3ZHEA

Structure of the c. elegans smg5-smg7 complex
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
399
structure length
399
Chain Sequence
QKSDEVTEKFKRYCNQLEKYGQTENVHSPVMAMLRRKGRKQLIEIMKRDGDCTSSINKLWIVGYYHPFQFFIRDKEKNMAIAVLLTMFCGELQEMLSLPDDKYPALWNMYIGDFHRYMPDEEIQKCLAVGYYSRAIDLDPNQGRAFHVLAGLRADLNVAQKLRLMILGQLADAPYKKGTELLEYLKFPQKESTDKLMVDFVIWALNEKSKRMDYQMTGIKIVNEFKAEIEQKLEFDWSLIMSTCRLASKLAMKKFGFQQFYNCFDTISTLYITIYSRTISSKCLLAEAISWISDSAEILGHLDEQKNEPHFQKLSVFAKTKWNELNDLVMNHINSVFTSMSLTINPSISMTSFLLNGPISEPNVEFLSQLINYLVSVEFPPMEIIHDREESGPLLRRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NONSENSE-MEDIATED MRNA DECAY PROTEIN
publication title An Unusual Arrangement of Two 14-3-3-Like Domains in the Smg5-Smg7 Heterodimer is Required for Efficient Nonsense-Mediated Mrna Decay.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Mrna-binding protein
total genus 133
structure length 399
sequence length 399
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zheA01
1.25.40.760 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zheA02
3Q5MA 1YA0A 3ASGA 4N3CA 4KBQA 2FEZA 1TJCA 2XGSA 2PL2A 3EDTB 4Y6WA 5FTPA 3LYAA 5FZRA 4WUYA 4EQFA 1NA3A 4JA9A 3AS5A 5KJNA 3CVQA 5DBKA 2J9QA 2AVPA 4HORA 2ONDA 5JJTA 3LKUA 2IFUA 3RIBA 3MKRA 5AYWD 5CCMA 5G05J 3MV2B 3KAEA 5D0OD 4YNDA 4WNDA 5KJKA 4J0UA 4YVQC 1WM5A 5LCWJ 3ZFWA 3OXGA 4N39A 3JYSA 4GA1A 3IEGA 3Q4AB 2Y4UA 5C1DA 3GZ2A 3ULQA 3ZPJA 4I2WA 4KXKB 4I9CA 3CVLA 1FCHA 2VSYA 4I1AA 1IHGA 3URZA 2HO1A 2UWJG 2V5FA 2LSVA 2P58C 4GYWA 4GYOA 3CK7A 3QKYA 2PQNA 4G1TA 3S7JA 4G23A 3LY7A 4JL0A 3O48A 1W3BA 4N3BA 4B94A 1ZBPA 4I17A 2FI7A 4BTAA 1Y8MA 4BT8A 4BWRA 2MHKA 5FZSA 4J8DA 3RO2A 5EX3A 3AS4A 3ASDA 3QWWA 5KJMA 2HR2A 5EX0A 4ABNA 3PE4A 2XCBA 2QFCA 4U04A 4NQ0A 2VQ2A 2OOEA 1HZ4A 3QDNA 3SZ7A 4JHRA 3LY8A 3TG4A 4RG6A 2BUGA 4G25A 4CGWA 4HOUA 2PQRA 1QQEA 4WNGA 3UQ3A 4IN3B 4O6FA 3QWPA 4CGVA 2VGXA 3VTYA 3LPZA 4AIFA 2Y4TA 4I2ZA 3ASHA 3ASFA 4U0ZA 4U07A 2FBNA 3WXXA 3RU0A 4F3VA 3U3WA 3Q15A 4UI9C 3HYMB 3ESKA 3UUXA 2LSUA 3S7FA 3Q49B 3OXFA 3CKBA 4CDRA 4U0SA 4UI9K 4UQXA 4GA0A 4AY6A 3U4TA 3CEQA 3TAXA 4GA2A 5KJLA 1HH8A 3RKVA 2I6HA 3CK8A 4I9EA 3ZN3A 2WQHA 4WNFA 4AY5A 3ZHEA 1WAO1 3MV3B 3MEKA 2UY1A 5M72A 3GZ1A 1KLXA 3K9IA 1XNFA 4RG9A 4BT9A 2VGYA 4GZ3A 2KATA 2FF4A 2KC7A 5FT9A 3FP3A 3NF1A 4HOSA 3QWVA 4GCNA 2KCLA 3SF4A 5EKQD 5HQ8A 3AS8A 2XCCA 3CKCA 5A7DB 3KS2A 4UI9J 4H7YA 5ARFA 3N71A 3S7DA 3BEEA 1A17A 3FWVA 3MA5A 4G24A 4J8FA 1NA0A 2IF4A 5FZQA 4J8EA 4H7XA 2Q7FA 2R5SA 5G04C 4HOQA 1NZNA 1E96B 1QZ2A 5BT1A 1ZU2A 3VTXA 4UQZA 5DIZA 4XI0A 3CVPA 1OUVA 3R9AB 2LNIA 4GYYA 2JLBA 4YVOA 3S7BA 3OXLA 3GYZA 2DBAA 1KT0A 3QOUA 4HOTA 2KCVA 4W9RA 2NC9A 3KD7A 5BNWA 2HYZA 5D0QD 3LY9A 4BTBA 1IYGA 3Q47B 4NRHB 3E4BA 3RO3A 2VGXB 2XEVA 2GW1A 2VYIA 2E2EA 4LEUA 3PE3A 3GW4A 1P5QA 2VSNA 3PDNA 3CVNA 4ME2A 2FO7A 4UQYA 5BW8C 2C2LA 4JA7A 1B89A 4GPKA 1ELWA 5HI7A 5G04J 3TGOA 4XIFA 5CCLA 4APOA 1PC2A 4N5CA 2WPVA 4XI9A 4GZ6A 2YHCA 3LCAA 1ELRA 3ZHEB 2UY1B 2PZIA 3UPVA 4G26A 4N2QA 2C0MA 4KYOB 3CK9A 1HXIA 3FFLA 5G05C 3CV0A 4N2SA 5A6CA 4AM9A 5FJYA 2YQ8A 4G2VA 2KCKA 4WNEA 5LCWC 3TG5A 2XPIA 5CHEE 5JJ7A 4A1SA 4Y6CA 4GZ5A 5ARGA 3RJVA 2C0LA 2XGMA 3ZGQA 1KT1A 4U0UA 5JJ6A 2L6JA 2XGOA 4N3AA 4GCOA
chains in the Genus database with same CATH superfamily
3EHRA 3ASGA 5ANLA 1YMPA 3Q78A 5CBNA 2XGSA 4DI3A 1E8XA 3DSWA 2P9KG 3QAQA 5FTPA 3TL5A 3LYAA 5FZRA 5LOZA 3PS6A 3IHVA 4AJWA 2L9BA 2I9CA 5KJNA 3CHQA 2WXLA 3CVQA 4GPMA 4EHMA 2R2LA 2J9QA 2EIME 3DRAA 3DBSA 4L23A 5JJTA 4TXPA 4ZHBA 3LKUA 4I6GA 5CECB 3C3QA 3KAEA 1WDYA 1D8DA 2P9IG 4YNDA 3ZYLA 4WAFA 4WWNA 5LCWJ 4FA6A 4GTMA 3E30A 2XHEA 2F8XK 2I1KA 1N0RA 2P2CP 4CT0A 2QYUA 3NZUA 3FUNA 3JUEA 3E32A 1HG5A 1INZA 3FU6A 1S70B 3ZIMA 1E8ZA 3HHMA 2P58C 1N11A 3CK7A 4G23A 4B93B 2BTDA 3AG2E 3O48A 3R7RA 3PZ3A 2VTBB 3DWLG 4G11A 1ZBPA 3HVEA 4I17A 5BV1A 1SA4A 2ZISA 3D9PA 4ANUA 4FLHA 4J8YA 2AJAA 3U64A 4LRZA 3RSEG 1AWCB 1XGWA 2MHKA 2RD0A 4C0EA 3G2UA 5FZSA 1IKND 1MYOA 3ASDA 2DWZA 3TWRA 1JCQA 1N94A 4K0RA 5KJMA 2ZXWE 1TYQG 2DYSE 3PZ2A 2ZIRA 1HZ4A 4IYPA 4F7AA 4Q96A 2R05A 3SZ7A 4JHRA 1X81A 3LY8A 4RG6A 2L0TB 1BD8A 3ABKE 3DEPA 2X3MA 4UWGA 4DLQA 4UWLA 3L17A 3L54A 3UQ3A 1N52A 3QWPA 4TXQA 2J08A 3UIOC 3SBSA 4HRLA 4AEZC 2LAIA 2XS8A 4I1OB 4BEPA 1U3CA 4DX2A 2NSZA 1O1TA 4DJAA 3ASHA 5A23A 1DVPA 2E0IA 1UJJA 3HYMB 3ESLA 5CMWA 2L6BA 3Q49B 4IULA 4OVUA 5E75A 2Y0BG 4UI9K 3Q79A 3CEQA 1V55E 3GZSA 5KJLA 1TN7A 3G2VA 1K1BA 3RKVA 4LNUD 3QB2A 4JZYA 4QFVA 1NP7A 2LXLA 2WQHA 2A4ZA 5BV0A 4M3OA 5EYLA 3FTYA 1L5JA 3GZ1A 3K9IA 1XNFA 1HX8A 2DIWA 2VGYA 4E85A 4Q69A 3V2XA 3D9HA 3ZKJA 3Q73A 2KCLA 3OTNA 1PY1A 2GRRB 3LXUX 3NAWA 3B13A 3HVEB 3U9WA 1DCQA 5T4YA 4F1SA 1IHBA 4F6RD 4FADA 3NZSA 1H2UA 3SFXA 3ABLE 3BEEA 3CHOA 2WXRA 2Q7FA 5G04C 1NZNA 1NFIE 2PM7A 2GRQB 4EPZA 5AQ9A 4FJYA 2WXHA 3VTXA 2QC9A 4UQZA 5DIZA 4DX5D 1D8EA 2OEWA 3ZEFA 4KZ0A 4I6JA 3CVWA 2LNIA 2P9PG 4V3IA 2WXGA 2KBXA 3FU0A 3IV0A 2JLBA 1OWOA 3JXIA 3DEOA 4U63A 3TWQA 2J8SD 1OY3D 2OV8A 3ZRHA 4JHKA 5CERB 3ASNE 4W9RA 1O1RA 4ANWA 3UTMA 2IOLA 4MKTA 3BG1B 3NB2A 1H19A 4BTBA 1IYGA 4NRHB 3X2QE 3RO3A 2XEVA 4HI8A 4KZCA 2E2EA 1KZOA 3ZU7B 2CG3A 4ZFHA 1TR4A 2WXFA 3EHMA 3T9KA 4UWHA 3ABME 4B0ZA 1BPOA 2C2LA 1B89A 4PS8A 4L1BA 3PH0C 2F8YA 3VLFA 1ELWA 5HI7A 3JQ1A 1MX2A 3QARA 3EU9A 3NQPA 2XS1A 4L2YA 5JHAA 2FO1E 3C5RA 4LSZE 2Y69E 5HKPA 4EECA 1RZ4A 3SY2A 4ILGA 3FTWA 3AG1E 3UPVA 3V79K 4G26A 4WWPA 4N2QA 3CK9A 3SGHA 2V8SE 4MRUA 4MBGA 3TXNA 