CVPA 4J0UA 1YA0A 3RO3A 4LEUA 2FBNA 2P58C 4UQYA 4A1SA 4BTAA 2WPVA 2UWJG 3QOUA 2FO7A 4IN3B 2J9QA 4U0SA 1IYGA 5EKQD 5JJ6A 3ESKA 3LCAA 2KCLA 4GZ6A 3FWVA 3RJVA 3N71A 4EQFA 3VTYA 4BWRA 2KC7A 3PE3A 3S7JA 3RIBA 2FEZA 3TAXA 5LCWC 4N3CA 5A6CA 2KCKA 2OOEA 3E4BA 4G26A 4JA9A 2UY1B 4RG9A 4BT9A 4I2ZA 1WAO1 2V5FA 4N3AA 3RKVA 3URZA 2KCVA 3NF1A 4U0ZA 1Y8MA 2PQRA 3FFLA 3QWPA 1HH8A 1HZ4A 3LKUA 4KXKB 3ZHEA 2NC9A 4U07A 4GYOA 2QFCA 4N39A 4UI9K 2JLBA 4ABNA 2MHKA 3KAEA 4I1AA 3CVNA 3WXXA 2XEVA 4GPKA 2VSYA 4GA0A 4G23A 4AM9A 4YNDA 3ZHEB 5JJ7A 1ELRA 4WNFA 1ELWA 5EX3A 3S7DA 3ZPJA 2HYZA 3GYZA 3MV2B 1E96B 3QWVA 4G2VA 2YHCA 4ME2A 4N5CA 5CHEE 5CCLA 1KT0A 1IHGA 3O48A 2IFUA 4NRHB 5KJKA 3QDNA 3UPVA 4XIFA 2LSVA 2PL2A 4BTBA 3BEEA 3OXLA 4CGVA 2VYIA 2C0LA 2XGOA 3MEKA 3MV3B 4H7YA 4UI9J 5FT9A 4F3VA 2XCBA 3LY9A 3PDNA 5ARGA 4HORA 2HO1A 3CK9A 3PE4A 4JA7A 3CKCA 4HOQA 2AVPA 4RG6A 4Y6CA 3ZFWA 2Y4UA 2VGXB 3FP3A 3U3WA 4WNGA 2I6HA 1ZU2A 1XNFA 4XI9A 1WM5A 1KT1A 4G25A 3Q5MA 4AY5A 3CK7A 2KATA 3MKRA 3ZGQA 3OXFA 2LNIA 4G1TA 5FZQA 4N2QA 5LCWJ 4CGWA 3RO2A 4J8FA 5BW8C 2VGYA 4N2SA 4CDRA 5ARFA 4I17A 4UQZA 5G04J 4GA1A 4J8DA 1TJCA 3LYAA 5DIZA 1NA0A 2UY1A 4AY6A 5HQ8A 1W3BA 3TG4A 4HOUA 2Q7FA 1A17A 4I9CA 3R9AB 2C2LA 4I9EA 1OUVA 1PC2A 2PZIA 3QWWA 2Y4TA 4GCOA 1B89A 4GCNA 1QZ2A 2HR2A 1NZNA 4H7XA 4GZ5A 2FI7A 4XI0A 3ASHA 5D0QD 3CVLA 5FTPA 5KJMA 5BNWA 3CEQA 4U0UA 3CK8A 1FCHA 3GZ1A 4JHRA 3AS5A 5G05C 4AIFA 3TG5A 3Q47B 4Y6WA 4W9RA 5HI7A 3Q49B 2PQNA 2FF4A 5M72A 5JJTA 4GYYA 5C1DA 3AS4A 2R5SA 1NA3A 3LPZA 4YVQC 3UQ3A 5KJNA 2VQ2A 3IEGA 1KLXA 3ASGA 4N3BA 4UI9C 3EDTB 3ZN3A 2XGMA 3KS2A 3S7BA 3U4TA 4B94A 3ULQA 3CKBA 3K9IA 4YVOA 4NQ0A 1HXIA 4O6FA 5DBKA 5FZSA 2L6JA 3ASDA 4APOA 2IF4A 3MA5A 3GZ2A 2C0MA 2WQHA 4KBQA 4JL0A 3LY8A 5G05J 5AYWD 5EX0A 2VSNA 2DBAA 4WNEA 3GW4A 5FZRA 4KYOB 4HOTA 3VTXA 4GYWA 3TGOA 1ZBPA 2E2EA 2YQ8A 3QKYA 4WNDA 3HYMB 2BUGA 1P5QA 2VGXA 2LSUA 5D0OD 4I2WA 3SZ7A 4J8EA 5G04C 5CCMA 3JYSA 3CV0A 3Q15A 3Q4AB 5A7DB 3CVQA 4BT8A 2ONDA 2XGSA 1QQEA 4UQXA
chains in the Genus database with same CATH superfamily
1K8KG 5CBOA 2ETBA 3KD7A 5EN5D 1MX4A 1OCOE 3UKUG 5J90A 2X6IA 3CLJA 3V79K 3FEYA 1RZ4A 4X8QA 2BKGA 2WXKA 5AQAA 3B7UX 3ZHEA 1N54A 4KT6B 4U95D 3ONLA 2VSOE 4FHJA 4NIKA 3ZHEB 1UW4B 4I1MA 4LSZE 1SQMA 2XRZA 2BKKB 3KEAA 2H6GA 2KM4A 3DSUA 4K03A 4CGVA 1G3NB 3PNLB 2WM9A 4HORA 1E8ZA 5H7PA 3PUJA 3SQVA 3TXNA 3JCKC 4HLLA 3UKRG 1N4PA 2WXPA 4J8FA 2VGYA 2WXLA 4U8HA 1UJJA 2WVIA 2YHEA 3FU0A 3TXMA 3I5PA 4A3TA 1U3CA 2V8SE 1N4RA 3NZSA 3CEQA 4JHRA 4HQDA 2P9UG 5HS0A 3PEUB 3PH0C 1IHBA 2B0OE 3FY4A 4TRQA 4YVOA 1TNBA 3ASDA 1TN8A 4QQIA 4TV3A 4OVVA 2MOWA 4GYWA 3HXCA 3FUEA 3BG1B 5ENQD 5B3SE 3HRAA 4CZ2D 3JYSA 4GTMA 1QQEA 4NACA 4GA2A 5KJLA 4XKCA 3AU4A 1BI7B 4B8AA 2P9LG 4XE0A 3ASNE 1KZPA 5J08A 4N3CA 2IJGX 5A6CA 5BT1A 2UY1B 2M63A 2KCVA 3SFXA 4DX1A 3PZ4A 4UI9K 2CG3A 3L16A 5KCMA 1MHQA 4BFRA 2ETAA 2IEJA 3NQPA 3ZPJA 5HRYA 4TXPA 4EZLA 2VYIA 2XS8A 3FTXA 2DVWA 3Q7FA 5FQ6A 4WNGA 3R7QA 1U3DA 4XI9A 1N0QA 4AY5A 4GZDA 3U64A 4N2QA 3EIJA 3EHMA 3B95A 4J8DA 3VLFA 4HI8A 1NA0A 2AW6A 2P9PG 4AY6A 2EILE 4L2YA 1DNPA 1LD7A 2HM8A 2QY7A 3GZ1A 4I43A 1QNFA 2MRIA 4U96D 1KLXA 3S7BA 2X38A 2IY0C 4ATZD 3TGOA 3KEZA 2H6IA 2YNQA 2WB2A 1ZBPA 5CCMA 1KPSB 3VLEA 4U04A 2XCCA 3LY7A 3Q9NC 5BUZA 1YA0A 3ML9A 2P9IG 3MJWA 2J9QA 3HXEA 1N0RA 2KCLA 4GZ6A 2WXMA 5BXOA 2Y1LE 3QAQA 1N9AA 3TWSA 5E75A 3UM2A 4CT4A 4J7WA 2NC9A 4A63B 4I1AA 4URKA 2XZDG 2CFZA 3SGHA 1OCZE 4JZYA 2R2LA 3IHVA 4BETA 4D10C 2H6FA 2C0LA 5ENRD 2DZNA 5G55A 4K5BA 1JCRA 3FP3A 3U3WA 3IKOB 4G11A 3U9WA 1TYQG 3CK7A 3MKRA 3DSXA 4JEHA 1YYHA 2DIWA 2LXLA 5BV0A 4GAAA 1H2UA 1DCEA 3CK8A 3D9KA 3D9NA 3L9TA 3Q47B 4P29A 3F6QA 3V30A 3LJNA 4DX7D 4YVQC 5JHBA 3DSSA 5IY5E 4NQ0A 4ILHB 3DSWA 3B7RL 4CRWA 5EIDA 2WQHA 3SNXA 3D9MA 5AYWD 3PZ2A 2XRYA 1Q2ZA 4HOTA 3VTXA 2E2EA 2DZOA 4DX2A 3CR3A 1HG5A 2Y3AA 4I2WA 4GTVA 5A7DB 1Z3YA 2ONDA 4FJYA 4DLOA 4JB8P 2H6HA 5AN8A 3FTSA 2CHZA 4R7LA 5ENTD 4U0SA 2GRQB 2BEDA 4N5QA 4XEIG 4YDYA 2FEZA 3G2UA 4BT9A 1L5JA 4I2ZA 4B93B 3QJZA 3FUHA 4Q69A 2ILRA 4K5AB 3QDNA 3CVVA 2ETCA 4FADA 3MEKA 3FTUA 2P9SG 2HO1A 2AXUA 5ENPD 2VGXB 1WM5A 3L13A 3D9OA 3R9MA 4OAUC 1OXJA 3CHMA 5DIZA 2UY1A 4KMOA 3J5QB 3PNTB 4GCNA 2J09A 3TWWA 2PQNA 1RW2A 5JJTA 1NA3A 1H6PA 2VGEA 4N3BA 1HO8A 2OVBA 3CKBA 4EZJA 5FZSA 3LVRE 4G8KA 2LUHA 1EPUA 3TWXA 3MZLB 4LUNU 3ZIMA 4ACKA 1DC2A 4C0EA 3I3NA 4L2LA 2AJAA 5FJYA 2MYOA 3AS8A 2J8SD 2XPIA 2GW1A 1OWOA 4GTRA 2FBNA 1TNUA 1IYGA 3N71A 3TWTA 3ZEFA 3PE3A 1S64A 2OV8A 3CIAA 4HRNA 4F1PA 1WAO1 3NAWA 2CG2A 2GRNB 2J08A 1N4SA 2I2OA 1BD8A 2XPYA 5B1BE 4AM9A 4CEMA 4JW1A 2HYZA 3SI5A 3PRZA 4DJAA 3OXLA 4BSZB 2RFAA 1FVHA 2JEKA 1Z6TA 3PE4A 4RG6A 1JWGA 3L22A 4RSYA 2KATA 1MX2A 1K1BA 5ARFA 2I1KA 3OAWA 4LNGA 5LX8A 3ABLE 4PS7A 1BI8B 2V4LA 3CVLA 2GGFA 3PS6A 3D9PA 3HG0D 2FF4A 3FUMA 2F8XK 4B94A 5LP0A 4I6JA 4APOA 4LERA 2NXPA 4RQIA 2IF4A 1OY3D 1OT8A 2CHXA 3L17A 5LFAA 5ENNA 1HU3A 2ZXWE 3SBSA 3PZ1A 4BTAA 4RLYA 4I6GA 5D2MC 5EKQD 5CMYA 3VTYA 3TAXA 4U63A 2RKKA 3LKUA 3FU3A 4WAFA 3FUDA 2NYJA 2IQCA 3IXEA 4JD2G 4TUUA 5EX3A 1E96B 3QWVA 4HBDA 2J07A 1E7UA 1IHGA 1IKND 1H0AA 4DK5A 3PDNA 3CQGB 4JA7A 3TWRA 4FA6A 2GRMA 5KNGA 3ZFWA 4JC8A 4FLHA 2GROB 4I17A 4DLQA 5ANLA 3HHMA 4UWGA 4HOUA 2F8YA 1OUVA 1ELKA 1QZ2A 4Z68A 3KSLA 4AV7A 3EJNA 1H19A 3FHEA 1V55E 1FPPA 3FH7A 1BU9A 