3ABME

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
total genus 42
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3abmE00
1V55E 2EINE 1OCRE 3ABLE 2EIJE 3ASNE 3X2QE 2DYRE 2EIME 3AG4E 5B1BE 2EILE 5B1AE 3AG3E 3ASOE 3AG2E 3ABME 2DYSE 1OCZE 1OCCE 2EIKE 1V54E 3WG7E 2OCCE 5B3SE 5IY5E 2ZXWE 3ABKE 2Y69E 3AG1E 1OCOE
chains in the Genus database with same CATH superfamily
2WXRA 4O60A 3CKCA 1UW4B 3L16A 5G05J 4URKA 1K1AA 2UWJG 3LY7A 2WXPA 3HXDA 1O1SA 5ANRA 3B7RL 4J8SA 3ZHEA 2E0IA 4I9EA 4CRWA 3JQ0A 5KJKA 2DWZA 4GZDA 4W9RA 3VLEA 4M7CA 3RAUA 4G8LA 3LCAA 2WXKA 4UUCA 4UWFA 5BV0A 2JABA 2J07A 4N3AA 4Z68A 5FQ7A 1DCQA 4U04A 3DEOA 3W9GA 4CGVA 5A6CA 3FHEA 2GGFA 4NQ0A 3KS2A 5D66A 1PAQA 4KVOA 1KZOA 3C3RA 5H7PA 3APCA 3C72A 4R7LA 1LD8A 1W3BA 2XGSA 4QQIA 4ANXA 4JA9A 5JHAA 3I4RB 4X8QA 5CEDB 3HXFA 2ZU6B 3FUHA 2EIME 3S7DA 3Q73A 1ELWA 2A5UA 3VLDA 3UMVA 5FINA 3LVRE 3T9KA 1JWFA 4XKCA 3EHMA 2GRRB 4DJAA 1TN8A 3Q47B 3ZXSA 1ELKA 1EF1C 3D9KA 3FTSA 4J7WA 3I3NA 1HFAA 1TN7A 2WXMA 4J6IA 3EIJA 1N4PA 2RD0A 2X6IA 4GTQA 4E85A 2RFAA 1D8DA 4CYMD 3VLFA 3Q79A 3TG5A 3C5RA 4GMLA 4RSYA 4I2ZA 2FI7A 3JCKC 3AG1E 1PC2A 3DSSA 5LX8A 3ZNGA 3UIOC 1ELRA 4PS8A 1E7VA 3UI2A 1P5QA 1TR4A 3G2SA 4JB8P 2WB2A 1A5EA 4H7XA 3AJIA 4GYWA 2V5FA 3O48A 1OCRE 1K3ZD 4EZJA 3U9WA 2CFZA 1E8XA 3BG0B 4WUYA 4NIKA 2VYIA 2WXJA 1E8ZA 3QC1A 4WWOA 4O6FA 2LNIA 4N5CA 2KXPC 3ZYQA 2WXOA 1INZA 3SFZA 4ABNA 3C98A 2J08A 3V2XA 2EQXA 2RKKA 2WXFA 4XE0A 2XENA 2KC7A 5EKQD 2X6HA 3CK7A 5JMND 3CVWA 2DZOA 4GCNA 5D2MC 4K5AB 4BY6A 3JXIA 4Q69A 3EHRA 3FUMA 3ZN3A 2VGYA 1N9AA 1JCRA 4PUCA 2JLBA 1FCHA 2OOEA 1V54E 4IYPA 3JUEA 2IU1A 3CLJA 3FWVA 4KZ0A 3SGHA 4K5CA 2IO3C 3MKRA 4GZ6A 5CCMA 3TWQA 3DWLG 3CVYA 4J8FA 4BESA 3PEUB 4Y6CA 5EIBE 2ZISA 4IN3B 2VTBB 3APDA 3MCXA 1IQUA 3TXMA 4JPSA 3GZ2A 3UT8A 3PREA 3QWPA 3TAXA 3AS4A 3RJVA 3ASHA 2LXMA 3AG3E 4N2QA 4FLBA 5AAOA 2YQ8A 3Q49B 5EILA 3FP3A 3R9AB 5CBOA 3AS5A 2IF4A 2I1KA 3CHSA 3FUIA 4B8AA 4BWRA 4MS6A 3L82A 3L9TA 2V4LA 3PRZA 3FDHA 3B13A 5AJLA 1MX6A 2XEVA 3IHYA 3FULA 4UWGA 3UKRG 1IYGA 3KEAA 5EN5D 3Q9UC 3K9IA 4UWKA 4APOA 3ABKE 3FUJA 2EIJE 3OAWA 3CK8A 2XEHA 5EYPF 4A63B 2J4DA 2ZGGA 1NP7A 3PZDA 1QBQA 4YVOA 3E30A 1L5JA 4NURA 1YYHA 3J5PA 1EPUA 3PEVB 2I9CA 1Z3YA 2MYOA 3KD7A 2DCPA 1UJKA 1S63A 5JHBA 3SI5A 2V5QC 4GTOA 2MRIA 5FQ4A 2JEKA 3FU3A 5DIZA 3HXEA 4M3OA 3LPZA 5G04J 5FWQA 3WG7E 4OVVA 3ZGQA 2XZDG 3SD5A 1QYMA 1OUVA 2FBNA 3CVPA 3UM1A 2IQCA 5HKPA 4ACKA 2H6HA 4I1MA 5KWDA 5CEAA 5D0QD 5KBAA 3CHPA 3NF1A 5HS0A 3FU0A 3JXJA 1TJFA 3DSXA 4J8EA 1TNZA 2DVWA 4JEHA 4BETA 3DSVA 2XHEA 3DEPA 4EPZA 3R7RA 5CMWA 3FU6A 5FQ8A 3MKQA 1IXVA 3ZU7B 1EYHA 2P9IG 4HRNA 1Z5SC 1LF8A 4B0ZA 3MYVA 4FADA 2P2CP 1ZB1A 1BI7B 3F6QA 1N0QA 2HYZA 2UY1B 4APFA 3TWSA 3LKUA 4OAUC 3DSUA 2CG3A 1DVPA 4GZ5A 2RFMA 2A4ZA 3QARA 2DIWA 3ABLE 1KZPA 2OEVA 2WPVA 3IXEA 5BT1A 1RZ4A 1S0PA 2ILRA 2XZTG 2Q7FA 4I9CA 2VSOE 3QOUA 5A7DB 2H6GA 3TWUA 2PM6A 3Q4AB 4G11A 3ONLA 