2DBAA

The solution structure of the tetratrico peptide repeat of human smooth muscle cell associated protein-1, isoform 2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
148
structure length
148
Chain Sequence
b'GSSGSSGMTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Smooth muscle cell associated protein-1, isoform 2
publication title The solution structure of the tetratrico peptide repeat of human Smooth muscle cell associated protein-1, isoform 2
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 35
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2dbaA01
3AS5A 3KS2A 2FI7A 4HORA 3CVPA 2XCBA 3N71A 1HXIA 4XI9A 4G23A 2LNIA 4GA2A 2I6HA 3RU0A 2AVPA 3QKYA 3ZFWA 3CVNA 4HOUA 4UQZA 4N5CA 2Y4UA 4UI9J 2XPIA 5HQ8A 5A7DB 3ZGQA 4GCNA 2OOEA 3RIBA 4CGWA 2J9QA 5FZQA 4IN3B 4J8EA 4G1TA 1XNFA 3ULQA 3LYAA 1KT0A 4Y6WA 5AYWD 2KCVA 2YQ8A 1HH8A 3U3WA 3CVQA 4JA7A 1ZBPA 1HZ4A 4HOTA 2HYZA 4XIFA 5D0QD 4GCOA 5FZSA 2XGOA 4JL0A 3CKCA 5LCWC 4WNGA 5FZRA 2V5FA 2E2EA 2IFUA 1Y8MA 4XI0A 5EX0A 5JJ6A 5A6CA 2IF4A 2L6JA 1ZU2A 2PL2A 3FWVA 3MV2B 2NC9A 5BT1A 2VSYA 3Q15A 4BT8A 5G05C 5M72A 2C0MA 4J0UA 3TAXA 3GW4A 4RG6A 2PQNA 3PE4A 5CHEE 2DBAA 4WNFA 3GZ2A 1FCHA 3MKRA 4G24A 3ZPJA 5EKQD 5G04C 3S7DA 3PE3A 4G26A 4AY6A 4W9RA 4AIFA 4U07A 3CEQA 1KLXA 4GZ6A 4G2VA 5JJ7A 4I2WA 5BW8C 3LKUA 2KC7A 4HOSA 4YVOA 4GA1A 1WAO1 4KBQA 3ZN3A 2WPVA 2LSVA 2VGYA 3K9IA 1WM5A 2YHCA 3URZA 5KJNA 2UWJG 1NA3A 4I9EA 4AY5A 3QWVA 3S7JA 2WQHA 3QWWA 5CCLA 4CGVA 2P58C 4F3VA 3CK8A 4JHRA 2VGXB 3OXLA 4U0SA 4I17A 3VTYA 5CCMA 3S7FA 4YVQC 4GPKA 3IEGA 4G25A 3TG4A 4BT9A 1IHGA 5DIZA 3WXXA 4H7YA 5C1DA 2LSUA 3ASFA 4O6FA 3OXGA 1W3BA 4N3AA 3S7BA 5DBKA 3LCAA 4AM9A 2UY1B 5KJKA 4CDRA 3LPZA 3MEKA 3SZ7A 3JYSA 4GYOA 4B94A 5JJTA 2KCKA 3NF1A 1NZNA 4UQYA 1ELRA 3GYZA 4U0ZA 3Q47B 4I2ZA 4UI9K 3LY7A 3SF4A 3ASHA 4N3BA 3HYMB 4BTBA 1A17A 5KJMA 3UPVA 4NRHB 4WUYA 4KXKB 4WNEA 3MV3B 5FT9A 4LEUA 4EQFA 5G05J 4I1AA 4H7XA 3KD7A 3AS4A 3FP3A 4GYYA 3RKVA 3AS8A 2PQRA 3ZHEB 3ESKA 4KYOB 5ARFA 3PDNA 4U0UA 5G04J 3LY8A 3EDTB 5ARGA 3RO2A 1E96B 3BEEA 1TJCA 3R9AB 2VGXA 1ELWA 2Q7FA 3OXFA 4GZ5A 5D0OD 4UI9C 2XGMA 3RJVA 4BTAA 2JLBA 3ASGA 5KJLA 2KCLA 3Q5MA 2VSNA 1NA0A 2XGSA 2FEZA 4N39A 2BUGA 3TG5A 2VQ2A 4I9CA 1YA0A 4UQXA 5FTPA 4J8FA 2HO1A 3CK9A 2XEVA 2KATA 4N2QA 2UY1A 3UQ3A 3VTXA 1QQEA 3CV0A 3CVLA 4WNDA 3U4TA 3QWPA 3QOUA 3Q49B 2FBNA 3RO3A 3Q4AB 5EX3A 3ASDA 2VYIA 1KT1A 2XCCA 2C0LA 4JA9A 3MA5A 1P5QA 3QDNA 1B89A 2C2LA 3E4BA 2ONDA 4N2SA 2QFCA 4ME2A 3UUXA 5LCWJ 4GA0A 5FJYA 4RG9A 2GW1A 5HI7A 2Y4TA 3CKBA 3KAEA 4GYWA 4N3CA 4J8DA 4A1SA 3CK7A 2FO7A 3ZHEA 2FF4A 2R5SA 1OUVA 2HR2A 1IYGA 3FFLA 2PZIA 1PC2A 3GZ1A 4GZ3A 4HOQA 2MHKA 3O48A 4YNDA 1QZ2A 4NQ0A 4BWRA 3LY9A 4U04A 4ABNA 3TGOA 5BNWA 4APOA 4Y6CA
chains in the Genus database with same CATH superfamily
3Q9NC 2WXMA 3AS5A 4M3OA 1E8YA 3N71A 3DSSA 1N52A 1SA4A 4NIKA 1Z3XA 4XI9A 2IU1A 2LO6A 3TL5A 1N0RA 1SVXA 4GA2A 4JHJA 2F8YA 2AVPA 4GTQA 3CVNA 4L23A 2ZGGA 3Q75A 4N5CA 5B3SE 3L9TA 5BPPA 3SFZA 3SO8A 1K3ZD 2ETCA 3ML9A 3ZGQA 3G2WA 3HXBA 1TNYA 2OOEA 2J9QA 4JVSA 4IN3B 4GMJA 1XNFA 1TR4A 5ENQD 3R9MA 3QC1A 2KCVA 5JHBA 1HH8A 1N11A 3CVQA 3D3MA 4LNBA 1HZ4A 5KNHD 3JQ1A 1S63A 5E75A 4DLOA 4GCOA 1JUQA 4HQDA 1YYHA 2ILRA 1EYHA 3CKCA 1FPPA 3ZKJA 4LG6A 1UN9A 2F37A 2EINE 4MRUA 3B13A 4X8QA 4XI0A 3TJPA 5FQ4A 3J5PA 4DI4A 2IF4A 4A3TA 1ZU2A 3JUEA 3MGBA 3FWVA 5E76A 4JEHA 2CFZA 4FJYA 4QFVA 5G05C 4PS3A 2C0MA 3G2TA 2WXLA 4RG6A 4RSYA 2GRNB 5EDSA 1D9SA 1JCSA 1UW4B 3LJ3A 5EKQD 3S7DA 1OCRE 3FTZA 3FTWA 3ZVVA 2V0PA 5KWDA 2WXHA 3PE3A 3L08A 3HXCA 1IQRA 3DSXA 1U3CA 3FUHA 4O1OA 3FU5A 4KVOA 2WXOA 3ONKA 3FTVA 2KC7A 3SD5A 4FA6A 4YVOA 4GA1A 1WAO1 3ONLA 3E33A 2LSVA 3K9IA 2WXQA 3LS8A 3JXIA 2GRPB 2YHCA 3DRAA 1UN8A 1Y6IA 1MQSA 5T8IA 1H2VC 1HG2A 2VSOE 2WQHA 3W9GA 3QWWA 5CCLA 4OVUA 3RAUA 2P58C 4CEMA 4F3VA 3DXMG 3SGHA 3FH5A 4JHRA 4CRWA 4I17A 2GGFA 5CCMA 3S7FA 3QNKA 4CYMD 4ACKA 4B8AA 4CT4A 4OVVA 3IEGA 4I6GA 3I4RB 2P2CP 4BT9A 5JA4D 2LSUA 1HG5A 3CQGB 4O6FA 3OXGA 4F53A 4AEZC 5DBKA 5KJKA 4CDRA 1Q2ZA 5CBOA 3MEKA 4PDXA 4DJAA 3I3NA 2XPYA 4GYOA 4DX6D 1XGWA 1AWCB 3L16A 2R59A 1SZ9A 2P9LG 1MJ0A 4WWPA 1RW2A 2AW6A 3SI5A 2M63A 4L2YA 3D9HA 5FQ7A 4TXRA 1O1TA 3ZEFA 3ASHA 2JEKA 4N3BA 2R2LA 3HYMB 4HXIA 3R7QA 5FQ8A 4MS6A 3UPVA 4DRXE 4AV7A 4IYPA 4KXKB 1E7UA 3MV3B 3EU5A 4JZYA 4UWLA 1O1SA 2I2OA 3QAQA 2WXNA 4I1AA 4H7XA 4LCTA 3KD7A 1H2TC 2JABA 3FH7A 4FU3A 2PQRA 3HHMA 5FIOA 1X5BA 4TXQA 2ZGDA 3HDXA 4Q96A 1TYQG 1S0PA 3J5QB 3LY8A 5CERB 4A63B 3BEEA 3BG1B 3RRNB 4K5AB 3R9AB 1QNFA 2VGXA 2XQ0A 3UMVA 3BU8A 3D9NA 3EHNA 2OCCE 2Q7FA 4GPMA 5D0OD 3TWUA 4BTAA 3RRMB 3HIZA 2L0TB 5BXOA 3HXFA 3CHOA 2FEZA 5EIBE 4FADA 3GZSA 4UQXA 4J8FA 4OAUC 3UQ3A 1SW6A 3SNXA 5B1BE 4FP7A 3CV0A 3QOUA 2WB2A 3FTSA 2J08A 3PEUB 3ASDA 5AQBA 2C0LA 3PNTB 4JA9A 2XHEA 2C2LA 1INZA 4KT6B 4KZCA 5AENA 4F7AA 3IXEA 4OAVB 4U8YD 2DVWA 2Y4TA 4KMOA 1H19A 4N3CA 2KZTA 4ILIA 4FHKA 4A1SA 2FO7A 3L82A 2HR2A 2J4DA 4ILGA 4GTVA 2PZIA 4ATZD 3G2VA 2BF0X 2WXGA 3GZ1A 2WMNA 1A5EA 1LTXA 2RFAA 2DIWA 2J8SD 5LX8A 3UT8A 5HKPA 4YNDA 2KZTB 1H6KA 4NQ0A 3SBTB 4BSXA 5ITZF 2LXLA 5HRYA 4TRQA 4APOA 4Y6CA 2ZU6B 4GZDA 3EJNA 4HORA 3CVPA 4I6JA 4JB8P 1LD7A 3HVEA 4EPZA 2OV8A 4HVBA 1FT2A 3CQCB 3JXJA 3CSTA 2P9KG 3ZXSA 3QKYA 4I1MA 5CMYA 4G11A 2ZISA 3HVEB 3W9FA 2XPIA 3PZ1A 1QYMA 3ZYMA 2XEHA 5ENRD 1N94A 3EHRA 4Q94A 1TJFA 3LYAA 5CRVA 1N0QA 2WXRA 1N9AA 2YQ8A 1EPUA 4JA7A 