3ZHEA

Structure of the c. elegans smg5-smg7 complex
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
399
structure length
399
Chain Sequence
QKSDEVTEKFKRYCNQLEKYGQTENVHSPVMAMLRRKGRKQLIEIMKRDGDCTSSINKLWIVGYYHPFQFFIRDKEKNMAIAVLLTMFCGELQEMLSLPDDKYPALWNMYIGDFHRYMPDEEIQKCLAVGYYSRAIDLDPNQGRAFHVLAGLRADLNVAQKLRLMILGQLADAPYKKGTELLEYLKFPQKESTDKLMVDFVIWALNEKSKRMDYQMTGIKIVNEFKAEIEQKLEFDWSLIMSTCRLASKLAMKKFGFQQFYNCFDTISTLYITIYSRTISSKCLLAEAISWISDSAEILGHLDEQKNEPHFQKLSVFAKTKWNELNDLVMNHINSVFTSMSLTINPSISMTSFLLNGPISEPNVEFLSQLINYLVSVEFPPMEIIHDREESGPLLRRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Unusual Arrangement of Two 14-3-3-Like Domains in the Smg5-Smg7 Heterodimer is Required for Efficient Nonsense-Mediated Mrna Decay.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Mrna-binding protein
molecule keywords NONSENSE-MEDIATED MRNA DECAY PROTEIN
total genus 133
structure length 399
sequence length 399
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zheA01
1.25.40.760 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zheA02
5CCLA 3MV2B 4WNGA 5CHEE 3KS2A 3CKBA 2LSUA 2KCLA 1ZBPA 5DBKA 4G24A 1QZ2A 4CDRA 5BNWA 3TG5A 4JA9A 3ZN3A 3CK7A 4WNEA 3R9AB 5D0QD 5BT1A 4J8DA 5FT9A 4BWRA 4ABNA 4GYOA 2VGXA 4GCOA 2IFUA 3AS4A 3CVQA 2VSNA 1ZU2A 2C0MA 5HQ8A 2LNIA 4RG9A 1IHGA 3AS8A 3UPVA 4N5CA 4N2SA 3Q47B 4G1TA 4JL0A 2OOEA 1FCHA 3LYAA 3ZHEB 2Y4UA 3ASDA 3QOUA 4O6FA 3RU0A 3ZFWA 2PZIA 3E4BA 4I2WA 3PDNA 3CK9A 5D0OD 2ONDA 5DIZA 5FZSA 5HI7A 4N2QA 3MA5A 1HXIA 3CVLA 3LKUA 3Q5MA 3ZPJA 1Y8MA 1PC2A 4W9RA 4WNDA 1KT1A 1NA0A 4AY6A 3LCAA 3MKRA 1NZNA 3FFLA 3RKVA 5CCMA 4LEUA 4UI9J 3FP3A 3K9IA 4GA0A 1KLXA 4Y6WA 4I2ZA 5EX3A 4WUYA 5EX0A 3PE4A 5EKQD 3LY7A 3S7DA 4AIFA 2Q7FA 3GZ1A 4B94A 2VYIA 4EQFA 2KATA 2FF4A 5G05J 4UQYA 2C0LA 4I1AA 3U4TA 2KCVA 3ULQA 1ELRA 2FBNA 2HYZA 2VSYA 2XEVA 3LPZA 4U0ZA 5G04J 5FTPA 5G05C 5AYWD 3ZHEA 5M72A 1IYGA 3S7BA 4H7XA 4ME2A 3GW4A 4NQ0A 4GCNA 3ASGA 1P5QA 4GYWA 3IEGA 3S7FA 3VTXA 3QWWA 3QWPA 2PQRA 4HOUA 2VGYA 4N39A 4BT8A 2KC7A 3Q4AB 3MEKA 3LY9A 3GZ2A 5LCWC 4N3AA 3KD7A 4U04A 2BUGA 1WM5A 4HOTA 2YQ8A 4UI9C 2J9QA 4KBQA 3CK8A 4CGWA 4UQXA 4JA7A 1ELWA 3RIBA 1QQEA 1W3BA 3WXXA 5KJKA 4I9CA 1HH8A 4AY5A 2PL2A 5JJ6A 4AM9A 1B89A 4HOQA 2P58C 3QDNA 2FI7A 2XCBA 2XCCA 2VQ2A 2UY1A 3KAEA 4G23A 3TAXA 4GPKA 3EDTB 5FJYA 2YHCA 3QWVA 5A7DB 3NF1A 3UQ3A 4G26A 2I6HA 2WQHA 2R5SA 2XGOA 3GYZA 5KJLA 3TG4A 5KJMA 3ASFA 3OXGA 3CEQA 4J8FA 4KXKB 3RJVA 4J8EA 4BTAA 3ESKA 4N3CA 4H7YA 4XI9A 2DBAA 4HOSA 5BW8C 3U3WA 2WPVA 3OXFA 4HORA 5FZRA 2AVPA 1YA0A 2C2LA 4U0UA 3ZGQA 4GZ6A 2XPIA 3CVPA 4XI0A 4Y6CA 1E96B 2HO1A 4F3VA 4GA1A 4CGVA 2QFCA 3O48A 4GA2A 1TJCA 2KCKA 1A17A 3RO2A 1WAO1 4APOA 3TGOA 2IF4A 4NRHB 4YVQC 4GYYA 4IN3B 3RO3A 3BEEA 4JHRA 2GW1A 1HZ4A 1NA3A 3N71A 2MHKA 3SF4A 3CV0A 4UI9K 3QKYA 3AS5A 2UY1B 2HR2A 3MV3B 5ARFA 3S7JA 4GZ3A 4YVOA 1KT0A 3CKCA 4N3BA 3VTYA 3HYMB 4BT9A 4I9EA 4BTBA 5C1DA 2LSVA 2JLBA 4U07A 4J0UA 4UQZA 3PE3A 4YNDA 3JYSA 5ARGA 3UUXA 3FWVA 2E2EA 2FEZA 3URZA 4A1SA 5LCWJ 2PQNA 2VGXB 3OXLA 2L6JA 4RG6A 4GZ5A 5JJ7A 4U0SA 5JJTA 1XNFA 4WNFA 2XGMA 3Q49B 3CVNA 4XIFA 2UWJG 2FO7A 2NC9A 3ASHA 3LY8A 2XGSA 1OUVA 2Y4TA 4G25A 2V5FA 4G2VA 4I17A 5A6CA 3Q15A 5FZQA 5KJNA 3SZ7A 5G04C 4KYOB
chains in the Genus database with same CATH superfamily
2NYJA 5E75A 3CKBA 4FJZA 2QYUA 2HE0A 4MBGA 5JHAA 4UWLA 4I1MA 4LCTA 1QYMA 3G2VA 3CK9A 1E8WA 3AG2E 4WWOA 1UOHA 3L08A 3LCAA 4I2ZA 3D3MA 4JHJA 1K1AA 4FHKA 5G05J 4JD2G 4HBDA 1DNPA 4N3AA 4GMLA 2YQ8A 3R9MA 1LD8A 1S0PA 1EF1C 4UQXA 4Q69A 3X2QE 3EIQC 5KJKA 3C3OA 4U8VD 3QDNA 2AXUA 3ZRHA 3B95A 2WQHA 3J5QB 4FADA 3TG4A 4U63A 4J8FA 1DC2A 1Y6IA 3CHQA 3SGHA 5ENSD 4PDXA 4CGVA 3CHSA 4YVQC 4A63B 3S7JA 4N3BA 4ACLA 4U07A 3C5RA 3UUXA 3AU4A 2XS8A 1TN8A 2CG3A 1HFAA 3T5VA 3ML8A 4XE0A 5AAOA 2LAIA 1MX4A 2LAHA 5CCLA 3FUHA 2WXQA 2EILE 3C72A 2WXKA 4GTPA 3B7TA 3ZNGA 1UJKA 4KZCA 4I2WA 5BV1A 1JUQA 4U7EB 1OWPA 5CEDB 4DI4A 4WUYA 4BEPA 3G2TA 3CHMA 2KATA 1TNBA 1U2VG 5M72A 2IO2C 4GCNA 4WWPA 4U96D 5LFAA 4HRNA 4LRZA 5AQBA 2GRQB 1JCQA 3JCKC 1H2UA 4GTVA 4K5AB 1BLXB 1B89A 1IHBA 1TN6A 2FI7A 2I2OA 3DSVA 1FVFA 3UQ3A 3RSEG 2WMNA 3ASOE 4C0MA 4N3CA 3CLJA 1E96B 4GA1A 3CHOA 4I6EA 2KCKA 2P9NG 4I6GA 3SHFA 2LUHA 4GYYA 2IONA 4I1OB 4UQZA 3PE3A 3Q9UC 4BY6A 2H6FA 3B7UX 2PM6A 2IU1A 2L9BA 3I4RB 5EYLA 3DSSA 3ASHA 3LY8A 1BU9A 3FULA 1E8XA 3FUJA 4CDRA 4EPZA 1HO8A 2KBXA 2VSNA 3U66A 2XEEA 4IULA 2ZXWE 4JL0A 3EHRA 4GMJA 3E4BA 4PS3A 5FZSA 5DIZA 2DYRE 3LKUA 3U9WA 4FC8A 3TJPA 4UI9J 3AJIA 3EU5A 3CHPA 3JQ1A 3APCA 3ZFWA 4U0ZA 5CMWA 1E7VA 4QQIA 3QWWA 2OVFA 2KC7A 1OXJA 4XKCA 3JXJA 4O1PA 3RIBA 4NURA 4AV7A 2L0TB 3IXEA 2GRNB 3NB2A 4GPKA 4B93B 1O1TA 3T5XA 1OCRE 5EDSA 3OXGA 2H6IA 1MX6A 3LDZA 3T8MA 2AVPA 3NOGD 3V30A 3OAWA 2ETAA 2WXLA 5KJLA 2LSVA 2P9UG 2R17C 4LG6A 2P9IG 4HRLA 2WMOA 3URZA 4LUNU 4A1SA 3OXLA 1JWFA 2UWJG 3UKUG 4TXPA 1DVPA 3ZYLA 3JUEA 2F0YA 3G2SA 1IHGA 5ITZF 1NP7A 3HIZA 4UWGA 1SZ9A 1Y8MA 3FFLA 3CVUA 4F6RD 2DZOA 3K9IA 1KLXA 3UINC 5LX8A 5FINA 1FPPA 5E76A 2EIJE 2Y1LE 4AJWA 1NI1A 1P5QA 3ABKE 3I4GA 2PQRA 1ZB1A 2EIKE 4NACA 5EYPF 1QQEA 4B89A 2XEHA 4RVBA 2P58C 3B7BA 4HOTA 5FWQA 1OCOE 3TWRA 1YYHA 2DWZA 2BKKB 3EU9A 4FA6A 3MGBA 4KXKB 3LVQE 1YCSB 3HXFA 3IKOB 3W9FA 4HLEA 4JEHA 3RO2A 5LOZA 2GW1A 3SF4A 2X3MA 5ARFA 3MKQB 1KZOA 2P9LG 5ARGA 3FWVA 4HI9A 3MCXA 2CHXA 3DRAA 4A1GA 2E0IA 5H7PA 2XGSA 1OUVA 4G8KA 1U3DA 3E32A 3PUKA 4GCOA 3ONLA 4N5CA 1WDYA 3Q47B 3E30A 2DVWA 3FTYA 2NSZA 3FY4A 