3ABME

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
b'ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3abmE00
5IY5E 2EIKE 2OCCE 3WG7E 2DYSE 2EIME 5B3SE 1V55E 2EIJE 1OCZE 3AG2E 3ABME 3AG1E 3AG3E 1OCOE 5B1AE 3ASNE 1OCCE 1V54E 3AG4E 2EINE 3ABKE 3ASOE 2EILE 5B1BE 2DYRE 2Y69E 2ZXWE 1OCRE 3X2QE 3ABLE
chains in the Genus database with same CATH superfamily
3ZPJA 4GZDA 3CHSA 2EIME 1PAQA 2HYZA 1H2UA 2VJ8A 1H6KA 1X5BA 1JPLA 3V79K 1TN6A 2CFZA 2CG3A 3CVQA 2PNNA 5DBKA 4OAUC 2V4HC 2FO1E 3W9GA 1E7VA 4DX7D 3FY4A 4CGWA 2LAIA 4BT8A 4GZ5A 3PE3A 1ELWA 1IHGA 3IEGA 3MEKA 4HI8A 3UQ3A 1IYGA 3Q9NC 3S7FA 5J08A 3MGBA 3UIPC 4LCTA 2AXUA 3CV0A 3ML9A 2XQ0A 3FP3A 1Y8MA 3QC1A 2OV8A 2ETBA 4IULA 5BPPA 3ULQA 2E2EA 4TXRA 1MX4A 4KMOA 4YDWA 3TJPA 3Q47B 5M72A 3TXMA 3K9IA 5AAOA 4H7XA 3KEAA 4Q69A 4GPMA 3L22A 2Y1LE 3TWUA 2LNIA 4LRZA 2B6CA 1HE8A 1JCQA 3SGHA 3KS2A 3LVQE 1N52A 1N11A 1L5JA 4G24A 2LSUA 1H6PA 1HG5A 5ANRA 3ZYQA 2BF0X 3LXUX 1WG0A 4E6HA 2DZNA 2AWIA 2B0OE 5KJMA 1MJ0A 4DX1A 1OWPA 4JPSA 5AQ7A 5AQ9A 4TXPA 3LPZA 3EHNA 3CLJA 3MA5A 4UWGA 2XEVA 4AM9A 1VDYA 2OEWA 2R03A 3SY2A 3WG7E 1PY1A 1S70B 4RSYA 1IKND 3FTVA 5G05C 4K5CA 5HKPA 1FT1A 5C1DA 4ZHBA 2IY0C 5CBNA 2KCVA 4I9EA 2VTBB 3FTSA 4BEPA 4XZ4A 1X81A 4XX5A 2KXPC 3ZIMA 4HRLA 3G2SA 4A55A 5D66A 3HXBA 3GW4A 2XCCA 1HG2A 4UI9K 1BI8B 4NRHB 3TWVA 4CRWA 3FUJA 1HU3A 4UWFA 3Q7AA 2WVIA 2ETCA 1TJCA 1TNZA 3NF1A 2WXFA 3UM2A 3DXMG 2ZGGA 2J4DA 4BERA 1QQEA 4HOUA 4F1SA 3D9LA 3C72A 3AG4E 4BSXA 1QNFA 5B1BE 2X6JA 3HG0D 1P5QA 3WXXA 2WM9A 4HRMB 1YMPA 1Z3XA 3AU4A 4GCOA 3CR3A 3FUKA 3Q75A 3D9OA 4KVMA 3ONLA 3MKRA 2L0IA 3CVWA 4L23A 1YCSB 3SFYA 3QJZA 3MKQA 3PREA 3FULA 5ARGA 3FEYA 5AJDA 2YHEA 2J07A 2ETAA 5T3RA 2AVPA 4JC8A 2AXVA 4XKBA 2EIKE 2L6BA 1RZ4A 2X3MA 1E96B 4TV3A 4M3OA 2XPIA 3B13A 2P9UG 2WXJA 5CHEE 5HS0A 1SA4A 4I43A 2WQ6A 4KT6B 5CECB 1SZAA 2MRIA 3LY9A 3DEPA 2WXIA 3TWTA 2WXQA 1OWLA 4QQIA 5T4YA 2X6KA 3FWVA 2I1KA 4J8EA 4EBAG 3ASDA 3SZ7A 4HOSA 4DX2A 4FLBA 5G55A 4HNAD 4DK5A 3ZFWA 1OCZE 3ONKA 2XENA 3ABME 3VLDA 2WXGA 1NI1A 3URZA 4PS7A 3RRUA 3PDNA 4AEZC 3APFA 1AP7A 4DJAA 3DSUA 3TWSA 3FUDA 3D9IA 2RD0A 2IO2C 1HO8A 3PS6A 3ULYA 3Q4AB 4N3BA 5AQBA 3W9FA 1BPOA 1IQRA 3LS8A 3U3WA 1YYHA 3JXIA 4EZKA 2CHXA 3MCXA 3EJNA 4GTQA 4GA2A 4UQZA 1QZ2A 5HRYA 4F3VA 3AG1E 3G2VA 4J8DA 3D9KA 4KBQA 1U3DA 4KVOA 1MQSA 3PZ4A 3FUIA 3SBSA 2EQXA 4UUCA 4Y6WA 4G23A 3KEZA 3GZ2A 3DSXA 5EX3A 2Y4TA 2V0PA 4FHJA 3I5PA 5EYPF 1JCSA 4GPKA 4I17A 4MLPA 2L6JA 4JB8P 5ENTD 1MZCA 2YNQA 2GRMA 2JABA 1INZA 3CK9A 2KZTB 4EQFA 4AVXA 3ASFA 1HS6A 5AARA 5ANLA 3TAXA 2YHCA 3QAQA 4HOTA 2WXMA 3O48A 3U64A 3PNLB 4GA0A 5EN5D 2VSXE 3ZKJA 4IN3B 2C2LA 1DNPA 3ZYKA 1O1TA 1DCQA 5D0QD 1IHBA 4NIKA 3APCA 2C0LA 4LERA 3S7JA 3CKCA 2P9PG 4ACLA 2J49A 2VTBA 1Q2ZA 1UN9A 3FTXA 3MV3B 4CDMA 3LKUA 1A5EA 4OVVA 1LF8A 2GRRB 3TWRA 3FTWA 2UY1B 1TN8A 5ENOD 3PZ2A 4LNBA 4YNDA 2JLBA 1N94A 1KT1A 4BFRA 1OCOE 4U0SA 4WNEA 2BKGA 3FUFA 3ZN3A 