1ZBPA 4F1PA 3C3OA 2HYZA 2RFMA 4AJWA 1FVHA 4JL0A 3VLFA 2AWIA 5LCWC 4UUCA 4GMRA 1K1AA 1E8ZA 2IQCA 3PEVB 4Q69A 4J6IA 3OTNA 3UT4A 5EX0A 5JJ6A 5ENSD 1EF1C 4CCAA 3V31A 4HLLA 5A6CA 2VSXE 3CSFA 3Q15A 1HFAA 5M72A 4PS8A 4ANXA 3ABLE 3GW4A 4DX2A 4UWHA 3U66A 3ASNE 1WDYA 5CHEE 4WNFA 3AG1E 1MHQA 1BD8A 4DUIA 2E0IA 3D9KA 2CHXA 3FUIA 4AY6A 4W9RA 4BERA 3MKQB 5BV1A 3T5VA 5H7PA 4I2WA 1MX4A 2WXPA 2EQXA 5ENNA 3ZN3A 2LAHA 1WM5A 4TV3A 3L13A 4EBAA 3Q78A 2UWJG 3L6AA 1NA3A 4I9EA 2AXUA 5CRUA 2OVBA 3C72A 4B93B 4V3IA 4FHJA 3LVRE 5LP0A 4C9BB 3AJIA 3PREA 1SZAA 4O60A 3CK8A 3PH0C 3RRUA 3Q73A 4U0SA 5FINA 3MZLB 2LUHA 3JQ0A 3NBNB 4GTPA 4BFRA 1DC2A 2WXFA 3ZYKA 4YVQC 1HS6A 2V4HC 3SFXA 1OY3D 3B7SA 3NZSA 4G25A 1IHGA 4PS7A 3EHQA 4WWNA 1OT8A 4EBAG 2I1KA 3ASFA 3TWSA 2QYJA 1W3BA 2X38A 4N3AA 3S7BA 4AM9A 1OWPA 3SFYA 3LPZA 4FJZA 4HI8A 2V5QC 3ZW3A 1S70B 1WG0A 2KCKA 1NZNA 1BI7B 2V8SE 4ACLA 3CVVA 2A5EA 3FH8A 4YDOA 1N54A 1N4SA 4A55A 3SF4A 3D9MA 1A17A 2ZIRA 3AG3E 4L2LA 4NRHB 4KZ0A 4WNEA 3V2XA 1LD8A 3P1UA 4LRZA 5FT9A 4LEUA 3UI2A 5G05J 4HI9A 4XKBA 3AS4A 2DWZA 3FP3A 2XPZA 3AS8A 3ZHEB 3PUKA 4JD2G 1PAQA 3PDNA 4U0UA 1JCRA 5ARGA 3KSQA 3O4ZA 2B6CA 4XKCA 4CT0A 3FU6A 2R17C 2ETBA 4GZ5A 2WXKA 3TXNA 4UI9C 4EHMA 3ASGA 2J4BA 4UWKA 3Q5MA 2XGSA 4B8CB 2EIME 1EDUA 1OWOA 3LXUX 3CK9A 4RQIA 4AVXA 2FULA 2IJGX 3HG0D 1LF8A 1QQEA 4WNDA 1YMPA 1OWNA 4DK5A 3DSVA 4MKTA 3Q49B 3APDA 5AJDA 2OEWA 4A3VA 2VYIA 1KT1A 4HRNA 2DZOA 1E7VA 4G8LA 3D9OA 2BKKB 1MZCA 3E4BA 2WQ7A 4J8YA 3APCA 3UIOC 3CVYA 2F0YA 3ENEA 1MX2A 1DVPA 3Q7AA 4YDYA 1TNUA 3ZUVB 2FF4A 3ISMC 2X6FA 2XS8A 3C3RA 1O1RA 3MX3A 3F6QA 1PC2A 3NAWA 2NYJA 3UTMA 4BEPA 3EIQC 3EUVA 5FWQA 4BY6A 4EECA 4XX5A 4BSZB 5BV0A 5G2NA 1PY1A 5AJLA 3TGOA 2H6GA 5CECB 5FQ6A 4KVMA 5AAOA 3APFA 4CDNA 5KNGA 4JEUA 4K5CA 3TWXA 4TUUA 1UG3A 3CR3A 2FI7A 4M7CA 2XCBA 1HXIA 1DNPA 3AAAC 1N4PA 2I9CA 4DPRA 4FLBA 2I6HA 3RU0A 5EIDA 5G55A 2DYSE 1BU9A 3KSLA 3PVLA 2DZNA 4UQZA 3TWVA 3PS6A 2P9SG 3ZIMA 2XS1A 4K5BA 2Y4UA 5ANLA 3PZ4A 3DBSA 5HQ8A 4ZFHA 4C48B 5BUZA 5A7DB 2NXPA 1ELKA 3D9PA 2YHEA 3FUFA 3DEOA 3RIBA 3TWWA 5EYPF 4J8EA 4PH4B 2NSZA 4G1TA 5ENTD 3UKRG 1FVFA 1KT0A 5J90A 2OEVA 3CHQA 4Y6WA 2LAIA 5AYWD 4DLQA 2AXZA 5AQAA 3V2OA 3VLDA 5T3RA 1IXVA 1E8WA 4RVBA 5FZSA 2XGOA 2ETAA 3Q79A 4WNGA 4JXTA 2WQ6A 2KBXA 1JWGA 2V5FA 1NP7A 1YCSB 2IOLA 3CVXA 2AJAA 3AU5A 2L6JA 2Y0BG 1H6OA 3MV2B 2NC9A 5BT1A 4J7WA 4JW1A 4BT8A 3G2UA 4HS2A 4ILHB 4E6HA 3CVWA 2PQNA 1H6PA 4C0EA 3MKRA 4G24A 1TN7A 4L7TA 3Q7FA 5G04C 2XEEA 4I6EA 4IRUA 2L9BA 3NQPA 3NOGD 3B7RL 4AIFA 3FEYA 1U2VG 3CEQA 2XENA 5JJ7A 1MYOA 4BX8A 4KBQA 4HRMB 4XZ4A 4LSZE 3IHVA 2P9PG 3QWVA 3S7JA 2B0OE 1SQMA 4ZHBA 3FUDA 3L22A 2WMOA 2IEJA 3FUKA 4DI3A 1IHBA 3R7RA 4K03A 3C5RA 3OXLA 3MJWA 3BQOA 3KEZA 1N4RA 1NI1A 4GPKA 4HLEA 4GZCA 5HS0A 2J49A 1L5JA 4GMLA 1NFIE 4N5QA 4F1SA 5DIZA 3RK6A 5LFAA 1UOHA 3WXXA 4H7YA 5C1DA 2LXMA 1BPOA 3UM1A 3MCXA 3CVUA 2VTBB 2UY1B 5AARA 1TNZA 2FO1E 3LJNA 1H0AA 1HX8A 3SZ7A 2Y69E 4B94A 1O5MA 5LOZA 5ENOD 2VJ8A 4UQYA 4AXHA 2H6HA 1GW6A 3GYZA 4U0ZA 3Q47B 4I1OB 4I2ZA 3IHYA 4BESA 3IKOB 1DCEA 5EN5D 3T8KA 3CHMA 3V30A 2MRIA 2WM9A 2GRMA 3PUJA 3L54A 4F6RD 3C3QA 3MKQA 5D2MC 2RD0A 5EYLA 5KJMA 2IO2C 4WUYA 3L17A 2WVIA 4L9PA 2IO3C 3DSUA 3SQVA 1NL4A 2MYOA 3FHEA 1Z3YA 4O1PA 1WY6A 3RKVA 3PZ2A 3DWLG 3ESKA 4KYOB 3T9KA 2X3MA 4URKA 5ARFA 3EHMA 1Z5SC 4APFA 4U8VD 4HFGA 2F8XK 1TJCA 4OYSA 1OWMA 3QB2A 3OXFA 3ULYA 5KBAA 4AOFA 3RJVA 4GTSA 3DSWA 2JLBA 4J8SA 2KCLA 1NA0A 2EIKE 2BUGA 4DX1A 3TG5A 1UJKA 3SBSA 3PRZA 2Y1LE 2XZDG 1YA0A 3B7TA 5FTPA 2HO1A 4AP2A 3FUJA 4N2QA 5JHAA 4XEIG 3U4TA 3ESLA 2XRYA 1TN8A 2DYRE 3AG2E 2FBNA 2QY7A 1E8XA 3AU4A 3EU9A 3RO3A 2DCPA 5EX3A 3UM0A 4QQIA 3NOCD 3DEPA 2KM4A 4GAAA 1P5QA 3QDNA 3SHFA 3TXMA 2L0IA 1B89A 5AQ7A 2P9UG 3D9LA 2ONDA 5A23A 4N2SA 2WXIA 2R03A 2QFCA 3D9JA 4ME2A 4RG9A 3CKBA 3KAEA 4GYWA 3ZNGA 3I5PA 4J8DA 5IY5E 2H6FA 2WXJA 3CK7A 2KXPC 3ZHEA 3QK0A 2R05A 1OUVA 2A5UA 2X6HA 3B7BA 4LNGA 4I43A 4TXPA 2EIJE 3U64A 4HOQA 1N95A 2MHKA 3DSTA 1KPSB 2GROB 4BWRA 3LY9A 4U04A 4ABNA 3WG7E 5CEAA 1D8DA 4GTRA 2P9IG 1QBQA 1OCCE 4U63A 1JWFA 3KS2A 3ASOE 3CHPA 3FULA 1X81A 1IQUA 2X6KA 1VDYA 1U3DA 2LNIA 4G23A 3ULEG 3SY2A 3ZFWA 4HNAD 2YINA 4BETA 4EZLA 4HOUA 1MX6A 3UT7A 3PNLB 4L1BA 3TWTA 5AIJA 1AP7A 4UI9J 3ML8A 3P2BA 4CZ2D 4D10C 4GCNA 4U8HA 5CEDB 3S2AA 3E32A 2Y3AA 3IV0A 4CGWA 1HU3A 5FZQA 3C98A 3T5XA 5D66A 3ULQA 3FTYA 3U3WA 4LUNU 4LNUD 4HOTA 5D0QD 4XIFA 3FU0A 3ZU7B 1K1BA 3OAWA 3ABME 4GTTA 5FZRA 4FULA 2GRRB 4GTOA 2XRZA 4HRLA 4RLYA 1BI8B 2E2EA 2IFUA 2P9NG 3BUAA 1Y8MA 3FY4A 3ZXPA 3E34A 4P29A 1UJJA 5KCMA 3I4GA 2CHZA 3CHRA 3FU3A 2PL2A 2VSYA 3NB2A 4B89A 1DCQA 5C2YA 4J0UA 2X6JA 3TAXA 2PNNA 2RG8A 3DPYA 3TWRA 3PE4A 2DBAA 3GZ2A 3BG0B 1FCHA 4IULA 3LEWA 3ZPJA 2GRLA 4G26A 2VGEA 3RSEG 2QZAA 3CHSA 4UWFA 4YDEA 4U07A 1KLXA 2X6IA 4UWGA 1JPLA 5AN8A 3FDHA 4GZ6A 4FC8A 3V79K 4G2VA 2CHWA 2EILE 5BW8C 3LKUA 4ANVA 4HOSA 2WPVA 2VGYA 3ZYQA 1TNBA 3HXDA 4TUMA 3URZA 5KJNA 3TWQA 4AY5A 2H6IA 4A1GA 3G2SA 2I1JA 5EILA 5J08A 2CG3A 1V55E 4CGVA 1TEZA 2XZTG 3FTXA 3FUEA 2VGXB 3U9WA 2OVFA 1S64A 3VTYA 2R02A 1OCZE 2GRQB 3UXGA 5B1AE 4B0ZA 3ABKE 3TG4A 1N4QA 2PM7A 3DPDA 4MBGA 3LCAA 1K8KG 1OXJA 5ENPD 4G8KA 4JPSA 1OWLA 2IY0C 3ZYLA 1Z6TA 1HO8A 3JYSA 4C0MA 4ATGA 2J09A 5JJTA 4U95D 3AG4E 1BLXB 3NF1A 1ELRA 3FUNA 4GTMA 3FUMA 4UI9K 2CG2A 4JHKA 3UM2A 3LY7A 3CLJA 1KZPA 4PUCA 2CFUA 4BTBA 3CIAA 3IBEA 3B95A 3FEXA 3E37A 2A4ZA 1V54E 1TNOA 1D8EA 