2IU1A 1ZB1A 3T8KA 3ML9A 4RVBA 1PAQA 3R9MA 3APCA 3V30A 3RJVA 2IO3C 3I4RB 3VLDA 2X6FA 1KT1A 1S64A 4U0UA 1UN9A 1Z6TA 4N3AA 4GCOA 4DK5A 1OXJA 2R17C 2P9UG 4B8CB 4EBAG 5JHBA 4N3CA 4JEUA 1MJ0A 4KBQA 2FEZA 2ZGGA 4BX8A 2WB2A 3HIZA 1NA3A 4JA9A 2LAHA 3AS5A 1H6KA 3APDA 4CCAA 5FQ8A 1EYHA 5AAOA 2IO2C 4GMLA 4GZDA 4OAVB 2AVPA 2WQ6A 5EIBE 2ONDA 3RIBA 3MKRA 4K5AB 5AYWD 1BI7B 5D0OD 4DPRA 2OEVA 3FH7A 3UM0A 3UKUG 4AV7A 3JCKC 3ZFWA 3HRAA 4PDXA 4GA1A 3CHSA 2IONA 3DPDA 3PZDA 4J7WA 2IOSA 3IKOB 3GZ2A 4EBAA 4I1MA 2CG2A 3ZPJA 4I2WA 3Q9NC 3CVLA 1FCHA 1SW6A 4LG6A 3SI5A 1UN8A 2BKGA 1JWFA 3URZA 2HO1A 1OCOE 4GTOA 4GYWA 2KM4A 5FINA 5EILA 4MLPA 4JHJA 4JL0A 4JW1A 5B1BE 4N3BA 5B1AE 3TWVA 4B94A 2FI7A 3MGBA 1Y8MA 3E37A 1TNBA 4JB8P 3ZUVB 2X38A 4HLEA 5EX3A 3AS4A 3CVXA 4RSYA 2HR2A 1AP7A 5ENOD 5AARA 3PE4A 2XCBA 2V4HC 4I6EA 5ENTD 2AXVA 3V2OA 4P29A 3SO8A 5ENNA 2AW6A 3QDNA 2YNQA 4JXTA 2DZNA 1UJKA 2XZDG 3VLEA 1TNYA 3RK6A 3B95A 3MYVA 3EUVA 4FLBA 4GB9A 4A1GA 1E90A 3L22A 4XEIG 1IQRA 1WY6A 4IN3B 5ENPD 3WG7E 2AXZA 4TUUA 4APFA 4HBDA 4AIFA 1N4SA 3D3MA 4U0ZA 3RU0A 3Q15A 4UI9C 4R7LA 3UUXA 3TWTA 3OXFA 4CDRA 3KEZA 4M7CA 3HXBA 3HG0D 4UQXA 4J6IA 4TXRA 3U4TA 4GA2A 4YDEA 4JEHA 1U2VG 3B7UX 3MKQA 4CYMD 2GRPB 3ZYQA 4XKCA 3KSLA 2EINE 4E6HA 2ZU6B 4GMJA 2UY1A 1MX6A 5CEAA 2I1JA 2CHWA 1K3ZD 4RQIA 2WXNA 2FF4A 5FT9A 4QQIA 3NF1A 1FT1A 3QWVA 4BERA 5KWDA 3SNXA 2XCCA 1HFAA 3JXJA 3FUDA 3Q75A 5BPPA 3L82A 2H6FA 3D9IA 3B7SA 1K8KG 3FWVA 3L9TA 4G24A 3NBNB 4J8EA 3UT4A 1E96B 4RLYA 1FVFA 2M63A 3UM2A 5G2NA 2P9SG 2RFMA 5E76A 3EIQC 4HI9A 5AJDA 5CRUA 1IQUA 3SBTB 2DBAA 3QOUA 3RRMB 4HOTA 2F0YA 3QJZA 3CHMA 3TWXA 5BNWA 1H6PA 2WVIA 5FQ6A 5D0QD 3W9FA 3EJNA 1Z3YA 3ZXSA 4Q94A 3ULEG 3UX4A 3CGHA 4LUNU 1UW4B 4ANVA 4XX5A 3PE3A 1P5QA 3F6QA 1JPLA 5IY5E 4ME2A 3AAAC 4XKBA 2P9LG 4LNGA 3Q9UC 3FEXA 1LD7A 2VJ8A 5G04J 3EHNA 2LO6A 3TGOA 2GRMA 4APOA 4CT4A 2P9NG 3ZYMA 4N5CA 1K1AA 1BI8B 5AQBA 2WPVA 4XI9A 1IXVA 3MKQB 3TWSA 2VSXE 4YDWA 1ELRA 4LNBA 3I4GA 5J90A 3NOCD 2UY1B 3B7TA 3J5QB 4KVOA 3PUKA 2WMOA 2C0MA 4CDMA 1UOHA 2CFZA 4J8SA 3ISMC 5C2YA 1HXIA 1E7UA 5G05C 1HF8A 3CV0A 3FUIA 1LD8A 2GRNB 1SZ9A 4WNEA 3TG5A 5BXOA 2ETCA 3AG4E 2XPIA 3UXGA 5JJ7A 1MHQA 4A1SA 1U3DA 4GZ5A 4GTPA 2JABA 1HE8A 4U8HA 2H6GA 5JJ6A 3BUAA 4B8AA 4AOFA 3Q5MA 1YA0A 3UM3A 4B89A 3EDTB 3D9LA 4GU5A 4XE0A 4WUYA 3PEVB 4PUCA 5AENA 2L0IA 3LEWA 4GMRA 5H7PA 4HORA 3T8MA 3CSFA 4Z68A 3FUEA 5CCMA 4U96D 1SVXA 4K5BA 2KZTA 3L16A 4WNDA 5KJKA 3CHRA 4J0UA 1WM5A 3OXGA 5T8IA 4L7TA 1TNUA 3JYSA 3IEGA 4HB5A 3JQ0A 3Q4AB 2Y4UA 2BKKB 3G2TA 3ULQA 1MX4A 4I9CA 4UUCA 3CLJA 1NI1A 3FHEA 3UM1A 1IHGA 4URKA 4HVBA 1MQSA 2XRYA 4CDNA 2LSVA 4HXIA 4XZ4A 1X5BA 4GYOA 3PZ4A 3KSQA 3CSTA 4U8VD 2CHZA 4CZ2D 2PQNA 3DXMG 3EHQA 3S7JA 3LY7A 3CVVA 1W3BA 4A3VA 5AJLA 3FU3A 2B0OE 4DI4A 4BT8A 1EPUA 3FTUA 4BWRA 3QC1A 4J8DA 3SHFA 5EN5D 3QWWA 4HRNA 1D9SA 5EX0A 1Z3XA 2NXPA 3DXKG 4ACKA 3FTZA 4NQ0A 5AQ7A 1N0QA 2OOEA 4ACLA 4U8YD 2EILE 3DPYA 3TG4A 4KMOA 2BUGA 5ANRA 4CGWA 1HS6A 2PQRA 1QQEA 2KXPC 4AVXA 1TNOA 2PM6A 3I5PA 3ML8A 3UT8A 3MX3A 1H6OA 3FH8A 3PVLA 1HG2A 1TN8A 1DC2A 3T5VA 4LCTA 3LPZA 2Y4TA 3KEAA 3PNTB 4I2ZA 4BSZB 3J5PA 3ASFA 2FBNA 3WXXA 2XEEA 2WXOA 1G3NB 3ESKA 1LTXA 2LSUA 4K5CA 4L2LA 3S7FA 1TEZA 3DSTA 3SFZA 3EIJA 4GTTA 3V31A 3CKBA 1OWMA 4GZCA 3D9KA 4LERA 4U0SA 2XRZA 2XPZA 4DUIA 4FHKA 4AY6A 4FP7A 2BEDA 3TAXA 2J49A 4JPSA 1HH8A 1N4PA 3CK8A 5JMND 1QBQA 3B7BA 1QNFA 4C48B 4WNFA 3ZHEA 3LS8A 2AXUA 1TN6A 3MEKA 4I43A 3BQOA 5M72A 5ITZF 1KLXA 4BFRA 1FVHA 4DRXE 4RG9A 4BT9A 3LVQE 2DCPA 4GZ3A 4YDOA 1A5EA 2KATA 1HU3A 4ANXA 3U66A 2VTBA 3FP3A 4HOSA 4YDYA 3IHYA 3SF4A 5HS0A 5HQ8A 3AS8A 3FUJA 4FHJA 1DNPA 3D9OA 2DYRE 5A7DB 3CQGB 3FUFA 4EZLA 3KS2A 4UI9J 3D9NA 4CRWA 4U95D 5ARFA 5LP0A 2R03A 1QYMA 1A17A 3MA5A 4J8FA 1NA0A 3UIPC 5FZQA 4DX6D 4H7XA 2R5SA 4NURA 1QZ2A 1ZU2A 4XI0A 2WXKA 5EIDA 3CVPA 3SD5A 5EYPF 4YVOA 3S7BA 2EQXA 2Y1LE 2OVBA 3G2WA 3GYZA 2WMNA 4O1OA 5ENRD 4F1PA 2NC9A 4HRMB 2A5EA 3LY9A 2XQ0A 3Q47B 4NACA 2EIJE 4AP2A 4C9BB 3HXFA 3ONKA 4OVVA 2GW1A 5AN8A 3AU4A 4HNAD 2OVFA 2PNNA 3GW4A 3C98A 4N5QA 5BUZA 2FO7A 4UQYA 5BW8C 1ELKA 3MZLB 2B6CA 3ZVVA 5ENQD 2HM8A 3DSVA 3P1UA 2HE0A 3NOGD 5HRYA 4XIFA 5T3RA 2LUHA 5AQAA 2X6JA 3D9MA 3E34A 5LFAA 4TUMA 4GZ6A 3LCAA 3MCXA 3ZHEB 2X6IA 2FULA 2PZIA 2RKKA 5EDSA 1Y6IA 2GGFA 4DLOA 2YHEA 4KYOB 3FH5A 1VDYA 3AJIA 4N2SA 5A6CA 4AM9A 5FJYA 2YQ8A 2KCKA 5LCWC 2J09A 3QK0A 4BX9A 3P2BA 4Y6CA 5ARGA 1E8WA 2XGMA 3ZGQA 5AIJA 3S2AA 3UINC 2YINA 1OCRE 3ONLA 3ZYKA 2F37A 1BU9A 4JVSA 2R02A 2RG8A 1TJCA 2EIKE 2PL2A 1E7VA 4Y6WA 1YYHA 3FTVA 4EQFA 3B7RL 5DBKA 3RRNB 1H2VC 3D9JA 2V0PA 2IFUA 2Y3AA 2NYJA 1SZAA 5CMYA 5G05J 2OCCE 3MV2B 3CR3A 5FQ7A 4YVQC 2I2OA 2WXQA 5CBOA 4FU3A 4N39A 3APFA 5C1DA 2AWIA 4KXKB 4C0MA 4HFGA 2VSYA 2WM9A 4I1AA 4BETA 5KCMA 2UWJG 3E33A 2V5FA 3TWUA 4A3TA 4A55A 2CHXA 2QYJA 2MYOA 3FEYA 3HXCA 4FULA 1OCCE 4DX7D 2IQCA 3QKYA 4G1TA 3AG3E 3CVYA 4TRQA 3TXMA 4UWFA 1NL4A 3T5XA 1OT8A 2WXIA 1EF1C 3IBEA 4IRUA 4BTAA 3FTSA 4GTRA 3UT7A 3JUIA 3ZXPA 3OAWA 3RO2A 2MOWA 1V54E 4EZJA 4ABNA 4HLLA 2QFCA 4U04A 4X8QA 1BLXB 3DSSA 2VQ2A 2DZOA 3HXDA 4GTSA 1WG0A 4NIKA 3PUJA 3FTXA 4G25A 4EZKA 4HOUA 1RW2A 4WNGA 5FIOA 1Q2ZA 2IY0C 3G2SA 4O6FA 3FUKA 5BXUA 2CFUA 3MJWA 4CGVA 3ZNGA 2VGXA 3VTYA 2JEKA 4MS6A 2VGEA 4U07A 4JD2G 4F3VA 3U3WA 4OAUC 1SA5A 3O4ZA 1O5MA 4HS2A 2X6KA 3R7QA 3QNKA 3DSXA 4GTQA 1TJFA 4KVMA 3LJNA 3W9GA 4K03A 1MZCA 3LJ3A 3C3OA 4GA0A 3SFYA 4KT6B 4D10C 1FPPA 1JWGA 2I6HA 5D66A 2LXMA 4I9EA 3UKRG 2J4BA 2GROB 4L9PA 