2DBAA

The solution structure of the tetratrico peptide repeat of human smooth muscle cell associated protein-1, isoform 2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
148
structure length
148
Chain Sequence
GSSGSSGMTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Smooth muscle cell associated protein-1, isoform 2
publication title The solution structure of the tetratrico peptide repeat of human Smooth muscle cell associated protein-1, isoform 2
rcsb
source organism Homo sapiens
total genus 35
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2dbaA01
3S7JA 3Q49B 2VGXB 4AY5A 3LYAA 5CHEE 4UI9C 4GA1A 4CDRA 3CKBA 4HORA 2Y4UA 5DIZA 4U0ZA 1XNFA 4O6FA 4WNEA 3IEGA 5G04J 5D0QD 1QZ2A 1ZU2A 5G05C 4N2QA 4RG6A 3U4TA 1W3BA 4GYYA 3TG4A 2XEVA 3LCAA 4G26A 4N3AA 3HYMB 3RO3A 2PQNA 2OOEA 3RIBA 4APOA 4G23A 5M72A 3PDNA 2HR2A 2FEZA 2HO1A 4ME2A 4F3VA 1PC2A 5BT1A 4G25A 4XI0A 5CCMA 2IFUA 2PL2A 2XCCA 2VQ2A 3UQ3A 3CVQA 4U0SA 3MEKA 4BTBA 3CVLA 1TJCA 3VTYA 3O48A 2XGOA 2KCLA 3SZ7A 2UY1A 5FZSA 4N5CA 3QDNA 3N71A 5DBKA 4GPKA 3CKCA 2V5FA 3MA5A 4J8FA 4A1SA 3RU0A 5ARGA 4HOTA 3CEQA 2KC7A 3TAXA 3S7FA 2UWJG 3ASFA 5G04C 5EKQD 4J8EA 3KD7A 2P58C 3OXGA 3RJVA 4CGWA 3PE4A 4HOSA 3URZA 2VSNA 3ZN3A 2HYZA 2VGXA 5CCLA 5JJ6A 5HQ8A 5KJMA 5LCWC 2Q7FA 3LY8A 2C2LA 4Y6WA 4GZ5A 3GZ2A 4GCOA 5FZQA 5A6CA 2FI7A 1FCHA 2VSYA 4NQ0A 2GW1A 2L6JA 3ASHA 2AVPA 5EX0A 2VYIA 3LY9A 4H7YA 3R9AB 3FP3A 4I2ZA 5FJYA 1ELRA 1HXIA 3KS2A 4BT9A 3TG5A 3QWWA 3ZPJA 2ONDA 3Q5MA 2VGYA 4WNGA 4IN3B 5LCWJ 3ZHEB 4BT8A 4UQZA 2Y4TA 2J9QA 4I17A 5FZRA 4KYOB 2IF4A 4H7XA 2XPIA 2KCKA 4W9RA 3QWVA 4I9CA 1B89A 5AYWD 3PE3A 5D0OD 1IHGA 2FO7A 3SF4A 3MV2B 5ARFA 4I9EA 3MV3B 3CVPA 2MHKA 3U3WA 2C0LA 1YA0A 2FBNA 5C1DA 3AS8A 4GA2A 4JA7A 3LKUA 3OXLA 3CVNA 3GYZA 1P5QA 4AIFA 4N2SA 5A7DB 4HOQA 1NA3A 2NC9A 1ELWA 3QOUA 3VTXA 3QWPA 3NF1A 4EQFA 4U0UA 1E96B 3ULQA 4UQYA 3FFLA 4UI9K 4U07A 3CK8A 1WM5A 3Q4AB 3OXFA 5JJTA 1Y8MA 3MKRA 2C0MA 4Y6CA 4YNDA 4N3CA 4LEUA 4WUYA 5HI7A 1A17A 2FF4A 3RKVA 4AY6A 4B94A 2YHCA 3ASGA 3GZ1A 3WXXA 3CK7A 3EDTB 3FWVA 5KJLA 3ESKA 4N39A 4I1AA 3CV0A 3K9IA 4GYWA 4GA0A 1KT1A 4XI9A 2PZIA 3BEEA 4I2WA 4GZ3A 2JLBA 3ZHEA 3ASDA 3Q47B 2YQ8A 4GYOA 4GCNA 1NA0A 2WQHA 4KBQA 4JL0A 3S7DA 3LPZA 4J8DA 4HOUA 4BTAA 4ABNA 1HH8A 5EX3A 5BNWA 2QFCA 2KCVA 4JA9A 4U04A 2E2EA 4N3BA 3S7BA 5KJNA 3ZFWA 1KT0A 2LNIA 2LSUA 4BWRA 4UI9J 3UUXA 1IYGA 3ZGQA 3KAEA 3RO2A 1ZBPA 2DBAA 4G24A 3E4BA 5G05J 3UPVA 5JJ7A 3LY7A 2PQRA 4YVQC 4GZ6A 1OUVA 4UQXA 1NZNA 4WNDA 3QKYA 1WAO1 4YVOA 4WNFA 2UY1B 3TGOA 4CGVA 4G2VA 4G1TA 3Q15A 4JHRA 5KJKA 1HZ4A 2LSVA 4KXKB 4AM9A 2XGMA 4NRHB 1KLXA 2R5SA 5FT9A 4RG9A 4J0UA 5BW8C 3CK9A 3GW4A 2KATA 3AS5A 2WPVA 2XCBA 3JYSA 2I6HA 4XIFA 3AS4A 1QQEA 5FTPA 2XGSA 2BUGA
chains in the Genus database with same CATH superfamily
3C5RA 3L9TA 1H2TC 4ANUA 2P9PG 4YDEA 5EIBE 2IO2C 4XKBA 1XNFA 1OCRE 4O6FA 2LAIA 2RFMA 3ZEFA 4LNGA 1OWOA 3LJNA 2AXZA 4N2QA 1KPSB 1N4PA 1Z5SC 4ANXA 1TYQG 5BXUA 3U4TA 3RRNB 4GZDA 3VLFA 4GYYA 4GTRA 3TWSA 3UXGA 3ZYLA 4GTPA 4DLOA 1U3DA 3HYMB 3IV0A 2DYSE 3RIBA 4A63B 3V79K 2KXPC 5M72A 1H2UA 4U7EB 2HO1A 3TWRA 3CSFA 4F3VA 2ZU6B 3BU8A 2I1KA 4KVMA 5CCMA 1TNUA 2VQ2A 4DUIA 1SQMA 3MEKA 3CVLA 4HI9A 5EDSA 4WWPA 2LXLA 1MX2A 2QZAA 3QAQA 1BD8A 2WXHA 3QDNA 5DBKA 2AXVA 4PH4B 3DSUA 4JVSA 4GPKA 1K8KG 3MA5A 4EPZA 4LRZA 3CEQA 1TNYA 1N95A 3EHRA 1KZOA 4BERA 2A4ZA 2GRRB 4B89A 2CFZA 3LVRE 4IRUA 5EKQD 3SBSA 3RRMB 2XS1A 3RJVA 2FULA 5AIJA 1IQRA 3QJZA 4X8QA 3URZA 4NURA 3AAAC 5LCWC 4ANWA 3SFYA 5CEDB 2Q7FA 3LY8A 3DSXA 4FHKA 5T4YA 4Q69A 2XRZA 4GCOA 2X6JA 3FUJA 2XPZA 4AEZC 4RVBA 1MX4A 2P9IG 2BF0X 2WXFA 4ANVA 1FCHA 4B93B 5E75A 2OVFA 1D9SA 3DPDA 4TV3A 5CMWA 4I6GA 2VYIA 3LY9A 3Q79A 4KZ0A 3PNLB 3AG2E 3KS2A 3TG5A 4U95D 3QWWA 4WAFA 4F1PA 2H6FA 1H19A 2VGYA 3TWXA 4TRQA 3AJIA 4URKA 2J9QA 4P29A 3PRZA 4LUNU 3FUIA 4H7XA 1IQUA 4I9CA 1WG0A 2EIME 3DEPA 3UX4A 2P9KG 1UG3A 3PNTB 1N4SA 2H6IA 3DSTA 2FO7A 3SF4A 4I9EA 2YNQA 5ITZF 1INZA 4UWGA 4F6RD 4FLHA 4WWOA 3SBTB 4BSXA 3MJWA 1MX6A 3LKUA 5JA4D 4MKTA 2P2CP 1N4QA 3OTNA 3SO8A 4GPMA 2DWZA 5A7DB 3FHEA 2OV8A 1Z3YA 1ELWA 3QOUA 3QWPA 3T5VA 3ZXSA 3FEXA 4U0UA 3ULQA 4UQYA 3FFLA 4U07A 1TN6A 5JJTA 4ACLA 2GRLA 5EYLA 2C0MA 3IHYA 4I1OB 2CHXA 4LEUA 2IO3C 4ZFHA 1AP7A 2MRIA 5CBNA 2FF4A 4B94A 3ASGA 1RW2A 5KJLA 3ESKA 1HO8A 1KZPA 2XZDG 4DX2A 1WDYA 4L2LA 1UJKA 4XI9A 4TXPA 3Q47B 4MS6A 4JZYA 3FU0A 3C3OA 4APFA 3W9FA 3JXIA 2I1JA 1YCSB 1HX8A 1WY6A 1E7VA 1GW6A 4N5QA 1S70B 4GTTA 5BNWA 2ZGGA 5T3RA 2J4BA 3B95A 3FTYA 3FTZA 2QFCA 4DPRA 2KCVA 3FU3A 4PUCA 2E2EA 3L82A 4N3BA 2QY7A 3TXMA 2LNIA 4UWKA 4ATZD 3UUXA 4KZCA 1K3ZD 5AARA 2EILE 1SA5A 1X5BA 2IOLA 2R05A 4G24A 1MYOA 4F1SA 4M7CA 1LF8A 3FH8A 5AN8A 4NIKA 4UUCA 3LY7A 4RSYA 1OY3D 3ULYA 2BKKB 1NZNA 1OCOE 4UQXA 4WNDA 1FVFA 1WAO1 4YVOA 4GTSA 4JHRA 5G55A 3CIAA 2LSVA 4FP7A 4KXKB 4CDMA 2XGMA 2RG8A 1N11A 3HDXA 2KZTB 3CK9A 5LX8A 2KATA 3ZRHA 4GTQA 3MZLB 2E0IA 4HI8A 2LAHA 4BY6A 3IXEA 3BG1B 2I6HA 3AS4A 3I5PA 2PM7A 3FUMA 3LVQE 5ENQD 2VGXB 4JW1A 4HB5A 4L7TA 3PZ4A 3U66A 2H6HA 5AQ9A 5BV0A 5DIZA 3ENEA 3CVXA 4WNEA 3IEGA 4FA6A 3TWTA 4GTVA 1QZ2A 5D0QD 2ETCA 2GRPB 1A5EA 3JQ1A 4E85A 1PAQA 4RQIA 4GZCA 3UI2A 3V2XA 2J4DA 3TG4A 2PM6A 3KEZA 2BEDA 1EYHA 1D8DA 4N3AA 3AU5A 4BX8A 1DC2A 4G23A 3HIZA 3CLJA 1PC2A 2WXQA 5BT1A 2IFUA 3QB2A 2XCCA 5ENTD 3CVQA 3MKQA 4BTBA 2R2LA 4HRLA 2P9UG 3IKOB 4L2YA 2XGOA 2KCLA 1DCEA 5D66A 4B8CB 1DCQA 