3ABME

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 42
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3abmE00
2EIJE 2EIME 5B1AE 2DYRE 1V55E 1OCZE 3AG3E 3ABME 2EIKE 3ASNE 1OCCE 2EILE 3X2QE 5B3SE 2OCCE 5B1BE 5IY5E 1OCOE 3WG7E 1V54E 2ZXWE 3AG2E 2DYSE 2EINE 3ABLE 1OCRE 3AG1E 3AG4E 2Y69E 3ABKE 3ASOE
chains in the Genus database with same CATH superfamily
2VJ8A 3FTSA 4CCAA 1H0AA 1VDYA 3QB2A 5AENA 2IONA 3E4BA 4DUIA 3I4RB 4UI9K 3GW4A 4GU5A 3FU0A 2WM9A 1SA4A 4AY5A 3C98A 2ETBA 2WQ7A 4PDXA 3D9PA 4U95D 1U3CA 2NC9A 5FJYA 3JUEA 3GZSA 1INZA 2A5UA 3MX3A 3U9WA 4RLYA 4BFRA 4HI8A 3P2BA 5AJLA 3D3MA 2P9SG 4AP2A 4L2YA 3LCAA 1K8KG 4J8SA 1N4RA 2C2LA 2P9LG 1OWLA 1FCHA 3UTMA 4I17A 4GA1A 3ZKJA 2BF0X 3HIZA 2JABA 3KSLA 1HF8A 3PREA 1D8DA 2KM4A 2FULA 3Q7AA 1BLXB 1KZOA 5BXUA 4GYOA 2OV8A 1H19A 1Z5SC 2XGMA 3SD5A 4EHMA 1TNYA 1XGWA 3X2QE 1HE8A 3PZ1A 2HM8A 4TXQA 3OXFA 2YHCA 3QAQA 3Q4AB 4U8VD 3UXGA 4ZFHA 3PDNA 3ZYLA 1DCEA 4TUMA 3L54A 5JHAA 3CQGB 2HE0A 2CFZA 1KT1A 2CHZA 5T4YA 3C3QA 3DSUA 4HBDA 2R59A 1RW2A 3QWWA 1HZ4A 2CHXA 4N2QA 3FU5A 2IO3C 1DVPA 4GPKA 4DX6D 5G05C 1EDUA 5D2MC 2WXQA 4BSXA 4C9BB 4CZ2D 3Q47B 5CBOA 2BTDA 2IF4A 3J5PA 4GTMA 3LY8A 5D66A 4C48B 1BI8B 3QDNA 3B7TA 4G24A 1PAQA 1IHBA 2XRYA 2DYSE 3FULA 3Q9NC 2F37A 3UT8A 1FVHA 4N39A 1Y6IA 4L9PA 3CVQA 5CERB 2PNNA 4UI9J 5ITZF 1UN9A 4Q94A 2J09A 1EYHA 1NI1A 3KS2A 3T5XA 3EUVA 2IU1A 4O6FA 3ONKA 5HQ8A 3TGOA 1A17A 1QZ2A 1TYQG 3HXCA 2GRQB 4UWLA 3CSFA 4IULA 4LEUA 2Y3AA 3MA5A 4JD2G 5KWDA 3ZVVA 2R03A 2EIKE 3FUFA 3L17A 2ZGDA 3T9KA 3U66A 2ZGGA 1E8YA 3LJ3A 2RFAA 3LPZA 5LCWJ 4YDOA 4F3VA 4OAUC 1Z3XA 2KATA 3R7QA 3ZXPA 1NL4A 5AAOA 4PS3A 5M72A 3PE3A 4I6GA 3B7SA 4ACLA 4WUYA 2WXKA 4RSYA 4Y6CA 2Y69E 1O1RA 3J5QB 4EECA 4ANWA 4GTOA 2RFMA 3ULYA 1TN6A 2IQCA 3TXNA 1OCCE 4IYPA 5ENRD 3FUEA 2V8SE 4U96D 3E32A 3TWVA 2F8YA 4B8CB 4QQIA 2Y0BG 5E75A 4TXRA 3K9IA 4UQYA 2X6KA 3ASOE 2GW1A 4F6RD 2XS8A 5BPPA 5EN5D 3PVLA 4HLEA 3R7RA 4H7XA 5FZSA 5D0OD 4FHJA 4FA6A 1OXJA 2LAHA 4J0UA 3OAWA 4BWRA 2DWZA 4E6HA 2VSYA 2Y1LE 4HOSA 3Q15A 3NAWA 2J9QA 5BUZA 3CV0A 4ILGA 3D9JA 2NYJA 4JA7A 3BG1B 3UX4A 3CVLA 4A3TA 4EBAA 3QWPA 2Y4UA 4CT0A 3U3WA 1JCRA 3FFLA 3SF4A 1OCOE 4K5BA 4FJZA 3PS6A 5FQ4A 3AJIA 4N3BA 4MKTA 4J8FA 3ZN3A 1O1TA 3PNLB 5AQBA 2KXPC 1H2UA 2OCCE 1OY3D 2XS1A 4D10C 3B95A 1N52A 1HX8A 4GTTA 4LRZA 3EJNA 2UWJG 4U07A 5HS0A 2VTBA 4EZKA 1K3ZD 2ZU6B 3V2XA 3ZFWA 4UQXA 3Q5MA 1JPLA 3IXEA 4GZCA 2UY1B 2WXPA 3MKRA 4N3AA 5CBNA 1E8ZA 4GB9A 5EYLA 2XPZA 4F1PA 1K1BA 2OOEA 4WNFA 3ZPJA 3PRZA 1N94A 5EIBE 2EIME 3DBSA 4JEUA 1OWOA 2AXUA 5EYPF 2DZOA 1U2VG 5B1BE 4J8EA 3NBNB 2FI7A 2L6BA 4FP7A 3FDHA 4NRHB 1ELKA 3ENEA 2IO2C 3SFXA 1TN8A 3CGHA 2WVIA 5AN8A 4XX5A 4MBGA 4JHRA 4HRMB 2ETCA 5CRUA 4IRUA 5LCWC 4HVBA 1HO8A 3KEAA 5IY5E 3B7BA 1SW6A 4DPRA 5T8IA 3AG1E 1BU9A 4YDYA 5DBKA 4YVOA 1N0RA 5EX0A 2VSXE 3FTVA 1X5BA 3L08A 5EX3A 2EQXA 3FH7A 3JXIA 5EILA 4BX8A 2XEEA 2OVBA 3L16A 4U0SA 4GA0A 2PL2A 