1OCRE

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 42
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1ocrE00
1OCZE 1OCCE 2EIME 5B1AE 3ABKE 3AG1E 3AG2E 1V54E 2EILE 2EIKE 3AG3E 1V55E 5IY5E 2DYSE 2Y69E 2ZXWE 2DYRE 2OCCE 3WG7E 5B1BE 2EIJE 3AG4E 3ASNE 3ABLE 1OCRE 5B3SE 3ASOE 3ABME 3X2QE 2EINE 1OCOE
chains in the Genus database with same CATH superfamily
1ELKA 4RG6A 3Q75A 5AQBA 1K1AA 2CG3A 2QYUA 3P1UA 5G05J 2E2EA 5LFAA 3RU0A 2GGFA 3GYZA 4JC8A 1EPUA 4DLOA 5EX3A 1H2VC 4A3TA 5CCLA 3SGHA 5B1AE 5C2YA 4CDRA 3LEWA 5KJNA 4WWNA 1JCQA 3ZXSA 2LSUA 3KSQA 4G11A 2XHEA 5FT9A 1FT1A 3NOGD 2JABA 1PY1A 3ZU7B 1OCOE 3UT8A 4HRLA 2IO3C 4HFGA 3ZHEA 4UWHA 3V30A 1TNBA 2Y1LE 1NFIE 4TXPA 2WMNA 2WXRA 3DSSA 4N3AA 3ZPJA 4I9CA 3DEPA 3GZSA 4BTAA 3IXEA 4I6JA 3CVVA 3FH8A 3U9WA 3OAWA 4YDYA 3R9AB 5IY5E 1KT0A 2DYSE 2YNQA 1NA3A 5CECB 3QWWA 4WAFA 2LNIA 2FI7A 2RG8A 4TXQA 1BPOA 3HG0D 5AN8A 1AP7A 1WM5A 3DSTA 3ZW3A 4FULA 1H19A 2PQRA 4JA7A 2CFZA 2J07A 2LXMA 4HQDA 3ZYMA 4N2QA 5BNWA 4GZDA 4WNEA 4U95D 3ZHEB 4ANWA 4OVUA 1TEZA 3MX3A 2AXUA 5DBKA 3LCAA 1QZ2A 4JB8P 3ONKA 4UWKA 4LCTA 1D8DA 1N0QA 2AW6A 1U3CA 3TWVA 4JA9A 3L54A 1QQEA 5AJDA 2ETCA 3EU9A 2WXFA 3B7RL 3CHQA 3QKYA 3B7UX 1IKND 2FULA 2XPYA 4GYYA 3DXKG 2Y69E 1S0PA 4HOUA 3UI2A 2FEZA 4FHJA 3ULQA 3KEZA 3DSUA 5EIDA 4BERA 5KJLA 4APFA 4ANUA 4J8EA 3E32A 3ZYLA 2VQ2A 2ZU6B 1N0RA 5E76A 3D9KA 2R03A 1TNOA 3IKOB 4PUCA 4U8VD 4TV3A 3TWQA 3FY4A 3FTVA 2HR2A 1RW2A 1TJCA 3FU3A 4YNDA 1N4QA 2NC9A 4KVMA 4U07A 4BT9A 4BY6A 1JWGA 3R7RA 3LY9A 2JEKA 3AS4A 3L08A 4KZ0A 3VTXA 1SA4A 3SFXA 5H7PA 4CCAA 3LKUA 5CBNA 2F37A 2XGMA 3NAWA 1YA0A 1NP7A 3PS6A 3SI5A 1H6KA 2VGXA 3DBSA 4A1SA 4PH4B 4GYWA 5HKPA 4GMRA 4C48B 3HXFA 5CEDB 2ZIRA 3B13A 1INZA 4FU3A 3RKVA 2XZDG 4PS3A 1DCEA 2GRLA 4AP2A 3S7FA 1Z5SC 4FJYA 3JXIA 2R2LA 3UIOC 4ACLA 4P29A 1X81A 5CMYA 4J7WA 4A3VA 3TWXA 3OXFA 1SA5A 3FHEA 4L7TA 5BT1A 3HIZA 2GRMA 4HOSA 4WNFA 4HB5A 3FTYA 5A6CA 3MV2B 2H6FA 2WQ6A 5EN5D 1ZB1A 1JWFA 4I43A 3IHYA 1OWOA 2LXLA 2VGXB 1OCZE 4GMJA 1E90A 5AENA 3FP3A 3FUNA 1H2UA 4UQXA 2Q7FA 2V4HC 5KCMA 1YMPA 4J8YA 4KBQA 5D2MC 1OWLA 4MLPA 4O1OA 4CT0A 2ONDA 2NYJA 4HXIA 5ITZF 5FWQA 4AV7A 2R02A 5G55A 4JHJA 3J5PA 2KCKA 3MZLB 4L9PA 3FTXA 3S7JA 4CGWA 3O48A 3URZA 2H6IA 2PQNA 4B89A 2EIKE 2R5SA 4EBAA 3AS5A 4MRUA 2AXVA 3T5XA 4EPZA 3N71A 4CRWA 2L0IA 4N5CA 3MJWA 1H6PA 3UTMA 3PE4A 2L6BA 2XENA 1FPPA 4DPRA 4KYOB 4IN3B 3MV3B 3Q78A 1W3BA 4YVOA 3SD5A 2QC9A 4H7YA 4KXKB 5JJ7A 3FU6A 3TG5A 1Z6TA 3BQOA 3BUAA 1HXIA 3D3MA 4CDNA 4FLHA 4ILGA 1UN8A 3G2WA 3V2XA 2X38A 2QFCA 3FUIA 4JL0A 4FJZA 3HXBA 5JMND 2IF4A 1DVPA 3S2AA 2WXMA 4FHKA 4HS2A 5B3SE 4B93B 1MX2A 2AWIA 5HQ8A 4NRHB 4LNUD 2EIME 5J08A 4BFRA 3UX4A 5T8IA 3T8KA 3ZYKA 4DLQA 2OEWA 2IOLA 4M3OA 2AVPA 4IYPA 1UN9A 2OV8A 3WXXA 3V31A 1K3ZD 2J4BA 4GB9A 1YYHA 1BLXB 1JCRA 3LY7A 3QOUA 3NF1A 4QQIA 3CHMA 3ASGA 5KNHD 4CT4A 3PREA 4I1OB 3RSEG 4AOFA 5HI7A 1EF1C 4IULA 3ASNE 2ETAA 2IEJA 5KNGA 