5FQ4A 3JXJA 4N5CA 4JD2G 1NFIE 3CKCA 5EYPF 1O1TA 4G8LA 3O4ZA 2GRQB 1S0PA 5LOZA 3UIOC 4F53A 3MGBA 4AJWA 2RFAA 2GRNB 3ASFA 1S63A 2B6CA 4XKCA 4J8EA 3KD7A 3OXGA 2OEVA 4CGWA 3CHQA 3HHMA 4LSZE 3TWWA 3HXEA 4DI4A 4J8SA 2VGXA 3FUKA 5JHAA 3Q9UC 5CECB 5CCLA 5JJ6A 5KJMA 2QC9A 2VTBB 3FUNA 4OAUC 2OVBA 4I43A 3TL5A 4HLEA 3PZ1A 4B0ZA 3T8KA 4Y6WA 4GZ5A 3GZ2A 4L23A 2DYRE 2CHZA 3UTMA 3PZDA 5E76A 2VSYA 5FWQA 4NQ0A 4L9PA 4MBGA 2DIWA 4AXHA 3ASHA 5BXOA 4J8YA 2AVPA 3R9AB 2MOWA 2A5UA 3I4RB 1SZAA 4I2ZA 3P2BA 2GGFA 5B3SE 2X6IA 4FJYA 1HXIA 2XHEA 4PDXA 4WNGA 3FEYA 5LCWJ 4LNUD 3CHSA 2Y4TA 3S2AA 4W9RA 3QWVA 3V2OA 5AQBA 3ESLA 5CRUA 1IHGA 3CHOA 4FLBA 1NP7A 3MV3B 3U3WA 2BTDA 3KEAA 2AXUA 3UM1A 5AQAA 3AS8A 3UKRG 4GA2A 4JA7A 3Q78A 3DSVA 1QBQA 1E8YA 1D8EA 3UT7A 1EF1C 4AIFA 3G2TA 4N2SA 2IY0C 4HOQA 2NC9A 3VTXA 2Y3AA 5J08A 1E96B 2VGEA 2VTBA 4UI9K 2VSXE 4IULA 1WM5A 3OXFA 4A3VA 1Y8MA 3MKRA 5JMND 3R9MA 3HRAA 3FH5A 4FJZA 1OWLA 3FH7A 3Q9NC 1BU9A 1FT2A 3ZKJA 1HS6A 2BKGA 5AJDA 4O60A 3HXDA 1VDYA 5LFAA 2DZOA 3D9LA 3CV0A 3K9IA 4GA0A 3TWQA 1TJFA 3ML9A 2IEJA 2PZIA 4I2WA 4GZ3A 2Y69E 1RZ4A 4G11A 3FTXA 3B7RL 4EZLA 2IJGX 2WXRA 3F6QA 3D9HA 3S7DA 5C2YA 4OAVB 4ILIA 4U96D 4EZJA 1EPUA 4ABNA 1HH8A 3MX3A 3DPYA 3BUAA 2YHEA 1N9AA 3T8MA 1H2VC 1LTXA 1MHQA 3ZW3A 3GZSA 4JA9A 4AVXA 4U04A 4YDOA 3S7BA 2CG2A 4BEPA 2X6FA 4AOFA 2WXIA 3T5XA 4XE0A 3X2QE 3ZVVA 1IYGA 2WXJA 2R59A 1AWCB 2WXNA 4ILHB 3ZGQA 3KAEA 2L6BA 4JHJA 1BLXB 5G05J 3APFA 2AWIA 2AW6A 4HS2A 1LD7A 3RRUA 4LNBA 5B1BE 2V5QC 1JWFA 1JCRA 3G2UA 2L0IA 4KMOA 4NRHB 3CR3A 5BW8C 3GW4A 4YDYA 3NAWA 2XCBA 2CHWA 3Q7FA 4FHJA 4BSZB 3EHMA 4CRWA 4CZ2D 2WM9A 3PEVB 3LS8A 3ABKE 1ELKA 4GMRA 1Z3XA 5J90A 4HQDA 3Q49B 2CG3A 1OWPA 3WG7E 5CHEE 2I2OA 4GA1A 3QNKA 3CKBA 4J6IA 5FQ6A 1N0QA 4HRNA 2XZTG 5G04J 1BPOA 1H6PA 5ENPD 2WVIA 4JC8A 5G05C 4RG6A 3TJPA 4DK5A 5EILA 4EHMA 2ETAA 3KSLA 1W3BA 3CHMA 2XEVA 1JWGA 4G26A 1UN9A 3RO3A 1G3NB 2OCCE 3C3QA 2OOEA 4APOA 3PDNA 2HR2A 4ME2A 1E8WA 4GB9A 2ETBA 3U64A 2P9NG 3ONKA 4G25A 2WXLA 3VLEA 1ZB1A 2PL2A 3FY4A 3HXCA 5CEAA 4U0SA 3Q73A 4LG6A 3FDHA 1NI1A 1TJCA 1LD8A 3I4GA 3SZ7A 3QARA 5FZSA 3MKQB 1HG2A 5B1AE 3N71A 3J5QB 2WXMA 3W9GA 4HRMB 2V5FA 2WXGA 1Y6IA 4J8FA 1N4RA 4A1SA 3DEOA 3DBSA 3SFZA 3DSSA 3RK6A 5BPPA 1SZ9A 2LO6A 3TAXA 4XX5A 5AAOA 3S7FA 4R7LA 3L22A 5G04C 3RAUA 3B7UX 3NOGD 3PE4A 3E32A 5ANRA 4HOSA 2L0TB 5AENA 4DRXE 3ZN3A 3PVLA 5HQ8A 4M3OA 3B7TA 1MQSA 5H7PA 4GAAA 3EJNA 3EU5A 1IKND 2C2LA 2M63A 4BESA 2NXPA 2MYOA 1HG5A 3FTWA 4K0RA 3NZSA 1FVHA 4HBDA 5A6CA 4OYSA 2F0YA 3L08A 3FP3A 1O1SA 5G2NA 2WXKA 3C98A 4Q94A 5FJYA 2X3MA 3C3RA 3FTSA 4BT9A 2QYUA 4K5AB 3ZPJA 3FU5A 2X6KA 3R7RA 3CGHA 1NL4A 4CDNA 4IN3B 4BT8A 4UQZA 1JPLA 3EHQA 3FU6A 3VLDA 3D9IA 5FQ7A 3TWUA 3Q7AA 2I9CA 4HLLA 3NOCD 3ZYMA 4JB8P 4KYOB 3SI5A 3JUEA 2KCKA 3FUFA 1B89A 5LP0A 5AYWD 5D0OD 3BG0B 3CQGB 5CERB 3ZNGA 5HKPA 4DX6D 3D9PA 2F8YA 3CVPA 3J5PA 2IQCA 1YA0A 3L16A 4DX1A 5C1DA 3ZUVB 2DCPA 5A23A 3GYZA 1QYMA 2XEHA 4K03A 1P5QA 3ML8A 3SY2A 3KSQA 1NA3A 3UIPC 2H6GA 3NF1A 3CVWA 4EQFA 4DLQA 4JPSA 2HM8A 2JABA 3E37A 3UKUG 3ABME 3LXUX 4QFVA 5KCMA 2L9BA 5FQ8A 4PS8A 4C9BB 4YNDA 4N3CA 5JHBA 1Q2ZA 1L5JA 3UM0A 2ZISA 5HI7A 1A17A 3RKVA 1O5MA 3AG1E 1N52A 3GZ1A 5CRVA 3WXXA 2KM4A 3EDTB 1S64A 1TNZA 4CT4A 4N39A 4I1AA 5IY5E 5EN5D 3CQCB 3NBNB 1TN8A 4ZHBA 1MJ0A 2PNNA 5FIOA 3BEEA 3ASDA 3MCXA 2LUHA 2YQ8A 5CMYA 4GYOA 1E7UA 1NA0A 5D2MC 3ZU7B 2GROB 3LPZA 2QYJA 3QK0A 4J8DA 4HOUA 2V4LA 5KNGA 4BTAA 1N94A 3D3MA 3FTUA 2KBXA 3E30A 4TXRA 3DXMG 5EX3A 3IHVA 2V8SE 3FUHA 1OT8A 4UWFA 3L6AA 2A5EA 4MLPA 1SA4A 2EIJE 3PS6A 4O1OA 1H6OA 5KJNA 3ZFWA 1KT0A 3PZ3A 2LSUA 4BWRA 4UI9J 4U8VD 5KBAA 1V54E 3JCKC 1N54A 3CVYA 3B13A 3RO2A 4HXIA 4JEHA 4F7AA 3B7SA 2XEEA 1UN8A 3HG0D 3SD5A 3HXFA 4HFGA 4RLYA 5ANLA 2PQRA 3HVEB 1HF8A 4YVQC 4ATGA 4GZ6A 3FTVA 4E6HA 3L54A 4G8KA 2UY1B 1V55E 4I6EA 3TGOA 4G2VA 4G1TA 2NYJA 3L13A 5HS0A 1HZ4A 4I6JA 3ONLA 5FT9A 3CSTA 4UWHA 3ULEG 2EIKE 1FPPA 4BX9A 3JYSA 3UM2A 4BFRA 4XIFA 4DI3A 2Y1LE 2RKKA 1EDUA 3G2VA 2WXPA 4U8YD 2BUGA 3OAWA 2J49A 3IBEA 1H0AA 4Q96A 1O1RA 3S7JA 4AY5A 1X81A 3LYAA 3V30A 4OVUA 2WMNA 4UI9C 4DX5D 4CDRA 4HORA 1OWNA 2Y4UA 4DJAA 4U0ZA 5ENSD 3EIJA 2AJAA 4A55A 1UJJA 3FUEA 5CBOA 2Y0BG 1DVPA 1ZU2A 1XGWA 3D9OA 2RD0A 4EBAG 1K1AA 2IU1A 3EHNA 3LCAA 4GTMA 2PQNA 4U8HA 4EBAA 3L17A 4WWNA 2FEZA 5ENNA 3D9NA 3ABLE 4KVOA 3C72A 4C0EA 3FUDA 4XI0A 1BI8B 1N0RA 3UQ3A 2WQ7A 3HVEA 3VTYA 3O48A 3D9KA 3LEWA 4IYPA 2EINE 1E8XA 2ZXWE 1PY1A 2UY1A 2X38A 3NB2A 1DNPA 4AP2A 1E90A 4CEMA 4QQIA 4FADA 2R17C 2ZGDA 3ASNE 3E34A 2ILRA 2X6HA 3RU0A 5ARGA 3ZYQA 4HOTA 2KC7A 3G2WA 4K5BA 3ZYKA 3D9MA 3UINC 4NACA 2UWJG 2J07A 2B0OE 2P58C 1OWMA 1HE8A 4ACKA 3PUJA 1JCSA 2JEKA 3BQOA 2VSNA 1FT1A 2HYZA 1SW6A 1OXJA 3AG4E 4K5CA 5BV1A 1UW4B 3T9KA 3EIQC 3CVVA 1HFAA 4FU3A 2F37A 2IONA 4EECA 3PZ2A 1TNOA 5FZQA 1U2VG 2V0PA 3PUKA 5KNHD 2FI7A 3ZIMA 2GW1A 3E33A 2L6JA 3EUVA 2ZIRA 5AJLA 5EX0A 2CFUA 4H7YA 1OCZE 3R7QA 4FC8A 1OCCE 3TXNA 3QC1A 1ELRA 4JEUA 3D9JA 3JQ0A 2ONDA 3Q5MA 2R03A 5KWDA 3Q75A 4UWLA 3PREA 1BI7B 3ZHEB 2EQXA 4KT6B 4I17A 4GU5A 5FZRA 1U3CA 3UMVA 2IF4A 2LXMA 2XPIA 3LJ3A 2VSOE 2NSZA 1YMPA 4GMLA 3PE3A 2XQ0A 2J8SD 3G2SA 2WMOA 3MV2B 5ARFA 3I3NA 2P9LG 2MHKA 4U63A 5T8IA 3CHPA 1QNFA 2C0LA 3UT4A 4CYMD 2FBNA 2YINA 4GTOA 3P1UA 3OXLA 4C0MA 4LCTA 3CVNA 1YYHA 3LDZA 1IHBA 1MZCA 3PH0C 4A1GA 2WXOA 3SQVA 3CK8A 3Q4AB 4J7WA 2GRMA 4Y6CA 4C48B 4WUYA 3AU4A 2V4HC 3TWVA 4AY6A 2J09A 4LERA 