3GZSA 1VDYA 2KXPC 1E8YA 5HKPA 3ZUVB 5ENQD 4L2YA 3DXMG 4GTMA 5EX3A 4OAVB 3GZ1A 1OCCE 5ENRD 5EILA 3U4TA 1ELRA 5AYWD 3ZHEA 2VSOE 4ATGA 1JCSA 1N4QA 1N4SA 1AWCB 1N0QA 1OWNA 4M7CA 4CGWA 2XENA 3MX3A 3Q79A 3PZ4A 2UY1A 3ABLE 4JHKA 4CRWA 4KZ0A 2QYJA 5FIOA 5CERB 3OTNA 3V31A 2QZAA 3D9JA 5T3RA 4B8AA 4NIKA 3VLEA 4CT4A 1EYHA 1EDUA 4GZ6A 1GW6A 3KSLA 4DX1A 5CBOA 3D9MA 2GRPB 1K8KG 4K03A 3FH8A 3PS6A 3SO8A 3V79K 4DUIA 3NBNB 5EIDA 1N52A 2A5UA 3TWVA 4RG6A 3ZYMA 3LJNA 2NC9A 2AJAA 1IQRA 4GYOA 3FEXA 4HVBA 2IO3C 2JABA 1TN7A 4BWRA 1Z3YA 2C0MA 3DSUA 3TWUA 3ZYQA 3PNLB 5HI7A 3ULYA 3ZIMA 5CEAA 1INZA 4UWHA 1BI8B 1SA4A 4LSZE 5EKQD 3R7QA 2XRYA 2FBNA 4D10C 5D66A 3QK0A 3FUNA 3UM1A 3FU0A 3MEKA 2ZISA 3FTUA 4ILIA 3KD7A 1PAQA 3QJZA 2RFMA 4GTOA 1QNFA 1SQMA 5B1BE 4DRXE 3CVVA 5A7DB 2Y3AA 3HDXA 3TXMA 4ZFHA 3AG4E 3SD5A 3FUDA 3JUIA 1D8DA 5ENNA 4U8YD 1H6OA 4EZKA 1O1RA 4TRQA 5BPPA 1TJCA 3CGHA 1S63A 3FUFA 1N94A 2MHKA 4UI9K 3IHVA 3IBEA 4N5QA 1JWGA 3S2AA 2P9SG 1EPUA 2L6JA 5AQ9A 4U0SA 3E33A 2V4HC 4HB5A 4F53A 4J7WA 5G04C 3CQCB 4EECA 4JA9A 4GAAA 3ESLA 2VGXA 3KSQA 4GU5A 1FCHA 3Q7AA 3D9NA 4ACKA 1N54A 3MKQA 5AARA 3UIPC 1OY3D 4HLLA 5KNGA 2L0IA 2J08A 3HVEA 4CCAA 3FTZA 5CCMA 2JEKA 2YINA 2VGEA 3RRUA 5BNWA 4B94A 3LY7A 1N4PA 2XHEA 4F7AA 4CT0A 2HYZA 4AVXA 3L82A 3D9PA 2AXZA 5AQAA 1Z5SC 2BUGA 5ANRA 4TXRA 5EIBE 2R03A 2XGOA 3D9HA 2WXGA 5C2YA 4O1OA 4HXIA 2EIME 2A4ZA 2WXOA 5BW8C 3OXFA 1PY1A 3ZGQA 3CVPA 1H6KA 1A17A 4BSZB 2HM8A 3AS5A 2UY1B 3MV3B 3CVXA 4UUCA 3CKCA 4TXQA 3C3QA 3ML9A 3RK6A 1NFIE 2E2EA 1IQUA 4XZ4A 3V2XA 4DLQA 4I17A 3Q15A 3NZUA 1HG5A 1E8ZA 3EHQA 3NOCD 2IOLA 1HE8A 5BT1A 1SVXA 2IFUA 3WG7E 3CVQA 1ZU2A 2IY0C 4FLHA 3T8KA 2XZTG 4G1TA 3D9OA 3UT8A 4BFRA 4OVVA 4KMOA 4WWNA 1PC2A 1MX2A 2XS1A 4AY5A 4ANUA 3MYVA 4ILHB 4EQFA 2C0LA 3FTWA 4QFVA 3ULQA 2XEVA 5G04J 4C9BB 3GW4A 1QBQA 2VGYA 4P29A 3I3NA 3DBSA 3W9GA 4AXHA 3QC1A 3RRMB 2I1KA 3P2BA 4GTSA 5JMND 4U04A 2J9QA 1IKND 4RQIA 4JA7A 3DXKG 2CFUA 2I1JA 2WM9A 1BPOA 5LCWC 5AN8A 3KAEA 2VSXE 3UT7A 5IY5E 3L13A 4FLBA 1U3CA 3KEAA 2R05A 4MLPA 1S64A 3U3WA 4M3OA 4HORA 2C2LA 5CECB 3E34A 2J4BA 4NRHB 1LTXA 2MRIA 4HI8A 3VTYA 4DK5A 4I9EA 5C1DA 3AG3E 1OWMA 4A3TA 4DX2A 1N9AA 2XGMA 1H2TC 5KJNA 3NQPA 3SZ7A 4C48B 1H19A 3ZVVA 3CK7A 2XRZA 4L1BA 5AJLA 2QY7A 2LNIA 4JW1A 3SBTB 3L22A 3EHNA 2CFZA 4O6FA 3RU0A 4E85A 2ONDA 2MOWA 3LS8A 4C0EA 5BV0A 1G3NB 1TNOA 4W9RA 3V2OA 3L54A 1HS6A 3TAXA 4AIFA 3S7DA 3PE4A 1JCRA 3PUJA 2H6HA 3S7BA 4GZDA 4ANXA 3VTXA 5CBNA 4JVSA 1H2VC 3SQVA 2LXMA 2CHWA 2J09A 4GZCA 4I6JA 2WQ7A 3SNXA 1N0RA 2F8YA 5FQ6A 3QWVA 5LP0A 2I6HA 1ELKA 4YDOA 3NZSA 5JA4D 3P1UA 5ENTD 3TWSA 4F1SA 1V54E 4XEIG 2VJ8A 2XPIA 4XI0A 4J8YA 1Z3XA 2IF4A 3Q9NC 3DSTA 3UT4A 3DPYA 1KT0A 4R7LA 5A23A 4X8QA 5LCWJ 3R7RA 4DX7D 5KNHD 2AW6A 5J08A 1RZ4A 2AXVA 5JJ6A 3DEPA 5FZQA 4MRUA 2J4DA 3QAQA 2J8SD 2P9PG 2WXFA 4OAUC 5HQ8A 4DX6D 1BI7B 4N2SA 4J8SA 1OWLA 3ZHEB 2PZIA 1KT1A 4MKTA 4JC8A 3Q73A 4TUMA 2ZIRA 3BG1B 1O5MA 3LPZA 1IYGA 4MS6A 4ANVA 3TWQA 1HU3A 4ME2A 3AU5A 5CMYA 3Q4AB 3ASNE 2GRRB 2WXHA 1W3BA 4FJYA 1HH8A 4L2LA 4JZYA 2VQ2A 3EDTB 2YHCA 4EBAA 3FTXA 4GTRA 2X6HA 3ZEFA 5KJMA 2KZTB 3ASFA 4FHJA 4GPMA 5T4YA 4BTAA 3LVRE 3TL5A 1FVHA 1D9SA 1WAO1 1AP7A 2V5QC 2RKKA 3RO3A 2GRLA 4DPRA 2NXPA 4GZ3A 5KWDA 3HYMB 3DSXA 4UWKA 5JHBA 4RLYA 2PQNA 5JJ7A 4WNFA 3CVNA 4G25A 3UI2A 3HXEA 3HG0D 4L23A 3HXDA 5DBKA 3FHEA 4CDMA 2Y0BG 4FULA 3UMVA 4Z68A 2BEDA 3IV0A 4Y6WA 4YDWA 4PH4B 1UJJA 2FF4A 2KCVA 1E90A 3TWXA 2I9CA 3G2UA 3HXCA 3ASGA 3FUEA 3LY9A 3AAAC 3ZW3A 1UG3A 2DZNA 1TJFA 4KVOA 3FUKA 4LNUD 4HQDA 3CIAA 5D2MC 3QB2A 1FT1A 4RSYA 3MJWA 3PVLA 4HOSA 4HFGA 3NAWA 3TGOA 4JPSA 4EZLA 3C98A 1MZCA 2RD0A 2WXMA 1WY6A 3VLDA 1H6PA 1KPSB 4YNDA 5B3SE 4DLOA 2VGXB 2ETCA 1HX8A 4PUCA 3SI5A 1XNFA 2Y4TA 4J6IA 1L5JA 3QNKA 5FQ8A 1DCEA 1WG0A 2KCLA 1ZBPA 3QARA 3EUVA 1IXVA 2X38A 1HG2A 4RG9A 3PREA 4ZHBA 1NL4A 2OOEA 4BSXA 3FTSA 5D0OD 4N2QA 4TV3A 3CVLA 4CZ2D 3UX4A 3J5PA 3FTVA 2Q7FA 2VYIA 3LXUX 3L9TA 4ILGA 4UQYA 1X5BA 1DCQA 5G05C 3I5PA 2DIWA 4UWFA 4H7XA 2QC9A 3GZ2A 3SFXA 2B6CA 5KBAA 2WB2A 2OEVA 2PL2A 1TNUA 1LF8A 3PZ2A 4YDYA 2IQCA 2MYOA 3HHMA 2ILRA 2RFAA 3EIJA 4EHMA 3UXGA 2ZGDA 3FEYA 3CEQA 4LNBA 3ESKA 4XI9A 1E7UA 2ZGGA 3APFA 3DEOA 2R02A 4EZJA 1MQSA 5FZRA 4E6HA 5G55A 4ANWA 3O48A 4GA2A 2KM4A 2RG8A 4IN3B 3FUIA 1NA3A 3ISMC 4DX5D 4YVOA 4BT9A 1FT2A 3CSTA 4K5BA 3LJ3A 4GZ5A 3DSWA 4XIFA 4BERA 4ATZD 4GTQA 2V5FA 4Q96A 5A6CA 2KZTA 4GB9A 4WNGA 5G2NA 5CHEE 5B1AE 3PEUB 4U8HA 1UN8A 5AQ7A 3ZN3A 2X6JA 5FT9A 5AIJA 1SW6A 2B0OE 3AS4A 2V8SE 3AS8A 2GROB 3PNTB 2LO6A 4KVMA 2V0PA 2Y4UA 3APDA 1SZAA 3BUAA 2IOSA 5FQ4A 4WNDA 2XZDG 3RRNB 2M63A 2DCPA 2WXIA 4KT6B 3D9KA 4HS2A 1Z6TA 3JQ0A 4BT8A 4HOUA 3B7RL 4AEZC 4GMRA 2PM7A 3RAUA 2CG2A 1BD8A 2WXRA 5BUZA 2EQXA 1O1SA 4Q94A 4G23A 3SFZA 4PS8A 5FJYA 2R5SA 3KEZA 4DI3A 3JXIA 4J8EA 1TYQG 2X6IA 3ABME 3FDHA 1YA0A 2WXPA 2A5EA 1K3ZD 4CEMA 2VTBB 3IHYA 3BEEA 3HRAA 4JHRA 3N71A 3CHRA 3CV0A 3UKRG 1YMPA 4J0UA 3JYSA 2GRMA 1RW2A 3B13A 2ETBA 5JJTA 2FO7A 2VTBA 3D9LA 3FU3A 3EHMA 3KS2A 2LSUA 4HNAD 3T9KA 3TG5A 3R9AB 4J8DA 4JXTA 2AWIA 3BU8A 3LEWA 2X6FA 3Q7FA 3UM0A 4DJAA 5KCMA 3G2WA 3LYAA 3ASDA 1HXIA 3AG1E 3Q5MA 1N4RA 3ZPJA 1TR4A 3MKRA 4AOFA 3PRZA 4GA0A 5EX0A 4OVUA 2BF0X 4A55A 1OWOA 4XKBA 2P9KG 2F37A 4O60A 2WVIA 3Q78A 2CHZA 4GYWA 3S7FA 4BX8A 3QWPA 4N39A 3DWLG 1MYOA 5ANLA 2P2CP 3B7SA 2X6KA 5FQ7A 4G8LA 1ELWA 1KZPA 3WXXA 4XX5A 3CVWA 2XCBA 5BXUA 1TNZA 3NF1A 3PH0C 4K5CA 2OV8A 4B0ZA 1N95A 4EBAG 3SFYA 5T8IA 3ZKJA 1X81A 2QFCA 1D8EA 4APOA 