3ABME

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3abmE00
3ASNE 3X2QE 2OCCE 2EINE 2ZXWE 2Y69E 3ABME 2EIKE 2EIME 2EILE 3ASOE 1V55E 1OCCE 3AG1E 1OCOE 5B1BE 2DYSE 3WG7E 3AG4E 3ABLE 3AG2E 5B3SE 1V54E 1OCZE 2EIJE 2DYRE 3ABKE 1OCRE 3AG3E 5IY5E 5B1AE
chains in the Genus database with same CATH superfamily
2Y4TA 4GCOA 5AQ7A 3LXUX 3FULA 5A7DB 4XE0A 2C0MA 4DK5A 2RKKA 1YA0A 2IQCA 4RLYA 4G23A 1TJFA 4RG6A 4HXIA 2IOLA 1NFIE 2XGSA 3C72A 3LY8A 5BXUA 3Q9UC 4QQIA 2XZTG 4LUNU 4JA7A 1OWMA 1O5MA 4U07A 2J9QA 4YVOA 4H7YA 3BEEA 4M3OA 1IYGA 3B7UX 3MEKA 4E6HA 1RZ4A 4W9RA 5LP0A 2R05A 3FUNA 4HI9A 3CK9A 1DC2A 3E4BA 1MQSA 5EKQD 3FFLA 2WPVA 4DI4A 4WNFA 2V5QC 1YCSB 4J8EA 4ANUA 1S64A 5FQ6A 5G04C 2X6IA 4BSXA 3GZ2A 1D8EA 3SO8A 3GW4A 5HRYA 3TG5A 3BU8A 2BF0X 2KZTB 3QAQA 3CVQA 5JJ7A 3U3WA 2OEVA 3ZYMA 3FEXA 4URKA 4NURA 4ME2A 3FU5A 4YDOA 3PDNA 3FTYA 3JCKC 2J8SD 2ONDA 2YQ8A 2IO2C 2YNQA 3E33A 3APDA 3L17A 3ULEG 3L22A 3V31A 4XEIG 2DYRE 4G25A 3DEPA 4I2ZA 4EZLA 3EHRA 3ABME 3PRZA 3DSWA 3E34A 3FTSA 2QFCA 1TEZA 4PH4B 2XGMA 4DJAA 4UWFA 2ILRA 1GW6A 4JHJA 3BG0B 2ETBA 3HXFA 3HDXA 3HVEB 3FH8A 4WWOA 2PQRA 1YYHA 2HR2A 4UWGA 5ARFA 1TN7A 3C5RA 1PC2A 2KM4A 2ZU6B 3G2WA 3KS2A 5FZRA 2R17C 1MX2A 4CGVA 3ASDA 3QC1A 1QYMA 3QOUA 4A3VA 4LSZE 1H6PA 2WXFA 3SNXA 3G2TA 2FF4A 4D10C 3VLEA 1N4RA 2LAHA 3W9FA 3MCXA 5BPPA 3UM0A 3PZDA 2YHCA 4O60A 4G8LA 4K5AB 2WQ7A 1H19A 5CBNA 1O1TA 3D9OA 3D9IA 2WXQA 3CKCA 1UG3A 3TWTA 4G8KA 2GRPB 4BFRA 2AXZA 3JUIA 1FVFA 3Q15A 2LAIA 4B94A 2WXGA 1FVHA 2IO3C 4UI9K 5B3SE 2XCBA 4HRNA 4GPKA 4XKCA 4MS6A 1KT1A 4FHJA 1ELRA 1V55E 1NA0A 3ML9A 3EHNA 4YDYA 4BT9A 3CHMA 4KZCA 1OCZE 2WB2A 3CK8A 5FQ8A 3OTNA 5KNHD 2P9NG 2I9CA 2L6JA 1H6OA 2LUHA 2VGXA 4OVVA 1HS6A 3VLDA 3SD5A 3DXKG 4F6RD 2WQHA 5ENRD 4JA9A 2GRRB 2ETCA 2XGOA 3V2OA 4WNGA 1Z3XA 4L2YA 4LCTA 3N71A 2WXPA 5D0QD 3Q4AB 3VLFA 3RO3A 5LOZA 2GRMA 4GCNA 3VTYA 4ACKA 4IN3B 3UKUG 4AXHA 3NF1A 2VGYA 3QDNA 2QYJA 5ENPD 3P1UA 2IJGX 2FI7A 3OXGA 4KXKB 2CFUA 4ATGA 4GA2A 2VGEA 4L1BA 3X2QE 3FUIA 1EPUA 3NBNB 2H6HA 2PM7A 4GZ3A 1EDUA 3LVRE 2CG2A 3AG1E 3L08A 1HO8A 4GTQA 4MBGA 1E96B 3IHVA 4J8DA 3MKQA 2WXRA 3J5QB 3ENEA 3LJ3A 1MJ0A 3CV0A 4GAAA 4LEUA 2F8XK 4G26A 2BTDA 3JXJA 3DWLG 4I1OB 4KYOB 2P9PG 1HFAA 3FHEA 3UI2A 3DSVA 3QWWA 5JMND 2WMOA 4GZDA 1G3NB 1UOHA 2DZNA 5CHEE 4EBAG 1UJKA 2PQNA 2XHEA 3FTUA 1NA3A 3LEWA 4JC8A 3HIZA 4F53A 1UJJA 4HVBA 3KAEA 2IFUA 4L2LA 5BXOA 2DVWA 2F0YA 5LCWJ 4C0EA 4N39A 2L9BA 5EX3A 3RAUA 4V3IA 4EBAA 3AG2E 3GZ1A 4DX7D 1AWCB 4LNUD 3ESKA 4I9CA 2H6FA 4XI0A 4XIFA 4BEPA 4HRLA 4B0ZA 4L9PA 4FADA 3PZ3A 2J4DA 5D2MC 3RJVA 2QYUA 1IXVA 4I1AA 1N94A 2P9SG 4N3CA 2AW6A 3TJPA 5HS0A 4P29A 3ZEFA 4GZ6A 3FTZA 2MYOA 2J08A 4HRMB 3TWQA 3CQGB 4JB8P 2EQXA 3IBEA 3ZUVB 3IKOB 4FP7A 1OCRE 3HHMA 4CRWA 4QFVA 1JCQA 3HVEA 3JQ1A 3QK0A 3ZYKA 2LNIA 1LF8A 4HNAD 4LRZA 1BU9A 3CHRA 5CECB 4NACA 4UI9C 2P2CP 1JCSA 4F3VA 4JHKA 2WM9A 1UN8A 5EYPF 5G2NA 3NZUA 4A63B 3LY9A 