3ZHEA

Structure of the c. elegans smg5-smg7 complex
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
399
structure length
399
Chain Sequence
QKSDEVTEKFKRYCNQLEKYGQTENVHSPVMAMLRRKGRKQLIEIMKRDGDCTSSINKLWIVGYYHPFQFFIRDKEKNMAIAVLLTMFCGELQEMLSLPDDKYPALWNMYIGDFHRYMPDEEIQKCLAVGYYSRAIDLDPNQGRAFHVLAGLRADLNVAQKLRLMILGQLADAPYKKGTELLEYLKFPQKESTDKLMVDFVIWALNEKSKRMDYQMTGIKIVNEFKAEIEQKLEFDWSLIMSTCRLASKLAMKKFGFQQFYNCFDTISTLYITIYSRTISSKCLLAEAISWISDSAEILGHLDEQKNEPHFQKLSVFAKTKWNELNDLVMNHINSVFTSMSLTINPSISMTSFLLNGPISEPNVEFLSQLINYLVSVEFPPMEIIHDREESGPLLRRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Mrna-binding protein
molecule keywords NONSENSE-MEDIATED MRNA DECAY PROTEIN
publication title An Unusual Arrangement of Two 14-3-3-Like Domains in the Smg5-Smg7 Heterodimer is Required for Efficient Nonsense-Mediated Mrna Decay.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 133
structure length 399
sequence length 399
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zheA01
1.25.40.760 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zheA02
3LKUA 4GCOA 4CGWA 3MKRA 3HYMB 3LYAA 4GA0A 2WPVA 3RU0A 3FWVA 5HQ8A 3LY9A 4H7XA 3LCAA 4A1SA 3LY8A 4BTAA 2PQRA 4ME2A 4APOA 4J0UA 4U07A 3VTXA 2PZIA 3QWPA 3TAXA 1TJCA 3ASDA 1HXIA 5EX3A 2VSYA 4BTBA 5AYWD 4U0UA 2KCKA 2VGYA 2VGXB 5JJTA 1Y8MA 5DBKA 3ZHEB 3ZGQA 1P5QA 3U4TA 5KJLA 4UI9J 4N2SA 1ELRA 3QOUA 1XNFA 3AS8A 2XCBA 1WAO1 4J8DA 3R9AB 1KT0A 4Y6WA 2GW1A 1OUVA 4B94A 3S7DA 3CVLA 4N3AA 3ASFA 3LY7A 3MV3B 1IYGA 5G04J 3OXGA 4GA2A 2C0MA 3WXXA 3SZ7A 2P58C 4AIFA 4UI9K 3CV0A 3EDTB 1W3BA 5G05C 2VGXA 2BUGA 5LCWJ 4I17A 3ZHEA 4G26A 2LSVA 2YQ8A 2C0LA 3FP3A 5BNWA 2V5FA 4GCNA 4O6FA 3URZA 3O48A 4WNFA 3CK8A 3UPVA 2VSNA 1QQEA 3CVQA 2HYZA 3OXLA 2FO7A 4RG9A 2J9QA 4WNDA 2NC9A 4UI9C 4UQZA 4ABNA 1ELWA 3CK7A 4N3CA 4J8EA 1HZ4A 5M72A 3RKVA 3ZFWA 5D0OD 4YVQC 5A7DB 3ULQA 4WNEA 2HR2A 4NQ0A 4HOUA 3CK9A 3ESKA 2XGSA 5D0QD 3OXFA 3UQ3A 3ASHA 5BT1A 5EKQD 1QZ2A 3E4BA 4F3VA 4N3BA 4LEUA 3K9IA 5CCMA 4HOSA 1A17A 2XCCA 3S7FA 2PL2A 3VTYA 2LSUA 1NZNA 4BT8A 1NA0A 3GW4A 2XPIA 5LCWC 5EX0A 5JJ7A 3RO2A 2AVPA 1KT1A 2OOEA 1B89A 4N5CA 2Y4TA 4GA1A 3ASGA 2E2EA 2IFUA 3Q5MA 4G1TA 2KCLA 3LPZA 4CGVA 4GZ5A 3BEEA 4RG6A 3FFLA 2KC7A 4UQXA 4YNDA 2WQHA 4KXKB 3Q47B 4KYOB 2I6HA 5A6CA 4N39A 3RO3A 4I1AA 3ZPJA 2FEZA 3PDNA 3KAEA 4H7YA 2Q7FA 1PC2A 4HOTA 3Q4AB 4JHRA 3ZN3A 1ZBPA 3CKCA 1ZU2A 3CEQA 4IN3B 2Y4UA 3SF4A 3MA5A 5BW8C 4N2QA 4UQYA 4BWRA 3KS2A 5JJ6A 2XGOA 1E96B 3QKYA 4HORA 3JYSA 2UY1B 5ARGA 4GYOA 3TGOA 1HH8A 4G23A 2C2LA 4G24A 3QDNA 2LNIA 3QWWA 1KLXA 4GZ6A 2VYIA 3U3WA 2FBNA 5G04C 4BT9A 5C1DA 4XI9A 4AM9A 3GYZA 4WNGA 4I2WA 4U04A 4I9EA 3MEKA 4GYYA 5FT9A 3N71A 5FZQA 4AY5A 3TG5A 4GYWA 4W9RA 5G05J 2XGMA 2FF4A 5HI7A 4U0SA 5KJNA 3Q49B 3AS4A 4J8FA 2UWJG 2UY1A 2XEVA 3S7BA 1WM5A 5DIZA 4KBQA 2ONDA 3CVNA 5FTPA 3TG4A 2R5SA 5FZSA 3RIBA 2VQ2A 5ARFA 3UUXA 4Y6CA 4XIFA 1YA0A 2HO1A 3S7JA 2MHKA 2JLBA 4WUYA 2DBAA 1FCHA 5CHEE 4GPKA 4NRHB 3CKBA 4G25A 2QFCA 4I9CA 2YHCA 4YVOA 5CCLA 4I2ZA 4G2VA 3IEGA 3PE3A 4GZ3A 3AS5A 3Q15A 3KD7A 3PE4A 3GZ2A 4JA7A 1IHGA 4XI0A 4HOQA 3CVPA 4CDRA 2PQNA 5FJYA 4JA9A 5KJKA 4AY6A 3GZ1A 3NF1A 3MV2B 5FZRA 3RJVA 2KATA 4U0ZA 2KCVA 1NA3A 4JL0A 2L6JA 3QWVA 2FI7A 5KJMA 2IF4A 4EQFA
chains in the Genus database with same CATH superfamily
5LX8A 5JHAA 3HYMB 3LYAA 3B7RL 2IU1A 3S2AA 4PH4B 5HQ8A 1IQUA 2P2CP 5E76A 1JCQA 1TNBA 1S63A 2PQRA 1O1SA 3HXCA 4APOA 4DUIA 2OVBA 4X8QA 3EHNA 4PDXA 1N11A 2H6IA 2WM9A 3UM0A 2X6FA 1TJCA 1S0PA 3D9NA 1KZOA 4HI9A 5EX3A 5FIOA 4DX5D 5JJTA 5DBKA 2F8YA 3ZHEB 2ETCA 4Q94A 5ENQD 1HO8A 4IYPA 3AS8A 3LDZA 4TUUA 3Q9UC 5A23A 1LD8A 2DWZA 2IEJA 3FUNA 2WXJA 3EUVA 3JXIA 4B94A 3C3OA 4AP2A 4ANXA 3MV3B 4U8YD 5EIDA 1IYGA 3CLJA 3KEZA 1D9SA 1BU9A 2P9SG 1ZB1A 4GA2A 1E7UA 1OWMA 2J4DA 3ZKJA 3IBEA 2P58C 4YDWA 2EQXA 4HQDA 2Y3AA 3HRAA 4O1PA 4AIFA 4UI9K 1MYOA 1W3BA 5FWQA 5LCWJ 4Q69A 2GRQB 3B13A 1H19A 4I1MA 1D8EA 4U8HA 4K03A 2LO6A 4GCNA 3LS8A 4HLLA 2R05A 4L7TA 2YNQA 2QYUA 2WXQA 4TXRA 3OXLA 4LCTA 3SNXA 4LNGA 4UI9C 1Q2ZA 1TYQG 4NACA 4MRUA 3BU8A 3RKVA 3EIJA 4PS8A 4PS3A 5A7DB 2RKKA 3ULQA 1K1BA 5B1BE 4NQ0A 4HOUA 4C48B 5D0QD 1HE8A 3HXEA 4LRZA 3RK6A 2KZTB 5JA4D 1QZ2A 4KT6B 2DYSE 5T3RA 2I1JA 4K5AB 4N3BA 2J09A 4O60A 2XHEA 2MRIA 5FQ6A 1TNOA 3FEYA 3SBSA 3S7FA 4BX8A 1NZNA 2LSUA 1BI7B 1NA0A 3FU0A 3UX4A 2X6HA 3L22A 2AVPA 2WQ6A 2V0PA 4AOFA 1UN8A 3MZLB 4JD2G 1N4QA 3D9IA 5BUZA 1SW6A 3KEAA 2X6KA 3UINC 1V54E 3B7BA 3V2XA 1H6OA 2WMNA 2LXLA 4KXKB 4I1OB 2QZAA 4KVOA 5AJLA 3E34A 4GZDA 4OYSA 3ZPJA 2FEZA 3PDNA 3KAEA 2ETAA 1H0AA 1N95A 4YDYA 4V3IA 3ONKA 1PC2A 5EN5D 3G2TA 3ZN3A 4XZ4A 2Y69E 3ESLA 3CKCA 3B7TA 1OCOE 5J08A 2Y4UA 4HNAD 3ZNGA 4N2QA 4UQYA 5JJ6A 2WQ7A 1E96B 2X6IA 5CBNA 3JYSA 2UY1B 4GYOA 3TGOA 2C2LA 1TJFA 3TWRA 2PM7A 1KLXA 3U9WA 4DLOA 4DJAA 2VYIA 1FT1A 4ATZD 4AM9A 5FQ8A 3W9FA 4TXPA 4XX5A 3CHRA 4YDOA 2P9UG 4GTOA 2J07A 4GYYA 4HS2A 4RVBA 1FVFA 3CVYA 4AY5A 4W9RA 5G05J 3D9HA 3LVRE 3GZSA 3V31A 4DX7D 5AARA 1LD7A 5HI7A 4BERA 1U3DA 3TWVA 3FTSA 2MOWA 4GB9A 3B7SA 4K0RA 4TV3A 4M7CA 4ACKA 3ZVVA 4EECA 1WM5A 2WXMA 3DSXA 2H6HA 1WDYA 2WXIA 4G8KA 1OWPA 3BUAA 3TG4A 5BXOA 2M63A 5ARFA 1NL4A 5ENOD 4KMOA 4XIFA 1YA0A 4LERA 3CHSA 3S7JA 5BV0A 4ACLA 2MHKA 3NOGD 2EINE 1IHBA 2NSZA 5CHEE 5ENRD 2CHWA 4XKBA 4DI3A 2EIKE 2HE0A 4WWOA 5CCLA 1E8XA 4DX1A 2P9KG 1EPUA 2IONA 3Q15A 3NOCD 3KD7A 3J5QB 4XKCA 4GMRA 2F37A 4XI0A 5ANRA 2WXNA 2PQNA 4JA9A 3ML9A 1OCZE 2VGEA 3HVEB 5CMYA 4A3VA 4U0ZA 