4OYSA 5LOZA 4CEMA 4HQDA 2R59A 3CQGB 3DSTA 3TWTA 3NB2A 4A3TA 1MX2A 4U63A 4AY6A 1H19A 3CVLA 3GYZA 3BUAA 2H6IA 4G8KA 5FZQA 2MHKA 5LP0A 4XI0A 1MJ0A 5FTPA 3TG4A 1IHBA 1OCOE 1KT1A 3L17A 4GTSA 5LCWC 1K1BA 2H6FA 3LS8A 4BX9A 4N3CA 2X6FA 2ONDA 3LY8A 2KCVA 4ANUA 3ONKA 3Q75A 4BFRA 2PQNA 3C3OA 2QZAA 1OWMA 3L13A 1JCQA 4EQFA 4A3VA 2P9LG 3GZ1A 4DX6D 2AW6A 2WXQA 2ZIRA 3UPVA 3UUXA 4HB5A 4GTTA 4L2LA 4GPKA 1FPPA 3RIBA 3E33A 5ENSD 3P1UA 4ILHB 4HI8A 2F0YA 2XGOA 3O4ZA 4N39A 3PZ1A 3HVEA 4XI9A 2CHWA 5G2NA 3FU5A 1VDYA 4G23A 1E8WA 2J4BA 2XPIA 4U0UA 1FVFA 2QYUA 1IHGA 2L0IA 3VTYA 1PY1A 4AEZC 4PS7A 1X5BA 4JD2G 1HF8A 3RRUA 3CQCB 1HU3A 2A5EA 3PZ4A 4RG9A 2P9NG 3U3WA 2AXZA 1QQEA 2WVIA 1NA3A 4HXIA 3MZLB 1U2VG 2YINA 4AVXA 1RW2A 5FT9A 4HOSA 4TXPA 4DX2A 4B8CB 3MV3B 4U8VD 1MZCA 3SBTB 2R03A 1E8YA 5KNHD 4B93B 5CMYA 1N11A 4KXKB 3PNLB 3CV0A 2VGXA 3D9JA 4TUUA 2ZGDA 5AQBA 2LO6A 1JUQA 2RG8A 2GW1A 3FEXA 2KZTA 2X38A 4PH4B 4JVSA 4XX5A 4I6GA 2OCCE 3TWXA 4YDOA 4CDMA 4HS2A 3QJZA 2KBXA 3TGOA 1AWCB 4F7AA 4HOTA 4FP7A 4GA2A 4Y6WA 3ABME 5EYLA 2EIKE 2PZIA 3HXCA 4DX5D 3S7FA 2XCBA 4U95D 2J09A 4EECA 1HXIA 4G1TA 1NI1A 1HG2A 4XEIG 2EILE 3OXLA 2IO2C 5EX0A 4XKBA 1E7UA 1MYOA 3ASFA 3TJPA 2R17C 2KCKA 3FFLA 4UQZA 4ME2A 4I6EA 1H0AA 3VTXA 2NYJA 3Q9NC 4G25A 4TXRA 4F53A 3PH0C 2HM8A 3HG0D 5CBNA 3AU4A 5B1BE 2YHCA 4CDRA 5B1AE 1H2TC 1BPOA 1N94A 4C0EA 3FTWA 3EUVA 4ZFHA 5AARA 3SQVA 3AS8A 5JJ7A 5AJDA 4PS3A 3U4TA 5BUZA 5FZSA 3UT7A 4A1SA 3IHVA 2LXLA 1WAO1 2AXUA 3ASGA 3B7BA 2LAHA 4A1GA 3TL5A 4WNDA 3TXNA 1YA0A 4K03A 4DLOA 3MX3A 5KJLA 2WXLA 3UM2A 3R9MA 3HYMB 4EZKA 4JC8A 3QNKA 3FTZA 3U64A 5M72A 4FULA 4J8DA 2IONA 3SZ7A 4HVBA 1NA0A 2FF4A 2C2LA 3D9HA 4F6RD 3RU0A 3ZHEB 2P9UG 1FT2A 3ESKA 4GMJA 2P58C 2P9PG 4WNGA 4CZ2D 2DYRE 3URZA 1U3CA 4GB9A 3UM3A 3NZSA 3L54A 3GW4A 3PVLA 5ARFA 3CHQA 3UT4A 4L7TA 1E90A 4FLHA 4FC8A 3IEGA 5AQAA 3CR3A 3TWRA 3OTNA 2PQRA 5D0OD 5J90A 3S7BA 1TNYA 1DNPA 1SQMA 3UINC 2QY7A 4DX1A 2R2LA 2GROB 3MEKA 3HRAA 4KZCA 2FEZA 3R7QA 3EU5A 3CIAA 1O1TA 4LERA 1N4RA 3FH8A 2WM9A 3EJNA 5BW8C 3V79K 4GTPA 4MLPA 3HDXA 4TRQA 2F37A 4U96D 2Y0BG 4MRUA 1JPLA 4WNFA 2ZXWE 3CGHA 5BV1A 4HRLA 3ULYA 2XPZA 5FZRA 3QDNA 1KT0A 1XNFA 3AG4E 3LDZA 4GYOA 4CT0A 2WXGA 2PM7A 3Q78A 4C0MA 2Y4UA 1UN9A 5AN8A 4HLEA 1BU9A 2OVBA 4G2VA 1TNUA 2GRMA 4KMOA 3PUJA 5C1DA 4HOQA 4U8YD 3FUEA 1NL4A 3RO2A 5JJTA 2X3MA 2WQHA 2AWIA 3UKUG 3E37A 5LFAA 4KYOB 1D8EA 3PE3A 4HFGA 4BT9A 4FHJA 3ZXPA 3ZYMA 2X6KA 1V55E 2ETBA 1UN8A 1B89A 4KBQA 4GTRA 4G24A 4LNUD 2FO1E 2R5SA 3FH5A 2J9QA 3PUKA 1DCEA 2LUHA 2WXHA 4B89A 2VQ2A 3T5VA 2XEEA 4DI3A 5KNGA 4O1PA 4LRZA 2Y3AA 1H2UA 3NOGD 5KJMA 2IFUA 3NQPA 4HI9A 4EBAG 5KJNA 4N2SA 2LSVA 2PNNA 3ISMC 3DBSA 4ATGA 2R02A 4YDYA 4H7YA 4JW1A 3EU9A 2V8SE 5LCWJ 1IKND 3CHOA 4CGWA 5HQ8A 3ENEA 3G2VA 4UWHA 4EHMA 4Q94A 1O1RA 3L08A 3V31A 1U3DA 3B7TA 4K0RA 4N3BA 3T8KA 1HH8A 5E75A 3ULEG 2AVPA 1JCSA 5BNWA 4Q96A 4J8YA 3QWWA 4RG6A 5HI7A 4HBDA 1OCCE 2F8YA 2P9SG 