4EQFA 4XE0A 3KEAA 3FTUA 4DX5D 2QC9A 4EZKA 4GYYA 2HE0A 3NZUA 3QARA 3MYVA 4NACA 3PZDA 4R7LA 5G04J 3VLEA 2AXVA 1OCOE 3EDTB 3PZ3A 1SA5A 3RO2A 3UX4A 1E96B 1JCQA 4K0RA 2J07A 4YDWA 2L6BA 1H2UA 3UM3A 1ELWA 1G3NB 4U7EB 4ANUA 2BTDA 1HE8A 2XGMA 4ANWA 3CGHA 5JMND 5KJLA 2VSNA 4DX7D 4N39A 2VQ2A 3EIJA 4I9CA 2QYUA 5T4YA 2XEVA 2VTBA 2KATA 3QJZA 5BXUA 2UY1A 3VTXA 2MOWA 3CVLA 2YNQA 3X2QE 5ANRA 3QWPA 2RKKA 4U96D 4E85A 3Q4AB 4CDMA 4LERA 4GU5A 2XCCA 4HB5A 1E90A 4WAFA 3E30A 3HRAA 3MA5A 2HM8A 1IKND 1RZ4A 1TN6A 3UIPC 2BEDA 4WWOA 5AQ9A 1KZOA 3UUXA 5CBNA 3D9IA 3Q9UC 5LCWJ 4GA0A 5FJYA 2BKGA 4JC8A 2GW1A 5HI7A 3HXEA 2IONA 1FT1A 5CMWA 3LVQE 3UINC 4GB9A 4BX9A 2IOSA 3DXKG 4EZJA 1ZB1A 2R5SA 3LDZA 3UKUG 1IYGA 3FFLA 3T8MA 2PM6A 3JCKC 4GZ3A 4MLPA 2ZXWE 3O48A 1QZ2A 4Z68A 2V4LA 1HF8A 4HBDA 5BNWA 3B7UX 4FLHA 3JUIA 4NURA 3ZRHA
chains in the Genus database with same CATH topology
4TUUA 2WXMA 1UG3A 3CR3A 2ZU6B 4GZDA 3EJNA 1JWFA 3AS5A 3KS2A 2FI7A 4HORA 4M3OA 3CVPA 4I6JA 3CHPA 2XCBA 3FULA 1E8YA 1HXIA 3HVEA 3N71A 4EPZA 2OV8A 4HVBA 1DNPA 1N52A 1Z3XA 4XI9A 2I9CA 2IU1A 1IQUA 2LO6A 4DPRA 3CQCB 3TL5A 2X6KA 1VDYA 1U3DA 2LNIA 4FLBA 4G23A 4GA2A 4JHJA 2I6HA 3CSTA 3RU0A 5G55A 3ZXSA 2AVPA 3QKYA 3ZFWA 3CVNA 4I1MA 2YINA 4EZLA 5CMYA 4HOUA 3PVLA 4UQZA 4G11A 3PS6A 4L23A 3ZIMA 3UT7A 3HVEB 3PNLB 4L1BA 4N5CA 5AIJA 2Y4UA 5ANLA 4UI9J 3ML8A 2XPIA 3P2BA 5BPPA 3DBSA 5HQ8A 3SFZA 5BUZA 5A7DB 4D10C 3ML9A 3ZGQA 3G2WA 2NXPA 4GCNA 1ELKA 4U8HA 3ZYMA 3D9PA 3S2AA 2YHEA 2OOEA 2Y3AA 3FUFA 3IV0A 3RIBA 4CGWA 2J9QA 1HU3A 4JVSA 5FZQA 4IN3B 4J8EA 3C98A 4PH4B 2NSZA 3T5XA 4GMJA 4G1TA 4Q94A 1TJFA 1XNFA 3ULQA 1FVFA 3LYAA 1KT0A 5J90A 3CHQA 3QC1A 4Y6WA 2LAIA 2WXRA 2KCVA 5AYWD 2YQ8A 5JHBA 1HH8A 3FTYA 5M72A 3U3WA 1EPUA 4DLQA 2AXZA 4LUNU 3CVQA 3D3MA 4JA7A 1ZBPA 1HZ4A 3JQ1A 5E75A 4DLOA 4HOTA 3VLDA 2HYZA 4XIFA 5D0QD 4GCOA 3FU0A 1JUQA 4AJWA 1FVHA 5T3RA 1E8WA 4RVBA 5FZSA 2ILRA 2XGOA 1EYHA 4JL0A 3VLFA 3CKCA 2AWIA 5LCWC 3OAWA 4WNGA 4JXTA 2WQ6A 5FZRA 4FULA 1UN9A 1JWGA 4MRUA 3B13A 2V5FA 2XRZA 1NP7A 1E8ZA 2IQCA 3PEVB 4Q69A 2E2EA 2IFUA 4J6IA 1Y8MA 3FY4A 4XI0A 3TJPA 2IOLA 3OTNA 3UT4A 4P29A 5EX0A 5JJ6A 1UJJA 5FQ4A 1EF1C 4CCAA 5KCMA 3CVXA 3I4GA 4DI4A 5A6CA 3AU5A 2IF4A 2CHZA 3CHRA 2L6JA 4A3TA 1ZU2A 3FU3A 3MGBA 2PL2A 3FWVA 3MV2B 2NC9A 2VSXE 3CSFA 2VSYA 5E76A 4JEHA 5BT1A 3Q15A 4JW1A 2CFZA 4BT8A 1HFAA 4FJYA 4QFVA 5G05C 4B89A 4PS3A 2C0MA 3G2UA 4HS2A 4ILHB 4J0UA 3G2TA 2WXLA 4PS8A 2X6JA 5C2YA 3TAXA 4ANXA 3GW4A 4E6HA 4RG6A 2RG8A 3CVWA 4RSYA 4UWHA 2PQNA 3U66A 3PE4A 5EDSA 5CHEE 2DBAA 4WNFA 3GZ2A 3BG0B 4C0EA 1FCHA 1MHQA 1UW4B 3MKRA 3LJ3A 4IULA 3LEWA 4G24A 3ZPJA 4L7TA 2GRLA 5EKQD 5G04C 3S7DA 4I6EA 4IRUA 3FTZA 2L9BA 3FTWA 3ZVVA 2E0IA 3D9KA 2V0PA 2WXHA 3PE3A 3NQPA 4G26A 3L08A 2CHXA 3FUIA 3B7RL 4AY6A 1IQRA 4W9RA 4AIFA 3CHSA 3FEYA 4UWFA 3MKQB 4U07A 3CEQA 1KLXA 1U3CA 2X6IA 3FUHA 4UWGA 1JPLA 5BV1A 3T5VA 3FDHA 3FU5A 4FC8A 4GZ6A 4G2VA 2CHWA 5JJ7A 4KVOA 4I2WA 5BW8C 4BX8A 2WXOA 3ONKA 2WXPA 3FTVA 2KC7A 3LKUA 3SD5A 2EQXA 4ANVA 4FA6A 4HOSA 4YVOA 4GA1A 1WAO1 3ONLA 4KBQA 5ENNA 3ZN3A 2WPVA 2LSVA 2LAHA 2VGYA 2WXQA 3K9IA 3LS8A 3ZYQA 4XZ4A 1WM5A 2YHCA 4TV3A 3L13A 3URZA 4EBAA 3IHVA 1UN8A 5KJNA 2UWJG 1Y6IA 3L6AA 1NA3A 4I9EA 4AY5A 3QWVA 2AXUA 3S7JA 1SQMA 1MQSA 4Y6CA 5T8IA 4A1GA 2OVBA 1H2VC 3G2SA 4V3IA 1HG2A 2I1JA 2VSOE 2WQHA 3FUDA 3LVRE 4FHJA 3L22A 5LP0A 2WMOA 4C9BB 3FUKA 5J08A 2CG3A 3PREA 3QWWA 4DI3A 5CCLA 1SZAA 4OVUA 4CGVA 2P58C 3R7RA 4CEMA 4F3VA 3CK8A 3FH5A 3SGHA 4JHRA 3PH0C 4CRWA 1TEZA 4K03A 3RRUA 3FTXA 3FUEA 2VGXB 3OXLA 3U9WA 4U0SA 3MJWA 3MZLB 2OVFA 4I17A 2GGFA 3VTYA 3JQ0A 5CCMA 3S7FA 3KEZA 3QNKA 4BFRA 2WXFA 4ACKA 4B8AA 3ZYKA 4YVQC 4CT4A 1HS6A 4GPKA 4HLEA 4OVVA 4GZCA 3IEGA 4B0ZA 2J49A 1L5JA 3B7SA 3I4RB 4I6GA 4GMLA 3NZSA 4G25A 3TG4A 4BT9A 4F1SA 1IHGA 4PS7A 5DIZA 3RK6A 5LFAA 4WWNA 3WXXA 4H7YA 5C1DA 2PM7A 4EBAG 2LSUA 1HG5A 2I1KA 1BPOA 3ASFA 3CQGB 3DPDA 4O6FA 3OXGA 3MCXA 1W3BA 4F53A 2X38A 3CVUA 4AEZC 4N3AA 3S7BA 2VTBB 5DBKA 3LCAA 4AM9A 2UY1B 1OWPA 4CDRA 5KJKA 4JPSA 3LPZA 3MEKA 4PDXA 1H0AA 1HX8A 1OWLA 4FJZA 3SZ7A 3ZYLA 1Z6TA 4DJAA 1HO8A 3I3NA 2XPYA 3JYSA 4GYOA 3ZW3A 4B94A 5LOZA 4C0MA 1XGWA 4ATGA 2J09A 5JJTA 2KCKA 2VJ8A 1NZNA 3NF1A 2V8SE 3CVVA 4ACLA 4UQYA 4AXHA 3L16A 1ELRA 2R59A 1SZ9A 1GW6A 3GYZA 4U0ZA 3FUNA 3Q47B 3FH8A 4WWPA 2AW6A 3FUMA 4I1OB 4I2ZA 3SI5A 2M63A 4L2YA 3IHYA 4UI9K 2CG2A 3IKOB 4JHKA 3LY7A 3CLJA 1N54A 5FQ7A 3CHMA 4A55A 3SF4A 2MRIA 3D9MA 2WM9A 2CFUA 2GRMA 2JEKA 3ASHA 3PUJA 4N3BA 3HYMB 4PUCA 3L54A 3MKQA 4HXIA 4BTBA 3CIAA 2RD0A 1A17A 3IBEA 3R7QA 3FEXA 5FQ8A 4L2LA 4MS6A 5KJMA 3UPVA 4NRHB 2A4ZA 4WUYA 4AV7A 3L17A 4IYPA 4KXKB 2WVIA 1E7UA 4KZ0A 4WNEA 3MV3B 3P1UA 4LRZA 5FT9A 4LEUA 4JZYA 4UWLA 4EQFA 5G05J 4XE0A 2I2OA 3QAQA 2WXNA 3FTUA 4I1AA 4H7XA 4LCTA 3FHEA 3KD7A 1H2TC 4XKBA 1Z3YA 3AS4A 4EZKA 3FH7A 3FP3A 4FU3A 1WY6A 2XPZA 3AS8A 4GYYA 3RKVA 3NZUA 2PQRA 3HHMA 3QARA 3ZHEB 3MYVA 3PUKA 4NACA 3ESKA 4KYOB 1X5BA 2X3MA 3PZDA 3HDXA 1PAQA 4URKA 4Q96A 3PDNA 5ARFA 3EHMA 4R7LA 4U0UA 1S0PA 5G04J 3VLEA 2AXVA 3LY8A 3EDTB 5ARGA 4APFA 3O4ZA 3RO2A 4HFGA 3UX4A 1E96B 4XKCA 3BEEA 4K0RA 1TJCA 3BG1B 3RRNB 4CT0A 3R9AB 1QNFA 3FU6A 2VGXA 2XQ0A 2J07A 1H2UA 3UMVA 4OYSA 1ELWA 2R17C 3D9NA 3EHNA 1OWMA 4ANUA 2Q7FA 2BTDA 3OXFA 3QB2A 4GZ5A 5D0OD 2WXKA 1HE8A 4AOFA 3TXNA 4UI9C 2XGMA 3RJVA 3RRMB 4BTAA 4ANWA 3CGHA 3HIZA 2JLBA 3ASGA 2J4BA 4J8SA 5KJLA 4UWKA 2KCLA 2L0TB 3Q5MA 2VSNA 1NA0A 2XGSA 