3G2WA 1N0QA 4MS6A 3QWVA 2IF4A 3PS6A 3EIQC 4QQIA 1DCEA 3MKRA 4CGWA 2AW6A 3IKOB 3SFZA 4OVVA 4GA0A 1UG3A 3RU0A 2V5QC 3ZYLA 5BV1A 3NZSA 4CEMA 3LY9A 1MZCA 3LCAA 3JXJA 1S70B 5ENNA 2BKGA 3LJNA 1AP7A 3RRNB 4J0UA 3ZRHA 4B8CB 4U07A 4JB8P 1UN9A 3JQ0A 2DZNA 4L2LA 1JWFA 4EHMA 3ASDA 4HLEA 5KWDA 2P9PG 3DSTA 4U0UA 4RSYA 1EF1C 4DPRA 2IOLA 2VGXB 5FQ7A 1Y8MA 3DEPA 1P5QA 1KZPA 4CT4A 4JPSA 5KJLA 4UI9J 2ZGDA 1XNFA 4LG6A 4L1BA 2XCBA 4HI8A 3CSFA 3IXEA 4KVMA 4AEZC 2R17C 2NXPA 3S7DA 4EBAA 3QB2A 5B3SE 2R03A 1X81A 3ISMC 3TWQA 4DK5A 5G04J 1TN7A 3PH0C 2XZTG 4AXHA 3OXGA 3APFA 4UWLA 4JHKA 2LAHA 4A63B 1X5BA 3L13A 4CCAA 5BPPA 1TNUA 1HS6A 4NIKA 5G05C 1E8YA 3HIZA 2BKKB 2BUGA 3ZYKA 2I1KA 5ITZF 3UM3A 2AXVA 5BNWA 3J5PA 3ABLE 4EZKA 1VDYA 3O48A 1AWCB 4WNFA 3FUDA 5B1AE 3UPVA 2XRZA 3DWLG 2BF0X 1SZ9A 1OWLA 2HYZA 4RG9A 4ABNA 3CK7A 4U8VD 3D9LA 3CSTA 4FC8A 4OAUC 3AJIA 1HG2A 4I43A 3RRUA 3RRMB 3PZ2A 4WNEA 5ENTD 1E90A 3RAUA 4JXTA 1S64A 3ESKA 3JCKC 2A5EA 2X3MA 4URKA 2GRNB 3ASHA 2YINA 2WVIA 3C3QA 4CDMA 3E4BA 1O5MA 4U63A 5HRYA 4J6IA 5KCMA 3NAWA 5CERB 3UMVA 3G2SA 3MCXA 2RD0A 1EYHA 2ZIRA 1QYMA 4BT8A 3JUEA 4FJYA 3LXUX 1UJJA 4FLBA 3APCA 4CZ2D 1A5EA 1KT1A 2V4HC 3PUKA 2OOEA 3FUHA 1B89A 3PNTB 3PEUB 4GA1A 3ASGA 3ZW3A 2B0OE 2HM8A 4BX9A 5D66A 1MJ0A 2VTBB 3FUJA 5KNGA 3BEEA 4MBGA 2L0TB 3AU5A 5ENSD 3Q9NC 3NB2A 1YCSB 1JCRA 3ASNE 3Q7FA 2WXFA 2ILRA 1TN8A 1K8KG 4H7YA 3FUEA 4HOTA 3D9OA 2IJGX 4BFRA 3ZUVB 3DSSA 4Z68A 1NP7A 1N54A 3MA5A 3DEOA 5G2NA 3EHMA 3C98A 3TWWA 3JQ1A 4ANUA 3FUMA 2NYJA 3V30A 2VSXE 4CT0A 4L2YA 3CHPA 2XPZA 3U3WA 3UTMA 5G04C 3FTVA 5CRUA 4BT9A 4XI9A 5C1DA 5C2YA 1DCQA 2GRMA 2I2OA 4WNGA 4I2WA 4GPMA 4U04A 3MEKA 3N71A 3D9PA 5FZQA 3TG5A 4D10C 3I3NA 5CRVA 4IRUA 3Q49B 5ANLA 3AS4A 4GAAA 3FU6A 3QAQA 3CVNA 2ZGGA 1INZA 5FTPA 5FZSA 3FH5A 2MYOA 5HS0A 3FTXA 2WXKA 3CVUA 1Z5SC 2HO1A 3OAWA 1BD8A 4G8LA 4LNUD 1Z6TA 5CEDB 1MQSA 4EZLA 3MKQA 2ZISA 2QFCA 3TXNA 2L9BA 5CMWA 4F1SA 1NI1A 4I2ZA 4C9BB 3IEGA 1N4SA 1MX6A 3PE3A 4JHJA 5AQBA 3PZ1A 4GZ3A 2DIWA 3AS5A 3PE4A 3GZ2A 5HKPA 4HXIA 4I6GA 4B0ZA 1LF8A 3TL5A 1JUQA 3MV2B 5FZRA 3RJVA 2KATA 4Q96A 3D9MA 3I4GA 1BLXB 3FUIA 3X2QE 3L82A 4EQFA 4GCOA 1MX4A 3HXDA 3HXBA 4A55A 3FWVA 3C72A 3EJNA 5J90A 2JEKA 3TJPA 4H7XA 1H2TC 1SA5A 3LY8A 5T8IA 4WAFA 4FP7A 5LP0A 1UW4B 3PZ4A 3ZEFA 3UM1A 1TEZA 2PZIA 3QWPA 3R7RA 3AG1E 1Z3YA 3TAXA 2A5UA 4BTBA 3TXMA 4MLPA 4J8YA 3U66A 2KCKA 2VGYA 3PNLB 3BG1B 4GTTA 4J8SA 1SZAA 1ELRA 4ILHB 5AQ7A 3ULYA 1WAO1 1KT0A 3C5RA 4Y6WA 2GW1A 5AENA 1G3NB 1D8DA 3L16A 2WXOA 1OUVA 1O1RA 3CVLA 3DPYA 3L08A 4N3AA 1V55E 2R59A 3LY7A 4HB5A 2XPYA 3FEXA 3E32A 3ULEG 3TWTA 3BG0B 4NURA 3SZ7A 4A3TA 4FULA 2V8SE 4OVUA 3FH8A 1H2UA 3CV0A 3EDTB 2PNNA 1E8WA 5BXUA 4LNBA 2BTDA 4I17A 1L5JA 3CHQA 3ZHEA 4APFA 1IXVA 3IHVA 5G55A 2C0LA 4O6FA 1PAQA 3QJZA 3CK8A 1DNPA 2VSNA 1QQEA 3ZXSA 2FO7A 4GTRA 4U7EB 1FPPA 3FHEA 2NC9A 3CIAA 3SGHA 2P9IG 4J8EA 3LJ3A 4GMLA 4IULA 3ZFWA 2PM6A 4YVQC 1H6PA 3AU4A 3CVWA 4E85A 5AN8A 3CK9A 4P29A 3KSQA 1HFAA 4HRLA 4O1OA 4KZCA 3CGHA 3ABME 2WXPA 1TR4A 2FULA 4PS7A 1HG5A 3Q7AA 3K9IA 2XEEA 5T4YA 4HOSA 2LAIA 2PL2A 3EHQA 3VTYA 1MX2A 3CHOA 3GW4A 4JVSA 2P9LG 2OCCE 1DVPA 3FTUA 5JJ7A 3VLFA 5KBAA 4OAVB 2WXHA 3I4RB 2KM4A 3FUKA 3ENEA 3FU3A 2X6JA 4MKTA 4E6HA 2EIJE 4N5CA 3V2OA 3UXGA 3Q5MA 3T8MA 2KZTA 4CGVA 4GZ5A 3FFLA 2KC7A 4UQXA 2WQHA 1O1TA 1LTXA 1H2VC 3UI2A 3PREA 4GTSA 4N39A 1OCRE 3O4ZA 2IO2C 4I1AA 3C3RA 3E37A 3QNKA 1TNYA 3CQGB 4ILIA 3UKRG 3SHFA 3HXFA 5CBOA 1RZ4A 2VSOE 4F1PA 3LEWA 3L17A 5ENPD 2F0YA 4K5CA 1ZU2A 3CEQA 3SF4A 4FHJA 1FT2A 3SFYA 4EZJA 5BW8C 4ATGA 3KS2A 4TRQA 3L9TA 2XGOA 3T9KA 4ZFHA 4HORA 3ZYMA 1TN6A 3APDA 3G2VA 3DPDA 3NZUA 3QWWA 3DXKG 2E0IA 3FU5A 4WWPA 4GZ6A 2ETBA 2XENA 1BPOA 2FBNA 4U96D 1FVHA 3DSUA 2WB2A 2ZXWE 2RG8A 3ML8A 4I9EA 5FT9A 4B8AA 4ILGA 2OVFA 4GTMA 5FINA 3T5VA 4U0SA 3EHRA 4GTQA 4UWHA 3WG7E 3SFXA 4RLYA 4J8FA 2AXZA 2CFZA 3QC1A 2UY1A 2XEVA 3FTYA 4KBQA 2JABA 4DRXE 3ASOE 2ONDA 3Q73A 5H7PA 4HVBA 2R5SA 3IV0A 3E30A 5CEAA 3JUIA 4UUCA 4AV7A 3UUXA 2RFMA 3AG3E 2I9CA 2JLBA 4WUYA 2OV8A 3E33A 4JW1A 4GPKA 3U64A 2F8XK 3CKBA 4I9CA 2IO3C 2YHCA 4C0MA 4YVOA 2IY0C 4L9PA 3FTWA 4N5QA 3TWSA 4HFGA 4JC8A 3DXMG 1E7VA 3IHYA 4CRWA 1JWGA 4HBDA 1OWNA 2YHEA 1IHGA 2CG2A 4HOQA 4GU5A 3CVPA 2J49A 1U2VG 3TWUA 5FJYA 3NF1A 4UWKA 4DX2A 2XEHA 1Z3XA 1NA3A 3CQCB 1IQRA 4FJZA 4JL0A 3B7UX 4BSZB 4KZ0A 1WG0A 3LKUA 3PUJA 2P9NG 4JZYA 4I6EA 4U95D 1OCCE 3UM2A 4RQIA 4G11A 3DBSA 2WPVA 3ONLA 2QC9A 4L23A 4FHKA 3Q79A 5AIJA 3I5PA 2XQ0A 4A1SA 4BTAA 4BESA 4ME2A 2X38A 5AJDA 3B95A 2BEDA 1E8ZA 3OTNA 4JEUA 5AQAA 2B6CA 4HRNA 3VTXA 2OEWA 3P2BA 1DC2A 4FLHA 3T5XA 3R9MA 3MYVA 5KNHD 1HXIA 2VJ8A 1OWOA 2VSYA 5AYWD 3HVEA 3W9GA 1SVXA 2KXPC 2GRPB 4F7AA 3QARA 4PUCA 3ZGQA 3U4TA 5JHBA 1SQMA 4N2SA 3QOUA 2DVWA 3ABKE 2CHXA 4J8DA 3R9AB 2AXUA 4F6RD 3Q78A 3VLEA 4DLQA 2WXLA 4DI4A 1N4RA 4EPZA 3SI5A 3ASFA 1HU3A 3DSWA 3KSLA 3RSEG 3F6QA 3D9KA 3AG4E 2CG3A 2DYRE 4QFVA 4B93B 2C0MA 3WXXA 1WY6A 3PZ3A 3R7QA 3MX3A 3SO8A 4UWGA 3SQVA 2VGXA 3Q75A 4G26A 2LSVA 2YQ8A 4JEHA 4UWFA 3FP3A 3UIPC 3FULA 2XRYA 2V5FA 3HG0D 2QYJA 3FDHA 3URZA 4GZCA 2ZU6B 4FA6A 1XGWA 1JPLA 3CVQA 2L6BA 3DSVA 2J9QA 4WNDA 1OT8A 4BETA 1NFIE 4UQZA 2R02A 4BY6A 1ELWA 3P1UA 4N3CA 1HZ4A 5AAOA 5D2MC 5AQ9A 5M72A 5D0OD 4LSZE 5EIBE 4CDNA 5FQ4A 3FUFA 2HR2A 3EU5A 3UKUG 2XGSA 3G2UA 3T8KA 3OXFA 3UQ3A 2WMOA 5BT1A 2Y1LE 5EKQD 2EIME 3ZYQA 3CR3A 1BI8B 3ZXPA 4F3VA 2CHZA 2Y0BG 4LEUA 2R2LA 1N0RA 5CCMA 3LVQE 4ZHBA 1A17A 2J4BA 3PEVB 2XCCA 2GRLA 4LUNU 2GGFA 2XPIA 