4I43A 2Y4TA 4UQYA 1OWOA 4UI9K 4D10C 4I17A 5FJYA 4K5BA 2FULA 3G2WA 4AV7A 2BEDA 1YMPA 3QKYA 3CVQA 5IY5E 2CHXA 3RRMB 5JA4D 3UQ3A 3LVQE 3SBSA 2BKKB 4P29A 3D9LA 4GZCA 3X2QE 4ATZD 3D9OA 3AAAC 1BLXB 2L6BA 4GA1A 3HHMA 3JQ1A 4JEUA 3SFXA 1HX8A 3BG1B 4GTMA 1Q2ZA 4I2WA 2KATA 2XPYA 3CVNA 4KT6B 4DI4A 4HRMB 4FA6A 2VSXE 3LY9A 3GZSA 5BXUA 3LXUX 3ML9A 4LNGA 3QK0A 5HRYA 4A55A 1ZU2A 4YDWA 3ASNE 3J5QB 4RQIA 1N0RA 4BT8A 4HOUA 2E2EA 4WAFA 3UX4A 4I6JA 4DK5A 1Y6IA 3DXKG 2WXNA 4JHJA 5ENQD 4TXQA 1WY6A 4U07A 2XRYA 2PL2A 4GMRA 3W9FA 2Y69E 3B7SA 3SO8A 3SHFA 2B6CA 3P2BA 3CKBA 2VGEA 3LJNA 4U8HA 3ASOE 5AQ9A 4F3VA 4HNAD 3SNXA 4LCTA 1WG0A 4YNDA 1WDYA 4G26A 3NZUA 2L6JA 3KSLA 3KEZA 4AXHA 3ZVVA 1E96B 3UXGA 4NRHB 2VTBA 3FTUA 1NZNA 1TNOA 3MKQB 2LSUA 3FUKA 2BTDA 5J08A 3FUDA 2L9BA 1MHQA 2XS8A 5G55A 4EZLA 1HE8A 4AOFA 1BI8B 2X6JA 3CEQA 1MX4A 2OEWA 3JYSA 3KAEA 3CK9A 3ESLA 4O1OA 5G05C 3OXFA 5A23A 3ULQA 1K8KG 3Q7AA 4OAVB 3QWVA 1OY3D 3NBNB 5EIDA 5CCLA 3IKOB 2M63A 3PS6A 2WQ6A 3HIZA 2I2OA 1TJCA 2WMOA 4MKTA 2CHZA 2B0OE 1OT8A 1FVHA 4J0UA 5E76A 1UOHA 3LEWA 4DPRA 2R05A 5DBKA 3MGBA 3ZEFA 3IBEA 2VSNA 3L22A 4UWLA 5CECB 1N4QA 1EDUA 4U7EB 3D9MA 2GRQB 3ML8A 1YCSB 3BQOA 3LJ3A 4UI9J 5B3SE 2XCCA 2IJGX 3I5PA 2ETCA 3APFA 1TNBA 5AENA 3E32A 5ENNA 4RVBA 2DYSE 2V0PA 1N54A 3PZ2A 4C9BB 3DSWA 5ENPD 3NAWA 1X81A 3UIPC 3QB2A 4ILGA 5C2YA 4AP2A 2YNQA 1UG3A 1JWGA 4DX7D 2GRNB 3D9NA 4TUMA 1N4SA 3S7JA 3HVEB 1A17A 4E6HA 1WM5A 4PDXA 4HLLA 5AYWD 4FJZA 3D9PA 1Z6TA 4OVUA 2C0LA 3ZRHA 3LYAA 2GRLA 3D9IA 2DZNA 5CRUA 5BPPA 1HO8A 2VJ8A 3EHNA 2CG2A 3CHMA 4LNBA 4UI9C 2L0TB 4GCOA 2UY1A 3ZW3A 3HXBA 4I1AA 1XGWA 2HO1A 4NACA 4DLQA 4L9PA 1HZ4A 4AJWA 4JZYA 3C3QA 3FH7A 1LTXA 4GU5A 2NC9A 3PZ3A 2ETAA 3Q7FA 3IV0A 4BSZB 4DUIA 3TWWA 2WMNA 1KLXA 5T8IA 1HG5A 2OV8A 1SVXA 3NOCD 3JUIA 2I6HA 3AU5A 2VGXB 3UTMA 2KZTB 2XQ0A 3V30A 4BSXA 4GPMA 1SZ9A 2I1JA 5CERB 1OCZE 3EDTB 3Q15A 1Y8MA 3TWVA 5T4YA 2HR2A 5CHEE 5EX3A 3ZIMA 1OXJA 4L1BA 1OWNA 3PE4A 4N5QA 2KM4A 5AIJA 1SZAA 5ENOD 2IY0C 3FY4A 1D9SA 3RK6A 2QC9A 4GAAA 2QFCA 3D3MA 3SY2A 3Q5MA 3CHRA 3FTYA 3ASDA 4QFVA 3AG2E 4UQXA 2J8SD 4JXTA 4JL0A 4L2YA 4B94A 1LD7A 3FEYA 5BXOA 4C48B 4CT4A 4WNEA 4MBGA 1FT1A 4WWPA 2AXVA 3BEEA 5KCMA 4FU3A 1S64A 5T3RA 3ZYLA 2NSZA 3PNTB 3MA5A 3FTVA 2EINE 4BTBA 4V3IA 4JA7A 2KCLA 3EHQA 1S70B 1Z3XA 3V2OA 3ZFWA 4CDNA 1MQSA 4U0ZA 3KSQA 4GYYA 3B7UX 4YVQC 4AY5A 1OWPA 4AM9A 2GRPB 4RLYA 3G2UA 1DC2A 3CSFA 2NXPA 3S2AA 2YHEA 1OWLA 4GTVA 2WQ7A 1BD8A 1H6KA 4XIFA 4F1SA 2J49A 3G2TA 4AIFA 2XGMA 3WXXA 4ANWA 2XRZA 3I4GA 3ZYKA 5FIOA 1N52A 4U0SA 1HS6A 1QZ2A 1ZBPA 3DRAA 3FTXA 5G04C 3PDNA 2V4HC 4HORA 4GZ3A 2IOSA 5ANLA 4IRUA 3CVUA 4L23A 5ARGA 1SA4A 4JHRA 4FJYA 3ZUVB 3T5XA 4IULA 3ZKJA 2HE0A 1UJJA 3DPYA 4LG6A 4JHKA 3MV2B 2WXIA 3BU8A 5AQ7A 1IQRA 4DRXE 2IOLA 3RKVA 2CFUA 2LAIA 2F8XK 3QAQA 1TEZA 4I1OB 1SA5A 3T8MA 3E4BA 1SW6A 5JJ6A 4ANVA 3RSEG 4LUNU 3DPDA 4ACLA 3U66A 3CVVA 3SFYA 5EDSA 3EIQC 4LEUA 1KPSB 4BEPA 1G3NB 1QNFA 4CCAA 4F1PA 2XS1A 1AP7A 3N71A 3DXMG 3UM0A 2MOWA 2BUGA 2OVFA 3MJWA 2IEJA 1NFIE 3E34A 4BTAA 4LSZE 3SF4A 4YDEA 4ILIA 4EBAA 1TN6A 3FUFA 2BF0X 3CVXA 1H2VC 3FUNA 1TYQG 1GW6A 4FHKA 3B95A 5ENTD 2C0MA 3L6AA 2AJAA 1N95A 1H6OA 3RRNB 3ZPJA 3CSTA 4BERA 3OXGA 4KVMA 5FQ6A 1O5MA 4GA0A 4ZHBA 1H6PA 2QYJA 5ITZF 2DBAA 3RO3A 4WWNA 4TV3A 5ENRD 5CRVA 2FO7A 2BKGA 2VSYA 4BX8A 2P9KG 4XZ4A 2Y1LE