3D9IA 1JPLA 2WXOA 3AJIA 3ONKA 3D9JA 4O6FA 2RFMA 4JXTA 3ASOE 2X6KA 4KBQA 3C3QA 3FTWA 3UX4A 3C3OA 3C72A 3APFA 2DYSE 5JHAA 4IULA 1SVXA 4APFA 3B7SA 3UUXA 4O1PA 3ZU7B 1X5BA 1UN9A 5T8IA 4E85A 3VLDA 3S7JA 3MKQB 5FQ8A 3B7TA 3IBEA 4MLPA 1UG3A 3EHNA 4F7AA 3V31A 4L7TA 4L23A 5ENSD 2EIME 3S7DA 3SFYA 3MV2B 2IO2C 4L1BA 4XZ4A 2IFUA 2LSVA 1D8EA 2WMOA 4PH4B 3FTYA 4PDXA 2LXMA 2I6HA 3E30A 2F0YA 2CHWA 4GTQA 3MCXA 5EIBE 2DCPA 2QYUA 5G04J 1TNZA 3FUFA 1HFAA 2BF0X 3T5XA 3T5VA 5FTPA 3LVQE 5BNWA 4AIFA 4OVUA 1E90A 5C1DA 2R5SA 3LDZA 3KSQA 1OWPA 4FU3A 3HXDA 3DSTA 2LAIA 5CECB 3GZ2A 1YCSB 2X6FA 3ZUVB 1S0PA 1N95A 2GRRB 3SHFA 3BU8A 1LF8A 1MZCA 3HVEA 1O1SA 2PNNA 4FP7A 1H2TC 4UQYA 5FQ7A 4IN3B 2UWJG 3APCA 4EPZA 4F53A 1TR4A 3ZNGA 3FWVA 4HB5A 1HF8A 4FHKA 2X6HA 3SO8A 2OOEA 4JA9A 1WY6A 1N11A 3ULEG 4U0ZA 2PQRA 3JQ0A 3RAUA 3QARA 2JLBA 4EZKA 2Y69E 3FUJA 3HIZA 4WNFA 2YHCA 4WWNA 3CHSA 3O48A 3Q73A 2KBXA 3CSFA 5ARGA 4EECA 4MRUA 2AVPA 1TNOA 1K3ZD 3CQCB 3DXMG 5EYLA 1KT1A 1JWFA 4G25A 3EU9A 4HI9A 3Q79A 3RO2A 3AG4E 3DPYA 3AG3E 4HFGA 4A55A 1W3BA 3TWQA 4DX5D 2PZIA 4WNDA 2AXVA 4F1SA 2RD0A 3C3RA 5CEDB 4TXRA 3ABME 1SZAA 4Y6WA 3C98A 3CHOA 4ANUA 2LO6A 5KJNA 2EINE 2AWIA 3QB2A 3KS2A 5C2YA 4ILIA 3R7RA 4KZ0A 3CHPA 3E32A 2XS1A 4LNUD 3EHQA 2J4DA 4ZHBA 3FTZA 4B0ZA 3TG5A 4FULA 4IYPA 3S7FA 1EF1C 1MQSA 3BQOA 3QOUA 4HRLA 3ESKA 2HE0A 4AXHA 4GTPA 3RIBA 3T8MA 3UIOC 3NF1A 3QWPA 5T3RA 1D9SA 2VSYA 2QZAA 4KZCA 5JJ7A 2WXIA 5CHEE 4ME2A 3DSVA 3BEEA 4J6IA 5EILA 3G2TA 3ZYKA 3MV3B 4UI9J 2V4HC 4HOQA 3DWLG 4Y6CA 3FU5A 4GB9A 5FWQA 1OWMA 2OVFA 3CVWA 2IOSA 5AENA 2EIKE 3PREA 4GA1A 3V2XA 1TJCA 2IO3C 3TG4A 2Q7FA 4I9CA 4YDOA 3FUNA 4GZ5A 2Y4TA 1NZNA 4U0UA 2R02A 1D8DA 1DCQA 5BPPA 3QC1A 4WWOA 2PM7A 3ZN3A 5E76A 4Q96A 4BSXA 3G2WA 3C5RA 4JL0A 5G05J 2KXPC 3GW4A 4KYOB 2WXRA 4I1OB 2YQ8A 4GMRA 1MX6A 2VGXA 4J8EA 5BV1A 4U8VD 3RU0A 4PUCA 1FT2A 2P58C 4YDEA 3CVYA 1KZOA 4UWLA 1BPOA 3LCAA 1X81A 3D3MA 5CMWA 3CVXA 3FDHA 2Y0BG 1IQRA 4UWHA 2ZGDA 4G26A 1LD8A 5FT9A 1A5EA 3FUIA 4ANVA 4N39A 4ACLA 4WWPA 4MKTA 2XEVA 2LAHA 3JXIA 3GYZA 3E33A 5CCLA 4H7YA 4C0MA 2L6BA 3HXBA 5KNHD 3DBSA 2E0IA 3UXGA 3DXKG 3NBNB 1H2VC 2GRLA 3U66A 3B7BA 2DWZA 3LXUX 2VJ8A 3DRAA 4HVBA 3R9AB 5CBNA 3FH8A 4DI4A 4H7XA 1VDYA 2B6CA 4BX9A 5HI7A 3Q49B 5M72A 4AVXA 4DUIA 4Q94A 3K9IA 2WXNA 2VSXE 5CERB 4MS6A 4HRMB 3SBTB 2VSNA 2ZGGA 2YINA 2OEVA 4A3VA 2ZU6B 1U2VG 3HYMB 5D0OD 3CV0A 4K5CA 4UQXA 1ZB1A 4CYMD 1WG0A 3UT7A 3PVLA 3CHQA 5CRUA 2VTBA 3DEOA 3UM3A 5KWDA 3URZA 1SA4A 4U07A 4M7CA 3RRUA 2MHKA 4LNBA 4GPKA 4G23A 2WXQA 1OCRE 1S63A 1O5MA 2F37A 1KT0A 2XGOA 3UM0A 5AQ7A 4F3VA 4CCAA 4OYSA 3Q75A 3T8KA 1ZU2A 3G2SA 3Q5MA 3FU6A 4G1TA 5JA4D 1H6KA 2L0TB 1PC2A 2WQ7A 5ENOD 3ISMC 2XHEA 4O60A 4TXQA 4M3OA 4GTSA 4GYYA 3AS4A 4IRUA 3IEGA 4LRZA 4UI9C 3NOCD 3U4TA 1HXIA 5DBKA 2WXJA 3E37A 5LOZA 1N52A 5HKPA 2LSUA 4HXIA 3SZ7A 1SW6A 2BTDA 3Q15A 3Q4AB 3MX3A 2XZTG 1TJFA 4RVBA 2WXHA 3FULA 5AQ9A 3RO3A 4KVOA 2V5QC 4CT0A 4EQFA 3I4RB 3UT8A 3JQ1A 5EYPF 3TWVA 4BERA 4EBAA 4ABNA 4DI3A 3CHRA 3TWUA 4YNDA 1ELWA 1HX8A 3QNKA 4BX8A 2XPZA 3EIQC 1OCCE 3SFZA 3UPVA 4NRHB 2JABA 1S70B 4MBGA 3TL5A 4DX6D 3CK9A 4LG6A 3UTMA 1Y6IA 2GRPB 3UMVA 5G2NA 3W9FA 5FQ4A 5BW8C 1FVFA 1Z3XA 3ZVVA 2A5EA 4GCOA 2P9NG 2XQ0A 1O1RA 3D9HA 5G05C 3IHYA 1V54E 4BEPA 2XENA 3I4GA 4GPMA 4UUCA 3V2OA 4K0RA 1JCQA 4BY6A 2QC9A 3UT4A 3UIPC 4BT8A 3LEWA 2KZTB 3ML8A 1EDUA 4HOSA 4G24A 3OXGA 4WUYA 3ZRHA 4TUMA 2KCKA 3X2QE 4RG9A 3G2VA 3PZ3A 3WG7E 3O4ZA 1HH8A 2R03A 2FO1E 3NZUA 3CVNA 4GA0A 2R17C 2AXZA 4G8LA 4JEUA 5KJKA 3PEVB 4XIFA 1QBQA 4UWKA 5CRVA 3CKCA 2A4ZA 2CFUA 1GW6A 5AJLA 1SA5A 4GZCA 3TJPA 1NP7A 1E8XA 3LS8A 5BXUA 4AOFA 2C2LA 4U8YD 5AQBA 1AWCB 3BUAA 4GTOA 2V0PA 1AP7A 3QK0A 4W9RA 2I9CA 5FINA 3LPZA 4FLBA 3NOGD 1HE8A 1TEZA 4YDWA 3SY2A 3W9GA 2P2CP 3AU5A 2DBAA 4WNEA 5FZRA 4FJZA 2X3MA 2R59A 3ULYA 3QKYA 1P5QA 1OWLA 5G04C 3AG2E 1Z5SC 2IU1A 4ATGA 3JUIA 3MKQA 5ITZF 1UJKA 1SZ9A 3MYVA 3CVPA 4J0UA 4LEUA 2VTBB 3P2BA 5JJ6A 1N4QA 2ZISA 5D66A 4BWRA 4J8SA 4NURA 5LCWC 4B8CB 3E4BA 4GMJA 2V5FA 1Y8MA 3FFLA 3ZXSA 4ANWA 3KAEA 3S2AA 4A1GA 3WXXA 4EHMA 2ZIRA 5B1AE 4GMLA 3ZKJA 2L9BA 4N5CA 4G2VA 2WMNA 3DPDA 3ZYLA 2PL2A 1MJ0A 3ENEA 2DYRE 3FUKA 3ZYMA 3CSTA 1PAQA 1H6OA 3Q9UC 1JCSA 1XNFA 3J5PA 3UINC 3ZGQA 5EDSA 2LNIA 4N2SA 4L9PA 2WQ6A 4JHJA 4LCTA 4CDMA 4AJWA 1A17A 3B13A 1B89A 2FI7A 3ASHA 3GZSA 3Q7AA 4I6EA 5CEAA 5ANRA 3AS5A 4U7EB 1TN6A 2IONA 1HG2A 2I1JA 3UQ3A 2XEEA 2VQ2A 5T4YA 3ASGA 5AAOA 3EDTB 2XGMA 2L6JA 3MA5A 2C0MA 3L6AA 3LY8A 4F6RD 3L54A 2IOLA 3DEPA 2KZTA 3RRNB 2RG8A 3RK6A 5KBAA 2L0IA 4GTTA 3NB2A 3RSEG 5A23A 1UN8A 2XGSA 4XX5A 4GZ3A 3ASFA 1K1AA 1QYMA 3CVUA 1HS6A 1TNYA 4A1SA 2WPVA 2FO7A 3APDA 3EUVA 1PY1A 3ZW3A 3IV0A 3RJVA 3PUKA 3Q78A 3ZYQA 2KC7A 2R05A 1E8YA 4KVMA 4N3AA 1FT1A 1HZ4A 4KXKB 1NI1A 3JXJA 3JUEA 5AARA 1N94A 1NFIE 2XEHA 3ZXPA 4HS2A 3AG1E 1LTXA 4BTBA 4GU5A 4DPRA 3LJ3A 3UI2A 2WXGA 3P1UA 3OXFA 5FZQA 1EYHA 4CGWA 3UM1A 4XKBA 3LYAA 2OEWA 5JMND 5AJDA 5HQ8A 4JVSA 4ILGA 5AIJA 1IQUA 4I9EA 2J49A 2HR2A 4XI0A 1XGWA 5D0QD 5KJMA 1FCHA 4FC8A 4JHKA 3HDXA 4JPSA 4EBAG 2X6JA 1INZA 4V3IA 3FEXA 2OCCE 4CDNA 1IXVA 4PS8A 4HLEA 3CGHA 5EX0A 3E34A 4ANXA 2BUGA 2A5UA 3CVQA 3OTNA 4J8YA 3SF4A 1OWNA 3ABKE 2WXFA 4QFVA 2EQXA 2PM6A 4BESA 3RKVA 4PS3A 4GYOA 2QFCA 3D9LA 4AEZC 1ELRA 3ESLA 1BLXB 4C48B 1YMPA 3RRMB 2XCBA 3LY9A 1WDYA 3AAAC 1UOHA 2Y4UA 4C9BB 1TN7A 4HNAD 4DRXE 4OAVB 5FIOA 5LCWJ 3SD5A 4E6HA 4CDRA 4O1OA 4UQZA 2NSZA 1MYOA 4UWFA 3EU5A 2QYJA 1E7VA 1NL4A 3T9KA 3PZDA 3QWWA 1DVPA 3L08A 3HXFA 3L82A 2EIJE 2P9KG 2FULA 4AP2A 3EHRA 3HVEB 1JUQA 3ULQA 3FH5A 3BG0B 1E8WA 4ZFHA 2J4BA 4B89A 3FTVA 3MGBA 1O1TA