4LNUD 1K1BA 2A5EA 2XS8A 2PM7A 2IQCA 3TGOA 2NXPA 4JXTA 2RFMA 1H0AA 2HM8A 3TWXA 3JCKC 3DWLG 3B7RL 1S63A 4BX9A 3PNTB 4GTTA 4CT4A 4G26A 2OOEA 4I2WA 1WY6A 1H6OA 2PQRA 4U0ZA 2J8SD 4YDOA 1FVHA 2J4BA 4JD2G 5FTPA 5EIDA 5FZSA 4JHRA 3RRMB 2BEDA 2VGYA 1ZBPA 4GMJA 4EBAA 5H7PA 2GW1A 3ABKE 4PS8A 2WMNA 5EYLA 3ZGQA 5G2NA 3ZXSA 2QFCA 5ENPD 4XI9A 3CVXA 5ENRD 3B7TA 4ANVA 3ASNE 3HVEB 1S64A 4DX5D 1N4QA 2EILE 3UPVA 2QYJA 3N71A 5KBAA 4I6JA 2JEKA 3R7QA 5FJYA 5AN8A 2WXHA 4TUUA 3UUXA 4OVUA 3C3QA 4UI9J 2FO7A 4BX8A 3CGHA 5AJLA 3PRZA 4GZ6A 2DCPA 3QDNA 4MS6A 3JQ1A 2HR2A 1JUQA 1XGWA 1ZU2A 2GRQB 2P9KG 1KPSB 4I9CA 3EU5A 5KJLA 5BV1A 3JUIA 3CHPA 5AIJA 4ANWA 4HXIA 3B7BA 4JHKA 4ME2A 5B3SE 1GW6A 5KWDA 4GMLA 3GYZA 3E37A 3ASHA 2XPZA 4PUCA 3TL5A 4ANUA 2ZU6B 3E32A 5JHAA 4GMRA 2FBNA 4HLEA 2ONDA 5JHBA 3Q9UC 3ESLA 2V5QC 1OUVA 2GROB 5D0OD 5ARFA 3OXFA 1NA3A 3TWWA 3PZ3A 3CHOA 2XRZA 4UWHA 2F8XK 5KNHD 5JJTA 3MV2B 3DBSA 4DX6D 1IXVA 3UT7A 1UW4B 5E75A 4JZYA 5B1AE 3Q5MA 2VSNA 3S7DA 4R7LA 4BTBA 2WXNA 5KCMA 3JXJA 4JEHA 4BWRA 4Q96A 2C0MA 3AU5A 4WWNA 4OAVB 3ESKA 4YDEA 2XGMA 2XEHA 3SO8A 4G8LA 4WNFA 2IU1A 5A6CA 3D3MA 2X6FA 3CKBA 2XEEA 3QARA 3UKRG 1MX2A 3LVRE 3ASOE 5JJ7A 2XZTG 4FP7A 2XRYA 4ILHB 5LCWJ 4FULA 1LD8A 3FH7A 3SI5A 3TG5A 4P29A 3QB2A 3VTXA 1E90A 3AS8A 2KCKA 5FQ6A 3CIAA 5FZRA 3T8MA 4ACKA 2LSVA 4L2LA 4F53A 2UY1A 4J8YA 4ATZD 3Q15A 2J09A 3CHQA 4H7YA 4HI9A 3MX3A 2PL2A 4J8SA 5CRVA 1PC2A 3VTYA 4KZCA 3FHEA 1WAO1 2MYOA 4XKCA 1K8KG 1BD8A 2MHKA 4J7WA 5KJNA 3PEUB 2FI7A 3DEOA 5T8IA 2Y3AA 3CVYA 1D8EA 4B94A 3SHFA 2Y4UA 2DZOA 3DSWA 1N4PA 1KT0A 3ISMC 5JA4D 2R02A 3UM0A 5J90A 3NAWA 3KD7A 4GB9A 4BESA 4RLYA 2X38A 5FWQA 3Q73A 4HBDA 3ZYLA 3ZYMA 2VGEA 2WXLA 4GTOA 1U3CA 3I4GA 4AJWA 3SBTB 4N2SA 5BXOA 3C3RA 4LUNU 3I3NA 2BTDA 2AJAA 2ZXWE 5DIZA 4EZLA 2P9LG 3UTMA 2DBAA 3OTNA 1SA5A 4LNGA 2V4LA 3RSEG 3QWVA 2L0TB 4CCAA 3VLFA 2KC7A 3EU9A 4O60A 1JCRA 2R05A 4RG6A 4N2QA 2F8YA 1UN8A 3Q7FA 3ULEG 3CHMA 3HDXA 2YINA 4DLQA 5G04J 2DVWA 4AIFA 5ITZF 3EDTB 3LJ3A 4DRXE 2GGFA 5CEDB 2WB2A 4C0MA 4YVOA 4L9PA 4I6GA 3VLEA 3L08A 1YA0A 4AOFA 4I1OB 5CMYA 4CZ2D 4E85A 2GRLA 2OVBA 1BU9A 4DI4A 2IEJA 4XIFA 3UXGA 3Q78A 1DCEA 1N4RA 2ILRA 1MHQA 1TEZA 2AXZA 1RW2A 3IHVA 5EDSA 3L54A 4N5QA 3KAEA 4ILGA 2Y0BG 5FZQA 3RAUA 4IRUA 1KZOA 1EF1C 3HHMA 3GZSA 1BI7B 4U8YD 3HXDA 2H6GA 2HE0A 5AQAA 1Z5SC 5FT9A 4HVBA 2J9QA 3ZNGA 3S2AA 1UG3A 3ZRHA 5CBOA 3UT4A 3FU0A 4PH4B 4BT9A 2QZAA 2F37A 2DIWA 4GZ3A 3PH0C 3QOUA 1ELKA 4GCNA 4GYOA 5KNGA 1DVPA 3LY8A 5FQ4A 1B89A 4HOQA 3QNKA 3U9WA 2WQHA 3FUEA 1DC2A 1U2VG 4HLLA 4U7EB 4X8QA 1TJFA 5HI7A 3L82A 2R2LA 3G2TA 1K1AA 3G2UA 4GAAA 5LOZA 4JVSA 3PZDA 3L6AA 4XE0A 3EIQC 4AY5A 3RU0A 4C0EA 3MZLB 3EHQA 1WDYA 2OVFA 5JMND 4TRQA 4F6RD 5ENNA 2WPVA 3KSLA 3V2XA 4HRNA 3Q79A 2M63A 3ZW3A 1E8WA 4UWLA 2ZGDA 4XEIG 2WMOA 1E8ZA 3LY7A 3HYMB 4B8CB 4HS2A 4DLOA 3D9PA 4HQDA 1TR4A 1HH8A 5IY5E 3QK0A 3IKOB 2GRNB 2VYIA 5E76A 2WXKA 4RG9A 3V31A 1E8YA 3Q49B 1G3NB 