3ZN3A 3BU8A 4AY5A 1GW6A 1WAO1 3MV3B 4BY6A 2QZAA 5LX8A 5KNGA 5FWQA 3PRZA 4GTVA 3TWWA 1DCEA 2DVWA 2KC7A 1OWLA 3FU5A 2V5QC 1JCRA 3ZW3A 4BSXA 4GCNA 5EKQD 4OYSA 3ASOE 3CKCA 5CRVA 2A5UA 2ETBA 2XEHA 4H7YA 2WXPA 2XENA 2V4LA 5KBAA 3N71A 3S7DA 1N9AA 2IF4A 3LDZA 4WWOA 3RRUA 4HOQA 5BT1A 4G8LA 1JCSA 3CQCB 4UWKA 4AXHA 4F53A 2IEJA 1OUVA 3HXEA 3C3RA 1S0PA 1OCZE 3R9AB 1S63A 4GYYA 4PH4B 1OWPA 5B3SE 3CHPA 2XPYA 3I3NA 1N4RA 3HDXA 5J08A 3FDHA 3PREA 2MRIA 3OXLA 1YCSB 1KT0A 1UG3A 4PS7A 3UMVA 2KCVA 3KD7A 1H0AA 3Q7FA 1KPSB 3SQVA 2HYZA 3RAUA 2BF0X 2R59A 1JUQA 3Q7AA 3TJPA 1N95A 4A63B 3LVRE 3E4BA 2VGXB 1LF8A 2VYIA 2KZTB 4LEUA 4DX1A 3CIAA 4PS3A 1O1SA 4GAAA 2VSNA 4ILHB 2H6IA 3PDNA 3AU5A 3CVNA 4ILIA 3DSUA 3PNLB 4G8KA 1Z5SC 2WXJA 4JA7A 2ILRA 4ATGA 5CEDB 3FUMA 5JA4D 4GPKA 1N4QA 5CCLA 3UI2A 2J07A 3EU5A 4CEMA 3FY4A 1OWNA 1PC2A 4O60A 3L6AA 5FQ4A 2VSOE 1E8YA 2ZGDA 3L08A 2YHCA 3PZ1A 1TNZA 2J4DA 2WXMA 3BG0B 3FULA 3L13A 5ENSD 5KNHD 4BESA 4FJZA 4HQDA 2QY7A 5G55A 2GRLA 3FFLA 1HO8A 4FC8A 3ULYA 2ETAA 3CVUA 1SQMA 1FT2A 4U7EB 4G2VA 2WQ7A 5D2MC 2H6HA 1EDUA 3FUHA 1KZPA 5CHEE 4ATZD 1N54A 3C72A 1H2TC 2C0LA 3PEUB 4O1PA 2XZTG 2L6JA 2XGOA 2IJGX 2X6HA 3ENEA 3IXEA 4TV3A 2RFAA 4JC8A
chains in the Genus database with same CATH topology
3Q5MA 1YA0A 4B8CB 4EBAG 3ASGA 5JHBA 4N3CA 5ANLA 4JEUA 4KBQA 2FEZA 4BX8A 2RG8A 1TJCA 4B89A 2WB2A 2XGSA 2PL2A 3EDTB 4DI3A 3D9LA 1E8XA 1E7VA 4GU5A 4Y6WA 3HIZA 3QAQA 4XE0A 5FTPA 3TL5A 3LYAA 5FZRA 5LOZA 3FTVA 4WUYA 3PS6A 3IHVA 4EQFA 1NA3A 4JA9A 2LAHA 3AS5A 1H6KA 2L9BA 2I9CA 3PEVB 2L0IA 3APDA 4PUCA 4AOFA 4AJWA 4CCAA 3CHQA 5KJNA 2WXLA 3LEWA 5FQ8A 3B7RL 3CVQA 1EYHA 5DBKA 4GMLA 4GZDA 2J9QA 2AVPA 3RRNB 4HORA 2WQ6A 3DBSA 3T8MA 1H2VC 2ONDA 4L23A 3D9JA 5JJTA 2V0PA 3LKUA 2IFUA 3CSFA 2Y3AA 4I6GA 3RIBA 3MKRA 3FUEA 5AYWD 5CCMA 1SZAA 5CMYA 5G05J 2KZTA 3KAEA 3MV2B 5D0OD 3CR3A 3L16A 5FQ7A 4YNDA 4WNDA 5KJKA 3CHRA 4DPRA 4J0UA 4YVQC 3ZYLA 2I2OA 2WXQA 1WM5A 3FH7A 4AV7A 4WAFA 4WWNA 5LCWJ 3JCKC 3OXGA 3ZFWA 4FA6A 4FU3A 5T8IA 4L7TA 4N39A 4PDXA 3JYSA 2XHEA 4GA1A 3CHSA 3IEGA 2IONA 3DPDA 2I1KA 3PZDA 2IOSA 4CT0A 3JQ0A 3APFA 3IKOB 3Q4AB 2Y4UA 5C1DA 3NZUA 3FUNA 3G2TA 3GZ2A 3ULQA 4EBAA 2AWIA 2CG2A 4I1MA 1HG5A 3ZPJA 4I2WA 1INZA 4KXKB 4I9CA 4C0MA 3CLJA 3CVLA 1FCHA 4HFGA 3FU6A 2VSYA 3FHEA 3ZIMA 2WM9A 3SI5A 4I1AA 1UN8A 1IHGA 4URKA 1JWFA 3URZA 1E8ZA 2HO1A 4HVBA 5KCMA 2UWJG 3HHMA 2XRYA 1MQSA 2V5FA 4A3TA 4CDNA 2LSVA 4A55A 4HXIA 2CHXA 2P58C 3FEYA 4FULA 1X5BA 4GYOA 4GYWA 4XZ4A 3CSTA 2KM4A 2CHZA 3CK7A 4MLPA 2IQCA 3QKYA 2PQNA 4G1TA 3S7JA 4G23A 3LY7A 2BTDA 4JHJA 3CVYA 4JL0A 3O48A 4TRQA 3TXMA 3CVVA 1W3BA 4JW1A 3R7RA 4A3VA 4UWFA 2VTBB 5AJLA 4N3BA 4G11A 4B94A 3T5XA 3FU3A 1ZBPA 3HVEA 2WXIA 4I17A 1EF1C 5BV1A 3IBEA 2FI7A 4IRUA 4BTAA 4DI4A 3D9PA 3MGBA 4ANUA 1Y8MA 4FLHA 4BT8A 3U64A 1EPUA 4LRZA 3FTSA 3FTUA 4BWRA 1XGWA 2MHKA 2RD0A 2X38A 3G2UA 3JUIA 3QC1A 5FZSA 3UT7A 4C0EA 4J8DA 4HLEA 3OAWA 3RO2A 5EX3A 3SHFA 3AS4A 2MOWA 3ASDA 3QWWA 3CVXA 4RSYA 4EZJA 4K0RA 5KJMA 2HR2A 5EX0A 4ABNA 3PE4A 2XCBA 2QFCA 4I6EA 4U04A 1Z3XA 2NXPA 4ACKA 3FTZA 4NQ0A 2AXVA 2VQ2A 2OOEA 1HZ4A 4P29A 4ACLA 4IYPA 4F7AA 5ENNA 2AW6A 4Q96A 3QDNA 2YNQA 4JXTA 3SZ7A 4JHRA 1UJKA 3LY8A 3TG4A 4RG6A 2L0TB 3VLEA 3PUJA 3RK6A 4KMOA 3MYVA 3FTXA 4FLBA 2BUGA 4G25A 5ANRA 4CGWA 2X3MA 4GB9A 4EZKA 1HS6A 4HOUA 4UWGA 4A1GA 2PQRA 4DLQA 1QQEA 4UWLA 4WNGA 1E90A 3L17A 4AVXA 3L22A 2PM6A 3I5PA 3L54A 3ML8A 1IQRA 3UQ3A 3UT8A 1WY6A 3MX3A 3FH8A 3G2SA 4IN3B 4O6FA 1N52A 3PVLA 3QWPA 3FUKA 2J08A 2AXZA 1HG2A 4DK5A 3SBSA 2CFUA 3MJWA 4TUUA 4CGVA 4APFA 3T5VA 4AEZC 4LCTA 2LAIA 2VGXA 3LPZA 3VTYA 4AIFA 4I1OB 2Y4TA 2JEKA 1U3CA 4MS6A 2NSZA 3PNTB 4I2ZA 3D3MA 4DJAA 3ASHA 3ASFA 5A23A 1DVPA 4U07A 2E0IA 4U0ZA 2FBNA 3WXXA 3RU0A 4F3VA 3U3WA 2WXOA 3Q15A 3O4ZA 4R7LA 4UI9C 1UJJA 3HYMB 4HS2A 3ESKA 2X6KA 3UUXA 3R7QA 2LSUA 3ESLA 3QNKA 4L2LA 3S7FA 1TEZA 3SFZA 5CMWA 3EIJA 3Q49B 3OXFA 1TJFA 3CKBA 4KVMA 1OWMA 4IULA 4GZCA 4CDRA 3D9KA 4OVUA 3KEZA 5E75A 4LERA 4U0SA 4UI9K 4K03A 3LJ3A 2XRZA 2XPZA 4UQXA 4FHKA 4GA0A 4FP7A 4AY6A 4J6IA 3U4TA 3CEQA 3TAXA 4GA2A 2J49A 4KT6B 4JEHA 3GZSA 4JPSA 1HH8A 3G2VA 3RKVA 4D10C 5KJLA 1JWGA 3QB2A 2I6HA 4JZYA 3B7UX 3CK8A 3MKQA 4I9EA 4QFVA 1NP7A 2J4BA 3ZN3A 3ZYQA 2WQHA 5BV0A 2A4ZA 1QNFA 4XKCA 4WNFA 4AY5A 1GW6A 3LS8A 1WAO1 3MV3B 4M3OA 2AXUA 3ZHEA 4E6HA 2ZU6B 4GMJA 3MEKA 2UY1A 3FTYA 4I43A 5M72A 4BY6A 1L5JA 3GZ1A 5LX8A 1KLXA 4BFRA 2I1JA 3K9IA 1FVHA 1XNFA 1HX8A 5FWQA 4RG9A 3PRZA 2CHWA 4BT9A 2DIWA 3LVQE 2DCPA 2VGYA 4GZ3A 2WXNA 4E85A 4Q69A 2KATA 2FF4A 2KC7A 1OWLA 1HU3A 5FT9A 4ANXA 3U66A 2VTBA 3FP3A 3FU5A 3NF1A 4HOSA 3ZW3A 3QWVA 4BSXA 4GCNA 3IHYA 2KCLA 3SF4A 5EKQD 4OYSA 3SNXA 5HQ8A 3AS8A 3FUJA 3OTNA 2XCCA 1DNPA 3CKCA 4FHJA 1HFAA 1PY1A 3FUDA 5BPPA 3D9IA 2A5UA 3D9OA 3LXUX 3B7SA 3B13A 3HVEB 5A7DB 3CQGB 3FUFA 4EZLA 3U9WA 5T4YA 4F1SA 3KS2A 4UI9J 3D9NA 4CRWA 4FADA 4H7YA 2WXPA 3NZSA 2V4LA 5ARFA 1H2UA 5LP0A 3N71A 3S7DA 3BEEA 1A17A 3CHOA 3FWVA 3MA5A 4G24A 4J8FA 1NA0A 2IF4A 5FZQA 3LDZA 4J8EA 4WWOA 2WXRA 2Q7FA 4H7XA 2R5SA 4NURA 4HOQA 1NZNA 5G04C 3RRUA 3UT4A 1E96B 1QZ2A 5BT1A 2PM7A 4EPZA 3CQCB 4FJYA 1FVFA 2WXHA 1ZU2A 3VTXA 4UWKA 2M63A 4UQZA 5DIZA 4AXHA 4XI0A 2WXKA 4F53A 3CVPA 5G2NA 1OUVA 3ZEFA 4KZ0A 4I6JA 3CVWA 1S0PA 3R9AB 2LNIA 4GYYA 4PH4B 4V3IA 2WXGA 3SD5A 3FU0A 1OWPA 2JLBA 3IV0A 5E76A 1OWOA 3EIQC 4U63A 4YVOA 3CHPA 3S7BA 2XPYA 2EQXA 3I3NA 3HDXA 2OV8A 5AJDA 5J08A 2OVBA 3FDHA 1IQUA 3G2WA 3PREA 2MRIA 3OXLA 3GYZA 2DBAA 3SBTB 2WMNA 4JHKA 1KT0A 