2FEZA 3CHOA 4N39A 2BUGA 2VQ2A 3TG5A 1UJKA 4B8CB 3EIJA 4I9CA 3PRZA 3SBSA 5T4YA 4FADA 1YA0A 3B7TA 3GZSA 1EDUA 4UQXA 5FTPA 1OWOA 4J8FA 2HO1A 4AP2A 3LXUX 3CK9A 2XEVA 2VTBA 2KATA 3FUJA 3QJZA 4N2QA 2UY1A 5JHAA 3UQ3A 4AVXA 3VTXA 2FULA 2IJGX 2MOWA 1LF8A 3SNXA 1QQEA 3CV0A 2YNQA 3CVLA 4FP7A 4WNDA 5ANRA 3QWPA 3U4TA 3QOUA 3ESLA 2WB2A 1OWNA 2XRYA 3FTSA 4DK5A 2J08A 4MKTA 3Q49B 3APDA 2FBNA 4E85A 2QY7A 1E8XA 3AU4A 3RO3A 3Q4AB 4CDMA 5AJDA 4LERA 3PEUB 4GU5A 2DCPA 4A3VA 5EX3A 3ASDA 2VYIA 1KT1A 2XCCA 1E90A 2C0LA 4WAFA 1E7VA 3PNTB 4JA9A 3MA5A 2KM4A 2XHEA 4GAAA 1P5QA 3QDNA 2HM8A 3SHFA 3TXMA 3D9OA 2L0IA 1B89A 2C2LA 3D9LA 3E4BA 1INZA 4KT6B 4KZCA 2ONDA 5A23A 4N2SA 5AENA 2WXIA 4WWOA 4F7AA 2QFCA 3D9JA 4ME2A 3UUXA 3D9IA 2WQ7A 5LCWJ 4GA0A 5FJYA 4JC8A 4RG9A 2GW1A 5HI7A 2Y4TA 3APCA 2IONA 3CVYA 3ENEA 3CKBA 3KAEA 1DVPA 4GYWA 4KMOA 1H19A 3LVQE 5CMWA 4N3CA 3I5PA 4J8DA 2KZTA 4ILIA 4FHKA 4GB9A 4A1SA 4BX9A 2IOSA 2WXJA 3CK7A 2FO7A 3QK0A 3ZHEA 4EZJA 2FF4A 2R5SA 3LDZA 1OUVA 2A5UA 2X6HA 2HR2A 2J4DA 2X6FA 4I43A 1IYGA 4ILGA 3FFLA 2PZIA 3MX3A 1PC2A 3T8MA 2PM6A 3U64A 3G2VA 2BF0X 2WXGA 3GZ1A 3JCKC 3EIQC 4GZ3A 2WMNA 4HOQA 5FWQA 2MHKA 4MLPA 3ZEFA 4BY6A 2DIWA 5LX8A 4EECA 3UT8A 3O48A 4XX5A 4YNDA 2KZTB 1QZ2A 1H6KA 4NQ0A 3SBTB 4BSXA 2V4LA 1HF8A 4BWRA 3LY9A 5BV0A 4U04A 5G2NA 1PY1A 5AJLA 4ABNA 3TGOA 5BNWA 3B7UX 4FLHA 4TRQA 5FQ6A 4KVMA 3APFA 3JUIA 4CDNA 4APOA 4NURA 3ZRHA 4JEUA 4U63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AS5 A;  3KS2 A;  2FI7 A;  4HOR A;  3CVP A;  2XCB A;  3N71 A;  1HXI A;  4XI9 A;  4G23 A;  2LNI A;  4GA2 A;  2I6H A;  3RU0 A;  2AVP A;  3QKY A;  3ZFW A;  3CVN A;  4HOU A;  4UQZ A;  4N5C A;  2Y4U A;  4UI9 J;  2XPI A;  5HQ8 A;  5A7D B;  3ZGQ A;  4GCN A;  2OOE A;  3RIB A;  4CGW A;  2J9Q A;  5FZQ A;  4IN3 B;  4J8E A;  4G1T A;  1XNF A;  3ULQ A;  3LYA A;  1KT0 A;  4Y6W A;  5AYW D;  2KCV A;  2YQ8 A;  1HH8 A;  3U3W A;  3CVQ A;  4JA7 A;  1ZBP A;  1HZ4 A;  4HOT A;  2HYZ A;  4XIF A;  5D0Q D;  4GCO A;  5FZS A;  2XGO A;  4JL0 A;  3CKC A;  5LCW C;  4WNG A;  5FZR A;  2V5F A;  2E2E A;  2IFU A;  1Y8M A;  4XI0 A;  5EX0 A;  5JJ6 A;  5A6C A;  2IF4 A;  2L6J A;  1ZU2 A;  2PL2 A;  3FWV A;  3MV2 B;  2NC9 A;  5BT1 A;  2VSY A;  3Q15 A;  4BT8 A;  5G05 C;  5M72 A;  2C0M A;  4J0U A;  3TAX A;  3GW4 A;  4RG6 A;  2PQN A;  3PE4 A;  5CHE E;  2DBA A;  4WNF A;  3GZ2 A;  1FCH A;  3MKR A;  4G24 A;  3ZPJ A;  5EKQ D;  5G04 C;  3S7D A;  3PE3 A;  4G26 A;  4AY6 A;  4W9R A;  4AIF A;  4U07 A;  3CEQ A;  1KLX A;  4GZ6 A;  4G2V A;  5JJ7 A;  4I2W A;  5BW8 C;  3LKU A;  2KC7 A;  4HOS A;  4YVO A;  4GA1 A;  1WAO 1;  4KBQ A;  3ZN3 A;  2WPV A;  2LSV A;  2VGY A;  3K9I A;  1WM5 A;  2YHC A;  3URZ A;  5KJN A;  2UWJ G;  1NA3 A;  4I9E A;  4AY5 A;  3QWV A;  3S7J A;  2WQH A;  3QWW A;  5CCL A;  4CGV A;  2P58 C;  4F3V A;  3CK8 A;  4JHR A;  2VGX B;  3OXL A;  4U0S A;  4I17 A;  3VTY A;  5CCM A;  3S7F A;  4YVQ C;  4GPK A;  3IEG A;  4G25 A;  3TG4 A;  4BT9 A;  1IHG A;  5DIZ A;  3WXX A;  4H7Y A;  5C1D A;  2LSU A;  3ASF A;  4O6F A;  3OXG A;  1W3B A;  4N3A A;  3S7B A;  5DBK A;  3LCA A;  4AM9 A;  2UY1 B;  5KJK A;  4CDR A;  3LPZ A;  3MEK A;  3SZ7 A;  3JYS A;  4GYO A;  4B94 A;  5JJT A;  2KCK A;  3NF1 A;  1NZN A;  4UQY A;  1ELR A;  3GYZ A;  4U0Z A;  3Q47 B;  4I2Z A;  4UI9 K;  3LY7 A;  3SF4 A;  3ASH A;  4N3B A;  3HYM B;  4BTB A;  1A17 A;  5KJM A;  3UPV A;  4NRH B;  4WUY A;  4KXK B;  4WNE A;  3MV3 B;  5FT9 A;  4LEU A;  4EQF A;  5G05 J;  4I1A A;  4H7X A;  3KD7 A;  3AS4 A;  3FP3 A;  4GYY A;  3RKV A;  3AS8 A;  2PQR A;  3ZHE B;  3ESK A;  4KYO B;  5ARF A;  3PDN A;  4U0U A;  5G04 J;  3LY8 A;  3EDT B;  5ARG A;  3RO2 A;  1E96 B;  3BEE A;  1TJC A;  3R9A B;  2VGX A;  1ELW A;  2Q7F A;  3OXF A;  4GZ5 A;  5D0O D;  4UI9 C;  2XGM A;  3RJV A;  4BTA A;  2JLB A;  3ASG A;  5KJL A;  2KCL A;  3Q5M A;  2VSN A;  1NA0 A;  2XGS A;  2FEZ A;  4N39 A;  2BUG A;  3TG5 A;  2VQ2 A;  4I9C A;  1YA0 A;  4UQX A;  5FTP A;  4J8F A;  2HO1 A;  3CK9 A;  2XEV A;  2KAT A;  4N2Q A;  2UY1 A;  3UQ3 A;  3VTX A;  1QQE A;  3CV0 A;  3CVL A;  4WND A;  3U4T A;  3QWP A;  3QOU A;  3Q49 B;  2FBN A;  3RO3 A;  3Q4A B;  5EX3 A;  3ASD A;  2VYI A;  1KT1 A;  2XCC A;  2C0L A;  4JA9 A;  3MA5 A;  1P5Q A;  3QDN A;  1B89 A;  2C2L A;  3E4B A;  2OND A;  4N2S A;  2QFC A;  4ME2 A;  3UUX A;  5LCW J;  4GA0 A;  5FJY A;  4RG9 A;  2GW1 A;  5HI7 A;  2Y4T A;  3CKB A;  3KAE A;  4GYW A;  4N3C A;  4J8D A;  4A1S A;  3CK7 A;  2FO7 A;  3ZHE A;  2FF4 A;  2R5S A;  1OUV A;  2HR2 A;  1IYG A;  3FFL A;  2PZI A;  1PC2 A;  3GZ1 A;  4GZ3 A;  4HOQ A;  2MHK A;  3O48 A;  4YND A;  1QZ2 A;  4NQ0 A;  4BWR A;  3LY9 A;  4U04 A;  4ABN A;  3TGO A;  5BNW A;  4APO A;  4Y6C A; 
#chains in the Genus database with same CATH topology