1EDUA 4BSXA 2XS8A 5LCWC 5EX0A 4CYMD 5JMND 3MGBA 3NQPA 3RO2A 1RW2A 2GROB 1PY1A 3AG2E 3PVLA 3HHMA 2Y4TA 2E2EA 2IFUA 4G1TA 2KCLA 3LPZA 3UIOC 3NBNB 3PZDA 3UT7A 4BEPA 4RG6A 1MHQA 4YNDA 1IKND 1KPSB 3Q47B 1HF8A 5CECB 4KYOB 2I6HA 5A6CA 3BQOA 4ANWA 4XEIG 2WXRA 4GMJA 3RO3A 3D9JA 1YMPA 2EILE 3FH7A 2AWIA 3D3MA 4GTVA 3SD5A 2Q7FA 2LUHA 4A1GA 2LXMA 4AVXA 4FU3A 3Q4AB 4JHRA 2L0IA 1ZBPA 2GRRB 4I6JA 5E75A 1QNFA 2QY7A 3CVVA 4IN3B 4XE0A 5LFAA 4AJWA 2V4LA 2J8SD 4BWRA 2VTBA 4YDEA 4EBAG 3QKYA 5IY5E 5ARGA 1HH8A 4G23A 4G24A 3QDNA 1TNZA 2LNIA 4FADA 1N94A 2H6GA 5LOZA 3GYZA 1H6KA 4R7LA 4GYWA 2KBXA 2XGMA 1N9AA 3MKQB 2FF4A 5KJNA 4J7WA 2OEVA 4C0EA 1JCSA 4F53A 2XS1A 4TUMA 3DRAA 1Y6IA 3CHMA 4M3OA 1ELKA 2UWJG 1YYHA 2A4ZA 3S7BA 2AJAA 3L6AA 2IOSA 5DIZA 4WWNA 3UT4A 3AAAC 3PRZA 4HRMB 3VLDA 1UJKA 5EILA 4TXQA 2DZOA 2H6FA 3RIBA 1OY3D 3L54A 2FO1E 3EU9A 2VQ2A 1HX8A 3SY2A 5EYLA 3ZU7B 1SA4A 4ANVA 4Y6CA 2RFAA 3CVXA 2DBAA 1FCHA 3SBTB 4NRHB 1QBQA 4G25A 2CFUA 2DCPA 4K5BA 4G2VA 2IQCA 1N4PA 3TWXA 1UOHA 3FTZA 2J08A 3FY4A 1K1AA 3MJWA 4JA7A 4B89A 2XZDG 5EYPF 3ZIMA 4CDRA 5KJKA 3V79K 4AY6A 3UT8A 3GZ1A 4DX6D 1OXJA 2KCVA 1N52A 2WXGA 1GW6A 3QK0A 1U3CA 4GTPA 3HDXA 1K3ZD 5EDSA 2L6JA 2FI7A 5KJMA
chains in the Genus database with same CATH topology
3LKUA 3PUJA 4GCOA 3EIQC 5LX8A 4JZYA 4I6EA 3MKRA 4CGWA 2AW6A 3IKOB 5JHAA 3SFZA 3HYMB 3LYAA 4OVVA 4GA0A 3B7RL 4G11A 2IU1A 3DBSA 2WPVA 1UG3A 3S2AA 3RU0A 4A55A 3ONLA 3FWVA 4PH4B 3ZYLA 3EJNA 4L23A 5BV1A 1IQUA 3NZSA 4FHKA 4CEMA 2JEKA 3LY9A 3TJPA 5J90A 4H7XA 5AIJA 5E76A 3LCAA 3I5PA 2XQ0A 1H2TC 4A1SA 5T8IA 3LY8A 4WAFA 4BTAA 4FP7A 5LP0A 2PQRA 4ME2A 2X38A 5AJDA 5ENNA 3RRNB 4APOA 4J0UA 3ZRHA 1UW4B 2OVBA 4B8CB 3EHNA 4U07A 1E8ZA 3OTNA 4JEUA 1UN9A 3ZEFA 4PDXA 1TEZA 3VTXA 3JQ0A 4L2LA 2PZIA 3QWPA 3R7RA 2WM9A 3P2BA 1JWFA 4FLHA 2X6FA 1Z3YA 3T5XA 3TAXA 1TJCA 1S0PA 3D9NA 3MYVA 3ASDA 4HLEA 1HXIA 5EX3A 2VJ8A 2A5UA 1OWOA 2VSYA 3TXMA 4BTBA 5AYWD 4MLPA 3HVEA 4U0UA 4RSYA 1EF1C 3U66A 2KCKA 2VGYA 2IOLA 2VGXB 3PNLB 4DPRA 5JJTA 3BG1B 5FQ7A 1Y8MA 5DBKA 4F7AA 3QARA 4PUCA 3ZHEB 3ZGQA 1P5QA 4J8SA 3U4TA 1SZAA 1SQMA 4CT4A 5JHBA 4JPSA 5KJLA 4Q94A 4UI9J 4N2SA 1ELRA 4ILHB 1HO8A 3QOUA 1XNFA 4IYPA 3AS8A 3LDZA 4TUUA 4L1BA 2CHXA 2XCBA 5A23A 1WAO1 4J8DA 3R9AB 2AXUA 1KT0A 4Y6WA 2GW1A 3CSFA 5AENA 3VLEA 4KVMA 4AEZC 3L16A 2WXOA 3FUNA 4DLQA 2R17C 1OUVA 2WXJA 2NXPA 2WXLA 3S7DA 4B94A 4EBAA 3CVLA 4DI4A 3L08A 4N3AA 3QB2A 4EPZA 4AP2A 2R59A 3SI5A 3ASFA 1HU3A 3LY7A 4ANXA 3MV3B 2XPYA 4DK5A 3CLJA 1IYGA 5G04J 3KEZA 3FEXA 3PH0C 4AXHA 3OXGA 3D9KA 3APFA 4UWLA 3BG0B 4JHKA 4GA2A 2LAHA 2CG3A 4QFVA 1E7UA 1OWMA 2C0MA 3WXXA 1WY6A 1X5BA 4NURA 2J4DA 3SZ7A 4A3TA 4FULA 2V8SE 3L13A 3IBEA 2P58C 4CCAA 4OVUA 2EQXA 3FH8A 5BPPA 2Y3AA 1H2UA 3R7QA 4AIFA 3MX3A 4UI9K 1HS6A 3CV0A 3EDTB 1W3BA 5G05C 1E8WA 4UWGA 1E8YA 5HQ8A 2VGXA 3HIZA 5FWQA 2BTDA 2BUGA 4I17A 1L5JA 3CHQA 5LCWJ 3ZHEA 4Q69A 3ZYKA 4APFA 2I1KA 3B13A 4G26A 2LSVA 1H19A 2YQ8A 3IHVA 2C0LA 4I1MA 4JEHA 4UWFA 4U8HA 4K03A 3FP3A 5G55A 2AXVA 3FULA 5BNWA 2XRYA 2LO6A 2V5FA 4GCNA 4O6FA 3FDHA 1PAQA 1VDYA 3LS8A 3O48A 3URZA 4EZKA 4GZCA 4WNFA 3FUDA 2ZU6B 3QJZA 3CK8A 1DNPA 3UPVA 4L7TA 2YNQA 2XRZA 2VSNA 4FA6A 1QQEA 1XGWA 1SZ9A 1JPLA 2BF0X 2WXQA 1OWLA 3CVQA 2HYZA 3OXLA 3ZXSA 4LCTA 2FO7A 4RG9A 2J9QA 4WNDA 3FHEA 2NC9A 3SNXA 3CIAA 4UI9C 4UQZA 4NACA 4ABNA 3SGHA 4BY6A 1ELWA 3CK7A 3P1UA 4N3CA 4J8EA 4MRUA 3D9LA 3LJ3A 1HZ4A 4GMLA 3CSTA 4FC8A 5M72A 4IULA 3RKVA 3ZFWA 1HG2A 2PM6A 3EIJA 4PS8A 5D0OD 4YVQC 4I43A 4PS3A 5A7DB 3RRUA 4CDNA 5FQ4A 3RRMB 3ULQA 3AU4A 4WNEA 3CVWA 4E85A 3FUFA 1E90A 2HR2A 4NQ0A 4HOUA 3CK9A 4JXTA 3ESKA 4P29A 2XGSA 3G2UA 1HFAA 1HE8A 3JCKC 3OXFA 5D0QD 3UQ3A 2X3MA 4URKA 4LRZA 4KZCA 3RK6A 2KZTB 3ASHA 2WMOA 5BT1A 2YINA 2WVIA 4CDMA 5EKQD 3CGHA 1QZ2A 4KT6B 3ZYQA 3E4BA 5T3RA 2I1JA 3CR3A 4U63A 2WXPA 4F3VA 2CHZA 4N3BA 2FULA 4J6IA 5KCMA 2J09A 4LEUA 3UMVA 4PS7A 1HG5A 2XHEA 3G2SA 3MCXA 3K9IA 2MRIA 5FQ6A 5T4YA 2RD0A 1EYHA 5CCMA 2LAIA 4HOSA 3LVQE 3FEYA 1A17A 3SBSA 2J4BA 3PEVB 2XCCA 3S7FA 2PL2A 4BX8A 2GRLA 3VTYA 1NZNA 2LSUA 4LUNU 4BT8A 3CHOA 1NA0A 2GGFA 3GW4A 4JVSA 2XPIA 1DVPA 1EDUA 4FJYA 4BSXA 5LCWC 3FTUA 3FU0A 5EX0A 5JJ7A 3LXUX 1UJJA 3MGBA 3NQPA 4FLBA 3RO2A 3APCA 3UX4A 2X6HA 3L22A 3VLFA 2AVPA 2WXHA 1KT1A 3I4RB 2WQ6A 2V0PA 3PUKA 4AOFA 1UN8A 1PY1A 2KM4A 3FUKA 3MZLB 3ENEA 3FU3A 2X6JA 4MKTA 3D9IA 3PVLA 4E6HA 2OOEA 3HHMA 3FUHA 1B89A 5BUZA 3PNTB 4N5CA 2Y4TA 3PEUB 4GA1A 3ASGA 2X6KA 2E2EA 2IFUA 3Q5MA 3ZW3A 4G1TA 2HM8A 2KCLA 3T8MA 3LPZA 4BX9A 3PZDA 2KZTA 2VTBB 3UT7A 3FUJA 4GZ5A 3BEEA 4CGVA 4RG6A 2WMNA 3FFLA 1MHQA 2KC7A 4UQXA 2L0TB 2WQHA 3AU5A 4KXKB 4I1OB 3Q47B 4YNDA 1HF8A 4KVOA 4KYOB 2I6HA 5A6CA 1H2VC 4ANWA 5AJLA 3PREA 2WXRA 3O4ZA 4GMJA 4GZDA 3D9JA 4N39A 4OYSA 3RO3A 4I1AA 3ZPJA 3QNKA 2FEZA 3PDNA 3CQGB 3KAEA 4ILIA 3SHFA 2WXFA 2ILRA 3FH7A 2AWIA 3D3MA 3SD5A 4H7YA 1H0AA 2VSOE 2Q7FA 3FUEA 4V3IA 4A1GA 3LEWA 3L17A 4AVXA 3ONKA 1PC2A 4HOTA 3D9OA 2IJGX 4FU3A 3Q4AB 4JHRA 3G2TA 2L0IA 3ZN3A 4XZ4A 1ZBPA 4BFRA 4I6JA 5E75A 1QNFA 3ESLA 3CKCA 2QY7A 1NP7A 3B7TA 3CVVA 1ZU2A 3CEQA 4IN3B 2Y4UA 4XE0A 5J08A 3SF4A 1N54A 5LFAA 4FHJA 3MA5A 4EZJA 4AJWA 5G2NA 2V4LA 5BW8C 4ATGA 4N2QA 4UQYA 4BWRA 3KS2A 2VTBA 4EBAG 4TRQA 5JJ6A 2WQ7A 3EHMA 2XGOA 1E96B 2X6IA 3QKYA 4HORA 3JYSA 3ZYMA 2UY1B 5ARGA 3C98A 3APDA 4GYOA 3TGOA 3G2VA 1HH8A 4G23A 3JQ1A 2C2LA 4ANUA 3DPDA 4G24A 3QDNA 3NZUA 3FUMA 1TJFA 2LNIA 2PM7A 4FADA 3QWWA 2VSXE 4CT0A 1KLXA 3U9WA 4DLOA 2E0IA 4L2YA 3FU5A 3CHPA 4WWPA 2XPZA 