chains in the Genus database with same CATH topology
1V55E 2EINE 1OCRE 3ABLE 2EIJE 3ASNE 3X2QE 2DYRE 2EIME 3AG4E 5B1BE 2EILE 5B1AE 3AG3E 3ASOE 3AG2E 3ABME 2DYSE 1OCZE 1OCCE 2EIKE 1V54E 3WG7E 2OCCE 5B3SE 5IY5E 2ZXWE 3ABKE 2Y69E 3AG1E 1OCOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V55 E;  2EIN E;  1OCR E;  3ABL E;  2EIJ E;  3ASN E;  3X2Q E;  2DYR E;  2EIM E;  3AG4 E;  5B1B E;  2EIL E;  5B1A E;  3AG3 E;  3ASO E;  3AG2 E;  3ABM E;  2DYS E;  1OCZ E;  1OCC E;  2EIK E;  1V54 E;  3WG7 E;  2OCC E;  5B3S E;  5IY5 E;  2ZXW E;  3ABK E;  2Y69 E;  3AG1 E;  1OCO E; 
#chains in the Genus database with same CATH topology
 2WXR A;  4O60 A;  3CKC A;  1UW4 B;  3L16 A;  5G05 J;  4URK A;  1K1A A;  2UWJ G;  3LY7 A;  2WXP A;  3HXD A;  1O1S A;  5ANR A;  3B7R L;  4J8S A;  3ZHE A;  2E0I A;  4I9E A;  4CRW A;  3JQ0 A;  5KJK A;  2DWZ A;  4GZD A;  4W9R A;  3VLE A;  4M7C A;  3RAU A;  4G8L A;  3LCA A;  2WXK A;  4UUC A;  4UWF A;  5BV0 A;  2JAB A;  2J07 A;  4N3A A;  4Z68 A;  5FQ7 A;  1DCQ A;  4U04 A;  3DEO A;  3W9G A;  4CGV A;  5A6C A;  3FHE A;  2GGF A;  4NQ0 A;  3KS2 A;  5D66 A;  1PAQ A;  4KVO A;  1KZO A;  3C3R A;  5H7P A;  3APC A;  3C72 A;  4R7L A;  1LD8 A;  1W3B A;  2XGS A;  4QQI A;  4ANX A;  4JA9 A;  5JHA A;  3I4R B;  4X8Q A;  5CED B;  3HXF A;  2ZU6 B;  3FUH A;  2EIM E;  3S7D A;  3Q73 A;  1ELW A;  2A5U A;  3VLD A;  3UMV A;  5FIN A;  3LVR E;  3T9K A;  1JWF A;  4XKC A;  3EHM A;  2GRR B;  4DJA A;  1TN8 A;  3Q47 B;  3ZXS A;  1ELK A;  1EF1 C;  3D9K A;  3FTS A;  4J7W A;  3I3N A;  1HFA A;  1TN7 A;  2WXM A;  4J6I A;  3EIJ A;  1N4P A;  2RD0 A;  2X6I A;  4GTQ A;  4E85 A;  2RFA A;  1D8D A;  4CYM D;  3VLF A;  3Q79 A;  3TG5 A;  3C5R A;  4GML A;  4RSY A;  4I2Z A;  2FI7 A;  3JCK C;  3AG1 E;  1PC2 A;  3DSS A;  5LX8 A;  3ZNG A;  3UIO C;  1ELR A;  4PS8 A;  1E7V A;  3UI2 A;  1P5Q A;  1TR4 A;  3G2S A;  4JB8 P;  2WB2 A;  1A5E A;  4H7X A;  3AJI A;  4GYW A;  2V5F A;  3O48 A;  1OCR E;  1K3Z D;  4EZJ A;  3U9W A;  2CFZ A;  1E8X A;  3BG0 B;  4WUY A;  4NIK A;  2VYI A;  2WXJ A;  1E8Z A;  3QC1 A;  4WWO A;  4O6F A;  2LNI A;  4N5C A;  2KXP C;  3ZYQ A;  2WXO A;  1INZ A;  3SFZ A;  4ABN A;  3C98 A;  2J08 A;  3V2X A;  2EQX A;  2RKK A;  2WXF A;  4XE0 A;  2XEN A;  2KC7 A;  5EKQ D;  2X6H A;  3CK7 A;  5JMN D;  3CVW A;  2DZO A;  4GCN A;  5D2M C;  4K5A B;  4BY6 A;  3JXI A;  4Q69 A;  3EHR A;  3FUM A;  3ZN3 A;  2VGY A;  1N9A A;  1JCR A;  4PUC A;  2JLB A;  1FCH A;  2OOE A;  1V54 E;  4IYP A;  3JUE A;  2IU1 A;  3CLJ A;  3FWV