1UG3A 3QOUA 4PS7A 3RRMB 3UMVA 3ZRHA 4HOTA 2KCVA 4W9RA 2NC9A 3KD7A 1H0AA 3QJZA 4ANWA 3CHMA 2IOLA 4MKTA 5BNWA 2WVIA 3BG1B 2HYZA 5FQ6A 5D0QD 3EJNA 2BF0X 2R59A 1H19A 3LY9A 4BTBA 1Z3YA 1JUQA 3ZXSA 4Q94A 1IYGA 2XQ0A 3Q47B 3TJPA 4NRHB 3UX4A 4NACA 3CGHA 3LVRE 4AP2A 4C9BB 3E4BA 3RO3A 4LUNU 2VGXB 3ONKA 2XEVA 1LF8A 4OVVA 2GW1A 2VYIA 2KZTB 3AU4A 4KZCA 2E2EA 4LEUA 3CIAA 1UW4B 4PS3A 2OVFA 4ANVA 2CG3A 4XX5A 4GAAA 3PE3A 3EHMA 2WXFA 3GW4A 3C98A 1P5QA 2VSNA 4ILHB 1JPLA 3PDNA 3AU5A 3CVNA 4ME2A 4UWHA 4ILIA 4B0ZA 5BUZA 3PNLB 2FO7A 1BPOA 4UQYA 5BW8C 2C2LA 2WXJA 4JA7A 2ILRA 4ATGA 1ELKA 1B89A 4XKBA 3MZLB 3FUMA 4PS8A 4L1BA 3ZVVA 3PH0C 3FEXA 2HM8A 3P1UA 2VJ8A 3VLFA 4GPKA 1ELWA 5HI7A 5G04J 3JQ1A 3EHNA 2LO6A 3TGOA 2GRMA 4XIFA 5CCLA 4APOA 2J07A 5T3RA 4CT4A 3QARA 4CEMA 2X6JA 3FY4A 1OWNA 3D9MA 1PC2A 3NQPA 4N5CA 3ZYMA 5LFAA 4L2YA 3L6AA 5FQ4A 2WPVA 4XI9A 5JHAA 2VSOE 1E8YA 3MKQB 3L08A 4GZ6A 2YHCA 3LCAA 2VSXE 1ELRA 4EECA 3I4GA 3MCXA 5J90A 2J4DA 2WXMA 3BG0B 3FULA 3ZHEB 3L13A 2X6IA 4ILGA 2UY1B 2FULA 2PZIA 3B7TA 3FTWA 3UPVA 4G26A 4KVOA 4WWPA 3PUKA 5EDSA 4FJZA 4N2QA 2QY7A 1Y6IA 2WMOA 2C0MA 5G55A 2GGFA 4CDMA 2CFZA 4DLOA 2YHEA 4KYOB 3FH5A 4J8SA 5AENA 5C2YA 2GRLA 3CK9A 1HXIA 3FFLA 1E7UA 1HO8A 1VDYA 5G05C 4FC8A 1HF8A 3CV0A 3FUIA 3SGHA 4N2SA 5A6CA 3CVUA 1SQMA 4AM9A 5FJYA 2YQ8A 2V8SE 4G2VA 1SZ9A 4MRUA 2KCKA 3TXNA 2WQ7A 4WNEA 5LCWC 1EDUA 2IU1A 3TG5A 3FUHA 2J09A 3QK0A 4BX9A 2XPIA 5CHEE 5JJ7A 1MHQA 1N54A 3P2BA 1U3DA 4A1SA 4Y6CA 3ML9A 4RVBA 1H2TC 4GZ5A 1PAQA 3APCA 5ARGA 3RJVA 2C0LA 1E8WA 2XGMA 3ZGQA 5AIJA 3S2AA 3PEUB 2YINA 3I4RB 2X6FA 1KT1A 3VLDA 1HE8A 4U0UA 4U8HA 1UN9A 1Z6TA 3ONLA 5JJ6A 2L6JA 2XGOA 2IJGX 2X6HA 3ENEA 4N3AA 4TV3A 3ZYKA 4GCOA 4B8AA 4JC8A 4JVSA 2R17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5M A;  1YA0 A;  3ASG A;  4N3C A;  4KBQ A;  2FEZ A;  1TJC A;  2XGS A;  2PL2 A;  3EDT B;  4Y6W A;  5FTP A;  3LYA A;  5FZR A;  4WUY A;  4EQF A;  1NA3 A;  4JA9 A;  3AS5 A;  5KJN A;  3CVQ A;  5DBK A;  2J9Q A;  2AVP A;  4HOR A;  2OND A;  5JJT A;  3LKU A;  2IFU A;  3RIB A;  3MKR A;  5AYW D;  5CCM A;  5G05 J;  3MV2 B;  3KAE A;  5D0O D;  4YND A;  4WND A;  5KJK A;  4J0U A;  4YVQ C;  1WM5 A;  5LCW J;  3ZFW A;  3OXG A;  4N39 A;  3JYS A;  4GA1 A;  3IEG A;  3Q4A B;  2Y4U A;  5C1D A;  3GZ2 A;  3ULQ A;  3ZPJ A;  4I2W A;  4KXK B;  4I9C A;  3CVL A;  1FCH A;  2VSY A;  4I1A A;  1IHG A;  3URZ A;  2HO1 A;  2UWJ G;  2V5F A;  2LSV A;  2P58 C;  4GYW A;  4GYO A;  3CK7 A;  3QKY A;  2PQN A;  4G1T A;  3S7J A;  4G23 A;  3LY7 A;  4JL0 A;  3O48 A;  1W3B A;  4N3B A;  4B94 A;  1ZBP A;  4I17 A;  2FI7 A;  4BTA A;  1Y8M A;  4BT8 A;  4BWR A;  2MHK A;  5FZS A;  4J8D A;  3RO2 A;  5EX3 A;  3AS4 A;  3ASD A;  3QWW A;  5KJM A;  2HR2 A;  5EX0 A;  4ABN A;  3PE4 A;  2XCB A;  2QFC A;  4U04 A;  4NQ0 A;  2VQ2 A;  2OOE A;  1HZ4 A;  3QDN A;  3SZ7 A;  4JHR A;  3LY8 A;  3TG4 A;  4RG6 A;  2BUG A;  4G25 A;  4CGW A;  4HOU A;  2PQR A;  1QQE A;  4WNG A;  3UQ3 A;  4IN3 B;  4O6F A;  3QWP A;  4CGV A;  2VGX A;  3VTY A;  3LPZ A;  4AIF A;  2Y4T A;  4I2Z A;  3ASH A;  3ASF A;  4U0Z A;  4U07 A;  2FBN A;  3WXX A;  3RU0 A;  4F3V A;  3U3W A;  3Q15 A;  4UI9 C;  3HYM B;  3ESK A;  3UUX A;  2LSU A;  3S7F A;  3Q49 B;  3OXF A;  3CKB A;  4CDR A;  4U0S A;  4UI9 K;  4UQX A;  4GA0 A;  4AY6 A;  3U4T A;  3CEQ A;  3TAX A;  4GA2 A;  5KJL A;  1HH8 A;  3RKV A;  2I6H A;  3CK8 A;  4I9E A;  3ZN3 A;  2WQH A;  4WNF A;  4AY5 A;  3ZHE A;  1WAO 1;  3MV3 B;  3MEK A;  2UY1 A;  5M72 A;  3GZ1 A;  1KLX A;  3K9I A;  1XNF A;  4RG9 A;  4BT9 A;  2VGY A;  4GZ3 A;  2KAT A;  2FF4 A;  2KC7 A;  5FT9 A;  3FP3 A;  3NF1 A;  4HOS A;  3QWV A;  4GCN A;  2KCL A;  3SF4 A;  5EKQ D;  5HQ8 A;  3AS8 A;  2XCC A;  3CKC A;  5A7D B;  3KS2 A;  4UI9 J;  4H7Y A;  5ARF A;  3N71 A;  3S7D A;  3BEE A;  1A17 A;  3FWV A;  3MA5 A;  4G24 A;  4J8F A;  1NA0 A;  2IF4 A;  5FZQ A;  4J8E A;  4H7X A;  2Q7F A;  2R5S A;  5G04 C;  4HOQ A;  1NZN A;  1E96 B;  1QZ2 A;  5BT1 A;  1ZU2 A;  3VTX A;  4UQZ A;  5DIZ A;  4XI0 A;  3CVP A;  1OUV A;  3R9A B;  2LNI A;  4GYY A;  2JLB A;  4YVO A;  3S7B A;  3OXL A;  3GYZ A;  2DBA A;  1KT0 A;  3QOU A;  4HOT A;  2KCV A;  4W9R A;  2NC9 A;  3KD7 A;  5BNW A;  2HYZ A;  5D0Q D;  3LY9 A;  4BTB A;  1IYG A;  3Q47 B;  4NRH B;  3E4B A;  3RO3 A;  2VGX B;  2XEV A;  2GW1 A;  2VYI A;  2E2E A;  4LEU A;  3PE3 A;  3GW4 A;  1P5Q A;  2VSN A;  3PDN A;  3CVN A;  4ME2 A;  2FO7 A;  4UQY A;  5BW8 C;  2C2L A;  4JA7 A;  1B89 A;  4GPK A;  1ELW A;  5HI7 A;  5G04 J;  3TGO A;  4XIF A;  5CCL A;  4APO A;  1PC2 A;  4N5C A;  2WPV A;  4XI9 A;  4GZ6 A;  2YHC A;  3LCA A;  1ELR A;  3ZHE B;  2UY1 B;  2PZI A;  3UPV A;  4G26 A;  4N2Q A;  2C0M A;  4KYO B;  3CK9 A;  1HXI A;  3FFL A;  5G05 C;  3CV0 A;  4N2S A;  5A6C A;  4AM9 A;  5FJY A;  2YQ8 A;  4G2V A;  2KCK A;  4WNE A;  5LCW C;  3TG5 A;  2XPI A;  5CHE E;  5JJ7 A;  4A1S A;  4Y6C A;  4GZ5 A;  5ARG A;  3RJV A;  2C0L A;  2XGM A;  3ZGQ A;  1KT1 A;  4U0U A;  5JJ6 A;  2L6J A;  2XGO A;  4N3A A;  4GCO A; 
#chains in the Genus database with same CATH topology