3TGOA 3V2OA 4N3BA 4B0ZA 2Y4TA 4K5BA 4DUIA 4I2ZA 3QARA 4G24A 3ZNGA 4RVBA 2DVWA 4D10C 4I9EA 3RRNB 4JZYA 5ARFA 2ETBA 2J8SD 3OXGA 2WXLA 1LD8A 4JXTA 1UOHA 3I5PA 1BI7B 3MGBA 4BSXA 3NOCD 4Q96A 4ABNA 3D9LA 4WUYA 3PUJA 5FZSA 3HRAA 4MS6A 2IQCA 2PZIA 3TWSA 3BEEA 1E7UA 2I2OA 2WMOA 3ASHA 3CK7A 3C3OA 5JHAA 1HE8A 5CEAA 4RLYA 1PAQA 3QWPA 5CRVA 4EZKA 3D9NA 4HRMB 4OVVA 2P9NG 4I1AA 3SY2A 2XZTG 2DCPA 2LSVA 3DPYA 4C0EA 2QY7A 2WXNA 4UQZA 3NZUA 2KATA 4F7AA 4MBGA 5D0QD 2BUGA 3FTUA 3HDXA 2F8YA 3SFYA 3FEYA 3DXMG 4I6EA 1SQMA 3L82A 5FINA 3GZ1A 4Y6WA 3HXDA 4XEIG 1TNUA 2IO2C 4B8AA 4BSZB 4YDOA 1RZ4A 1HFAA 3Q79A 4F1PA 2IONA 3L9TA 3NQPA 3PDNA 1PC2A 1D9SA 3NB2A 1MHQA 3APDA 4DK5A 3HXEA 4K5CA 2B6CA 3B7BA 3JUEA 2QYJA 2VSXE 2XQ0A 1KLXA 3G2SA 3CHPA 4ANXA 3BU8A 3G2TA 2XEEA 1OCRE 2HM8A 5EX0A 5EDSA 2WXQA 3FH7A 3D9MA 1HF8A 4I2WA 1S64A 4GTOA 4Y6CA 3ZKJA 3CVYA 3MCXA 3J5QB 4C0MA 3RRMB 4G1TA 4F1SA 5ENNA 2OCCE 4TXRA 4CDMA 2HE0A 4G2VA 1KT1A 5T4YA 4FC8A 3UIPC 4GPMA 3GW4A 2YINA 4BTBA 3CK8A 2YHEA 1XNFA 4DRXE 1HS6A 3U66A 3B7TA 3APCA 4EZJA 5LP0A 1LF8A 5BV0A 3ZVVA 5JHBA 3VLFA 3FULA 4I17A 1O1TA 2IFUA 2HYZA 3FDHA 2I1JA 3CKCA 3QC1A 5G04C 1K1BA 5G2NA 3TJPA 3PEUB 4HLLA 3CHOA 3AAAC 3LXUX 1D8EA 5J90A 4LRZA 2DWZA 4XKCA 4UUCA 3R7QA 2ZGDA 1BI8B 4YDWA 4FADA 3QJZA 3Q4AB 4U0SA 1OCCE 5ANLA 4GMLA 4JD2G 3JCKC 1FCHA 2WQ7A 2IY0C 2DIWA 2P9IG 4QFVA 5M72A 3HVEA 5FTPA 1TN7A 1N11A 2H6GA 3UUXA 2P9KG 4JW1A 3TXNA 3FUMA 1OY3D 3CVQA 4AVXA 2WB2A 2XPIA 4R7LA 3PZ1A 1N52A 5LOZA 4DX6D 3FUDA 3EHRA 3AG4E 1MJ0A 5G04J 4ATGA 1OWMA 3ZYQA 3T5VA 4NQ0A 3C3QA 2MRIA 3RO3A 5CCMA 2A5EA 3FUJA 4NACA 1NA0A 3EIJA 3PNTB 4ILHB 1FT2A 1GW6A 3ZEFA 2VGYA 5ENOD 2X3MA 4U0ZA 2X6IA 3ZFWA 2M63A 4URKA 4HOQA 1QBQA 2XEHA 3UM0A 1Y8MA 4U63A 3Q5MA 4DX1A 3AU4A 2FO1E 4J0UA 5D66A 3CVNA 5LCWC 3EU5A 5A7DB 3HVEB 3TWWA 2OOEA 3LS8A 3DSVA 3DWLG 1OWNA 3PZ4A 4Q69A 1MX6A 1SZAA 2XPZA 5ENQD 4CZ2D 3UPVA 3SBTB 1OXJA 2B0OE 5FIOA 2CG2A 4A1GA 2VSYA 3SZ7A 3ONLA 4N3CA 3KS2A 4Q94A 4GCOA 4V3IA 3Q47B 3ASFA 4GYOA 2XRZA 2F0YA 4TUMA 1WY6A 2NSZA 4J8SA 1HO8A 3JQ0A 2KM4A 3CIAA 2DYRE 3ESKA 4W9RA 2C0LA 3IEGA 2ILRA 4APOA 2OVFA 1N95A 4GTRA 2VGEA 5D0OD 2NXPA 5LCWJ 1QNFA 3U64A 3EDTB 4DX2A 2Y3AA 2R59A 2AXZA 2EIJE 1TNYA 4LNBA 1TR4A 5JA4D 3CGHA 1L5JA 3Q9NC 3ABKE 3G2UA 1SVXA 1JCSA 1H0AA 2WXIA 4EECA 5CMWA 3FUFA 5A23A 1N4PA 4ME2A 1NI1A 1E8YA 4K03A 4LNGA 4AXHA 3D9OA 3PNLB 2LO6A 1V54E 3QB2A 4O60A 3C72A 5BUZA 4IRUA 3PUKA 5DIZA 3ML8A 5CBOA 4FLBA 3Q9UC 5KJKA 3RIBA 3PZ2A 4CYMD 4C9BB 5HS0A 3C98A 1HH8A 1UJJA 3LJ3A 2I6HA 2L6JA 2VSNA 3D9JA 3D9PA 2WXGA 4UI9C 3T8MA 2V0PA 4PDXA 1WG0A 3EHQA 3C3RA 2J08A 2OVBA 3CVLA 2P9PG 2P58C 2X6JA 4LUNU 4EQFA 4AY5A 2CHWA 4X8QA 3ZIMA 3TAXA 3E34A 5B1BE 3NBNB 3R9MA 5EYLA 1N9AA 2ZISA 3PZ3A 2WXJA 4GTPA 4AJWA 2XGOA 4A55A 2YQ8A 1S70B 5BXUA 4G23A 1KPSB 2WQHA 1IYGA 4HOTA 4L1BA 1O1SA 3QAQA 4CGVA 2C2LA 2WXKA 3UXGA 1DCQA 1N94A 3Q7AA 1A17A 1Y6IA 1FVHA 2KXPC 5FJYA 4BESA 4KVOA 5JJTA 