A;  4KZ0 A;  3SGH A;  4K5C A;  2IO3 C;  3MKR A;  4GZ6 A;  5CCM A;  3TWQ A;  3DWL G;  3CVY A;  4J8F A;  4BES A;  3PEU B;  4Y6C A;  5EIB E;  2ZIS A;  4IN3 B;  2VTB B;  3APD A;  3MCX A;  1IQU A;  3TXM A;  4JPS A;  3GZ2 A;  3UT8 A;  3PRE A;  3QWP A;  3TAX A;  3AS4 A;  3RJV A;  3ASH A;  2LXM A;  3AG3 E;  4N2Q A;  4FLB A;  5AAO A;  2YQ8 A;  3Q49 B;  5EIL A;  3FP3 A;  3R9A B;  5CBO A;  3AS5 A;  2IF4 A;  2I1K A;  3CHS A;  3FUI A;  4B8A A;  4BWR A;  4MS6 A;  3L82 A;  3L9T A;  2V4L A;  3PRZ A;  3FDH A;  3B13 A;  5AJL A;  1MX6 A;  2XEV A;  3IHY A;  3FUL A;  4UWG A;  3UKR G;  1IYG A;  3KEA A;  5EN5 D;  3Q9U C;  3K9I A;  4UWK A;  4APO A;  3ABK E;  3FUJ A;  2EIJ E;  3OAW A;  3CK8 A;  2XEH A;  5EYP F;  4A63 B;  2J4D A;  2ZGG A;  1NP7 A;  3PZD A;  1QBQ A;  4YVO A;  3E30 A;  1L5J A;  4NUR A;  1YYH A;  3J5P A;  1EPU A;  3PEV B;  2I9C A;  1Z3Y A;  2MYO A;  3KD7 A;  2DCP A;  1UJK A;  1S63 A;  5JHB A;  3SI5 A;  2V5Q C;  4GTO A;  2MRI A;  5FQ4 A;  2JEK A;  3FU3 A;  5DIZ A;  3HXE A;  4M3O A;  3LPZ A;  5G04 J;  5FWQ A;  3WG7 E;  4OVV A;  3ZGQ A;  2XZD G;  3SD5 A;  1QYM A;  1OUV A;  2FBN A;  3CVP A;  3UM1 A;  2IQC A;  5HKP A;  4ACK A;  2H6H A;  4I1M A;  5KWD A;  5CEA A;  5D0Q D;  5KBA A;  3CHP A;  3NF1 A;  5HS0 A;  3FU0 A;  3JXJ A;  1TJF A;  3DSX A;  4J8E A;  1TNZ A;  2DVW A;  4JEH A;  4BET A;  3DSV A;  2XHE A;  3DEP A;  4EPZ A;  3R7R A;  5CMW A;  3FU6 A;  5FQ8 A;  3MKQ A;  1IXV A;  3ZU7 B;  1EYH A;  2P9I G;  4HRN A;  1Z5S C;  1LF8 A;  4B0Z A;  3MYV A;  4FAD A;  2P2C P;  1ZB1 A;  1BI7 B;  3F6Q A;  1N0Q A;  2HYZ A;  2UY1 B;  4APF A;  3TWS A;  3LKU A;  4OAU C;  3DSU A;  2CG3 A;  1DVP A;  4GZ5 A;  2RFM A;  2A4Z A;  3QAR A;  2DIW A;  3ABL E;  1KZP A;  2OEV A;  2WPV A;  3IXE A;  5BT1 A;  1RZ4 A;  1S0P A;  2ILR A;  2XZT G;  2Q7F A;  4I9C A;  2VSO E;  3QOU A;  5A7D B;  2H6G A;  3TWU A;  2PM6 A;  3Q4A B;  4G11 A;  3ONL A;  4OYS A;  5LOZ A;  4CEM A;  4HQD A;  2R59 A;  3CQG B;  3DST A;  3TWT A;  3NB2 A;  4A3T A;  1MX2 A;  4U63 A;  4AY6 A;  1H19 A;  3CVL A;  3GYZ A;  3BUA A;  2H6I A;  4G8K A;  5FZQ A;  2MHK A;  5LP0 A;  4XI0 A;  1MJ0 A;  5FTP A;  3TG4 A;  1IHB A;  1OCO E;  1KT1 A;  3L17 A;  4GTS A;  5LCW C;  1K1B A;  2H6F A;  3LS8 A;  4BX9 A;  4N3C A;  2X6F A;  2OND A;  3LY8 A;  2KCV A;  4ANU A;  3ONK A;  3Q75 A;  4BFR A;  2PQN A;  3C3O A;  2QZA A;  1OWM A;  3L13 A;  1JCQ A;  4EQF A;  4A3V A;  2P9L G;  3GZ1 A;  4DX6 D;  2AW6 A;  2WXQ A;  2ZIR A;  3UPV A;  3UUX A;  4HB5 A;  4GTT A;  4L2L A;  4GPK A;  1FPP A;  3RIB A;  3E33 A;  5ENS D;  3P1U A;  4ILH B;  4HI8 A;  2F0Y A;  2XGO A;  3O4Z A;  4N39 A;  3PZ1 A;  3HVE A;  4XI9 A;  2CHW A;  5G2N A;  3FU5 A;  1VDY A;  4G23 A;  1E8W A;  2J4B A;  2XPI A;  4U0U A;  1FVF A;  2QYU A;  1IHG A;  2L0I A;  3VTY A;  1PY1 A;  4AEZ C;  4PS7 A;  1X5B A;  4JD2 G;  1HF8 A;  3RRU A;  3CQC B;  1HU3 A;  2A5E A;  3PZ4 A;  4RG9 A;  2P9N G;  