3HVEB 3TWWA 3SY2A 4JEUA 2FEZA 1Q2ZA 4TUUA 5CRUA 2GGFA 5HS0A 3ONKA 2XQ0A 3MV2B 3C3RA 2OVBA 3TWTA 1TEZA 1HF8A 4U95D 4BX9A 3VLFA 3FU6A 3MZLB 3L17A 3QOUA 3SBSA 3PDNA 1JPLA 4BESA 3DPDA 1OT8A 1NZNA 3PZ1A 2F8XK 4LEUA 4F3VA 3UM2A 1SA5A 3FUMA 5FTPA 1V55E 3CR3A 2J07A 5J90A 4FP7A 4NQ0A 1MJ0A 4BTBA 4V3IA 4IRUA 4JB8P 3U64A 4A3VA 1WM5A 4UI9C 4AP2A 3BG0B 4GTTA 3PEVB 1S70B 4APFA 4I9CA 5EN5D 4YDEA 2XCCA 3ENEA 3TXNA 2IJGX 4CDNA 3RJVA 5ENOD 4L9PA 1XGWA 2LXLA 2Y69E 4IYPA 2DYSE 4L7TA 4Y6CA 1K1BA 3ZXSA 3F6QA 2R2LA 4B8CB 3FH5A 3FU5A 3HXBA 2YNQA 3BQOA 4I43A 3L16A 3QKYA 2HR2A 3UM3A 2JLBA 4LNGA 4WAFA 3O4ZA 4HRMB 1UN9A 4FU3A 3ZXPA 4OYSA 2EINE 3CSFA 3Q49B 3UTMA 3UIOC 2OEWA 3E37A 3EJNA 3D9IA 4URKA 4G24A 1QZ2A 2V4LA 4WNEA 5D0QD 3CQGB 4ABNA 2R59A 2PNNA 2H6GA 3UPVA 4G11A 4PS7A 1H0AA 4CYMD 2WQ6A 3MA5A 3PZ3A 1NA0A 4AY6A 3RKVA 3FP3A 3ZYKA 3CVYA 4I1AA 1A5EA 2FULA 3PZDA 2VSYA 4BETA 2BKGA 3IEGA 5CRVA 1LD7A 4KBQA 3CK8A 2J49A 2YHEA 5HRYA 5BXOA 3FH7A 2OCCE 4AM9A 4HOQA 2XPZA 4G26A 3L6AA 3GYZA 5AENA 2FO1E 5ENPD 2XPYA 1UW4B 4H7YA 2DBAA 2BTDA 2WPVA 3Q75A 4U0UA 2L6BA 2HO1A 2IEJA 2WXNA 2WXJA 1TNYA 4K0RA 1N11A 1HZ4A 5AJDA 3ZU7B 2ZU6B 4F1PA 3ULEG 1OCZE 1MHQA 4G2VA 4LERA 4KYOB
chains in the Genus database with same CATH topology
5E75A 1U3DA 4WNGA 5CHEE 5G2NA 3CKBA 3PEUB 4U8HA 1H19A 1UN8A 4FJZA 3ZVVA 3ZN3A 3CK7A 2X6JA 2XRZA 4L1BA 5FT9A 5AIJA 5AJLA 3PUKA 2QY7A 4GCOA 3AS4A 3ONLA 2V8SE 2LNIA 4JW1A 4I1MA 3AS8A 3L22A 4LCTA 4UWLA 3PNTB 4N5CA 3EHNA 3Q47B 2LO6A 4KVMA 2CFZA 2V0PA 2Y4UA 4O6FA 3RU0A 4E85A 3G2VA 3CK9A 2ONDA 3APDA 1E8WA 1SZAA 2MOWA 2IOSA 2NSZA 3FTYA 3FY4A 1VDYA 3GZSA 3LS8A 5FQ4A 5BV0A 1E8YA 4WWOA 3L08A 4W9RA 4WNDA 3LCAA 3L54A 3RRNB 1HS6A 3TAXA 4L2YA 4I2ZA 5EX3A 2M63A 3D3MA 3PE4A 3S7DA 4AIFA 4JHJA 3GZ1A 3PUJA 2DCPA 4FHKA 5G05J 3U4TA 1ELRA 2WXIA 5AYWD 3ZHEA 4KT6B 2VSOE 4ATGA 3D9KA 4HS2A 3S7BA 4GZDA 4ANXA 3VTXA 4JVSA 1Z6TA 3JQ0A 4BT8A 1H2VC 3B7RL 4HOUA 2CHWA 1DNPA 4N3AA 1OWNA 4GMLA 4AEZC 2YQ8A 2PM7A 2J09A 4GZCA 1S0PA 4I6JA 2WQ7A 4CGWA 1EF1C 4UQXA 4Q69A 3SNXA 3EIQC 2CG2A 5KJKA 2WXRA 5BUZA 2EQXA 3MX3A 4Q94A 3QDNA 2AXUA 4G23A 2UY1A 3ZRHA 3SFZA 4PS8A 5FQ6A 5FJYA 3QWVA 5LP0A 4JHKA 2I6HA 1ELKA 2R5SA 2WQHA 4KZ0A 4CRWA 3KEZA 4FADA 3TG4A 4DI3A 3NZSA 4U63A 3OTNA 4J8FA 3P1UA 1Y6IA 5JHAA 4J8EA 3D9JA 2X6IA 5T3RA 4B8AA 3CHQA 3SGHA 4F1SA 3FDHA 4PDXA 3VLEA 1EYHA 1YA0A 1EDUA 2WXPA 4CT4A 2VJ8A 4GZ6A 1GW6A 2XPIA 4XI0A 3D9MA 4CGVA 4K03A 4CEMA 1Z3XA 2IF4A 3FH8A 3IHYA 3CHSA 3PS6A 4YVQC 2VTBB 3BEEA 4JHRA 3N71A 3CHRA 3UT4A 3CV0A 3S7JA 1KT0A 4N3BA 4ACLA 4R7LA 4U07A 4J0UA 1N52A 2A5UA 5A23A 3JYSA 2GRMA 3B13A 3UUXA 5LCWJ 3AU4A 3R7RA 4RG6A 3ZYMA 2CG3A 1HFAA 5JJTA 3T5VA 3ML8A 2AW6A 4XE0A 5J08A 2AXVA 2FO7A 2LAIA 2NC9A 5JJ6A 2VTBA 1IQRA 3D9LA 4GYOA 2LAHA 3FU3A 3FEXA 5FZQA 3EHMA 5CCLA 3FUHA 2WXQA 3KS2A 4HVBA 2LSUA 4MRUA 2J4DA 3TG5A 3QAQA 3R9AB 4J8DA 4JXTA 4BWRA 2AWIA 1Z3YA 2WXFA 3LEWA 2C0MA 5HQ8A 2X6FA 2WXKA 4N2SA 4J8SA 1OWLA 3B7TA 4DJAA 5KCMA 3G2WA 3LYAA 3ZYQA 3ZHEB 3ASDA 1UJKA 3PNLB 2PZIA 4KZCA 4I2WA 5BV1A 5HI7A 1JUQA 3NQPA 1OWPA 3ZIMA 1HXIA 3Q5MA 3ZPJA 1KT1A 3MKRA 4AOFA 3PRZA 4DI4A 1INZA 4GA0A 4UWHA 5EX0A 4OVUA 4WUYA 4MKTA 5EKQD 3R7QA 2BF0X 4A55A 3G2TA 4JC8A 3CHMA 2KATA 1OWOA 4XKBA 3BG1B 2XRYA 2FBNA 3LPZA 4D10C 1IYGA 4MS6A 5M72A 4ANVA 2WVIA 1HU3A 4ME2A 3AU5A 4GCNA 2CHZA 3FUNA 3QK0A 4GYWA 4WWPA 3S7FA 4BX8A 3QWPA 4N39A 5CMYA 3Q4AB 3FU0A 3MEKA 5LFAA 3FTUA 4ILIA 4LRZA 3KD7A 1PAQA 5ANLA 3B7SA 2X6KA 3QJZA 5FQ7A 2WXHA 1ELWA 3JCKC 1H2UA 1QNFA 1W3BA 1SQMA 3WXXA 4FJYA 4XX5A 1HH8A 4L2LA 4JZYA 3CVWA 1B89A 2FI7A 2XCBA 2VQ2A 2I2OA 3CVVA 3EDTB 2Y3AA 2YHCA 1FVFA 5A7DB 3FTXA 3NF1A 3UQ3A 4EBAA 3HDXA 3TXMA 3PH0C 2X6HA 2WMNA 3ZEFA 2OV8A 3SD5A 3FUDA 2KZTB 3ASFA 3JUIA 4B0ZA 4C0MA 5KJMA 4FHJA 5T4YA 5ENNA 4BTAA 4N3CA 3CLJA 4EZKA 3LVRE 4TRQA 4EBAG 5BPPA 5T8IA 3TL5A 1FVHA 1E96B 4GA1A 2QFCA 3CHOA 4I6EA 1TJCA 2KCKA 4I6GA 3SHFA 1WAO1 3CGHA 4APOA 3FUFA 3HVEB 4GYYA 3RO3A 2IONA 4I1OB 2GRLA 4DPRA 2MHKA 4JEUA 4UI9K 3IHVA 2NXPA 4GZ3A 3IBEA 3HYMB 1JWGA 4UQZA 3S2AA 3PE3A 4UWKA 5JHBA 4BY6A 2FEZA 2PQNA 1EPUA 3B7UX 2L6JA 2PM6A 4TUUA 2IU1A 5JJ7A 2GGFA 2L9BA 3I4RB 4U0SA 4WNFA 3CVNA 4G25A 3ASHA 3LY8A 4F53A 3ONKA 2XQ0A 3FULA 5G04C 1E8XA 3CQCB 3FUJA 4L23A 3MV2B 5DBKA 2OVBA 4CDRA 1TEZA 1HF8A 4EPZA 4EECA 3FHEA 1HO8A 4CDMA 4JA9A 4BX9A 3VLFA 4GAAA 3ESLA 2VGXA 4FULA 2VSNA 3UMVA 3U66A 4GU5A 4IULA 3FU6A 3MZLB 4JL0A 1FCHA 3L17A 3QOUA 3SBSA 4GMJA 3D9NA 4ACKA 3E4BA 4PS3A 1N54A 3MKQA 3PDNA 5DIZA 5FZSA 1JPLA 3DPDA 2L0IA 2J08A 3HVEA 3LKUA 3U9WA 4CCAA 3FTZA 4FC8A 5CCMA 1NZNA 3TJPA 2JEKA 2YINA 3IV0A 4LEUA 4UI9J 4Y6WA 3RRUA 4F3VA 3SBTB 5BNWA 4B94A 3CHPA 3LY7A 4PH4B 1UJJA 2XHEA 2FF4A 3JQ1A 4F7AA 4CT0A 2KCVA 3APCA 1E90A 2HYZA 3FUMA 4U0ZA 3ZFWA 5CMWA 2I9CA 1E7VA 5FTPA 3CR3A 2J07A 3G2UA 5J90A 4FP7A 4NQ0A 4BTBA 3ASGA 3FUEA 3QWWA 4AVXA 2OVFA 4V3IA 4IRUA 2KC7A 3LY9A 3D9PA 2AXZA 4XKCA 3U64A 2BUGA 1WM5A 1UG3A 4A3VA 3ZW3A 4UI9C 4AP2A 3BG0B 1TJFA 4KVOA 3FUKA 3RIBA 3PEVB 4APFA 4NURA 4I9CA 3CIAA 5ANRA 4AV7A 2L0TB 2XCCA 3ENEA 4GPKA 3TXNA 2XGOA 3QB2A 2IJGX 2WXGA 5C2YA 3T5XA 5EDSA 3OXGA 4HXIA 4RSYA 4CDNA 3RJVA 2A4ZA 3MJWA 1XGWA 2WXOA 3PVLA 4HOSA 5BW8C 3OXFA 3LDZA 4C0EA 4HFGA 2AVPA 4IYPA 3T8MA 1PY1A 3ZGQA 4L7TA 3CVPA 4Y6CA 1H6KA 3ZXSA 4B8CB 3FH5A 3FU5A 1A17A 2YNQA 3TGOA 4JPSA 3OAWA 4I43A 3C98A 4EZLA 2RD0A 2WXLA 2WXMA 2HM8A 3L16A 5KJLA 3QKYA 3AS5A 2UY1B 2HR2A 3MV3B 1WY6A 3CVXA 3VLDA 3CKCA 3ML9A 2LSVA 2JLBA 4YNDA 3RK6A 2R17C 