3VTYA 3PE3A 1P5QA 4HI8A 4BT8A 1OT8A 5FQ8A 4G25A 2XEVA 4RSYA 4UI9J 1HX8A 3CVPA 4DI3A 5G05C 3CV0A 3IV0A 2AJAA 3CSTA 5JJ6A 5ANRA 3Q7FA 5BW8C 2UY1A 3PEVB 2PM7A 4GTQA 4H7XA 4M7CA 4NIKA 3CVWA 3EHNA 4E6HA 3FEXA 4F3VA 4JEHA 3QWVA 4HLEA 4ILIA 1E8WA 3SHFA 3ZRHA 5T3RA 2P9SG 3UKUG 2BKKB 5AQ9A 1DNPA 3KEAA 2WXPA 3B7SA 4F53A 5FZRA 2I9CA 5CRUA 3I3NA 2BKGA 3D9IA 1IQUA 3RRUA 4XIFA 4KMOA 3NZSA 2KCLA 2GRPB 1TNZA 3I4GA 3RAUA 3ZGQA 3ABLE 4XX5A 1S63A 4UWGA 1IQRA 2UY1B 5EILA 1IHGA 2FF4A 1QYMA 3FTSA 3LVRE 4G8LA 2DZNA 3CEQA 4UWLA 5BV1A 2Y0BG 3WG7E 2V4LA 3KD7A 3O4ZA 3T9KA 1E8XA 2J9QA 4GPKA 2VSOE 4WWPA 3LY8A 1MQSA 2WVIA 4KT6B 3DPDA 4WNGA 3L17A 3BG1B 1ELRA 4I1MA 3SF4A 3Q73A 1XGWA 3P2BA 3PRZA 2V5QC 3V79K 2DZOA 2GRRB 3MKQA 3ML9A 1TYQG 5E75A 1K8KG 2BTDA 5AIJA 2ZGGA 3S7BA 3AG2E 3AS8A 3FH5A 4EZLA 4F6RD 4A63B 1WAO1 5BXOA 4OAUC 4AY6A 3FTWA 3DSXA 5AJLA 5EIBE 4GU5A 4LG6A 1BD8A 5ENSD 4JPSA 3G2VA 5AQ7A 4LEUA 2R17C 4TUUA 2UWJG 4J8DA 5AARA 1G3NB 2OEVA 5AYWD 2F8XK 4PS8A 4TRQA 1E7VA 3SBSA 3CQGB 4GZ5A 2HO1A 4CEMA 4GTVA 1NL4A 4XE0A 3VLEA 4DI4A 1FVFA 3UM2A 2X6HA 4U0UA 5EYPF 3MKQB 2CFUA 2X6FA 2L9BA 1MZCA 4DX7D 1WDYA 4DJAA 3ULEG 5KBAA 3RK6A 1A5EA 3VLDA 4G8KA 4NURA 4HBDA 2FBNA 2C0MA 4RG9A 3B95A 3CLJA 3U4TA 1LTXA 2FO7A 2R05A 3AG1E 4BETA 4ZHBA 1Q2ZA 1IXVA 2JLBA 3MKRA 3JYSA 1O1RA 1KZPA 2EQXA 2LUHA 4FP7A 4HNAD 2WM9A 3QDNA 4I6GA 3UM1A 1TN8A 1Z3YA 1E8ZA 3DRAA 3AG3E 2A4ZA 3CVUA 4JEUA 3UMVA 3TWTA 4L23A 4ACKA 4JHRA 2KBXA 3HYMB 4MKTA 1BU9A 3TXMA 3ABME 1LD7A 2MYOA 2XCBA 3Q15A 4OAVB 3ZN3A 4XKBA 3AU5A 3CK9A 4N5QA 5FQ4A 5KWDA 4JVSA 1ZBPA 1VDYA 3PH0C 4N2SA 1N4SA 1ELWA 3BG0B 2LAHA 5CHEE 4BEPA 3Q49B 3JUIA 3LVQE 1OUVA 2PL2A 2XGSA 2DBAA 4EHMA 3CR3A 3CKBA 5FQ6A 5HRYA 1UG3A 1X5BA 2P9LG 1UJKA 1JUQA 2PM6A 3KAEA 3OTNA 5BPPA 1SZ9A 5FQ7A 2J09A 4GZ3A 4BWRA 2L0TB 3CQCB 4J6IA 4ANVA 3JXJA 3UM3A 3SO8A 4FA6A 2V5FA 5CERB 3TWUA 3QK0A 2WXHA 3U3WA 2LAIA 3LYAA 3ISMC 5AQAA 3ESLA 3UQ3A 3MA5A 1MYOA 3RO2A 3TL5A 4XI0A 1HG5A 2KC7A 4GZ6A 3DSWA 3TWRA 2BF0X 3LPZA 4GZCA 2J4DA 2XCCA 2QZAA 4GAAA 4BX9A 5ARGA 2WPVA 3PZDA 4LERA 4RQIA 3RJVA 4UQYA 4U04A 3UT7A 3ENEA 1TJFA 3UT4A 4L2YA 3FU0A 3S7DA 3I4RB 2VYIA 4YVQC 4O6FA 3SNXA 1AWCB 4HORA 5AAOA 3ULYA 3EUVA 2J49A 1KZOA 2GRQB 3X2QE 3E4BA 4N39A 4G26A 4XI9A 3D9HA 2XS1A 2X6KA 2Y4UA 4B94A 2GW1A 5KJMA 3CHRA 4JHKA 4LSZE 1B89A 1HU3A 1U3DA 3FU5A 3EIQC 3KSLA 3ZUVB 1TN6A 4ZFHA 1ZU2A 3FUEA 2RFAA 1H2TC 3MYVA 1NZNA 2VTBA 3LDZA 2YHCA 3IBEA 1V55E 1U2VG 2E0IA 4HI9A 1YCSB 1MX4A 2MOWA 1N4RA 3ASDA 1HG2A 2P2CP 4K0RA 3UKRG 2EINE 4AM9A 1E96B 2GROB 4HVBA 4KZCA 4WNDA 1EDUA 2RFMA 4DX5D 1OWPA 2XS8A 3K9IA 4UWFA 3UINC 3F6QA 5LX8A 3E30A 3IHVA 3C5RA 4GTMA 4U8HA 2KCVA 2H6HA 3AJIA 4XZ4A 4OYSA 4GA1A 3FFLA 3E37A 4AIFA 2A5UA 2EILE 3JQ1A 1H6OA 2P9UG 3L16A 3HHMA 1HZ4A 3GZ2A 2RD0A 2RKKA 4PS7A 3OXLA 5ENTD 2XRYA 4GA2A 3SFZA 5ENPD 4ATZD 3W9FA 2IU1A 3EJNA 3SQVA 2VTBB 2KZTA 4AEZC 3CHSA 3DEOA 3MEKA 4U96D 4UI9K 3FWVA 5ENRD 4BX8A 2WXOA 3L22A 4EBAG 4Z68A 2I1KA 4L2LA 1SW6A 2GRNB 2V8SE 4GTSA 3ASOE 3FTZA 2MHKA 2IJGX 3QNKA 4U7EB 4GA0A 4U8YD 2CHXA 4WWOA 3W9GA 3TG4A 1EYHA 4B8CB 3L13A 1UW4B 4YDEA 1N54A 2CHZA 1Z3XA 5C1DA 1O5MA 3CVXA 3EHMA 3ZXPA 4O1PA 3FUHA 3HXCA 4GCNA 2IOSA 2PNNA 4J8FA 3FUKA 5EKQD 3E33A 1IHBA 4E85A 3APFA 4HRNA 3L6AA 1JPLA 2ZXWE 5FZQA 2VJ8A 4GTTA 4K5AB 3LJNA 3PVLA 1DC2A 3CSFA 2BEDA 2KZTB