3RRNB 1HX8A 2XCBA 1ELRA 3BG0B 3D9MA 4K0RA 1OWNA 4I1AA 4B89A 5CRUA 1WM5A 3PUKA 2J08A 2LXMA 4K03A 4GYWA 1UJKA 2WXOA 3IBEA 3U66A 4HFGA 4ILIA 4O1PA 4N3CA 4GZCA 3G2WA 1EPUA 2I9CA 3P1UA 2KM4A 3TWQA 3R9AB 1A17A 4Q94A 1H19A 4CYMD 2FF4A 2VQ2A 5LFAA 3UINC 4MBGA 2QYUA 3CVUA 3ZUVB 3IHYA 1NFIE 4U96D 2I6HA 2VGXB 4G8KA 4UI9C 1NL4A 1O1SA 3DSTA 3PZ1A 3SFZA 4B93B 4GTRA 3FUHA 3KSQA 1FPPA 3FU3A 4O1OA 4CT0A 5LP0A 1N9AA 3ZU7B 4L2YA 2P9SG 2XGSA 3ZHEB 4BTAA 4D10C 3C98A 3AS5A 3RK6A 2L9BA 2NC9A 2WQ7A 3UMVA 3LYAA 1EDUA 1Z3YA 4WUYA 1OCCE 4QFVA 4JL0A 3UIOC 4A1GA 4NACA 2V8SE 2GRPB 4J8FA 3CEQA 4BETA 1MX6A 4JA7A 3BQOA 3DSVA 1N4SA 3QWPA 4B0ZA 3FH8A 3CSFA 3FTUA 1TNYA 4FU3A 4JW1A 4GA1A 4G2VA 5AENA 4ABNA 4AXHA 1QBQA 3E34A 1E8XA 2UWJG 3FUMA 5C2YA 1JWGA 1O1RA 3ENEA 3JUEA 4MRUA 4U04A 1JWFA 5A7DB 1FCHA 3UI2A 3CK7A 2H6IA 1NZNA 4MKTA 3E33A 1OXJA 1OCRE 3UX4A 2NYJA 3T5XA 3LEWA 4TXQA 3B95A 3GZ1A 2KZTA 5BUZA 3JQ0A 3NQPA 2XHEA 2IJGX 3C5RA 4URKA 4APOA 2OEVA 3FH5A 3R9MA 2WXRA 4WNGA 3HIZA 3T8KA 5LCWC 2OCCE 3D9NA 2XS1A 2FULA 5JJ6A 1TNOA 2KCLA 2P2CP 4OYSA 4WWOA 3CVVA 1TNUA 3NOGD 4V3IA 3UT8A 4NQ0A 5CCMA 5BXUA 4BY6A 2R5SA 1EYHA 4FJYA 4I2ZA 4WWPA 1NA0A 3APDA 3I4RB 1KZPA 4GTPA 4CDNA 4KXKB 3SF4A 2DYRE 4ATGA 5EX0A 4G25A 4FA6A 5BNWA 3UM1A 2IONA 3FTZA 4Z68A 5G05J 3J5PA 4APFA 4CEMA 3ZEFA 1D9SA 5HQ8A 2ZISA 4GYYA 5FIOA 3NBNB 3FFLA 1MYOA 1XNFA 3P2BA 4EHMA 2NSZA 2LXLA 4LSZE 4A1SA 2PM6A 1Z6TA 1TNBA 4CGVA 3AAAC 3TG4A 2A4ZA 3DSSA 3X2QE 3FUNA 3NOCD 3T9KA 3CVLA 1V55E 3NZSA 5KJKA 3AG3E 3ASGA 3F6QA 1SW6A 2MOWA 3L16A 3DXKG 3HXFA 4DUIA 2AW6A 3O4ZA 3C3OA 3V2OA 3ABLE 3SQVA 4I6EA 4G1TA 2ZIRA 2P58C 4C9BB 3HVEA 4J0UA 3PE4A 2P9NG 2IFUA 5ENSD 5G04C 2HO1A 2VGXA 3NB2A 3CQCB 5EKQD 3AJIA 1N54A 3PUJA 3E4BA 1AWCB 1HZ4A 3HXCA 5FQ8A 3D9JA 4A3VA 2DYSE 4K5AB 4RVBA 2VSOE 3BUAA 4WAFA 4UWKA 1OWOA 2EIJE 3MJWA 4N5CA 5CMWA 3FTYA 4NURA 1OWMA 3ZHEA 3BEEA 2LAHA 1S0PA 2DWZA 5CEAA 3L13A 3AG2E 1SVXA 3B7SA 1IQUA 3BG1B 1OT8A 1LTXA 4EZJA 1HF8A 5FQ7A 2R17C 2VSYA 3CK8A 4UQYA 4JHJA 3OAWA 1UJJA 2QY7A 2H6FA 2H6HA 1BLXB 3DRAA 3R7RA 4LG6A 2PZIA 3S7BA 3EHMA 4DPRA 4N39A 2LO6A 2WXPA 2YQ8A 3HXEA 4A63B 3PVLA 5ENQD 3SFXA 3UM3A 5BV0A 2BKKB 4U07A 1N95A 3IXEA 4KYOB 4GTMA 4M7CA 3J5QB 4JEUA 3RKVA 2I1JA 3CHRA 1TN7A 4WNDA 4J6IA 4GTVA 5CERB 2RKKA 3ZXPA 3E30A 3BU8A 4A3TA 1N0RA 1Y6IA 1H2TC 1UOHA 3RO3A 2IOLA 4G11A 1ZB1A 4K5BA 1K3ZD 3D9HA 3FEXA 4CDRA 3SD5A 3B7UX 4JA9A 4U63A 3JYSA 2EINE 4GTSA 4AP2A 2CHZA 2KATA 4LEUA 3RIBA 2F0YA 1E7UA 4O6FA 4YDYA 3CSTA 4TUMA 4C48B 5D2MC 4BSZB 1HFAA 2X6HA 1FVFA 2RG8A 4ZFHA 4YVQC 3FU6A 4W9RA 4GU5A 4Y6CA 1QYMA 1H2VC 3L17A 1FT2A 2I2OA 1W3BA 2P9IG 3ZVVA 2LUHA 2XZDG 5EIBE 4B8AA 3U4TA 3RO2A 3HRAA 4I1MA 5BW8C 1D8DA 2BUGA 1KLXA 3LJNA 3L9TA 4XI0A 4FJZA 4U8VD 1OY3D 3MYVA 2CHWA 2KBXA 4HORA 2IOSA 3IV0A 4F7AA 4KZ0A 1NP7A 3RJVA 2A5UA 3OXGA 5FINA 5CCLA 3LDZA 2QC9A 3QWWA 5A23A 4AV7A 2X6IA 3T5VA 4FLHA 2R59A 4HB5A 4EECA 3EIJA 1SZ9A 3AS4A 1N0QA 4FC8A 3OXLA 4PS3A 2IO3C 4PDXA 2CG2A 3CVPA 3MKQB 3UKUG 2Y69E 3FDHA 1SQMA 3TXNA 2V5FA 2IF4A 4N3AA 4DI3A 1HXIA 5EILA 2XPYA 5AYWD 3V30A 5BT1A 1LD7A 4F1PA 3DPDA 4FHKA 2PQNA 2Q7FA 4EPZA 4ANXA 3CVNA 3PEVB 3EHRA 3CQGB 2CFUA 3ML8A 5LX8A 2RFAA 4U95D 4UQXA 3SNXA 3NZUA 4IYPA 3EUVA 1O5MA 3QKYA 4L7TA 3LCAA 4FADA 1V54E 4AY6A 2E0IA 1TYQG 4U0UA 2FEZA 2XGOA 4RQIA 3DPYA 3FU5A 4U8HA 4L1BA