4GZ6A 4DJAA 2VYIA 3U3WA 1BPOA 2FBNA 5G04C 3FTVA 4BT9A 5C1DA 4XI9A 1FVHA 5LOZA 5C2YA 4AM9A 3GYZA 1H6KA 5FQ8A 2GRMA 2I2OA 4WNGA 4XX5A 2WB2A 4R7LA 3CHRA 2RG8A 3ML8A 4I2WA 4U04A 4I9EA 3MEKA 2J07A 4GYYA 5FT9A 4HS2A 4RVBA 4B8AA 1FVFA 3CVYA 3N71A 3D9PA 5FZQA 3TG5A 4AY5A 4GYWA 4W9RA 4D10C 4ILGA 5G05J 2OVFA 2XGMA 3LVRE 3GZSA 3I3NA 3MKQB 2FF4A 5HI7A 3T5VA 4IRUA 4U0SA 1U3DA 5KJNA 3Q49B 4C0EA 3FTSA 5ANLA 2MOWA 4GB9A 3AS4A 3B7SA 4F53A 4GAAA 4K0RA 4UWHA 4TV3A 1Y6IA 3CHMA 3FU6A 3QAQA 4ACKA 4J8FA 4M3OA 1ELKA 2AXZA 2CFZA 2UWJG 3QC1A 2A4ZA 2UY1A 2XEVA 3ZVVA 4EECA 3S7BA 3FTYA 1WM5A 2WXMA 3L6AA 2IOSA 5DIZA 4KBQA 4WWNA 3UT4A 2ONDA 3PRZA 3VLDA 3CVNA 1UJKA 2WXIA 1OWPA 1INZA 5FTPA 3TG4A 4HVBA 2R5SA 3IV0A 5FZSA 3RIBA 3FH5A 3L54A 2M63A 3JUIA 2VQ2A 1HX8A 3FTXA 5ARFA 2WXKA 3CVUA 4AV7A 4KMOA 3UUXA 4ANVA 4Y6CA 4XIFA 1YA0A 4LERA 3CHSA 2HO1A 3S7JA 5BV0A 4ACLA 3OAWA 2MHKA 2I9CA 3CVXA 2JLBA 4WUYA 2OV8A 2DBAA 1FCHA 3SBTB 2NSZA 1Z6TA 5CHEE 1MQSA 4JW1A 4GPKA 4EZLA 3U64A 2CHWA 3MKQA 4NRHB 4XKBA 3CKBA 4DI3A 4G25A 2QFCA 3TXNA 4I9CA 2L9BA 2YHCA 2CFUA 4C0MA 5CMWA 4YVOA 4WWOA 4F1SA 2DCPA 5CCLA 4I2ZA 4C9BB 4G2VA 3IEGA 3PE3A 1E8XA 2IQCA 4JHJA 3FTWA 4GZ3A 2DIWA 1EPUA 2IONA 3AS5A 3Q15A 4HFGA 3KD7A 4JC8A 3FTZA 2J08A 3FY4A 1E7VA 3PE4A 3IHYA 4CRWA 1JWGA 1OWNA 2YHEA 3MJWA 3GZ2A 4JA7A 4XKCA 4B89A 4HXIA 4I6GA 1IHGA 4XI0A 4B0ZA 2CG2A 3ZIMA 4HOQA 2WXNA 4GU5A 5ANRA 1LF8A 2J49A 3CVPA 3TL5A 1JUQA 4CDRA 2PQNA 5FJYA 4JA9A 3ML9A 5KJKA 3UT8A 3GZ1A 4AY6A 3NF1A 3MV2B 5FZRA 3RJVA 3HVEB 2KATA 4Q96A 3D9MA 3I4GA 4UWKA 5CMYA 4A3VA 4U0ZA 3G2WA 1Z3XA 2KCVA 1NA3A 1N52A 2WXGA 1GW6A 1IQRA 3CQCB 1U3CA 3QK0A 3B7UX 4FJZA 3HDXA 4JL0A 4MS6A 5EDSA 2L6JA 4KZ0A 3QWVA 2FI7A 5KJMA 2IF4A 3FUIA 4EQFA 3PS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKU A;  4GCO A;  4CGW A;  3MKR A;  3HYM B;  3LYA A;  4GA0 A;  2WPV A;  3RU0 A;  3FWV A;  5HQ8 A;  3LY9 A;  4H7X A;  3LCA A;  4A1S A;  3LY8 A;  4BTA A;  2PQR A;  4ME2 A;  4APO A;  4J0U A;  4U07 A;  3VTX A;  2PZI A;  3QWP A;  3TAX A;  1TJC A;  3ASD A;  1HXI A;  5EX3 A;  2VSY A;  4BTB A;  5AYW D;  4U0U A;  2KCK A;  2VGY A;  2VGX B;  5JJT A;  1Y8M A;  5DBK A;  3ZHE B;  3ZGQ A;  1P5Q A;  3U4T A;  5KJL A;  4UI9 J;  4N2S A;  1ELR A;  3QOU A;  1XNF A;  3AS8 A;  2XCB A;  1WAO 1;  4J8D A;  3R9A B;  1KT0 A;  4Y6W A;  2GW1 A;  1OUV A;  4B94 A;  3S7D A;  3CVL A;  4N3A A;  3ASF A;  3LY7 A;  3MV3 B;  1IYG A;  5G04 J;  3OXG A;  4GA2 A;  2C0M A;  3WXX A;  3SZ7 A;  2P58 C;  4AIF A;  4UI9 K;  3CV0 A;  3EDT B;  1W3B A;  5G05 C;  2VGX A;  2BUG A;  5LCW J;  4I17 A;  3ZHE A;  4G26 A;  2LSV A;  2YQ8 A;  2C0L A;  3FP3 A;  5BNW A;  2V5F A;  4GCN A;  4O6F A;  3URZ A;  3O48 A;  4WNF A;  3CK8 A;  3UPV A;  2VSN A;  1QQE A;  3CVQ A;  2HYZ A;  3OXL A;  2FO7 A;  4RG9 A;  2J9Q A;  4WND A;  2NC9 A;  4UI9 C;  4UQZ A;  4ABN A;  1ELW A;  3CK7 A;  4N3C A;  4J8E A;  1HZ4 A;  5M72 A;  3RKV A;  3ZFW A;  5D0O D;  4YVQ C;  5A7D B;  3ULQ A;  4WNE A;  2HR2 A;  4NQ0 A;  4HOU A;  3CK9 A;  3ESK A;  2XGS A;  5D0Q D;  3OXF A;  3UQ3 A;  3ASH A;  5BT1 A;  5EKQ D;  1QZ2 A;  3E4B A;  4F3V A;  4N3B A;  4LEU A;  3K9I A;  5CCM A;  4HOS A;  1A17 A;  2XCC A;  3S7F A;  2PL2 A;  3VTY A;  2LSU A;  1NZN A;  4BT8 A;  1NA0 A;  3GW4 A;  2XPI A;  5LCW C;  5EX0 A;  5JJ7 A;  3RO2 A;  2AVP A;  1KT1 A;  2OOE A;  1B89 A;  4N5C A;  2Y4T A;  4GA1 A;  3ASG A;  2E2E A;  2IFU A;  3Q5M A;  4G1T A;  2KCL A;  3LPZ A;  4CGV A;  4GZ5 A;  3BEE A;  4RG6 A;  3FFL A;  2KC7 A;  4UQX A;  4YND A;  2WQH A;  4KXK B;  3Q47 B;  4KYO B;  2I6H A;  5A6C A;  4N39 A;  3RO3 A;  4I1A A;  3ZPJ A;  2FEZ A;  3PDN A;  3KAE A;  4H7Y A;  2Q7F A;  1PC2 A;  4HOT A;  3Q4A B;  4JHR A;  3ZN3 A;  1ZBP A;  3CKC A;  1ZU2 A;  3CEQ A;  4IN3 B;  2Y4U A;  3SF4 A;  3MA5 A;  5BW8 C;  4N2Q A;  4UQY A;  4BWR A;  3KS2 A;  5JJ6 A;  2XGO A;  1E96 B;  3QKY A;  4HOR A;  3JYS A;  2UY1 B;  5ARG A;  4GYO A;  3TGO A;  1HH8 A;  4G23 A;  2C2L A;  4G24 A;  3QDN A;  2LNI A;  3QWW A;  1KLX A;  4GZ6 A;  2VYI A;  3U3W A;  2FBN A;  5G04 C;  4BT9 A;  5C1D A;  4XI9 A;  4AM9 A;  3GYZ A;  4WNG A;  4I2W A;  4U04 A;  4I9E A;  3MEK A;  4GYY A;  5FT9 A;  3N71 A;  5FZQ A;  4AY5 A;  3TG5 A;  4GYW A;  4W9R A;  5G05 J;  2XGM A;  2FF4 A;  5HI7 A;  4U0S A;  5KJN A;  3Q49 B;  3AS4 A;  4J8F A;  2UWJ G;  2UY1 A;  2XEV A;  3S7B A;  1WM5 A;  5DIZ A;  4KBQ A;  2OND A;  3CVN A;  5FTP A;  3TG4 A;  2R5S A;  5FZS A;  3RIB A;  2VQ2 A;  5ARF A;  3UUX A;  4Y6C A;  4XIF A;  1YA0 A;  2HO1 A;  3S7J A;  2MHK A;  2JLB A;  4WUY A;  2DBA A;  1FCH A;  5CHE E;  4GPK A;  4NRH B;  3CKB A;  4G25 A;  2QFC A;  4I9C A;  2YHC A;  4YVO A;  5CCL A;  4I2Z A;  4G2V A;  3IEG A;  3PE3 A;  4GZ3 A;  3AS5 A;  3Q15 A;  3KD7 A;  3PE4 A;  3GZ2 A;  4JA7 A;  1IHG A;  4XI0 A;  4HOQ A;  3CVP A;  4CDR A;  2PQN A;  5FJY A;  4JA9 A;  5KJK A;  4AY6 A;  3GZ1 A;  3NF1 A;  3MV2 B;  5FZR A;  3RJV A;  2KAT A;  4U0Z A;  2KCV A;  1NA3 A;  4JL0 A;  2L6J A;  3QWV A;  2FI7 A;  5KJM A;  2IF4 A;  4EQF A; 
#chains in the Genus database with same CATH topology