3C3RA 5KJMA 4U8YD 1K1AA 2X3MA 4I6EA 3UM0A 5B1AE 4TXPA 4I2ZA 3AU4A 2GRRB 2B6CA 3U4TA 4KZCA 2LUHA 3DEPA 4J7WA 4CEMA 1TNBA 4UWHA 1UN8A 4APFA 3TWRA 3PZ3A 3ML9A 5KJKA 4WWPA 3GZ2A 4CGVA 3FUHA 1UOHA 4XIFA 4BT8A 3APFA 5A23A 1YMPA 3C3OA 3U64A 3RKVA 3DXMG 1EF1C 1H2TC 3ESLA 3QOUA 4JVSA 4O1OA 3BQOA 3HHMA 4BTAA 1LD7A 2I2OA 2GROB 3RRMB 4BT9A 3UT7A 4AV7A 4G11A 2JLBA 3DXKG 3N71A 1IHGA 3ABME 4FJYA 3ASNE 4K5AB 3CKCA 4GZ5A 5ENOD 5FTPA 1TNUA 3MKQA 3B7UX 4A3VA 3TWQA 3FTUA 4JA9A 1TN7A 2C0MA 4JHJA 5AJDA 2BEDA 3W9FA 4Q96A 1SVXA 4MS6A 4YDEA 4IN3B 5ENQD 4CDNA 3SZ7A 1AWCB 5ARGA 3OTNA 3ZUVB 3RO3A 3GYZA 3CKBA 3CVXA 3R9AB 1SQMA 3LEWA 1D9SA 4E85A 3NZSA 3APDA 4GTVA 5A6CA 2IOLA 4FADA 3DEOA 3HXBA 3ZYMA 3TXMA 2QYJA 3ASFA 2PM6A 4K03A 2V5QC 1H6PA 1UW4B 3DSVA 3PEVB 4QFVA 2L0IA 3ISMC 3WG7E 2HYZA 4I9CA 1N11A 1H2VC 1MX6A 2FBNA 5EKQD 1MHQA 3JQ1A 2X6JA 1TR4A 3D9OA 4Z68A 4NACA 2R05A 2F8XK 2I9CA 3FUJA 4YVQC 2BKGA 3ZRHA 4HOTA 3BUAA 3DSSA 3IHVA 2LNIA 4I43A 1E96B 4LNUD 3CHSA 4JPSA 2V5FA 2WXHA 2XRZA 2MYOA 2ZIRA 1MZCA 2VGEA 2QC9A 1IQUA 4KXKB 3IBEA 3CSTA 2XPYA 3HXDA 3FH5A 3T5VA 5CHEE 1ELWA 3CHQA 4AOFA 1SZAA 1S64A 1RZ4A 3B13A 2DYRE 5AQ7A 3Q75A 4KZ0A 3T8MA 2V4HC 1JCQA 3FU3A 3CVVA 4B89A 4HI9A 4XI0A 3UI2A 3UINC 3NOCD 3DPYA 5HKPA 3KEZA 5LFAA 4OVVA 3TWSA 4G8KA 4L7TA 4UUCA 1DCQA 1SZ9A 2IFUA 4U8HA 4CYMD 5BXOA 1NA0A 1OT8A 4I9EA 2AVPA 5JMND 2WXNA 5FQ6A 1EPUA 2WPVA 3PZDA 3S2AA 4LUNU 3EHNA 4LERA 4DX7D 3FTZA 4LSZE 5HI7A 3HRAA 4I2WA 5D0QD 2VQ2A 4GTQA 3RSEG 3CHOA 2AJAA 4ANUA 2PQRA 2KC7A 4KVOA 5JJTA 4AVXA 2VTBB 3L13A 3EHRA 5A7DB 2WXRA 3FP3A 3SFZA 5KJNA 4PS8A 3VTYA 3T8KA 1HG5A 5DIZA 4JW1A 3BG0B 3FY4A 2PM7A 3G2VA 3DSTA 3HDXA 3VLEA 3G2SA 3JXJA 2I1KA 3D9KA 1IKND 4I1MA 1HG2A 2X6IA 1WAO1 5HRYA 3UPVA 5G55A 2Q7FA 5B3SE 2IJGX 1OWNA 2IOSA 4Y6WA 4HORA 4DX2A 3RAUA 4F53A 2P9PG 4WWOA 2AXZA 2R17C 3ONLA 4KT6B 3FUKA 2L9BA 4DLOA 1FT2A 1LTXA 3MJWA 3Q79A 4CT4A 1TEZA 4B8AA 2J07A 4GPMA 4KMOA 2VYIA 3O48A 3FUMA 2L6JA 1TJFA 3SNXA 2ZXWE 3LS8A 1WY6A 4G25A 2WXGA 1S70B 3E30A 2P2CP 3Q9UC 1OWPA 3FUNA 3ZU7B 2RD0A 4DI4A 2YNQA 4YDWA 3UQ3A 3S7FA 3W9GA 3QKYA 3V2OA 4AXHA 3AU5A 3V31A 3D9NA 2H6HA 4B93B 3UM2A 2QY7A 1DNPA 3ZHEA 4G8LA 4HNAD 4AEZC 4B0ZA 2IEJA 4EBAG 4UWGA 2XHEA 4A1SA 2VGXA 3G2TA 2WXLA 4HQDA 2XPIA 3S7JA 3SHFA 3L9TA 3KAEA 3NZUA 4WNDA 1WDYA 2WXMA 2X38A 2HO1A 3HXEA 4OAVB 3CVPA 2UY1A 2IY0C 3UKRG 4OYSA 2KZTA 1X81A 2KCKA 1N4SA 3CVNA 3AS5A 1JWFA 5ARFA 3CIAA 3FEXA 2RKKA 4LNGA 5ENSD 5CEAA 1FPPA 4CGWA 3TWXA 2J4BA 1AP7A 3C5RA 4DI3A 2MOWA 4WWNA 4APOA 3JYSA 4G2VA 3MKQB 3NB2A 3ZW3A 1D8EA 4BTBA 4PH4B 3CR3A 1H6KA 4GZDA 4KVMA 5KJLA 4DRXE 1JCSA 3ULQA 5LP0A 1L5JA 5KCMA 2RG8A 4GZ3A 3RRUA 4GZ6A 2YHEA 3GZ1A 2DVWA 1Z6TA 3EIJA 2XENA 5G04C 3JQ0A 2XCBA 3RO2A 3CHPA 1G3NB 3E33A 1N54A 2H6FA 3SFYA 4ME2A 1NA3A 2F0YA 4N5QA 5LOZA 2HR2A 5JA4D 2BKKB 2I1JA 1HXIA 5AQ9A 2CFUA 2XGOA 3Q49B 3AS4A 4UI9C 4I1OB 2AXVA 5ENTD 2XZDG 1E7VA 3SO8A 3ASGA 3KSQA 4AJWA 3LYAA 