chains in the Genus database with same CATH topology
5IY5E 2EIKE 2OCCE 3WG7E 2DYSE 2EIME 5B3SE 1V55E 2EIJE 1OCZE 3AG2E 3ABME 3AG1E 3AG3E 1OCOE 5B1AE 3ASNE 1OCCE 1V54E 3AG4E 2EINE 3ABKE 3ASOE 2EILE 5B1BE 2DYRE 2Y69E 2ZXWE 1OCRE 3X2QE 3ABLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 E;  2EIK E;  2OCC E;  3WG7 E;  2DYS E;  2EIM E;  5B3S E;  1V55 E;  2EIJ E;  1OCZ E;  3AG2 E;  3ABM E;  3AG1 E;  3AG3 E;  1OCO E;  5B1A E;  3ASN E;  1OCC E;  1V54 E;  3AG4 E;  2EIN E;  3ABK E;  3ASO E;  2EIL E;  5B1B E;  2DYR E;  2Y69 E;  2ZXW E;  1OCR E;  3X2Q E;  3ABL E; 
#chains in the Genus database with same CATH topology
 3ZPJ A;  4GZD A;  3CHS A;  2EIM E;  1PAQ A;  2HYZ A;  1H2U A;  2VJ8 A;  1H6K A;  1X5B A;  1JPL A;  3V79 K;  1TN6 A;  2CFZ A;  2CG3 A;  3CVQ A;  2PNN A;  5DBK A;  4OAU C;  2V4H C;  2FO1 E;  3W9G A;  1E7V A;  4DX7 D;  3FY4 A;  4CGW A;  2LAI A;  4BT8 A;  4GZ5 A;  3PE3 A;  1ELW A;  1IHG A;  3IEG A;  3MEK A;  4HI8 A;  3UQ3 A;  1IYG A;  3Q9N C;  3S7F A;  5J08 A;  3MGB A;  3UIP C;  4LCT A;  2AXU A;  3CV0 A;  3ML9 A;  2XQ0 A;  3FP3 A;  1Y8M A;  3QC1 A;  2OV8 A;  2ETB A;  4IUL A;  5BPP A;  3ULQ A;  2E2E A;  4TXR A;  1MX4 A;  4KMO A;  4YDW A;  3TJP A;  3Q47 B;  5M72 A;  3TXM A;  3K9I A;  5AAO A;  4H7X A;  3KEA A;  4Q69 A;  4GPM A;  3L22 A;  2Y1L E;  3TWU A;  2LNI A;  4LRZ A;  2B6C A;  1HE8 A;  1JCQ A;  3SGH A;  3KS2 A;  3LVQ E;  1N52 A;  1N11 A;  1L5J A;  4G24 A;  2LSU A;  1H6P A;  1HG5 A;  5ANR A;  3ZYQ A;  2BF0 X;  3LXU X;  1WG0 A;  4E6H A;  2DZN A;  2AWI A;  2B0O E;  5KJM A;  1MJ0 A;  4DX1 A;  1OWP A;  4JPS A;  5AQ7 A;  5AQ9 A;  4TXP A;  3LPZ A;  3EHN A;  3CLJ A;  3MA5 A;  4UWG A;  2XEV A;  4AM9 A;  1VDY A;  2OEW A;  2R03 A;  3SY2 A;  3WG7 E;  1PY1 A;  1S70 B;  4RSY A;  1IKN D;  3FTV A;  5G05 C;  4K5C A;  5HKP A;  1FT1 A;  5C1D A;  4ZHB A;  2IY0 C;  5CBN A;  2KCV A;  4I9E A;  2VTB B;  3FTS A;  4BEP A;  4XZ4 A;  1X81 A;  4XX5 A;  2KXP C;  3ZIM A;  4HRL A;  3G2S A;  4A55 A;  5D66 A;  3HXB A;  3GW4 A;  2XCC A;  1HG2 A;  4UI9 K;  1BI8 B;  4NRH B;  3TWV A;  4CRW A;  3FUJ A;  1HU3 A;  4UWF A;  3Q7A A;  2WVI A;  2ETC A;  1TJC A;  1TNZ A;  3NF1 A;  2WXF A;  3UM2 A;  3DXM G;  2ZGG A;  2J4D A;  4BER A;  1QQE A;  4HOU A;  4F1S A;  3D9L A;  3C72 A;  3AG4 E;  4BSX A;  1QNF A;  5B1B E;  2X6J A;  3HG0 D;  1P5Q A;  3WXX A;  2WM9 A;  4HRM B;  1YMP A;  1Z3X A;  3AU4 A;  4GCO A;  3CR3 A;  3FUK A;  3Q75 A;  3D9O A;  4KVM A;  3ONL A;  3MKR A;  2L0I A;  3CVW A;  4L23 A;  1YCS B;  