 5LX8 A;  5JHA A;  3HYM B;  3LYA A;  3B7R L;  2IU1 A;  3S2A A;  4PH4 B;  5HQ8 A;  1IQU A;  2P2C P;  5E76 A;  1JCQ A;  1TNB A;  1S63 A;  2PQR A;  1O1S A;  3HXC A;  4APO A;  4DUI A;  2OVB A;  4X8Q A;  3EHN A;  4PDX A;  1N11 A;  2H6I A;  2WM9 A;  3UM0 A;  2X6F A;  1TJC A;  1S0P A;  3D9N A;  1KZO A;  4HI9 A;  5EX3 A;  5FIO A;  4DX5 D;  5JJT A;  5DBK A;  2F8Y A;  3ZHE B;  2ETC A;  4Q94 A;  5ENQ D;  1HO8 A;  4IYP A;  3AS8 A;  3LDZ A;  4TUU A;  3Q9U C;  5A23 A;  1LD8 A;  2DWZ A;  2IEJ A;  3FUN A;  2WXJ A;  3EUV A;  3JXI A;  4B94 A;  3C3O A;  4AP2 A;  4ANX A;  3MV3 B;  4U8Y D;  5EID A;  1IYG A;  3CLJ A;  3KEZ A;  1D9S A;  1BU9 A;  2P9S G;  1ZB1 A;  4GA2 A;  1E7U A;  1OWM A;  2J4D A;  3ZKJ A;  3IBE A;  2P58 C;  4YDW A;  2EQX A;  4HQD A;  2Y3A A;  3HRA A;  4O1P A;  4AIF A;  4UI9 K;  1MYO A;  1W3B A;  5FWQ A;  5LCW J;  4Q69 A;  2GRQ B;  3B13 A;  1H19 A;  4I1M A;  1D8E A;  4U8H A;  4K03 A;  2LO6 A;  4GCN A;  3LS8 A;  4HLL A;  2R05 A;  4L7T A;  2YNQ A;  2QYU A;  2WXQ A;  4TXR A;  3OXL A;  4LCT A;  3SNX A;  4LNG A;  4UI9 C;  1Q2Z A;  1TYQ G;  4NAC A;  4MRU A;  3BU8 A;  3RKV A;  3EIJ A;  4PS8 A;  4PS3 A;  5A7D B;  2RKK A;  3ULQ A;  1K1B A;  5B1B E;  4NQ0 A;  4HOU A;  4C48 B;  5D0Q D;  1HE8 A;  3HXE A;  4LRZ A;  3RK6 A;  2KZT B;  5JA4 D;  1QZ2 A;  4KT6 B;  2DYS E;  5T3R A;  2I1J A;  4K5A B;  4N3B A;  2J09 A;  4O60 A;  2XHE A;  2MRI A;  5FQ6 A;  1TNO A;  3FEY A;  3SBS A;  3S7F A;  4BX8 A;  1NZN A;  2LSU A;  1BI7 B;  1NA0 A;  3FU0 A;  3UX4 A;  2X6H A;  3L22 A;  2AVP A;  2WQ6 A;  2V0P A;  4AOF A;  1UN8 A;  3MZL B;  4JD2 G;  1N4Q A;  3D9I A;  5BUZ A;  1SW6 A;  3KEA A;  2X6K A;  3UIN C;  1V54 E;  3B7B A;  3V2X A;  1H6O A;  2WMN A;  2LXL A;  4KXK B;  4I1O B;  2QZA A;  4KVO A;  5AJL A;  3E34 A;  4GZD A;  4OYS A;  3ZPJ A;  2FEZ A;  3PDN A;  3KAE A;  2ETA A;  1H0A A;  1N95 A;  4YDY A;  4V3I A;  3ONK A;  1PC2 A;  5EN5 D;  3G2T A;  3ZN3 A;  4XZ4 A;  2Y69 E;  3ESL A;  3CKC A;  3B7T A;  1OCO E;  5J08 A;  2Y4U A;  4HNA D;  3ZNG A;  4N2Q A;  4UQY A;  5JJ6 A;  2WQ7 A;  1E96 B;  2X6I A;  5CBN A;  3JYS A;  2UY1 B;  4GYO A;  3TGO A;  2C2L A;  1TJF A;  3TWR A;  2PM7 A;  1KLX A;  3U9W A;  4DLO A;  4DJA A;  2VYI A;  1FT1 A;  4ATZ D;  4AM9 A;  5FQ8 A;  3W9F A;  4TXP A;  4XX5 A;  3CHR A;  4YDO A;  2P9U G;  4GTO A;  2J07 A;  4GYY A;  4HS2 A;  4RVB A;  1FVF A;  3CVY A;  4AY5 A;  4W9R A;  5G05 J;  3D9H A;  3LVR E;  3GZS A;  3V31 A;  4DX7 D;  5AAR A;  1LD7 A;  5HI7 A;  4BER A;  1U3D A;  3TWV A;  3FTS A;  2MOW A;  4GB9 A;  3B7S A;  4K0R A;  4TV3 A;  4M7C A;  4ACK A;  3ZVV A;  4EEC A;  1WM5 A;  2WXM A;  3DSX A;  2H6H A;  1WDY A;  2WXI A;  4G8K A;  1OWP A;  3BUA A;  3TG4 A;  5BXO A;  2M63 A;  5ARF A;  1NL4 A;  5ENO D;  4KMO A;  4XIF A;  1YA0 A;  4LER A;  3CHS A;  3S7J A;  5BV0 A;  4ACL A;  2MHK A;  3NOG D;  2EIN E;  1IHB A;  2NSZ A;  5CHE E;  5ENR D;  2CHW A;  4XKB A;  4DI3 A;  2EIK E;  2HE0 A;  4WWO A;  5CCL A;  1E8X A;  4DX1 A;  2P9K G;  1EPU A;  2ION A;  3Q15 A;  3NOC D;  3KD7 A;  3J5Q B;  4XKC A;  4GMR A;  2F37 A;  4XI0 A;  5ANR A;  2WXN A;  2PQN A;  4JA9 A;  3ML9 A;  1OCZ E;  2VGE A;  3HVE B;  5CMY A;  4A3V A;  4U0Z A;  3G2W A;  1N0Q A;  4MS6 A;  3QWV A;  2IF4 A;  3PS6 A;  3EIQ C;  4QQI A;  1DCE A;  3MKR A;  4CGW A;  2AW6 A;  3IKO B;  3SFZ A;  4OVV A;  4GA0 A;  1UG3 A;  3RU0 A;  2V5Q C;  3ZYL A;  5BV1 A;  3NZS A;  4CEM A;  3LY9 A;  1MZC A;  3LCA A;  3JXJ A;  1S70 B;  5ENN A;  2BKG A;  3LJN A;  1AP7 A;  3RRN B;  4J0U A;  3ZRH A;  4B8C B;  4U07 A;  4JB8 P;  1UN9 A;  3JQ0 A;  2DZN A;  4L2L A;  1JWF A;  4EHM A;  3ASD A;  4HLE A;  5KWD A;  2P9P G;  3DST A;  4U0U A;  4RSY A;  1EF1 C;  4DPR A;  2IOL A;  2VGX B;  5FQ7 A;  1Y8M A;  3DEP A;  1P5Q A;  1KZP A;  4CT4 A;  4JPS A;  5KJL A;  4UI9 J;  2ZGD A;  1XNF A;  4LG6 A;  4L1B A;  2XCB A;  4HI8 A;  3CSF A;  3IXE A;  4KVM A;  4AEZ C;  2R17 C;  2NXP A;  3S7D A;  4EBA A;  3QB2 A;  5B3S E;  2R03 A;  1X81 A;  3ISM C;  3TWQ A;  4DK5 A;  5G04 J;  1TN7 A;  3PH0 C;  2XZT G;  4AXH A;  3OXG A;  3APF A;  4UWL A;  4JHK A;  2LAH A;  4A63 B;  1X5B A;  3L13 A;  4CCA A;  5BPP A;  1TNU A;  1HS6 A;  4NIK A;  5G05 C;  1E8Y A;  3HIZ A;  2BKK B;  2BUG A;  3ZYK A;  2I1K A;  5ITZ F;  3UM3 A;  2AXV A;  5BNW A;  3J5P A;  3ABL E;  4EZK A;  1VDY A;  3O48 A;  1AWC B;  4WNF A;  3FUD A;  5B1A E;  3UPV A;  2XRZ A;  3DWL G;  2BF0 X;  1SZ9 A;  1OWL A;  2HYZ A;  4RG9 A;  4ABN A;  3CK7 A;  4U8V D;  3D9L A;  3CST A;  4FC8 A;  4OAU C;  3AJI A;  1HG2 A;  4I43 A;  3RRU A;  3RRM B;  3PZ2 A;  4WNE A;  5ENT D;  1E90 A;  3RAU A;  4JXT A;  1S64 A;  3ESK A;  3JCK C;  2A5E A;  2X3M A;  4URK A;  2GRN B;  3ASH A;  2YIN A;  2WVI A;  3C3Q A;  4CDM A;  3E4B A;  1O5M A;  4U63 A;  5HRY A;  4J6I A;  5KCM A;  3NAW A;  5CER B;  3UMV A;  3G2S A;  3MCX A;  2RD0 A;  1EYH A;  2ZIR A;  1QYM A;  4BT8 A;  3JUE A;  4FJY A;  3LXU X;  1UJJ A;  4FLB A;  3APC A;  4CZ2 D;  1A5E A;  1KT1 A;  2V4H C;  3PUK A;  2OOE A;  3FUH A;  1B89 A;  3PNT B;  3PEU B;  4GA1 A;  3ASG A;  3ZW3 A;  2B0O E;  2HM8 A;  4BX9 A;  5D66 A;  1MJ0 A;  2VTB B;  3FUJ A;  5KNG A;  3BEE A;  4MBG A;  2L0T B;  3AU5 A;  5ENS D;  3Q9N C;  3NB2 A;  1YCS B;  1JCR A;  3ASN E;  3Q7F A;  2WXF A;  2ILR A;  1TN8 A;  1K8K G;  4H7Y A;  3FUE A;  4HOT A;  3D9O A;  2IJG X;  4BFR A;  3ZUV B;  3DSS A;  4Z68 A;  1NP7 A;  1N54 A;  3MA5 A;  3DEO A;  5G2N A;  3EHM A;  3C98 A;  3TWW A;  3JQ1 A;  4ANU A;  3FUM A;  2NYJ A;  3V30 A;  2VSX E;  4CT0 A;  4L2Y A;  3CHP A;  2XPZ A;  3U3W A;  3UTM A;  5G04 C;  3FTV A;  5CRU A;  4BT9 A;  4XI9 A;  5C1D A;  5C2Y A;  1DCQ A;  2GRM A;  2I2O A;  4WNG A;  4I2W A;  4GPM A;  4U04 A;  3MEK A;  3N71 A;  3D9P A;  5FZQ A;  3TG5 A;  4D10 C;  3I3N A;  5CRV A;  4IRU A;  3Q49 B;  5ANL A;  3AS4 A;  4GAA A;  3FU6 A;  3QAQ A;  3CVN