3RU0A 2UY1B 2WXLA 1A17A 2XPYA 2I2OA 4MLPA 1KZPA 4A55A 2XQ0A 5AQBA 3FWVA 1IHBA 5KWDA 4HS2A 2EINE 3MJWA 1N0QA 3EIQC 3TAXA 4JEHA 1OCCE 3FDHA 1S70B 3UINC 2FO7A 4BSZB 2J49A 3LKUA 4JL0A 1D9SA 1Z3YA 1L5JA 4NQ0A 2P9UG 3O4ZA 5AQ9A 3MV3B 4UWLA 2H6GA 2HM8A 3DRAA 2V4HC 1IKND 1TNZA 2MRIA 2MHKA 3J5PA 4N3AA 3CVYA 1OXJA 4O1OA 3PVLA 2WXHA 3PEUB 5G55A 2X38A 3G2SA 3LPZA 1X5BA 4U04A 3PNTB 3NOGD 1E8WA 4TRQA 3AJIA 5FTPA 1AP7A 3MKRA 3QKYA 2GW1A 5LX8A 1H0AA 3CVPA 2HE0A 2VYIA 2FULA 3ASNE 3CSTA 4U0UA 2X6JA 3PS6A 3FUJA 2AJAA 3LS8A 3ASOE 3CVNA 2PNNA 4OYSA 3MKQB 3JUEA 3ONKA 3RRMB 4CT4A 4UWHA 4BTAA 3E37A 3TWSA 5HI7A 2OEWA 4JZYA 3AU4A 3L16A 2PM6A 3DBSA 5KJNA 3SZ7A 2EIJE 4N5QA 5CMYA 4A3TA 2M63A 3LVQE 2V8SE 4DRXE 5KJLA 3WG7E 5D66A 4FHKA 3MV2B 2CHWA 5BNWA 5IY5E 5EYLA 2Y1LE 4XI9A 4CDRA 4ANVA 2OCCE 4L7TA 4WAFA 4HOQA 4AV7A 4ILIA 4U8YD 4OAUC 3QB2A 2J07A 3ZKJA 5KJKA 2R02A 2KCLA 3R7RA 4IYPA 1ZU2A 3EJNA 1RW2A 3DSXA 3QWPA 3Q75A 3GZSA 3MA5A 3U9WA 4B8CB 3UX4A 3D9JA 4NRHB 2MOWA 3ZGQA 4GMJA 1JPLA 2XPIA 1KZOA 4ATZD 3B7SA 4AOFA 4EQFA 5T4YA 3E32A 5J90A 3QWVA 1LD7A 3TWVA 2VJ8A 4C48B 4K0RA 2E0IA 5ENQD 3TXMA 2XS1A 4I1MA 3SFYA 3UM2A 2OV8A 4FLBA 1LD8A 4GPMA 2YINA 1ZB1A 4RQIA 4ACLA 3T9KA 3FUMA 1FCHA 2IU1A 1H2VC 5CBOA 3P2BA 2WXMA 2VSXE 4PS8A 5KBAA 4LNGA 4F7AA 1HG2A 2Y69E 3LY7A 3FU3A 2XRZA 3UQ3A 3PE4A 3KD7A 4CT0A 4A1SA 4DLOA 5CCLA 3Q7FA 2WVIA 3BG1B 3IV0A 4FA6A 3BQOA 1NI1A 2XCCA 2UY1A 2BEDA 3ASFA 4I6JA 4GTRA 3UMVA 4N3BA 4CEMA 1WDYA 3Q47B 3FEYA 4AY6A 1TN6A 2Y0BG 4PS3A 1SQMA 4KT6B 5B1AE 2DCPA 2V0PA 3ESLA 3HXEA 5G05J 1DNPA 4ILHB 1OWPA 2FEZA 4CZ2D 3FU0A 2XPZA 2A4ZA 5JHAA 1E7UA 4J6IA 1H2TC 1S0PA 5FZSA 2WXKA 2VTBB 3T8KA 4I43A 4KZ0A 3FTVA 5ITZF 3TWWA 4HI8A 3HYMB 2I1JA 1BPOA 1IHGA 2BKKB 2EIKE 2ETAA 3S7BA 4I2WA 3I4RB 3NQPA 4ZHBA 4U8HA 2GRQB 2WXOA 1PY1A 3E30A 4LERA 5FJYA 2ZISA 3D9HA 5BW8C 3CVLA 4TV3A 3APCA 1HE8A 3KSLA 3ZHEB 5FZQA 2FBNA 5J08A 3UXGA 1HH8A 2NSZA 2WMNA 2KBXA 3D9KA 5CERB 4DLQA 2NYJA 1SA5A 3Q5MA 2NXPA 4RSYA 2P9LG 3DEOA 3V30A 1TNUA 2C0LA 3GYZA 1XGWA 2IONA 2ZGDA 3ZXSA 4BESA 2Y4UA 2BKGA 4WNEA 2QY7A 3R7QA 4AVXA 3EU9A 1FPPA 4TXRA 1EYHA 4C9BB 5A6CA 1IQUA 4F1SA 4GZ5A 3SGHA 4J7WA 4J0UA 2X6FA 4Q69A 2E2EA 4AJWA 3G2UA 3ZFWA 4WWPA 4A1GA 3L54A 3TG4A 1OUVA 4O1PA 4GTTA 3IEGA 5HKPA 3FY4A 5EN5D 4DUIA 4F1PA 1TNOA 3ZW3A 3D9MA 5T3RA 3ZRHA 3UKRG 1INZA 2PZIA 4PDXA 4BX8A 3TXNA 4BX9A 3S7FA 2OVFA 2WXNA 3DPDA 3B7RL 5FIOA 2CFZA 4U96D 3UPVA 1N4PA 5ENTD 3ZYQA 3L82A 3CGHA 1NZNA 2B0OE 3NOCD 1U2VG 4RVBA 2V4LA 4FULA 2DZOA 2JLBA 4G24A 1K1BA 1H6KA 4L23A 4HB5A 3IHYA 4JEUA 3SY2A 1WAO1 2VQ2A 3UM1A 3BUAA 3RKVA 3S7DA 1Z6TA 3CIAA 3D3MA 3T8MA 4UQXA 3Q49B 1ZBPA 3O48A 4AY5A 1H2UA 3FP3A 4DX2A 1TN8A 3PZ2A 1WG0A 4CGWA 1N54A 3RK6A 4GTVA 4C0MA 5KCMA 4APOA 1O1SA 2GRLA 2LSVA 5LCWC 4KMOA 3HXDA 3AG3E 2R2LA 4EPZA 4IRUA 1SZAA 1D8DA 4JVSA 5ARGA 4UQZA 1TJCA 4U0SA 3SHFA 4HOTA 3APFA 4GA1A 4Y6WA 4XX5A 3ABKE 4JW1A 1OWOA 3Q9NC 4GTSA 3ASGA 