 3Q9N C;  2WXM A;  3AS5 A;  4M3O A;  1E8Y A;  3N71 A;  3DSS A;  1N52 A;  1SA4 A;  4NIK A;  1Z3X A;  4XI9 A;  2IU1 A;  2LO6 A;  3TL5 A;  1N0R A;  1SVX A;  4GA2 A;  4JHJ A;  2F8Y A;  2AVP A;  4GTQ A;  3CVN A;  4L23 A;  2ZGG A;  3Q75 A;  4N5C A;  5B3S E;  3L9T A;  5BPP A;  3SFZ A;  3SO8 A;  1K3Z D;  2ETC A;  3ML9 A;  3ZGQ A;  3G2W A;  3HXB A;  1TNY A;  2OOE A;  2J9Q A;  4JVS A;  4IN3 B;  4GMJ A;  1XNF A;  1TR4 A;  5ENQ D;  3R9M A;  3QC1 A;  2KCV A;  5JHB A;  1HH8 A;  1N11 A;  3CVQ A;  3D3M A;  4LNB A;  1HZ4 A;  5KNH D;  3JQ1 A;  1S63 A;  5E75 A;  4DLO A;  4GCO A;  1JUQ A;  4HQD A;  1YYH A;  2ILR A;  1EYH A;  3CKC A;  1FPP A;  3ZKJ A;  4LG6 A;  1UN9 A;  2F37 A;  2EIN E;  4MRU A;  3B13 A;  4X8Q A;  4XI0 A;  3TJP A;  5FQ4 A;  3J5P A;  4DI4 A;  2IF4 A;  4A3T A;  1ZU2 A;  3JUE A;  3MGB A;  3FWV A;  5E76 A;  4JEH A;  2CFZ A;  4FJY A;  4QFV A;  5G05 C;  4PS3 A;  2C0M A;  3G2T A;  2WXL A;  4RG6 A;  4RSY A;  2GRN B;  5EDS A;  1D9S A;  1JCS A;  1UW4 B;  3LJ3 A;  5EKQ D;  3S7D A;  1OCR E;  3FTZ A;  3FTW A;  3ZVV A;  2V0P A;  5KWD A;  2WXH A;  3PE3 A;  3L08 A;  3HXC A;  1IQR A;  3DSX A;  1U3C A;  3FUH A;  4O1O A;  3FU5 A;  4KVO A;  2WXO A;  3ONK A;  3FTV A;  2KC7 A;  3SD5 A;  4FA6 A;  4YVO A;  4GA1 A;  1WAO 1;  3ONL A;  3E33 A;  2LSV A;  3K9I A;  2WXQ A;  3LS8 A;  3JXI A;  2GRP B;  2YHC A;  3DRA A;  1UN8 A;  1Y6I A;  1MQS A;  5T8I A;  1H2V C;  1HG2 A;  2VSO E;  2WQH A;  3W9G A;  3QWW A;  5CCL A;  4OVU A;  3RAU A;  2P58 C;  4CEM A;  4F3V A;  3DXM G;  3SGH A;  3FH5 A;  4JHR A;  4CRW A;  4I17 A;  2GGF A;  5CCM A;  3S7F A;  3QNK A;  4CYM D;  4ACK A;  4B8A A;  4CT4 A;  4OVV A;  3IEG A;  4I6G A;  3I4R B;  2P2C P;  4BT9 A;  5JA4 D;  2LSU A;  1HG5 A;  3CQG B;  4O6F A;  3OXG A;  4F53 A;  4AEZ C;  5DBK A;  5KJK A;  4CDR A;  1Q2Z A;  5CBO A;  3MEK A;  4PDX A;  4DJA A;  3I3N A;  2XPY A;  4GYO A;  4DX6 D;  1XGW A;  1AWC B;  3L16 A;  2R59 A;  1SZ9 A;  2P9L G;  1MJ0 A;  4WWP A;  1RW2 A;  2AW6 A;  3SI5 A;  2M63 A;  4L2Y A;  3D9H A;  5FQ7 A;  4TXR A;  1O1T A;  3ZEF A;  3ASH A;  2JEK A;  4N3B A;  2R2L A;  3HYM B;  4HXI A;  3R7Q A;  5FQ8 A;  4MS6 A;  3UPV A;  4DRX E;  4AV7 A;  4IYP A;  4KXK B;  1E7U A;  3MV3 B;  3EU5 A;  4JZY A;  4UWL A;  1O1S A;  2I2O A;  3QAQ A;  2WXN A;  4I1A A;  4H7X A;  4LCT A;  3KD7 A;  1H2T C;  2JAB A;  3FH7 A;  4FU3 A;  2PQR A;  3HHM A;  5FIO A;  1X5B A;  4TXQ A;  2ZGD A;  3HDX A;  4Q96 A;  1TYQ G;  1S0P A;  3J5Q B;  3LY8 A;  5CER B;  4A63 B;  3BEE A;  3BG1 B;  3RRN B;  4K5A B;  3R9A B;  1QNF A;  2VGX A;  2XQ0 A;  3UMV A;  3BU8 A;  3D9N A;  3EHN A;  2OCC E;  2Q7F A;  4GPM A;  5D0O D;  3TWU A;  4BTA A;  3RRM B;  3HIZ A;  2L0T B;  5BXO A;  3HXF A;  3CHO A;  2FEZ A;  5EIB E;  4FAD A;  3GZS A;  4UQX A;  4J8F A;  4OAU C;  3UQ3 A;  1SW6 A;  3SNX A;  5B1B E;  4FP7 A;  3CV0 A;  3QOU A;  2WB2 A;  3FTS A;  2J08 A;  3PEU B;  3ASD A;  5AQB A;  2C0L A;  3PNT B;  4JA9 A;  2XHE A;  2C2L A;  1INZ A;  4KT6 B;  4KZC A;  5AEN A;  4F7A A;  3IXE A;  4OAV B;  4U8Y D;  2DVW A;  2Y4T A;  4KMO A;  1H19 A;  4N3C A;  2KZT A;  4ILI A;  4FHK A;  4A1S A;  2FO7 A;  3L82 A;  2HR2 A;  2J4D A;  4ILG A;  4GTV A;  2PZI A;  4ATZ D;  3G2V A;  2BF0 X;  2WXG A;  3GZ1 A;  2WMN A;  1A5E A;  1LTX A;  2RFA A;  2DIW A;  2J8S D;  5LX8 A;  3UT8 A;  5HKP A;  4YND A;  2KZT B;  1H6K A;  4NQ0 A;  3SBT B;  4BSX A;  5ITZ F;  2LXL A;  5HRY A;  4TRQ A;  4APO A;  4Y6C A;  2ZU6 B;  4GZD A;  3EJN A;  4HOR A;  3CVP A;  4I6J A;  4JB8 P;  1LD7 A;  3HVE A;  4EPZ A;  2OV8 A;  4HVB A;  1FT2 A;  3CQC B;  3JXJ A;  3CST A;  2P9K G;  3ZXS A;  3QKY A;  4I1M A;  5CMY A;  4G11 A;  2ZIS A;  3HVE B;  3W9F A;  2XPI A;  3PZ1 A;  1QYM A;  3ZYM A;  2XEH A;  5ENR D;  1N94 A;  3EHR A;  4Q94 A;  1TJF A;  3LYA A;  5CRV A;  1N0Q A;  2WXR A;  1N9A A;  2YQ8 A;  1EPU A;  4JA7 A;  1ZBP A;  4F1P A;  3C3O A;  2HYZ A;  2RFM A;  4AJW A;  1FVH A;  4JL0 A;  3VLF A;  2AWI A;  5LCW C;  4UUC A;  4GMR A;  1K1A A;  1E8Z A;  2IQC A;  3PEV B;  4Q69 A;  4J6I A;  3OTN A;  3UT4 A;  5EX0 A;  5JJ6 A;  5ENS D;  1EF1 C;  4CCA A;  3V31 A;  4HLL A;  5A6C A;  2VSX E;  3CSF A;  3Q15 A;  1HFA A;  5M72 A;  4PS8 A;  4ANX A;  3ABL E;  3GW4 A;  4DX2 A;  4UWH A;  3U66 A;  3ASN E;  1WDY A;  5CHE E;  4WNF A;  3AG1 E;  1MHQ A;  1BD8 A;  4DUI A;  2E0I A;  3D9K A;  2CHX A;  3FUI A;  4AY6 A;  4W9R A;  4BER A;  3MKQ B;  5BV1 A;  3T5V A;  5H7P A;  4I2W A;  1MX4 A;  2WXP A;  2EQX A;  5ENN A;  3ZN3 A;  2LAH A;  1WM5 A;  4TV3 A;  3L13 A;  4EBA A;  3Q78 A;  2UWJ G;  3L6A A;  1NA3 A;  4I9E A;  2AXU A;  5CRU A;  2OVB A;  3C72 A;  4B93 B;  4V3I A;  4FHJ A;  3LVR E;  5LP0 A;  4C9B B;  3AJI A;  3PRE A;  1SZA A;  4O60 A;  3CK8 A;  3PH0 C;  3RRU A;  3Q73 A;  4U0S A;  5FIN A;  3MZL B;  2LUH A;  3JQ0 A;  3NBN B;  4GTP A;  4BFR A;  1DC2 A;  2WXF A;  3ZYK A;  4YVQ C;  1HS6 A;  2V4H C;  3SFX A;  1OY3 D;  3B7S A;  3NZS A;  4G25 A;  1IHG A;  4PS7 A;  3EHQ A;  4WWN A;  1OT8 A;  4EBA G;  2I1K A;  3ASF A;  3TWS A;  2QYJ A;  1W3B A;  2X38 A;  4N3A A;  3S7B A;  4AM9 A;  1OWP A;  3SFY A;  3LPZ A;  4FJZ A;  4HI8 A;  2V5Q C;  3ZW3 A;  1S70 B;  1WG0 A;  2KCK A;  1NZN A;  1BI7 B;  2V8S E;  4ACL A;  3CVV A;  2A5E A;  3FH8 A;  4YDO A;  1N54 A;  1N4S A;  4A55 A;  3SF4 A;  3D9M A;  1A17 A;  2ZIR A;  3AG3 E;  4L2L A;  4NRH B;  4KZ0 A;  4WNE A;  3V2X A;  1LD8 A;  3P1U A;  4LRZ A;  5FT9 A;  4LEU A;  3UI2 A;  5G05 J;  4HI9 A;  4XKB A;  3AS4 A;  2DWZ A;  3FP3 A;  2XPZ A;  3AS8 A;  3ZHE B;  3PUK A;  4JD2 G;  1PAQ A;  3PDN A;  4U0U A;  1JCR A;  5ARG A;  3KSQ A;  3O4Z A;  2B6C A;  4XKC A;  4CT0 A;  3FU6 A;  2R17 C;  2ETB A;  4GZ5 A;  2WXK A;  3TXN A;  4UI9 C;  4EHM A;  3ASG A;  2J4B A;  4UWK A;  3Q5M A;  2XGS A;  4B8C B;  2EIM E;  1EDU A;  1OWO A;  3LXU X;  3CK9 A;  4RQI A;  4AVX A;  2FUL A;  2IJG X;  3HG0 D;  1LF8 A;  1QQE A;  4WND A;  1YMP A;  1OWN A;  4DK5 A;  3DSV A;  4MKT A;  3Q49 B;  3APD A;  5AJD A;  2OEW A;  4A3V A;  2VYI A;  1KT1 A;  4HRN A;  2DZO A;  1E7V A;  