 3EHR A;  3ASG A;  5ANL A;  1YMP A;  3Q78 A;  5CBN A;  2XGS A;  4DI3 A;  1E8X A;  3DSW A;  2P9K G;  3QAQ A;  5FTP A;  3TL5 A;  3LYA A;  5FZR A;  5LOZ A;  3PS6 A;  3IHV A;  4AJW A;  2L9B A;  2I9C A;  5KJN A;  3CHQ A;  2WXL A;  3CVQ A;  4GPM A;  4EHM A;  2R2L A;  2J9Q A;  2EIM E;  3DRA A;  3DBS A;  4L23 A;  5JJT A;  4TXP A;  4ZHB A;  3LKU A;  4I6G A;  5CEC B;  3C3Q A;  3KAE A;  1WDY A;  1D8D A;  2P9I G;  4YND A;  3ZYL A;  4WAF A;  4WWN A;  5LCW J;  4FA6 A;  4GTM A;  3E30 A;  2XHE A;  2F8X K;  2I1K A;  1N0R A;  2P2C P;  4CT0 A;  2QYU A;  3NZU A;  3FUN A;  3JUE A;  3E32 A;  1HG5 A;  1INZ A;  3FU6 A;  1S70 B;  3ZIM A;  1E8Z A;  3HHM A;  2P58 C;  1N11 A;  3CK7 A;  4G23 A;  4B93 B;  2BTD A;  3AG2 E;  3O48 A;  3R7R A;  3PZ3 A;  2VTB B;  3DWL G;  4G11 A;  1ZBP A;  3HVE A;  4I17 A;  5BV1 A;  1SA4 A;  2ZIS A;  3D9P A;  4ANU A;  4FLH A;  4J8Y A;  2AJA A;  3U64 A;  4LRZ A;  3RSE G;  1AWC B;  1XGW A;  2MHK A;  2RD0 A;  4C0E A;  3G2U A;  5FZS A;  1IKN D;  1MYO A;  3ASD A;  2DWZ A;  3TWR A;  1JCQ A;  1N94 A;  4K0R A;  5KJM A;  2ZXW E;  1TYQ G;  2DYS E;  3PZ2 A;  2ZIR A;  1HZ4 A;  4IYP A;  4F7A A;  4Q96 A;  2R05 A;  3SZ7 A;  4JHR A;  1X81 A;  3LY8 A;  4RG6 A;  2L0T B;  1BD8 A;  3ABK E;  3DEP A;  2X3M A;  4UWG A;  4DLQ A;  4UWL A;  3L17 A;  3L54 A;  3UQ3 A;  1N52 A;  3QWP A;  4TXQ A;  2J08 A;  3UIO C;  3SBS A;  4HRL A;  4AEZ C;  2LAI A;  2XS8 A;  4I1O B;  4BEP A;  1U3C A;  4DX2 A;  2NSZ A;  1O1T A;  4DJA A;  3ASH A;  5A23 A;  1DVP A;  2E0I A;  1UJJ A;  3HYM B;  3ESL A;  5CMW A;  2L6B A;  3Q49 B;  4IUL A;  4OVU A;  5E75 A;  2Y0B G;  4UI9 K;  3Q79 A;  3CEQ A;  1V55 E;  3GZS A;  5KJL A;  1TN7 A;  3G2V A;  1K1B A;  3RKV A;  4LNU D;  3QB2 A;  4JZY A;  4QFV A;  1NP7 A;  2LXL A;  2WQH A;  2A4Z A;  5BV0 A;  4M3O A;  5EYL A;  3FTY A;  1L5J A;  3GZ1 A;  3K9I A;  1XNF A;  1HX8 A;  2DIW A;  2VGY A;  4E85 A;  4Q69 A;  3V2X A;  3D9H A;  3ZKJ A;  3Q73 A;  2KCL A;  3OTN A;  1PY1 A;  2GRR B;  3LXU X;  3NAW A;  3B13 A;  3HVE B;  3U9W A;  1DCQ A;  5T4Y A;  4F1S A;  1IHB A;  4F6R D;  4FAD A;  3NZS A;  1H2U A;  3SFX A;  3ABL E;  3BEE A;  3CHO A;  2WXR A;  2Q7F A;  5G04 C;  1NZN A;  1NFI E;  2PM7 A;  2GRQ B;  4EPZ A;  5AQ9 A;  4FJY A;  2WXH A;  3VTX A;  2QC9 A;  4UQZ A;  5DIZ A;  4DX5 D;  1D8E A;  2OEW A;  3ZEF A;  4KZ0 A;  4I6J A;  3CVW A;  2LNI A;  2P9P G;  4V3I A;  2WXG A;  2KBX A;  3FU0 A;  3IV0 A;  2JLB A;  1OWO A;  3JXI A;  3DEO A;  4U63 A;  3TWQ A;  2J8S D;  1OY3 D;  2OV8 A;  3ZRH A;  4JHK A;  5CER B;  3ASN E;  4W9R A;  1O1R A;  4ANW A;  3UTM A;  2IOL A;  4MKT A;  3BG1 B;  3NB2 A;  1H19 A;  4BTB A;  1IYG A;  4NRH B;  3X2Q E;  3RO3 A;  2XEV A;  4HI8 A;  4KZC A;  2E2E A;  1KZO A;  3ZU7 B;  2CG3 A;  4ZFH A;  1TR4 A;  2WXF A;  3EHM A;  3T9K A;  4UWH A;  3ABM E;  4B0Z A;  1BPO A;  2C2L A;  1B89 A;  4PS8 A;  4L1B A;  3PH0 C;  2F8Y A;  3VLF A;  1ELW A;  5HI7 A;  3JQ1 A;  1MX2 A;  3QAR A;  3EU9 A;  3NQP A;  2XS1 A;  4L2Y A;  5JHA A;  2FO1 E;  3C5R A;  4LSZ E;  2Y69 E;  5HKP A;  4EEC A;  1RZ4 A;  3SY2 A;  4ILG A;  3FTW A;  3AG1 E;  3UPV A;  3V79 K;  4G26 A;  4WWP A;  4N2Q A;  3CK9 A;  3SGH A;  2V8S E;  4MRU A;  4MBG A;  3TXN A;  2IU1 A;  1ZB1 A;  3T8K A;  3ML9 A;  4RVB A;  1PAQ A;  3R9M A;  3APC A;  3V30 A;  3RJV A;  2IO3 C;  3I4R B;  3VLD A;  2X6F A;  1KT1 A;  1S64 A;  4U0U A;  1UN9 A;  1Z6T A;  4N3A A;  4GCO A;  4DK5 A;  1OXJ A;  2R17 C;  2P9U G;  4B8C B;  4EBA G;  5JHB A;  4N3C A;  4JEU A;  1MJ0 A;  4KBQ A;  2FEZ A;  2ZGG A;  4BX8 A;  2WB2 A;  3HIZ A;  1NA3 A;  4JA9 A;  2LAH A;  3AS5 A;  1H6K A;  3APD A;  4CCA A;  5FQ8 A;  1EYH A;  5AAO A;  2IO2 C;  4GML A;  4GZD A;  4OAV B;  2AVP A;  2WQ6 A;  5EIB E;  2OND A;  3RIB A;  3MKR A;  4K5A B;  5AYW D;  1BI7 B;  5D0O D;  4DPR A;  2OEV A;  3FH7 A;  3UM0 A;  3UKU G;  4AV7 A;  3JCK C;  3ZFW A;  3HRA A;  4PDX A;  4GA1 A;  3CHS A;  2ION A;  3DPD A;  3PZD A;  4J7W A;  2IOS A;  3IKO B;  3GZ2 A;  4EBA A;  4I1M A;  2CG2 A;  3ZPJ A;  4I2W A;  3Q9N C;  3CVL A;  1FCH A;  1SW6 A;  4LG6 A;  3SI5 A;  1UN8 A;  2BKG A;  1JWF A;  3URZ A;  2HO1 A;  1OCO E;  4GTO A;  4GYW A;  2KM4 A;  5FIN A;  5EIL A;  4MLP A;  4JHJ A;  4JL0 A;  4JW1 A;  5B1B E;  4N3B A;  5B1A E;  3TWV A;  4B94 A;  2FI7 A;  3MGB A;  1Y8M A;  3E37 A;  1TNB A;  4JB8 P;  3ZUV B;  2X38 A;  4HLE A;  5EX3 A;  3AS4 A;  3CVX A;  4RSY A;  2HR2 A;  1AP7 A;  5ENO D;  5AAR A;  3PE4 A;  2XCB A;  2V4H C;  4I6E A;  5ENT D;  2AXV A;  3V2O A;  4P29 A;  3SO8 A;  5ENN A;  2AW6 A;  3QDN A;  2YNQ A;  4JXT A;  2DZN A;  1UJK A;  2XZD G;  3VLE A;  1TNY A;  3RK6 A;  3B95 A;  3MYV A;  3EUV A;  4FLB A;  4GB9 A;  4A1G A;  1E90 A;  3L22 A;  4XEI G;  1IQR A;  1WY6 A;  4IN3 B;  5ENP D;  3WG7 E;  2AXZ A;  4TUU A;  4APF A;  4HBD A;  4AIF A;  1N4S A;  3D3M A;  4U0Z A;  3RU0 A;  3Q15 A;  4UI9 C;  4R7L A;  3UUX A;  3TWT A;  3OXF A;  4CDR A;  3KEZ A;  4M7C A;  3HXB A;  3HG0 D;  4UQX A;  4J6I A;  4TXR A;  3U4T A;  4GA2 A;  4YDE A;  4JEH A;  1U2V G;  3B7U X;  3MKQ A;  4CYM D;  2GRP B;  3ZYQ A;  4XKC A;  3KSL A;  2EIN E;  4E6H A;  2ZU6 B;  4GMJ A;  2UY1 A;  1MX6 A;  5CEA A;  2I1J A;  2CHW A;  1K3Z D;  4RQI A;  2WXN A;  2FF4 A;  5FT9 A;  4QQI A;  3NF1 A;  1FT1 A;  3QWV A;  4BER A;  5KWD A;  3SNX A;  2XCC A;  1HFA A;  3JXJ A;  3FUD A;  3Q75 A;  5BPP A;  3L82 A;  2H6F A;  3D9I A;  3B7S A;  1K8K G;  3FWV A;  3L9T A;  4G24 A;  3NBN B;  4J8E A;  3UT4 A;  1E96 B;  4RLY A;  1FVF A;  2M63 A;  3UM2 A;  5G2N A;  2P9S G;  2RFM A;  5E76 A;  3EIQ C;  4HI9 A;  5AJD A;  5CRU A;  1IQU A;  3SBT B;  2DBA A;  3QOU A;  3RRM B;  4HOT A;  2F0Y A;  3QJZ A;  3CHM A;  3TWX A;  5BNW A;  1H6P A;  2WVI A;  5FQ6 A;  5D0Q D;  3W9F A;  3EJN A;  1Z3Y A;  3ZXS A;  4Q94 A;  3ULE G;  3UX4 A;  3CGH A;  4LUN U;  1UW4 B;  4ANV A;  4XX5 A;  3PE3 A;  1P5Q