chains in the Genus database with same CATH topology
5FJYA 4FULA 3ML8A 3AS8A 1EDUA 4HOSA 3KD7A 4G24A 4IYPA 2XPIA 2GW1A 3S7FA 1OWOA 3OXGA 4WUYA 5J90A 1EF1C 1MQSA 2FBNA 2X6IA 3QOUA 3CLJA 1IYGA 3ESKA 3N71A 3FEYA 3ZEFA 3PE3A 2WXKA 4AXHA 3RIBA 3T8MA 3ZRHA 2KCKA 4RG9A 2OV8A 3CIAA 3G2VA 1WAO1 3B7UX 3O4ZA 3NF1A 3QWPA 2CG2A 1HH8A 5T3RA 3ZHEA 1N54A 4KT6B 2J08A 2I2OA 3ONLA 3NZUA 3CVNA 2VSYA 2XPYA 4GA0A 2VSOE 4KZCA 4FHJA 2R17C 4AM9A 4CEMA 3ZHEB 1UW4B 5JJ7A 4JW1A 4I1MA 1SQMA 2HYZA 2WXIA 2XRZA 2AXZA 5CHEE 4ME2A 4JEUA 3SI5A 5KJKA 2KM4A 4K03A 3PRZA 3PEVB 4XIFA 4DJAA 3BEEA 3OXLA 4J6IA 4CGVA 4UWKA 3G2TA 3ZYKA 3PNLB 3MV3B 4UI9J 2WM9A 1FVHA 1E8ZA 2JEKA 1Z6TA 4HORA 3PE4A 3CKCA 4HOQA 4RG6A 2A4ZA 4Y6CA 2CFUA 3FU5A 1GW6A 5AJLA 4GZCA 3PUJA 1JWGA 4GB9A 5FWQA 3L22A 1OWMA 2OVFA 3CVWA 3TXNA 2IOSA 3JCKC 4RSYA 2KATA 2WXPA 5AENA 4J8FA 2VGYA 3PREA 3TJPA 5ARFA 1NP7A 2I1KA 1E8XA 4GA1A 2WXLA 1TJCA 3LS8A 4U8HA 3OAWA 1UJJA 3TG4A 2WVIA 2YHEA 5LX8A 2Q7FA 4I9CA 4AOFA 2C2LA 3FU0A 3TXMA 3FUNA 3I5PA 4A3TA 4GZ5A 2Y4TA 1U3CA 2V8SE 1NZNA 4PS7A 2V4LA 3NZSA 3CVLA 3CEQA 2GGFA 4U0UA 3PS6A 4JHRA 3D9PA 2V0PA 3QK0A 4W9RA 2FF4A 2I9CA 3PEUB 3PH0C 3LPZA 4FLBA 5BPPA 3QC1A 4WWOA 2PM7A 3FUMA 3FY4A 3ZN3A 1HE8A 4B94A 5E76A 1TEZA 4TRQA 5LP0A 4I6JA 4Q96A 4YVOA 4APOA 4LERA 4BSXA 3ASDA 3G2WA 2NXPA 2IF4A 5G05J 4JL0A 3AU5A 4TV3A 2DBAA 4WNEA 3GW4A 2MOWA 4KYOB 2WXRA 4OVVA 5FZRA 4FJZA 4GYWA 4I1OB 2X3MA 2YQ8A 3BG1B 2CHXA 2R59A 3FUEA 3QKYA 1P5QA 2VGXA 3L17A 1OWLA 4J8EA 5G04C 3JYSA 2IU1A 4ATGA 5LFAA 3JUIA 5ENNA 1QQEA 5BV1A 1HU3A 3SBSA 3MKQA 4NACA 4GA2A 1UJKA 5KJLA 1SZ9A 3RU0A 4XKCA 3MYVA 3CVPA 4J0UA 4PUCA 4LEUA 2VTBB 2P58C 4BTAA 3CVYA 3AU4A 4B8AA 4I6GA 3P2BA 4UWLA 5EKQD 1BPOA 3LCAA 4XE0A 5JJ6A 3D3MA 5CMWA 3CVXA 3FDHA 5CMYA 3VTYA 5J08A 4BWRA 1IQRA 4J8SA 4UWHA 3TAXA 4NURA 4N3CA 2IJGX 4B8CB 5A6CA 5LCWC 3E4BA 4G26A 5BT1A 4GMJA 2UY1B 2M63A 2V5FA 2KCVA 5FT9A 4U63A 1Y8MA 3FFLA 3ZXSA 3FUIA 3LKUA 4ANVA 3FU3A 4N39A 4UI9K 4ACLA 2CG3A 4WAFA 3L16A 4ANWA 3KAEA 4MKTA 4WWPA 3FUDA 1MHQA 5KCMA 3S2AA 2XEVA 3WXXA 4A1GA 4BFRA 2LAHA 2IQCA 4GMLA 4TUUA 3NQPA 5EX3A 3ZPJA 2L9BA 3GYZA 1E96B 3QWVA 4G2VA 4N5CA 2WMNA 3DPDA 2J07A 1E7UA 1IHGA 5CCLA 3ZYLA 2PL2A 4EZLA 1H0AA 2VYIA 3ENEA 3FTXA 3FUKA 4H7YA 4DK5A 3ZYMA 4C0MA 3PDNA 3CQGB 3CSTA 1PAQA 4JA7A 4FA6A 5FQ6A 2GRMA 3ZFWA 4JC8A 4WNGA 3R7QA 1U3DA 4FLHA 1XNFA 3DBSA 2E0IA 4XI9A 4AY5A 4GZDA 3ZGQA 3U64A 2LNIA 5EDSA 4N2QA 3EIJA 3EHMA 4N2SA 1H2VC 2GRLA 4I17A 4DLQA 2WQ6A 4J8DA 4JHJA 3LXUX 4LCTA 3VLFA 3U66A 5ANLA 1NA0A 2AW6A 4AY6A 3HHMA 4CDMA 4UWGA 2VJ8A 4HOUA 4AJWA 1A17A 3R9AB 4HVBA 3B13A 4L2YA 1OUVA 3FH8A 4DI4A 4H7XA 1ELKA 1B89A 1DNPA 1QZ2A 2FI7A 4AV7A 3ASHA 3GZSA 3EJNA 1VDYA 1H19A 2HM8A 2QY7A 3FHEA 3GZ1A 4I6EA 5ANRA 3AS5A 4BX9A 4I43A 3FH7A 5HI7A 3Q49B 5M72A 4AVXA 3D9IA 1JPLA 2IONA 1HG2A 2I1JA 3UQ3A 1QNFA 2VQ2A 2WXOA 2MRIA 1KLXA 3ASGA 5T4YA 3EDTB 2XGMA 3S7BA 3ONKA 3D9JA 4Q94A 3K9IA 2X38A 2WXNA 2VSXE 4O6FA 2L6JA 4JXTA 4KBQA 2X6KA 3MA5A 2C0MA 3KEZA 4MS6A 3TGOA 3L6AA 3LY8A 3SBTB 2VSNA 3L54A 2IOLA 2YNQA 2YINA 2WB2A 1ZBPA 2KZTA 3FTWA 3RRNB 4A3VA 2ZU6B 2RG8A 3HYMB 5D0OD 3RK6A 3UX4A 5CCMA 2L0IA 3APFA 3CV0A 5A23A 5JHAA 1UN8A 3VLEA 2XGSA 4IULA 4UQXA 4XX5A 4APFA 4GZ3A 3B7SA 3ASFA 4U04A 3UUXA 3CVUA 1HS6A 3UT7A 2XCCA 3LY7A 5BUZA 1YA0A 3PVLA 1X5BA 3ML9A 3CHQA 4A1SA 3MJWA 1UN9A 2WPVA 2FO7A 3APDA 2J9QA 2VTBA 1PY1A 3ZW3A 5T8IA 2KCLA 4GZ6A 3IV0A 3RJVA 4E85A 3PUKA 3VLDA 3ZYQA 2KC7A 1E8YA 3MKQB 3S7JA 2WXMA 5FQ8A 3QAQA 3B7TA 4KVMA 5E75A 4N3AA 3URZA 4CT4A 3IBEA 4MLPA 1HZ4A 4KXKB 2NC9A 4U07A 1UG3A 3EHNA 4F7AA 3RRUA 2MHKA 4L7TA 4I1AA 4L23A 4GPKA 4G23A 4URKA 2WXQA 3S7DA 2CFZA 3SGHA 3MV2B 4L1BA 4HS2A 4JZYA 1KT0A 4XZ4A 2IFUA 3IHVA 2LSVA 4BTBA 4D10C 4GU5A 2C0LA 2XGOA 4DPRA 4F3VA 4CCAA 2WMOA 3LJ3A 5G55A 4OYSA 4PH4B 3FTYA 4PDXA 3FP3A 3U3WA 3IKOB 2I6HA 4G11A 2WXGA 1ZU2A 3P1UA 2CHWA 3U9WA 3G2SA 3Q5MA 3MCXA 3CK7A 3MKRA 3FU6A 2DCPA 3OXFA 4G1TA 5FZQA 1EYHA 4CGWA 1H6KA 4JEHA 2L0TB 5G04J 3FUFA 1HFAA 3LYAA 2BF0X 4XKBA 3T5XA 5AJDA 5HQ8A 4JVSA 2DIWA 3T5VA 4ILGA 5AIJA 5BV0A 4GAAA 1IQUA 4I9EA 1PC2A 2J49A 2WQ7A 2HR2A 4XI0A 5FTPA 1XGWA 3LVQE 5D0QD 5KJMA 5BNWA 1H2UA 3CK8A 1FCHA 2XHEA 3D9KA 4FC8A 4JHKA 4AIFA 3D9NA 3HDXA 3Q47B 4OVUA 4P29A 4JPSA 4M3OA 4EBAG 1E90A 4GYYA 5C1DA 3AS4A 2R5SA 3LDZA 2X6JA 4IRUA 4YVQC 3IEGA 1INZA 4V3IA 3FEXA 4LRZA 4UI9C 1OWPA 4FU3A 3U4TA 5JHBA 4CDNA 4NQ0A 1HXIA 5DBKA 4ILHB 2LAIA 2WXJA 3B7RL 4CRWA 3GZ2A 2WQHA 4PS8A 3D9MA 5AYWD 5LOZA 3SNXA 4HLEA 3CGHA 1N52A 2XRYA 2X6FA 5EX0A 4ANXA 4HOTA 3VTXA 1S0PA 2E2EA 3CR3A 2BUGA 1HG5A 2LSUA 2Y3AA 2A5UA 4HXIA 4I2WA 3SZ7A 2BTDA 3Q15A 3Q4AB 3MX3A 5A7DB 3CVQA 1Z3YA 2ONDA 4FJYA 3OTNA 3SHFA 4DLOA 1TJFA 1LF8A 3SF4A 4RVBA 3HVEA 4FP7A 3FTSA 2WXHA 1OWNA 2CHZA 3FULA 1H2TC 3RO3A 4R7LA 2WXFA 4UQYA 5FQ7A 4IN3B 2UWJG 4KVOA 4QFVA 4U0SA 3APCA 4EPZA 4F53A 4CT0A 2EQXA 3FWVA 2PM6A 4EQFA 3I4RB 1HF8A 3JQ1A 4FHKA 3UT8A 2FEZA 2X6HA 2OOEA 3G2UA 4JA9A 4BT9A 1WY6A 1L5JA 4I2ZA 3RKVA 4U0ZA 2PQRA 3JQ0A 3QJZA 4EBAA 3QARA 4PS3A 3FUHA 4GYOA 