chains in the Genus database with same CATH topology
1OCZE 1OCCE 2EIME 5B1AE 3ABKE 3AG1E 3AG2E 1V54E 2EILE 2EIKE 3AG3E 1V55E 5IY5E 2DYSE 2Y69E 2ZXWE 2DYRE 2OCCE 3WG7E 5B1BE 2EIJE 3AG4E 3ASNE 3ABLE 1OCRE 5B3SE 3ASOE 3ABME 3X2QE 2EINE 1OCOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCZ E;  1OCC E;  2EIM E;  5B1A E;  3ABK E;  3AG1 E;  3AG2 E;  1V54 E;  2EIL E;  2EIK E;  3AG3 E;  1V55 E;  5IY5 E;  2DYS E;  2Y69 E;  2ZXW E;  2DYR E;  2OCC E;  3WG7 E;  5B1B E;  2EIJ E;  3AG4 E;  3ASN E;  3ABL E;  1OCR E;  5B3S E;  3ASO E;  3ABM E;  3X2Q E;  2EIN E;  1OCO E; 
#chains in the Genus database with same CATH topology
 1ELK A;  4RG6 A;  3Q75 A;  5AQB A;  1K1A A;  2CG3 A;  2QYU A;  3P1U A;  5G05 J;  2E2E A;  5LFA A;  3RU0 A;  2GGF A;  3GYZ A;  4JC8 A;  1EPU A;  4DLO A;  5EX3 A;  1H2V C;  4A3T A;  5CCL A;  3SGH A;  5B1A E;  5C2Y A;  4CDR A;  3LEW A;  5KJN A;  4WWN A;  1JCQ A;  3ZXS A;  2LSU A;  3KSQ A;  4G11 A;  2XHE A;  5FT9 A;  1FT1 A;  3NOG D;  2JAB A;  1PY1 A;  3ZU7 B;  1OCO E;  3UT8 A;  4HRL A;  2IO3 C;  4HFG A;  3ZHE A;  4UWH A;  3V30 A;  1TNB A;  2Y1L E;  1NFI E;  4TXP A;  2WMN A;  2WXR A;  3DSS A;  4N3A A;  3ZPJ A;  4I9C A;  3DEP A;  3GZS A;  4BTA A;  3IXE A;  4I6J A;  3CVV A;  3FH8 A;  3U9W A;  3OAW A;  4YDY A;  3R9A B;  5IY5 E;  1KT0 A;  2DYS E;  2YNQ A;  1NA3 A;  5CEC B;  3QWW A;  4WAF A;  2LNI A;  2FI7 A;  2RG8 A;  4TXQ A;  1BPO A;  3HG0 D;  5AN8 A;  1AP7 A;  1WM5 A;  3DST A;  3ZW3 A;  4FUL A;  1H19 A;  2PQR A;  4JA7 A;  2CFZ A;  2J07 A;  2LXM A;  4HQD A;  3ZYM A;  4N2Q A;  5BNW A;  4GZD A;  4WNE A;  4U95 D;  3ZHE B;  4ANW A;  4OVU A;  1TEZ A;  3MX3 A;  2AXU A;  5DBK A;  3LCA A;  1QZ2 A;  4JB8 P;  3ONK A;  4UWK A;  4LCT A;  1D8D A;  1N0Q A;  2AW6 A;  1U3C A;  3TWV A;  4JA9 A;  3L54 A;  1QQE A;  5AJD A;  2ETC A;  3EU9 A;  2WXF A;  3B7R L;  3CHQ A;  3QKY A;  3B7U X;  1IKN D;  2FUL A;  2XPY A;  4GYY A;  3DXK G;  2Y69 E;  1S0P A;  4HOU A;  3UI2 A;  2FEZ A;  4FHJ A;  3ULQ A;  3KEZ A;  3DSU A;  5EID A;  4BER A;  5KJL A;  4APF A;  4ANU A;  4J8E A;  3E32 A;  3ZYL A;  2VQ2 A;  2ZU6 B;  1N0R A;  5E76 A;  3D9K A;  2R03 A;  1TNO A;  3IKO B;  4PUC A;  4U8V D;  4TV3 A;  3TWQ A;  3FY4 A;  3FTV A;  2HR2 A;  1RW2 A;  1TJC A;  3FU3 A;  4YND A;  1N4Q A;  2NC9 A;  4KVM A;  4U07 A;  4BT9 A;  4BY6 A;  1JWG A;  3R7R A;  3LY9 A;  2JEK A;  3AS4 A;  3L08 A;  4KZ0 A;  3VTX A;  1SA4 A;  3SFX A;  5H7P A;  4CCA A;  3LKU A;  5CBN A;  2F37 A;  2XGM A;  3NAW A;  1YA0 A;  1NP7 A;  3PS6 A;  