2YHCA 4TUUA 3CK7A 3FULA 3FWVA 2IOSA 3ZXPA 3SNXA 1K1BA 4GYWA 3SHFA 1JUQA 4BETA 3PEUB 1KT1A 3UM3A 2VJ8A 2JLBA 3ZHEA 2P9SG 3ASOE 4GCNA 4MRUA 1TN7A 2WQHA 4I1MA 5AQ7A 4KBQA 3JUIA 4JL0A 3APDA 4EZKA 1H6KA 4JXTA 3RSEG 2FO1E 2DVWA 3NQPA 4TXQA 3SFXA 4HNAD 3U9WA 4B8AA 1Z6TA 2WB2A 4GMJA 3HXBA 1TR4A 3DXKG 2R02A 1JCQA 4ILGA 5HRYA 4OVVA 4PS3A 3UT8A 4A3TA 4PS7A 3EU9A 4JHKA 4V3IA 1TEZA 2J08A 1TNBA 3AG3E 3ISMC 3DWLG 5FINA 1ZBPA 2OEWA 2DBAA 5ENOD 3E4BA 2XPYA 3UPVA 2XS8A 5JJ7A 3SGHA 5EIDA 1HU3A 1OUVA 3MYVA 1SVXA 1E8ZA 3QKYA 2KZTA 4WNFA 4CGVA 1IXVA 2XRYA 3Q15A 5KJKA 3B7BA 4DX7D 2HE0A 4HVBA 3NZUA 4AM9A 4D10C 4YDWA 1KLXA 1UOHA 5ENRD 2R5SA 4RG9A 4J0UA 4L1BA 4CCAA 2WQ6A 3CVUA 3DSWA 3AS5A 3DRAA 2DZNA 2WPVA 4FULA 4O1PA 4AV7A 4CT0A 4XEIG 1QQEA 2XENA 4XZ4A 5BUZA 5FTPA 3APCA 2F8XK 4Z68A 3CHRA 3V31A 2XGSA 4TUMA
chains in the Genus database with same CATH topology
2PM7A 1ELKA 3FUMA 1Z3XA 3LVQE 5J90A 3S7JA 3Q49B 1H2TC 2VGXB 4JW1A 4AY5A 2CG3A 1OWPA 3LYAA 4OVUA 4ANUA 2WMNA 5CHEE 2I2OA 4GA1A 4UI9C 4CDRA 3QNKA 4L7TA 3CKBA 4J6IA 4HORA 1OWNA 3U66A 5BV0A 2Y4UA 4XKBA 5DIZA 3ENEA 4U0ZA 4DJAA 1XNFA 5FQ6A 3CVXA 4O6FA 2LAIA 3ZEFA 3EIJA 4WNEA 3R9AB 4A55A 1UJJA 3IEGA 3FUEA 1OWOA 5G04J 4FA6A 1BPOA 2WVIA 1QZ2A 5D0QD 1DVPA 4JC8A 1ZU2A 2AXZA 1XGWA 5G05C 4N2QA 4RG6A 3TJPA 3JQ1A 4ANXA 4E85A 3U4TA 4DK5A 3D9OA 1PAQA 2RD0A 4GZDA 3RRNB 3VLFA 4EBAG 1W3BA 4GZCA 4GYYA 2IU1A 2J4DA 3EHNA 3CHMA 3TG4A 2XEVA 2PM6A 3ZYLA 3LCAA 1JWGA 4G26A 3KEZA 4DLOA 1U3DA 1UN9A 1EYHA 4N3AA 3AU5A 3HYMB 3RO3A 2PQNA 3IV0A 4U8HA 4EBAA 2OOEA 3RIBA 4BX8A 4APOA 3L17A 4G23A 4WWNA 5M72A 3PDNA 1H2UA 2FEZA 2HR2A 2HO1A 3HIZA 1E8WA 4ME2A 3CLJA 3CSFA 4F3VA 1PC2A 2WXQA 5ENNA 3D9NA 4GB9A 5BT1A 3U64A 2ZU6B 4KVOA 3ONKA 4C0EA 3FUDA 4G25A 2I1KA 2WXLA 4XI0A 4KVMA 3VLEA 5CCMA 2IFUA 3QB2A 2PL2A 3FY4A 2XCCA 2VQ2A 3UQ3A 2WQ7A 3CVQA 4U0SA 3MKQA 1SQMA 3MEKA 4BTBA 3CVLA 3HVEA 5EDSA 3FDHA 1TJCA 3VTYA 3O48A 4WWPA 3D9KA 3IKOB 4L2YA 3LEWA 4IYPA 3I4GA 2XGOA 3QAQA 2KCLA 1E8XA 3QARA 3SZ7A 1PY1A 2UY1A 2X38A 5FZSA 1DNPA 4B8CB 5FQ4A 2WXHA 4AP2A 1E90A 3MKQB 4CEMA 1HG2A 4N5CA 3QDNA 4FADA 3N71A 5DBKA 2AXVA 4PH4B 2WXMA 4JVSA 2R17C 4GPKA 3CKCA 2V5FA 2WXGA 1Y6IA 3MA5A 4J8FA 4EPZA 4LRZA 4A1SA 2ILRA 2X6HA 3DBSA 3RU0A 5ARGA 3O4ZA 3ZYQA 4HOTA 3CEQA 1S0PA 3SFZA 2KC7A 3RK6A 5LOZA 3G2WA 5BPPA 4F53A 1SZ9A 2LO6A 3MGBA 3TAXA 4XX5A 4AJWA 2A4ZA 3ZYKA 3D9MA 3S7FA 4B89A 2CFZA 4NACA 2UWJG 2J07A 3ASFA 3LVRE 3L22A 4IRUA 4R7LA 5EKQD 4XKCA 5G04C 3SBSA 3RRMB 4J8EA 3KD7A 2P58C 3B7UX 3OXGA 1OWMA 3RJVA 4CGWA 3PE4A 3CHQA 3HHMA 2FULA 5ANRA 5AIJA 1IQRA 1HE8A 3PUJA 4ACKA 4DI4A 4HOSA 3QJZA 2JEKA 3URZA 2L0TB 2VSNA 4NURA 5AENA 3ZN3A 2HYZA 2VGXA 3FUKA 4J8SA 5JHAA 5CCLA 3PVLA 5JJ6A 5HQ8A 4M3OA 5KJMA 3B7TA 2VTBB 3FUNA 5LCWC 1MQSA 2OVBA 4ANWA 4I43A 2Q7FA 3TL5A 5BV1A 4GAAA 1UW4B 3EJNA 4HLEA 3LY8A 2C2LA 4B0ZA 3EIQC 3CVVA 1HFAA 4FU3A 4FHKA 4Y6WA 5T4YA 2IONA 2M63A 4GZ5A 4Q69A 3GZ2A 2XRZA 4GCOA 4L23A 2NXPA 2BUGA 4EECA 2X6JA 2CHZA 3FUJA 2XPZA 1HG5A 5FZQA 4AEZC 4RVBA 3FTWA 4K0RA 2BF0X 3PZDA 2V0PA 2WXFA 4ANVA 3NZSA 1FVHA 3PUKA 5A6CA 2FI7A 4OYSA 1FCHA 3ZIMA 5E76A 2VSYA 5E75A 3L08A 5FWQA 4NQ0A 2DIWA 2GW1A 4AXHA 2OVFA 2L6JA 3DPDA 4TV3A 3ASHA 5AJLA 2AVPA 5CMWA 4I6GA 5EX0A 2CFUA 2VYIA 3LY9A 4H7YA 3FP3A 2MOWA 5G2NA 2A5UA 2WXKA 3C98A 3I4RB 4Q94A 3R7QA 4FC8A 1SZAA 4I2ZA 5FJYA 3P2BA 2GGFA 3TXNA 2X3MA 2X6IA 3QC1A 4FJYA 4KZ0A 3PNLB 3FTSA 1ELRA 1HXIA 3KS2A 2XHEA 4PDXA 4JEUA 4BT9A 3D9JA 3TG5A 3JQ0A 3QWWA 3ZPJA 2ONDA 4WAFA 3FU5A 2X6KA 3Q5MA 1H19A 3R7RA 4UWLA 2VGYA 3PREA 4WNGA 3CGHA 3FEYA 4CDNA 4IN3B 4TRQA 5LCWJ 3ZHEB 4BT8A 4UQZA 1JPLA 3CHSA 3FU6A 2Y4TA 3VLDA 2EQXA 3D9IA 4URKA 5FQ7A 2I9CA 4KT6B 3ZYMA 2J9QA 4I17A 4GU5A 4P29A 3PRZA 5FZRA 1U3CA 4KYOB 4LUNU 3FUIA 3SI5A 3S2AA 3UMVA 2IF4A 4H7XA 2XPIA 2KCKA 1IQUA 3FUFA 3OAWA 3QWVA 4I9CA 3LJ3A 1B89A 2VSOE 4W9RA 5AYWD 5LP0A 2NSZA 4GMLA 3PE3A 3UX4A 5D0OD 1UG3A 3BG0B 2XQ0A 3CQGB 3PNTB 3ESLA 3G2SA 1IHGA 3CHOA 2FO7A 2WMOA 3SF4A 3MV2B 5ARFA 4FLBA 4I9EA 1NP7A 3I3NA 2YNQA 3D9PA 3MV3B 1INZA 3CVPA 2MHKA 2BTDA 3U3WA 4U63A 5T8IA 3CHPA 1QNFA 2C0LA 3UT4A 4UWGA 2AXUA 1YA0A 2IQCA 2FBNA 3L16A 5C1DA 4FLHA 4WWOA 3SBTB 4BSXA 2YINA 3AS8A 3MJWA 4GA2A 4JA7A 3LKUA 3P1UA 3OXLA 4MKTA 4C0MA 4LCTA 2DCPA 3CVNA 5A23A 3GYZA 3OTNA 1E8YA 3LDZA 3UT7A 4K03A 1EF1C 1P5QA 3ML8A 4AIFA 3G2TA 4N2SA 5A7DB 3FHEA 4HOQA 1NA3A 2OV8A 1Z3YA 2NC9A 1ELWA 3QOUA 3VTXA 3QWPA 3NF1A 2Y3AA 3T5VA 3ZXSA 4EQFA 3FEXA 3PH0C 4U0UA 4A1GA 3CVWA 5J08A 4DLQA 1E96B 3ULQA 4JPSA 2HM8A 4UQYA 2VTBA 2WXOA 3FFLA 4UI9K 3LXUX 2VSXE 4QFVA 4IULA 3CK8A 4U07A 1WM5A 3Q4AB 5KCMA 3OXFA 5JJTA 4ACLA 2GRLA 1Y8MA 4A3VA 3MKRA 2L9BA 5FQ8A 4PS8A 2C0MA 4C9BB 3IHYA 4FJZA 3FH5A 4I1OB 2GRMA 1OWLA 4Y6CA 3FH7A 4YNDA 4N3CA 2CHXA 4LEUA 4WUYA 5JHBA 3AU4A 1L5JA 1HS6A 2MRIA 5HI7A 1A17A 2FF4A 3RKVA 4AY6A 5AJDA 2J09A 4LERA 4B94A 2YHCA 3ASGA 1N52A 3GZ1A 4TUUA 3WXXA 3CK7A 3FULA 2KM4A 3EDTB 3FWVA 2IOSA 5KJLA 3ESKA 1VDYA 4CT4A 1HO8A 4N39A 5LFAA 4I1AA 3D9LA 3CV0A 3SNXA 3K9IA 4GYWA 3SHFA 1JUQA 3CQCB 4GA0A 3PEUB 1KT1A 4L2LA 1UJKA 1TJFA 3ML9A 4XI9A 2PZIA 3BEEA 4I2WA 2VJ8A 4GZ3A 2JLBA 3ZHEA 3ASDA 3Q47B 3MCXA 4G11A 2YQ8A 4MS6A 5CMYA 3FTXA 3B7RL 4GYOA 4JZYA 3FU0A 1E7UA 4APFA 4GCNA 1NA0A 4EZLA 4MRUA 2I1JA 2WQHA 2IJGX 4I1MA 4KBQA 3JUIA 2WXRA 1HX8A 4JL0A 3APDA 1WY6A 3LPZA 3S7DA 1E7VA 3QK0A 4J8DA 4EZKA 5C2YA 1H6KA 4JXTA 4HOUA 2V4LA 4ILIA 4BTAA 1GW6A 3D3MA 3NQPA 3FTUA 