4WAFA 3O4ZA 2E2EA 2WMOA 3URZA 1UN9A 4LUNU 3OXLA 2VGXB 4A1SA 4DLOA 4FU3A 1IQUA 4OYSA 1JWFA 1HX8A 4PUCA 3SI5A 1XNFA 3CSFA 3Q49B 4XZ4A 2UWJG 2Y4TA 4DLQA 4I17A 4J6IA 1L5JA 3Q15A 3QNKA 5FQ8A 3EJNA 3D9IA 3NZUA 4URKA 1HG5A 1E8ZA 1ZBPA 2KCLA 1QZ2A 1DVPA 2IOLA 3QARA 4G24A 1HE8A 2V4LA 3ZYLA 5BT1A 4WNEA 5D0QD 3CQGB 4ABNA 2R59A 2IFUA 3CVQA 1ZU2A 2X38A 1HG2A 1IHGA 3G2SA 4FLHA 3PREA 4G11A 4RG9A 4PS7A 3UPVA 1H0AA 4G1TA 3D9OA 2OOEA 1NP7A 3UT8A 4BFRA 4BSXA 3FTSA 3HIZA 5D0OD 4OVVA 4UWGA 2WQ6A 4N2QA 4TV3A 3MA5A 1SZ9A 4KMOA 3CVLA 4WWNA 1Y8MA 1PC2A 1NA0A 4AY6A 3RKVA 3FFLA 3CVUA 3FP3A 3K9IA 1KLXA 4AY5A 3UX4A 4ANUA 3ZYKA 3CVYA 3FTVA 2Q7FA 3MYVA 5LX8A 2VYIA 3LXUX 4ILHB 4EQFA 4ILGA 4UQYA 2C0LA 4I1AA 1X5BA 2FULA 3FTWA 3PZDA 4QFVA 3ULQA 5E76A 2VSYA 2XEVA 5G04J 5G05C 3I5PA 2DIWA 4AJWA 4C9BB 4UWFA 4H7XA 3GW4A 1P5QA 3I4GA 3IEGA 2PQRA 2VGYA 4P29A 3I3NA 3DBSA 3GZ2A 4NACA 3RRMB 3QC1A 4AXHA 2I1KA 3P2BA 4U04A 2J9QA 4KBQA 3CK8A 2J49A 2YHEA 4JA7A 1QQEA 4B89A 2WB2A 2CFUA 2I1JA 2WM9A 3FH7A 1BPOA 4RVBA 2PL2A 1LF8A 4AM9A 5LCWC 4HOQA 2IQCA 2P58C 2XPZA 3HHMA 2ILRA 3KAEA 4HOTA 3EIJA 5FWQA 2VSXE 4G26A 3L6AA 3UT7A 3GYZA 5AENA 3L13A 4FLBA 2XPYA 1U3CA 4FA6A 3FEYA 3CEQA 3MGBA 4KXKB 3LVQE 1UW4B 3ESKA 4MLPA 4H7YA 1E7UA 2DBAA 4XI9A 3APFA 2BTDA 2WPVA 4M3OA 4EZJA 1MQSA 5FZRA 3U3WA 4HORA 2C2LA 4U0UA 5G55A 4E6HA 3IKOB 2HO1A 4ANWA 4HLEA 3O48A 4GA2A 2KM4A 2RG8A 4JEHA 3RO2A 2WXNA 2J4BA 2WXJA 5LOZA 4K0RA 4NRHB 4IN3B 3FUIA 2GW1A 1HZ4A 1NA3A 3SF4A 2X3MA 5AJDA 5ARFA 2MRIA 3MKQB 4YVOA 4BT9A 3VTYA 4DK5A 4I9EA 5C1DA 2ZU6B 3CSTA 5ARGA 1OWMA 3LJ3A 3FWVA 3MCXA 4GZ5A 4A3TA 2CHXA 2XGMA 1MHQA 4XIFA 4A1GA 2E0IA 2XGSA 1OUVA 1H2TC 2V5FA 4G2VA 4Q96A 4LERA 5A6CA 5KJNA 2KZTA 3SZ7A 4GB9A 4KYOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCL A;  3MV2 B;  4WNG A;  5CHE E;  3KS2 A;  3CKB A;  2LSU A;  2KCL A;  1ZBP A;  5DBK A;  4G24 A;  1QZ2 A;  4CDR A;  5BNW A;  3TG5 A;  4JA9 A;  3ZN3 A;  3CK7 A;  4WNE A;  3R9A B;  5D0Q D;  5BT1 A;  4J8D A;  5FT9 A;  4BWR A;  4ABN A;  4GYO A;  2VGX A;  4GCO A;  2IFU A;  3AS4 A;  3CVQ A;  2VSN A;  1ZU2 A;  2C0M A;  5HQ8 A;  2LNI A;  4RG9 A;  1IHG A;  3AS8 A;  3UPV A;  4N5C A;  4N2S A;  3Q47 B;  4G1T A;  4JL0 A;  2OOE A;  1FCH A;  3LYA A;  3ZHE B;  2Y4U A;  3ASD A;  3QOU A;  4O6F A;  3RU0 A;  3ZFW A;  2PZI A;  3E4B A;  4I2W A;  3PDN A;  3CK9 A;  5D0O D;  2OND A;  5DIZ A;  5FZS A;  5HI7 A;  4N2Q A;  3MA5 A;  1HXI A;  3CVL A;  3LKU A;  3Q5M A;  3ZPJ A;  1Y8M A;  1PC2 A;  4W9R A;  4WND A;  1KT1 A;  1NA0 A;  4AY6 A;  3LCA A;  3MKR A;  1NZN A;  3FFL A;  3RKV A;  5CCM A;  4LEU A;  4UI9 J;  3FP3 A;  3K9I A;  4GA0 A;  1KLX A;  4Y6W A;  4I2Z A;  5EX3 A;  4WUY A;  5EX0 A;  3PE4 A;  5EKQ D;  3LY7 A;  3S7D A;  4AIF A;  2Q7F A;  3GZ1 A;  4B94 A;  2VYI A;  4EQF A;  2KAT A;  2FF4 A;  5G05 J;  4UQY A;  2C0L A;  4I1A A;  3U4T A;  2KCV A;  3ULQ A;  1ELR A;  2FBN A;  2HYZ A;  2VSY A;  2XEV A;  3LPZ A;  4U0Z A;  5G04 J;  5FTP A;  5G05 C;  5AYW D;  3ZHE A;  5M72 A;  1IYG A;  3S7B A;  4H7X A;  4ME2 A;  3GW4 A;  4NQ0 A;  4GCN A;  3ASG A;  1P5Q A;  4GYW A;  3IEG A;  3S7F A;  3VTX A;  3QWW A;  3QWP A;  2PQR A;  4HOU A;  2VGY A;  4N39 A;  4BT8 A;  2KC7 A;  3Q4A B;  3MEK A;  3LY9 A;  3GZ2 A;  5LCW C;  4N3A A;  3KD7 A;  4U04 A;  2BUG A;  1WM5 A;  4HOT A;  2YQ8 A;  4UI9 C;  2J9Q A;  4KBQ A;  3CK8 A;  4CGW A;  4UQX A;  4JA7 A;  1ELW A;  3RIB A;  1QQE A;  1W3B A;  3WXX A;  5KJK A;  4I9C A;  1HH8 A;  4AY5 A;  2PL2 A;  5JJ6 A;  4AM9 A;  1B89 A;  4HOQ A;  2P58 C;  3QDN A;  2FI7 A;  2XCB A;  2XCC A;  2VQ2 A;  2UY1 A;  3KAE A;  4G23 A;  3TAX A;  4GPK A;  3EDT B;  5FJY A;  2YHC A;  3QWV A;  5A7D B;  3NF1 A;  3UQ3 A;  4G26 A;  2I6H A;  2WQH A;  2R5S A;  2XGO A;  3GYZ A;  5KJL A;  3TG4 A;  5KJM A;  3ASF A;  3OXG A;  3CEQ A;  4J8F A;  4KXK B;  3RJV A;  4J8E A;  4BTA A;  3ESK A;  4N3C A;  4H7Y A;  4XI9 A;  2DBA A;  4HOS A;  5BW8 C;  3U3W A;  2WPV A;  3OXF A;  4HOR A;  5FZR A;  2AVP A;  1YA0 A;  2C2L A;  4U0U A;  3ZGQ A;  4GZ6 A;  2XPI A;  3CVP A;  4XI0 A;  4Y6C A;  1E96 B;  2HO1 A;  4F3V A;  4GA1 A;  4CGV A;  2QFC A;  3O48 A;  4GA2 A;  1TJC A;  2KCK A;  1A17 A;  3RO2 A;  1WAO 1;  4APO A;  3TGO A;  2IF4 A;  4NRH B;  4YVQ C;  4GYY A;  4IN3 B;  3RO3 A;  3BEE A;  4JHR A;  2GW1 A;  1HZ4 A;  1NA3 A;  3N71 A;  2MHK A;  3SF4 A;  3CV0 A;  4UI9 K;  3QKY A;  3AS5 A;  2UY1 B;  2HR2 A;  3MV3 B;  5ARF A;  3S7J A;  4GZ3 A;  4YVO A;  1KT0 A;  3CKC A;  4N3B A;  3VTY A;  3HYM B;  4BT9 A;  4I9E A;  4BTB A;  5C1D A;  2LSV A;  2JLB A;  4U07 A;  4J0U A;  4UQZ A;  3PE3 A;  4YND A;  3JYS A;  5ARG A;  3UUX A;  3FWV A;  2E2E A;  2FEZ A;  3URZ A;  4A1S A;  5LCW J;  2PQN A;  2VGX B;  3OXL A;  2L6J A;  4RG6 A;  4GZ5 A;  5JJ7 A;  4U0S A;  5JJT A;  1XNF A;  4WNF A;  2XGM A;  3Q49 B;  3CVN A;  4XIF A;  2UWJ G;  2FO7 A;  2NC9 A;  3ASH A;  3LY8 A;  2XGS A;  1OUV A;  2Y4T A;  4G25 A;  2V5F A;  4G2V A;  4I17 A;  5A6C A;  3Q15 A;  5FZQ A;  5KJN A;  3SZ7 A;  5G04 C;  4KYO B; 
#chains in the Genus database with same CATH topology