4MKTA 3G2VA 1DVPA 4KBQA 3TWXA 4EHMA 2CHZA 2A5UA 3I3NA 4APFA 1TNYA 3ZIMA 3R9AB 2C2LA 5G04J 2AWIA 4K03A 2CG3A 1LTXA 3UM3A 3KEAA 2XZDG 4DX1A 2RFAA 2XS8A 3UT7A 4ANWA 2R03A 2GRNB 3CVXA 4FJZA 4Z68A 4HLEA 1U3DA 5FT9A 5JA4D 3EHQA 3WXXA 4NIKA 3EUVA 2VTBA 1QNFA 3U4TA 4I9EA 5DBKA 3URZA 1EF1C 3OAWA 4HOUA 4I17A 3CLJA 2P58C 1SW6A 4GTPA 4GTOA 3EHMA 4Y6CA 3ZXPA 3CKBA 3SFZA 4B8AA 1UW4B 1N0RA 5B1BE 4N2SA 1HX8A 2XEEA 2AVPA 3NB2A 5AIJA 2WXJA 3Q7AA 4FJYA 5ANLA 3JXIA 4B93B 5M72A 5AJLA 1QZ2A 3AAAC 3U66A 3EU5A 1JUQA 1NP7A 5CRUA 5FQ4A 5BUZA 3UIPC 2VSNA 3RIBA 2F8YA 3OXLA 3ZHEA 3PE3A 1HU3A 2P9IG 1K3ZD 5C1DA 3AS5A 5EDSA 5AYWD 5KJMA 3AS8A 3Q73A 2LXLA 5AN8A 1TYQG 1HXIA 1W3BA 4Q94A 3V2XA 4TXPA 4CCAA 2DIWA 1YMPA 1OCOE 3SI5A 3CVWA 2AXUA 4AP2A 3UIOC 2BUGA 4YVQC 3QJZA 5BT1A 3SBSA 3ULYA 3R9MA 1N52A 3T5XA 2ZIRA 4JXTA 1ELWA 3RRUA 3KEZA 4EZKA 3HXBA 5AJDA 3LDZA 3V79K 1A5EA 4BETA 4GYOA 4YDEA 4J8FA 3SQVA 4ANXA 1E8XA 1NL4A 2R59A 1HG5A 4KVOA 3TWUA 4X8QA 2NC9A 4GYWA 3PUKA 4JHRA 4FU3A 3SBTB 1OWNA 4H7XA 2OVBA 3C3QA 3UT8A 3T5VA 4PUCA 5AAOA 4FC8A 1SVXA 3DSSA 2R5SA 4U63A 5KNGA 3CHOA 2RG8A 1V54E 3D9LA 1Q2ZA 2QC9A 4DPRA 5AENA 1TNBA 3LJNA 2L0IA 4BTBA 2IF4A 3HG0D 1K8KG 3L6AA 3CR3A 5AQAA 4DI3A 4EECA 4GMRA 5BV0A 5EX0A 5CEAA 4TXQA 3I4GA 2DWZA 1WY6A 3ABLE 5E75A 5FINA 2WQ6A 1VDYA 1QQEA 1XNFA 1PAQA 2L0TB 5ENOD 2UWJG 3C3RA 4JPSA 4HBDA 4DX6D 2L6BA 2VSOE 3TL5A 5A23A 1N11A 4ZFHA 4I6GA 3U64A 3JQ0A 1BD8A 3AG4E 3HRAA 2RD0A 4G1TA 1JWFA 3LYAA 3B95A 1BI8B 2J4BA 2ZXWE 2GROB 3SF4A 2JEKA 2H6IA 1E7VA 2WXIA 2EILE 3UUXA 1IQRA 2XENA 1E8YA 1UN9A 1QBQA 3D9NA 2P9KG 3ML8A 3ISMC 1S63A 1Y8MA 3FU6A 3CVVA 3MGBA 3ZYLA 2EIME 4GB9A 1U3CA 2RFMA 3DSUA 3EIJA 1O1RA 2I6HA 4U8VD 5CMWA 3CEQA 1KPSB 3C98A 4XKBA 4UQYA 3CHPA 4TUUA 4GZCA 5JHBA 4U7EB 5LFAA 4YNDA 2XRYA 4HORA 3K9IA 4DX5D 1N4SA 3RRNB 4WNDA 3FH7A 3L9TA 1E90A 3CHSA 4EZJA 2IOSA 4KVMA 3S2AA 1Y6IA 3CHQA 1BLXB 5CRVA 3FTXA 4R7LA 3FTWA 3ZPJA 1N95A 5JJTA 4AIFA 3B7BA 5CEDB 3DXMG 4LG6A 5AARA 4LNBA 4GMLA 4MRUA 1OT8A 3FUHA 4K5CA 4OAVB 3ULQA 2AXVA 2X6KA 2V5FA 3CK7A 1MX4A 5EIDA 2KCKA 1P5QA 3B13A 3B7TA 3QNKA 4E85A 5JJ6A 4BERA 3PEVB 5FQ7A 3ZVVA 4AM9A 3FUEA 3TWRA 5BV1A 5C2YA 3QARA 4BY6A 4AEZC 2LO6A 3VTXA 3FUDA 3PUJA 3NAWA 2Y3AA 2XEVA 4J8SA 5H7PA 2A5EA 3HXCA 3AS4A 3NZSA 2B6CA 4O6FA 5G05C 4N5CA 2OOEA 3ONLA 4UI9J 3ZN3A 5ENNA 2KATA 4IULA 4G11A 4OVUA 5T8IA 4WUYA 4HQDA 3MYVA 1N4QA 4GTMA 3L13A 3UTMA 1N9AA 5EIBE 4TUMA 2KZTA 3OXFA 3Q79A 4CYMD 4UUCA 3F6QA 2X3MA 1KT0A 4XZ4A 3IXEA 1Z5SC 3AU5A 5E76A 2CHXA 3DPYA 5ENSD 2YHEA 3ZU7B 4GYYA 4CDMA 4HFGA 2IY0C 3ZNGA 1SZ9A 4GA0A 2DYSE 3I5PA 2F37A 5FWQA 3RO2A 5EILA 2JABA 4B89A 1SA4A 2KXPC 1HF8A 1WM5A 2HYZA 4FLHA 1DCEA 3PH0C 4ABNA 2LSUA 3MX3A 4GU5A 3UT4A 1X81A 3PREA 1HZ4A 4HLLA 4BT8A 4WWNA 2Q7FA 5ANRA 3MZLB 4Q96A 3PNLB 3CVUA 3EDTB 4YDWA 4U95D 4JD2G 2I1KA 3S7JA 4CDNA 1TR4A 3JYSA 3FUKA 4M7CA 4PS7A 3FUFA 2PL2A 1E8ZA 4HOSA 3W9GA 3CQCB 3PZ4A 1JCRA 5D0OD 3DSTA 1FT1A 4U0ZA 4BWRA 3TGOA 2J09A 2IEJA 1KLXA 4UWKA 2QZAA 3FH5A 4RG9A 3ASHA 4N2QA 2ZGGA 2FO1E 1JWGA 4I6EA 5CCMA 1K1AA 4J8YA 5HQ8A 3RSEG 1DCQA 2DBAA 3Q78A 5DIZA 3CSFA 3C3OA 4G2VA 2LXMA 3PZ1A 2KCVA 2GGFA 1MYOA 1B89A 1ELKA 1BI7B 1MX6A 3D9PA 4ILGA 1MHQA 2VSYA 2X6HA 1MZCA 1FT2A 4K5BA 2VGXB 1OY3D 3LCAA 3SFXA 1OWLA 3KSQA 2HO1A 2XEHA 2KC7A