1EPUA 4ABNA 4EZJA 3U9WA 4B8AA 1Z6TA 1HH8A 5EX3A 3MX3A 2WB2A 5BNWA 3IHVA 2V8SE 2J4BA 3FUHA 4GMJA 5T3RA 3FTYA 4UWFA 3FTZA 2QFCA 2YHEA 3L6AA 3T8MA 1H2VC 1MHQA 4ILGA 3ZW3A 4DPRA 4MLPA 4OVVA 2KCVA 3GZSA 3FU3A 4JA9A 4AVXA 4PS3A 4U04A 3UT8A 3PS6A 4PUCA 2E2EA 4A3TA 4PS7A 4N3BA 3S7BA 5KJNA 2QY7A 2CG2A 3ZFWA 4JHKA 1KT0A 4V3IA 3TXMA 1TEZA 2LNIA 2LSUA 4UWKA 4BWRA 2X6FA 4UI9J 3UUXA 4AOFA 4KZCA 2J08A 2WXIA 3T5XA 4XE0A 3ZVVA 1IYGA 2WXJA 3JCKC 2R59A 2WXNA 4ILHB 1N54A 3ZGQA 3B13A 3KAEA 3RO2A 1ZBPA 4HXIA 3CVYA 4JHJA 1X5BA 2DBAA 2IOLA 4JEHA 4G24A 4F7AA 3B7SA 4F1SA 1UN8A 3E4BA 5G05J 2XPYA 3UPVA 1LF8A 3APFA 3FH8A 3SD5A 2AWIA 2AW6A 5JJ7A 3SGHA 4HFGA 4HS2A 3LY7A 5ANLA 2PQRA 3HVEB 1HF8A 4RSYA 4YVQC 4ATGA 1HU3A 1OUVA 4GZ6A 3MYVA 3FTVA 3RRUA 4UQXA 1NZNA 4WNDA 4E6HA 3L54A 3QKYA 1E8ZA 1FVFA 1WAO1 2KZTA 4YVOA 4WNFA 2UY1B 4I6EA 3TGOA 4CGVA 4G2VA 4G1TA 2XRYA 1JWFA 3L13A 3Q15A 4JHRA 5KJKA 5G55A 3CIAA 1HZ4A 2LSVA 4FP7A 3G2UA 2L0IA 4KMOA 4HVBA 4KXKB 4CDMA 3NZUA 4AM9A 4D10C 2XGMA 4NRHB 4I6JA 1KLXA 3ONLA 2R5SA 3CR3A 2RG8A 5FT9A 4RG9A 3HDXA 4J0UA 2KZTB 5BW8C 3CSTA 3CK9A 4L1BA 3GW4A 4CCAA 4UWHA 2WQ6A 3CVUA 5LX8A 2KATA 3AS5A 3ZRHA 3MZLB 2WPVA 2XCBA 4FULA 2E0IA 2CHWA 2LAHA 4BY6A 4BX9A 3JYSA 4BFRA 4AV7A 3BG1B 2I6HA 4FHJA 4XIFA 4CT0A 3AS4A 4DI3A 1QQEA 4XZ4A 3EHMA 5BUZA 5FTPA 3APCA 2WM9A 4CRWA 3PEVB 3CHRA 1EDUA 3G2VA 3I5PA 3LS8A 2WXPA 2XGSA 2J49A 3IBEA 1H0AA 4Q96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7J A;  3Q49 B;  2VGX B;  4AY5 A;  3LYA A;  5CHE E;  4UI9 C;  4GA1 A;  4CDR A;  3CKB A;  4HOR A;  2Y4U A;  5DIZ A;  4U0Z A;  1XNF A;  4O6F A;  4WNE A;  3IEG A;  5G04 J;  5D0Q D;  1QZ2 A;  1ZU2 A;  5G05 C;  4N2Q A;  4RG6 A;  3U4T A;  1W3B A;  4GYY A;  3TG4 A;  2XEV A;  3LCA A;  4G26 A;  4N3A A;  3HYM B;  3RO3 A;  2PQN A;  2OOE A;  3RIB A;  4APO A;  4G23 A;  5M72 A;  3PDN A;  2HR2 A;  2FEZ A;  2HO1 A;  4ME2 A;  4F3V A;  1PC2 A;  5BT1 A;  4G25 A;  4XI0 A;  5CCM A;  2IFU A;  2PL2 A;  2XCC A;  2VQ2 A;  3UQ3 A;  3CVQ A;  4U0S A;  3MEK A;  4BTB A;  3CVL A;  1TJC A;  3VTY A;  3O48 A;  2XGO A;  2KCL A;  3SZ7 A;  2UY1 A;  5FZS A;  4N5C A;  3QDN A;  3N71 A;  5DBK A;  4GPK A;  3CKC A;  2V5F A;  3MA5 A;  4J8F A;  4A1S A;  3RU0 A;  5ARG A;  4HOT A;  3CEQ A;  2KC7 A;  3TAX A;  3S7F A;  2UWJ G;  3ASF A;  5G04 C;  5EKQ D;  4J8E A;  3KD7 A;  2P58 C;  3OXG A;  3RJV A;  4CGW A;  3PE4 A;  4HOS A;  3URZ A;  2VSN A;  3ZN3 A;  2HYZ A;  2VGX A;  5CCL A;  5JJ6 A;  5HQ8 A;  5KJM A;  5LCW C;  2Q7F A;  3LY8 A;  2C2L A;  4Y6W A;  4GZ5 A;  3GZ2 A;  4GCO A;  5FZQ A;  5A6C A;  2FI7 A;  1FCH A;  2VSY A;  4NQ0 A;  2GW1 A;  2L6J A;  3ASH A;  2AVP A;  5EX0 A;  2VYI A;  3LY9 A;  4H7Y A;  3R9A B;  3FP3 A;  4I2Z A;  5FJY A;  1ELR A;  1HXI A;  3KS2 A;  4BT9 A;  3TG5 A;  3QWW A;  3ZPJ A;  2OND A;  3Q5M A;  2VGY A;  4WNG A;  4IN3 B;  5LCW J;  3ZHE B;  4BT8 A;  4UQZ A;  2Y4T A;  2J9Q A;  4I17 A;  5FZR A;  4KYO B;  2IF4 A;  4H7X A;  2XPI A;  2KCK A;  4W9R A;  3QWV A;  4I9C A;  1B89 A;  5AYW D;  3PE3 A;  5D0O D;  1IHG A;  2FO7 A;  3SF4 A;  3MV2 B;  5ARF A;  4I9E A;  3MV3 B;  3CVP A;  2MHK A;  3U3W A;  2C0L A;  1YA0 A;  2FBN A;  5C1D A;  3AS8 A;  4GA2 A;  4JA7 A;  3LKU A;  3OXL A;  3CVN A;  3GYZ A;  1P5Q A;  4AIF A;  4N2S A;  5A7D B;  4HOQ A;  1NA3 A;  2NC9 A;  1ELW A;  3QOU A;  3VTX A;  3QWP A;  3NF1 A;  4EQF A;  4U0U A;  1E96 B;  3ULQ A;  4UQY A;  3FFL A;  4UI9 K;  4U07 A;  3CK8 A;  1WM5 A;  3Q4A B;  3OXF A;  5JJT A;  1Y8M A;  3MKR A;  2C0M A;  4Y6C A;  4YND A;  4N3C A;  4LEU A;  4WUY A;  5HI7 A;  1A17 A;  2FF4 A;  3RKV A;  4AY6 A;  4B94 A;  2YHC A;  3ASG A;  3GZ1 A;  3WXX A;  3CK7 A;  3EDT B;  3FWV A;  5KJL A;  3ESK A;  4N39 A;  4I1A A;  3CV0 A;  3K9I A;  4GYW A;  4GA0 A;  1KT1 A;  4XI9 A;  2PZI A;  3BEE A;  4I2W A;  4GZ3 A;  2JLB A;  3ZHE A;  3ASD A;  3Q47 B;  2YQ8 A;  4GYO A;  4GCN A;  1NA0 A;  2WQH A;  4KBQ A;  4JL0 A;  3S7D A;  3LPZ A;  4J8D A;  4HOU A;  4BTA A;  4ABN A;  1HH8 A;  5EX3 A;  5BNW A;  2QFC A;  2KCV A;  4JA9 A;  4U04 A;  2E2E A;  4N3B A;  3S7B A;  5KJN A;  3ZFW A;  1KT0 A;  2LNI A;  2LSU A;  4BWR A;  4UI9 J;  3UUX A;  1IYG A;  3ZGQ A;  3KAE A;  3RO2 A;  1ZBP A;  2DBA A;  4G24 A;  3E4B A;  5G05 J;  3UPV A;  5JJ7 A;  3LY7 A;  2PQR A;  4YVQ C;  4GZ6 A;  1OUV A;  4UQX A;  1NZN A;  4WND A;  3QKY A;  1WAO 1;  4YVO A;  4WNF A;  2UY1 B;  3TGO A;  4CGV A;  4G2V A;  4G1T A;  3Q15 A;  4JHR A;  5KJK A;  1HZ4 A;  2LSV A;  4KXK B;  4AM9 A;  2XGM A;  4NRH B;  1KLX A;  2R5S A;  5FT9 A;  4RG9 A;  4J0U A;  5BW8 C;  3CK9 A;  3GW4 A;  2KAT A;  3AS5 A;  2WPV A;  2XCB A;  3JYS A;  2I6H A;  4XIF A;  3AS4 A;  1QQE A;  5FTP A;  2XGS A;  2BUG A; 
#chains in the Genus database with same CATH topology