3SI5 A;  1H6K A;  2VGX A;  3DBS A;  4A1S A;  4PH4 B;  4GYW A;  5HKP A;  4GMR A;  4C48 B;  3HXF A;  5CED B;  2ZIR A;  3B13 A;  1INZ A;  4FU3 A;  3RKV A;  2XZD G;  4PS3 A;  1DCE A;  2GRL A;  4AP2 A;  3S7F A;  1Z5S C;  4FJY A;  3JXI A;  2R2L A;  3UIO C;  4ACL A;  4P29 A;  1X81 A;  5CMY A;  4J7W A;  4A3V A;  3TWX A;  3OXF A;  1SA5 A;  3FHE A;  4L7T A;  5BT1 A;  3HIZ A;  2GRM A;  4HOS A;  4WNF A;  4HB5 A;  3FTY A;  5A6C A;  3MV2 B;  2H6F A;  2WQ6 A;  5EN5 D;  1ZB1 A;  1JWF A;  4I43 A;  3IHY A;  1OWO A;  2LXL A;  2VGX B;  1OCZ E;  4GMJ A;  1E90 A;  5AEN A;  3FP3 A;  3FUN A;  1H2U A;  4UQX A;  2Q7F A;  2V4H C;  5KCM A;  1YMP A;  4J8Y A;  4KBQ A;  5D2M C;  1OWL A;  4MLP A;  4O1O A;  4CT0 A;  2OND A;  2NYJ A;  4HXI A;  5ITZ F;  5FWQ A;  4AV7 A;  2R02 A;  5G55 A;  4JHJ A;  3J5P A;  2KCK A;  3MZL B;  4L9P A;  3FTX A;  3S7J A;  4CGW A;  3O48 A;  3URZ A;  2H6I A;  2PQN A;  4B89 A;  2EIK E;  2R5S A;  4EBA A;  3AS5 A;  4MRU A;  2AXV A;  3T5X A;  4EPZ A;  3N71 A;  4CRW A;  2L0I A;  4N5C A;  3MJW A;  1H6P A;  3UTM A;  3PE4 A;  2L6B A;  2XEN A;  1FPP A;  4DPR A;  4KYO B;  4IN3 B;  3MV3 B;  3Q78 A;  1W3B A;  4YVO A;  3SD5 A;  2QC9 A;  4H7Y A;  4KXK B;  5JJ7 A;  3FU6 A;  3TG5 A;  1Z6T A;  3BQO A;  3BUA A;  1HXI A;  3D3M A;  4CDN A;  4FLH A;  4ILG A;  1UN8 A;  3G2W A;  3V2X A;  2X38 A;  2QFC A;  3FUI A;  4JL0 A;  4FJZ A;  3HXB A;  5JMN D;  2IF4 A;  1DVP A;  3S2A A;  2WXM A;  4FHK A;  4HS2 A;  5B3S E;  4B93 B;  1MX2 A;  2AWI A;  5HQ8 A;  4NRH B;  4LNU D;  2EIM E;  5J08 A;  4BFR A;  3UX4 A;  5T8I A;  3T8K A;  3ZYK A;  4DLQ A;  2OEW A;  2IOL A;  4M3O A;  2AVP A;  4IYP A;  1UN9 A;  2OV8 A;  3WXX A;  3V31 A;  1K3Z D;  2J4B A;  4GB9 A;  1YYH A;  1BLX B;  1JCR A;  3LY7 A;  3QOU A;  3NF1 A;  4QQI A;  3CHM A;  3ASG A;  5KNH D;  4CT4 A;  3PRE A;  4I1O B;  3RSE G;  4AOF A;  5HI7 A;  1EF1 C;  4IUL A;  3ASN E;  2ETA A;  2IEJ A;  5KNG A;  3TGO A;  3V2O A;  4N3B A;  4B0Z A;  2Y4T A;  4K5B A;  4DUI A;  4I2Z A;  3QAR A;  4G24 A;  3ZNG A;  4RVB A;  2DVW A;  4D10 C;  4I9E A;  3RRN B;  4JZY A;  5ARF A;  2ETB A;  2J8S D;  3OXG A;  2WXL A;  1LD8 A;  4JXT A;  1UOH A;  3I5P A;  1BI7 B;  3MGB A;  4BSX A;  3NOC D;  4Q96 A;  4ABN A;  3D9L A;  4WUY A;  3PUJ A;  5FZS A;  3HRA A;  4MS6 A;  2IQC A;  2PZI A;  3TWS A;  3BEE A;  1E7U A;  2I2O A;  2WMO A;  3ASH A;  3CK7 A;  3C3O A;  5JHA A;  1HE8 A;  5CEA A;  4RLY A;  1PAQ A;  3QWP A;  5CRV A;  4EZK A;  3D9N A;  4HRM B;  4OVV A;  2P9N G;  4I1A A;  3SY2 A;  2XZT G;  2DCP A;  2LSV A;  3DPY A;  4C0E A;  2QY7 A;  2WXN A;  4UQZ A;  3NZU A;  2KAT A;  4F7A A;  4MBG A;  5D0Q D;  2BUG A;  3FTU A;  3HDX A;  2F8Y A;  3SFY A;  3FEY A;  3DXM G;  4I6E A;  1SQM A;  3L82 A;  5FIN A;  3GZ1 A;  4Y6W A;  3HXD A;  4XEI G;  1TNU A;  2IO2 C;  4B8A A;  4BSZ B;  4YDO A;  1RZ4 A;  1HFA A;  3Q79 A;  4F1P A;  2ION A;  3L9T A;  3NQP A;  3PDN A;  1PC2 A;  1D9S