3SFY A;  3QJZ A;  3MKQ A;  3PRE A;  3FUL A;  5ARG A;  3FEY A;  5AJD A;  2YHE A;  2J07 A;  2ETA A;  5T3R A;  2AVP A;  4JC8 A;  2AXV A;  4XKB A;  2EIK E;  2L6B A;  1RZ4 A;  2X3M A;  1E96 B;  4TV3 A;  4M3O A;  2XPI A;  3B13 A;  2P9U G;  2WXJ A;  5CHE E;  5HS0 A;  1SA4 A;  4I43 A;  2WQ6 A;  4KT6 B;  5CEC B;  1SZA A;  2MRI A;  3LY9 A;  3DEP A;  2WXI A;  3TWT A;  2WXQ A;  1OWL A;  4QQI A;  5T4Y A;  2X6K A;  3FWV A;  2I1K A;  4J8E A;  4EBA G;  3ASD A;  3SZ7 A;  4HOS A;  4DX2 A;  4FLB A;  5G55 A;  4HNA D;  4DK5 A;  3ZFW A;  1OCZ E;  3ONK A;  2XEN A;  3ABM E;  3VLD A;  2WXG A;  1NI1 A;  3URZ A;  4PS7 A;  3RRU A;  3PDN A;  4AEZ C;  3APF A;  1AP7 A;  4DJA A;  3DSU A;  3TWS A;  3FUD A;  3D9I A;  2RD0 A;  2IO2 C;  1HO8 A;  3PS6 A;  3ULY A;  3Q4A B;  4N3B A;  5AQB A;  3W9F A;  1BPO A;  1IQR A;  3LS8 A;  3U3W A;  1YYH A;  3JXI A;  4EZK A;  2CHX A;  3MCX A;  3EJN A;  4GTQ A;  4GA2 A;  4UQZ A;  1QZ2 A;  5HRY A;  4F3V A;  3AG1 E;  3G2V A;  4J8D A;  3D9K A;  4KBQ A;  1U3D A;  4KVO A;  1MQS A;  3PZ4 A;  3FUI A;  3SBS A;  2EQX A;  4UUC A;  4Y6W A;  4G23 A;  3KEZ A;  3GZ2 A;  3DSX A;  5EX3 A;  2Y4T A;  2V0P A;  4FHJ A;  3I5P A;  5EYP F;  1JCS A;  4GPK A;  4I17 A;  4MLP A;  2L6J A;  4JB8 P;  5ENT D;  1MZC A;  2YNQ A;  2GRM A;  2JAB A;  1INZ A;  3CK9 A;  2KZT B;  4EQF A;  4AVX A;  3ASF A;  1HS6 A;  5AAR A;  5ANL A;  3TAX A;  2YHC A;  3QAQ A;  4HOT A;  2WXM A;  3O48 A;  3U64 A;  3PNL B;  4GA0 A;  5EN5 D;  2VSX E;  3ZKJ A;  4IN3 B;  2C2L A;  1DNP A;  3ZYK A;  1O1T A;  1DCQ A;  5D0Q D;  1IHB A;  4NIK A;  3APC A;  2C0L A;  4LER A;  3S7J A;  3CKC A;  2P9P G;  4ACL A;  2J49 A;  2VTB A;  1Q2Z A;  1UN9 A;  3FTX A;  3MV3 B;  4CDM A;  3LKU A;  1A5E A;  4OVV A;  1LF8 A;  2GRR B;  3TWR A;  3FTW A;  2UY1 B;  1TN8 A;  5ENO D;  3PZ2 A;  4LNB A;  4YND A;  2JLB A;  1N94 A;  1KT1 A;  4BFR A;  1OCO E;  4U0S A;  4WNE A;  2BKG A;  3FUF A;  3ZN3 A;  4LNU D;  1K1B A;  2A5E A;  2XS8 A;  2PM7 A;  2IQC A;  3TGO A;  2NXP A;  4JXT A;  2RFM A;  1H0A A;  2HM8 A;  3TWX A;  3JCK C;  3DWL G;  3B7R L;  1S63 A;  4BX9 A;  3PNT B;  4GTT A;  4CT4 A;  4G26 A;  2OOE A;  4I2W A;  1WY6 A;  1H6O A;  2PQR A;  4U0Z A;  2J8S D;  4YDO A;  1FVH A;  2J4B A;  4JD2 G;  5FTP A;  5EID A;  5FZS A;  4JHR A;  3RRM B;  2BED A;  2VGY A;  1ZBP A;  4GMJ A;  4EBA A;  5H7P A;  2GW1 A;  3ABK E;  4PS8 A;  2WMN A;  5EYL A;  3ZGQ A;  5G2N A;  3ZXS A;  2QFC A;  5ENP D;  4XI9 A;  3CVX A;  5ENR D;  3B7T A;  4ANV A;  3ASN E;  3HVE B;  1S64 A;  4DX5 D;  1N4Q A;  2EIL E;  3UPV A;  2QYJ A;  3N71 A;  5KBA A;  4I6J A;  2JEK A;  3R7Q A;  5FJY A;  5AN8 A;  2WXH A;  4TUU A;  3UUX A;  4OVU A;  3C3Q A;  4UI9 J;  2FO7 A;  4BX8 A;  3CGH A;  5AJL A;  3PRZ A;  4GZ6 A;  2DCP A;  3QDN A;  4MS6 A;  3JQ1 A;  2HR2 A;  1JUQ A;  1XGW A;  1ZU2 A;  2GRQ B;  2P9K G;  1KPS B;  4I9C A;  3EU5 A;  5KJL A;  5BV1 A;  3JUI A;  3CHP A;  5AIJ A;  4ANW A;  