 2NYJ A;  5E75 A;  3CKB A;  4FJZ A;  2QYU A;  2HE0 A;  4MBG A;  5JHA A;  4UWL A;  4I1M A;  4LCT A;  1QYM A;  3G2V A;  3CK9 A;  1E8W A;  3AG2 E;  4WWO A;  1UOH A;  3L08 A;  3LCA A;  4I2Z A;  3D3M A;  4JHJ A;  1K1A A;  4FHK A;  5G05 J;  4JD2 G;  4HBD A;  1DNP A;  4N3A A;  4GML A;  2YQ8 A;  3R9M A;  1LD8 A;  1S0P A;  1EF1 C;  4UQX A;  4Q69 A;  3X2Q E;  3EIQ C;  5KJK A;  3C3O A;  4U8V D;  3QDN A;  2AXU A;  3ZRH A;  3B95 A;  2WQH A;  3J5Q B;  4FAD A;  3TG4 A;  4U63 A;  4J8F A;  1DC2 A;  1Y6I A;  3CHQ A;  3SGH A;  5ENS D;  4PDX A;  4CGV A;  3CHS A;  4YVQ C;  4A63 B;  3S7J A;  4N3B A;  4ACL A;  4U07 A;  3C5R A;  3UUX A;  3AU4 A;  2XS8 A;  1TN8 A;  2CG3 A;  1HFA A;  3T5V A;  3ML8 A;  4XE0 A;  5AAO A;  2LAI A;  1MX4 A;  2LAH A;  5CCL A;  3FUH A;  2WXQ A;  2EIL E;  3C72 A;  2WXK A;  4GTP A;  3B7T A;  3ZNG A;  1UJK A;  4KZC A;  4I2W A;  5BV1 A;  1JUQ A;  4U7E B;  1OWP A;  5CED B;  4DI4 A;  4WUY A;  4BEP A;  3G2T A;  3CHM A;  2KAT A;  1TNB A;  1U2V G;  5M72 A;  2IO2 C;  4GCN A;  4WWP A;  4U96 D;  5LFA A;  4HRN A;  4LRZ A;  5AQB A;  2GRQ B;  1JCQ A;  3JCK C;  1H2U A;  4GTV A;  4K5A B;  1BLX B;  1B89 A;  1IHB A;  1TN6 A;  2FI7 A;  2I2O A;  3DSV A;  1FVF A;  3UQ3 A;  3RSE G;  2WMN A;  3ASO E;  4C0M A;  4N3C A;  3CLJ A;  1E96 B;  4GA1 A;  3CHO A;  4I6E A;  2KCK A;  2P9N G;  4I6G A;  3SHF A;  2LUH A;  4GYY A;  2ION A;  4I1O B;  4UQZ A;  3PE3 A;  3Q9U C;  4BY6 A;  2H6F A;  3B7U X;  2PM6 A;  2IU1 A;  2L9B A;  3I4R B;  5EYL A;  3DSS A;  3ASH A;  3LY8 A;  1BU9 A;  3FUL A;  1E8X A;  3FUJ A;  4CDR A;  4EPZ A;  1HO8 A;  2KBX A;  2VSN A;  3U66 A;  2XEE A;  4IUL A;  2ZXW E;  4JL0 A;  3EHR A;  4GMJ A;  3E4B A;  4PS3 A;  5FZS A;  5DIZ A;  2DYR E;  3LKU A;  3U9W A;  4FC8 A;  3TJP A;  4UI9 J;  3AJI A;  3EU5 A;  3CHP A;  3JQ1 A;  3APC A;  3ZFW A;  4U0Z A;  5CMW A;  1E7V A;  4QQI A;  3QWW A;  2OVF A;  2KC7 A;  1OXJ A;  4XKC A;  3JXJ A;  4O1P A;  3RIB A;  4NUR A;  4AV7 A;  2L0T B;  3IXE A;  2GRN B;  3NB2 A;  4GPK A;  4B93 B;  1O1T A;  3T5X A;  1OCR E;  5EDS A;  3OXG A;  2H6I A;  1MX6 A;  3LDZ A;  3T8M A;  2AVP A;  3NOG D;  3V30 A;  3OAW A;  2ETA A;  2WXL A;  5KJL A;  2LSV A;  2P9U G;  2R17 C;  4LG6 A;  2P9I G;  4HRL A;  2WMO A;  3URZ A;  4LUN U;  4A1S A;  3OXL A;  1JWF A;  2UWJ G;  3UKU G;  4TXP A;  1DVP A;  3ZYL A;  3JUE A;  2F0Y A;  3G2S A;  1IHG A;  5ITZ F;  1NP7 A;  3HIZ A;  4UWG A;  1SZ9 A;  1Y8M A;  3FFL A;  3CVU A;  4F6R D;  2DZO A;  3K9I A;  1KLX A;  3UIN C;  5LX8 A;  5FIN A;  1FPP A;  5E76 A;  2EIJ E;  2Y1L E;  4AJW A;  1NI1 A;  1P5Q A;  3ABK E;  3I4G A;  2PQR A;  1ZB1 A;  2EIK E;  4NAC A;  5EYP F;  1QQE A;  4B89 A;  2XEH A;  4RVB A;  2P58 C;  3B7B A;  4HOT A;  5FWQ A;  1OCO E;  3TWR A;  1YYH A;  2DWZ A;  2BKK B;  3EU9 A;  4FA6 A;  3MGB A;  4KXK B;  3LVQ E;  1YCS B;  3HXF A;  3IKO B;  3W9F A;  4HLE A;  4JEH A;  3RO2 A;  5LOZ A;  2GW1 A;  3SF4 A;  2X3M A;  5ARF A;  3MKQ B;  1KZO A;  2P9L G;  5ARG A;  3FWV A;  4HI9 A;  3MCX A;  2CHX A;  3DRA A;  4A1G A;  2E0I A;  5H7P A;  2XGS A;  1OUV A;  4G8K A;  1U3D A;  3E32 A;  3PUK A;  4GCO A;  3ONL A;  4N5C A;  1WDY A;  3Q47 B;  3E30 A;  2DVW A;  3FTY A;  2NSZ A;  3FY4 A;  3GZS A;  1VDY A;  2KXP C;  1E8Y A;  5HKP A;  3ZUV B;  5ENQ D;  4L2Y A;  3DXM G;  4GTM A;  5EX3 A;  4OAV B;  3GZ1 A;  1OCC E;  5ENR D;  5EIL A;  3U4T A;  1ELR A;  5AYW D;  3ZHE A;  2VSO E;  4ATG A;  1JCS A;  1N4Q A;  1N4S A;  1AWC B;  1N0Q A;  1OWN A;  4M7C A;  4CGW A;  2XEN A;  3MX3 A;  3Q79 A;  3PZ4 A;  2UY1 A;  3ABL E;  4JHK A;  4CRW A;  4KZ0 A;  2QYJ A;  5FIO A;  5CER B;  3OTN A;  3V31 A;  2QZA A;  3D9J A;  5T3R A;  4B8A A;  4NIK A;  3VLE A;  4CT4 A;  1EYH A;  1EDU A;  4GZ6 A;  1GW6 A;  3KSL A;  4DX1 A;  5CBO A;  3D9M A;  2GRP B;  1K8K G;  4K03 A;  3FH8 A;  3PS6 A;  3SO8 A;  3V79 K;  4DUI A;  3NBN B;  5EID A;  1N52 A;  2A5U A;  3TWV A;  4RG6 A;  3ZYM A;  3LJN A;  2NC9 A;  2AJA A;  1IQR A;  4GYO A;  3FEX A;  4HVB A;  2IO3 C;  2JAB A;  1TN7 A;  4BWR A;  1Z3Y A;  2C0M A;  3DSU A;  3TWU A;  3ZYQ A;  3PNL B;  5HI7 A;  3ULY A;  3ZIM A;  5CEA A;  1INZ A;  4UWH A;  1BI8 B;  1SA4 A;  4LSZ E;  5EKQ D;  3R7Q A;  2XRY A;  2FBN A;  4D10 C;  5D66 A;  3QK0 A;  3FUN A;  3UM1 A;  3FU0 A;  3MEK A;  2ZIS A;  3FTU A;  4ILI A;  3KD7 A;  1PAQ A;  3QJZ A;  2RFM A;  4GTO A;  1QNF A;  1SQM A;  5B1B E;  4DRX E;  3CVV A;  5A7D B;  2Y3A A;  3HDX A;  3TXM A;  4ZFH A;  3AG4 E;  3SD5 A;  3FUD A;  3JUI A;  1D8D A;  5ENN A;  4U8Y D;  1H6O A;  4EZK A;  1O1R A;  4TRQ A;  5BPP A;  1TJC A;  3CGH A;  1S63 A;  3FUF A;  1N94 A;  2MHK A;  4UI9 K;  3IHV A;  3IBE A;  4N5Q A;  1JWG A;  3S2A A;  2P9S G;  1EPU A;  2L6J A;  5AQ9 A;  4U0S A;  3E33 A;  2V4H C;  4HB5 A;  4F53 A;  4J7W A;  5G04 C;  3CQC B;  4EEC A;  4JA9 A;  4GAA A;  3ESL A;  2VGX A;  3KSQ A;  4GU5 A;  1FCH A;  3Q7A A;  3D9N A;  4ACK A;  1N54 A;  3MKQ A;  5AAR A;  3UIP C;  1OY3 D;  4HLL A;  5KNG A;  2L0I A;  2J08 A;  3HVE A;  4CCA A;  3FTZ A;  5CCM A;  2JEK A;  2YIN A;  2VGE A;  3RRU A;  5BNW A;  4B94 A;  3LY7 A;  1N4P A;  2XHE A;  4F7A A;  4CT0 A;  2HYZ A;  4AVX A;  3L82 A;  3D9P A;  2AXZ A;  5AQA A;  1Z5S C;  2BUG A;  5ANR A;  4TXR A;  5EIB E;  2R03 A;  2XGO A;  3D9H A;  2WXG A;  5C2Y A;  4O1O A;  4HXI A;  2EIM E;  2A4Z A;  2WXO A;  5BW8 C;  3OXF A;  1PY1 A;  3ZGQ A;  3CVP A;  1H6K A;  1A17 A;  4BSZ B;  2HM8 A;  3AS5 A;  2UY1 B;  3MV3 B;  3CVX A;  4UUC A;  3CKC A;  4TXQ A;  3C3Q A;  3ML9 A;  3RK6 A;  1NFI E;  2E2E A;  1IQU A;  4XZ4 A;  3V2X A;  4DLQ A;  4I17 A;  3Q15 A;  3NZU A;  1HG5 A;  1E8Z A;  3EHQ A;  3NOC D;  2IOL A;  1HE8 A;  5BT1 A;  1SVX A;  2IFU A;  3WG7 E;  3CVQ A;  1ZU2 A;  2IY0 C;  4FLH A;  3T8K A;  2XZT G;  4G1T A;  3D9O A;  3UT8 A;  4BFR A;  4OVV A;  4KMO A;  4WWN A;  1PC2 A;  1MX2 A;  2XS1 A;  4AY5 A;  4ANU A;  