chains in the Genus database with same CATH topology
3ASNE 3X2QE 2OCCE 2EINE 2ZXWE 2Y69E 3ABME 2EIKE 2EIME 2EILE 3ASOE 1V55E 1OCCE 3AG1E 1OCOE 5B1BE 2DYSE 3WG7E 3AG4E 3ABLE 3AG2E 5B3SE 1V54E 1OCZE 2EIJE 2DYRE 3ABKE 1OCRE 3AG3E 5IY5E 5B1AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASN E;  3X2Q E;  2OCC E;  2EIN E;  2ZXW E;  2Y69 E;  3ABM E;  2EIK E;  2EIM E;  2EIL E;  3ASO E;  1V55 E;  1OCC E;  3AG1 E;  1OCO E;  5B1B E;  2DYS E;  3WG7 E;  3AG4 E;  3ABL E;  3AG2 E;  5B3S E;  1V54 E;  1OCZ E;  2EIJ E;  2DYR E;  3ABK E;  1OCR E;  3AG3 E;  5IY5 E;  5B1A E; 
#chains in the Genus database with same CATH topology
 2Y4T A;  4GCO A;  5AQ7 A;  3LXU X;  3FUL A;  5A7D B;  4XE0 A;  2C0M A;  4DK5 A;  2RKK A;  1YA0 A;  2IQC A;  4RLY A;  4G23 A;  1TJF A;  4RG6 A;  4HXI A;  2IOL A;  1NFI E;  2XGS A;  3C72 A;  3LY8 A;  5BXU A;  3Q9U C;  4QQI A;  2XZT G;  4LUN U;  4JA7 A;  1OWM A;  1O5M A;  4U07 A;  2J9Q A;  4YVO A;  4H7Y A;  3BEE A;  4M3O A;  1IYG A;  3B7U X;  3MEK A;  4E6H A;  1RZ4 A;  4W9R A;  5LP0 A;  2R05 A;  3FUN A;  4HI9 A;  3CK9 A;  1DC2 A;  3E4B A;  1MQS A;  5EKQ D;  3FFL A;  2WPV A;  4DI4 A;  4WNF A;  2V5Q C;  1YCS B;  4J8E A;  4ANU A;  1S64 A;  5FQ6 A;  5G04 C;  2X6I A;  4BSX A;  3GZ2 A;  1D8E A;  3SO8 A;  3GW4 A;  5HRY A;  3TG5 A;  3BU8 A;  2BF0 X;  2KZT B;  3QAQ A;  3CVQ A;  5JJ7 A;  3U3W A;  2OEV A;  3ZYM A;  3FEX A;  4URK A;  4NUR A;  4ME2 A;  3FU5 A;  4YDO A;  3PDN A;  3FTY A;  3JCK C;  2J8S D;  2OND A;  2YQ8 A;  2IO2 C;  2YNQ A;  3E33 A;  3APD A;  3L17 A;  3ULE G;  3L22 A;  3V31 A;  4XEI G;  2DYR E;  4G25 A;  3DEP A;  4I2Z A;  4EZL A;  3EHR A;  3ABM E;  3PRZ A;  3DSW A;  3E34 A;  3FTS A;  2QFC A;  1TEZ A;  4PH4 B;  2XGM A;  4DJA A;  4UWF A;  2ILR A;  1GW6 A;  4JHJ A;  3BG0 B;  2ETB A;  3HXF A;  3HDX A;  3HVE B;  3FH8 A;  4WWO A;  2PQR A;  1YYH A;  2HR2 A;  4UWG A;  5ARF A;  1TN7 A;  3C5R A;  1PC2 A;  2KM4 A;  2ZU6 B;  3G2W A;  3KS2 A;  5FZR A;  2R17 C;  1MX2 A;  4CGV A;  3ASD A;  3QC1 A;  1QYM A;  3QOU A;  4A3V A;  4LSZ E;  1H6P A;  2WXF A;  3SNX A;  3G2T A;  2FF4 A;  4D10 C;  3VLE A;  1N4R A;  2LAH A;  3W9F A;  3MCX A;  5BPP A;  3UM0 A;  3PZD A;  2YHC A;  4O60 A;  4G8L A;  4K5A B;  2WQ7 A;  1H19 A;  5CBN A;  1O1T A;  3D9O A;  3D9I A;  2WXQ A;  3CKC A;  1UG3 A;  3TWT A;  4G8K A;  2GRP B;  4BFR A;  2AXZ A;  3JUI A;  1FVF A;  3Q15 A;  2LAI A;  4B94 A;  2WXG A;  1FVH A;  2IO3 C;  4UI9 K;  5B3S E;  2XCB A;  4HRN A;  4GPK A;  4XKC A;  4MS6 A;  1KT1 A;  4FHJ A;  1ELR A;  1V55 E;  1NA0 A;  