3U3W A;  2AXZ A;  1QQE A;  2WVI A;  1NA3 A;  4HXI A;  3MZL B;  1U2V G;  2YIN A;  4AVX A;  1RW2 A;  5FT9 A;  4HOS A;  4TXP A;  4DX2 A;  4B8C B;  3MV3 B;  4U8V D;  1MZC A;  3SBT B;  2R03 A;  1E8Y A;  5KNH D;  4B93 B;  5CMY A;  1N11 A;  4KXK B;  3PNL B;  3CV0 A;  2VGX A;  3D9J A;  4TUU A;  2ZGD A;  5AQB A;  2LO6 A;  1JUQ A;  2RG8 A;  2GW1 A;  3FEX A;  2KZT A;  2X38 A;  4PH4 B;  4JVS A;  4XX5 A;  4I6G A;  2OCC E;  3TWX A;  4YDO A;  4CDM A;  4HS2 A;  3QJZ A;  2KBX A;  3TGO A;  1AWC B;  4F7A A;  4HOT A;  4FP7 A;  4GA2 A;  4Y6W A;  3ABM E;  5EYL A;  2EIK E;  2PZI A;  3HXC A;  4DX5 D;  3S7F A;  2XCB A;  4U95 D;  2J09 A;  4EEC A;  1HXI A;  4G1T A;  1NI1 A;  1HG2 A;  4XEI G;  2EIL E;  3OXL A;  2IO2 C;  5EX0 A;  4XKB A;  1E7U A;  1MYO A;  3ASF A;  3TJP A;  2R17 C;  2KCK A;  3FFL A;  4UQZ A;  4ME2 A;  4I6E A;  1H0A A;  3VTX A;  2NYJ A;  3Q9N C;  4G25 A;  4TXR A;  4F53 A;  3PH0 C;  2HM8 A;  3HG0 D;  5CBN A;  3AU4 A;  5B1B E;  2YHC A;  4CDR A;  5B1A E;  1H2T C;  1BPO A;  1N94 A;  4C0E A;  3FTW A;  3EUV A;  4ZFH A;  5AAR A;  3SQV A;  3AS8 A;  5JJ7 A;  5AJD A;  4PS3 A;  3U4T A;  5BUZ A;  5FZS A;  3UT7 A;  4A1S A;  3IHV A;  2LXL A;  1WAO 1;  2AXU A;  3ASG A;  3B7B A;  2LAH A;  4A1G A;  3TL5 A;  4WND A;  3TXN A;  1YA0 A;  4K03 A;  4DLO A;  3MX3 A;  5KJL A;  2WXL A;  3UM2 A;  3R9M A;  3HYM B;  4EZK A;  4JC8 A;  3QNK A;  3FTZ A;  3U64 A;  5M72 A;  4FUL A;  4J8D A;  2ION A;  3SZ7 A;  4HVB A;  1NA0 A;  2FF4 A;  2C2L A;  3D9H A;  4F6R D;  3RU0 A;  3ZHE B;  2P9U G;  1FT2 A;  3ESK A;  4GMJ A;  2P58 C;  2P9P G;  4WNG A;  4CZ2 D;  2DYR E;  3URZ A;  1U3C A;  4GB9 A;  3UM3 A;  3NZS A;  3L54 A;  3GW4 A;  3PVL A;  5ARF A;  3CHQ A;  3UT4 A;  4L7T A;  1E90 A;  4FLH A;  4FC8 A;  3IEG A;  5AQA A;  3CR3 A;  3TWR A;  3OTN A;  2PQR A;  5D0O D;  5J90 A;  3S7B A;  1TNY A;  1DNP A;  1SQM A;  3UIN C;  2QY7 A;  4DX1 A;  2R2L A;  2GRO B;  3MEK A;  3HRA A;  4KZC A;  2FEZ A;  3R7Q A;  3EU5 A;  3CIA A;  1O1T A;  4LER A;  1N4R A;  3FH8 A;  2WM9 A;  3EJN A;  5BW8 C;  3V79 K;  4GTP A;  4MLP A;  3HDX A;  4TRQ A;  2F37 A;  4U96 D;  2Y0B G;  4MRU A;  1JPL A;  4WNF A;  2ZXW E;  3CGH A;  5BV1 A;  4HRL A;  3ULY A;  2XPZ A;  5FZR A;  3QDN A;  1KT0 A;  1XNF A;  3AG4 E;  3LDZ A;  4GYO A;  4CT0 A;  2WXG A;  2PM7 A;  3Q78 A;  4C0M A;  2Y4U A;  1UN9 A;  5AN8 A;  4HLE A;  1BU9 A;  2OVB A;  4G2V A;  1TNU A;  2GRM A;  4KMO A;  3PUJ A;  5C1D A;  4HOQ A;  4U8Y D;  3FUE A;  1NL4 A;  3RO2 A;  5JJT A;  2X3M A;  2WQH A;  2AWI A;  3UKU G;  3E37 A;  5LFA A;  4KYO B;  1D8E A;  3PE3 A;  4HFG A;  4BT9 A;  4FHJ A;  3ZXP A;  3ZYM A;  2X6K A;  1V55 E;  2ETB A;  1UN8 A;  1B89 A;  4KBQ A;  4GTR A;  4G24 A;  4LNU D;  2FO1 E;  2R5S A;  3FH5 A;  2J9Q A;  3PUK A;  1DCE A;  2LUH A;  2WXH A;  4B89 A;  2VQ2 A;  3T5V A;  2XEE A;  4DI3 A;  5KNG A;  4O1P A;  4LRZ A;  2Y3A A;  1H2U A;  3NOG D;  5KJM A;  2IFU A;  3NQP A;  