 3C5R A;  3L9T A;  1H2T C;  4ANU A;  2P9P G;  4YDE A;  5EIB E;  2IO2 C;  4XKB A;  1XNF A;  1OCR E;  4O6F A;  2LAI A;  2RFM A;  3ZEF A;  4LNG A;  1OWO A;  3LJN A;  2AXZ A;  4N2Q A;  1KPS B;  1N4P A;  1Z5S C;  4ANX A;  1TYQ G;  5BXU A;  3U4T A;  3RRN B;  4GZD A;  3VLF A;  4GYY A;  4GTR A;  3TWS A;  3UXG A;  3ZYL A;  4GTP A;  4DLO A;  1U3D A;  3HYM B;  3IV0 A;  2DYS E;  3RIB A;  4A63 B;  3V79 K;  2KXP C;  5M72 A;  1H2U A;  4U7E B;  2HO1 A;  3TWR A;  3CSF A;  4F3V A;  2ZU6 B;  3BU8 A;  2I1K A;  4KVM A;  5CCM A;  1TNU A;  2VQ2 A;  4DUI A;  1SQM A;  3MEK A;  3CVL A;  4HI9 A;  5EDS A;  4WWP A;  2LXL A;  1MX2 A;  2QZA A;  3QAQ A;  1BD8 A;  2WXH A;  3QDN A;  5DBK A;  2AXV A;  4PH4 B;  3DSU A;  4JVS A;  4GPK A;  1K8K G;  3MA5 A;  4EPZ A;  4LRZ A;  3CEQ A;  1TNY A;  1N95 A;  3EHR A;  1KZO A;  4BER A;  2A4Z A;  2GRR B;  4B89 A;  2CFZ A;  3LVR E;  4IRU A;  5EKQ D;  3SBS A;  3RRM B;  2XS1 A;  3RJV A;  2FUL A;  5AIJ A;  1IQR A;  3QJZ A;  4X8Q A;  3URZ A;  4NUR A;  3AAA C;  5LCW C;  4ANW A;  3SFY A;  5CED B;  2Q7F A;  3LY8 A;  3DSX A;  4FHK A;  5T4Y A;  4Q69 A;  2XRZ A;  4GCO A;  2X6J A;  3FUJ A;  2XPZ A;  4AEZ C;  4RVB A;  1MX4 A;  2P9I G;  2BF0 X;  2WXF A;  4ANV A;  1FCH A;  4B93 B;  5E75 A;  2OVF A;  1D9S A;  3DPD A;  4TV3 A;  5CMW A;  4I6G A;  2VYI A;  3LY9 A;  3Q79 A;  4KZ0 A;  3PNL B;  3AG2 E;  3KS2 A;  3TG5 A;  4U95 D;  3QWW A;  4WAF A;  4F1P A;  2H6F A;  1H19 A;  2VGY A;  3TWX A;  4TRQ A;  3AJI A;  4URK A;  2J9Q A;  4P29 A;  3PRZ A;  4LUN U;  3FUI A;  4H7X A;  1IQU A;  4I9C A;  1WG0 A;  2EIM E;  3DEP A;  3UX4 A;  2P9K G;  1UG3 A;  3PNT B;  1N4S A;  2H6I A;  3DST A;  2FO7 A;  3SF4 A;  4I9E A;  2YNQ A;  5ITZ F;  1INZ A;  4UWG A;  4F6R D;  4FLH A;  4WWO A;  3SBT B;  4BSX A;  3MJW A;  1MX6 A;  3LKU A;  5JA4 D;  4MKT A;  2P2C P;  1N4Q A;  3OTN A;  3SO8 A;  4GPM A;  2DWZ A;  5A7D B;  3FHE A;  2OV8 A;  1Z3Y A;  1ELW A;  3QOU A;  3QWP A;  3T5V A;  3ZXS A;  3FEX A;  4U0U A;  3ULQ A;  4UQY A;  3FFL A;  4U07 A;  1TN6 A;  5JJT A;  4ACL A;  2GRL A;  5EYL A;  2C0M A;  3IHY A;  4I1O B;  2CHX A;  4LEU A;  2IO3 C;  4ZFH A;  1AP7 A;  2MRI A;  5CBN A;  2FF4 A;  4B94 A;  3ASG A;  1RW2 A;  5KJL A;  3ESK A;  1HO8 A;  1KZP A;  2XZD G;  4DX2 A;  1WDY A;  4L2L A;  1UJK A;  4XI9 A;  4TXP A;  3Q47 B;  4MS6 A;  4JZY A;  3FU0 A;  3C3O A;  4APF A;  3W9F A;  3JXI A;  2I1J A;  1YCS B;  1HX8 A;  1WY6 A;  1E7V A;  1GW6 A;  4N5Q A;  1S70 B;  4GTT A;  5BNW A;  2ZGG A;  5T3R A;  2J4B A;  3B95 A;  3FTY A;  3FTZ A;  2QFC A;  4DPR A;  2KCV A;  3FU3 A;  4PUC A;  2E2E A;  3L82 A;  4N3B A;  2QY7 A;  3TXM A;  2LNI A;  4UWK A;  4ATZ D;  3UUX A;  4KZC A;  1K3Z D;  5AAR A;  2EIL E;  1SA5 A;  1X5B A;  2IOL A;  2R05 A;  4G24 A;  1MYO A;  4F1S A;  4M7C A;  1LF8 A;  3FH8 A;  5AN8 A;  4NIK A;  4UUC A;  3LY7 A;  4RSY A;  1OY3 D;  3ULY A;  2BKK B;  1NZN A;  1OCO E;  4UQX A;  4WND A;  1FVF A;  1WAO 1;  4YVO A;  4GTS A;  4JHR A;  5G55 A;  3CIA A;  2LSV A;  4FP7 A;  4KXK B;  4CDM A;  2XGM A;  2RG8 A;  1N11 A;  3HDX A;  2KZT B;  3CK9 A;  5LX8 A;  2KAT A;  3ZRH A;  4GTQ A;  3MZL B;  2E0I A;  4HI8 A;  2LAH A;  4BY6 A;  3IXE A;  3BG1 B;  2I6H A;  3AS4 A;  3I5P A;  2PM7 A;  3FUM A;  3LVQ E;  5ENQ D;  2VGX B;  4JW1 A;  4HB5 A;  4L7T A;  3PZ4 A;  3U66 A;  2H6H A;  5AQ9 A;  5BV0 A;  5DIZ A;  3ENE A;  3CVX A;  4WNE A;  3IEG A;  4FA6 A;  3TWT A;  4GTV A;  1QZ2 A;  5D0Q D;  2ETC A;  2GRP B;  1A5E A;  3JQ1 A;  4E85 A;  1PAQ A;  4RQI A;  4GZC A;  3UI2 A;  3V2X A;  2J4D A;  3TG4 A;  2PM6 A;  3KEZ A;  2BED A;  1EYH A;  1D8D A;  4N3A A;  3AU5 A;  4BX8 A;  1DC2 A;  4G23 A;  3HIZ A;  3CLJ A;  1PC2 A;  2WXQ A;  5BT1 A;  2IFU A;  3QB2 A;  2XCC A;  5ENT D;  3CVQ A;  3MKQ A;  4BTB A;  2R2L A;  4HRL A;  2P9U G;  3IKO B;  4L2Y A;  2XGO A;  2KCL A;  1DCE A;  5D66 A;  4B8C B;  1DCQ A;  5FQ4 A;  3JXJ A;  4N5C A;  4JD2 G;  1NFI E;  3CKC A;  5EYP F;  1O1T A;  4G8L A;  3O4Z A;  2GRQ B;  1S0P A;  5LOZ A;  3UIO C;  4F53 A;  3MGB A;  4AJW A;  2RFA A;  2GRN B;  3ASF A;  1S63 A;  2B6C A;  4XKC A;  4J8E A;  3KD7 A;  3OXG A;  2OEV A;  4CGW A;  3CHQ A;  3HHM A;  4LSZ E;  3TWW A;  3HXE A;  4DI4 A;  4J8S A;  2VGX A;  3FUK A;  5JHA A;  3Q9U C;  5CEC B;  5CCL A;  5JJ6 A;  5KJM A;  2QC9 A;  2VTB B;  3FUN A;  4OAU C;  2OVB A;  4I43 A;  3TL5 A;  4HLE A;  3PZ1 A;  4B0Z A;  3T8K A;  4Y6W A;  4GZ5 A;  3GZ2 A;  4L23 A;  2DYR E;  2CHZ A;  3UTM A;  3PZD A;  5E76 A;  2VSY A;  5FWQ A;  4NQ0 A;  4L9P A;  4MBG A;  2DIW A;  4AXH A;  3ASH A;  5BXO A;  4J8Y A;  2AVP A;  3R9A B;  2MOW A;  2A5U A;  3I4R B;  1SZA A;  4I2Z A;  3P2B A;  2GGF A;  5B3S E;  2X6I A;  4FJY A;  1HXI A;  2XHE A;  4PDX A;  4WNG A;  3FEY A;  5LCW J;  4LNU D;  3CHS A;  2Y4T A;  3S2A A;  4W9R A;  3QWV A;  3V2O A;  5AQB A;  3ESL A;  5CRU A;  1IHG A;  3CHO A;  4FLB A;  1NP7 A;  3MV3 B;  3U3W A;  2BTD A;  3KEA A;  2AXU A;  3UM1 A;  5AQA A;  3AS8 A;  3UKR G;  4GA2 A;  4JA7 A;  3Q78 A;  3DSV A;  1QBQ A;  1E8Y A;  1D8E A;  3UT7 A;  1EF1 C;  4AIF A;  3G2T A;  4N2S A;  2IY0 C;  4HOQ A;  2NC9 A;  3VTX A;  2Y3A A;  5J08 A;  1E96 B;  2VGE A;  2VTB A;  4UI9 K;  2VSX E;  4IUL A;  1WM5 A;  3OXF A;  4A3V A;  1Y8M A;  3MKR A;  5JMN D;  3R9M A;  3HRA A;  3FH5 A;  4FJZ A;  1OWL A;  3FH7 A;  3Q9N C;  1BU9 A;  1FT2 A;  3ZKJ A;  1HS6 A;  2BKG A;  5AJD A;  4O60 A;  3HXD A;  1VDY A;  5LFA A;  2DZO A;  3D9L A;  3CV0 A;  3K9I A;  4GA0 A;  3TWQ A;  1TJF A;  3ML9 A;  2IEJ A;  2PZI A;  4I2W A;  4GZ3 A;  2Y69 E;  1RZ4 A;  4G11 A;  3FTX A;  3B7R L;  4EZL A;  2IJG X;  2WXR A;  3F6Q A;  3D9H A;  3S7D A;  5C2Y A;  4OAV B;  4ILI A;  4U96 D;  4EZJ A;  1EPU A;  4ABN A;  1HH8 A;  3MX3 A;  3DPY A;  3BUA A;  2YHE A;  1N9A A;  3T8M A;  1H2V C;  1LTX A;  1MHQ A;  3ZW3 A;  3GZS A;  4JA9 A;  4AVX A;  4U04 A;  4YDO A;  3S7B A;  2CG2 A;  4BEP A;  2X6F A;  4AOF A;  2WXI A;  3T5X A;  4XE0 A;  3X2Q E;  3ZVV A;  1IYG A;  2WXJ A;  2R59 A;  1AWC B;  2WXN A;  4ILH B;  3ZGQ A;  3KAE A;  2L6B A;  4JHJ A;  1BLX