A;  3F6Q A;  1JPL A;  5IY5 E;  4ME2 A;  3AAA C;  4XKB A;  2P9L G;  4LNG A;  3Q9U C;  3FEX A;  1LD7 A;  2VJ8 A;  5G04 J;  3EHN A;  2LO6 A;  3TGO A;  2GRM A;  4APO A;  4CT4 A;  2P9N G;  3ZYM A;  4N5C A;  1K1A A;  1BI8 B;  5AQB A;  2WPV A;  4XI9 A;  1IXV A;  3MKQ B;  3TWS A;  2VSX E;  4YDW A;  1ELR A;  4LNB A;  3I4G A;  5J90 A;  3NOC D;  2UY1 B;  3B7T A;  3J5Q B;  4KVO A;  3PUK A;  2WMO A;  2C0M A;  4CDM A;  1UOH A;  2CFZ A;  4J8S A;  3ISM C;  5C2Y A;  1HXI A;  1E7U A;  5G05 C;  1HF8 A;  3CV0 A;  3FUI A;  1LD8 A;  2GRN B;  1SZ9 A;  4WNE A;  3TG5 A;  5BXO A;  2ETC A;  3AG4 E;  2XPI A;  3UXG A;  5JJ7 A;  1MHQ A;  4A1S A;  1U3D A;  4GZ5 A;  4GTP A;  2JAB A;  1HE8 A;  4U8H A;  2H6G A;  5JJ6 A;  3BUA A;  4B8A A;  4AOF A;  3Q5M A;  1YA0 A;  3UM3 A;  4B89 A;  3EDT B;  3D9L A;  4GU5 A;  4XE0 A;  4WUY A;  3PEV B;  4PUC A;  5AEN A;  2L0I A;  3LEW A;  4GMR A;  5H7P A;  4HOR A;  3T8M A;  3CSF A;  4Z68 A;  3FUE A;  5CCM A;  4U96 D;  1SVX A;  4K5B A;  2KZT A;  3L16 A;  4WND A;  5KJK A;  3CHR A;  4J0U A;  1WM5 A;  3OXG A;  5T8I A;  4L7T A;  1TNU A;  3JYS A;  3IEG A;  4HB5 A;  3JQ0 A;  3Q4A B;  2Y4U A;  2BKK B;  3G2T A;  3ULQ A;  1MX4 A;  4I9C A;  4UUC A;  3CLJ A;  1NI1 A;  3FHE A;  3UM1 A;  1IHG A;  4URK A;  4HVB A;  1MQS A;  2XRY A;  4CDN A;  2LSV A;  4HXI A;  4XZ4 A;  1X5B A;  4GYO A;  3PZ4 A;  3KSQ A;  3CST A;  4U8V D;  2CHZ A;  4CZ2 D;  2PQN A;  3DXM G;  3EHQ A;  3S7J A;  3LY7 A;  3CVV A;  1W3B A;  4A3V A;  5AJL A;  3FU3 A;  2B0O E;  4DI4 A;  4BT8 A;  1EPU A;  3FTU A;  4BWR A;  3QC1 A;  4J8D A;  3SHF A;  5EN5 D;  3QWW A;  4HRN A;  1D9S A;  5EX0 A;  1Z3X A;  2NXP A;  3DXK G;  4ACK A;  3FTZ A;  4NQ0 A;  5AQ7 A;  1N0Q A;  2OOE A;  4ACL A;  4U8Y D;  2EIL E;  3DPY A;  3TG4 A;  4KMO A;  2BUG A;  5ANR A;  4CGW A;  1HS6 A;  2PQR A;  1QQE A;  2KXP C;  4AVX A;  1TNO A;  2PM6 A;  3I5P A;  3ML8 A;  3UT8 A;  3MX3 A;  1H6O A;  3FH8 A;  3PVL A;  1HG2 A;  1TN8 A;  1DC2 A;  3T5V A;  4LCT A;  3LPZ A;  2Y4T A;  3KEA A;  3PNT B;  4I2Z A;  4BSZ B;  3J5P A;  3ASF A;  2FBN A;  3WXX A;  2XEE A;  2WXO A;  1G3N B;  3ESK A;  1LTX A;  2LSU A;  4K5C A;  4L2L A;  3S7F A;  1TEZ A;  3DST A;  3SFZ A;  3EIJ A;  4GTT A;  3V31 A;  3CKB A;  1OWM A;  4GZC A;  3D9K A;  4LER A;  4U0S A;  2XRZ A;  2XPZ A;  4DUI A;  4FHK A;  4AY6 A;  4FP7 A;  2BED A;  3TAX A;  2J49 A;  4JPS A;  1HH8 A;  1N4P A;  3CK8 A;  5JMN D;  1QBQ A;  3B7B A;  1QNF A;  4C48 B;  4WNF A;  3ZHE A;  3LS8 A;  2AXU A;  1TN6 A;  3MEK A;  4I43 A;  3BQO A;  5M72 A;  5ITZ F;  1KLX A;  4BFR A;  1FVH A;  4DRX E;  4RG9 A;  4BT9 A;  3LVQ E;  2DCP A;  4GZ3 A;  4YDO A;  1A5E A;  2KAT A;  1HU3 A;  4ANX A;  3U66 A;  2VTB A;  3FP3 A;  4HOS A;  4YDY A;  3IHY A;  3SF4 A;  5HS0 A;  5HQ8 A;  3AS8 A;  3FUJ A;  4FHJ A;  1DNP A;  3D9O A;  2DYR E;  5A7D B;  3CQG B;  3FUF A;  4EZL A;  3KS2 A;  4UI9 J;  3D9N A;  4CRW A;  4U95 D;  5ARF A;  5LP0 A;  2R03 A;  1QYM A;  1A17 A;  3MA5 A;  4J8F A;  1NA0 A;  3UIP C;  5FZQ A;  4DX6 D;  4H7X A;  2R5S A;  4NUR A;  1QZ2 A;  1ZU2 A;  4XI0 A;  2WXK A;  5EID A;  3CVP A;  3SD5 A;  5EYP F;  4YVO A;  3S7B A;  2EQX A;  2Y1L E;  2OVB A;  3G2W A;  3GYZ A;  2WMN A;  4O1O A;  5ENR D;  4F1P A;  2NC9 A;  4HRM B;  2A5E A;  3LY9 A;  2XQ0 A;  3Q47 B;  4NAC A;  2EIJ E;  4AP2 A;  4C9B B;  3HXF A;  3ONK A;  4OVV A;  2GW1 A;  5AN8 A;  3AU4 A;  4HNA D;  2OVF A;  2PNN A;  3GW4 A;  3C98 A;  4N5Q A;  5BUZ A;  2FO7 A;  4UQY A;  5BW8 C;  1ELK A;  3MZL B;  2B6C A;  3ZVV A;  5ENQ D;  2HM8 A;  3DSV A;  3P1U A;  2HE0 A;  3NOG D;  5HRY A;  4XIF A;  5T3R A;  2LUH A;  5AQA A;  2X6J A;  3D9M A;  3E34 A;  5LFA A;  4TUM A;  4GZ6 A;  3LCA A;  3MCX A;  3ZHE B;  2X6I A;  2FUL A;  2PZI A;  2RKK A;  5EDS A;  1Y6I A;  2GGF A;  4DLO A;  2YHE A;  4KYO B;  3FH5 A;  1VDY A;  3AJI A;  4N2S A;  5A6C A;  4AM9 A;  5FJY A;  2YQ8 A;  2KCK A;  5LCW C;  2J09 A;  3QK0 A;  4BX9 A;  3P2B A;  4Y6C A;  5ARG A;  1E8W A;  2XGM A;  3ZGQ A;  5AIJ A;  3S2A A;  3UIN C;  2YIN A;  1OCR E;  3ONL A;  3ZYK A;  2F37 A;  1BU9 A;  4JVS A;  2R02 A;  2RG8 A;  1TJC A;  2EIK E;  2PL2 A;  1E7V A;  4Y6W A;  1YYH A;  3FTV A;  4EQF A;  3B7R L;  5DBK A;  3RRN B;  1H2V C;  3D9J A;  2V0P A;  2IFU A;  2Y3A A;  2NYJ A;  1SZA A;  5CMY A;  5G05 J;  2OCC E;  3MV2 B;  3CR3 A;  5FQ7 A;  4YVQ C;  2I2O A;  2WXQ A;  5CBO A;  4FU3 A;  4N39 A;  3APF A;  5C1D A;  2AWI A;  4KXK B;  4C0M A;  4HFG A;  2VSY A;  2WM9 A;  4I1A A;  4BET A;  5KCM A;  2UWJ G;  3E33 A;  2V5F A;  3TWU A;  4A3T A;  4A55 A;  2CHX A;  2QYJ A;  2MYO A;  3FEY A;  3HXC A;  4FUL A;  1OCC E;  4DX7 D;  2IQC A;  3QKY A;  4G1T A;  3AG3 E;  3CVY A;  4TRQ A;  3TXM A;  4UWF A;  1NL4 A;  3T5X A;  1OT8 A;  2WXI A;  1EF1 C;  3IBE A;  4IRU A;  4BTA A;  3FTS A;  4GTR A;  3UT7 A;  3JUI A;  3ZXP A;  3OAW A;  3RO2 A;  2MOW A;  1V54 E;  4EZJ A;  4ABN A;  4HLL A;  2QFC A;  4U04 A;  4X8Q A;  1BLX B;  3DSS A;  2VQ2 A;  2DZO A;  3HXD A;  4GTS A;  1WG0 A;  4NIK A;  3PUJ A;  3FTX A;  4G25 A;  4EZK A;  4HOU A;  1RW2 A;  4WNG A;  5FIO A;  1Q2Z A;  2IY0 C;  3G2S A;  4O6F A;  3FUK A;  5BXU A;  2CFU A;  3MJW A;  4CGV A;  3ZNG A;  2VGX A;  3VTY A;  2JEK A;  4MS6 A;  2VGE A;  4U07 A;  4JD2 G;  4F3V A;  3U3W A;  4OAU C;  1SA5 A;  3O4Z A;  1O5M A;  4HS2 A;  2X6K A;  3R7Q A;  3QNK A;  3DSX A;  4GTQ A;  1TJF A;  4KVM A;  3LJN A;  3W9G A;  4K03 A;  1MZC A;  3LJ3 A;  3C3O A;  4GA0 A;  3SFY A;  4KT6 B;  4D10 