3ML9 A;  3EHN A;  4YDY A;  4BT9 A;  3CHM A;  4KZC A;  1OCZ E;  2WB2 A;  3CK8 A;  5FQ8 A;  3OTN A;  5KNH D;  2P9N G;  2I9C A;  2L6J A;  1H6O A;  2LUH A;  2VGX A;  4OVV A;  1HS6 A;  3VLD A;  3SD5 A;  3DXK G;  4F6R D;  2WQH A;  5ENR D;  4JA9 A;  2GRR B;  2ETC A;  2XGO A;  3V2O A;  4WNG A;  1Z3X A;  4L2Y A;  4LCT A;  3N71 A;  2WXP A;  5D0Q D;  3Q4A B;  3VLF A;  3RO3 A;  5LOZ A;  2GRM A;  4GCN A;  3VTY A;  4ACK A;  4IN3 B;  3UKU G;  4AXH A;  3NF1 A;  2VGY A;  3QDN A;  2QYJ A;  5ENP D;  3P1U A;  2IJG X;  2FI7 A;  3OXG A;  4KXK B;  2CFU A;  4ATG A;  4GA2 A;  2VGE A;  4L1B A;  3X2Q E;  3FUI A;  1EPU A;  3NBN B;  2H6H A;  2PM7 A;  4GZ3 A;  1EDU A;  3LVR E;  2CG2 A;  3AG1 E;  3L08 A;  1HO8 A;  4GTQ A;  4MBG A;  1E96 B;  3IHV A;  4J8D A;  3MKQ A;  2WXR A;  3J5Q B;  3ENE A;  3LJ3 A;  1MJ0 A;  3CV0 A;  4GAA A;  4LEU A;  2F8X K;  4G26 A;  2BTD A;  3JXJ A;  3DWL G;  4I1O B;  4KYO B;  2P9P G;  1HFA A;  3FHE A;  3UI2 A;  3DSV A;  3QWW A;  5JMN D;  2WMO A;  4GZD A;  1G3N B;  1UOH A;  2DZN A;  5CHE E;  4EBA G;  1UJK A;  2PQN A;  2XHE A;  3FTU A;  1NA3 A;  3LEW A;  4JC8 A;  3HIZ A;  4F53 A;  1UJJ A;  4HVB A;  3KAE A;  2IFU A;  4L2L A;  5BXO A;  2DVW A;  2F0Y A;  5LCW J;  4C0E A;  4N39 A;  2L9B A;  5EX3 A;  3RAU A;  4V3I A;  4EBA A;  3AG2 E;  3GZ1 A;  4DX7 D;  1AWC B;  4LNU D;  3ESK A;  4I9C A;  2H6F A;  4XI0 A;  4XIF A;  4BEP A;  4HRL A;  4B0Z A;  4L9P A;  4FAD A;  3PZ3 A;  2J4D A;  5D2M C;  3RJV A;  2QYU A;  1IXV A;  4I1A A;  1N94 A;  2P9S G;  4N3C A;  2AW6 A;  3TJP A;  5HS0 A;  4P29 A;  3ZEF A;  4GZ6 A;  3FTZ A;  2MYO A;  2J08 A;  4HRM B;  3TWQ A;  3CQG B;  4JB8 P;  2EQX A;  3IBE A;  3ZUV B;  3IKO B;  4FP7 A;  1OCR E;  3HHM A;  4CRW A;  4QFV A;  1JCQ A;  3HVE A;  3JQ1 A;  3QK0 A;  3ZYK A;  2LNI A;  1LF8 A;  4HNA D;  4LRZ A;  1BU9 A;  3CHR A;  5CEC B;  4NAC A;  4UI9 C;  2P2C P;  1JCS A;  4F3V A;  4JHK A;  2WM9 A;  1UN8 A;  5EYP F;  5G2N A;  3NZU A;  4A63 B;  3LY9 A;  3RU0 A;  2UY1 B;  2WXL A;  1A17 A;  2XPY A;  2I2O A;  4MLP A;  1KZP A;  4A55 A;  2XQ0 A;  5AQB A;  3FWV A;  1IHB A;  5KWD A;  4HS2 A;  2EIN E;  3MJW A;  1N0Q A;  3EIQ C;  3TAX A;  4JEH A;  1OCC E;  3FDH A;  1S70 B;  3UIN C;  2FO7 A;  4BSZ B;  2J49 A;  3LKU A;  4JL0 A;  1D9S A;  1Z3Y A;  1L5J A;  4NQ0 A;  2P9U G;  3O4Z A;  5AQ9 A;  3MV3 B;  4UWL A;  2H6G A;  2HM8 A;  3DRA A;  2V4H C;  1IKN D;  1TNZ A;  2MRI A;  2MHK A;  3J5P A;  4N3A A;  3CVY A;  1OXJ A;  4O1O A;  3PVL A;  2WXH A;  3PEU B;  5G55 A;  2X38 A;  3G2S A;  3LPZ A;  1X5B A;  4U04 A;  3PNT B;  3NOG D;  1E8W A;  4TRQ A;  3AJI A;  5FTP A;  1AP7 A;  3MKR A;  3QKY A;  2GW1 A;  5LX8 A;  1H0A A;  3CVP A;  2HE0 A;  2VYI A;  2FUL A;  3ASN E;  3CST A;  4U0U A;  2X6J A;  3PS6 A;  3FUJ A;  2AJA A;  3LS8 A;  3ASO E;  3CVN A;  2PNN A;  4OYS A;  3MKQ B;  3JUE A;  3ONK A;  3RRM B;  4CT4 A;  4UWH A;  4BTA A;  3E37 A;  3TWS A;  5HI7 A;  