B;  5G05 J;  3APF A;  2AWI A;  2AW6 A;  4HS2 A;  1LD7 A;  3RRU A;  4LNB A;  5B1B E;  2V5Q C;  1JWF A;  1JCR A;  3G2U A;  2L0I A;  4KMO A;  4NRH B;  3CR3 A;  5BW8 C;  3GW4 A;  4YDY A;  3NAW A;  2XCB A;  2CHW A;  3Q7F A;  4FHJ A;  4BSZ B;  3EHM A;  4CRW A;  4CZ2 D;  2WM9 A;  3PEV B;  3LS8 A;  3ABK E;  1ELK A;  4GMR A;  1Z3X A;  5J90 A;  4HQD A;  3Q49 B;  2CG3 A;  1OWP A;  3WG7 E;  5CHE E;  2I2O A;  4GA1 A;  3QNK A;  3CKB A;  4J6I A;  5FQ6 A;  1N0Q A;  4HRN A;  2XZT G;  5G04 J;  1BPO A;  1H6P A;  5ENP D;  2WVI A;  4JC8 A;  5G05 C;  4RG6 A;  3TJP A;  4DK5 A;  5EIL A;  4EHM A;  2ETA A;  3KSL A;  1W3B A;  3CHM A;  2XEV A;  1JWG A;  4G26 A;  1UN9 A;  3RO3 A;  1G3N B;  2OCC E;  3C3Q A;  2OOE A;  4APO A;  3PDN A;  2HR2 A;  4ME2 A;  1E8W A;  4GB9 A;  2ETB A;  3U64 A;  2P9N G;  3ONK A;  4G25 A;  2WXL A;  3VLE A;  1ZB1 A;  2PL2 A;  3FY4 A;  3HXC A;  5CEA A;  4U0S A;  3Q73 A;  4LG6 A;  3FDH A;  1NI1 A;  1TJC A;  1LD8 A;  3I4G A;  3SZ7 A;  3QAR A;  5FZS A;  3MKQ B;  1HG2 A;  5B1A E;  3N71 A;  3J5Q B;  2WXM A;  3W9G A;  4HRM B;  2V5F A;  2WXG A;  1Y6I A;  4J8F A;  1N4R A;  4A1S A;  3DEO A;  3DBS A;  3SFZ A;  3DSS A;  3RK6 A;  5BPP A;  1SZ9 A;  2LO6 A;  3TAX A;  4XX5 A;  5AAO A;  3S7F A;  4R7L A;  3L22 A;  5G04 C;  3RAU A;  3B7U X;  3NOG D;  3PE4 A;  3E32 A;  5ANR A;  4HOS A;  2L0T B;  5AEN A;  4DRX E;  3ZN3 A;  3PVL A;  5HQ8 A;  4M3O A;  3B7T A;  1MQS A;  5H7P A;  4GAA A;  3EJN A;  3EU5 A;  1IKN D;  2C2L A;  2M63 A;  4BES A;  2NXP A;  2MYO A;  1HG5 A;  3FTW A;  4K0R A;  3NZS A;  1FVH A;  4HBD A;  5A6C A;  4OYS A;  2F0Y A;  3L08 A;  3FP3 A;  1O1S A;  5G2N A;  2WXK A;  3C98 A;  4Q94 A;  5FJY A;  2X3M A;  3C3R A;  3FTS A;  4BT9 A;  2QYU A;  4K5A B;  3ZPJ A;  3FU5 A;  2X6K A;  3R7R A;  3CGH A;  1NL4 A;  4CDN A;  4IN3 B;  4BT8 A;  4UQZ A;  1JPL A;  3EHQ A;  3FU6 A;  3VLD A;  3D9I A;  5FQ7 A;  3TWU A;  3Q7A A;  2I9C A;  4HLL A;  3NOC D;  3ZYM A;  4JB8 P;  4KYO B;  3SI5 A;  3JUE A;  2KCK A;  3FUF A;  1B89 A;  5LP0 A;  5AYW D;  5D0O D;  3BG0 B;  3CQG B;  5CER B;  3ZNG A;  5HKP A;  4DX6 D;  3D9P A;  2F8Y A;  3CVP A;  3J5P A;  2IQC A;  1YA0 A;  3L16 A;  4DX1 A;  5C1D A;  3ZUV B;  2DCP A;  5A23 A;  3GYZ A;  1QYM A;  2XEH A;  4K03 A;  1P5Q A;  3ML8 A;  3SY2 A;  3KSQ A;  1NA3 A;  3UIP C;  2H6G A;  3NF1 A;  3CVW A;  4EQF A;  4DLQ A;  4JPS A;  2HM8 A;  2JAB A;  3E37 A;  3UKU G;  3ABM E;  3LXU X;  4QFV A;  5KCM A;  2L9B A;  5FQ8 A;  4PS8 A;  4C9B B;  4YND A;  4N3C A;  5JHB A;  1Q2Z A;  1L5J A;  3UM0 A;  2ZIS A;  5HI7 A;  1A17 A;  3RKV A;  1O5M A;  3AG1 E;  1N52 A;  3GZ1 A;  5CRV A;  3WXX A;  2KM4 A;  3EDT B;  1S64 A;  1TNZ A;  4CT4 A;  4N39 A;  4I1A A;  5IY5 E;  5EN5 D;  3CQC B;  3NBN B;  1TN8 A;  4ZHB A;  1MJ0 A;  2PNN A;  5FIO A;  3BEE A;  3ASD A;  3MCX A;  2LUH A;  2YQ8 A;  5CMY A;  4GYO A;  1E7U A;  1NA0 A;  5D2M C;  3ZU7 B;  2GRO B;  3LPZ A;  2QYJ A;  3QK0 A;  4J8D A;  4HOU A;  2V4L A;  5KNG A;  4BTA A;  1N94 A;  3D3M A;  3FTU A;  2KBX A;  3E30 A;  4TXR A;  3DXM G;  5EX3 A;  3IHV A;  2V8S E;  3FUH A;  1OT8 A;  4UWF A;  3L6A A;  2A5E A;  4MLP A;  1SA4 A;  2EIJ E;  3PS6 A;  4O1O A;  1H6O A;  5KJN A;  3ZFW A;  1KT0 A;  3PZ3 A;  2LSU A;  4BWR A;  4UI9 J;  4U8V D;  5KBA A;  1V54 E;  3JCK C;  1N54 A;  3CVY A;  3B13 A;  3RO2 A;  4HXI A;  4JEH A;  4F7A A;  3B7S A;  2XEE A;  1UN8 A;  3HG0 D;  3SD5 A;  3HXF A;  4HFG A;  4RLY A;  5ANL A;  2PQR A;  3HVE B;  1HF8 A;  4YVQ C;  4ATG A;  4GZ6 A;  3FTV A;  4E6H A;  3L54 A;  4G8K A;  2UY1 B;  1V55 E;  4I6E A;  3TGO A;  4G2V A;  4G1T A;  2NYJ A;  3L13 A;  5HS0 A;  1HZ4 A;  4I6J A;  3ONL A;  5FT9 A;  3CST A;  4UWH A;  3ULE G;  2EIK E;  1FPP A;  4BX9 A;  3JYS A;  3UM2 A;  4BFR A;  4XIF A;  4DI3 A;  2Y1L E;  2RKK A;  1EDU A;  3G2V A;  2WXP A;  4U8Y D;  2BUG A;  3OAW A;  2J49 A;  3IBE A;  1H0A A;  4Q96 A;  1O1R A;  3S7J A;  4AY5 A;  1X81 A;  3LYA A;  3V30 A;  4OVU A;  2WMN A;  4UI9 C;  4DX5 D;  4CDR A;  4HOR A;  1OWN A;  2Y4U A;  4DJA A;  4U0Z A;  5ENS D;  3EIJ A;  2AJA A;  4A55 A;  1UJJ A;  3FUE A;  5CBO A;  2Y0B G;  1DVP A;  1ZU2 A;  1XGW A;  3D9O A;  2RD0 A;  4EBA G;  1K1A A;  2IU1 A;  3EHN A;  3LCA A;  4GTM A;  2PQN A;  4U8H A;  4EBA A;  3L17 A;  4WWN A;  2FEZ A;  5ENN A;  3D9N A;  3ABL E;  4KVO A;  3C72 A;  4C0E A;  3FUD A;  4XI0 A;  1BI8 B;  1N0R A;  3UQ3 A;  2WQ7 A;  3HVE A;  3VTY A;  3O48 A;  3D9K A;  3LEW A;  4IYP A;  2EIN E;  1E8X A;  2ZXW E;  1PY1 A;  2UY1 A;  2X38 A;  3NB2 A;  1DNP A;  4AP2 A;  1E90 A;  4CEM A;  4QQI A;  4FAD A;  2R17 C;  2ZGD A;  3ASN E;  3E34 A;  2ILR A;  2X6H A;  3RU0 A;  5ARG A;  3ZYQ A;  4HOT A;  2KC7 A;  3G2W A;  4K5B A;  3ZYK A;  3D9M A;  3UIN C;  4NAC A;  2UWJ G;  2J07 A;  2B0O E;  2P58 C;  1OWM A;  1HE8 A;  4ACK A;  3PUJ A;  1JCS A;  2JEK A;  3BQO A;  2VSN A;  1FT1 A;  2HYZ A;  1SW6 A;  1OXJ A;  3AG4 E;  4K5C A;  5BV1 A;  1UW4 B;  3T9K A;  3EIQ C;  3CVV A;  1HFA A;  4FU3 A;  2F37 A;  2ION A;  4EEC A;  3PZ2 A;  1TNO A;  5FZQ A;  1U2V G;  2V0P A;  3PUK A;  5KNH D;  2FI7 A;  3ZIM A;  2GW1 A;  3E33 A;  2L6J A;  3EUV A;  2ZIR A;  5AJL A;  5EX0 A;  2CFU A;  4H7Y A;  1OCZ E;  3R7Q A;  4FC8 A;  1OCC E;  3TXN A;  3QC1 A;  1ELR A;  4JEU A;  3D9J A;  3JQ0 A;  2OND A;  3Q5M A;  2R03 A;  5KWD A;  3Q75 A;  4UWL A;  3PRE A;  1BI7 B;  3ZHE B;  2EQX A;  4KT6 B;  4I17 A;  4GU5 A;  5FZR A;  