3MYV A;  4ILH B;  4EQF A;  2C0L A;  3FTW A;  4QFV A;  3ULQ A;  2XEV A;  5G04 J;  4C9B B;  3GW4 A;  1QBQ A;  2VGY A;  4P29 A;  3I3N A;  3DBS A;  3W9G A;  4AXH A;  3QC1 A;  3RRM B;  2I1K A;  3P2B A;  4GTS A;  5JMN D;  4U04 A;  2J9Q A;  1IKN D;  4RQI A;  4JA7 A;  3DXK G;  2CFU A;  2I1J A;  2WM9 A;  1BPO A;  5LCW C;  5AN8 A;  3KAE A;  2VSX E;  3UT7 A;  5IY5 E;  3L13 A;  4FLB A;  1U3C A;  3KEA A;  2R05 A;  4MLP A;  1S64 A;  3U3W A;  4M3O A;  4HOR A;  2C2L A;  5CEC B;  3E34 A;  2J4B A;  4NRH B;  1LTX A;  2MRI A;  4HI8 A;  3VTY A;  4DK5 A;  4I9E A;  5C1D A;  3AG3 E;  1OWM A;  4A3T A;  4DX2 A;  1N9A A;  2XGM A;  1H2T C;  5KJN A;  3NQP A;  3SZ7 A;  4C48 B;  1H19 A;  3ZVV A;  3CK7 A;  2XRZ A;  4L1B A;  5AJL A;  2QY7 A;  2LNI A;  4JW1 A;  3SBT B;  3L22 A;  3EHN A;  2CFZ A;  4O6F A;  3RU0 A;  4E85 A;  2OND A;  2MOW A;  3LS8 A;  4C0E A;  5BV0 A;  1G3N B;  1TNO A;  4W9R A;  3V2O A;  3L54 A;  1HS6 A;  3TAX A;  4AIF A;  3S7D A;  3PE4 A;  1JCR A;  3PUJ A;  2H6H A;  3S7B A;  4GZD A;  4ANX A;  3VTX A;  5CBN A;  4JVS A;  1H2V C;  3SQV A;  2LXM A;  2CHW A;  2J09 A;  4GZC A;  4I6J A;  2WQ7 A;  3SNX A;  1N0R A;  2F8Y A;  5FQ6 A;  3QWV A;  5LP0 A;  2I6H A;  1ELK A;  4YDO A;  3NZS A;  5JA4 D;  3P1U A;  5ENT D;  3TWS A;  4F1S A;  1V54 E;  4XEI G;  2VJ8 A;  2XPI A;  4XI0 A;  4J8Y A;  1Z3X A;  2IF4 A;  3Q9N C;  3DST A;  3UT4 A;  3DPY A;  1KT0 A;  4R7L A;  5A23 A;  4X8Q A;  5LCW J;  3R7R A;  4DX7 D;  5KNH D;  2AW6 A;  5J08 A;  1RZ4 A;  2AXV A;  5JJ6 A;  3DEP A;  5FZQ A;  4MRU A;  2J4D A;  3QAQ A;  2J8S D;  2P9P G;  2WXF A;  4OAU C;  5HQ8 A;  4DX6 D;  1BI7 B;  4N2S A;  4J8S A;  1OWL A;  3ZHE B;  2PZI A;  1KT1 A;  4MKT A;  4JC8 A;  3Q73 A;  4TUM A;  2ZIR A;  3BG1 B;  1O5M A;  3LPZ A;  1IYG A;  4MS6 A;  4ANV A;  3TWQ A;  1HU3 A;  4ME2 A;  3AU5 A;  5CMY A;  3Q4A B;  3ASN E;  2GRR B;  2WXH A;  1W3B A;  4FJY A;  1HH8 A;  4L2L A;  4JZY A;  2VQ2 A;  3EDT B;  2YHC A;  4EBA A;  3FTX A;  4GTR A;  2X6H A;  3ZEF A;  5KJM A;  2KZT B;  3ASF A;  4FHJ A;  4GPM A;  5T4Y A;  4BTA A;  3LVR E;  3TL5 A;  1FVH A;  1D9S A;  1WAO 1;  1AP7 A;  2V5Q C;  2RKK A;  3RO3 A;  2GRL A;  4DPR A;  2NXP A;  4GZ3 A;  5KWD A;  3HYM B;  3DSX A;  4UWK A;  5JHB A;  4RLY A;  2PQN A;  5JJ7 A;  4WNF A;  3CVN A;  4G25 A;  3UI2 A;  3HXE A;  3HG0 D;  4L23 A;  3HXD A;  5DBK A;  3FHE A;  4CDM A;  2Y0B G;  4FUL A;  3UMV A;  4Z68 A;  2BED A;  3IV0 A;  4Y6W A;  4YDW A;  4PH4 B;  1UJJ A;  2FF4 A;  2KCV A;  1E90 A;  3TWX A;  2I9C A;  3G2U A;  3HXC A;  3ASG A;  3FUE A;  3LY9 A;  3AAA C;  3ZW3 A;  1UG3 A;  2DZN A;  1TJF A;  4KVO A;  3FUK A;  4LNU D;  4HQD A;  3CIA A;  5D2M C;  3QB2 A;  1FT1 A;  4RSY A;  3MJW A;  3PVL A;  4HOS A;  4HFG A;  3NAW A;  3TGO A;  4JPS A;  4EZL A;  3C98 A;  1MZC A;  2RD0 A;  2WXM A;  1WY6 A;  3VLD A;  1H6P A;  1KPS B;  4YND A;  5B3S E;  4DLO A;  2VGX B;  2ETC A;  1HX8 A;  4PUC A;  3SI5 A;  1XNF A;  2Y4T A;  4J6I A;  1L5J A;  3QNK A;  5FQ8 A;  1DCE A;  1WG0 A;  2KCL A;  1ZBP A;  3QAR A;  3EUV A;  1IXV A;  2X38 A;  1HG2 A;  4RG9 A;  3PRE A;  4ZHB A;  1NL4 A;  2OOE A;  4BSX A;  3FTS A;  5D0O D;  4N2Q A;  4TV3 A;  3CVL A;  4CZ2 D;  3UX4 A;  3J5P A;  3FTV A;  2Q7F A;  2VYI A;  3LXU X;  3L9T A;  4ILG A;  4UQY A;  1X5B A;  1DCQ A;  5G05 C;  3I5P A;  2DIW A;  4UWF A;  4H7X A;  2QC9 A;  3GZ2 A;  3SFX A;  2B6C A;  5KBA A;  2WB2 A;  2OEV A;  2PL2 A;  1TNU A;  1LF8 A;  3PZ2 A;  4YDY A;  2IQC A;  2MYO A;  3HHM A;  2ILR A;  2RFA A;  3EIJ A;  4EHM A;  3UXG A;  2ZGD A;  3FEY A;  3CEQ A;  4LNB A;  3ESK A;  4XI9 A;  1E7U A;  2ZGG A;  3APF A;  3DEO A;  2R02 A;  4EZJ A;  1MQS A;  5FZR A;  4E6H A;  5G55 A;  4ANW A;  3O48 A;  4GA2 A;  2KM4 A;  2RG8 A;  4IN3 B;  3FUI A;  1NA3 A;  3ISM C;  4DX5 D;  4YVO A;  4BT9 A;  1FT2 A;  3CST A;  4K5B A;  3LJ3 A;  4GZ5 A;  3DSW A;  4XIF A;  4BER A;  4ATZ D;  4GTQ A;  2V5F A;  4Q96 A;  5A6C A;  2KZT A;  4GB9 A;  4WNG A;  5G2N A;  5CHE E;  5B1A E;  3PEU B;  4U8H A;  1UN8 A;  5AQ7 A;  3ZN3 A;  2X6J A;  5FT9 A;  5AIJ A;  1SW6 A;  2B0O E;  3AS4 A;  2V8S E;  3AS8 A;  2GRO B;  3PNT B;  2LO6 A;  4KVM A;  2V0P A;  2Y4U A;  3APD A;  1SZA A;  3BUA A;  2IOS A;  5FQ4 A;  4WND A;  2XZD G;  3RRN B;  2M63 A;  2DCP A;  2WXI A;  4KT6 B;  3D9K A;  4HS2 A;  1Z6T A;  3JQ0 A;  4BT8 A;  4HOU A;  3B7R L;  4AEZ C;  4GMR A;  2PM7 A;  3RAU A;  2CG2 A;  1BD8 A;  2WXR A;  5BUZ A;  2EQX A;  1O1S A;  4Q94 A;  4G23 A;  3SFZ A;  4PS8 A;  5FJY A;  2R5S A;  3KEZ A;  4DI3 A;  3JXI A;  4J8E A;  1TYQ G;  2X6I A;  3ABM E;  3FDH A;  1YA0 A;  2WXP A;  2A5E A;  1K3Z D;  4CEM A;  2VTB B;  3IHY A;  3BEE A;  3HRA A;  4JHR A;  3N71 A;  3CHR A;  3CV0 A;  3UKR G;  1YMP A;  4J0U A;  3JYS A;  2GRM A;  1RW2 A;  3B13 A;  2ETB A;  5JJT A;  2FO7 A;  2VTB A;  3D9L A;  3FU3 A;  3EHM A;  3KS2 A;  2LSU A;  4HNA D;  3T9K A;  3TG5 A;  3R9A B;  4J8D A;  4JXT A;  2AWI A;  3BU8 A;  3LEW A;  2X6F A;  3Q7F A;  3UM0 A;  4DJA A;  5KCM A;  3G2W A;  3LYA A;  3ASD A;  1HXI A;  3AG1 E;  3Q5M A;  1N4R A;  3ZPJ A;  1TR4 A;  3MKR A;  4AOF A;  3PRZ A;  4GA0 A;  5EX0 A;  4OVU A;  2BF0 X;  4A55 A;  1OWO A;  4XKB A;  2P9K G;  2F37 A;  4O60 A;  2WVI A;  3Q78 A;  2CHZ A;  4GYW A;  3S7F A;  4BX8 A;  3QWP A;  4N39 A;  3DWL G;  1MYO A;  5ANL A;  2P2C P;  3B7S A;  2X6K A;  5FQ7 A;  4G8L A;  1ELW A;  1KZP A;  3WXX A;  4XX5 A;  3CVW A;  2XCB A;  5BXU A;  1TNZ A;  3NF1 A;  3PH0 C;  4K5C A;  2OV8 A;  