A;  2ZGG A;  1INZ A;  5FTP A;  5FZS A;  3FH5 A;  2MYO A;  5HS0 A;  3FTX A;  2WXK A;  3CVU A;  1Z5S C;  2HO1 A;  3OAW A;  1BD8 A;  4G8L A;  4LNU D;  1Z6T A;  5CED B;  1MQS A;  4EZL A;  3MKQ A;  2ZIS A;  2QFC A;  3TXN A;  2L9B A;  5CMW A;  4F1S A;  1NI1 A;  4I2Z A;  4C9B B;  3IEG A;  1N4S A;  1MX6 A;  3PE3 A;  4JHJ A;  5AQB A;  3PZ1 A;  4GZ3 A;  2DIW A;  3AS5 A;  3PE4 A;  3GZ2 A;  5HKP A;  4HXI A;  4I6G A;  4B0Z A;  1LF8 A;  3TL5 A;  1JUQ A;  3MV2 B;  5FZR A;  3RJV A;  2KAT A;  4Q96 A;  3D9M A;  3I4G A;  1BLX B;  3FUI A;  3X2Q E;  3L82 A;  4EQF A;  4GCO A;  1MX4 A;  3HXD A;  3HXB A;  4A55 A;  3FWV A;  3C72 A;  3EJN A;  5J90 A;  2JEK A;  3TJP A;  4H7X A;  1H2T C;  1SA5 A;  3LY8 A;  5T8I A;  4WAF A;  4FP7 A;  5LP0 A;  1UW4 B;  3PZ4 A;  3ZEF A;  3UM1 A;  1TEZ A;  2PZI A;  3QWP A;  3R7R A;  3AG1 E;  1Z3Y A;  3TAX A;  2A5U A;  4BTB A;  3TXM A;  4MLP A;  4J8Y A;  3U66 A;  2KCK A;  2VGY A;  3PNL B;  3BG1 B;  4GTT A;  4J8S A;  1SZA A;  1ELR A;  4ILH B;  5AQ7 A;  3ULY A;  1WAO 1;  1KT0 A;  3C5R A;  4Y6W A;  2GW1 A;  5AEN A;  1G3N B;  1D8D A;  3L16 A;  2WXO A;  1OUV A;  1O1R A;  3CVL A;  3DPY A;  3L08 A;  4N3A A;  1V55 E;  2R59 A;  3LY7 A;  4HB5 A;  2XPY A;  3FEX A;  3E32 A;  3ULE G;  3TWT A;  3BG0 B;  4NUR A;  3SZ7 A;  4A3T A;  4FUL A;  2V8S E;  4OVU A;  3FH8 A;  1H2U A;  3CV0 A;  3EDT B;  2PNN A;  1E8W A;  5BXU A;  4LNB A;  2BTD A;  4I17 A;  1L5J A;  3CHQ A;  3ZHE A;  4APF A;  1IXV A;  3IHV A;  5G55 A;  2C0L A;  4O6F A;  1PAQ A;  3QJZ A;  3CK8 A;  1DNP A;  2VSN A;  1QQE A;  3ZXS A;  2FO7 A;  4GTR A;  4U7E B;  1FPP A;  3FHE A;  2NC9 A;  3CIA A;  3SGH A;  2P9I G;  4J8E A;  3LJ3 A;  4GML A;  4IUL A;  3ZFW A;  2PM6 A;  4YVQ C;  1H6P A;  3AU4 A;  3CVW A;  4E85 A;  5AN8 A;  3CK9 A;  4P29 A;  3KSQ A;  1HFA A;  4HRL A;  4O1O A;  4KZC A;  3CGH A;  3ABM E;  2WXP A;  1TR4 A;  2FUL A;  4PS7 A;  1HG5 A;  3Q7A A;  3K9I A;  2XEE A;  5T4Y A;  4HOS A;  2LAI A;  2PL2 A;  3EHQ A;  3VTY A;  1MX2 A;  3CHO A;  3GW4 A;  4JVS A;  2P9L G;  2OCC E;  1DVP A;  3FTU A;  5JJ7 A;  3VLF A;  5KBA A;  4OAV B;  2WXH A;  3I4R B;  2KM4 A;  3FUK A;  3ENE A;  3FU3 A;  2X6J A;  4MKT A;  4E6H A;  2EIJ E;  4N5C A;  3V2O A;  3UXG A;  3Q5M A;  3T8M A;  2KZT A;  4CGV A;  4GZ5 A;  3FFL A;  2KC7 A;  4UQX A;  2WQH A;  1O1T A;  1LTX A;  1H2V C;  3UI2 A;  3PRE A;  4GTS A;  4N39 A;  1OCR E;  3O4Z A;  2IO2 C;  4I1A A;  3C3R A;  3E37 A;  3QNK A;  1TNY A;  3CQG B;  4ILI A;  3UKR G;  3SHF A;  3HXF A;  5CBO A;  1RZ4 A;  2VSO E;  4F1P A;  3LEW A;  3L17 A;  5ENP D;  2F0Y A;  4K5C A;  1ZU2 A;  3CEQ A;  3SF4 A;  4FHJ A;  1FT2 A;  3SFY A;  4EZJ A;  5BW8 C;  4ATG A;  3KS2 A;  4TRQ A;  3L9T A;  2XGO A;  3T9K A;  4ZFH A;  4HOR A;  3ZYM A;  1TN6 A;  3APD A;  3G2V A;  3DPD A;  3NZU A;  3QWW A;  3DXK G;  2E0I A;  3FU5 A;  4WWP A;  4GZ6 A;  2ETB A;  2XEN A;  1BPO A;  2FBN A;  4U96 D;  1FVH A;  3DSU A;  2WB2 A;  2ZXW E;  2RG8 A;  3ML8 A;  4I9E A;  5FT9 A;  4B8A A;  4ILG A;  2OVF A;  4GTM A;  5FIN A;  3T5V A;  4U0S A;  3EHR A;  4GTQ A;  4UWH A;  3WG7 E;  3SFX A;  4RLY A;  4J8F A;  2AXZ A;  2CFZ A;  3QC1 A;  2UY1 A;  2XEV A;  3FTY A;  4KBQ A;  2JAB A;  4DRX E;  3ASO E;  2OND A;  3Q73 A;  5H7P A;  4HVB A;  2R5S A;  3IV0 A;  3E30 A;  5CEA A;  3JUI A;  4UUC A;  4AV7 A;  3UUX A;  2RFM A;  3AG3 E;  2I9C A;  2JLB A;  4WUY A;  2OV8 A;  3E33 A;  4JW1 A;  4GPK A;  3U64 A;  2F8X K;  3CKB A;  4I9C A;  2IO3 C;  2YHC A;  4C0M A;  4YVO A;  2IY0 C;  4L9P A;  3FTW A;  4N5Q A;  3TWS A;  4HFG A;  4JC8 A;  3DXM G;  1E7V A;  3IHY A;  4CRW A;  1JWG A;  4HBD A;  1OWN A;  2YHE A;  1IHG A;  2CG2 A;  4HOQ A;  4GU5 A;  3CVP A;  2J49 A;  1U2V G;  3TWU A;  5FJY A;  3NF1 A;  4UWK A;  4DX2 A;  2XEH A;  1Z3X A;  1NA3 A;  3CQC B;  1IQR A;  4FJZ A;  4JL0 A;  3B7U X;  4BSZ B;  4KZ0 A;  1WG0 A;  3LKU A;  3PUJ A;  2P9N G;  4JZY A;  4I6E A;  4U95 D;  1OCC E;  3UM2 A;  4RQI A;  4G11 A;  3DBS A;  2WPV A;  3ONL A;  2QC9 A;  4L23 A;  4FHK A;  3Q79 A;  5AIJ A;  3I5P A;  2XQ0 A;  4A1S A;  4BTA A;  4BES A;  4ME2 A;  2X38 A;  5AJD A;  3B95 A;  2BED A;  1E8Z A;  3OTN A;  4JEU A;  5AQA A;  2B6C A;  4HRN A;  3VTX A;  2OEW A;  3P2B A;  1DC2 A;  4FLH A;  3T5X A;  3R9M A;  3MYV A;  5KNH D;  1HXI A;  2VJ8 A;  1OWO A;  2VSY A;  5AYW D;  3HVE A;  3W9G A;  1SVX A;  2KXP C;  2GRP B;  4F7A A;  3QAR A;  4PUC A;  3ZGQ A;  3U4T A;  5JHB A;  1SQM A;  4N2S A;  3QOU A;  2DVW A;  3ABK E;  2CHX A;  4J8D A;  3R9A B;  2AXU A;  4F6R D;  3Q78 A;  3VLE A;  4DLQ A;  2WXL A;  4DI4 A;  1N4R A;  4EPZ A;  3SI5 A;  3ASF A;  1HU3 A;  3DSW A;  3KSL A;  3RSE G;  3F6Q A;  3D9K A;  3AG4 E;  2CG3 A;  2DYR E;  4QFV A;  4B93 B;  2C0M A;  3WXX A;  1WY6 A;  3PZ3 A;  3R7Q A;  3MX3 A;  3SO8 A;  4UWG A;  3SQV A;  2VGX A;  3Q75 A;  4G26 A;  2LSV A;  2YQ8 A;  4JEH A;  4UWF A;  3FP3 A;  3UIP C;  3FUL A;  2XRY A;  2V5F A;  3HG0 D;  2QYJ A;  3FDH A;  3URZ A;  4GZC A;  2ZU6 B;  4FA6 A;  1XGW A;  1JPL A;  3CVQ A;  2L6B A;  3DSV A;  2J9Q A;  4WND A;  1OT8 A;  4BET A;  1NFI E;  4UQZ A;  2R02 A;  4BY6 A;  1ELW A;  3P1U A;  4N3C A;  1HZ4 A;  5AAO A;  5D2M C;  5AQ9 A;  5M72 A;  5D0O D;  4LSZ E;  5EIB E;  4CDN A;  5FQ4 A;  3FUF A;  2HR2 A;  3EU5 A;  3UKU G;  2XGS A;  3G2U A;  3T8K A;  3OXF A;  3UQ3 A;  2WMO A;  5BT1 A;  2Y1L E;  5EKQ D;  2EIM E;  3ZYQ A;  3CR3 A;  1BI8 B;  3ZXP A;  4F3V A;  2CHZ A;  2Y0B G;  4LEU A;  2R2L A;  1N0R A;  5CCM A;  3LVQ E;  4ZHB A;  1A17 A;  2J4B A;  3PEV B;  2XCC A;  2GRL A;  4LUN U;  2GGF A;  2XPI A;  1EDU A;  4BSX A;  2XS8 A;  5LCW C;  5EX0 A;  4CYM D;  5JMN D;  3MGB A;  3NQP A;  3RO2 A;  1RW2 A;  2GRO B;  1PY1 A;  3AG2 E;  3PVL A;  3HHM A;  2Y4T A;  2E2E A;  2IFU A;  4G1T A;  2KCL A;  3LPZ A;  3UIO C;  3NBN B;  3PZD A;  3UT7 A;  4BEP A;  4RG6 A;  1MHQ A;  4YND A;  1IKN D;  1KPS B;  3Q47 B;  1HF8 A;  5CEC B;  4KYO B;  2I6H A;  5A6C A;  3BQO A;  4ANW A;  4XEI G;  2WXR A;  4GMJ A;  3RO3 A;  3D9J A;  1YMP A;  2EIL E;  3FH7 A;  2AWI A;  3D3M A;  4GTV A;  3SD5 A;  2Q7F A;  2LUH A;  4A1G A;  2LXM A;  4AVX A;  4FU3 A;  3Q4A B;  4JHR A;  2L0I A;  1ZBP A;  2GRR B;  4I6J A;  5E75 A;  1QNF A;  2QY7 A;  3CVV A;  4IN3 B;  4XE0 A;  5LFA A;  4AJW A;  2V4L A;  2J8S D;  4BWR A;  2VTB A;  4YDE A;  4EBA G;  3QKY A;  5IY5 E;  5ARG A;  1HH8 A;  4G23 A;  4G24 A;  3QDN A;  1TNZ A;  2LNI A;  4FAD A;  1N94 A;  2H6G A;  5LOZ A;  3GYZ A;  1H6K A;  4R7L A;  4GYW A;  2KBX A;  2XGM A;  1N9A A;  3MKQ B;  2FF4 A;  5KJN A;  4J7W A;  2OEV A;  4C0E A;  1JCS A;  4F53 A;  2XS1 A;  4TUM A;  3DRA A;  1Y6I A;  3CHM A;  4M3O A;  1ELK A;  2UWJ G;  1YYH A;  2A4Z A;  3S7B A;  2AJA A;  3L6A A;  2IOS A;  5DIZ A;  4WWN A;  3UT4 A;  3AAA C;  3PRZ A;  4HRM B;  3VLD A;  1UJK A;  5EIL A;  4TXQ A;  2DZO A;  2H6F A;  3RIB A;  1OY3 D;  3L54 A;  2FO1 E;  3EU9 A;  2VQ2 A;  1HX8 A;  3SY2 A;  5EYL A;  3ZU7 B;  1SA4 A;  4ANV A;  4Y6C A;  2RFA A;  3CVX A;  2DBA A;  1FCH A;  3SBT B;  4NRH B;  1QBQ A;  4G25 A;  2CFU A;  2DCP A;  4K5B A;  4G2V A;  2IQC A;  1N4P A;  3TWX A;  1UOH A;  3FTZ A;  2J08 A;  3FY4 A;  1K1A A;  3MJW A;  4JA7 A;  4B89 A;  2XZD G;  5EYP F;  3ZIM A;  4CDR A;  5KJK A;  3V79 K;  4AY6 A;  3UT8 A;  3GZ1 A;  4DX6 D;  1OXJ A;  2KCV A;  1N52 A;  2WXG A;  1GW6 A;  3QK0 A;  1U3C A;  4GTP A;  3HDX A;  1K3Z D;  5EDS A;  2L6J A;  2FI7 A;  5KJM A; 
#chains in the Genus database with same CATH homology
 3LKU A;  3PUJ A;  4GCO A;  3EIQ C;  5LX8 A;  4JZY A;  4I6E A;  3MKR A;  4CGW A;  2AW6 A;  3IKO B;  5JHA A;  3SFZ A;  3HYM B;  3LYA A;  4OVV A;  4GA0 A;  3B7R L;  4G11 A;  2IU1 A;  3DBS A;  2WPV A;  1UG3 A;  3S2A A;  3RU0 A;  4A55 A;  3ONL A;  3FWV A;  4PH4 B;  3ZYL A;  3EJN A;  4L23 A;  5BV1 A;  1IQU A;  3NZS A;  4FHK A;  4CEM A;  2JEK A;  3LY9 A;  3TJP A;  5J90 A;  4H7X A;  5AIJ A;  5E76 A;  3LCA A;  3I5P A;  2XQ0 A;  1H2T C;  4A1S A;  5T8I A;  3LY8 A;  4WAF A;  4BTA A;  4FP7 A;  5LP0 A;  2PQR A;  4ME2 A;  2X38 A;  5AJD A;  5ENN A;  3RRN B;  4APO A;  4J0U A;  3ZRH A;  1UW4 B;  2OVB A;  4B8C B;  3EHN A;  4U07 A;  1E8Z A;  3OTN A;  4JEU A;  1UN9 A;  3ZEF A;  4PDX A;  1TEZ A;  3VTX A;  3JQ0 A;  4L2L A;  2PZI A;  3QWP A;  3R7R A;  2WM9 A;  3P2B A;  1JWF A;  4FLH A;  2X6F A;  1Z3Y A;  3T5X A;  3TAX A;  1TJC A;  1S0P A;  3D9N A;  3MYV A;  3ASD A;  4HLE A;  1HXI A;  5EX3 A;  2VJ8 A;  2A5U A;  1OWO A;  2VSY A;  3TXM A;  4BTB A;  5AYW D;  4MLP A;  3HVE A;  4U0U A;  4RSY A;  1EF1 C;  3U66 A;  2KCK A;  2VGY A;  2IOL A;  2VGX B;  3PNL B;  4DPR A;  5JJT A;  3BG1 B;  5FQ7 A;  1Y8M A;  5DBK A;  4F7A A;  3QAR A;  4PUC A;  3ZHE B;  3ZGQ A;  1P5Q A;  4J8S A;  3U4T A;  1SZA A;  1SQM A;  4CT4 A;  5JHB A;  4JPS A;  5KJL A;  4Q94 A;  4UI9 J;  4N2S A;  1ELR A;  4ILH B;  1HO8 A;  3QOU A;  1XNF A;  4IYP A;  3AS8 A;  3LDZ A;  4TUU A;  4L1B A;  2CHX A;  2XCB A;  5A23 A;  1WAO 1;  4J8D A;  3R9A B;  2AXU A;  1KT0 A;  4Y6W A;  2GW1 A;  3CSF A;  5AEN A;  3VLE A;  4KVM A;  4AEZ C;  3L16 A;  2WXO A;  3FUN A;  4DLQ A;  2R17 C;  1OUV A;  2WXJ A;  2NXP A;  2WXL A;  3S7D A;  4B94 A;  4EBA A;  3CVL A;  4DI4 A;  3L08 A;  4N3A A;  3QB2 A;  4EPZ A;  4AP2 A;  2R59 A;  3SI5 A;  3ASF A;  1HU3 A;  3LY7 A;  4ANX A;  3MV3 B;  2XPY A;  4DK5 A;  3CLJ A;  1IYG A;  5G04 J;  3KEZ A;  3FEX A;  3PH0 C;  4AXH A;  3OXG A;  3D9K A;  3APF A;  4UWL A;  3BG0 B;  4JHK A;  4GA2 A;  2LAH A;  2CG3 A;  4QFV A;  1E7U A;  1OWM A;  2C0M A;  3WXX A;  1WY6 A;  1X5B A;  4NUR A;  2J4D A;  3SZ7 A;  4A3T A;  4FUL A;  2V8S E;  3L13 A;  3IBE A;  2P58 C;  4CCA A;  4OVU A;  2EQX A;  3FH8 A;  5BPP A;  2Y3A A;  1H2U A;  3R7Q A;  4AIF A;  3MX3 A;  4UI9 K;  1HS6 A;  3CV0 A;  3EDT B;  1W3B A;  5G05 C;  1E8W A;  4UWG A;  1E8Y A;  5HQ8 A;  2VGX A;  3HIZ A;  5FWQ A;  2BTD A;  2BUG A;  4I17 A;  1L5J A;  3CHQ A;  5LCW J;  3ZHE A;  4Q69 A;  3ZYK A;  4APF A;  2I1K A;  3B13 A;  4G26 A;  2LSV A;  1H19 A;  2YQ8 A;  3IHV A;  2C0L A;  4I1M A;  4JEH A;  4UWF A;  4U8H A;  4K03 A;  3FP3 A;  5G55 A;  2AXV A;  3FUL A;  5BNW A;  2XRY A;  2LO6 A;  2V5F A;  4GCN A;  4O6F A;  3FDH A;  1PAQ A;  1VDY A;  3LS8 A;  3O48 A;  3URZ A;  4EZK A;  4GZC A;  4WNF A;  3FUD A;  2ZU6 B;  3QJZ A;  3CK8 A;  1DNP A;  3UPV A;  4L7T A;  2YNQ A;  2XRZ A;  2VSN A;  4FA6 A;  1QQE A;  1XGW A;  1SZ9 A;  1JPL A;  2BF0 X;  2WXQ A;  1OWL A;  3CVQ A;  2HYZ A;  3OXL A;  3ZXS A;  4LCT A;  2FO7 A;  4RG9 A;  2J9Q A;  4WND A;  3FHE A;  2NC9 A;  3SNX A;  3CIA A;  4UI9 C;  4UQZ A;  4NAC A;  4ABN A;  3SGH A;  4BY6 A;  1ELW A;  3CK7 A;  3P1U A;  4N3C A;  4J8E A;  4MRU A;  3D9L A;  3LJ3 A;  1HZ4 A;  4GML A;  3CST A;  4FC8 A;  5M72 A;  4IUL A;  3RKV A;  3ZFW A;  1HG2 A;  2PM6 A;  3EIJ A;  4PS8 A;  5D0O D;  4YVQ C;  4I43 A;  4PS3 A;  5A7D B;  3RRU A;  4CDN A;  5FQ4 A;  3RRM B;  3ULQ A;  3AU4 A;  4WNE A;  3CVW A;  4E85 A;  3FUF A;  1E90 A;  2HR2 A;  4NQ0 A;  4HOU A;  3CK9 A;  4JXT