1U3C A;  3UMV A;  2IF4 A;  2LXM A;  2XPI A;  3LJ3 A;  2VSO E;  2NSZ A;  1YMP A;  4GML A;  3PE3 A;  2XQ0 A;  2J8S D;  3G2S A;  2WMO A;  3MV2 B;  5ARF A;  3I3N A;  2P9L G;  2MHK A;  4U63 A;  5T8I A;  3CHP A;  1QNF A;  2C0L A;  3UT4 A;  4CYM D;  2FBN A;  2YIN A;  4GTO A;  3P1U A;  3OXL A;  4C0M A;  4LCT A;  3CVN A;  1YYH A;  3LDZ A;  1IHB A;  1MZC A;  3PH0 C;  4A1G A;  2WXO A;  3SQV A;  3CK8 A;  3Q4A B;  4J7W A;  2GRM A;  4Y6C A;  4C48 B;  4WUY A;  3AU4 A;  2V4H C;  3TWV A;  4AY6 A;  2J09 A;  4LER A;  2YHC A;  4TUU A;  3CK7 A;  3FUL A;  3FWV A;  2IOS A;  3ZXP A;  3SNX A;  1K1B A;  4GYW A;  3SHF A;  1JUQ A;  4BET A;  3PEU B;  1KT1 A;  3UM3 A;  2VJ8 A;  2JLB A;  3ZHE A;  2P9S G;  3ASO E;  4GCN A;  4MRU A;  1TN7 A;  2WQH A;  4I1M A;  5AQ7 A;  4KBQ A;  3JUI A;  4JL0 A;  3APD A;  4EZK A;  1H6K A;  4JXT A;  3RSE G;  2FO1 E;  2DVW A;  3NQP A;  4TXQ A;  3SFX A;  4HNA D;  3U9W A;  4B8A A;  1Z6T A;  2WB2 A;  4GMJ A;  3HXB A;  1TR4 A;  3DXK G;  2R02 A;  1JCQ A;  4ILG A;  5HRY A;  4OVV A;  4PS3 A;  3UT8 A;  4A3T A;  4PS7 A;  3EU9 A;  4JHK A;  4V3I A;  1TEZ A;  2J08 A;  1TNB A;  3AG3 E;  3ISM C;  3DWL G;  5FIN A;  1ZBP A;  2OEW A;  2DBA A;  5ENO D;  3E4B A;  2XPY A;  3UPV A;  2XS8 A;  5JJ7 A;  3SGH A;  5EID A;  1HU3 A;  1OUV A;  3MYV A;  1SVX A;  1E8Z A;  3QKY A;  2KZT A;  4WNF A;  4CGV A;  1IXV A;  2XRY A;  3Q15 A;  5KJK A;  3B7B A;  4DX7 D;  2HE0 A;  4HVB A;  3NZU A;  4AM9 A;  4D10 C;  4YDW A;  1KLX A;  1UOH A;  5ENR D;  2R5S A;  4RG9 A;  4J0U A;  4L1B A;  4CCA A;  2WQ6 A;  3CVU A;  3DSW A;  3AS5 A;  3DRA A;  2DZN A;  2WPV A;  4FUL A;  4O1P A;  4AV7 A;  4CT0 A;  4XEI G;  1QQE A;  2XEN A;  4XZ4 A;  5BUZ A;  5FTP A;  3APC A;  2F8X K;  4Z68 A;  3CHR A;  3V31 A;  2XGS A;  4TUM A; 
#chains in the Genus database with same CATH homology
 2PM7 A;  1ELK A;  3FUM A;  1Z3X A;  3LVQ E;  5J90 A;  3S7J A;  3Q49 B;  1H2T C;  2VGX B;  4JW1 A;  4AY5 A;  2CG3 A;  1OWP A;  3LYA A;  4OVU A;  4ANU A;  2WMN A;  5CHE E;  2I2O A;  4GA1 A;  4UI9 C;  4CDR A;  3QNK A;  4L7T A;  3CKB A;  4J6I A;  4HOR A;  1OWN A;  3U66 A;  5BV0 A;  2Y4U A;  4XKB A;  5DIZ A;  3ENE A;  4U0Z A;  4DJA A;  1XNF A;  5FQ6 A;  3CVX A;  4O6F A;  2LAI A;  3ZEF A;  3EIJ A;  4WNE A;  3R9A B;  4A55 A;  1UJJ A;  3IEG A;  3FUE A;  1OWO A;  5G04 J;  4FA6 A;  1BPO A;  2WVI A;  1QZ2 A;  5D0Q D;  1DVP A;  4JC8 A;  1ZU2 A;  2AXZ A;  1XGW A;  5G05 C;  4N2Q A;  4RG6 A;  3TJP A;  3JQ1 A;  4ANX A;  4E85 A;  3U4T A;  4DK5 A;  3D9O A;  1PAQ A;  2RD0 A;  4GZD A;  3RRN B;  3VLF A;  4EBA G;  1W3B A;  4GZC A;  4GYY A;  2IU1 A;  2J4D A;  3EHN A;  3CHM A;  3TG4 A;  2XEV A;  2PM6 A;  3ZYL A;  3LCA A;  1JWG A;  4G26 A;  3KEZ A;  4DLO A;  1U3D A;  1UN9 A;  1EYH A;  4N3A A;  3AU5 A;  3HYM B;  3RO3 A;  2PQN A;  3IV0 A;  4U8H A;  4EBA A;  2OOE A;  3RIB A;  4BX8 A;  4APO A;  3L17 A;  4G23 A;  4WWN A;  5M72 A;  3PDN A;  1H2U A;  2FEZ A;  2HR2 A;  2HO1 A;  3HIZ A;  1E8W A;  4ME2 A;  3CLJ A;  3CSF A;  4F3V A;  1PC2 A;  2WXQ A;  5ENN A;  3D9N A;  4GB9 A;  5BT1 A;  3U64 A;  2ZU6 B;  4KVO A;  3ONK A;  4C0E A;  3FUD A;  4G25 A;  2I1K A;  2WXL A;  4XI0 A;  4KVM A;  3VLE A;  5CCM A;  2IFU A;  3QB2 A;  2PL2 A;  3FY4 A;  2XCC A;  2VQ2 A;  3UQ3 A;  2WQ7 A;  3CVQ A;  4U0S A;  3MKQ A;  1SQM A;  3MEK A;  4BTB A;  3CVL A;  3HVE A;  5EDS A;  3FDH A;  1TJC A;  3VTY A;  3O48 A;  4WWP A;  3D9K A;  3IKO B;  4L2Y A;  3LEW A;  4IYP A;  3I4G A;  2XGO A;  3QAQ A;  2KCL A;  1E8X A;  3QAR A;  3SZ7 A;  1PY1 A;  2UY1 A;  2X38 A;  5FZS A;  1DNP A;  4B8C B;  5FQ4 A;  2WXH A;  4AP2 A;  1E90 A;  3MKQ B;  4CEM A;  1HG2 A;  4N5C A;  3QDN A;  4FAD A;  3N71 A;  5DBK A;  2AXV A;  4PH4 B;  2WXM A;  4JVS A;  2R17 C;  4GPK A;  3CKC A;  2V5F A;  2WXG A;  1Y6I A;  3MA5 A;  4J8F A;  4EPZ A;  4LRZ A;  4A1S A;  2ILR A;  2X6H A;  3DBS A;  3RU0 A;  5ARG A;  3O4Z A;  3ZYQ A;  4HOT A;  3CEQ A;  1S0P A;  3SFZ A;  2KC7 A;  3RK6 A;  5LOZ A;  3G2W A;  5BPP A;  4F53 A;  1SZ9 A;  2LO6 A;  3MGB A;  3TAX A;  4XX5 A;  4AJW A;  2A4Z A;  3ZYK A;  3D9M A;  3S7F A;  4B89 A;  2CFZ A;  4NAC A;  2UWJ G;  2J07 A;  3ASF A;  3LVR E;  3L22 A;  4IRU A;  4R7L A;  5EKQ D;  4XKC A;  5G04 C;  3SBS A;  3RRM B;  4J8E A;  3KD7 A;  2P58 C;  3B7U X;  3OXG A;  1OWM A;  3RJV A;  4CGW A;  3PE4 A;  3CHQ A;  3HHM A;  2FUL A;  5ANR A;  5AIJ A;  1IQR A;  1HE8 A;  3PUJ A;  4ACK A;  4DI4 A;  4HOS A;  3QJZ A;  2JEK A;  3URZ A;  2L0T B;  2VSN A;  4NUR A;  5AEN A;  3ZN3 A;  2HYZ A;  2VGX A;  3FUK A;  4J8S A;  5JHA A;  5CCL A;  3PVL A;  5JJ6 A;  5HQ8 A;  4M3O A;  5KJM A;  3B7T A;  2VTB B;  3FUN A;  5LCW C;  1MQS A;  2OVB A;  4ANW A;  4I43 A;  2Q7F A;  3TL5 A;  5BV1 A;  4GAA A;  1UW4 B;  3EJN A;  4HLE A;  3LY8 A;  2C2L A;  4B0Z A;  3EIQ C;  3CVV A;  1HFA A;  4FU3 A;  4FHK A;  4Y6W A;  5T4Y A;  2ION A;  2M63 A;  4GZ5 A;  4Q69 A;  3GZ2 A;  2XRZ A;  4GCO A;  4L23 A;  2NXP A;  2BUG A;  4EEC A;  2X6J A;  2CHZ A;  3FUJ A;  2XPZ A;  1HG5 A;  5FZQ A;  4AEZ C;  4RVB A;  3FTW A;  4K0R A;  2BF0 X;  3PZD A;  2V0P A;  2WXF A;  4ANV A;  3NZS A;  1FVH A;  3PUK A;  5A6C A;  2FI7 A;  4OYS A;  1FCH A;  3ZIM A;  5E76 A;  2VSY A;  5E75 A;  3L08 A;  5FWQ A;  4NQ0 A;  2DIW A;  2GW1 A;  4AXH A;  2OVF A;  2L6J A;  3DPD A;  4TV3 A;  3ASH A;  5AJL A;  2AVP A;  5CMW A;  4I6G A;  5EX0 A;  2CFU A;  2VYI A;  3LY9 A;  4H7Y A;  