3BEEA 2H6GA 4HOQA 4AY6A 2VGXB 2OEWA 4P29A 3QWVA 4XI9A 2XEHA 1V55E 2WMOA 4X8QA 4JC8A 2NSZA 3BU8A 2YQ8A 4M7CA 5ANRA 4BESA 3O4ZA 1QBQA 4YNDA 4N3CA 4FC8A 4N2SA 3URZA 2X6HA 1JUQA 4CRWA 2XQ0A 2KZTB 1JWGA 3UM1A 4G26A 3DPDA 3G2WA 3S7DA 1HFAA 3FWVA 4ATZD 2LSUA 4K5CA 2FO7A 3D9MA 4RQIA 5J08A 3CVWA 4F1SA 5KBAA 1GW6A 4URKA 1QYMA 4XEIG 4LCTA 3PZ2A 4BETA 4K0RA 5CMWA 2R5SA 4UWFA 3S7BA 5AARA 4HS2A 1MQSA 3VLDA 2ZISA 3IKOB 3UT4A 3AG3E 5CEDB 4HOUA 2X6FA 4L23A 5ENNA 4PS7A 4ACKA 4ZHBA 3D9HA 1XNFA 3NOGD 2VSOE 4NURA 3CEQA 4U0UA 3RK6A 4TUUA 2LSVA 2GRLA 5FINA 5KNHD 4EZLA 2B0OE 3SY2A 1IXVA 4HRLA 4H7YA 2DZNA 2YINA 2I6HA 2AW6A 3ZYQA 2GRNB 4G23A 4DX5D 3LDZA 5KNGA 3FUIA 4J6IA 1FT1A 3SGHA 1E90A 1Z3YA 4LG6A 3ML8A 1Y8MA 1UJKA 5C1DA 3ASHA 3CK8A 3NF1A 2P9KG 2WXFA 3CHRA 4TV3A 3CQCB 5FZQA 2R2LA 2KCVA 1E8XA 2FO1E 3CHMA 4BEPA 1S0PA 1OCRE 2J4DA 1OWMA 1BI7B 2OEVA 1P5QA 4DLQA 3ZNGA 3LY9A 3UKUG 3TL5A 5BV0A 4RG6A 2XZTG 2ETAA 4O60A 3QK0A 3PEUB 1NZNA 4GCNA 2NXPA 4OVUA 2QZAA 2M63A 2WQHA 4XKBA 4Q69A 2AWIA 4FLBA 4HLLA 3MEKA 4FLHA 3E34A 5JHBA 4A1GA 1BD8A 4WNEA 2GRMA 4GTSA 2CG2A 2CHWA 4FULA 3HXFA 5G2NA 4KBQA 4ANVA 3IHYA 4GMRA 3RIBA 5ANLA 5BW8C 1TNOA 3L22A 4C0MA 3UIOC 3ZHEB 3QJZA 4PUCA 4UQZA 3FEYA 4EPZA 3FTYA 1U3DA 5G04J 3JUIA 2P9UG 4R7LA 3DSWA 5J90A 3LY7A 2E0IA 4JHKA 3AAAC 3Q78A 4GTRA 3DRAA 3FTWA 3RRNB 2WQ6A 3APCA 3TG4A 3FTXA 4JL0A 5CRVA 3TWWA 3ZGQA 3C72A 4EQFA 5FWQA 3QARA 3I5PA 1MJ0A 4XZ4A 1UJJA 1N9AA 4HRNA 3V79K 1B89A 4CDMA 5ENPD 1FVFA 3ABKE 3HVEB 3IV0A 1A5EA 5JJ6A 4GYYA 2KCLA 2V4LA 2GRPB 3MGBA 3TG5A 5JJ7A 2P9NG 2C0LA 4I1AA 3R9MA 3VLFA 3EIQC 1O5MA 5T3RA 3SBTB 5BV1A 2PZIA 4AM9A 2OVFA 3MZLB 4MRUA 2VSNA 2L0TB 3CLJA 4B94A 3MCXA 4V3IA 1N95A 5CCLA 3UUXA 2DCPA 3JCKC 2EIJE 3LKUA 4J8DA 4BSZB 2MHKA 3E37A 2FF4A 4W9RA 3PZ4A 3QNKA 4GMLA 4XE0A 1IYGA 1ELRA 3P1UA 5FZRA 1MX2A 4LNBA 5FQ7A 4FU3A 4ATGA 3NQPA 5BNWA 2LXMA 2QYUA 4NIKA 2A5EA 4U7EB 4F7AA 4BERA 1YA0A 4HB5A 2WB2A 2P9IG 4L1BA 4JEHA 3F6QA 3SQVA 3EU9A 5CECB 3TAXA 3HG0D 1MYOA 4GCOA 3SBSA 4TRQA 5CCMA 1ZBPA 3CVUA 5G05J 3I4GA 1MX4A 2E2EA 1NFIE 2Y4TA 1N4PA 3IEGA 4I6JA 2DIWA 4EZJA 4L2LA 3D9IA 4AIFA 1WM5A 1WG0A 3G2UA 2EINE 2BUGA 1PC2A 1KLXA 3QC1A 4GA2A 3MV3B 4J8YA 1YCSB 2GGFA 3OXGA 5AQAA 3ASDA 4ILIA 4M3OA 1DC2A 2VGYA 1HU3A 2P58C 2QFCA 4JXTA 1Q2ZA 1QQEA 4FHKA 5FIOA 3PE4A 1E8WA 3UIPC 3FU6A 4N5CA 3L6AA 2KBXA 1S63A 3V30A 1OUVA 2LXLA 4KYOB 2WXJA 3ULEG 2XGSA 5AYWD 3TWTA 5CMYA 3FUDA 2EILE 4A55A 4RVBA 1KT0A 5FQ8A 3ZXSA 3PNTB 2DBAA 3AS8A 2A4ZA 3HYMB 4GYWA 3LXUX 3OXLA 2XEVA 3MYVA 3TJPA 3LJNA 3DWLG 5EIDA 4GTPA 2CG3A 1HH8A 1LF8A 1KZPA 4ILHB 3VTXA 4C0EA 1YYHA 1H6OA 4GAAA 2ILRA 2WXIA 1TJCA 3I3NA 1NP7A 1W3BA 3EHQA 5LX8A 4ABNA 4CDRA 3UMVA 4U04A 3FH8A 4DJAA 3KD7A 4DK5A 4BX9A 5AIJA 4WNGA 3ZIMA 2H6IA 3LVQE 2J49A 4MLPA 3CK7A 1SA5A 2ONDA 5FT9A 4U63A 3AG2E 3WXXA 1N0QA 1HS6A 2PQNA 1IQRA 4JB8P 4O1PA 4ANXA 2WMNA 4WAFA 3Q73A 1N4QA 2LAIA 2FEZA 4RG9A 3FHEA 2J08A 3DSXA 2J8SD 4A63B 4HXIA 4JZYA 3LVRE 3Q7FA 3TWUA 1LD8A 4GMJA 5BT1A 3PUJA 1TNZA 3ESKA 3ZYKA 3EU5A 2R02A 1PY1A 4G1TA 3SI5A 2V0PA 3EHMA 5E76A 3EDTB 3D9LA 1BPOA 1ZU2A 1UG3A 2MRIA 1ZB1A 1KPSB 3PH0C 2WXOA 1V54E 4BY6A 3B7RL 3RJVA 2XCCA 3ZEFA 3HVEA 2JEKA 2LO6A 4U0ZA 3CVYA 3UM3A 4UWKA 4DX1A 1OCZE 3L82A 4HFGA 3PUKA 3CK9A 4NQ0A 5C2YA 1O1SA 1E7UA 5EDSA 5H7PA 4XKCA 3ABLE 3MV2B 3AG4E 3RU0A 1QNFA