C;  1FPP A;  1JWG A;  2I6H A;  5D66 A;  2LXM A;  4I9E A;  3UKR G;  2J4B A;  2GRO B;  4L9P A;  3ZN3 A;  3BU8 A;  4AY5 A;  1GW6 A;  1WAO 1;  3MV3 B;  4BY6 A;  2QZA A;  5LX8 A;  5KNG A;  5FWQ A;  3PRZ A;  4GTV A;  3TWW A;  1DCE A;  2DVW A;  2KC7 A;  1OWL A;  3FU5 A;  2V5Q C;  1JCR A;  3ZW3 A;  4BSX A;  4GCN A;  5EKQ D;  4OYS A;  3ASO E;  3CKC A;  5CRV A;  2A5U A;  2ETB A;  2XEH A;  4H7Y A;  2WXP A;  2XEN A;  2V4L A;  5KBA A;  3N71 A;  3S7D A;  1N9A A;  2IF4 A;  3LDZ A;  4WWO A;  3RRU A;  4HOQ A;  5BT1 A;  4G8L A;  1JCS A;  3CQC B;  4UWK A;  4AXH A;  4F53 A;  2IEJ A;  1OUV A;  3HXE A;  3C3R A;  1S0P A;  1OCZ E;  3R9A B;  1S63 A;  4GYY A;  4PH4 B;  1OWP A;  5B3S E;  3CHP A;  2XPY A;  3I3N A;  1N4R A;  3HDX A;  5J08 A;  3FDH A;  3PRE A;  2MRI A;  3OXL A;  1YCS B;  1KT0 A;  1UG3 A;  4PS7 A;  3UMV A;  2KCV A;  3KD7 A;  1H0A A;  3Q7F A;  1KPS B;  3SQV A;  2HYZ A;  3RAU A;  2BF0 X;  2R59 A;  1JUQ A;  3Q7A A;  3TJP A;  1N95 A;  4A63 B;  3LVR E;  3E4B A;  2VGX B;  1LF8 A;  2VYI A;  2KZT B;  4LEU A;  4DX1 A;  3CIA A;  4PS3 A;  1O1S A;  4GAA A;  2VSN A;  4ILH B;  2H6I A;  3PDN A;  3AU5 A;  3CVN A;  4ILI A;  3DSU A;  3PNL B;  4G8K A;  1Z5S C;  2WXJ A;  4JA7 A;  2ILR A;  4ATG A;  5CED B;  3FUM A;  5JA4 D;  4GPK A;  1N4Q A;  5CCL A;  3UI2 A;  2J07 A;  3EU5 A;  4CEM A;  3FY4 A;  1OWN A;  1PC2 A;  4O60 A;  3L6A A;  5FQ4 A;  2VSO E;  1E8Y A;  2ZGD A;  3L08 A;  2YHC A;  3PZ1 A;  1TNZ A;  2J4D A;  2WXM A;  3BG0 B;  3FUL A;  3L13 A;  5ENS D;  5KNH D;  4BES A;  4FJZ A;  4HQD A;  2QY7 A;  5G55 A;  2GRL A;  3FFL A;  1HO8 A;  4FC8 A;  3ULY A;  2ETA A;  3CVU A;  1SQM A;  1FT2 A;  4U7E B;  4G2V A;  2WQ7 A;  5D2M C;  2H6H A;  1EDU A;  3FUH A;  1KZP A;  5CHE E;  4ATZ D;  1N54 A;  3C72 A;  1H2T C;  2C0L A;  3PEU B;  4O1P A;  2XZT G;  2L6J A;  2XGO A;  2IJG X;  2X6H A;  3ENE A;  3IXE A;  4TV3 A;  2RFA A;  4JC8 A; 
#chains in the Genus database with same CATH homology
 3Q5M A;  1YA0 A;  4B8C B;  4EBA G;  3ASG A;  5JHB A;  4N3C A;  5ANL A;  4JEU A;  4KBQ A;  2FEZ A;  4BX8 A;  2RG8 A;  1TJC A;  4B89 A;  2WB2 A;  2XGS A;  2PL2 A;  3EDT B;  4DI3 A;  3D9L A;  1E8X A;  1E7V A;  4GU5 A;  4Y6W A;  3HIZ A;  3QAQ A;  4XE0 A;  5FTP A;  3TL5 A;  3LYA A;  5FZR A;  5LOZ A;  3FTV A;  4WUY A;  3PS6 A;  3IHV A;  4EQF A;  1NA3 A;  4JA9 A;  2LAH A;  3AS5 A;  1H6K A;  2L9B A;  2I9C A;  3PEV B;  2L0I A;  3APD A;  4PUC A;  4AOF A;  4AJW A;  4CCA A;  3CHQ A;  5KJN A;  2WXL A;  3LEW A;  5FQ8 A;  3B7R L;  3CVQ A;  1EYH A;  5DBK A;  4GML A;  4GZD A;  2J9Q A;  2AVP A;  3RRN B;  4HOR A;  2WQ6 A;  3DBS A;  3T8M A;  1H2V C;  2OND A;  4L23 A;  3D9J A;  5JJT A;  2V0P A;  3LKU A;  2IFU A;  3CSF A;  2Y3A A;  4I6G A;  3RIB A;  3MKR A;  3FUE A;  5AYW D;  5CCM A;  1SZA A;  5CMY A;  5G05 J;  2KZT A;  3KAE A;  3MV2 B;  5D0O D;  3CR3 A;  3L16 A;  5FQ7 A;  4YND A;  4WND A;  5KJK A;  3CHR A;  4DPR A;  4J0U A;  4YVQ C;  3ZYL A;  2I2O A;  2WXQ A;  1WM5 A;  3FH7 A;  4AV7 A;  4WAF A;  4WWN A;  5LCW J;  3JCK C;  3OXG A;  3ZFW A;  4FA6 A;  4FU3 A;  5T8I A;  4L7T A;  4N39 A;  4PDX A;  3JYS A;  2XHE A;  4GA1 A;  3CHS A;  3IEG A;  2ION A;  3DPD A;  2I1K A;  3PZD A;  2IOS A;  4CT0 A;  3JQ0 A;  3APF A;  3IKO B;  3Q4A B;  2Y4U A;  5C1D A;  3NZU A;  3FUN A;  3G2T A;  3GZ2 A;  3ULQ A;  4EBA A;  2AWI A;  2CG2 A;  4I1M A;  1HG5 A;  3ZPJ A;  4I2W A;  1INZ A;  4KXK B;  4I9C A;  4C0M A;  3CLJ A;  3CVL A;  1FCH A;  4HFG A;  3FU6 A;  2VSY A;  3FHE A;  3ZIM A;  2WM9 A;  3SI5 A;  4I1A A;  1UN8 A;  1IHG A;  4URK A;  1JWF A;  3URZ A;  1E8Z A;  2HO1 A;  4HVB A;  5KCM A;  2UWJ G;  3HHM A;  2XRY A;  1MQS A;  2V5F A;  4A3T A;  4CDN A;  2LSV A;  4A55 A;  4HXI A;  2CHX A;  2P58 C;  3FEY A;  4FUL A;  1X5B A;  4GYO A;  4GYW A;  4XZ4 A;  3CST A;  2KM4 A;  2CHZ A;  3CK7 A;  4MLP A;  2IQC A;  3QKY A;  2PQN A;  4G1T A;  3S7J A;  4G23 A;  3LY7 A;  2BTD A;  4JHJ A;  3CVY A;  4JL0 A;  3O48 A;  4TRQ A;  3TXM A;  3CVV A;  1W3B A;  4JW1 A;  3R7R A;  4A3V A;  4UWF A;  2VTB B;  5AJL A;  4N3B A;  4G11 A;  4B94 A;  3T5X A;  3FU3 A;  1ZBP A;  3HVE A;  2WXI A;  4I17 A;  1EF1 C;  5BV1 A;  3IBE A;  2FI7 A;  4IRU A;  4BTA A;  4DI4 A;  3D9P A;  3MGB A;  4ANU A;  1Y8M A;  4FLH A;  4BT8 A;  3U64 A;  1EPU A;  4LRZ A;  3FTS A;  3FTU A;  4BWR A;  1XGW A;  2MHK A;  2RD0 A;  2X38 A;  3G2U A;  3JUI A;  3QC1 A;  5FZS A;  3UT7 A;  4C0E A;  4J8D A;  4HLE A;  3OAW A;  3RO2 A;  5EX3 A;  3SHF A;  3AS4 A;  2MOW A;  3ASD A;  3QWW A;  3CVX A;  4RSY A;  4EZJ A;  4K0R A;  5KJM A;  2HR2 A;  5EX0 A;  4ABN A;  3PE4 A;  2XCB A;  2QFC A;  4I6E A;  4U04 A;  1Z3X A;  2NXP A;  4ACK A;  3FTZ A;  4NQ0 A;  2AXV A;  2VQ2 A;  2OOE A;  1HZ4 A;  4P29 A;  4ACL A;  4IYP A;  4F7A A;  5ENN A;  2AW6 A;  4Q96 A;  3QDN A;  2YNQ A;  4JXT A;  3SZ7 A;  4JHR A;  1UJK A;  3LY8 A;  3TG4 A;  4RG6 A;  2L0T B;  3VLE A;  3PUJ A;  3RK6 A;  4KMO A;  3MYV A;  3FTX A;  4FLB A;  2BUG A;  4G25 A;  5ANR A;  4CGW A;  2X3M A;  4GB9 A;  4EZK A;  1HS6 A;  4HOU A;  4UWG A;  4A1G A;  2PQR A;  4DLQ A;  1QQE A;  4UWL A;  4WNG A;  1E90 A;  3L17 A;  4AVX A;  3L22 A;  2PM6 A;  3I5P A;  3L54 A;  3ML8 A;  1IQR A;  3UQ3 A;  3UT8 A;  1WY6 A;  3MX3 A;  3FH8 A;  3G2S A;  4IN3 B;  4O6F A;  1N52 A;  3PVL A;  3QWP A;  3FUK A;  2J08 A;  2AXZ A;  1HG2 A;  4DK5 A;  3SBS A;  2CFU A;  3MJW A;  4TUU A;  4CGV A;  4APF A;  3T5V A;  4AEZ C;  4LCT A;  2LAI A;  2VGX A;  3LPZ A;  3VTY