2OEW A;  4JZY A;  3AU4 A;  3L16 A;  2PM6 A;  3DBS A;  5KJN A;  3SZ7 A;  2EIJ E;  4N5Q A;  5CMY A;  4A3T A;  2M63 A;  3LVQ E;  2V8S E;  4DRX E;  5KJL A;  3WG7 E;  5D66 A;  4FHK A;  3MV2 B;  2CHW A;  5BNW A;  5IY5 E;  5EYL A;  2Y1L E;  4XI9 A;  4CDR A;  4ANV A;  2OCC E;  4L7T A;  4WAF A;  4HOQ A;  4AV7 A;  4ILI A;  4U8Y D;  4OAU C;  3QB2 A;  2J07 A;  3ZKJ A;  5KJK A;  2R02 A;  2KCL A;  3R7R A;  4IYP A;  1ZU2 A;  3EJN A;  1RW2 A;  3DSX A;  3QWP A;  3Q75 A;  3GZS A;  3MA5 A;  3U9W A;  4B8C B;  3UX4 A;  3D9J A;  4NRH B;  2MOW A;  3ZGQ A;  4GMJ A;  1JPL A;  2XPI A;  1KZO A;  4ATZ D;  3B7S A;  4AOF A;  4EQF A;  5T4Y A;  3E32 A;  5J90 A;  3QWV A;  1LD7 A;  3TWV A;  2VJ8 A;  4C48 B;  4K0R A;  2E0I A;  5ENQ D;  3TXM A;  2XS1 A;  4I1M A;  3SFY A;  3UM2 A;  2OV8 A;  4FLB A;  1LD8 A;  4GPM A;  2YIN A;  1ZB1 A;  4RQI A;  4ACL A;  3T9K A;  3FUM A;  1FCH A;  2IU1 A;  1H2V C;  5CBO A;  3P2B A;  2WXM A;  2VSX E;  4PS8 A;  5KBA A;  4LNG A;  4F7A A;  1HG2 A;  2Y69 E;  3LY7 A;  3FU3 A;  2XRZ A;  3UQ3 A;  3PE4 A;  3KD7 A;  4CT0 A;  4A1S A;  4DLO A;  5CCL A;  3Q7F A;  2WVI A;  3BG1 B;  3IV0 A;  4FA6 A;  3BQO A;  1NI1 A;  2XCC A;  2UY1 A;  2BED A;  3ASF A;  4I6J A;  4GTR A;  3UMV A;  4N3B A;  4CEM A;  1WDY A;  3Q47 B;  3FEY A;  4AY6 A;  1TN6 A;  2Y0B G;  4PS3 A;  1SQM A;  4KT6 B;  5B1A E;  2DCP A;  2V0P A;  3ESL A;  3HXE A;  5G05 J;  1DNP A;  4ILH B;  1OWP A;  2FEZ A;  4CZ2 D;  3FU0 A;  2XPZ A;  2A4Z A;  5JHA A;  1E7U A;  4J6I A;  1H2T C;  1S0P A;  5FZS A;  2WXK A;  2VTB B;  3T8K A;  4I43 A;  4KZ0 A;  3FTV A;  5ITZ F;  3TWW A;  4HI8 A;  3HYM B;  2I1J A;  1BPO A;  1IHG A;  2BKK B;  2EIK E;  2ETA A;  3S7B A;  4I2W A;  3I4R B;  3NQP A;  4ZHB A;  4U8H A;  2GRQ B;  2WXO A;  1PY1 A;  3E30 A;  4LER A;  5FJY A;  2ZIS A;  3D9H A;  5BW8 C;  3CVL A;  4TV3 A;  3APC A;  1HE8 A;  3KSL A;  3ZHE B;  5FZQ A;  2FBN A;  5J08 A;  3UXG A;  1HH8 A;  2NSZ A;  2WMN A;  2KBX A;  3D9K A;  5CER B;  4DLQ A;  2NYJ A;  1SA5 A;  3Q5M A;  2NXP A;  4RSY A;  2P9L G;  3DEO A;  3V30 A;  1TNU A;  2C0L A;  3GYZ A;  1XGW A;  2ION A;  2ZGD A;  3ZXS A;  4BES A;  2Y4U A;  2BKG A;  4WNE A;  2QY7 A;  3R7Q A;  4AVX A;  3EU9 A;  1FPP A;  4TXR A;  1EYH A;  4C9B B;  5A6C A;  1IQU A;  4F1S A;  4GZ5 A;  3SGH A;  4J7W A;  4J0U A;  2X6F A;  4Q69 A;  2E2E A;  4AJW A;  3G2U A;  3ZFW A;  4WWP A;  4A1G A;  3L54 A;  3TG4 A;  1OUV A;  4O1P A;  4GTT A;  3IEG A;  5HKP A;  3FY4 A;  5EN5 D;  4DUI A;  4F1P A;  1TNO A;  3ZW3 A;  3D9M A;  5T3R A;  3ZRH A;  3UKR G;  1INZ A;  2PZI A;  4PDX A;  4BX8 A;  3TXN A;  4BX9 A;  3S7F A;  2OVF A;  2WXN A;  3DPD A;  3B7R L;  5FIO A;  2CFZ A;  4U96 D;  3UPV A;  1N4P A;  5ENT D;  3ZYQ A;  3L82 A;  3CGH A;  1NZN A;  2B0O E;  3NOC D;  1U2V G;  4RVB A;  2V4L A;  4FUL A;  2DZO A;  2JLB A;  4G24 A;  1K1B A;  1H6K A;  4L23 A;  4HB5 A;  3IHY A;  4JEU A;  3SY2 A;  1WAO 1;  2VQ2 A;  