chains in the Genus database with same CATH topology
2EIJE 2EIME 5B1AE 2DYRE 1V55E 1OCZE 3AG3E 3ABME 2EIKE 3ASNE 1OCCE 2EILE 3X2QE 5B3SE 2OCCE 5B1BE 5IY5E 1OCOE 3WG7E 1V54E 2ZXWE 3AG2E 2DYSE 2EINE 3ABLE 1OCRE 3AG1E 3AG4E 2Y69E 3ABKE 3ASOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIJ E;  2EIM E;  5B1A E;  2DYR E;  1V55 E;  1OCZ E;  3AG3 E;  3ABM E;  2EIK E;  3ASN E;  1OCC E;  2EIL E;  3X2Q E;  5B3S E;  2OCC E;  5B1B E;  5IY5 E;  1OCO E;  3WG7 E;  1V54 E;  2ZXW E;  3AG2 E;  2DYS E;  2EIN E;  3ABL E;  1OCR E;  3AG1 E;  3AG4 E;  2Y69 E;  3ABK E;  3ASO E; 
#chains in the Genus database with same CATH topology
 2VJ8 A;  3FTS A;  4CCA A;  1H0A A;  1VDY A;  3QB2 A;  5AEN A;  2ION A;  3E4B A;  4DUI A;  3I4R B;  4UI9 K;  3GW4 A;  4GU5 A;  3FU0 A;  2WM9 A;  1SA4 A;  4AY5 A;  3C98 A;  2ETB A;  2WQ7 A;  4PDX A;  3D9P A;  4U95 D;  1U3C A;  2NC9 A;  5FJY A;  3JUE A;  3GZS A;  1INZ A;  2A5U A;  3MX3 A;  3U9W A;  4RLY A;  4BFR A;  4HI8 A;  3P2B A;  5AJL A;  3D3M A;  2P9S G;  4AP2 A;  4L2Y A;  3LCA A;  1K8K G;  4J8S A;  1N4R A;  2C2L A;  2P9L G;  1OWL A;  1FCH A;  3UTM A;  4I17 A;  4GA1 A;  3ZKJ A;  2BF0 X;  3HIZ A;  2JAB A;  3KSL A;  1HF8 A;  3PRE A;  1D8D A;  2KM4 A;  2FUL A;  3Q7A A;  1BLX B;  1KZO A;  5BXU A;  4GYO A;  2OV8 A;  1H19 A;  1Z5S C;  2XGM A;  3SD5 A;  4EHM A;  1TNY A;  1XGW A;  3X2Q E;  1HE8 A;  3PZ1 A;  2HM8 A;  4TXQ A;  3OXF A;  2YHC A;  3QAQ A;  3Q4A B;  4U8V D;  3UXG A;  4ZFH A;  3PDN A;  3ZYL A;  1DCE A;  4TUM A;  3L54 A;  5JHA A;  3CQG B;  2HE0 A;  2CFZ A;  1KT1 A;  2CHZ A;  5T4Y A;  3C3Q A;  3DSU A;  4HBD A;  2R59 A;  1RW2 A;  3QWW A;  1HZ4 A;  2CHX A;  4N2Q A;  3FU5 A;  2IO3 C;  1DVP A;  4GPK A;  4DX6 D;  5G05 C;  1EDU A;  5D2M C;  2WXQ A;  4BSX A;  4C9B B;  4CZ2 D;  3Q47 B;  5CBO A;  2BTD A;  2IF4 A;  3J5P A;  4GTM A;  3LY8 A;  5D66 A;  4C48 B;  1BI8 B;  3QDN A;  3B7T A;  4G24 A;  1PAQ A;  1IHB A;  2XRY A;  2DYS E;  3FUL A;  3Q9N C;  2F37 A;  3UT8 A;  1FVH A;  4N39 A;  1Y6I A;  4L9P A;  3CVQ A;  5CER B;  2PNN A;  4UI9 J;  5ITZ F;  1UN9 A;  4Q94 A;  2J09 A;  1EYH A;  1NI1 A;  3KS2 A;  3T5X A;  3EUV A;  2IU1 A;  4O6F A;  3ONK A;  5HQ8 A;  3TGO A;  1A17 A;  1QZ2 A;  1TYQ G;  3HXC A;  2GRQ B;  4UWL A;  3CSF A;  4IUL A;  4LEU A;  2Y3A A;  3MA5 A;  4JD2 G;  5KWD A;  3ZVV A;  2R03 A;  2EIK E;  3FUF A;  3L17 A;  2ZGD A;  3T9K A;  3U66 A;  2ZGG A;  1E8Y A;  3LJ3 A;  2RFA A;  3LPZ A;  5LCW J;  4YDO A;  4F3V A;  4OAU C;  1Z3X A;  2KAT A;  3R7Q A;  3ZXP A;  