4G8L A;  3D9O A;  2BKK B;  1MZC A;  3E4B A;  2WQ7 A;  4J8Y A;  3APC A;  3UIO C;  3CVY A;  2F0Y A;  3ENE A;  1MX2 A;  1DVP A;  3Q7A A;  4YDY A;  1TNU A;  3ZUV B;  2FF4 A;  3ISM C;  2X6F A;  2XS8 A;  3C3R A;  1O1R A;  3MX3 A;  3F6Q A;  1PC2 A;  3NAW A;  2NYJ A;  3UTM A;  4BEP A;  3EIQ C;  3EUV A;  5FWQ A;  4BY6 A;  4EEC A;  4XX5 A;  4BSZ B;  5BV0 A;  5G2N A;  1PY1 A;  5AJL A;  3TGO A;  2H6G A;  5CEC B;  5FQ6 A;  4KVM A;  5AAO A;  3APF A;  4CDN A;  5KNG A;  4JEU A;  4K5C A;  3TWX A;  4TUU A;  1UG3 A;  3CR3 A;  2FI7 A;  4M7C A;  2XCB A;  1HXI A;  1DNP A;  3AAA C;  1N4P A;  2I9C A;  4DPR A;  4FLB A;  2I6H A;  3RU0 A;  5EID A;  5G55 A;  2DYS E;  1BU9 A;  3KSL A;  3PVL A;  2DZN A;  4UQZ A;  3TWV A;  3PS6 A;  2P9S G;  3ZIM A;  2XS1 A;  4K5B A;  2Y4U A;  5ANL A;  3PZ4 A;  3DBS A;  5HQ8 A;  4ZFH A;  4C48 B;  5BUZ A;  5A7D B;  2NXP A;  1ELK A;  3D9P A;  2YHE A;  3FUF A;  3DEO A;  3RIB A;  3TWW A;  5EYP F;  4J8E A;  4PH4 B;  2NSZ A;  4G1T A;  5ENT D;  3UKR G;  1FVF A;  1KT0 A;  5J90 A;  2OEV A;  3CHQ A;  4Y6W A;  2LAI A;  5AYW D;  4DLQ A;  2AXZ A;  5AQA A;  3V2O A;  3VLD A;  5T3R A;  1IXV A;  1E8W A;  4RVB A;  5FZS A;  2XGO A;  2ETA A;  3Q79 A;  4WNG A;  4JXT A;  2WQ6 A;  2KBX A;  1JWG A;  2V5F A;  1NP7 A;  1YCS B;  2IOL A;  3CVX A;  2AJA A;  3AU5 A;  2L6J A;  2Y0B G;  1H6O A;  3MV2 B;  2NC9 A;  5BT1 A;  4J7W A;  4JW1 A;  4BT8 A;  3G2U A;  4HS2 A;  4ILH B;  4E6H A;  3CVW A;  2PQN A;  1H6P A;  4C0E A;  3MKR A;  4G24 A;  1TN7 A;  4L7T A;  3Q7F A;  5G04 C;  2XEE A;  4I6E A;  4IRU A;  2L9B A;  3NQP A;  3NOG D;  3B7R L;  4AIF A;  3FEY A;  1U2V G;  3CEQ A;  2XEN A;  5JJ7 A;  1MYO A;  4BX8 A;  4KBQ A;  4HRM B;  4XZ4 A;  4LSZ E;  3IHV A;  2P9P G;  3QWV A;  3S7J A;  2B0O E;  1SQM A;  4ZHB A;  3FUD A;  3L22 A;  2WMO A;  2IEJ A;  3FUK A;  4DI3 A;  1IHB A;  3R7R A;  4K03 A;  3C5R A;  3OXL A;  3MJW A;  3BQO A;  3KEZ A;  1N4R A;  1NI1 A;  4GPK A;  4HLE A;  4GZC A;  5HS0 A;  2J49 A;  1L5J A;  4GML A;  1NFI E;  4N5Q A;  4F1S A;  5DIZ A;  3RK6 A;  5LFA A;  1UOH A;  3WXX A;  4H7Y A;  5C1D A;  2LXM A;  1BPO A;  3UM1 A;  3MCX A;  3CVU A;  2VTB B;  2UY1 B;  5AAR A;  1TNZ A;  2FO1 E;  3LJN A;  1H0A A;  1HX8 A;  3SZ7 A;  2Y69 E;  4B94 A;  1O5M A;  5LOZ A;  5ENO D;  2VJ8 A;  4UQY A;  4AXH A;  2H6H A;  1GW6 A;  3GYZ A;  4U0Z A;  3Q47 B;  4I1O B;  4I2Z A;  3IHY A;  4BES A;  3IKO B;  1DCE A;  5EN5 D;  3T8K A;  3CHM A;  3V30 A;  2MRI A;  2WM9 A;  2GRM A;  3PUJ A;  3L54 A;  4F6R D;  3C3Q A;  3MKQ A;  5D2M C;  2RD0 A;  5EYL A;  5KJM A;  2IO2 C;  4WUY A;  3L17 A;  2WVI A;  4L9P A;  2IO3 C;  3DSU A;  3SQV A;  1NL4 A;  2MYO A;  3FHE A;  1Z3Y A;  4O1P A;  1WY6 A;  3RKV A;  3PZ2 A;  3DWL G;  3ESK A;  4KYO B;  3T9K A;  2X3M A;  4URK A;  5ARF A;  3EHM A;  1Z5S C;  4APF A;  4U8V D;  4HFG A;  2F8X K;  1TJC A;  4OYS A;  1OWM A;  3QB2 A;  3OXF A;  3ULY A;  5KBA A;  4AOF A;  3RJV A;  4GTS A;  3DSW A;  2JLB A;  4J8S A;  2KCL A;  1NA0 A;  2EIK E;  2BUG A;  4DX1 A;  3TG5 A;  1UJK A;  3SBS A;  3PRZ A;  2Y1L E;  2XZD G;  1YA0 A;  3B7T A;  5FTP A;  2HO1 A;  4AP2 A;  3FUJ A;  4N2Q A;  5JHA A;  4XEI G;  3U4T A;  3ESL A;  2XRY A;  1TN8 A;  2DYR E;  3AG2 E;  2FBN A;  2QY7 A;  1E8X A;  3AU4 A;  3EU9 A;  3RO3 A;  2DCP A;  5EX3 A;  3UM0 A;  4QQI A;  3NOC D;  3DEP A;  2KM4 A;  4GAA A;  1P5Q A;  3QDN A;  3SHF A;  3TXM A;  2L0I A;  1B89 A;  5AQ7 A;  2P9U G;  3D9L A;  2OND A;  5A23 A;  4N2S A;  2WXI A;  2R03 A;  2QFC A;  3D9J A;  4ME2 A;  4RG9 A;  3CKB A;  3KAE A;  4GYW A;  3ZNG A;  3I5P A;  4J8D A;  5IY5 E;  2H6F A;  2WXJ A;  3CK7 A;  2KXP C;  3ZHE A;  3QK0 A;  2R05 A;  1OUV A;  2A5U A;  2X6H A;  3B7B A;  4LNG A;  4I43 A;  4TXP A;  2EIJ E;  3U64 A;  4HOQ A;  1N95 A;  2MHK A;  3DST A;  1KPS B;  2GRO B;  4BWR A;  3LY9 A;  4U04 A;  4ABN A;  3WG7 E;  5CEA A;  1D8D A;  4GTR A;  2P9I G;  1QBQ A;  1OCC E;  4U63 A;  1JWF A;  3KS2 A;  3ASO E;  3CHP A;  3FUL A;  1X81 A;  1IQU A;  2X6K A;  1VDY A;  1U3D A;  2LNI A;  4G23 A;  3ULE G;  3SY2 A;  3ZFW A;  4HNA D;  2YIN A;  4BET A;  4EZL A;  4HOU A;  1MX6 A;  3UT7 A;  3PNL B;  4L1B A;  3TWT A;  5AIJ A;  1AP7 A;  4UI9 J;  3ML8 A;  3P2B A;  4CZ2 D;  4D10 C;  4GCN A;  4U8H A;  5CED B;  3S2A A;  3E32 A;  2Y3A A;  3IV0 A;  4CGW A;  1HU3 A;  5FZQ A;  3C98 A;  3T5X A;  5D66 A;  3ULQ A;  3FTY A;  3U3W A;  4LUN U;  4LNU D;  4HOT A;  5D0Q D;  4XIF A;  3FU0 A;  3ZU7 B;  1K1B A;  3OAW A;  3ABM E;  4GTT A;  5FZR A;  4FUL A;  2GRR B;  4GTO A;  2XRZ A;  4HRL A;  4RLY A;  1BI8 B;  2E2E A;  2IFU A;  2P9N G;  3BUA A;  1Y8M A;  3FY4 A;  3ZXP A;  3E34 A;  4P29 A;  1UJJ A;  5KCM A;  3I4G A;  2CHZ A;  3CHR A;  3FU3 A;  2PL2 A;  2VSY A;  3NB2 A;  4B89 A;  1DCQ A;  5C2Y A;  4J0U A;  2X6J A;  3TAX A;  2PNN A;  2RG8 A;  3DPY A;  3TWR A;  3PE4 A;  2DBA A;  3GZ2 A;  3BG0 B;  1FCH A;  4IUL A;  3LEW A;  3ZPJ A;  2GRL A;  4G26 A;  2VGE A;  3RSE G;  2QZA A;  3CHS A;  4UWF A;  4YDE A;  4U07 A;  1KLX A;  2X6I A;  4UWG A;  1JPL A;  5AN8 A;  3FDH A;  4GZ6 A;  4FC8 A;  3V79 K;  4G2V A;  2CHW A;  2EIL E;  5BW8 C;  3LKU A;  4ANV A;  4HOS A;  2WPV A;  2VGY A;  3ZYQ A;  1TNB A;  3HXD A;  4TUM A;  3URZ A;  5KJN A;  3TWQ A;  4AY5 A;  2H6I A;  4A1G A;  3G2S A;  2I1J A;  5EIL A;  5J08 A;  2CG3 A;  1V55 E;  4CGV A;  1TEZ A;  2XZT G;  3FTX A;  3FUE A;  2VGX B;  3U9W A;  2OVF A;  1S64 A;  3VTY