2QFCA 2JLBA 4ABNA 4DI3A 4EZKA 3D9LA 3CHRA 3FUJA 4AEZC 4Q69A 4YNDA 3HIZA 1ELRA 4WNFA 1ELWA 1HX8A 3QNKA 4BX8A 2XPZA 2YHCA 3EIQC 4WWNA 3ESLA 3CHSA 2ILRA 3SFZA 3O48A 4NRHB 3UPVA 3QDNA 3CVVA 3RRMB 4FADA 3MEKA 3FTUA 3CSFA 2XCBA 3LY9A 5ARGA 3TL5A 2HO1A 4EECA 3CK9A 2AXUA 4MRUA 1Y6IA 2AVPA 3UMVA 2Y4UA 4C9BB 2VGXB 3CQCB 1WM5A 1KT1A 1JWFA 4G25A 3L13A 3D9OA 5G2NA 5FQ4A 5LCWJ 3RO2A 5BW8C 3SD5A 4E6HA 1FVFA 1Z3XA 4CDRA 4UQZA 3ZVVA 3CHMA 2NSZA 5DIZA 2UY1A 4UWFA 4HFGA 4A55A 1W3BA 1E7VA 4KMOA 2PZIA 3PZDA 1DVPA 2AXVA 3PNTB 3QWWA 4GCNA 4GCOA 4WNDA 3L08A 4F1SA 2RD0A 2J09A 2XQ0A 2FULA 5G05C 4AP2A 3TG5A 1SZAA 4Y6WA 2PQNA 3IHYA 3C98A 3HVEB 3CHOA 1JUQA 5JJTA 4ANUA 2LO6A 1NA3A 5KJNA 2AWIA 4N3BA 3QB2A 1HO8A 3I4GA 2OVBA 3KS2A 3ULQA 3CKBA 4EZJA 5FZSA 3FH5A 5C2YA 4ILIA 3BG0B 4K0RA 3R7RA 3LVRE 4KZ0A 1E8WA 3CHPA 4BY6A 1EPUA 3MZLB 4LUNU 3UT4A 2J4BA 2J4DA 3ZIMA 4ACKA 4B89A 4C0EA 3I3NA 3FTZA 4L2LA 4BT8A 3LEWA 4B0ZA 3FTVA 3MGBA 2KZTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJY A;  3AS8 A;  4GA2 A;  4GZ3 A;  3ASF A;  3KD7 A;  4G24 A;  4HOS A;  2XPI A;  2GW1 A;  3S7F A;  3SF4 A;  3OXG A;  4U04 A;  3UUX A;  5BT1 A;  4WUY A;  5KJL A;  3RU0 A;  2XCC A;  3LY7 A;  3CVP A;  4J0U A;  1YA0 A;  3RO3 A;  4LEU A;  2FBN A;  2P58 C;  4UQY A;  4A1S A;  4BTA A;  2WPV A;  2UWJ G;  3QOU A;  2FO7 A;  4IN3 B;  2J9Q A;  4U0S A;  1IYG A;  5EKQ D;  5JJ6 A;  3ESK A;  3LCA A;  2KCL A;  4GZ6 A;  3FWV A;  3RJV A;  3N71 A;  4EQF A;  3VTY A;  4BWR A;  2KC7 A;  3PE3 A;  3S7J A;  3RIB A;  2FEZ A;  3TAX A;  5LCW C;  4N3C A;  5A6C A;  2KCK A;  2OOE A;  3E4B A;  4G26 A;  4JA9 A;  2UY1 B;  4RG9 A;  4BT9 A;  4I2Z A;  1WAO 1;  2V5F A;  4N3A A;  3RKV A;  3URZ A;  2KCV A;  3NF1 A;  4U0Z A;  1Y8M A;  2PQR A;  3FFL A;  3QWP A;  1HH8 A;  1HZ4 A;  3LKU A;  4KXK B;  3ZHE A;  2NC9 A;  4U07 A;  4GYO A;  2QFC A;  4N39 A;  4UI9 K;  2JLB A;  4ABN A;  2MHK A;  3KAE A;  4I1A A;  3CVN A;  3WXX A;  2XEV A;  4GPK A;  2VSY A;  4GA0 A;  4G23 A;  4AM9 A;  4YND A;  3ZHE B;  5JJ7 A;  1ELR A;  4WNF A;  1ELW A;  5EX3 A;  3S7D A;  3ZPJ A;  2HYZ A;  3GYZ A;  3MV2 B;  1E96 B;  3QWV A;  4G2V A;  2YHC A;  4ME2 A;  4N5C A;  5CHE E;  5CCL A;  1KT0 A;  1IHG A;  3O48 A;  2IFU A;  4NRH B;  5KJK A;  3QDN A;  3UPV A;  4XIF A;  2LSV A;  2PL2 A;  4BTB A;  3BEE A;  3OXL A;  4CGV A;  2VYI A;  2C0L A;  2XGO A;  3MEK A;  3MV3 B;  4H7Y A;  4UI9 J;  5FT9 A;  4F3V A;  2XCB A;  3LY9 A;  3PDN A;  5ARG A;  4HOR A;  2HO1 A;  3CK9 A;  3PE4 A;  4JA7 A;  3CKC A;  4HOQ A;  2AVP A;  4RG6 A;  4Y6C A;  3ZFW A;  2Y4U A;  2VGX B;  3FP3 A;  3U3W A;  4WNG A;  2I6H A;  1ZU2 A;  1XNF A;  4XI9 A;  1WM5 A;  1KT1 A;  4G25 A;  3Q5M A;  4AY5 A;  3CK7 A;  2KAT A;  3MKR A;  3ZGQ A;  3OXF A;  2LNI A;  4G1T A;  5FZQ A;  4N2Q A;  5LCW J;  4CGW A;  3RO2 A;  4J8F A;  5BW8 C;  2VGY A;  4N2S A;  4CDR A;  5ARF A;  4I17 A;  4UQZ A;  5G04 J;  4GA1 A;  4J8D A;  1TJC A;  3LYA A;  5DIZ A;  1NA0 A;  2UY1 A;  4AY6 A;  5HQ8 A;  1W3B A;  3TG4 A;  4HOU A;  2Q7F A;  1A17 A;  4I9C A;  3R9A B;  2C2L A;  4I9E A;  1OUV A;  1PC2 A;  2PZI A;  3QWW A;  2Y4T A;  4GCO A;  1B89 A;  4GCN A;  1QZ2 A;  2HR2 A;  1NZN A;  4H7X A;  4GZ5 A;  2FI7 A;  4XI0 A;  3ASH A;  5D0Q D;  3CVL A;  5FTP A;  5KJM A;  5BNW A;  3CEQ A;  4U0U A;  3CK8 A;  1FCH A;  3GZ1 A;  4JHR A;  3AS5 A;  5G05 C;  4AIF A;  3TG5 A;  3Q47 B;  4Y6W A;  4W9R A;  5HI7 A;  3Q49 B;  2PQN A;  2FF4 A;  5M72 A;  5JJT A;  4GYY A;  5C1D A;  3AS4 A;  2R5S A;  1NA3 A;  3LPZ A;  4YVQ C;  3UQ3 A;  5KJN A;  2VQ2 A;  3IEG A;  1KLX A;  3ASG A;  4N3B A;  4UI9 C;  3EDT B;  3ZN3 A;  2XGM A;  3KS2 A;  3S7B A;  3U4T A;  4B94 A;  3ULQ A;  3CKB A;  3K9I A;  4YVO A;  4NQ0 A;  1HXI A;  4O6F A;  5DBK A;  5FZS A;  2L6J A;  3ASD A;  4APO A;  2IF4 A;  3MA5 A;  3GZ2 A;  2C0M A;  2WQH A;  4KBQ A;  4JL0 A;  3LY8 A;  5G05 J;  5AYW D;  5EX0 A;  2VSN A;  2DBA A;  4WNE A;  3GW4 A;  5FZR A;  4KYO B;  4HOT A;  3VTX A;  4GYW A;  3TGO A;  1ZBP A;  2E2E A;  2YQ8 A;  3QKY A;  4WND A;  3HYM B;  2BUG A;  1P5Q A;  2VGX A;  2LSU A;  5D0O D;  4I2W A;  3SZ7 A;  4J8E A;  5G04 C;  5CCM A;  3JYS A;  3CV0 A;  3Q15 A;  3Q4A B;  5A7D B;  3CVQ A;  4BT8 A;  2OND A;  2XGS A;  1QQE A;  4UQX A; 
#chains in the Genus database with same CATH topology
 1K8K G;  5CBO A;  2ETB A;  3KD7 A;  5EN5 D;  1MX4 A;  1OCO E;  3UKU G;  5J90 A;  2X6I A;  3CLJ A;  3V79 K;  3FEY A;  1RZ4 A;  4X8Q A;  2BKG A;  2WXK A;  5AQA A;  3B7U X;  3ZHE A;  1N54 A;  4KT6 B;  4U95 D;  3ONL A;  2VSO E;  4FHJ A;  4NIK A;  3ZHE B;  1UW4 B;  4I1M A;  4LSZ E;  1SQM A;  2XRZ A;  2BKK B;  3KEA A;  2H6G A;  2KM4 A;  3DSU A;  4K03 A;  4CGV A;  1G3N B;  3PNL B;  2WM9 A;  4HOR A;  1E8Z A;  5H7P A;  3PUJ A;  3SQV A;  3TXN A;  3JCK C;  4HLL A;  3UKR G;  1N4P A;  2WXP A;  4J8F A;  2VGY A;  2WXL A;  4U8H A;  1UJJ A;  2WVI A;  2YHE A;  3FU0 A;  3TXM A;  3I5P A;  4A3T A;  1U3C A;  2V8S E;  1N4R A;  3NZS A;  3CEQ A;  4JHR A;  4HQD A;  2P9U G;  5HS0 A;  3PEU B;  3PH0 C;  1IHB A;  2B0O E;  3FY4 A;  4TRQ A;  4YVO A;  1TNB A;  3ASD A;  1TN8 A;  4QQI A;  4TV3 A;  4OVV A;  2MOW A;  4GYW A;  3HXC A;  3FUE A;  3BG1 B;  5ENQ D;  5B3S E;  3HRA A;  4CZ2 D;  3JYS A;  4GTM A;  1QQE A;  4NAC A;  4GA2 A;  5KJL A;  4XKC A;  3AU4 A;  1BI7 B;  4B8A A;  