A;  3NB2 A;  1MHQ A;  3APD A;  4DK5 A;  3HXE A;  4K5C A;  2B6C A;  3B7B A;  3JUE A;  2QYJ A;  2VSX E;  2XQ0 A;  1KLX A;  3G2S A;  3CHP A;  4ANX A;  3BU8 A;  3G2T A;  2XEE A;  1OCR E;  2HM8 A;  5EX0 A;  5EDS A;  2WXQ A;  3FH7 A;  3D9M A;  1HF8 A;  4I2W A;  1S64 A;  4GTO A;  4Y6C A;  3ZKJ A;  3CVY A;  3MCX A;  3J5Q B;  4C0M A;  3RRM B;  4G1T A;  4F1S A;  5ENN A;  2OCC E;  4TXR A;  4CDM A;  2HE0 A;  4G2V A;  1KT1 A;  5T4Y A;  4FC8 A;  3UIP C;  4GPM A;  3GW4 A;  2YIN A;  4BTB A;  3CK8 A;  2YHE A;  1XNF A;  4DRX E;  1HS6 A;  3U66 A;  3B7T A;  3APC A;  4EZJ A;  5LP0 A;  1LF8 A;  5BV0 A;  3ZVV A;  5JHB A;  3VLF A;  3FUL A;  4I17 A;  1O1T A;  2IFU A;  2HYZ A;  3FDH A;  2I1J A;  3CKC A;  3QC1 A;  5G04 C;  1K1B A;  5G2N A;  3TJP A;  3PEU B;  4HLL A;  3CHO A;  3AAA C;  3LXU X;  1D8E A;  5J90 A;  4LRZ A;  2DWZ A;  4XKC A;  4UUC A;  3R7Q A;  2ZGD A;  1BI8 B;  4YDW A;  4FAD A;  3QJZ A;  3Q4A B;  4U0S A;  1OCC E;  5ANL A;  4GML A;  4JD2 G;  3JCK C;  1FCH A;  2WQ7 A;  2IY0 C;  2DIW A;  2P9I G;  4QFV A;  5M72 A;  3HVE A;  5FTP A;  1TN7 A;  1N11 A;  2H6G A;  3UUX A;  2P9K G;  4JW1 A;  3TXN A;  3FUM A;  1OY3 D;  3CVQ A;  4AVX A;  2WB2 A;  2XPI A;  4R7L A;  3PZ1 A;  1N52 A;  5LOZ A;  4DX6 D;  3FUD A;  3EHR A;  3AG4 E;  1MJ0 A;  5G04 J;  4ATG A;  1OWM A;  3ZYQ A;  3T5V A;  4NQ0 A;  3C3Q A;  2MRI A;  3RO3 A;  5CCM A;  2A5E A;  3FUJ A;  4NAC A;  1NA0 A;  3EIJ A;  3PNT B;  4ILH B;  1FT2 A;  1GW6 A;  3ZEF A;  2VGY A;  5ENO D;  2X3M A;  4U0Z A;  2X6I A;  3ZFW A;  2M63 A;  4URK A;  4HOQ A;  1QBQ A;  2XEH A;  3UM0 A;  1Y8M A;  4U63 A;  3Q5M A;  4DX1 A;  3AU4 A;  2FO1 E;  4J0U A;  5D66 A;  3CVN A;  5LCW C;  3EU5 A;  5A7D B;  3HVE B;  3TWW A;  2OOE A;  3LS8 A;  3DSV A;  3DWL G;  1OWN A;  3PZ4 A;  4Q69 A;  1MX6 A;  1SZA A;  2XPZ A;  5ENQ D;  4CZ2 D;  3UPV A;  3SBT B;  1OXJ A;  2B0O E;  5FIO A;  2CG2 A;  4A1G A;  2VSY A;  3SZ7 A;  3ONL A;  4N3C A;  3KS2 A;  4Q94 A;  4GCO A;  4V3I A;  3Q47 B;  3ASF A;  4GYO A;  2XRZ A;  2F0Y A;  4TUM A;  1WY6 A;  2NSZ A;  4J8S A;  1HO8 A;  3JQ0 A;  2KM4 A;  3CIA A;  2DYR E;  3ESK A;  4W9R A;  2C0L A;  3IEG A;  2ILR A;  4APO A;  2OVF A;  1N95 A;  4GTR A;  2VGE A;  5D0O D;  2NXP A;  5LCW J;  1QNF A;  3U64 A;  3EDT B;  4DX2 A;  2Y3A A;  2R59 A;  2AXZ A;  2EIJ E;  1TNY A;  4LNB A;  1TR4 A;  5JA4 D;  3CGH A;  1L5J A;  3Q9N C;  3ABK E;  3G2U A;  1SVX A;  1JCS A;  1H0A A;  2WXI A;  4EEC A;  5CMW A;  3FUF A;  5A23 A;  1N4P A;  4ME2 A;  1NI1 A;  1E8Y A;  4K03 A;  4LNG A;  4AXH A;  3D9O A;  3PNL B;  2LO6 A;  1V54 E;  3QB2 A;  4O60 A;  3C72 A;  5BUZ A;  4IRU A;  3PUK A;  5DIZ A;  3ML8 A;  5CBO A;  4FLB A;  3Q9U C;  5KJK A;  3RIB A;  3PZ2 A;  4CYM D;  4C9B B;  5HS0 A;  3C98 A;  1HH8 A;  1UJJ A;  3LJ3 A;  2I6H A;  2L6J A;  2VSN A;  3D9J A;  3D9P A;  2WXG A;  4UI9 C;  3T8M A;  2V0P A;  4PDX A;  1WG0 A;  3EHQ A;  3C3R A;  2J08 A;  2OVB A;  3CVL