1NL4 A;  5AAO A;  4PS3 A;  5M72 A;  3PE3 A;  4I6G A;  3B7S A;  4ACL A;  4WUY A;  2WXK A;  4RSY A;  4Y6C A;  2Y69 E;  1O1R A;  3J5Q B;  4EEC A;  4ANW A;  4GTO A;  2RFM A;  3ULY A;  1TN6 A;  2IQC A;  3TXN A;  1OCC E;  4IYP A;  5ENR D;  3FUE A;  2V8S E;  4U96 D;  3E32 A;  3TWV A;  2F8Y A;  4B8C B;  4QQI A;  2Y0B G;  5E75 A;  4TXR A;  3K9I A;  4UQY A;  2X6K A;  3ASO E;  2GW1 A;  4F6R D;  2XS8 A;  5BPP A;  5EN5 D;  3PVL A;  4HLE A;  3R7R A;  4H7X A;  5FZS A;  5D0O D;  4FHJ A;  4FA6 A;  1OXJ A;  2LAH A;  4J0U A;  3OAW A;  4BWR A;  2DWZ A;  4E6H A;  2VSY A;  2Y1L E;  4HOS A;  3Q15 A;  3NAW A;  2J9Q A;  5BUZ A;  3CV0 A;  4ILG A;  3D9J A;  2NYJ A;  4JA7 A;  3BG1 B;  3UX4 A;  3CVL A;  4A3T A;  4EBA A;  3QWP A;  2Y4U A;  4CT0 A;  3U3W A;  1JCR A;  3FFL A;  3SF4 A;  1OCO E;  4K5B A;  4FJZ A;  3PS6 A;  5FQ4 A;  3AJI A;  4N3B A;  4MKT A;  4J8F A;  3ZN3 A;  1O1T A;  3PNL B;  5AQB A;  2KXP C;  1H2U A;  2OCC E;  1OY3 D;  2XS1 A;  4D10 C;  3B95 A;  1N52 A;  1HX8 A;  4GTT A;  4LRZ A;  3EJN A;  2UWJ G;  4U07 A;  5HS0 A;  2VTB A;  4EZK A;  1K3Z D;  2ZU6 B;  3V2X A;  3ZFW A;  4UQX A;  3Q5M A;  1JPL A;  3IXE A;  4GZC A;  2UY1 B;  2WXP A;  3MKR A;  4N3A A;  5CBN A;  1E8Z A;  4GB9 A;  5EYL A;  2XPZ A;  4F1P A;  1K1B A;  2OOE A;  4WNF A;  3ZPJ A;  3PRZ A;  1N94 A;  5EIB E;  2EIM E;  3DBS A;  4JEU A;  1OWO A;  2AXU A;  5EYP F;  2DZO A;  1U2V G;  5B1B E;  4J8E A;  3NBN B;  2FI7 A;  2L6B A;  4FP7 A;  3FDH A;  4NRH B;  1ELK A;  3ENE A;  2IO2 C;  3SFX A;  1TN8 A;  3CGH A;  2WVI A;  5AN8 A;  4XX5 A;  4MBG A;  4JHR A;  4HRM B;  2ETC A;  5CRU A;  4IRU A;  5LCW C;  4HVB A;  1HO8 A;  3KEA A;  5IY5 E;  3B7B A;  1SW6 A;  4DPR A;  5T8I A;  3AG1 E;  1BU9 A;  4YDY A;  5DBK A;  4YVO A;  1N0R A;  5EX0 A;  2VSX E;  3FTV A;  1X5B A;  3L08 A;  5EX3 A;  2EQX A;  3FH7 A;  3JXI A;  5EIL A;  4BX8 A;  2XEE A;  2OVB A;  3L16 A;  4U0S A;  4GA0 A;  2PL2 A;  3C3R A;  5KJM A;  4U8Y D;  1K1A A;  2X3M A;  4I6E A;  3UM0 A;  5B1A E;  4TXP A;  4I2Z A;  3AU4 A;  2GRR B;  2B6C A;  3U4T A;  4KZC A;  2LUH A;  3DEP A;  4J7W A;  4CEM A;  1TNB A;  4UWH A;  1UN8 A;  4APF A;  3TWR A;  3PZ3 A;  3ML9 A;  5KJK A;  4WWP A;  3GZ2 A;  4CGV A;  3FUH A;  1UOH A;  4XIF A;  4BT8 A;  3APF A;  5A23 A;  1YMP A;  3C3O A;  3U64 A;  3RKV A;  3DXM G;  1EF1 C;  1H2T C;  3ESL A;  3QOU A;  4JVS A;  4O1O A;  3BQO A;  3HHM A;  4BTA A;  1LD7 A;  2I2O A;  2GRO B;  3RRM B;  4BT9 A;  3UT7 A;  4AV7 A;  4G11 A;  2JLB A;  3DXK G;  3N71 A;  1IHG A;  3ABM E;  4FJY A;  3ASN E;  4K5A B;  3CKC A;  4GZ5 A;  5ENO D;  5FTP A;  1TNU A;  3MKQ A;  3B7U X;  4A3V A;  3TWQ A;  3FTU A;  4JA9 A;  1TN7 A;  2C0M A;  4JHJ A;  5AJD A;  2BED A;  3W9F A;  4Q96 A;  1SVX A;  4MS6 A;  4YDE A;  4IN3 B;  5ENQ D;  4CDN A;  3SZ7 A;  1AWC B;  5ARG A;  3OTN A;  3ZUV B;  3RO3 A;  3GYZ A;  3CKB A;  3CVX A;  3R9A B;  1SQM A;  3LEW A;  1D9S A;  4E85 A;  3NZS