4HI9 A;  4EBA G;  5KJN A;  4N2S A;  2LSV A;  2PNN A;  3ISM C;  3DBS A;  4ATG A;  2R02 A;  4YDY A;  4H7Y A;  4JW1 A;  3EU9 A;  2V8S E;  5LCW J;  1IKN D;  3CHO A;  4CGW A;  5HQ8 A;  3ENE A;  3G2V A;  4UWH A;  4EHM A;  4Q94 A;  1O1R A;  3L08 A;  3V31 A;  1U3D A;  3B7T A;  4K0R A;  4N3B A;  3T8K A;  1HH8 A;  5E75 A;  3ULE G;  2AVP A;  1JCS A;  5BNW A;  4Q96 A;  4J8Y A;  3QWW A;  4RG6 A;  5HI7 A;  4HBD A;  1OCC E;  2F8Y A;  2P9S G;  4I43 A;  2Y4T A;  4UQY A;  1OWO A;  4UI9 K;  4D10 C;  4I17 A;  5FJY A;  4K5B A;  2FUL A;  3G2W A;  4AV7 A;  2BED A;  1YMP A;  3QKY A;  3CVQ A;  5IY5 E;  2CHX A;  3RRM B;  5JA4 D;  3UQ3 A;  3LVQ E;  3SBS A;  2BKK B;  4P29 A;  3D9L A;  4GZC A;  3X2Q E;  4ATZ D;  3D9O A;  3AAA C;  1BLX B;  2L6B A;  4GA1 A;  3HHM A;  3JQ1 A;  4JEU A;  3SFX A;  1HX8 A;  3BG1 B;  4GTM A;  1Q2Z A;  4I2W A;  2KAT A;  2XPY A;  3CVN A;  4KT6 B;  4DI4 A;  4HRM B;  4FA6 A;  2VSX E;  3LY9 A;  3GZS A;  5BXU A;  3LXU X;  3ML9 A;  4LNG A;  3QK0 A;  5HRY A;  4A55 A;  1ZU2 A;  4YDW A;  3ASN E;  3J5Q B;  4RQI A;  1N0R A;  4BT8 A;  4HOU A;  2E2E A;  4WAF A;  3UX4 A;  4I6J A;  4DK5 A;  1Y6I A;  3DXK G;  2WXN A;  4JHJ A;  5ENQ D;  4TXQ A;  1WY6 A;  4U07 A;  2XRY A;  2PL2 A;  4GMR A;  3W9F A;  2Y69 E;  3B7S A;  3SO8 A;  3SHF A;  2B6C A;  3P2B A;  3CKB A;  2VGE A;  3LJN A;  4U8H A;  3ASO E;  5AQ9 A;  4F3V A;  4HNA D;  3SNX A;  4LCT A;  1WG0 A;  4YND A;  1WDY A;  4G26 A;  3NZU A;  2L6J A;  3KSL A;  3KEZ A;  4AXH A;  3ZVV A;  1E96 B;  3UXG A;  4NRH B;  2VTB A;  3FTU A;  1NZN A;  1TNO A;  3MKQ B;  2LSU A;  3FUK A;  2BTD A;  5J08 A;  3FUD A;  2L9B A;  1MHQ A;  2XS8 A;  5G55 A;  4EZL A;  1HE8 A;  4AOF A;  1BI8 B;  2X6J A;  3CEQ A;  1MX4 A;  2OEW A;  3JYS A;  3KAE A;  3CK9 A;  3ESL A;  4O1O A;  5G05 C;  3OXF A;  5A23 A;  3ULQ A;  1K8K G;  3Q7A A;  4OAV B;  3QWV A;  1OY3 D;  3NBN B;  5EID A;  5CCL A;  3IKO B;  2M63 A;  3PS6 A;  2WQ6 A;  3HIZ A;  2I2O A;  1TJC A;  2WMO A;  4MKT A;  2CHZ A;  2B0O E;  1OT8 A;  1FVH A;  4J0U A;  5E76 A;  1UOH A;  3LEW A;  4DPR A;  2R05 A;  5DBK A;  3MGB A;  3ZEF A;  3IBE A;  2VSN A;  3L22 A;  4UWL A;  5CEC B;  1N4Q A;  1EDU A;  4U7E B;  3D9M A;  2GRQ B;  3ML8 A;  1YCS B;  3BQO A;  3LJ3 A;  4UI9 J;  5B3S E;  2XCC A;  2IJG X;  3I5P A;  2ETC A;  3APF A;  1TNB A;  5AEN A;  3E32 A;  5ENN A;  4RVB A;  2DYS E;  2V0P A;  1N54 A;  3PZ2 A;  4C9B B;  3DSW A;  5ENP D;  3NAW A;  1X81 A;  3UIP C;  3QB2 A;  4ILG A;  5C2Y A;  4AP2 A;  2YNQ A;  1UG3 A;  1JWG A;  4DX7 D;  2GRN B;  3D9N A;  4TUM A;  1N4S A;  3S7J A;  3HVE B;  1A17 A;  4E6H A;  1WM5 A;  4PDX A;  4HLL A;  5AYW D;  4FJZ A;  3D9P A;  1Z6T A;  4OVU A;  2C0L A;  3ZRH A;  3LYA A;  2GRL A;  3D9I A;  2DZN A;  5CRU A;  5BPP A;  1HO8 A;  2VJ8 A;  3EHN A;  2CG2 A;  3CHM A;  4LNB A;  4UI9 C;  2L0T B;  4GCO A;  2UY1 A;  3ZW3 A;  3HXB A;  4I1A A;  1XGW A;  2HO1 A;  4NAC A;  4DLQ A;  4L9P A;  1HZ4 A;  4AJW A;  4JZY A;  3C3Q A;  3FH7 A;  1LTX A;  4GU5 A;  2NC9 A;  3PZ3 A;  2ETA A;  3Q7F A;  3IV0 A;  4BSZ B;  4DUI A;  3TWW A;  2WMN A;  1KLX A;  5T8I A;  1HG5 A;  2OV8 A;  1SVX A;  3NOC D;  3JUI A;  2I6H A;  3AU5 A;  2VGX B;  3UTM A;  2KZT B;  2XQ0 A;  3V30 A;  4BSX A;  4GPM A;  1SZ9 A;  2I1J A;  5CER B;  1OCZ E;  3EDT B;  3Q15 A;  1Y8M A;  3TWV A;  5T4Y A;  2HR2 A;  5CHE E;  5EX3 A;  3ZIM A;  1OXJ A;  4L1B A;  1OWN A;  3PE4 A;  4N5Q A;  2KM4 A;  5AIJ A;  1SZA A;  5ENO D;  2IY0 C;  3FY4 A;  1D9S A;  3RK6 A;  2QC9 A;  4GAA A;  2QFC A;  3D3M A;  3SY2 A;  3Q5M A;  3CHR A;  3FTY A;  3ASD A;  4QFV A;  3AG2 E;  4UQX A;  2J8S D;  4JXT A;  4JL0 A;  4L2Y A;  4B94 A;  1LD7 A;  3FEY A;  5BXO A;  4C48 B;  4CT4 A;  4WNE A;  4MBG A;  1FT1 A;  4WWP A;  2AXV A;  3BEE A;  5KCM A;  4FU3 A;  1S64 A;  5T3R A;  3ZYL A;  2NSZ A;  3PNT B;  3MA5 A;  3FTV A;  2EIN E;  4BTB A;  4V3I A;  4JA7 A;  2KCL A;  3EHQ A;  1S70 B;  1Z3X A;  3V2O A;  3ZFW A;  4CDN A;  1MQS A;  4U0Z A;  3KSQ A;  4GYY A;  3B7U X;  4YVQ C;  4AY5 A;  1OWP A;  4AM9 A;  2GRP B;  4RLY A;  3G2U A;  1DC2 A;  3CSF A;  2NXP A;  3S2A A;  2YHE A;  1OWL A;  4GTV A;  2WQ7 A;  1BD8 A;  1H6K A;  4XIF A;  4F1S A;  2J49 A;  3G2T A;  4AIF A;  2XGM A;  3WXX A;  4ANW A;  2XRZ A;  3I4G A;  3ZYK A;  5FIO A;  1N52 A;  4U0S A;  1HS6 A;  1QZ2 A;  1ZBP A;  3DRA A;  3FTX A;  5G04 C;  3PDN A;  2V4H C;  4HOR A;  4GZ3 A;  2IOS A;  5ANL A;  4IRU A;  3CVU A;  4L23 A;  5ARG A;  1SA4 A;  4JHR A;  4FJY A;  3ZUV B;  3T5X A;  4IUL A;  3ZKJ A;  2HE0 A;  1UJJ A;  3DPY A;  4LG6 A;  4JHK A;  3MV2 B;  2WXI A;  3BU8 A;  5AQ7 A;  1IQR A;  4DRX E;  2IOL A;  3RKV A;  2CFU A;  2LAI A;  2F8X K;  3QAQ A;  1TEZ A;  4I1O B;  1SA5 A;  3T8M A;  3E4B A;  1SW6 A;  5JJ6 A;  4ANV A;  3RSE G;  4LUN U;  3DPD A;  4ACL A;  3U66 A;  3CVV A;  3SFY A;  5EDS A;  3EIQ C;  4LEU A;  1KPS B;  4BEP A;  1G3N B;  1QNF A;  4CCA A;  4F1P A;  2XS1 A;  1AP7 A;  3N71 A;  3DXM G;  3UM0 A;  2MOW A;  2BUG A;  2OVF A;  3MJW A;  2IEJ A;  1NFI E;  3E34 A;  4BTA A;  4LSZ E;  3SF4 A;  4YDE A;  4ILI A;  4EBA A;  1TN6 A;  3FUF A;  2BF0 X;  3CVX A;  1H2V C;  3FUN A;  1TYQ G;  1GW6 A;  4FHK A;  3B95 A;  5ENT D;  2C0M A;  3L6A A;  2AJA A;  1N95 A;  1H6O A;  3RRN B;  3ZPJ A;  3CST A;  4BER A;  3OXG A;  4KVM A;  5FQ6 A;  1O5M A;  4GA0 A;  4ZHB A;  1H6P A;  2QYJ A;  5ITZ F;  2DBA A;  3RO3 A;  4WWN A;  4TV3 A;  5ENR D;  5CRV A;  2FO7 A;  2BKG A;  2VSY A;  4BX8 A;  2P9K G;  4XZ4 A;  2Y1L E; 
#chains in the Genus database with same CATH homology
 1V55 E;  2EIN E;  1OCR E;  3ABL E;  2EIJ E;  3ASN E;  3X2Q E;  2DYR E;  2EIM E;  3AG4 E;  5B1B E;  2EIL E;  5B1A E;  3AG3 E;  3ASO E;  3AG2 E;  3ABM E;  2DYS E;  1OCZ E;  1OCC E;  2EIK E;  1V54 E;  3WG7 E;  2OCC E;  5B3S E;  5IY5 E;  2ZXW E;  3ABK E;  2Y69 E;  3AG1 E;  1OCO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...