A;  4AIF A;  4I1O B;  2Y4T A;  2JEK A;  1U3C A;  4MS6 A;  2NSZ A;  3PNT B;  4I2Z A;  3D3M A;  4DJA A;  3ASH A;  3ASF A;  5A23 A;  1DVP A;  4U07 A;  2E0I A;  4U0Z A;  2FBN A;  3WXX A;  3RU0 A;  4F3V A;  3U3W A;  2WXO A;  3Q15 A;  3O4Z A;  4R7L A;  4UI9 C;  1UJJ A;  3HYM B;  4HS2 A;  3ESK A;  2X6K A;  3UUX A;  3R7Q A;  2LSU A;  3ESL A;  3QNK A;  4L2L A;  3S7F A;  1TEZ A;  3SFZ A;  5CMW A;  3EIJ A;  3Q49 B;  3OXF A;  1TJF A;  3CKB A;  4KVM A;  1OWM A;  4IUL A;  4GZC A;  4CDR A;  3D9K A;  4OVU A;  3KEZ A;  5E75 A;  4LER A;  4U0S A;  4UI9 K;  4K03 A;  3LJ3 A;  2XRZ A;  2XPZ A;  4UQX A;  4FHK A;  4GA0 A;  4FP7 A;  4AY6 A;  4J6I A;  3U4T A;  3CEQ A;  3TAX A;  4GA2 A;  2J49 A;  4KT6 B;  4JEH A;  3GZS A;  4JPS A;  1HH8 A;  3G2V A;  3RKV A;  4D10 C;  5KJL A;  1JWG A;  3QB2 A;  2I6H A;  4JZY A;  3B7U X;  3CK8 A;  3MKQ A;  4I9E A;  4QFV A;  1NP7 A;  2J4B A;  3ZN3 A;  3ZYQ A;  2WQH A;  5BV0 A;  2A4Z A;  1QNF A;  4XKC A;  4WNF A;  4AY5 A;  1GW6 A;  3LS8 A;  1WAO 1;  3MV3 B;  4M3O A;  2AXU A;  3ZHE A;  4E6H A;  2ZU6 B;  4GMJ A;  3MEK A;  2UY1 A;  3FTY A;  4I43 A;  5M72 A;  4BY6 A;  1L5J A;  3GZ1 A;  5LX8 A;  1KLX A;  4BFR A;  2I1J A;  3K9I A;  1FVH A;  1XNF A;  1HX8 A;  5FWQ A;  4RG9 A;  3PRZ A;  2CHW A;  4BT9 A;  2DIW A;  3LVQ E;  2DCP A;  2VGY A;  4GZ3 A;  2WXN A;  4E85 A;  4Q69 A;  2KAT A;  2FF4 A;  2KC7 A;  1OWL A;  1HU3 A;  5FT9 A;  4ANX A;  3U66 A;  2VTB A;  3FP3 A;  3FU5 A;  3NF1 A;  4HOS A;  3ZW3 A;  3QWV A;  4BSX A;  4GCN A;  3IHY A;  2KCL A;  3SF4 A;  5EKQ D;  4OYS A;  3SNX A;  5HQ8 A;  3AS8 A;  3FUJ A;  3OTN A;  2XCC A;  1DNP A;  3CKC A;  4FHJ A;  1HFA A;  1PY1 A;  3FUD A;  5BPP A;  3D9I A;  2A5U A;  3D9O A;  3LXU X;  3B7S A;  3B13 A;  3HVE B;  5A7D B;  3CQG B;  3FUF A;  4EZL A;  3U9W A;  5T4Y A;  4F1S A;  3KS2 A;  4UI9 J;  3D9N A;  4CRW A;  4FAD A;  4H7Y A;  2WXP A;  3NZS A;  2V4L A;  5ARF A;  1H2U A;  5LP0 A;  3N71 A;  3S7D A;  3BEE A;  1A17 A;  3CHO A;  3FWV A;  3MA5 A;  4G24 A;  4J8F A;  1NA0 A;  2IF4 A;  5FZQ A;  3LDZ A;  4J8E A;  4WWO A;  2WXR A;  2Q7F A;  4H7X A;  2R5S A;  4NUR A;  4HOQ A;  1NZN A;  5G04 C;  3RRU A;  3UT4 A;  1E96 B;  1QZ2 A;  5BT1 A;  2PM7 A;  4EPZ A;  3CQC B;  4FJY A;  1FVF A;  2WXH A;  1ZU2 A;  3VTX A;  4UWK A;  2M63 A;  4UQZ A;  5DIZ A;  4AXH A;  4XI0 A;  2WXK A;  4F53 A;  3CVP A;  5G2N A;  1OUV A;  3ZEF A;  4KZ0 A;  4I6J A;  3CVW A;  1S0P A;  3R9A B;  2LNI A;  4GYY A;  4PH4 B;  4V3I A;  2WXG A;  3SD5 A;  3FU0 A;  1OWP A;  2JLB A;  3IV0 A;  5E76 A;  1OWO A;  3EIQ C;  4U63 A;  4YVO A;  3CHP A;  3S7B A;  2XPY A;  2EQX A;  3I3N A;  3HDX A;  2OV8 A;  5AJD A;  5J08 A;  2OVB A;  3FDH A;  1IQU A;  3G2W A;  3PRE A;  2MRI A;  3OXL A;  3GYZ A;  2DBA A;  3SBT B;  2WMN A;  4JHK A;  1KT0 A;  1UG3 A;  3QOU A;  4PS7 A;  3RRM B;  3UMV A;  3ZRH A;  4HOT A;  2KCV A;  4W9R A;  2NC9 A;  3KD7 A;  1H0A A;  3QJZ A;  4ANW A;  3CHM A;  2IOL A;  4MKT A;  5BNW A;  2WVI A;  3BG1 B;  2HYZ A;  5FQ6 A;  5D0Q D;  3EJN A;  2BF0 X;  2R59 A;  1H19 A;  3LY9 A;  4BTB A;  1Z3Y A;  1JUQ A;  3ZXS A;  4Q94 A;  1IYG A;  2XQ0 A;  3Q47 B;  3TJP A;  4NRH B;  3UX4 A;  4NAC A;  3CGH A;  3LVR E;  4AP2 A;  4C9B B;  3E4B A;  3RO3 A;  4LUN U;  2VGX B;  3ONK A;  2XEV A;  1LF8 A;  4OVV A;  2GW1 A;  2VYI A;  2KZT B;  3AU4 A;  4KZC A;  2E2E A;  4LEU A;  3CIA A;  1UW4 B;  4PS3 A;  2OVF A;  4ANV A;  2CG3 A;  4XX5 A;  4GAA A;  3PE3 A;  3EHM A;  2WXF A;  3GW4 A;  3C98 A;  1P5Q A;  2VSN A;  4ILH B;  1JPL A;  3PDN A;  3AU5 A;  3CVN A;  4ME2 A;  4UWH A;  4ILI A;  4B0Z A;  5BUZ A;  3PNL B;  2FO7 A;  1BPO A;  4UQY A;  5BW8 C;  2C2L A;  2WXJ A;  4JA7 A;  2ILR A;  4ATG A;  1ELK A;  1B89 A;  4XKB A;  3MZL B;  3FUM A;  4PS8 A;  4L1B A;  3ZVV A;  3PH0 C;  3FEX A;  2HM8 A;  3P1U A;  2VJ8 A;  3VLF A;  4GPK A;  1ELW A;  5HI7 A;  5G04 J;  3JQ1 A;  3EHN A;  2LO6 A;  3TGO A;  2GRM A;  4XIF A;  5CCL A;  4APO A;  2J07 A;  5T3R A;  4CT4 A;  3QAR A;  4CEM A;  2X6J A;  3FY4 A;  1OWN A;  3D9M A;  1PC2 A;  3NQP A;  4N5C A;  3ZYM A;  5LFA A;  4L2Y A;  3L6A A;  5FQ4 A;  2WPV A;  4XI9 A;  5JHA A;  2VSO E;  1E8Y A;  3MKQ B;  3L08 A;  4GZ6 A;  2YHC A;  3LCA A;  2VSX E;  1ELR A;  4EEC A;  3I4G A;  3MCX A;  5J90 A;  2J4D A;  2WXM A;  3BG0 B;  3FUL A;  3ZHE B;  3L13 A;  2X6I A;  4ILG A;  2UY1 B;  2FUL A;  2PZI A;  3B7T A;  3FTW A;  3UPV A;  4G26 A;  4KVO A;  4WWP A;  3PUK A;  5EDS A;  4FJZ A;  4N2Q A;  2QY7 A;  1Y6I A;  2WMO A;  2C0M A;  5G55 A;  2GGF A;  4CDM A;  2CFZ A;  4DLO A;  2YHE A;  4KYO B;  3FH5 A;  4J8S A;  5AEN A;  5C2Y A;  2GRL A;  3CK9 A;  1HXI A;  3FFL A;  1E7U A;  1HO8 A;  1VDY A;  5G05 C;  4FC8 A;  1HF8 A;  3CV0 A;  3FUI A;  3SGH A;  4N2S A;  5A6C A;  3CVU A;  1SQM A;  4AM9 A;  5FJY A;  2YQ8 A;  2V8S E;  4G2V A;  1SZ9 A;  4MRU A;  2KCK A;  3TXN A;  2WQ7 A;  4WNE A;  5LCW C;  1EDU A;  2IU1 A;  3TG5 A;  3FUH A;  2J09 A;  3QK0 A;  4BX9 A;  2XPI A;  5CHE E;  5JJ7 A;  1MHQ A;  1N54 A;  3P2B A;  1U3D A;  4A1S A;  4Y6C A;  3ML9 A;  4RVB A;  1H2T C;  4GZ5 A;  1PAQ A;  3APC A;  5ARG A;  3RJV A;  2C0L A;  1E8W A;  2XGM A;  3ZGQ A;  5AIJ A;  3S2A A;  3PEU B;  2YIN A;  3I4R B;  2X6F A;  1KT1 A;  3VLD A;  1HE8 A;  4U0U A;  4U8H A;  1UN9 A;  1Z6T A;  3ONL A;  5JJ6 A;  2L6J A;  2XGO A;  2IJG X;  2X6H A;  3ENE A;  4N3A A;  4TV3 A;  3ZYK A;  4GCO A;  4B8A A;  4JC8 A;  4JVS A;  2R17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...