2P9L G;  4XE0 A;  3ASN E;  1KZP A;  5J08 A;  4N3C A;  2IJG X;  5A6C A;  5BT1 A;  2UY1 B;  2M63 A;  2KCV A;  3SFX A;  4DX1 A;  3PZ4 A;  4UI9 K;  2CG3 A;  3L16 A;  5KCM A;  1MHQ A;  4BFR A;  2ETA A;  2IEJ A;  3NQP A;  3ZPJ A;  5HRY A;  4TXP A;  4EZL A;  2VYI A;  2XS8 A;  3FTX A;  2DVW A;  3Q7F A;  5FQ6 A;  4WNG A;  3R7Q A;  1U3D A;  4XI9 A;  1N0Q A;  4AY5 A;  4GZD A;  3U64 A;  4N2Q A;  3EIJ A;  3EHM A;  3B95 A;  4J8D A;  3VLF A;  4HI8 A;  1NA0 A;  2AW6 A;  2P9P G;  4AY6 A;  2EIL E;  4L2Y A;  1DNP A;  1LD7 A;  2HM8 A;  2QY7 A;  3GZ1 A;  4I43 A;  1QNF A;  2MRI A;  4U96 D;  1KLX A;  3S7B A;  2X38 A;  2IY0 C;  4ATZ D;  3TGO A;  3KEZ A;  2H6I A;  2YNQ A;  2WB2 A;  1ZBP A;  5CCM A;  1KPS B;  3VLE A;  4U04 A;  2XCC A;  3LY7 A;  3Q9N C;  5BUZ A;  1YA0 A;  3ML9 A;  2P9I G;  3MJW A;  2J9Q A;  3HXE A;  1N0R A;  2KCL A;  4GZ6 A;  2WXM A;  5BXO A;  2Y1L E;  3QAQ A;  1N9A A;  3TWS A;  5E75 A;  3UM2 A;  4CT4 A;  4J7W A;  2NC9 A;  4A63 B;  4I1A A;  4URK A;  2XZD G;  2CFZ A;  3SGH A;  1OCZ E;  4JZY A;  2R2L A;  3IHV A;  4BET A;  4D10 C;  2H6F A;  2C0L A;  5ENR D;  2DZN A;  5G55 A;  4K5B A;  1JCR A;  3FP3 A;  3U3W A;  3IKO B;  4G11 A;  3U9W A;  1TYQ G;  3CK7 A;  3MKR A;  3DSX A;  4JEH A;  1YYH A;  2DIW A;  2LXL A;  5BV0 A;  4GAA A;  1H2U A;  1DCE A;  3CK8 A;  3D9K A;  3D9N A;  3L9T A;  3Q47 B;  4P29 A;  3F6Q A;  3V30 A;  3LJN A;  4DX7 D;  4YVQ C;  5JHB A;  3DSS A;  5IY5 E;  4NQ0 A;  4ILH B;  3DSW A;  3B7R L;  4CRW A;  5EID A;  2WQH A;  3SNX A;  3D9M A;  5AYW D;  3PZ2 A;  2XRY A;  1Q2Z A;  4HOT A;  3VTX A;  2E2E A;  2DZO A;  4DX2 A;  3CR3 A;  1HG5 A;  2Y3A A;  4I2W A;  4GTV A;  5A7D B;  1Z3Y A;  2OND A;  4FJY A;  4DLO A;  4JB8 P;  2H6H A;  5AN8 A;  3FTS A;  2CHZ A;  4R7L A;  5ENT D;  4U0S A;  2GRQ B;  2BED A;  4N5Q A;  4XEI G;  4YDY A;  2FEZ A;  3G2U A;  4BT9 A;  1L5J A;  4I2Z A;  4B93 B;  3QJZ A;  3FUH A;  4Q69 A;  2ILR A;  4K5A B;  3QDN A;  3CVV A;  2ETC A;  4FAD A;  3MEK A;  3FTU A;  2P9S G;  2HO1 A;  2AXU A;  5ENP D;  2VGX B;  1WM5 A;  3L13 A;  3D9O A;  3R9M A;  4OAU C;  1OXJ A;  3CHM A;  5DIZ A;  2UY1 A;  4KMO A;  3J5Q B;  3PNT B;  4GCN A;  2J09 A;  3TWW A;  2PQN A;  1RW2 A;  5JJT A;  1NA3 A;  1H6P A;  2VGE A;  4N3B A;  1HO8 A;  2OVB A;  3CKB A;  4EZJ A;  5FZS A;  3LVR E;  4G8K A;  2LUH A;  1EPU A;  3TWX A;  3MZL B;  4LUN U;  3ZIM A;  4ACK A;  1DC2 A;  4C0E A;  3I3N A;  4L2L A;  2AJA A;  5FJY A;  2MYO A;  3AS8 A;  2J8S D;  2XPI A;  2GW1 A;  1OWO A;  4GTR A;  2FBN A;  1TNU A;  1IYG A;  3N71 A;  3TWT A;  3ZEF A;  3PE3 A;  1S64 A;  2OV8 A;  3CIA A;  4HRN A;  4F1P A;  1WAO 1;  3NAW A;  2CG2 A;  2GRN B;  2J08 A;  1N4S A;  2I2O A;  1BD8 A;  2XPY A;  5B1B E;  4AM9 A;  4CEM A;  4JW1 A;  2HYZ A;  3SI5 A;  3PRZ A;  4DJA A;  3OXL A;  4BSZ B;  2RFA A;  1FVH A;  2JEK A;  1Z6T A;  3PE4 A;  4RG6 A;  1JWG A;  3L22 A;  4RSY A;  2KAT A;  1MX2 A;  1K1B A;  5ARF A;  2I1K A;  3OAW A;  4LNG A;  5LX8 A;  3ABL E;  4PS7 A;  1BI8 B;  2V4L A;  3CVL A;  2GGF A;  3PS6 A;  3D9P A;  3HG0 D;  2FF4 A;  3FUM A;  2F8X K;  4B94 A;  5LP0 A;  4I6J A;  4APO A;  4LER A;  2NXP A;  4RQI A;  2IF4 A;  1OY3 D;  1OT8 A;  2CHX A;  3L17 A;  5LFA A;  5ENN A;  1HU3 A;  2ZXW E;  3SBS A;  3PZ1 A;  4BTA A;  4RLY A;  4I6G A;  5D2M C;  5EKQ D;  5CMY A;  3VTY A;  3TAX A;  4U63 A;  2RKK A;  3LKU A;  3FU3 A;  4WAF A;  3FUD A;  2NYJ A;  2IQC A;  3IXE A;  4JD2 G;  4TUU A;  5EX3 A;  1E96 B;  3QWV A;  4HBD A;  2J07 A;  1E7U A;  1IHG A;  1IKN D;  1H0A A;  4DK5 A;  3PDN A;  3CQG B;  4JA7 A;  3TWR A;  4FA6 A;  2GRM A;  5KNG A;  3ZFW A;  4JC8 A;  4FLH A;  2GRO B;  4I17 A;  4DLQ A;  5ANL A;  3HHM A;  4UWG A;  4HOU A;  2F8Y A;  1OUV A;  1ELK A;  1QZ2 A;  4Z68 A;  3KSL A;  4AV7 A;  3EJN A;  1H19 A;  3FHE A;  1V55 E;  1FPP A;  3FH7 A;  1BU9 A;  3D9I A;  1JPL A;  2WXO A;  3AJI A;  3ONK A;  3D9J A;  4O6F A;  2RFM A;  4JXT A;  3ASO E;  2X6K A;  4KBQ A;  3C3Q A;  3FTW A;  3UX4 A;  3C3O A;  3C72 A;  3APF A;  2DYS E;  5JHA A;  4IUL A;  1SVX A;  4APF A;  3B7S A;  3UUX A;  4O1P A;  3ZU7 B;  1X5B A;  1UN9 A;  5T8I A;  4E85 A;  3VLD A;  3S7J A;  3MKQ B;  5FQ8 A;  3B7T A;  3IBE A;  4MLP A;  1UG3 A;  3EHN A;  4F7A A;  3V31 A;  4L7T A;  4L23 A;  5ENS D;  2EIM E;  3S7D A;  3SFY A;  3MV2 B;  2IO2 C;  4L1B A;  4XZ4 A;  2IFU A;  2LSV A;  1D8E A;  2WMO A;  4PH4 B;  3FTY A;  4PDX A;  2LXM A;  2I6H A;  3E30 A;  2F0Y A;  2CHW A;  4GTQ A;  3MCX A;  5EIB E;  2DCP A;  2QYU A;  5G04 J;  1TNZ A;  3FUF A;  1HFA A;  2BF0 X;  3T5X A;  3T5V A;  5FTP A;  3LVQ E;  5BNW A;  4AIF A;  4OVU A;  1E90 A;  5C1D A;  2R5S A;  3LDZ A;  3KSQ A;  1OWP A;  4FU3 A;  3HXD A;  3DST A;  2LAI A;  5CEC B;  3GZ2 A;  1YCS B;  2X6F A;  3ZUV B;  1S0P A;  1N95 A;  2GRR B;  3SHF A;  3BU8 A;  1LF8 A;  1MZC A;  3HVE A;  1O1S A;  2PNN A;  4FP7 A;  1H2T C;  4UQY A;  5FQ7 A;  4IN3 B;  2UWJ G;  3APC A;  4EPZ A;  4F53 A;  1TR4 A;  3ZNG A;  3FWV A;  4HB5 A;  1HF8 A;  4FHK A;  2X6H A;  3SO8 A;  2OOE A;  4JA9 A;  1WY6 A;  1N11 A;  3ULE G;  4U0Z A;  2PQR A;  3JQ0 A;  3RAU A;  3QAR A;  2JLB A;  4EZK A;  2Y69 E;  3FUJ A;  3HIZ A;  4WNF A;  2YHC A;  4WWN A;  3CHS A;  3O48 A;  3Q73 A;  2KBX A;  3CSF A;  5ARG A;  4EEC A;  4MRU A;  2AVP A;  1TNO A;  1K3Z D;  3CQC B;  3DXM G;  5EYL