3UM1 A;  3BUA A;  3RKV A;  3S7D A;  1Z6T A;  3CIA A;  3D3M A;  3T8M A;  4UQX A;  3Q49 B;  1ZBP A;  3O48 A;  4AY5 A;  1H2U A;  3FP3 A;  4DX2 A;  1TN8 A;  3PZ2 A;  1WG0 A;  4CGW A;  1N54 A;  3RK6 A;  4GTV A;  4C0M A;  5KCM A;  4APO A;  1O1S A;  2GRL A;  2LSV A;  5LCW C;  4KMO A;  3HXD A;  3AG3 E;  2R2L A;  4EPZ A;  4IRU A;  1SZA A;  1D8D A;  4JVS A;  5ARG A;  4UQZ A;  1TJC A;  4U0S A;  3SHF A;  4HOT A;  3APF A;  4GA1 A;  4Y6W A;  4XX5 A;  3ABK E;  4JW1 A;  1OWO A;  3Q9N C;  4GTS A;  3ASG A;  4MKT A;  3G2V A;  1DVP A;  4KBQ A;  3TWX A;  4EHM A;  2CHZ A;  2A5U A;  3I3N A;  4APF A;  1TNY A;  3ZIM A;  3R9A B;  2C2L A;  5G04 J;  2AWI A;  4K03 A;  2CG3 A;  1LTX A;  3UM3 A;  3KEA A;  2XZD G;  4DX1 A;  2RFA A;  2XS8 A;  3UT7 A;  4ANW A;  2R03 A;  2GRN B;  3CVX A;  4FJZ A;  4Z68 A;  4HLE A;  1U3D A;  5FT9 A;  5JA4 D;  3EHQ A;  3WXX A;  4NIK A;  3EUV A;  2VTB A;  1QNF A;  3U4T A;  4I9E A;  5DBK A;  3URZ A;  1EF1 C;  3OAW A;  4HOU A;  4I17 A;  3CLJ A;  2P58 C;  1SW6 A;  4GTP A;  4GTO A;  3EHM A;  4Y6C A;  3ZXP A;  3CKB A;  3SFZ A;  4B8A A;  1UW4 B;  1N0R A;  5B1B E;  4N2S A;  1HX8 A;  2XEE A;  2AVP A;  3NB2 A;  5AIJ A;  2WXJ A;  3Q7A A;  4FJY A;  5ANL A;  3JXI A;  4B93 B;  5M72 A;  5AJL A;  1QZ2 A;  3AAA C;  3U66 A;  3EU5 A;  1JUQ A;  1NP7 A;  5CRU A;  5FQ4 A;  5BUZ A;  3UIP C;  2VSN A;  3RIB A;  2F8Y A;  3OXL A;  3ZHE A;  3PE3 A;  1HU3 A;  2P9I G;  1K3Z D;  5C1D A;  3AS5 A;  5EDS A;  5AYW D;  5KJM A;  3AS8 A;  3Q73 A;  2LXL A;  5AN8 A;  1TYQ G;  1HXI A;  1W3B A;  4Q94 A;  3V2X A;  4TXP A;  4CCA A;  2DIW A;  1YMP A;  1OCO E;  3SI5 A;  3CVW A;  2AXU A;  4AP2 A;  3UIO C;  2BUG A;  4YVQ C;  3QJZ A;  5BT1 A;  3SBS A;  3ULY A;  3R9M A;  1N52 A;  3T5X A;  2ZIR A;  4JXT A;  1ELW A;  3RRU A;  3KEZ A;  4EZK A;  3HXB A;  5AJD A;  3LDZ A;  3V79 K;  1A5E A;  4BET A;  4GYO A;  4YDE A;  4J8F A;  3SQV A;  4ANX A;  1E8X A;  1NL4 A;  2R59 A;  1HG5 A;  4KVO A;  3TWU A;  4X8Q A;  2NC9 A;  4GYW A;  3PUK A;  4JHR A;  4FU3 A;  3SBT B;  1OWN A;  4H7X A;  2OVB A;  3C3Q A;  3UT8 A;  3T5V A;  4PUC A;  5AAO A;  4FC8 A;  1SVX A;  3DSS A;  2R5S A;  4U63 A;  5KNG A;  3CHO A;  2RG8 A;  1V54 E;  3D9L A;  1Q2Z A;  2QC9 A;  4DPR A;  5AEN A;  1TNB A;  3LJN A;  2L0I A;  4BTB A;  2IF4 A;  3HG0 D;  1K8K G;  3L6A A;  3CR3 A;  5AQA A;  4DI3 A;  4EEC A;  4GMR A;  5BV0 A;  5EX0 A;  5CEA A;  4TXQ A;  3I4G A;  2DWZ A;  1WY6 A;  3ABL E;  5E75 A;  5FIN A;  2WQ6 A;  1VDY A;  1QQE A;  1XNF A;  1PAQ A;  2L0T B;  5ENO D;  2UWJ G;  3C3R A;  4JPS A;  4HBD A;  4DX6 D;  2L6B A;  2VSO E;  3TL5 A;  5A23 A;  1N11 A;  4ZFH A;  4I6G A;  3U64 A;  3JQ0 A;  1BD8 A;  3AG4 E;  3HRA A;  2RD0 A;  4G1T A;  1JWF A;  3LYA A;  3B95 A;  1BI8 B;  2J4B A;  2ZXW E;  2GRO B;  3SF4 A;  2JEK A;  2H6I A;  1E7V A;  2WXI A;  2EIL E;  3UUX A;  1IQR A;  2XEN A;  1E8Y A;  1UN9 A;  1QBQ A;  3D9N A;  2P9K G;  3ML8 A;  