4B0Z A;  1N95 A;  4EBA G;  3SFY A;  5T8I A;  3ZKJ A;  1X81 A;  2QFC A;  1D8E A;  4APO A;  3HVE B;  3TWW A;  3SY2 A;  4JEU A;  2FEZ A;  1Q2Z A;  4TUU A;  5CRU A;  2GGF A;  5HS0 A;  3ONK A;  2XQ0 A;  3MV2 B;  3C3R A;  2OVB A;  3TWT A;  1TEZ A;  1HF8 A;  4U95 D;  4BX9 A;  3VLF A;  3FU6 A;  3MZL B;  3L17 A;  3QOU A;  3SBS A;  3PDN A;  1JPL A;  4BES A;  3DPD A;  1OT8 A;  1NZN A;  3PZ1 A;  2F8X K;  4LEU A;  4F3V A;  3UM2 A;  1SA5 A;  3FUM A;  5FTP A;  1V55 E;  3CR3 A;  2J07 A;  5J90 A;  4FP7 A;  4NQ0 A;  1MJ0 A;  4BTB A;  4V3I A;  4IRU A;  4JB8 P;  3U64 A;  4A3V A;  1WM5 A;  4UI9 C;  4AP2 A;  3BG0 B;  4GTT A;  3PEV B;  1S70 B;  4APF A;  4I9C A;  5EN5 D;  4YDE A;  2XCC A;  3ENE A;  3TXN A;  2IJG X;  4CDN A;  3RJV A;  5ENO D;  4L9P A;  1XGW A;  2LXL A;  2Y69 E;  4IYP A;  2DYS E;  4L7T A;  4Y6C A;  1K1B A;  3ZXS A;  3F6Q A;  2R2L A;  4B8C B;  3FH5 A;  3FU5 A;  3HXB A;  2YNQ A;  3BQO A;  4I43 A;  3L16 A;  3QKY A;  2HR2 A;  3UM3 A;  2JLB A;  4LNG A;  4WAF A;  3O4Z A;  4HRM B;  1UN9 A;  4FU3 A;  3ZXP A;  4OYS A;  2EIN E;  3CSF A;  3Q49 B;  3UTM A;  3UIO C;  2OEW A;  3E37 A;  3EJN A;  3D9I A;  4URK A;  4G24 A;  1QZ2 A;  2V4L A;  4WNE A;  5D0Q D;  3CQG B;  4ABN A;  2R59 A;  2PNN A;  2H6G A;  3UPV A;  4G11 A;  4PS7 A;  1H0A A;  4CYM D;  2WQ6 A;  3MA5 A;  3PZ3 A;  1NA0 A;  4AY6 A;  3RKV A;  3FP3 A;  3ZYK A;  3CVY A;  4I1A A;  1A5E A;  2FUL A;  3PZD A;  2VSY A;  4BET A;  2BKG A;  3IEG A;  5CRV A;  1LD7 A;  4KBQ A;  3CK8 A;  2J49 A;  2YHE A;  5HRY A;  5BXO A;  3FH7 A;  2OCC E;  4AM9 A;  4HOQ A;  2XPZ A;  4G26 A;  3L6A A;  3GYZ A;  5AEN A;  2FO1 E;  5ENP D;  2XPY A;  1UW4 B;  4H7Y A;  2DBA A;  2BTD A;  2WPV A;  3Q75 A;  4U0U A;  2L6B A;  2HO1 A;  2IEJ A;  2WXN A;  2WXJ A;  1TNY A;  4K0R A;  1N11 A;  1HZ4 A;  5AJD A;  3ZU7 B;  2ZU6 B;  4F1P A;  3ULE G;  1OCZ E;  1MHQ A;  4G2V A;  4LER A;  4KYO B; 
#chains in the Genus database with same CATH homology
 5E75 A;  1U3D A;  4WNG A;  5CHE E;  5G2N A;  3CKB A;  3PEU B;  4U8H A;  1H19 A;  1UN8 A;  4FJZ A;  3ZVV A;  3ZN3 A;  3CK7 A;  2X6J A;  2XRZ A;  4L1B A;  5FT9 A;  5AIJ A;  5AJL A;  3PUK A;  2QY7 A;  4GCO A;  3AS4 A;  3ONL A;  2V8S E;  2LNI A;  4JW1 A;  4I1M A;  3AS8 A;  3L22 A;  4LCT A;  4UWL A;  3PNT B;  4N5C A;  3EHN A;  3Q47 B;  2LO6 A;  4KVM A;  2CFZ A;  2V0P A;  2Y4U A;  4O6F A;  3RU0 A;  4E85 A;  3G2V A;  3CK9 A;  2OND A;  3APD A;  1E8W A;  1SZA A;  2MOW A;  2IOS A;  2NSZ A;  3FTY A;  3FY4 A;  1VDY A;  3GZS A;  3LS8 A;  5FQ4 A;  5BV0 A;  1E8Y A;  4WWO A;  3L08 A;  4W9R A;  4WND A;  3LCA A;  3L54 A;  3RRN B;  1HS6 A;  3TAX A;  4L2Y A;  4I2Z A;  5EX3 A;  2M63 A;  3D3M A;  3PE4 A;  3S7D A;  4AIF A;  4JHJ A;  3GZ1 A;  3PUJ A;  2DCP A;  4FHK A;  5G05 J;  3U4T A;  1ELR A;  2WXI A;  5AYW D;  3ZHE A;  4KT6 B;  2VSO E;  4ATG A;  3D9K A;  4HS2 A;  3S7B A;  4GZD A;  4ANX A;  3VTX A;  4JVS A;  1Z6T A;  3JQ0 A;  4BT8 A;  1H2V C;  3B7R L;  4HOU A;  2CHW A;  1DNP A;  4N3A A;  1OWN A;  4GML A;  4AEZ C;  2YQ8 A;  2PM7 A;  2J09 A;  4GZC A;  1S0P A;  4I6J A;  2WQ7 A;  4CGW A;  1EF1 C;  4UQX A;  4Q69 A;  3SNX A;  3EIQ C;  2CG2 A;  5KJK A;  2WXR A;  5BUZ A;  2EQX A;  3MX3 A;  4Q94 A;  3QDN A;  2AXU A;  4G23 A;  2UY1 A;  3ZRH A;  3SFZ A;  4PS8 A;  5FQ6 A;  5FJY A;  3QWV A;  5LP0 A;  4JHK A;  2I6H A;  1ELK A;  2R5S A;  2WQH A;  4KZ0 A;  4CRW A;  3KEZ A;  4FAD A;  3TG4 A;  4DI3 A;  3NZS A;  4U63 A;  3OTN A;  4J8F A;  3P1U A;  1Y6I A;  5JHA A;  4J8E A;  3D9J A;  2X6I A;  5T3R A;  4B8A A;  3CHQ A;  3SGH A;  4F1S A;  3FDH A;  4PDX A;  3VLE A;  1EYH A;  1YA0 A;  1EDU A;  2WXP A;  4CT4 A;  2VJ8 A;  4GZ6 A;  1GW6 A;  2XPI A;  4XI0 A;  3D9M A;  4CGV A;  4K03 A;  4CEM A;  1Z3X A;  2IF4 A;  3FH8 A;  3IHY A;  3CHS A;  3PS6 A;  4YVQ C;  2VTB B;  3BEE A;  4JHR A;  3N71 A;  3CHR A;  3UT4 A;  3CV0 A;  3S7J A;  1KT0 A;  4N3B A;  4ACL A;  4R7L A;  4U07 A;  4J0U A;  1N52 A;  2A5U A;  5A23 A;  3JYS A;  2GRM A;  3B13 A;  3UUX A;  5LCW J;  3AU4 A;  3R7R A;  4RG6 A;  3ZYM A;  2CG3 A;  1HFA A;  5JJT A;  3T5V A;  3ML8 A;  2AW6 A;  4XE0 A;  5J08 A;  2AXV A;  2FO7 A;  2LAI A;  2NC9 A;  5JJ6 A;  2VTB A;  1IQR A;  3D9L A;  4GYO A;  2LAH A;  3FU3 A;  3FEX A;  5FZQ A;  3EHM A;  5CCL A;  3FUH A;  2WXQ A;  3KS2 A;  4HVB A;  2LSU A;  4MRU A;  2J4D A;  3TG5 A;  3QAQ A;  3R9A B;  4J8D A;  4JXT A;  4BWR A;  2AWI A;  1Z3Y A;  2WXF A;  3LEW A;  2C0M A;  5HQ8 A;  2X6F A;  2WXK A;  4N2S A;  4J8S A;  1OWL A;  3B7T A;  4DJA A;  5KCM A;  3G2W A;  3LYA A;  3ZYQ A;  3ZHE B;  3ASD A;  1UJK A;  3PNL B;  2PZI A;  4KZC A;  4I2W A;  5BV1 A;  5HI7 A;  1JUQ A;  3NQP A;  1OWP A;  3ZIM A;  1HXI A;  3Q5M A;  3ZPJ A;  1KT1 A;  3MKR A;  4AOF A;  3PRZ A;  4DI4 A;  1INZ A;  4GA0 A;  4UWH A;  5EX0 A;  4OVU A;  4WUY A;  4MKT A;  5EKQ D;  3R7Q A;  2BF0 X;  4A55 A;  3G2T A;  4JC8 A;  3CHM A;  2KAT A;  1OWO A;  4XKB A;  3BG1 B;  2XRY A;  2FBN A;  3LPZ A;  4D10 C;  1IYG A;  4MS6 A;  5M72 A;  4ANV A;  2WVI A;  1HU3 A;  4ME2 A;  3AU5 A;  4GCN A;  2CHZ A;  3FUN A;  3QK0 A;  4GYW A;  4WWP A;  3S7F A;  4BX8 A;  3QWP A;  4N39 A;  5CMY A;  3Q4A B;  3FU0 A;  3MEK A;  5LFA A;  3FTU A;  4ILI A;  4LRZ A;  3KD7 A;  1PAQ A;  5ANL A;  3B7S A;  2X6K A;  3QJZ A;  5FQ7 A;  2WXH A;  1ELW A;  3JCK C;  1H2U A;  1QNF A;  1W3B A;  1SQM A;  3WXX A;  4FJY A;  4XX5 A;  1HH8 A;  4L2L A;  4JZY A;  3CVW A;  1B89 A;  2FI7 A;  2XCB A;  2VQ2 A;  2I2O