A;  3APD A;  4GTV A;  5A6C A;  2IOL A;  4FAD A;  3DEO A;  3HXB A;  3ZYM A;  3TXM A;  2QYJ A;  3ASF A;  2PM6 A;  4K03 A;  2V5Q C;  1H6P A;  1UW4 B;  3DSV A;  3PEV B;  4QFV A;  2L0I A;  3ISM C;  3WG7 E;  2HYZ A;  4I9C A;  1N11 A;  1H2V C;  1MX6 A;  2FBN A;  5EKQ D;  1MHQ A;  3JQ1 A;  2X6J A;  1TR4 A;  3D9O A;  4Z68 A;  4NAC A;  2R05 A;  2F8X K;  2I9C A;  3FUJ A;  4YVQ C;  2BKG A;  3ZRH A;  4HOT A;  3BUA A;  3DSS A;  3IHV A;  2LNI A;  4I43 A;  1E96 B;  4LNU D;  3CHS A;  4JPS A;  2V5F A;  2WXH A;  2XRZ A;  2MYO A;  2ZIR A;  1MZC A;  2VGE A;  2QC9 A;  1IQU A;  4KXK B;  3IBE A;  3CST A;  2XPY A;  3HXD A;  3FH5 A;  3T5V A;  5CHE E;  1ELW A;  3CHQ A;  4AOF A;  1SZA A;  1S64 A;  1RZ4 A;  3B13 A;  2DYR E;  5AQ7 A;  3Q75 A;  4KZ0 A;  3T8M A;  2V4H C;  1JCQ A;  3FU3 A;  3CVV A;  4B89 A;  4HI9 A;  4XI0 A;  3UI2 A;  3UIN C;  3NOC D;  3DPY A;  5HKP A;  3KEZ A;  5LFA A;  4OVV A;  3TWS A;  4G8K A;  4L7T A;  4UUC A;  1DCQ A;  1SZ9 A;  2IFU A;  4U8H A;  4CYM D;  5BXO A;  1NA0 A;  1OT8 A;  4I9E A;  2AVP A;  5JMN D;  2WXN A;  5FQ6 A;  1EPU A;  2WPV A;  3PZD A;  3S2A A;  4LUN U;  3EHN A;  4LER A;  4DX7 D;  3FTZ A;  4LSZ E;  5HI7 A;  3HRA A;  4I2W A;  5D0Q D;  2VQ2 A;  4GTQ A;  3RSE G;  3CHO A;  2AJA A;  4ANU A;  2PQR A;  2KC7 A;  4KVO A;  5JJT A;  4AVX A;  2VTB B;  3L13 A;  3EHR A;  5A7D B;  2WXR A;  3FP3 A;  3SFZ A;  5KJN A;  4PS8 A;  3VTY A;  3T8K A;  1HG5 A;  5DIZ A;  4JW1 A;  3BG0 B;  3FY4 A;  2PM7 A;  3G2V A;  3DST A;  3HDX A;  3VLE A;  3G2S A;  3JXJ A;  2I1K A;  3D9K A;  1IKN D;  4I1M A;  1HG2 A;  2X6I A;  1WAO 1;  5HRY A;  3UPV A;  5G55 A;  2Q7F A;  5B3S E;  2IJG X;  1OWN A;  2IOS A;  4Y6W A;  4HOR A;  4DX2 A;  3RAU A;  4F53 A;  2P9P G;  4WWO A;  2AXZ A;  2R17 C;  3ONL A;  4KT6 B;  3FUK A;  2L9B A;  4DLO A;  1FT2 A;  1LTX A;  3MJW A;  3Q79 A;  4CT4 A;  1TEZ A;  4B8A A;  2J07 A;  4GPM A;  4KMO A;  2VYI A;  3O48 A;  3FUM A;  2L6J A;  1TJF A;  3SNX A;  2ZXW E;  3LS8 A;  1WY6 A;  4G25 A;  2WXG A;  1S70 B;  3E30 A;  2P2C P;  3Q9U C;  1OWP A;  3FUN A;  3ZU7 B;  2RD0 A;  4DI4 A;  2YNQ A;  4YDW A;  3UQ3 A;  3S7F A;  3W9G A;  3QKY A;  3V2O A;  4AXH A;  3AU5 A;  3V31 A;  3D9N A;  2H6H A;  4B93 B;  3UM2 A;  2QY7 A;  1DNP A;  3ZHE A;  4G8L A;  4HNA D;  4AEZ C;  4B0Z A;  2IEJ A;  4EBA G;  4UWG A;  2XHE A;  4A1S A;  2VGX A;  3G2T A;  2WXL A;  4HQD A;  2XPI A;  3S7J A;  3SHF A;  3L9T A;  3KAE A;  3NZU A;  4WND A;  1WDY A;  2WXM A;  2X38 A;  2HO1 A;  3HXE A;  4OAV B;  3CVP A;  2UY1 A;  2IY0 C;  3UKR G;  4OYS A;  2KZT A;  1X81 A;  2KCK A;  1N4S A;  3CVN A;  3AS5 A;  1JWF A;  5ARF A;  3CIA A;  3FEX A;  2RKK A;  4LNG A;  5ENS D;  5CEA A;  1FPP A;  4CGW A;  3TWX A;  2J4B A;  1AP7 A;  3C5R A;  4DI3 A;  2MOW A;  4WWN A;  4APO A;  3JYS A;  4G2V A;  3MKQ B;  3NB2 A;  3ZW3 A;  1D8E A;  4BTB A;  4PH4 B;  3CR3 A;  1H6K A;  4GZD A;  4KVM A;  5KJL A;  4DRX E;  1JCS A;  3ULQ A;  5LP0 A;  1L5J A;  5KCM A;  2RG8 A;  4GZ3 A;  3RRU A;  4GZ6 A;  2YHE A;  3GZ1 A;  2DVW A;  1Z6T A;  3EIJ A;  2XEN A;  5G04 C;  3JQ0 A;  2XCB A;  3RO2 A;  3CHP A;  1G3N B;  3E33 A;  1N54 A;  2H6F A;  3SFY A;  4ME2 A;  1NA3 A;  2F0Y A;  4N5Q A;  5LOZ A;  2HR2 A;  5JA4 D;  2BKK B;  2I1J A;  1HXI A;  5AQ9 A;  2CFU A;  2XGO A;  3Q49 B;  3AS4 A;  4UI9 C;  4I1O B;  2AXV A;  5ENT D;  2XZD G;  1E7V A;  3SO8 A;  3ASG A;  3KSQ A;  4AJW A;  3LYA A;  3BEE A;  2H6G A;  4HOQ A;  4AY6 A;  2VGX B;  2OEW A;  4P29 A;  3QWV A;  4XI9 A;  2XEH A;  1V55 E;  2WMO A;  4X8Q A;  4JC8 A;  2NSZ A;  3BU8 A;  2YQ8 A;  4M7C A;  5ANR A;  4BES A;  3O4Z A;  1QBQ A;  4YND A;  4N3C A;  4FC8 A;  4N2S A;  3URZ A;  2X6H A;  1JUQ A;  4CRW A;  2XQ0 A;  2KZT B;  1JWG A;  3UM1 A;  4G26 A;  3DPD A;  3G2W A;  3S7D A;  1HFA A;  3FWV A;  4ATZ D;  2LSU A;  4K5C A;  2FO7 A;  3D9M A;  4RQI A;  5J08 A;  3CVW A;  4F1S A;  5KBA A;  1GW6 A;  4URK A;  1QYM A;  4XEI G;  4LCT A;  3PZ2 A;  4BET A;  4K0R A;  5CMW A;  2R5S A;  4UWF A;  3S7B A;  5AAR A;  4HS2 A;  1MQS A;  3VLD A;  2ZIS A;  3IKO B;  3UT4 A;  3AG3 E;  5CED B;  4HOU A;  2X6F A;  4L23 A;  5ENN A;  4PS7 A;  4ACK A;  4ZHB A;  3D9H A;  1XNF A;  3NOG D;  2VSO E;  4NUR A;  3CEQ A;  4U0U A;  3RK6 A;  4TUU A;  2LSV A;  2GRL A;  5FIN A;  5KNH D;  4EZL A;  2B0O E;  3SY2 A;  1IXV A;  4HRL A;  4H7Y A;  2DZN A;  2YIN A;  2I6H A;  2AW6 A;  3ZYQ A;  2GRN B;  4G23 A;  4DX5 D;  3LDZ A;  5KNG A;  3FUI A;  4J6I A;  1FT1 A;  3SGH A;  1E90 A;  1Z3Y A;  4LG6 A;  3ML8 A;  1Y8M A;  1UJK A;  5C1D A;  3ASH A;  3CK8 A;  3NF1 A;  2P9K G;  2WXF A;  3CHR A;  4TV3 A;  3CQC B;  5FZQ A;  2R2L A;  2KCV A;  1E8X A;  2FO1 E;  3CHM A;  4BEP A;  1S0P A;  1OCR E;  2J4D A;  1OWM A;  1BI7 B;  2OEV A;  1P5Q A;  4DLQ A;  3ZNG A;  3LY9 A;  3UKU G;  3TL5 A;  5BV0 A;  4RG6 A;  2XZT G;  2ETA A;  4O60 A;  3QK0 A;  3PEU B;  1NZN A;  4GCN A;  2NXP A;  4OVU A;  2QZA A;  2M63 A;  2WQH A;  4XKB A;  4Q69 A;  2AWI A;  4FLB A;  4HLL A;  3MEK A;  4FLH A;  3E34 A;  5JHB A;  4A1G A;  1BD8 A;  4WNE A;  2GRM A;  4GTS A;  2CG2 A;  2CHW A;  4FUL A;  3HXF A;  5G2N A;  4KBQ A;  4ANV A;  3IHY A;  4GMR A;  3RIB A;  5ANL A;  5BW8 C;  1TNO A;  3L22 A;  4C0M A;  3UIO C;  3ZHE B;  3QJZ A;  4PUC A;  4UQZ A;  3FEY A;  4EPZ A;  3FTY A;  1U3D A;  5G04 J;  3JUI A;  2P9U G;  4R7L A;  3DSW A;  5J90 A;  3LY7 A;  2E0I A;  4JHK A;  3AAA C;  3Q78 A;  4GTR A;  3DRA A;  3FTW A;  3RRN B;  2WQ6 A;  3APC A;  3TG4 A;  3FTX A;  4JL0 A;  5CRV A;  3TWW A;  3ZGQ A;  3C72 A;  4EQF A;  5FWQ A;  3QAR A;  3I5P A;  1MJ0 A;  4XZ4 A;  1UJJ A;  1N9A A;  4HRN A;  3V79 K;  1B89 A;  4CDM A;  5ENP D;  1FVF A;  3ABK E;  3HVE B;  3IV0 A;  1A5E A;  5JJ6 A;  4GYY A;  2KCL A;  2V4L A;  2GRP B;  3MGB A;  3TG5 A;  5JJ7 A;  2P9N G;  2C0L A;  4I1A A;  3R9M A;  3VLF A;  3EIQ C;  1O5M A;  5T3R A;  3SBT B;  5BV1 A;  2PZI A;  4AM9 A;  