A;  2R02 A;  1OCZ E;  2GRQ B;  3UXG A;  5B1A E;  4B0Z A;  3ABK E;  3TG4 A;  1N4Q A;  2PM7 A;  3DPD A;  4MBG A;  3LCA A;  1K8K G;  1OXJ A;  5ENP D;  4G8K A;  4JPS A;  1OWL A;  2IY0 C;  3ZYL A;  1Z6T A;  1HO8 A;  3JYS A;  4C0M A;  4ATG A;  2J09 A;  5JJT A;  4U95 D;  3AG4 E;  1BLX B;  3NF1 A;  1ELR A;  3FUN A;  4GTM A;  3FUM A;  4UI9 K;  2CG2 A;  4JHK A;  3UM2 A;  3LY7 A;  3CLJ A;  1KZP A;  4PUC A;  2CFU A;  4BTB A;  3CIA A;  3IBE A;  3B95 A;  3FEX A;  3E37 A;  2A4Z A;  1V54 E;  1TNO A;  1D8E A;  4EQF A;  4XE0 A;  3KEA A;  3FTU A;  4DX5 D;  2QC9 A;  4EZK A;  4GYY A;  2HE0 A;  3NZU A;  3QAR A;  3MYV A;  4NAC A;  3PZD A;  4R7L A;  5G04 J;  3VLE A;  2AXV A;  1OCO E;  3EDT B;  3PZ3 A;  1SA5 A;  3RO2 A;  3UX4 A;  1E96 B;  1JCQ A;  4K0R A;  2J07 A;  4YDW A;  2L6B A;  1H2U A;  3UM3 A;  1ELW A;  1G3N B;  4U7E B;  4ANU A;  2BTD A;  1HE8 A;  2XGM A;  4ANW A;  3CGH A;  5JMN D;  5KJL A;  2VSN A;  4DX7 D;  4N39 A;  2VQ2 A;  3EIJ A;  4I9C A;  2QYU A;  5T4Y A;  2XEV A;  2VTB A;  2KAT A;  3QJZ A;  5BXU A;  2UY1 A;  3VTX A;  2MOW A;  3CVL A;  2YNQ A;  3X2Q E;  5ANR A;  3QWP A;  2RKK A;  4U96 D;  4E85 A;  3Q4A B;  4CDM A;  4LER A;  4GU5 A;  2XCC A;  4HB5 A;  1E90 A;  4WAF A;  3E30 A;  3HRA A;  3MA5 A;  2HM8 A;  1IKN D;  1RZ4 A;  1TN6 A;  3UIP C;  2BED A;  4WWO A;  5AQ9 A;  1KZO A;  3UUX A;  5CBN A;  3D9I A;  3Q9U C;  5LCW J;  4GA0 A;  5FJY A;  2BKG A;  4JC8 A;  2GW1 A;  5HI7 A;  3HXE A;  2ION A;  1FT1 A;  5CMW A;  3LVQ E;  3UIN C;  4GB9 A;  4BX9 A;  2IOS A;  3DXK G;  4EZJ A;  1ZB1 A;  2R5S A;  3LDZ A;  3UKU G;  1IYG A;  3FFL A;  3T8M A;  2PM6 A;  3JCK C;  4GZ3 A;  4MLP A;  2ZXW E;  3O48 A;  1QZ2 A;  4Z68 A;  2V4L A;  1HF8 A;  4HBD A;  5BNW A;  3B7U X;  4FLH A;  3JUI A;  4NUR A;  3ZRH A; 
#chains in the Genus database with same CATH homology
 4TUU A;  2WXM A;  1UG3 A;  3CR3 A;  2ZU6 B;  4GZD A;  3EJN A;  1JWF A;  3AS5 A;  3KS2 A;  2FI7 A;  4HOR A;  4M3O A;  3CVP A;  4I6J A;  3CHP A;  2XCB A;  3FUL A;  1E8Y A;  1HXI A;  3HVE A;  3N71 A;  4EPZ A;  2OV8 A;  4HVB A;  1DNP A;  1N52 A;  1Z3X A;  4XI9 A;  2I9C A;  2IU1 A;  1IQU A;  2LO6 A;  4DPR A;  3CQC B;  3TL5 A;  2X6K A;  1VDY A;  1U3D A;  2LNI A;  4FLB A;  4G23 A;  4GA2 A;  4JHJ A;  2I6H A;  3CST A;  3RU0 A;  5G55 A;  3ZXS A;  2AVP A;  3QKY A;  3ZFW A;  3CVN A;  4I1M A;  2YIN A;  4EZL A;  5CMY A;  4HOU A;  3PVL A;  4UQZ A;  4G11 A;  3PS6 A;  4L23 A;  3ZIM A;  3UT7 A;  3HVE B;  3PNL B;  4L1B A;  4N5C A;  5AIJ A;  2Y4U A;  5ANL A;  4UI9 J;  3ML8 A;  2XPI A;  3P2B A;  5BPP A;  3DBS A;  5HQ8 A;  3SFZ A;  5BUZ A;  5A7D B;  4D10 C;  3ML9 A;  3ZGQ A;  3G2W A;  2NXP A;  4GCN A;  1ELK A;  4U8H A;  3ZYM A;  3D9P A;  3S2A A;  2YHE A;  2OOE A;  2Y3A A;  3FUF A;  3IV0 A;  3RIB A;  4CGW A;  2J9Q A;  1HU3 A;  4JVS A;  5FZQ A;  4IN3 B;  4J8E A;  3C98 A;  4PH4 B;  2NSZ A;  3T5X A;  4GMJ A;  4G1T A;  4Q94 A;  1TJF A;  1XNF A;  3ULQ A;  1FVF A;  3LYA A;  1KT0 A;  5J90 A;  3CHQ A;  3QC1 A;  4Y6W A;  2LAI A;  2WXR A;  2KCV A;  5AYW D;  2YQ8 A;  5JHB A;  1HH8 A;  3FTY A;  5M72 A;  3U3W A;  1EPU A;  4DLQ A;  2AXZ A;  4LUN U;  3CVQ A;  3D3M A;  4JA7 A;  1ZBP A;  1HZ4 A;  3JQ1 A;  5E75 A;  4DLO A;  4HOT A;  3VLD A;  2HYZ A;  4XIF A;  5D0Q D;  4GCO A;  3FU0 A;  1JUQ A;  4AJW A;  1FVH A;  5T3R A;  1E8W A;  4RVB A;  5FZS A;  2ILR A;  2XGO A;  1EYH A;  4JL0 A;  3VLF A;  3CKC A;  2AWI A;  5LCW C;  3OAW A;  4WNG A;  4JXT A;  2WQ6 A;  5FZR A;  4FUL A;  1UN9 A;  1JWG A;  4MRU A;  3B13 A;  2V5F A;  2XRZ A;  1NP7 A;  1E8Z A;  2IQC A;  3PEV B;  4Q69 A;  2E2E A;  2IFU A;  4J6I A;  1Y8M A;  3FY4 A;  4XI0 A;  3TJP A;  2IOL A;  3OTN A;  3UT4 A;  4P29 A;  5EX0 A;  5JJ6 A;  1UJJ A;  5FQ4 A;  1EF1 C;  4CCA A;  5KCM A;  3CVX A;  3I4G A;  4DI4 A;  5A6C A;  3AU5 A;  2IF4 A;  2CHZ A;  3CHR A;  2L6J A;  4A3T A;  1ZU2 A;  3FU3 A;  3MGB A;  2PL2 A;  3FWV A;  3MV2 B;  2NC9 A;  2VSX E;  3CSF A;  2VSY A;  5E76 A;  4JEH A;  5BT1 A;  3Q15 A;  4JW1 A;  2CFZ A;  4BT8 A;  1HFA A;  4FJY A;  4QFV A;  5G05 C;  4B89 A;  4PS3 A;  2C0M A;  3G2U A;  4HS2 A;  4ILH B;  4J0U A;  3G2T A;  2WXL A;  4PS8 A;  2X6J A;  5C2Y A;  3TAX A;  4ANX A;  3GW4 A;  4E6H A;  4RG6 A;  2RG8 A;  3CVW A;  4RSY A;  4UWH A;  2PQN A;  3U66 A;  3PE4 A;  5EDS A;  5CHE E;  2DBA A;  4WNF A;  3GZ2 A;  3BG0 B;  4C0E A;  1FCH A;  1MHQ A;  1UW4 B;  3MKR A;  3LJ3 A;  4IUL A;  3LEW A;  4G24 A;  3ZPJ A;  4L7T A;  2GRL A;  5EKQ D;  5G04 C;  3S7D A;  4I6E A;  4IRU A;  3FTZ A;  2L9B A;  3FTW A;  3ZVV A;  2E0I A;  3D9K A;  2V0P A;  2WXH A;  3PE3 A;  3NQP A;  4G26 A;  3L08 A;  2CHX A;  3FUI A;  3B7R L;  4AY6 A;  1IQR A;  4W9R A;  4AIF A;  3CHS A;  3FEY A;  4UWF A;  3MKQ B;  4U07 A;  3CEQ A;  1KLX A;  1U3C A;  2X6I A;  3FUH A;  4UWG A;  1JPL A;  5BV1 A;  3T5V A;  3FDH A;  3FU5 A;  4FC8 A;  4GZ6 A;  4G2V A;  2CHW A;  5JJ7 A;  4KVO A;  4I2W A;  5BW8 C;  4BX8 A;  2WXO A;  3ONK A;  2WXP A;  3FTV A;  2KC7 A;  3LKU A;  3SD5 A;  2EQX A;  4ANV A;  4FA6 A;  4HOS A;  4YVO A;  4GA1 A;  1WAO 1;  3ONL A;  4KBQ A;  5ENN A;  3ZN3 A;  2WPV A;  2LSV A;  2LAH A;  2VGY A;  2WXQ A;  3K9I A;  3LS8 A;  3ZYQ A;  4XZ4 A;  1WM5 A;  2YHC A;  4TV3 A;  3L13 A;  3URZ A;  4EBA A;  3IHV A;  1UN8 A;  5KJN A;  2UWJ G;  1Y6I A;  3L6A A;  1NA3 A;  4I9E A;  4AY5 A;  3QWV A;  2AXU A;  3S7J A;  1SQM A;  1MQS A;  4Y6C A;  5T8I A;  