A;  3ESK A;  4P29 A;  2XGS A;  3G2U A;  1HFA A;  1HE8 A;  3JCK C;  3OXF A;  5D0Q D;  3UQ3 A;  2X3M A;  4URK A;  4LRZ A;  4KZC A;  3RK6 A;  2KZT B;  3ASH A;  2WMO A;  5BT1 A;  2YIN A;  2WVI A;  4CDM A;  5EKQ D;  3CGH A;  1QZ2 A;  4KT6 B;  3ZYQ A;  3E4B A;  5T3R A;  2I1J A;  3CR3 A;  4U63 A;  2WXP A;  4F3V A;  2CHZ A;  4N3B A;  2FUL A;  4J6I A;  5KCM A;  2J09 A;  4LEU A;  3UMV A;  4PS7 A;  1HG5 A;  2XHE A;  3G2S A;  3MCX A;  3K9I A;  2MRI A;  5FQ6 A;  5T4Y A;  2RD0 A;  1EYH A;  5CCM A;  2LAI A;  4HOS A;  3LVQ E;  3FEY A;  1A17 A;  3SBS A;  2J4B A;  3PEV B;  2XCC A;  3S7F A;  2PL2 A;  4BX8 A;  2GRL A;  3VTY A;  1NZN A;  2LSU A;  4LUN U;  4BT8 A;  3CHO A;  1NA0 A;  2GGF A;  3GW4 A;  4JVS A;  2XPI A;  1DVP A;  1EDU A;  4FJY A;  4BSX A;  5LCW C;  3FTU A;  3FU0 A;  5EX0 A;  5JJ7 A;  3LXU X;  1UJJ A;  3MGB A;  3NQP A;  4FLB A;  3RO2 A;  3APC A;  3UX4 A;  2X6H A;  3L22 A;  3VLF A;  2AVP A;  2WXH A;  1KT1 A;  3I4R B;  2WQ6 A;  2V0P A;  3PUK A;  4AOF A;  1UN8 A;  1PY1 A;  2KM4 A;  3FUK A;  3MZL B;  3ENE A;  3FU3 A;  2X6J A;  4MKT A;  3D9I A;  3PVL A;  4E6H A;  2OOE A;  3HHM A;  3FUH A;  1B89 A;  5BUZ A;  3PNT B;  4N5C A;  2Y4T A;  3PEU B;  4GA1 A;  3ASG A;  2X6K A;  2E2E A;  2IFU A;  3Q5M A;  3ZW3 A;  4G1T A;  2HM8 A;  2KCL A;  3T8M A;  3LPZ A;  4BX9 A;  3PZD A;  2KZT A;  2VTB B;  3UT7 A;  3FUJ A;  4GZ5 A;  3BEE A;  4CGV A;  4RG6 A;  2WMN A;  3FFL A;  1MHQ A;  2KC7 A;  4UQX A;  2L0T B;  2WQH A;  3AU5 A;  4KXK B;  4I1O B;  3Q47 B;  4YND A;  1HF8 A;  4KVO A;  4KYO B;  2I6H A;  5A6C A;  1H2V C;  4ANW A;  5AJL A;  3PRE A;  2WXR A;  3O4Z A;  4GMJ A;  4GZD A;  3D9J A;  4N39 A;  4OYS A;  3RO3 A;  4I1A A;  3ZPJ A;  3QNK A;  2FEZ A;  3PDN A;  3CQG B;  3KAE A;  4ILI A;  3SHF A;  2WXF A;  2ILR A;  3FH7 A;  2AWI A;  3D3M A;  3SD5 A;  4H7Y A;  1H0A A;  2VSO E;  2Q7F A;  3FUE A;  4V3I A;  4A1G A;  3LEW A;  3L17 A;  4AVX A;  3ONK A;  1PC2 A;  4HOT A;  3D9O A;  2IJG X;  4FU3 A;  3Q4A B;  4JHR A;  3G2T A;  2L0I A;  3ZN3 A;  4XZ4 A;  1ZBP A;  4BFR A;  4I6J A;  5E75 A;  1QNF A;  3ESL A;  3CKC A;  2QY7 A;  1NP7 A;  3B7T A;  3CVV A;  1ZU2 A;  3CEQ A;  4IN3 B;  2Y4U A;  4XE0 A;  5J08 A;  3SF4 A;  1N54 A;  5LFA A;  4FHJ A;  3MA5 A;  4EZJ A;  4AJW A;  5G2N A;  2V4L A;  5BW8 C;  4ATG A;  4N2Q A;  4UQY A;  4BWR A;  3KS2 A;  2VTB A;  4EBA G;  4TRQ A;  5JJ6 A;  2WQ7 A;  3EHM A;  2XGO A;  1E96 B;  2X6I A;  3QKY A;  4HOR A;  3JYS A;  3ZYM A;  2UY1 B;  5ARG A;  3C98 A;  3APD A;  4GYO A;  3TGO A;  3G2V A;  1HH8 A;  4G23 A;  3JQ1 A;  2C2L A;  4ANU A;  3DPD A;  4G24 A;  3QDN A;  3NZU A;  3FUM A;  1TJF A;  2LNI A;  2PM7 A;  4FAD A;  3QWW A;  2VSX E;  4CT0 A;  1KLX A;  3U9W A;  4DLO A;  2E0I A;  4L2Y A;  3FU5 A;  3CHP A;  4WWP A;  2XPZ A;  4GZ6 A;  4DJA A;  2VYI A;  3U3W A;  1BPO A;  2FBN A;  5G04 C;  3FTV A;  4BT9 A;  5C1D A;  4XI9 A;  1FVH A;  5LOZ A;  5C2Y A;  4AM9 A;  3GYZ A;  1H6K A;  5FQ8 A;  2GRM A;  2I2O A;  4WNG A;  4XX5 A;  2WB2 A;  4R7L A;  3CHR A;  2RG8 A;  3ML8 A;  4I2W A;  4U04 A;  4I9E A;  3MEK A;  2J07 A;  4GYY A;  5FT9 A;  4HS2 A;  4RVB A;  4B8A A;  1FVF A;  3CVY A;  3N71 A;  3D9P A;  5FZQ A;  3TG5 A;  4AY5 A;  4GYW A;  4W9R A;  4D10 C;  4ILG A;  5G05 J;  2OVF A;  2XGM A;  3LVR E;  3GZS A;  3I3N A;  3MKQ B;  2FF4 A;  5HI7 A;  3T5V A;  4IRU A;  4U0S A;  1U3D A;  5KJN A;  3Q49 B;  4C0E A;  3FTS A;  5ANL A;  2MOW A;  4GB9 A;  3AS4 A;  3B7S A;  4F53 A;  4GAA A;  4K0R A;  4UWH A;  4TV3 A;  1Y6I A;  3CHM A;  3FU6 A;  3QAQ A;  4ACK A;  4J8F A;  4M3O A;  1ELK A;  2AXZ A;  2CFZ A;  2UWJ G;  3QC1 A;  2A4Z A;  2UY1 A;  2XEV A;  3ZVV A;  4EEC A;  3S7B A;  3FTY A;  1WM5 A;  2WXM A;  3L6A A;  2IOS A;  5DIZ A;  4KBQ A;  4WWN A;  3UT4 A;  2OND A;  3PRZ A;  3VLD A;  3CVN A;  1UJK A;  2WXI A;  1OWP A;  1INZ A;  5FTP A;  3TG4 A;  4HVB A;  2R5S A;  3IV0 A;  5FZS A;  3RIB A;  3FH5 A;  3L54 A;  2M63 A;  3JUI A;  2VQ2 A;  1HX8 A;  3FTX A;  5ARF A;  2WXK A;  3CVU A;  4AV7 A;  4KMO A;  3UUX A;  4ANV A;  4Y6C A;  4XIF A;  1YA0 A;  4LER A;  3CHS A;  2HO1 A;  3S7J A;  5BV0 A;  4ACL A;  3OAW A;  2MHK A;  2I9C A;  3CVX A;  2JLB A;  4WUY A;  2OV8 A;  2DBA A;  1FCH A;  3SBT B;  2NSZ A;  1Z6T A;  5CHE E;  1MQS A;  4JW1 A;  4GPK A;  4EZL A;  3U64 A;  2CHW A;  3MKQ A;  4NRH B;  4XKB A;  3CKB A;  4DI3 A;  4G25 A;  2QFC A;  3TXN A;  4I9C A;  2L9B A;  2YHC A;  2CFU A;  4C0M A;  5CMW A;  4YVO A;  4WWO A;  4F1S A;  2DCP A;  5CCL A;  4I2Z A;  4C9B B;  4G2V A;  3IEG A;  3PE3 A;  1E8X A;  2IQC A;  4JHJ A;  3FTW A;  4GZ3 A;  2DIW A;  1EPU A;  2ION A;  3AS5 A;  3Q15 A;  4HFG A;  3KD7 A;  4JC8 A;  3FTZ A;  2J08 A;  3FY4 A;  1E7V A;  3PE4 A;  3IHY A;  4CRW A;  1JWG A;  1OWN A;  2YHE A;  3MJW A;  3GZ2 A;  4JA7 A;  4XKC A;  4B89 A;  4HXI A;  4I6G A;  1IHG A;  4XI0 A;  4B0Z A;  2CG2 A;  3ZIM A;  4HOQ A;  2WXN A;  4GU5 A;  5ANR A;  1LF8 A;  2J49 A;  3CVP A;  3TL5 A;  1JUQ A;  4CDR A;  2PQN A;  5FJY A;  4JA9 A;  3ML9 A;  5KJK A;  3UT8 A;  3GZ1 A;  4AY6 A;  3NF1 A;  3MV2 B;  5FZR A;  3RJV A;  3HVE B;  2KAT A;  4Q96 A;  3D9M A;  3I4G A;  4UWK A;  5CMY A;  4A3V A;  4U0Z A;  3G2W A;  1Z3X A;  2KCV A;  1NA3 A;  1N52 A;  2WXG A;  1GW6 A;  1IQR A;  3CQC B;  1U3C A;  3QK0 A;  3B7U X;  4FJZ A;  3HDX A;  4JL0 A;  4MS6 A;  5EDS A;  2L6J A;  4KZ0 A;  3QWV A;  2FI7 A;  5KJM A;  2IF4 A;  3FUI A;  4EQF A;  3PS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...