4HXI A;  3B7B A;  4JHK A;  4ME2 A;  5B3S E;  1GW6 A;  5KWD A;  4GML A;  3GYZ A;  3E37 A;  3ASH A;  2XPZ A;  4PUC A;  3TL5 A;  4ANU A;  2ZU6 B;  3E32 A;  5JHA A;  4GMR A;  2FBN A;  4HLE A;  2OND A;  5JHB A;  3Q9U C;  3ESL A;  2V5Q C;  1OUV A;  2GRO B;  5D0O D;  5ARF A;  3OXF A;  1NA3 A;  3TWW A;  3PZ3 A;  3CHO A;  2XRZ A;  4UWH A;  2F8X K;  5KNH D;  5JJT A;  3MV2 B;  3DBS A;  4DX6 D;  1IXV A;  3UT7 A;  1UW4 B;  5E75 A;  4JZY A;  5B1A E;  3Q5M A;  2VSN A;  3S7D A;  4R7L A;  4BTB A;  2WXN A;  5KCM A;  3JXJ A;  4JEH A;  4BWR A;  4Q96 A;  2C0M A;  3AU5 A;  4WWN A;  4OAV B;  3ESK A;  4YDE A;  2XGM A;  2XEH A;  3SO8 A;  4G8L A;  4WNF A;  2IU1 A;  5A6C A;  3D3M A;  2X6F A;  3CKB A;  2XEE A;  3QAR A;  3UKR G;  1MX2 A;  3LVR E;  3ASO E;  5JJ7 A;  2XZT G;  4FP7 A;  2XRY A;  4ILH B;  5LCW J;  4FUL A;  1LD8 A;  3FH7 A;  3SI5 A;  3TG5 A;  4P29 A;  3QB2 A;  3VTX A;  1E90 A;  3AS8 A;  2KCK A;  5FQ6 A;  3CIA A;  5FZR A;  3T8M A;  4ACK A;  2LSV A;  4L2L A;  4F53 A;  2UY1 A;  4J8Y A;  4ATZ D;  3Q15 A;  2J09 A;  3CHQ A;  4H7Y A;  4HI9 A;  3MX3 A;  2PL2 A;  4J8S A;  5CRV A;  1PC2 A;  3VTY A;  4KZC A;  3FHE A;  1WAO 1;  2MYO A;  4XKC A;  1K8K G;  1BD8 A;  2MHK A;  4J7W A;  5KJN A;  3PEU B;  2FI7 A;  3DEO A;  5T8I A;  2Y3A A;  3CVY A;  1D8E A;  4B94 A;  3SHF A;  2Y4U A;  2DZO A;  3DSW A;  1N4P A;  1KT0 A;  3ISM C;  5JA4 D;  2R02 A;  3UM0 A;  5J90 A;  3NAW A;  3KD7 A;  4GB9 A;  4BES A;  4RLY A;  2X38 A;  5FWQ A;  3Q73 A;  4HBD A;  3ZYL A;  3ZYM A;  2VGE A;  2WXL A;  4GTO A;  1U3C A;  3I4G A;  4AJW A;  3SBT B;  4N2S A;  5BXO A;  3C3R A;  4LUN U;  3I3N A;  2BTD A;  2AJA A;  2ZXW E;  5DIZ A;  4EZL A;  2P9L G;  3UTM A;  2DBA A;  3OTN A;  1SA5 A;  4LNG A;  2V4L A;  3RSE G;  3QWV A;  2L0T B;  4CCA A;  3VLF A;  2KC7 A;  3EU9 A;  4O60 A;  1JCR A;  2R05 A;  4RG6 A;  4N2Q A;  2F8Y A;  1UN8 A;  3Q7F A;  3ULE G;  3CHM A;  3HDX A;  2YIN A;  4DLQ A;  5G04 J;  2DVW A;  4AIF A;  5ITZ F;  3EDT B;  3LJ3 A;  4DRX E;  2GGF A;  5CED B;  2WB2 A;  4C0M A;  4YVO A;  4L9P A;  4I6G A;  3VLE A;  3L08 A;  1YA0 A;  4AOF A;  4I1O B;  5CMY A;  4CZ2 D;  4E85 A;  2GRL A;  2OVB A;  1BU9 A;  4DI4 A;  2IEJ A;  4XIF A;  3UXG A;  3Q78 A;  1DCE A;  1N4R A;  2ILR A;  1MHQ A;  1TEZ A;  2AXZ A;  1RW2 A;  3IHV A;  5EDS A;  3L54 A;  4N5Q A;  3KAE A;  4ILG A;  2Y0B G;  5FZQ A;  3RAU A;  4IRU A;  1KZO A;  1EF1 C;  3HHM A;  3GZS A;  1BI7 B;  4U8Y D;  3HXD A;  2H6G A;  2HE0 A;  5AQA A;  1Z5S C;  5FT9 A;  4HVB A;  2J9Q A;  3ZNG A;  3S2A A;  1UG3 A;  3ZRH A;  5CBO A;  3UT4 A;  3FU0 A;  4PH4 B;  4BT9 A;  2QZA A;  2F37 A;  2DIW A;  4GZ3 A;  3PH0 C;  3QOU A;  1ELK A;  4GCN A;  4GYO A;  5KNG A;  1DVP A;  3LY8 A;  5FQ4 A;  1B89 A;  4HOQ A;  3QNK A;  3U9W A;  2WQH A;  3FUE A;  1DC2 A;  1U2V G;  4HLL A;  4U7E B;  4X8Q A;  1TJF A;  5HI7 A;  3L82 A;  2R2L A;  3G2T A;  1K1A A;  3G2U A;  4GAA A;  5LOZ A;  4JVS A;  3PZD A;  3L6A A;  4XE0 A;  3EIQ C;  4AY5 A;  3RU0 A;  4C0E A;  3MZL B;  3EHQ A;  1WDY A;  2OVF A;  5JMN D;  4TRQ A;  4F6R D;  5ENN A;  2WPV A;  3KSL A;  3V2X A;  4HRN A;  3Q79 A;  2M63 A;  3ZW3 A;  1E8W A;  4UWL A;  2ZGD A;  4XEI G;  2WMO A;  1E8Z A;  3LY7 A;  3HYM B;  4B8C B;  4HS2 A;  4DLO A;  3D9P A;  4HQD A;  1TR4 A;  1HH8 A;  5IY5 E;  3QK0 A;  3IKO B;  2GRN B;  2VYI A;  5E76 A;  2WXK A;  4RG9 A;  3V31 A;  1E8Y A;  3Q49 B;  1G3N B;  3RRN B;  1HX8 A;  2XCB A;  1ELR A;  3BG0 B;  3D9M A;  4K0R A;  1OWN A;  4I1A A;  4B89 A;  5CRU A;  1WM5 A;  3PUK A;  2J08 A;  2LXM A;  4K03 A;  4GYW A;  1UJK A;  2WXO A;  3IBE A;  3U66 A;  4HFG A;  4ILI A;  4O1P A;  4N3C A;  4GZC A;  3G2W A;  1EPU A;  2I9C A;  3P1U A;  2KM4 A;  3TWQ A;  3R9A B;  1A17 A;  4Q94 A;  1H19 A;  4CYM D;  2FF4 A;  2VQ2 A;  5LFA A;  3UIN C;  4MBG A;  2QYU A;  3CVU A;  3ZUV B;  3IHY A;  1NFI E;  4U96 D;  2I6H A;  2VGX B;  4G8K A;  4UI9 C;  1NL4 A;  1O1S A;  3DST A;  3PZ1 A;  3SFZ A;  4B93 B;  4GTR A;  3FUH A;  3KSQ A;  1FPP A;  3FU3 A;  4O1O A;  4CT0 A;  5LP0 A;  1N9A A;  3ZU7 B;  4L2Y A;  2P9S G;  2XGS A;  3ZHE B;  4BTA A;  4D10 C;  3C98 A;  3AS5 A;  3RK6 A;  2L9B A;  2NC9 A;  2WQ7 A;  3UMV A;  3LYA A;  1EDU A;  1Z3Y A;  4WUY A;  1OCC E;  4QFV A;  4JL0 A;  3UIO C;  4A1G A;  4NAC A;  2V8S E;  2GRP B;  4J8F A;  3CEQ A;  4BET A;  1MX6 A;  4JA7 A;  3BQO A;  3DSV A;  1N4S A;  3QWP A;  4B0Z A;  3FH8 A;  3CSF A;  3FTU A;  1TNY A;  4FU3 A;  4JW1 A;  4GA1 A;  4G2V A;  5AEN A;  4ABN A;  4AXH A;  1QBQ A;  3E34 A;  1E8X A;  2UWJ G;  3FUM A;  5C2Y A;  1JWG A;  1O1R A;  3ENE A;  3JUE A;  4MRU A;  4U04 A;  1JWF A;  5A7D B;  1FCH A;  3UI2 A;  3CK7 A;  2H6I A;  1NZN A;  4MKT A;  3E33 A;  1OXJ A;  1OCR E;  3UX4 A;  2NYJ A;  3T5X A;  3LEW A;  4TXQ A;  3B95 A;  3GZ1 A;  2KZT A;  5BUZ A;  3JQ0 A;  3NQP A;  2XHE A;  2IJG X;  3C5R A;  4URK A;  4APO A;  2OEV A;  3FH5 A;  3R9M A;  2WXR A;  4WNG A;  3HIZ A;  3T8K A;  5LCW C;  2OCC E;  3D9N A;  2XS1 A;  2FUL A;  5JJ6 A;  1TNO A;  2KCL A;  2P2C P;  4OYS A;  4WWO A;  3CVV A;  1TNU A;  3NOG D;  4V3I A;  3UT8 A;  4NQ0 A;  5CCM A;  5BXU A;  4BY6 A;  2R5S A;  1EYH A;  4FJY A;  4I2Z A;  4WWP A;  1NA0 A;  3APD A;  3I4R B;  1KZP A;  4GTP A;  4CDN A;  4KXK B;  3SF4 A;  2DYR E;  4ATG A;  5EX0 A;  4G25 A;  4FA6 A;  5BNW A;  3UM1 A;  2ION A;  3FTZ A;  4Z68 A;  5G05 J;  3J5P A;  4APF A;  4CEM A;  3ZEF A;  1D9S A;  5HQ8 A;  2ZIS A;  4GYY A;  5FIO A;  3NBN B;  3FFL A;  1MYO A;  1XNF A;  3P2B A;  4EHM A;  2NSZ A;  2LXL A;  4LSZ E;  4A1S A;  2PM6 A;  1Z6T A;  1TNB A;  4CGV A;  3AAA C;  3TG4 A;  2A4Z A;  3DSS A;  3X2Q E;  3FUN A;  3NOC D;  3T9K A;  3CVL A;  1V55 E;  3NZS A;  5KJK A;  3AG3 E;  3ASG A;  3F6Q A;  1SW6 A;  2MOW A;  3L16 A;  3DXK G;  3HXF A;  4DUI A;  2AW6 A;  3O4Z A;  3C3O A;  3V2O A;  3ABL E;  3SQV A;  4I6E A;  4G1T A;  2ZIR A;  2P58 C;  4C9B B;  