A;  3CVV A;  3EDT B;  2Y3A A;  2YHC A;  1FVF A;  5A7D B;  3FTX A;  3NF1 A;  3UQ3 A;  4EBA A;  3HDX A;  3TXM A;  3PH0 C;  2X6H A;  2WMN A;  3ZEF A;  2OV8 A;  3SD5 A;  3FUD A;  2KZT B;  3ASF A;  3JUI A;  4B0Z A;  4C0M A;  5KJM A;  4FHJ A;  5T4Y A;  5ENN A;  4BTA A;  4N3C A;  3CLJ A;  4EZK A;  3LVR E;  4TRQ A;  4EBA G;  5BPP A;  5T8I A;  3TL5 A;  1FVH A;  1E96 B;  4GA1 A;  2QFC A;  3CHO A;  4I6E A;  1TJC A;  2KCK A;  4I6G A;  3SHF A;  1WAO 1;  3CGH A;  4APO A;  3FUF A;  3HVE B;  4GYY A;  3RO3 A;  2ION A;  4I1O B;  2GRL A;  4DPR A;  2MHK A;  4JEU A;  4UI9 K;  3IHV A;  2NXP A;  4GZ3 A;  3IBE A;  3HYM B;  1JWG A;  4UQZ A;  3S2A A;  3PE3 A;  4UWK A;  5JHB A;  4BY6 A;  2FEZ A;  2PQN A;  1EPU A;  3B7U X;  2L6J A;  2PM6 A;  4TUU A;  2IU1 A;  5JJ7 A;  2GGF A;  2L9B A;  3I4R B;  4U0S A;  4WNF A;  3CVN A;  4G25 A;  3ASH A;  3LY8 A;  4F53 A;  3ONK A;  2XQ0 A;  3FUL A;  5G04 C;  1E8X A;  3CQC B;  3FUJ A;  4L23 A;  3MV2 B;  5DBK A;  2OVB A;  4CDR A;  1TEZ A;  1HF8 A;  4EPZ A;  4EEC A;  3FHE A;  1HO8 A;  4CDM A;  4JA9 A;  4BX9 A;  3VLF A;  4GAA A;  3ESL A;  2VGX A;  4FUL A;  2VSN A;  3UMV A;  3U66 A;  4GU5 A;  4IUL A;  3FU6 A;  3MZL B;  4JL0 A;  1FCH A;  3L17 A;  3QOU A;  3SBS A;  4GMJ A;  3D9N A;  4ACK A;  3E4B A;  4PS3 A;  1N54 A;  3MKQ A;  3PDN A;  5DIZ A;  5FZS A;  1JPL A;  3DPD A;  2L0I A;  2J08 A;  3HVE A;  3LKU A;  3U9W A;  4CCA A;  3FTZ A;  4FC8 A;  5CCM A;  1NZN A;  3TJP A;  2JEK A;  2YIN A;  3IV0 A;  4LEU A;  4UI9 J;  4Y6W A;  3RRU A;  4F3V A;  3SBT B;  5BNW A;  4B94 A;  3CHP A;  3LY7 A;  4PH4 B;  1UJJ A;  2XHE A;  2FF4 A;  3JQ1 A;  4F7A A;  4CT0 A;  2KCV A;  3APC A;  1E90 A;  2HYZ A;  3FUM A;  4U0Z A;  3ZFW A;  5CMW A;  2I9C A;  1E7V A;  5FTP A;  3CR3 A;  2J07 A;  3G2U A;  5J90 A;  4FP7 A;  4NQ0 A;  4BTB A;  3ASG A;  3FUE A;  3QWW A;  4AVX A;  2OVF A;  4V3I A;  4IRU A;  2KC7 A;  3LY9 A;  3D9P A;  2AXZ A;  4XKC A;  3U64 A;  2BUG A;  1WM5 A;  1UG3 A;  4A3V A;  3ZW3 A;  4UI9 C;  4AP2 A;  3BG0 B;  1TJF A;  4KVO A;  3FUK A;  3RIB A;  3PEV B;  4APF A;  4NUR A;  4I9C A;  3CIA A;  5ANR A;  4AV7 A;  2L0T B;  2XCC A;  3ENE A;  4GPK A;  3TXN A;  2XGO A;  3QB2 A;  2IJG X;  2WXG A;  5C2Y A;  3T5X A;  5EDS A;  3OXG A;  4HXI A;  4RSY A;  4CDN A;  3RJV A;  2A4Z A;  3MJW A;  1XGW A;  2WXO A;  3PVL A;  4HOS A;  5BW8 C;  3OXF A;  3LDZ A;  4C0E A;  4HFG A;  2AVP A;  4IYP A;  3T8M A;  1PY1 A;  3ZGQ A;  4L7T A;  3CVP A;  4Y6C A;  1H6K A;  3ZXS A;  4B8C B;  3FH5 A;  3FU5 A;  1A17 A;  2YNQ A;  3TGO A;  4JPS A;  3OAW A;  4I43 A;  3C98 A;  4EZL A;  2RD0 A;  2WXL A;  2WXM A;  2HM8 A;  3L16 A;  5KJL A;  3QKY A;  3AS5 A;  2UY1 B;  2HR2 A;  3MV3 B;  1WY6 A;  3CVX A;  3VLD A;  3CKC A;  3ML9 A;  2LSV A;  2JLB A;  4YND A;  3RK6 A;  2R17 C;  4WAF A;  3O4Z A;  2E2E A;  2WMO A;  3URZ A;  1UN9 A;  4LUN U;  3OXL A;  2VGX B;  4A1S A;  4DLO A;  4FU3 A;  1IQU A;  4OYS A;  1JWF A;  1HX8 A;  4PUC A;  3SI5 A;  1XNF A;  3CSF A;  3Q49 B;  4XZ4 A;  2UWJ G;  2Y4T A;  4DLQ A;  4I17 A;  4J6I A;  1L5J A;  3Q15 A;  3QNK A;  5FQ8 A;  3EJN A;  3D9I A;  3NZU A;  4URK A;  1HG5 A;  1E8Z A;  1ZBP A;  2KCL A;  1QZ2 A;  1DVP A;  2IOL A;  3QAR A;  4G24 A;  1HE8 A;  2V4L A;  3ZYL A;  5BT1 A;  4WNE A;  5D0Q D;  3CQG B;  4ABN A;  2R59 A;  2IFU A;  3CVQ A;  1ZU2 A;  2X38 A;  1HG2 A;  1IHG A;  3G2S A;  4FLH A;  3PRE A;  4G11 A;  4RG9 A;  4PS7 A;  3UPV A;  1H0A A;  4G1T A;  3D9O A;  2OOE A;  1NP7 A;  3UT8 A;  4BFR A;  4BSX A;  3FTS A;  3HIZ A;  5D0O D;  4OVV A;  4UWG A;  2WQ6 A;  4N2Q A;  4TV3 A;  3MA5 A;  1SZ9 A;  4KMO A;  3CVL A;  4WWN A;  1Y8M A;  1PC2 A;  1NA0 A;  4AY6 A;  3RKV A;  3FFL A;  3CVU A;  3FP3 A;  3K9I A;  1KLX A;  4AY5 A;  3UX4 A;  4ANU A;  3ZYK A;  3CVY A;  3FTV A;  2Q7F A;  3MYV A;  5LX8 A;  2VYI A;  3LXU X;  4ILH B;  4EQF A;  4ILG A;  4UQY A;  2C0L A;  4I1A A;  1X5B A;  2FUL A;  3FTW A;  3PZD A;  4QFV A;  3ULQ A;  5E76 A;  2VSY A;  2XEV A;  5G04 J;  5G05 C;  3I5P A;  2DIW A;  4AJW A;  4C9B B;  4UWF A;  4H7X A;  3GW4 A;  1P5Q A;  3I4G A;  3IEG A;  2PQR A;  2VGY A;  4P29 A;  3I3N A;  3DBS A;  3GZ2 A;  4NAC A;  3RRM B;  3QC1 A;  4AXH A;  2I1K A;  3P2B A;  4U04 A;  2J9Q A;  4KBQ A;  3CK8 A;  2J49 A;  2YHE A;  4JA7 A;  1QQE A;  4B89 A;  2WB2 A;  2CFU A;  2I1J A;  2WM9 A;  3FH7 A;  1BPO A;  4RVB A;  2PL2 A;  1LF8 A;  4AM9 A;  5LCW C;  4HOQ A;  2IQC A;  2P58 C;  2XPZ A;  3HHM A;  2ILR A;  3KAE A;  4HOT A;  3EIJ A;  5FWQ A;  2VSX E;  4G26 A;  3L6A A;  3UT7 A;  3GYZ A;  5AEN A;  3L13 A;  4FLB A;  2XPY A;  1U3C A;  4FA6 A;  3FEY A;  3CEQ A;  3MGB A;  4KXK B;  3LVQ E;  1UW4 B;  3ESK A;  4MLP A;  4H7Y A;  1E7U A;  2DBA A;  4XI9 A;  3APF A;  2BTD A;  2WPV A;  4M3O A;  4EZJ A;  1MQS A;  5FZR A;  3U3W A;  4HOR A;  2C2L A;  4U0U A;  5G55 A;  4E6H A;  3IKO B;  2HO1 A;  4ANW A;  4HLE A;  3O48 A;  4GA2 A;  2KM4 A;  2RG8 A;  4JEH A;  3RO2 A;  2WXN A;  2J4B A;  2WXJ A;  5LOZ A;  4K0R A;  4NRH B;  4IN3 B;  3FUI A;  2GW1 A;  1HZ4 A;  1NA3 A;  3SF4 A;  2X3M A;  5AJD A;  5ARF A;  2MRI A;  3MKQ B;  4YVO A;  4BT9 A;  3VTY A;  4DK5 A;  4I9E A;  5C1D A;  2ZU6 B;  3CST A;  5ARG A;  1OWM A;  3LJ3 A;  3FWV A;  3MCX A;  4GZ5 A;  4A3T A;  2CHX A;  2XGM A;  1MHQ A;  4XIF A;  4A1G A;  2E0I A;  2XGS A;  1OUV A;  1H2T C;  2V5F A;  4G2V A;  4Q96 A;  4LER A;  5A6C A;  5KJN A;  2KZT A;  3SZ7 A;  4GB9 A;  4KYO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...