3FP3 A;  2MOW A;  5G2N A;  2A5U A;  2WXK A;  3C98 A;  3I4R B;  4Q94 A;  3R7Q A;  4FC8 A;  1SZA A;  4I2Z A;  5FJY A;  3P2B A;  2GGF A;  3TXN A;  2X3M A;  2X6I A;  3QC1 A;  4FJY A;  4KZ0 A;  3PNL B;  3FTS A;  1ELR A;  1HXI A;  3KS2 A;  2XHE A;  4PDX A;  4JEU A;  4BT9 A;  3D9J A;  3TG5 A;  3JQ0 A;  3QWW A;  3ZPJ A;  2OND A;  4WAF A;  3FU5 A;  2X6K A;  3Q5M A;  1H19 A;  3R7R A;  4UWL A;  2VGY A;  3PRE A;  4WNG A;  3CGH A;  3FEY A;  4CDN A;  4IN3 B;  4TRQ A;  5LCW J;  3ZHE B;  4BT8 A;  4UQZ A;  1JPL A;  3CHS A;  3FU6 A;  2Y4T A;  3VLD A;  2EQX A;  3D9I A;  4URK A;  5FQ7 A;  2I9C A;  4KT6 B;  3ZYM A;  2J9Q A;  4I17 A;  4GU5 A;  4P29 A;  3PRZ A;  5FZR A;  1U3C A;  4KYO B;  4LUN U;  3FUI A;  3SI5 A;  3S2A A;  3UMV A;  2IF4 A;  4H7X A;  2XPI A;  2KCK A;  1IQU A;  3FUF A;  3OAW A;  3QWV A;  4I9C A;  3LJ3 A;  1B89 A;  2VSO E;  4W9R A;  5AYW D;  5LP0 A;  2NSZ A;  4GML A;  3PE3 A;  3UX4 A;  5D0O D;  1UG3 A;  3BG0 B;  2XQ0 A;  3CQG B;  3PNT B;  3ESL A;  3G2S A;  1IHG A;  3CHO A;  2FO7 A;  2WMO A;  3SF4 A;  3MV2 B;  5ARF A;  4FLB A;  4I9E A;  1NP7 A;  3I3N A;  2YNQ A;  3D9P A;  3MV3 B;  1INZ A;  3CVP A;  2MHK A;  2BTD A;  3U3W A;  4U63 A;  5T8I A;  3CHP A;  1QNF A;  2C0L A;  3UT4 A;  4UWG A;  2AXU A;  1YA0 A;  2IQC A;  2FBN A;  3L16 A;  5C1D A;  4FLH A;  4WWO A;  3SBT B;  4BSX A;  2YIN A;  3AS8 A;  3MJW A;  4GA2 A;  4JA7 A;  3LKU A;  3P1U A;  3OXL A;  4MKT A;  4C0M A;  4LCT A;  2DCP A;  3CVN A;  5A23 A;  3GYZ A;  3OTN A;  1E8Y A;  3LDZ A;  3UT7 A;  4K03 A;  1EF1 C;  1P5Q A;  3ML8 A;  4AIF A;  3G2T A;  4N2S A;  5A7D B;  3FHE A;  4HOQ A;  1NA3 A;  2OV8 A;  1Z3Y A;  2NC9 A;  1ELW A;  3QOU A;  3VTX A;  3QWP A;  3NF1 A;  2Y3A A;  3T5V A;  3ZXS A;  4EQF A;  3FEX A;  3PH0 C;  4U0U A;  4A1G A;  3CVW A;  5J08 A;  4DLQ A;  1E96 B;  3ULQ A;  4JPS A;  2HM8 A;  4UQY A;  2VTB A;  2WXO A;  3FFL A;  4UI9 K;  3LXU X;  2VSX E;  4QFV A;  4IUL A;  3CK8 A;  4U07 A;  1WM5 A;  3Q4A B;  5KCM A;  3OXF A;  5JJT A;  4ACL A;  2GRL A;  1Y8M A;  4A3V A;  3MKR A;  2L9B A;  5FQ8 A;  4PS8 A;  2C0M A;  4C9B B;  3IHY A;  4FJZ A;  3FH5 A;  4I1O B;  2GRM A;  1OWL A;  4Y6C A;  3FH7 A;  4YND A;  4N3C A;  2CHX A;  4LEU A;  4WUY A;  5JHB A;  3AU4 A;  1L5J A;  1HS6 A;  2MRI A;  5HI7 A;  1A17 A;  2FF4 A;  3RKV A;  4AY6 A;  5AJD A;  2J09 A;  4LER A;  4B94 A;  2YHC A;  3ASG A;  1N52 A;  3GZ1 A;  4TUU A;  3WXX A;  3CK7 A;  3FUL A;  2KM4 A;  3EDT B;  3FWV A;  2IOS A;  5KJL A;  3ESK A;  1VDY A;  4CT4 A;  1HO8 A;  4N39 A;  5LFA A;  4I1A A;  3D9L A;  3CV0 A;  3SNX A;  3K9I A;  4GYW A;  3SHF A;  1JUQ A;  3CQC B;  4GA0 A;  3PEU B;  1KT1 A;  4L2L A;  1UJK A;  1TJF A;  3ML9 A;  4XI9 A;  2PZI A;  3BEE A;  4I2W A;  2VJ8 A;  4GZ3 A;  2JLB A;  3ZHE A;  3ASD A;  3Q47 B;  3MCX A;  4G11 A;  2YQ8 A;  4MS6 A;  5CMY A;  3FTX A;  3B7R L;  4GYO A;  4JZY A;  3FU0 A;  1E7U A;  4APF A;  4GCN A;  1NA0 A;  4EZL A;  4MRU A;  2I1J A;  2WQH A;  2IJG X;  4I1M A;  4KBQ A;  3JUI A;  2WXR A;  1HX8 A;  4JL0 A;  3APD A;  1WY6 A;  3LPZ A;  3S7D A;  1E7V A;  3QK0 A;  4J8D A;  4EZK A;  5C2Y A;  1H6K A;  4JXT A;  4HOU A;  2V4L A;  4ILI A;  4BTA A;  1GW6 A;  3D3M A;  3NQP A;  3FTU A;  1EPU A;  4ABN A;  4EZJ A;  3U9W A;  4B8A A;  1Z6T A;  1HH8 A;  5EX3 A;  3MX3 A;  2WB2 A;  5BNW A;  3IHV A;  2V8S E;  2J4B A;  3FUH A;  4GMJ A;  5T3R A;  3FTY A;  4UWF A;  3FTZ A;  2QFC A;  2YHE A;  3L6A A;  3T8M A;  1H2V C;  1MHQ A;  4ILG A;  3ZW3 A;  4DPR A;  4MLP A;  4OVV A;  2KCV A;  3GZS A;  3FU3 A;  4JA9 A;  4AVX A;  4PS3 A;  4U04 A;  3UT8 A;  3PS6 A;  4PUC A;  2E2E A;  4A3T A;  4PS7 A;  4N3B A;  3S7B A;  5KJN A;  2QY7 A;  2CG2 A;  3ZFW A;  4JHK A;  1KT0 A;  4V3I A;  3TXM A;  1TEZ A;  2LNI A;  2LSU A;  4UWK A;  4BWR A;  2X6F A;  4UI9 J;  3UUX A;  4AOF A;  4KZC A;  2J08 A;  2WXI A;  3T5X A;  4XE0 A;  3ZVV A;  1IYG A;  2WXJ A;  3JCK C;  2R59 A;  2WXN A;  4ILH B;  1N54 A;  3ZGQ A;  3B13 A;  3KAE A;  3RO2 A;  1ZBP A;  4HXI A;  3CVY A;  4JHJ A;  1X5B A;  2DBA A;  2IOL A;  4JEH A;  4G24 A;  4F7A A;  3B7S A;  4F1S A;  1UN8 A;  3E4B A;  5G05 J;  2XPY A;  3UPV A;  1LF8 A;  3APF A;  3FH8 A;  3SD5 A;  2AWI A;  2AW6 A;  5JJ7 A;  3SGH A;  4HFG A;  4HS2 A;  3LY7 A;  5ANL A;  2PQR A;  3HVE B;  1HF8 A;  4RSY A;  4YVQ C;  4ATG A;  1HU3 A;  1OUV A;  4GZ6 A;  3MYV A;  3FTV A;  3RRU A;  4UQX A;  1NZN A;  4WND A;  4E6H A;  3L54 A;  3QKY A;  1E8Z A;  1FVF A;  1WAO 1;  2KZT A;  4YVO A;  4WNF A;  2UY1 B;  4I6E A;  3TGO A;  4CGV A;  4G2V A;  4G1T A;  2XRY A;  1JWF A;  3L13 A;  3Q15 A;  4JHR A;  5KJK A;  5G55 A;  3CIA A;  1HZ4 A;  2LSV A;  4FP7 A;  3G2U A;  2L0I A;  4KMO A;  4HVB A;  4KXK B;  4CDM A;  3NZU A;  4AM9 A;  4D10 C;  2XGM A;  4NRH B;  4I6J A;  1KLX A;  3ONL A;  2R5S A;  3CR3 A;  2RG8 A;  5FT9 A;  4RG9 A;  3HDX A;  4J0U A;  2KZT B;  5BW8 C;  3CST A;  3CK9 A;  4L1B A;  3GW4 A;  4CCA A;  4UWH A;  2WQ6 A;  3CVU A;  5LX8 A;  2KAT A;  3AS5 A;  3ZRH A;  3MZL B;  2WPV A;  2XCB A;  4FUL A;  2E0I A;  2CHW A;  2LAH A;  4BY6 A;  4BX9 A;  3JYS A;  4BFR A;  4AV7 A;  3BG1 B;  2I6H A;  4FHJ A;  4XIF A;  4CT0 A;  3AS4 A;  4DI3 A;  1QQE A;  4XZ4 A;  3EHM A;  5BUZ A;  5FTP A;  3APC A;  2WM9 A;  4CRW A;  3PEV B;  3CHR A;  1EDU A;  3G2V A;  3I5P A;  3LS8 A;  2WXP A;  2XGS A;  2J49 A;  3IBE A;  1H0A A;  4Q96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...