A;  1KT1 A;  1JWF A;  4G25 A;  3EU9 A;  4HI9 A;  3Q79 A;  3RO2 A;  3AG4 E;  3DPY A;  3AG3 E;  4HFG A;  4A55 A;  1W3B A;  3TWQ A;  4DX5 D;  2PZI A;  4WND A;  2AXV A;  4F1S A;  2RD0 A;  3C3R A;  5CED B;  4TXR A;  3ABM E;  1SZA A;  4Y6W A;  3C98 A;  3CHO A;  4ANU A;  2LO6 A;  5KJN A;  2EIN E;  2AWI A;  3QB2 A;  3KS2 A;  5C2Y A;  4ILI A;  3R7R A;  4KZ0 A;  3CHP A;  3E32 A;  2XS1 A;  4LNU D;  3EHQ A;  2J4D A;  4ZHB A;  3FTZ A;  4B0Z A;  3TG5 A;  4FUL A;  4IYP A;  3S7F A;  1EF1 C;  1MQS A;  3BQO A;  3QOU A;  4HRL A;  3ESK A;  2HE0 A;  4AXH A;  4GTP A;  3RIB A;  3T8M A;  3UIO C;  3NF1 A;  3QWP A;  5T3R A;  1D9S A;  2VSY A;  2QZA A;  4KZC A;  5JJ7 A;  2WXI A;  5CHE E;  4ME2 A;  3DSV A;  3BEE A;  4J6I A;  5EIL A;  3G2T A;  3ZYK A;  3MV3 B;  4UI9 J;  2V4H C;  4HOQ A;  3DWL G;  4Y6C A;  3FU5 A;  4GB9 A;  5FWQ A;  1OWM A;  2OVF A;  3CVW A;  2IOS A;  5AEN A;  2EIK E;  3PRE A;  4GA1 A;  3V2X A;  1TJC A;  2IO3 C;  3TG4 A;  2Q7F A;  4I9C A;  4YDO A;  3FUN A;  4GZ5 A;  2Y4T A;  1NZN A;  4U0U A;  2R02 A;  1D8D A;  1DCQ A;  5BPP A;  3QC1 A;  4WWO A;  2PM7 A;  3ZN3 A;  5E76 A;  4Q96 A;  4BSX A;  3G2W A;  3C5R A;  4JL0 A;  5G05 J;  2KXP C;  3GW4 A;  4KYO B;  2WXR A;  4I1O B;  2YQ8 A;  4GMR A;  1MX6 A;  2VGX A;  4J8E A;  5BV1 A;  4U8V D;  3RU0 A;  4PUC A;  1FT2 A;  2P58 C;  4YDE A;  3CVY A;  1KZO A;  4UWL A;  1BPO A;  3LCA A;  1X81 A;  3D3M A;  5CMW A;  3CVX A;  3FDH A;  2Y0B G;  1IQR A;  4UWH A;  2ZGD A;  4G26 A;  1LD8 A;  5FT9 A;  1A5E A;  3FUI A;  4ANV A;  4N39 A;  4ACL A;  4WWP A;  4MKT A;  2XEV A;  2LAH A;  3JXI A;  3GYZ A;  3E33 A;  5CCL A;  4H7Y A;  4C0M A;  2L6B A;  3HXB A;  5KNH D;  3DBS A;  2E0I A;  3UXG A;  3DXK G;  3NBN B;  1H2V C;  2GRL A;  3U66 A;  3B7B A;  2DWZ A;  3LXU X;  2VJ8 A;  3DRA A;  4HVB A;  3R9A B;  5CBN A;  3FH8 A;  4DI4 A;  4H7X A;  1VDY A;  2B6C A;  4BX9 A;  5HI7 A;  3Q49 B;  5M72 A;  4AVX A;  4DUI A;  4Q94 A;  3K9I A;  2WXN A;  2VSX E;  5CER B;  4MS6 A;  4HRM B;  3SBT B;  2VSN A;  2ZGG A;  2YIN A;  2OEV A;  4A3V A;  2ZU6 B;  1U2V G;  3HYM B;  5D0O D;  3CV0 A;  4K5C A;  4UQX A;  1ZB1 A;  4CYM D;  1WG0 A;  3UT7 A;  3PVL A;  3CHQ A;  5CRU A;  2VTB A;  3DEO A;  3UM3 A;  5KWD A;  3URZ A;  1SA4 A;  4U07 A;  4M7C A;  3RRU A;  2MHK A;  4LNB A;  4GPK A;  4G23 A;  2WXQ A;  1OCR E;  1S63 A;  1O5M A;  2F37 A;  1KT0 A;  2XGO A;  3UM0 A;  5AQ7 A;  4F3V A;  4CCA A;  4OYS A;  3Q75 A;  3T8K A;  1ZU2 A;  3G2S A;  3Q5M A;  3FU6 A;  4G1T A;  5JA4 D;  1H6K A;  2L0T B;  1PC2 A;  2WQ7 A;  5ENO D;  3ISM C;  2XHE A;  4O60 A;  4TXQ A;  4M3O A;  4GTS A;  4GYY A;  3AS4 A;  4IRU A;  3IEG A;  4LRZ A;  4UI9 C;  3NOC D;  3U4T A;  1HXI A;  5DBK A;  2WXJ A;  3E37 A;  5LOZ A;  1N52 A;  5HKP A;  2LSU A;  4HXI A;  3SZ7 A;  1SW6 A;  2BTD A;  3Q15 A;  3Q4A B;  3MX3 A;  2XZT G;  1TJF A;  4RVB A;  2WXH A;  3FUL A;  5AQ9 A;  3RO3 A;  4KVO A;  2V5Q C;  4CT0 A;  4EQF A;  3I4R B;  3UT8 A;  3JQ1 A;  5EYP F;  3TWV A;  4BER A;  4EBA A;  4ABN A;  4DI3 A;  3CHR A;  3TWU A;  4YND A;  1ELW A;  1HX8 A;  3QNK A;  4BX8 A;  2XPZ A;  3EIQ C;  1OCC E;  3SFZ A;  3UPV A;  4NRH B;  2JAB A;  1S70 B;  4MBG A;  3TL5 A;  4DX6 D;  3CK9 A;  4LG6 A;  3UTM A;  1Y6I A;  2GRP B;  3UMV A;  5G2N A;  3W9F A;  5FQ4 A;  5BW8 C;  1FVF A;  1Z3X A;  3ZVV A;  2A5E A;  4GCO A;  2P9N G;  2XQ0 A;  1O1R A;  3D9H A;  5G05 C;  3IHY A;  1V54 E;  4BEP A;  2XEN A;  3I4G A;  4GPM A;  4UUC A;  3V2O A;  4K0R A;  1JCQ A;  4BY6 A;  2QC9 A;  3UT4 A;  3UIP C;  4BT8 A;  3LEW A;  2KZT B;  3ML8 A;  1EDU A;  4HOS A;  4G24 A;  3OXG A;  4WUY A;  3ZRH A;  4TUM A;  2KCK A;  3X2Q E;  4RG9 A;  3G2V A;  3PZ3 A;  3WG7 E;  3O4Z A;  1HH8 A;  2R03 A;  2FO1 E;  3NZU A;  3CVN A;  4GA0 A;  2R17 C;  2AXZ A;  4G8L A;  4JEU A;  5KJK A;  3PEV B;  4XIF A;  1QBQ A;  4UWK A;  5CRV A;  3CKC A;  2A4Z A;  2CFU A;  1GW6 A;  5AJL A;  1SA5 A;  4GZC A;  3TJP A;  1NP7 A;  1E8X A;  3LS8 A;  5BXU A;  4AOF A;  2C2L A;  4U8Y D;  5AQB A;  1AWC B;  3BUA A;  4GTO A;  2V0P A;  1AP7 A;  3QK0 A;  4W9R A;  2I9C A;  5FIN A;  3LPZ A;  4FLB A;  3NOG D;  1HE8 A;  1TEZ A;  4YDW A;  3SY2 A;  3W9G A;  2P2C P;  3AU5 A;  2DBA A;  4WNE A;  5FZR A;  4FJZ A;  2X3M A;  2R59 A;  3ULY A;  3QKY A;  1P5Q A;  1OWL A;  5G04 C;  3AG2 E;  1Z5S C;  2IU1 A;  4ATG A;  3JUI A;  3MKQ A;  5ITZ F;  1UJK A;  1SZ9 A;  3MYV A;  3CVP A;  4J0U A;  4LEU A;  2VTB B;  3P2B A;  5JJ6 A;  1N4Q A;  2ZIS A;  5D66 A;  4BWR A;  4J8S A;  4NUR A;  5LCW C;  4B8C B;  3E4B A;  4GMJ A;  2V5F A;  1Y8M A;  3FFL A;  3ZXS A;  4ANW A;  3KAE A;  3S2A A;  4A1G A;  3WXX A;  4EHM A;  2ZIR A;  5B1A E;  4GML A;  3ZKJ A;  2L9B A;  4N5C A;  4G2V A;  2WMN A;  3DPD A;  3ZYL A;  2PL2 A;  1MJ0 A;  3ENE A;  2DYR E;  3FUK A;  3ZYM A;  3CST A;  1PAQ A;  1H6O A;  3Q9U C;  1JCS A;  1XNF A;  3J5P A;  3UIN C;  3ZGQ A;  5EDS A;  2LNI A;  4N2S A;  4L9P A;  2WQ6 A;  4JHJ A;  4LCT A;  4CDM A;  4AJW A;  1A17 A;  3B13 A;  1B89 A;  2FI7 A;  3ASH A;  3GZS A;  3Q7A A;  4I6E A;  5CEA A;  5ANR A;  3AS5 A;  4U7E B;  1TN6 A;  2ION A;  1HG2 A;  2I1J A;  3UQ3 A;  2XEE A;  2VQ2 A;  5T4Y A;  3ASG A;  5AAO A;  3EDT B;  2XGM A;  2L6J A;  3MA5 A;  2C0M A;  3L6A A;  3LY8 A;  4F6R D;  3L54 A;  2IOL A;  3DEP A;  2KZT A;  3RRN B;  2RG8 A;  3RK6 A;  5KBA