A;  2P9P G;  2P58 C;  2X6J A;  4LUN U;  4EQF A;  4AY5 A;  2CHW A;  4X8Q A;  3ZIM A;  3TAX A;  3E34 A;  5B1B E;  3NBN B;  3R9M A;  5EYL A;  1N9A A;  2ZIS A;  3PZ3 A;  2WXJ A;  4GTP A;  4AJW A;  2XGO A;  4A55 A;  2YQ8 A;  1S70 B;  5BXU A;  4G23 A;  1KPS B;  2WQH A;  1IYG A;  4HOT A;  4L1B A;  1O1S A;  3QAQ A;  4CGV A;  2C2L A;  2WXK A;  3UXG A;  1DCQ A;  1N94 A;  3Q7A A;  1A17 A;  1Y6I A;  1FVH A;  2KXP C;  5FJY A;  4BES A;  4KVO A;  5JJT A;  3VTY A;  3PE3 A;  1P5Q A;  4HI8 A;  4BT8 A;  1OT8 A;  5FQ8 A;  4G25 A;  2XEV A;  4RSY A;  4UI9 J;  1HX8 A;  3CVP A;  4DI3 A;  5G05 C;  3CV0 A;  3IV0 A;  2AJA A;  3CST A;  5JJ6 A;  5ANR A;  3Q7F A;  5BW8 C;  2UY1 A;  3PEV B;  2PM7 A;  4GTQ A;  4H7X A;  4M7C A;  4NIK A;  3CVW A;  3EHN A;  4E6H A;  3FEX A;  4F3V A;  4JEH A;  3QWV A;  4HLE A;  4ILI A;  1E8W A;  3SHF A;  3ZRH A;  5T3R A;  2P9S G;  3UKU G;  2BKK B;  5AQ9 A;  1DNP A;  3KEA A;  2WXP A;  3B7S A;  4F53 A;  5FZR A;  2I9C A;  5CRU A;  3I3N A;  2BKG A;  3D9I A;  1IQU A;  3RRU A;  4XIF A;  4KMO A;  3NZS A;  2KCL A;  2GRP B;  1TNZ A;  3I4G A;  3RAU A;  3ZGQ A;  3ABL E;  4XX5 A;  1S63 A;  4UWG A;  1IQR A;  2UY1 B;  5EIL A;  1IHG A;  2FF4 A;  1QYM A;  3FTS A;  3LVR E;  4G8L A;  2DZN A;  3CEQ A;  4UWL A;  5BV1 A;  2Y0B G;  3WG7 E;  2V4L A;  3KD7 A;  3O4Z A;  3T9K A;  1E8X A;  2J9Q A;  4GPK A;  2VSO E;  4WWP A;  3LY8 A;  1MQS A;  2WVI A;  4KT6 B;  3DPD A;  4WNG A;  3L17 A;  3BG1 B;  1ELR A;  4I1M A;  3SF4 A;  3Q73 A;  1XGW A;  3P2B A;  3PRZ A;  2V5Q C;  3V79 K;  2DZO A;  2GRR B;  3MKQ A;  3ML9 A;  1TYQ G;  5E75 A;  1K8K G;  2BTD A;  5AIJ A;  2ZGG A;  3S7B A;  3AG2 E;  3AS8 A;  3FH5 A;  4EZL A;  4F6R D;  4A63 B;  1WAO 1;  5BXO A;  4OAU C;  4AY6 A;  3FTW A;  3DSX A;  5AJL A;  5EIB E;  4GU5 A;  4LG6 A;  1BD8 A;  5ENS D;  4JPS A;  3G2V A;  5AQ7 A;  4LEU A;  2R17 C;  4TUU A;  2UWJ G;  4J8D A;  5AAR A;  1G3N B;  2OEV A;  5AYW D;  2F8X K;  4PS8 A;  4TRQ A;  1E7V A;  3SBS A;  3CQG B;  4GZ5 A;  2HO1 A;  4CEM A;  4GTV A;  1NL4 A;  4XE0 A;  3VLE A;  4DI4 A;  1FVF A;  3UM2 A;  2X6H A;  4U0U A;  5EYP F;  3MKQ B;  2CFU A;  2X6F A;  2L9B A;  1MZC A;  4DX7 D;  1WDY A;  4DJA A;  3ULE G;  5KBA A;  3RK6 A;  1A5E A;  3VLD A;  4G8K A;  4NUR A;  4HBD A;  2FBN A;  2C0M A;  4RG9 A;  3B95 A;  3CLJ A;  3U4T A;  1LTX A;  2FO7 A;  2R05 A;  3AG1 E;  4BET A;  4ZHB A;  1Q2Z A;  1IXV A;  2JLB A;  3MKR A;  3JYS A;  1O1R A;  1KZP A;  2EQX A;  2LUH A;  4FP7 A;  4HNA D;  2WM9 A;  3QDN A;  4I6G A;  3UM1 A;  1TN8 A;  1Z3Y A;  1E8Z A;  3DRA A;  3AG3 E;  2A4Z A;  3CVU A;  4JEU A;  3UMV A;  3TWT A;  4L23 A;  4ACK A;  4JHR A;  2KBX A;  3HYM B;  4MKT A;  1BU9 A;  3TXM A;  3ABM E;  1LD7 A;  2MYO A;  2XCB A;  3Q15 A;  4OAV B;  3ZN3 A;  4XKB A;  3AU5 A;  3CK9 A;  4N5Q A;  5FQ4 A;  5KWD A;  4JVS A;  1ZBP A;  1VDY A;  3PH0 C;  4N2S A;  1N4S A;  1ELW A;  3BG0 B;  2LAH A;  5CHE E;  4BEP A;  