3HVE A;  4J0U A;  3PE4 A;  2P9N G;  2IFU A;  5ENS D;  5G04 C;  2HO1 A;  2VGX A;  3NB2 A;  3CQC B;  5EKQ D;  3AJI A;  1N54 A;  3PUJ A;  3E4B A;  1AWC B;  1HZ4 A;  3HXC A;  5FQ8 A;  3D9J A;  4A3V A;  2DYS E;  4K5A B;  4RVB A;  2VSO E;  3BUA A;  4WAF A;  4UWK A;  1OWO A;  2EIJ E;  3MJW A;  4N5C A;  5CMW A;  3FTY A;  4NUR A;  1OWM A;  3ZHE A;  3BEE A;  2LAH A;  1S0P A;  2DWZ A;  5CEA A;  3L13 A;  3AG2 E;  1SVX A;  3B7S A;  1IQU A;  3BG1 B;  1OT8 A;  1LTX A;  4EZJ A;  1HF8 A;  5FQ7 A;  2R17 C;  2VSY A;  3CK8 A;  4UQY A;  4JHJ A;  3OAW A;  1UJJ A;  2QY7 A;  2H6F A;  2H6H A;  1BLX B;  3DRA A;  3R7R A;  4LG6 A;  2PZI A;  3S7B A;  3EHM A;  4DPR A;  4N39 A;  2LO6 A;  2WXP A;  2YQ8 A;  3HXE A;  4A63 B;  3PVL A;  5ENQ D;  3SFX A;  3UM3 A;  5BV0 A;  2BKK B;  4U07 A;  1N95 A;  3IXE A;  4KYO B;  4GTM A;  4M7C A;  3J5Q B;  4JEU A;  3RKV A;  2I1J A;  3CHR A;  1TN7 A;  4WND A;  4J6I A;  4GTV A;  5CER B;  2RKK A;  3ZXP A;  3E30 A;  3BU8 A;  4A3T A;  1N0R A;  1Y6I A;  1H2T C;  1UOH A;  3RO3 A;  2IOL A;  4G11 A;  1ZB1 A;  4K5B A;  1K3Z D;  3D9H A;  3FEX A;  4CDR A;  3SD5 A;  3B7U X;  4JA9 A;  4U63 A;  3JYS A;  2EIN E;  4GTS A;  4AP2 A;  2CHZ A;  2KAT A;  4LEU A;  3RIB A;  2F0Y A;  1E7U A;  4O6F A;  4YDY A;  3CST A;  4TUM A;  4C48 B;  5D2M C;  4BSZ B;  1HFA A;  2X6H A;  1FVF A;  2RG8 A;  4ZFH A;  4YVQ C;  3FU6 A;  4W9R A;  4GU5 A;  4Y6C A;  1QYM A;  1H2V C;  3L17 A;  1FT2 A;  2I2O A;  1W3B A;  2P9I G;  3ZVV A;  2LUH A;  2XZD G;  5EIB E;  4B8A A;  3U4T A;  3RO2 A;  3HRA A;  4I1M A;  5BW8 C;  1D8D A;  2BUG A;  1KLX A;  3LJN A;  3L9T A;  4XI0 A;  4FJZ A;  4U8V D;  1OY3 D;  3MYV A;  2CHW A;  2KBX A;  4HOR A;  2IOS A;  3IV0 A;  4F7A A;  4KZ0 A;  1NP7 A;  3RJV A;  2A5U A;  3OXG A;  5FIN A;  5CCL A;  3LDZ A;  2QC9 A;  3QWW A;  5A23 A;  4AV7 A;  2X6I A;  3T5V A;  4FLH A;  2R59 A;  4HB5 A;  4EEC A;  3EIJ A;  1SZ9 A;  3AS4 A;  1N0Q A;  4FC8 A;  3OXL A;  4PS3 A;  2IO3 C;  4PDX A;  2CG2 A;  3CVP A;  3MKQ B;  3UKU G;  2Y69 E;  3FDH A;  1SQM A;  3TXN A;  2V5F A;  2IF4 A;  4N3A A;  4DI3 A;  1HXI A;  5EIL A;  2XPY A;  5AYW D;  3V30 A;  5BT1 A;  1LD7 A;  4F1P A;  3DPD A;  4FHK A;  2PQN A;  2Q7F A;  4EPZ A;  4ANX A;  3CVN A;  3PEV B;  3EHR A;  3CQG B;  2CFU A;  3ML8 A;  5LX8 A;  2RFA A;  4U95 D;  4UQX A;  3SNX A;  3NZU A;  4IYP A;  3EUV A;  1O5M A;  3QKY A;  4L7T A;  3LCA A;  4FAD A;  1V54 E;  4AY6 A;  2E0I A;  1TYQ G;  4U0U A;  2FEZ A;  2XGO A;  4RQI A;  3DPY A;  3FU5 A;  4U8H A;  4L1B A; 
#chains in the Genus database with same CATH homology
 5IY5 E;  2EIK E;  2OCC E;  3WG7 E;  2DYS E;  2EIM E;  5B3S E;  1V55 E;  2EIJ E;  1OCZ E;  3AG2 E;  3ABM E;  3AG1 E;  3AG3 E;  1OCO E;  5B1A E;  3ASN E;  1OCC E;  1V54 E;  3AG4 E;  2EIN E;  3ABK E;  3ASO E;  2EIL E;  5B1B E;  2DYR E;  2Y69 E;  2ZXW E;  1OCR E;  3X2Q E;  3ABL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...