A;  2L0I A;  4GTT A;  3NB2 A;  3RSE G;  5A23 A;  1UN8 A;  2XGS A;  4XX5 A;  4GZ3 A;  3ASF A;  1K1A A;  1QYM A;  3CVU A;  1HS6 A;  1TNY A;  4A1S A;  2WPV A;  2FO7 A;  3APD A;  3EUV A;  1PY1 A;  3ZW3 A;  3IV0 A;  3RJV A;  3PUK A;  3Q78 A;  3ZYQ A;  2KC7 A;  2R05 A;  1E8Y A;  4KVM A;  4N3A A;  1FT1 A;  1HZ4 A;  4KXK B;  1NI1 A;  3JXJ A;  3JUE A;  5AAR A;  1N94 A;  1NFI E;  2XEH A;  3ZXP A;  4HS2 A;  3AG1 E;  1LTX A;  4BTB A;  4GU5 A;  4DPR A;  3LJ3 A;  3UI2 A;  2WXG A;  3P1U A;  3OXF A;  5FZQ A;  1EYH A;  4CGW A;  3UM1 A;  4XKB A;  3LYA A;  2OEW A;  5JMN D;  5AJD A;  5HQ8 A;  4JVS A;  4ILG A;  5AIJ A;  1IQU A;  4I9E A;  2J49 A;  2HR2 A;  4XI0 A;  1XGW A;  5D0Q D;  5KJM A;  1FCH A;  4FC8 A;  4JHK A;  3HDX A;  4JPS A;  4EBA G;  2X6J A;  1INZ A;  4V3I A;  3FEX A;  2OCC E;  4CDN A;  1IXV A;  4PS8 A;  4HLE A;  3CGH A;  5EX0 A;  3E34 A;  4ANX A;  2BUG A;  2A5U A;  3CVQ A;  3OTN A;  4J8Y A;  3SF4 A;  1OWN A;  3ABK E;  2WXF A;  4QFV A;  2EQX A;  2PM6 A;  4BES A;  3RKV A;  4PS3 A;  4GYO A;  2QFC A;  3D9L A;  4AEZ C;  1ELR A;  3ESL A;  1BLX B;  4C48 B;  1YMP A;  3RRM B;  2XCB A;  3LY9 A;  1WDY A;  3AAA C;  1UOH A;  2Y4U A;  4C9B B;  1TN7 A;  4HNA D;  4DRX E;  4OAV B;  5FIO A;  5LCW J;  3SD5 A;  4E6H A;  4CDR A;  4O1O A;  4UQZ A;  2NSZ A;  1MYO A;  4UWF A;  3EU5 A;  2QYJ A;  1E7V A;  1NL4 A;  3T9K A;  3PZD A;  3QWW A;  1DVP A;  3L08 A;  3HXF A;  3L82 A;  2EIJ E;  2P9K G;  2FUL A;  4AP2 A;  3EHR A;  3HVE B;  1JUQ A;  3ULQ A;  3FH5 A;  3BG0 B;  1E8W A;  4ZFH A;  2J4B A;  4B89 A;  3FTV A;  3MGB A;  1O1T A; 
#chains in the Genus database with same CATH homology
 5FJY A;  4FUL A;  3ML8 A;  3AS8 A;  1EDU A;  4HOS A;  3KD7 A;  4G24 A;  4IYP A;  2XPI A;  2GW1 A;  3S7F A;  1OWO A;  3OXG A;  4WUY A;  5J90 A;  1EF1 C;  1MQS A;  2FBN A;  2X6I A;  3QOU A;  3CLJ A;  1IYG A;  3ESK A;  3N71 A;  3FEY A;  3ZEF A;  3PE3 A;  2WXK A;  4AXH A;  3RIB A;  3T8M A;  3ZRH A;  2KCK A;  4RG9 A;  2OV8 A;  3CIA A;  3G2V A;  1WAO 1;  3B7U X;  3O4Z A;  3NF1 A;  3QWP A;  2CG2 A;  1HH8 A;  5T3R A;  3ZHE A;  1N54 A;  4KT6 B;  2J08 A;  2I2O A;  3ONL A;  3NZU A;  3CVN A;  2VSY A;  2XPY A;  4GA0 A;  2VSO E;  4KZC A;  4FHJ A;  2R17 C;  4AM9 A;  4CEM A;  3ZHE B;  1UW4 B;  5JJ7 A;  4JW1 A;  4I1M A;  1SQM A;  2HYZ A;  2WXI A;  2XRZ A;  2AXZ A;  5CHE E;  4ME2 A;  4JEU A;  3SI5 A;  5KJK A;  2KM4 A;  4K03 A;  3PRZ A;  3PEV B;  4XIF A;  4DJA A;  3BEE A;  3OXL A;  4J6I A;  4CGV A;  4UWK A;  3G2T A;  3ZYK A;  3PNL B;  3MV3 B;  4UI9 J;  2WM9 A;  1FVH A;  1E8Z A;  2JEK A;  1Z6T A;  4HOR A;  3PE4 A;  3CKC A;  4HOQ A;  4RG6 A;  2A4Z A;  4Y6C A;  2CFU A;  3FU5 A;  1GW6 A;  5AJL A;  4GZC A;  3PUJ A;  1JWG A;  4GB9 A;  5FWQ A;  3L22 A;  1OWM A;  2OVF A;  3CVW A;  3TXN A;  2IOS A;  3JCK C;  4RSY A;  2KAT A;  2WXP A;  5AEN A;  4J8F A;  2VGY A;  3PRE A;  3TJP A;  5ARF A;  1NP7 A;  2I1K A;  1E8X A;  4GA1 A;  2WXL A;  1TJC A;  3LS8 A;  4U8H A;  3OAW A;  1UJJ A;  3TG4 A;  2WVI A;  2YHE A;  5LX8 A;  2Q7F A;  4I9C A;  4AOF A;  2C2L A;  3FU0 A;  3TXM A;  3FUN A;  3I5P A;  4A3T A;  4GZ5 A;  2Y4T A;  1U3C A;  2V8S E;  1NZN A;  4PS7 A;  2V4L A;  3NZS A;  3CVL A;  3CEQ A;  2GGF A;  4U0U A;  3PS6 A;  4JHR A;  3D9P A;  2V0P A;  3QK0 A;  4W9R A;  2FF4 A;  2I9C A;  3PEU B;  3PH0 C;  3LPZ A;  4FLB A;  5BPP A;  3QC1 A;  4WWO A;  2PM7 A;  3FUM A;  3FY4 A;  3ZN3 A;  1HE8 A;  4B94 A;  5E76 A;  1TEZ A;  4TRQ A;  5LP0 A;  4I6J A;  4Q96 A;  4YVO A;  4APO A;  4LER A;  4BSX A;  3ASD A;  3G2W A;  2NXP A;  2IF4 A;  5G05 J;  4JL0 A;  3AU5 A;  4TV3 A;  2DBA A;  4WNE A;  3GW4 A;  2MOW A;  4KYO B;  2WXR A;  4OVV A;  5FZR A;  4FJZ A;  4GYW A;  4I1O B;  2X3M A;  2YQ8 A;  3BG1 B;  2CHX A;  2R59 A;  3FUE A;  3QKY A;  1P5Q A;  2VGX A;  3L17 A;  1OWL A;  4J8E A;  5G04 C;  3JYS A;  2IU1 A;  4ATG A;  5LFA A;  3JUI A;  5ENN A;  1QQE A;  5BV1 A;  1HU3 A;  3SBS A;  3MKQ A;  4NAC A;  4GA2 A;  1UJK A;  5KJL A;  1SZ9 A;  3RU0 A;  4XKC A;  3MYV A;  3CVP A;  4J0U A;  4PUC A;  4LEU A;  2VTB B;  2P58 C;  4BTA A;  3CVY A;  3AU4 A;  4B8A A;  4I6G A;  3P2B A;  4UWL A;  5EKQ D;  1BPO A;  3LCA A;  4XE0 A;  5JJ6 A;  3D3M A;  5CMW A;  3CVX A;  3FDH A;  5CMY A;  3VTY A;  5J08 A;  4BWR A;  1IQR A;  4J8S A;  4UWH A;  3TAX A;  4NUR A;  4N3C A;  2IJG X;  4B8C B;  5A6C A;  5LCW C;  3E4B A;  4G26 A;  5BT1 A;  4GMJ A;  2UY1 B;  2M63 A;  2V5F A;  2KCV A;  5FT9 A;  4U63 A;  1Y8M A;  3FFL A;  3ZXS A;  3FUI A;  3LKU A;  4ANV A;  3FU3 A;  4N39 A;  4UI9 K;  4ACL A;  2CG3 A;  4WAF A;  3L16 A;  4ANW A;  3KAE A;  4MKT A;  4WWP A;  3FUD A;  1MHQ A;  5KCM A;  3S2A A;  2XEV A;  3WXX A;  4A1G A;  4BFR A;  2LAH A;  2IQC A;  4GML A;  4TUU A;  3NQP A;  5EX3 A;  3ZPJ A;  2L9B A;  3GYZ A;  1E96 B;  3QWV A;  4G2V A;  4N5C A;  2WMN A;  3DPD A;  2J07 A;  1E7U A;  1IHG A;  5CCL A;  3ZYL A;  2PL2 A;  4EZL A;  1H0A A;  2VYI A;  3ENE A;  3FTX A;  3FUK A;  4H7Y A;  4DK5 A;  3ZYM A;  4C0M A;  3PDN A;  3CQG B;  3CST A;  1PAQ A;  4JA7 A;  4FA6 A;  5FQ6 A;  2GRM A;  3ZFW A;  4JC8 A;  4WNG A;  3R7Q A;  1U3D A;  4FLH A;  1XNF A;  3DBS A;  2E0I A;  4XI9 A;  4AY5 A;  4GZD A;  3ZGQ A;  3U64 A;  2LNI A;  5EDS A;  4N2Q A;  3EIJ A;  3EHM A;  4N2S A;  1H2V C;  2GRL A;  4I17 A;  4DLQ A;  2WQ6 A;  