3Q49 B;  3JUI A;  3LVQ E;  1OUV A;  2PL2 A;  2XGS A;  2DBA A;  4EHM A;  3CR3 A;  3CKB A;  5FQ6 A;  5HRY A;  1UG3 A;  1X5B A;  2P9L G;  1UJK A;  1JUQ A;  2PM6 A;  3KAE A;  3OTN A;  5BPP A;  1SZ9 A;  5FQ7 A;  2J09 A;  4GZ3 A;  4BWR A;  2L0T B;  3CQC B;  4J6I A;  4ANV A;  3JXJ A;  3UM3 A;  3SO8 A;  4FA6 A;  2V5F A;  5CER B;  3TWU A;  3QK0 A;  2WXH A;  3U3W A;  2LAI A;  3LYA A;  3ISM C;  5AQA A;  3ESL A;  3UQ3 A;  3MA5 A;  1MYO A;  3RO2 A;  3TL5 A;  4XI0 A;  1HG5 A;  2KC7 A;  4GZ6 A;  3DSW A;  3TWR A;  2BF0 X;  3LPZ A;  4GZC A;  2J4D A;  2XCC A;  2QZA A;  4GAA A;  4BX9 A;  5ARG A;  2WPV A;  3PZD A;  4LER A;  4RQI A;  3RJV A;  4UQY A;  4U04 A;  3UT7 A;  3ENE A;  1TJF A;  3UT4 A;  4L2Y A;  3FU0 A;  3S7D A;  3I4R B;  2VYI A;  4YVQ C;  4O6F A;  3SNX A;  1AWC B;  4HOR A;  5AAO A;  3ULY A;  3EUV A;  2J49 A;  1KZO A;  2GRQ B;  3X2Q E;  3E4B A;  4N39 A;  4G26 A;  4XI9 A;  3D9H A;  2XS1 A;  2X6K A;  2Y4U A;  4B94 A;  2GW1 A;  5KJM A;  3CHR A;  4JHK A;  4LSZ E;  1B89 A;  1HU3 A;  1U3D A;  3FU5 A;  3EIQ C;  3KSL A;  3ZUV B;  1TN6 A;  4ZFH A;  1ZU2 A;  3FUE A;  2RFA A;  1H2T C;  3MYV A;  1NZN A;  2VTB A;  3LDZ A;  2YHC A;  3IBE A;  1V55 E;  1U2V G;  2E0I A;  4HI9 A;  1YCS B;  1MX4 A;  2MOW A;  1N4R A;  3ASD A;  1HG2 A;  2P2C P;  4K0R A;  3UKR G;  2EIN E;  4AM9 A;  1E96 B;  2GRO B;  4HVB A;  4KZC A;  4WND A;  1EDU A;  2RFM A;  4DX5 D;  1OWP A;  2XS8 A;  3K9I A;  4UWF A;  3UIN C;  3F6Q A;  5LX8 A;  3E30 A;  3IHV A;  3C5R A;  4GTM A;  4U8H A;  2KCV A;  2H6H A;  3AJI A;  4XZ4 A;  4OYS A;  4GA1 A;  3FFL A;  3E37 A;  4AIF A;  2A5U A;  2EIL E;  3JQ1 A;  1H6O A;  2P9U G;  3L16 A;  3HHM A;  1HZ4 A;  3GZ2 A;  2RD0 A;  2RKK A;  4PS7 A;  3OXL A;  5ENT D;  2XRY A;  4GA2 A;  3SFZ A;  5ENP D;  4ATZ D;  3W9F A;  2IU1 A;  3EJN A;  3SQV A;  2VTB B;  2KZT A;  4AEZ C;  3CHS A;  3DEO A;  3MEK A;  4U96 D;  4UI9 K;  3FWV A;  5ENR D;  4BX8 A;  2WXO A;  3L22 A;  4EBA G;  4Z68 A;  2I1K A;  4L2L A;  1SW6 A;  2GRN B;  2V8S E;  4GTS A;  3ASO E;  3FTZ A;  2MHK A;  2IJG X;  3QNK A;  4U7E B;  4GA0 A;  4U8Y D;  2CHX A;  4WWO A;  3W9G A;  3TG4 A;  1EYH A;  4B8C B;  3L13 A;  1UW4 B;  4YDE A;  1N54 A;  2CHZ A;  1Z3X A;  5C1D A;  1O5M A;  3CVX A;  3EHM A;  3ZXP A;  4O1P A;  3FUH A;  3HXC A;  4GCN A;  2IOS A;  2PNN A;  4J8F A;  3FUK A;  5EKQ D;  3E33 A;  1IHB A;  4E85 A;  3APF A;  4HRN A;  3L6A A;  1JPL A;  2ZXW E;  5FZQ A;  2VJ8 A;  4GTT A;  4K5A B;  3LJN A;  3PVL A;  1DC2 A;  3CSF A;  2BED A;  2KZT B; 
#chains in the Genus database with same CATH homology
 1OCZ E;  1OCC E;  2EIM E;  5B1A E;  3ABK E;  3AG1 E;  3AG2 E;  1V54 E;  2EIL E;  2EIK E;  3AG3 E;  1V55 E;  5IY5 E;  2DYS E;  2Y69 E;  2ZXW E;  2DYR E;  2OCC E;  3WG7 E;  5B1B E;  2EIJ E;  3AG4 E;  3ASN E;  3ABL E;  1OCR E;  5B3S E;  3ASO E;  3ABM E;  3X2Q E;  2EIN E;  1OCO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...