3ISM C;  1S63 A;  1Y8M A;  3FU6 A;  3CVV A;  3MGB A;  3ZYL A;  2EIM E;  4GB9 A;  1U3C A;  2RFM A;  3DSU A;  3EIJ A;  1O1R A;  2I6H A;  4U8V D;  5CMW A;  3CEQ A;  1KPS B;  3C98 A;  4XKB A;  4UQY A;  3CHP A;  4TUU A;  4GZC A;  5JHB A;  4U7E B;  5LFA A;  4YND A;  2XRY A;  4HOR A;  3K9I A;  4DX5 D;  1N4S A;  3RRN B;  4WND A;  3FH7 A;  3L9T A;  1E90 A;  3CHS A;  4EZJ A;  2IOS A;  4KVM A;  3S2A A;  1Y6I A;  3CHQ A;  1BLX B;  5CRV A;  3FTX A;  4R7L A;  3FTW A;  3ZPJ A;  1N95 A;  5JJT A;  4AIF A;  3B7B A;  5CED B;  3DXM G;  4LG6 A;  5AAR A;  4LNB A;  4GML A;  4MRU A;  1OT8 A;  3FUH A;  4K5C A;  4OAV B;  3ULQ A;  2AXV A;  2X6K A;  2V5F A;  3CK7 A;  1MX4 A;  5EID A;  2KCK A;  1P5Q A;  3B13 A;  3B7T A;  3QNK A;  4E85 A;  5JJ6 A;  4BER A;  3PEV B;  5FQ7 A;  3ZVV A;  4AM9 A;  3FUE A;  3TWR A;  5BV1 A;  5C2Y A;  3QAR A;  4BY6 A;  4AEZ C;  2LO6 A;  3VTX A;  3FUD A;  3PUJ A;  3NAW A;  2Y3A A;  2XEV A;  4J8S A;  5H7P A;  2A5E A;  3HXC A;  3AS4 A;  3NZS A;  2B6C A;  4O6F A;  5G05 C;  4N5C A;  2OOE A;  3ONL A;  4UI9 J;  3ZN3 A;  5ENN A;  2KAT A;  4IUL A;  4G11 A;  4OVU A;  5T8I A;  4WUY A;  4HQD A;  3MYV A;  1N4Q A;  4GTM A;  3L13 A;  3UTM A;  1N9A A;  5EIB E;  4TUM A;  2KZT A;  3OXF A;  3Q79 A;  4CYM D;  4UUC A;  3F6Q A;  2X3M A;  1KT0 A;  4XZ4 A;  3IXE A;  1Z5S C;  3AU5 A;  5E76 A;  2CHX A;  3DPY A;  5ENS D;  2YHE A;  3ZU7 B;  4GYY A;  4CDM A;  4HFG A;  2IY0 C;  3ZNG A;  1SZ9 A;  4GA0 A;  2DYS E;  3I5P A;  2F37 A;  5FWQ A;  3RO2 A;  5EIL A;  2JAB A;  4B89 A;  1SA4 A;  2KXP C;  1HF8 A;  1WM5 A;  2HYZ A;  4FLH A;  1DCE A;  3PH0 C;  4ABN A;  2LSU A;  3MX3 A;  4GU5 A;  3UT4 A;  1X81 A;  3PRE A;  1HZ4 A;  4HLL A;  4BT8 A;  4WWN A;  2Q7F A;  5ANR A;  3MZL B;  4Q96 A;  3PNL B;  3CVU A;  3EDT B;  4YDW A;  4U95 D;  4JD2 G;  2I1K A;  3S7J A;  4CDN A;  1TR4 A;  3JYS A;  3FUK A;  4M7C A;  4PS7 A;  3FUF A;  2PL2 A;  1E8Z A;  4HOS A;  3W9G A;  3CQC B;  3PZ4 A;  1JCR A;  5D0O D;  3DST A;  1FT1 A;  4U0Z A;  4BWR A;  3TGO A;  2J09 A;  2IEJ A;  1KLX A;  4UWK A;  2QZA A;  3FH5 A;  4RG9 A;  3ASH A;  4N2Q A;  2ZGG A;  2FO1 E;  1JWG A;  4I6E A;  5CCM A;  1K1A A;  4J8Y A;  5HQ8 A;  3RSE G;  1DCQ A;  2DBA A;  3Q78 A;  5DIZ A;  3CSF A;  3C3O A;  4G2V A;  2LXM A;  3PZ1 A;  2KCV A;  2GGF A;  1MYO A;  1B89 A;  1ELK A;  1BI7 B;  1MX6 A;  3D9P A;  4ILG A;  1MHQ A;  2VSY A;  2X6H A;  1MZC A;  1FT2 A;  4K5B A;  2VGX B;  1OY3 D;  3LCA A;  3SFX A;  1OWL A;  3KSQ A;  2HO1 A;  2XEH A;  2KC7 A; 
#chains in the Genus database with same CATH homology
 3ASN E;  3X2Q E;  2OCC E;  2EIN E;  2ZXW E;  2Y69 E;  3ABM E;  2EIK E;  2EIM E;  2EIL E;  3ASO E;  1V55 E;  1OCC E;  3AG1 E;  1OCO E;  5B1B E;  2DYS E;  3WG7 E;  3AG4 E;  3ABL E;  3AG2 E;  5B3S E;  1V54 E;  1OCZ E;  2EIJ E;  2DYR E;  3ABK E;  1OCR E;  3AG3 E;  5IY5 E;  5B1A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...