4J8D A;  4JHJ A;  3LXU X;  4LCT A;  3VLF A;  3U66 A;  5ANL A;  1NA0 A;  2AW6 A;  4AY6 A;  3HHM A;  4CDM A;  4UWG A;  2VJ8 A;  4HOU A;  4AJW A;  1A17 A;  3R9A B;  4HVB A;  3B13 A;  4L2Y A;  1OUV A;  3FH8 A;  4DI4 A;  4H7X A;  1ELK A;  1B89 A;  1DNP A;  1QZ2 A;  2FI7 A;  4AV7 A;  3ASH A;  3GZS A;  3EJN A;  1VDY A;  1H19 A;  2HM8 A;  2QY7 A;  3FHE A;  3GZ1 A;  4I6E A;  5ANR A;  3AS5 A;  4BX9 A;  4I43 A;  3FH7 A;  5HI7 A;  3Q49 B;  5M72 A;  4AVX A;  3D9I A;  1JPL A;  2ION A;  1HG2 A;  2I1J A;  3UQ3 A;  1QNF A;  2VQ2 A;  2WXO A;  2MRI A;  1KLX A;  3ASG A;  5T4Y A;  3EDT B;  2XGM A;  3S7B A;  3ONK A;  3D9J A;  4Q94 A;  3K9I A;  2X38 A;  2WXN A;  2VSX E;  4O6F A;  2L6J A;  4JXT A;  4KBQ A;  2X6K A;  3MA5 A;  2C0M A;  3KEZ A;  4MS6 A;  3TGO A;  3L6A A;  3LY8 A;  3SBT B;  2VSN A;  3L54 A;  2IOL A;  2YNQ A;  2YIN A;  2WB2 A;  1ZBP A;  2KZT A;  3FTW A;  3RRN B;  4A3V A;  2ZU6 B;  2RG8 A;  3HYM B;  5D0O D;  3RK6 A;  3UX4 A;  5CCM A;  2L0I A;  3APF A;  3CV0 A;  5A23 A;  5JHA A;  1UN8 A;  3VLE A;  2XGS A;  4IUL A;  4UQX A;  4XX5 A;  4APF A;  4GZ3 A;  3B7S A;  3ASF A;  4U04 A;  3UUX A;  3CVU A;  1HS6 A;  3UT7 A;  2XCC A;  3LY7 A;  5BUZ A;  1YA0 A;  3PVL A;  1X5B A;  3ML9 A;  3CHQ A;  4A1S A;  3MJW A;  1UN9 A;  2WPV A;  2FO7 A;  3APD A;  2J9Q A;  2VTB A;  1PY1 A;  3ZW3 A;  5T8I A;  2KCL A;  4GZ6 A;  3IV0 A;  3RJV A;  4E85 A;  3PUK A;  3VLD A;  3ZYQ A;  2KC7 A;  1E8Y A;  3MKQ B;  3S7J A;  2WXM A;  5FQ8 A;  3QAQ A;  3B7T A;  4KVM A;  5E75 A;  4N3A A;  3URZ A;  4CT4 A;  3IBE A;  4MLP A;  1HZ4 A;  4KXK B;  2NC9 A;  4U07 A;  1UG3 A;  3EHN A;  4F7A A;  3RRU A;  2MHK A;  4L7T A;  4I1A A;  4L23 A;  4GPK A;  4G23 A;  4URK A;  2WXQ A;  3S7D A;  2CFZ A;  3SGH A;  3MV2 B;  4L1B A;  4HS2 A;  4JZY A;  1KT0 A;  4XZ4 A;  2IFU A;  3IHV A;  2LSV A;  4BTB A;  4D10 C;  4GU5 A;  2C0L A;  2XGO A;  4DPR A;  4F3V A;  4CCA A;  2WMO A;  3LJ3 A;  5G55 A;  4OYS A;  4PH4 B;  3FTY A;  4PDX A;  3FP3 A;  3U3W A;  3IKO B;  2I6H A;  4G11 A;  2WXG A;  1ZU2 A;  3P1U A;  2CHW A;  3U9W A;  3G2S A;  3Q5M A;  3MCX A;  3CK7 A;  3MKR A;  3FU6 A;  2DCP A;  3OXF A;  4G1T A;  5FZQ A;  1EYH A;  4CGW A;  1H6K A;  4JEH A;  2L0T B;  5G04 J;  3FUF A;  1HFA A;  3LYA A;  2BF0 X;  4XKB A;  3T5X A;  5AJD A;  5HQ8 A;  4JVS A;  2DIW A;  3T5V A;  4ILG A;  5AIJ A;  5BV0 A;  4GAA A;  1IQU A;  4I9E A;  1PC2 A;  2J49 A;  2WQ7 A;  2HR2 A;  4XI0 A;  5FTP A;  1XGW A;  3LVQ E;  5D0Q D;  5KJM A;  5BNW A;  1H2U A;  3CK8 A;  1FCH A;  2XHE A;  3D9K A;  4FC8 A;  4JHK A;  4AIF A;  3D9N A;  3HDX A;  3Q47 B;  4OVU A;  4P29 A;  4JPS A;  4M3O A;  4EBA G;  1E90 A;  4GYY A;  5C1D A;  3AS4 A;  2R5S A;  3LDZ A;  2X6J A;  4IRU A;  4YVQ C;  3IEG A;  1INZ A;  4V3I A;  3FEX A;  4LRZ A;  4UI9 C;  1OWP A;  4FU3 A;  3U4T A;  5JHB A;  4CDN A;  4NQ0 A;  1HXI A;  5DBK A;  4ILH B;  2LAI A;  2WXJ A;  3B7R L;  4CRW A;  3GZ2 A;  2WQH A;  4PS8 A;  3D9M A;  5AYW D;  5LOZ A;  3SNX A;  4HLE A;  3CGH A;  1N52 A;  2XRY A;  2X6F A;  5EX0 A;  4ANX A;  4HOT A;  3VTX A;  1S0P A;  2E2E A;  3CR3 A;  2BUG A;  1HG5 A;  2LSU A;  2Y3A A;  2A5U A;  4HXI A;  4I2W A;  3SZ7 A;  2BTD A;  3Q15 A;  3Q4A B;  3MX3 A;  5A7D B;  3CVQ A;  1Z3Y A;  2OND A;  4FJY A;  3OTN A;  3SHF A;  4DLO A;  1TJF A;  1LF8 A;  3SF4 A;  4RVB A;  3HVE A;  4FP7 A;  3FTS A;  2WXH A;  1OWN A;  2CHZ A;  3FUL A;  1H2T C;  3RO3 A;  4R7L A;  2WXF A;  4UQY A;  5FQ7 A;  4IN3 B;  2UWJ G;  4KVO A;  4QFV A;  4U0S A;  3APC A;  4EPZ A;  4F53 A;  4CT0 A;  2EQX A;  3FWV A;  2PM6 A;  4EQF A;  3I4R B;  1HF8 A;  3JQ1 A;  4FHK A;  3UT8 A;  2FEZ A;  2X6H A;  2OOE A;  3G2U A;  4JA9 A;  4BT9 A;  1WY6 A;  1L5J A;  4I2Z A;  3RKV A;  4U0Z A;  2PQR A;  3JQ0 A;  3QJZ A;  4EBA A;  3QAR A;  4PS3 A;  3FUH A;  4GYO A;  2QFC A;  2JLB A;  4ABN A;  4DI3 A;  4EZK A;  3D9L A;  3CHR A;  3FUJ A;  4AEZ C;  4Q69 A;  4YND A;  3HIZ A;  1ELR A;  4WNF A;  1ELW A;  1HX8 A;  3QNK A;  4BX8 A;  2XPZ A;  2YHC A;  3EIQ C;  4WWN A;  3ESL A;  3CHS A;  2ILR A;  3SFZ A;  3O48 A;  4NRH B;  3UPV A;  3QDN A;  3CVV A;  3RRM B;  4FAD A;  3MEK A;  3FTU A;  3CSF A;  2XCB A;  3LY9 A;  5ARG A;  3TL5 A;  2HO1 A;  4EEC A;  3CK9 A;  2AXU A;  4MRU A;  1Y6I A;  2AVP A;  3UMV A;  2Y4U A;  4C9B B;  2VGX B;  3CQC B;  1WM5 A;  1KT1 A;  1JWF A;  4G25 A;  3L13 A;  3D9O A;  5G2N A;  5FQ4 A;  5LCW J;  3RO2 A;  5BW8 C;  3SD5 A;  4E6H A;  1FVF A;  1Z3X A;  4CDR A;  4UQZ A;  3ZVV A;  3CHM A;  2NSZ A;  5DIZ A;  2UY1 A;  4UWF A;  4HFG A;  4A55 A;  1W3B A;  1E7V A;  4KMO A;  2PZI A;  3PZD A;  1DVP A;  2AXV A;  3PNT B;  3QWW A;  4GCN A;  4GCO A;  4WND A;  3L08 A;  4F1S A;  2RD0 A;  2J09 A;  2XQ0 A;  2FUL A;  5G05 C;  4AP2 A;  3TG5 A;  1SZA A;  4Y6W A;  2PQN A;  3IHY A;  3C98 A;  3HVE B;  3CHO A;  1JUQ A;  5JJT A;  4ANU A;  2LO6 A;  1NA3 A;  5KJN A;  2AWI A;  4N3B A;  3QB2 A;  1HO8 A;  3I4G A;  2OVB A;  3KS2 A;  3ULQ A;  3CKB A;  4EZJ A;  5FZS A;  3FH5 A;  5C2Y A;  4ILI A;  3BG0 B;  4K0R A;  3R7R A;  3LVR E;  4KZ0 A;  1E8W A;  3CHP A;  4BY6 A;  1EPU A;  3MZL B;  4LUN U;  3UT4 A;  2J4B A;  2J4D A;  3ZIM A;  4ACK A;  4B89 A;  4C0E A;  3I3N A;  3FTZ A;  4L2L A;  4BT8 A;  3LEW A;  4B0Z A;  3FTV A;  3MGB A;  2KZT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...