4A1G A;  2OVB A;  1H2V C;  3G2S A;  4V3I A;  1HG2 A;  2I1J A;  2VSO E;  2WQH A;  3FUD A;  3LVR E;  4FHJ A;  3L22 A;  5LP0 A;  2WMO A;  4C9B B;  3FUK A;  5J08 A;  2CG3 A;  3PRE A;  3QWW A;  4DI3 A;  5CCL A;  1SZA A;  4OVU A;  4CGV A;  2P58 C;  3R7R A;  4CEM A;  4F3V A;  3CK8 A;  3FH5 A;  3SGH A;  4JHR A;  3PH0 C;  4CRW A;  1TEZ A;  4K03 A;  3RRU A;  3FTX A;  3FUE A;  2VGX B;  3OXL A;  3U9W A;  4U0S A;  3MJW A;  3MZL B;  2OVF A;  4I17 A;  2GGF A;  3VTY A;  3JQ0 A;  5CCM A;  3S7F A;  3KEZ A;  3QNK A;  4BFR A;  2WXF A;  4ACK A;  4B8A A;  3ZYK A;  4YVQ C;  4CT4 A;  1HS6 A;  4GPK A;  4HLE A;  4OVV A;  4GZC A;  3IEG A;  4B0Z A;  2J49 A;  1L5J A;  3B7S A;  3I4R B;  4I6G A;  4GML A;  3NZS A;  4G25 A;  3TG4 A;  4BT9 A;  4F1S A;  1IHG A;  4PS7 A;  5DIZ A;  3RK6 A;  5LFA A;  4WWN A;  3WXX A;  4H7Y A;  5C1D A;  2PM7 A;  4EBA G;  2LSU A;  1HG5 A;  2I1K A;  1BPO A;  3ASF A;  3CQG B;  3DPD A;  4O6F A;  3OXG A;  3MCX A;  1W3B A;  4F53 A;  2X38 A;  3CVU A;  4AEZ C;  4N3A A;  3S7B A;  2VTB B;  5DBK A;  3LCA A;  4AM9 A;  2UY1 B;  1OWP A;  4CDR A;  5KJK A;  4JPS A;  3LPZ A;  3MEK A;  4PDX A;  1H0A A;  1HX8 A;  1OWL A;  4FJZ A;  3SZ7 A;  3ZYL A;  1Z6T A;  4DJA A;  1HO8 A;  3I3N A;  2XPY A;  3JYS A;  4GYO A;  3ZW3 A;  4B94 A;  5LOZ A;  4C0M A;  1XGW A;  4ATG A;  2J09 A;  5JJT A;  2KCK A;  2VJ8 A;  1NZN A;  3NF1 A;  2V8S E;  3CVV A;  4ACL A;  4UQY A;  4AXH A;  3L16 A;  1ELR A;  2R59 A;  1SZ9 A;  1GW6 A;  3GYZ A;  4U0Z A;  3FUN A;  3Q47 B;  3FH8 A;  4WWP A;  2AW6 A;  3FUM A;  4I1O B;  4I2Z A;  3SI5 A;  2M63 A;  4L2Y A;  3IHY A;  4UI9 K;  2CG2 A;  3IKO B;  4JHK A;  3LY7 A;  3CLJ A;  1N54 A;  5FQ7 A;  3CHM A;  4A55 A;  3SF4 A;  2MRI A;  3D9M A;  2WM9 A;  2CFU A;  2GRM A;  2JEK A;  3ASH A;  3PUJ A;  4N3B A;  3HYM B;  4PUC A;  3L54 A;  3MKQ A;  4HXI A;  4BTB A;  3CIA A;  2RD0 A;  1A17 A;  3IBE A;  3R7Q A;  3FEX A;  5FQ8 A;  4L2L A;  4MS6 A;  5KJM A;  3UPV A;  4NRH B;  2A4Z A;  4WUY A;  4AV7 A;  3L17 A;  4IYP A;  4KXK B;  2WVI A;  1E7U A;  4KZ0 A;  4WNE A;  3MV3 B;  3P1U A;  4LRZ A;  5FT9 A;  4LEU A;  4JZY A;  4UWL A;  4EQF A;  5G05 J;  4XE0 A;  2I2O A;  3QAQ A;  2WXN A;  3FTU A;  4I1A A;  4H7X A;  4LCT A;  3FHE A;  3KD7 A;  1H2T C;  4XKB A;  1Z3Y A;  3AS4 A;  4EZK A;  3FH7 A;  3FP3 A;  4FU3 A;  1WY6 A;  2XPZ A;  3AS8 A;  4GYY A;  3RKV A;  3NZU A;  2PQR A;  3HHM A;  3QAR A;  3ZHE B;  3MYV A;  3PUK A;  4NAC A;  3ESK A;  4KYO B;  1X5B A;  2X3M A;  3PZD A;  3HDX A;  1PAQ A;  4URK A;  4Q96 A;  3PDN A;  5ARF A;  3EHM A;  4R7L A;  4U0U A;  1S0P A;  5G04 J;  3VLE A;  2AXV A;  3LY8 A;  3EDT B;  5ARG A;  4APF A;  3O4Z A;  3RO2 A;  4HFG A;  3UX4 A;  1E96 B;  4XKC A;  3BEE A;  4K0R A;  1TJC A;  3BG1 B;  3RRN B;  4CT0 A;  3R9A B;  1QNF A;  3FU6 A;  2VGX A;  2XQ0 A;  2J07 A;  1H2U A;  3UMV A;  4OYS A;  1ELW A;  2R17 C;  3D9N A;  3EHN A;  1OWM A;  4ANU A;  2Q7F A;  2BTD A;  3OXF A;  3QB2 A;  4GZ5 A;  5D0O D;  2WXK A;  1HE8 A;  4AOF A;  3TXN A;  4UI9 C;  2XGM A;  3RJV A;  3RRM B;  4BTA A;  4ANW A;  3CGH A;  3HIZ A;  2JLB A;  3ASG A;  2J4B A;  4J8S A;  5KJL A;  4UWK A;  2KCL A;  2L0T B;  3Q5M A;  2VSN A;  1NA0 A;  2XGS A;  2FEZ A;  3CHO A;  4N39 A;  2BUG A;  2VQ2 A;  3TG5 A;  1UJK A;  4B8C B;  3EIJ A;  4I9C A;  3PRZ A;  3SBS A;  5T4Y A;  4FAD A;  1YA0 A;  3B7T A;  3GZS A;  1EDU A;  4UQX A;  5FTP A;  1OWO A;  4J8F A;  2HO1 A;  4AP2 A;  3LXU X;  3CK9 A;  2XEV A;  2VTB A;  2KAT A;  3FUJ A;  3QJZ A;  4N2Q A;  2UY1 A;  5JHA A;  3UQ3 A;  4AVX A;  3VTX A;  2FUL A;  2IJG X;  2MOW A;  1LF8 A;  3SNX A;  1QQE A;  3CV0 A;  2YNQ A;  3CVL A;  4FP7 A;  4WND A;  5ANR A;  3QWP A;  3U4T A;  3QOU A;  3ESL A;  2WB2 A;  1OWN A;  2XRY A;  3FTS A;  4DK5 A;  2J08 A;  4MKT A;  3Q49 B;  3APD A;  2FBN A;  4E85 A;  2QY7 A;  1E8X A;  3AU4 A;  3RO3 A;  3Q4A B;  4CDM A;  5AJD A;  4LER A;  3PEU B;  4GU5 A;  2DCP A;  4A3V A;  5EX3 A;  3ASD A;  2VYI A;  1KT1 A;  2XCC A;  1E90 A;  2C0L A;  4WAF A;  1E7V A;  3PNT B;  4JA9 A;  3MA5 A;  2KM4 A;  2XHE A;  4GAA A;  1P5Q A;  3QDN A;  2HM8 A;  3SHF A;  3TXM A;  3D9O A;  2L0I A;  1B89 A;  2C2L A;  3D9L A;  3E4B A;  1INZ A;  4KT6 B;  4KZC A;  2OND A;  5A23 A;  4N2S A;  5AEN A;  2WXI A;  4WWO A;  4F7A A;  2QFC A;  3D9J A;  4ME2 A;  3UUX A;  3D9I A;  2WQ7 A;  5LCW J;  4GA0 A;  5FJY A;  4JC8 A;  4RG9 A;  2GW1 A;  5HI7 A;  2Y4T A;  3APC A;  2ION A;  3CVY A;  3ENE A;  3CKB A;  3KAE A;  1DVP A;  4GYW A;  4KMO A;  1H19 A;  3LVQ E;  5CMW A;  4N3C A;  3I5P A;  4J8D A;  2KZT A;  4ILI A;  4FHK A;  4GB9 A;  4A1S A;  4BX9 A;  2IOS A;  2WXJ A;  3CK7 A;  2FO7 A;  3QK0 A;  3ZHE A;  4EZJ A;  2FF4 A;  2R5S A;  3LDZ A;  1OUV A;  2A5U A;  2X6H A;  2HR2 A;  2J4D A;  2X6F A;  4I43 A;  1IYG A;  4ILG A;  3FFL A;  2PZI A;  3MX3 A;  1PC2 A;  3T8M A;  2PM6 A;  3U64 A;  3G2V A;  2BF0 X;  2WXG A;  3GZ1 A;  3JCK C;  3EIQ C;  4GZ3 A;  2WMN A;  4HOQ A;  5FWQ A;  2MHK A;  4MLP A;  3ZEF A;  4BY6 A;  2DIW A;  5LX8 A;  4EEC A;  3UT8 A;  3O48 A;  4XX5 A;  4YND A;  2KZT B;  1QZ2 A;  1H6K A;  4NQ0 A;  3SBT B;  4BSX A;  2V4L A;  1HF8 A;  4BWR A;  3LY9 A;  5BV0 A;  4U04 A;  5G2N A;  1PY1 A;  5AJL A;  4ABN A;  3TGO A;  5BNW A;  3B7U X;  4FLH A;  4TRQ A;  5FQ6 A;  4KVM A;  3APF A;  3JUI A;  4CDN A;  4APO A;  4NUR A;  3ZRH A;  4JEU A;  4U63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...