2OVF A;  3MZL B;  4MRU A;  2VSN A;  2L0T B;  3CLJ A;  4B94 A;  3MCX A;  4V3I A;  1N95 A;  5CCL A;  3UUX A;  2DCP A;  3JCK C;  2EIJ E;  3LKU A;  4J8D A;  4BSZ B;  2MHK A;  3E37 A;  2FF4 A;  4W9R A;  3PZ4 A;  3QNK A;  4GML A;  4XE0 A;  1IYG A;  1ELR A;  3P1U A;  5FZR A;  1MX2 A;  4LNB A;  5FQ7 A;  4FU3 A;  4ATG A;  3NQP A;  5BNW A;  2LXM A;  2QYU A;  4NIK A;  2A5E A;  4U7E B;  4F7A A;  4BER A;  1YA0 A;  4HB5 A;  2WB2 A;  2P9I G;  4L1B A;  4JEH A;  3F6Q A;  3SQV A;  3EU9 A;  5CEC B;  3TAX A;  3HG0 D;  1MYO A;  4GCO A;  3SBS A;  4TRQ A;  5CCM A;  1ZBP A;  3CVU A;  5G05 J;  3I4G A;  1MX4 A;  2E2E A;  1NFI E;  2Y4T A;  1N4P A;  3IEG A;  4I6J A;  2DIW A;  4EZJ A;  4L2L A;  3D9I A;  4AIF A;  1WM5 A;  1WG0 A;  3G2U A;  2EIN E;  2BUG A;  1PC2 A;  1KLX A;  3QC1 A;  4GA2 A;  3MV3 B;  4J8Y A;  1YCS B;  2GGF A;  3OXG A;  5AQA A;  3ASD A;  4ILI A;  4M3O A;  1DC2 A;  2VGY A;  1HU3 A;  2P58 C;  2QFC A;  4JXT A;  1Q2Z A;  1QQE A;  4FHK A;  5FIO A;  3PE4 A;  1E8W A;  3UIP C;  3FU6 A;  4N5C A;  3L6A A;  2KBX A;  1S63 A;  3V30 A;  1OUV A;  2LXL A;  4KYO B;  2WXJ A;  3ULE G;  2XGS A;  5AYW D;  3TWT A;  5CMY A;  3FUD A;  2EIL E;  4A55 A;  4RVB A;  1KT0 A;  5FQ8 A;  3ZXS A;  3PNT B;  2DBA A;  3AS8 A;  2A4Z A;  3HYM B;  4GYW A;  3LXU X;  3OXL A;  2XEV A;  3MYV A;  3TJP A;  3LJN A;  3DWL G;  5EID A;  4GTP A;  2CG3 A;  1HH8 A;  1LF8 A;  1KZP A;  4ILH B;  3VTX A;  4C0E A;  1YYH A;  1H6O A;  4GAA A;  2ILR A;  2WXI A;  1TJC A;  3I3N A;  1NP7 A;  1W3B A;  3EHQ A;  5LX8 A;  4ABN A;  4CDR A;  3UMV A;  4U04 A;  3FH8 A;  4DJA A;  3KD7 A;  4DK5 A;  4BX9 A;  5AIJ A;  4WNG A;  3ZIM A;  2H6I A;  3LVQ E;  2J49 A;  4MLP A;  3CK7 A;  1SA5 A;  2OND A;  5FT9 A;  4U63 A;  3AG2 E;  3WXX A;  1N0Q A;  1HS6 A;  2PQN A;  1IQR A;  4JB8 P;  4O1P A;  4ANX A;  2WMN A;  4WAF A;  3Q73 A;  1N4Q A;  2LAI A;  2FEZ A;  4RG9 A;  3FHE A;  2J08 A;  3DSX A;  2J8S D;  4A63 B;  4HXI A;  4JZY A;  3LVR E;  3Q7F A;  3TWU A;  1LD8 A;  4GMJ A;  5BT1 A;  3PUJ A;  1TNZ A;  3ESK A;  3ZYK A;  3EU5 A;  2R02 A;  1PY1 A;  4G1T A;  3SI5 A;  2V0P A;  3EHM A;  5E76 A;  3EDT B;  3D9L A;  1BPO A;  1ZU2 A;  1UG3 A;  2MRI A;  1ZB1 A;  1KPS B;  3PH0 C;  2WXO A;  1V54 E;  4BY6 A;  3B7R L;  3RJV A;  2XCC A;  3ZEF A;  3HVE A;  2JEK A;  2LO6 A;  4U0Z A;  3CVY A;  3UM3 A;  4UWK A;  4DX1 A;  1OCZ E;  3L82 A;  4HFG A;  3PUK A;  3CK9 A;  4NQ0 A;  5C2Y A;  1O1S A;  1E7U A;  5EDS A;  5H7P A;  4XKC A;  3ABL E;  3MV2 B;  3AG4 E;  3RU0 A;  1QNF A; 
#chains in the Genus database with same CATH homology
 2EIJ E;  2EIM E;  5B1A E;  2DYR E;  1V55 E;  1OCZ E;  3AG3 E;  3ABM E;  2EIK E;  3ASN E;  1OCC E;  2EIL E;  3X2Q E;  5B3S E;  2OCC E;  5B1B E;  5IY5 E;  1OCO E;  3WG7 E;  1V54 E;  2ZXW E;  3AG2 E;  2DYS E;  2EIN E;  3ABL E;  1OCR E;  3AG1 E;  3AG4 E;  2Y69 E;  3ABK E;  3ASO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...