1OCRE

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
b'SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1ocrE00
2DYRE 3WG7E 2ZXWE 3ASNE 5B1BE 5B1AE 1OCZE 1OCRE 3ABLE 1V54E 2Y69E 3AG2E 1OCOE 2EIJE 3AG3E 1OCCE 5B3SE 2EIKE 3X2QE 3AG1E 2EILE 3ASOE 2OCCE 3ABKE 2EINE 5IY5E 2DYSE 3ABME 1V55E 2EIME 3AG4E
chains in the Genus database with same CATH superfamily
1IXVA 2XEEA 4Q69A 3RKVA 5HRYA 5G04J 4OAUC 3L54A 3RRNB 3FTZA 3RK6A 4K0RA 2IOSA 3CV0A 3TWUA 3V79K 3ASOE 1DCEA 4WNGA 1OWMA 5EILA 3UTMA 1S0PA 2A4ZA 3AS5A 3SGHA 4A63B 2GRLA 4JW1A 1IQUA 3FFLA 3UKRG 2Y4UA 3D9JA 2KZTA 2P58C 4HFGA 3LEWA 3EJNA 1BD8A 1A5EA 3GZSA 4DRXE 5A6CA 1Z3XA 2ZISA 4N3AA 3PZDA 1BLXB 3MKQA 3Q5MA 3E4BA 3PZ2A 2PM7A 5KJLA 2LNIA 3FH5A 3B7UX 1SQMA 4G8LA 2V4LA 2P9IG 4H7XA 3LY7A 4GTVA 1E96B 3FEXA 2B0OE 3RO3A 3NOCD 3IBEA 3PEVB 5E75A 3FU0A 1D9SA 3UT7A 2Y69E 1U3CA 2AXZA 2WMNA 2EILE 2FEZA 1KLXA 5KJNA 3AS4A 3IKOB 4N3CA 3SZ7A 4MKTA 4J8FA 4HXIA 4GPKA 4CCAA 2WQ6A 3KS2A 3NB2A 3KSQA 5ENOD 3EHRA 3CVLA 1LF8A 3PZ4A 2DCPA 4EZJA 1TJCA 4EHMA 2X6IA 1INZA 3UM0A 4QFVA 2PL2A 4IN3B 4GTTA 1TNYA 5BT1A 4L1BA 3UM2A 2Y4TA 1UN9A 3D3MA 1O5MA 4KMOA 5G55A 3ASNE 2ILRA 5G05C 3T8KA 5KCMA 2BUGA 3CHRA 2XHEA 4WWPA 2X6KA 3HXBA 3I4GA 4ANVA 4J8DA 4I1MA 4U95D 3ZXSA 3FTUA 5FZSA 3DSVA 4FA6A 3GW4A 3S7BA 1W3BA 1OY3D 3CHSA 4AY6A 1N11A 4HOSA 2UY1B 1XNFA 1O1SA 5E76A 2QZAA 2J07A 5BXOA 1N52A 3ZNGA 4HRLA 4PS7A 3D9HA 4DI3A 2XZDG 5ANLA 3LCAA 3DSUA 3T9KA 3FUDA 4G23A 2IFUA 2NXPA 3PH0C 2VQ2A 2LSUA 4I2WA 3ZHEA 3ONLA 2L0IA 2L6BA 4UUCA 3Q9UC 4XEIG 5BW8C 4OVUA 2KCLA 1JPLA 2KATA 4C48B 2WXRA 2PQNA 2F8YA 4AV7A 2JEKA 2AWIA 3FUIA 5KWDA 3R7QA 5J08A 3PZ3A 3Q9NC 5EDSA 4NACA 4GTMA 2X38A 2BEDA 4DJAA 2IY0C 1FVFA 3KEZA 1IQRA 3FHEA 3LDZA 3CVYA 4JD2G 5EIBE 4U8YD 2GRRB 2UWJG 2R5SA 4BEPA 2IONA 1WM5A 2XZTG 2GRNB 2JABA 2PNNA 3FUHA 4XKCA 1OT8A 2KCKA 3NAWA 3QWPA 4BX9A 3OTNA 3EIQC 4PH4B 2DIWA 4ACKA 3Q7AA 3DXKG 4TXQA 3FWVA 3JXJA 4U0UA 2B6CA 4HQDA 3UPVA 4DX2A 4B93B 3EDTB 4HS2A 3LY9A 3KSLA 3QK0A 4GZ5A 4N3BA 3MA5A 2J49A 3GYZA 3CHOA 4RVBA 1H2TC 5BPPA 4XI9A 3BG1B 4RLYA 3VTXA 2VJ8A 3QDNA 4Y6CA 3ML8A 3L82A 2YNQA 1V55E 3CQGB 3UUXA 1MQSA 4I1OB 3UI2A 1E8WA 3ZYMA 3E32A 4JHJA 3C98A 1TN6A 3QB2A 5AIJA 5ENRD 1KT1A 1E8YA 1KZPA 3NF1A 4L9PA 4N39A 1TR4A 2EIME 4Y6WA 3UIOC 4HOQA 3B95A 2ETCA 4KVMA 4KYOB 3N71A 3O48A 4U96D 4U04A 1K8KG 3D9MA 5HI7A 3V2OA 3NOGD 5ENSD 5CEDB 4G25A 3CHPA 2AXUA 2RG8A 4FJZA 4HLLA 4TRQA 3S7JA 4A3VA 5AENA 4FC8A 4B0ZA 4ILIA 3U4TA 4G11A 3RU0A 3FTWA 1FT1A 4GTPA 1E8XA 1JUQA 3SF4A 2EIKE 4LCTA 3LVRE 5ARGA 3CVNA 5ENQD 3MZLB 1HO8A 5HQ8A 2WXMA 3EIJA 2WQ7A 2ZU6B 4B94A 3QWWA 1QYMA 2AJAA 1V54E 1MZCA 3RAUA 5CCLA 3V30A 3JYSA 2EQXA 3D9LA 3QKYA 4LNBA 4RG6A 4I6JA 4J6IA 2I1JA 3SHFA 4CGWA 1S64A 2NC9A 4N5CA 3EU5A 3DSTA 4I9CA 4AEZC 3S2AA 3DEPA 4DX5D 3IEGA 4JHKA 4GMRA 3Q75A 3QARA 4UWLA 2YQ8A 2F37A 2GGFA 3ULQA 3HXDA 1QNFA 3UMVA 2XENA 4JA9A 5CECB 4CDNA 5LCWC 4C9BB 2LUHA 1HG2A 3ZYLA 4CT0A 3W9GA 3QAQA 4DLQA 2J4DA 4IULA 3WG7E 5G05J 2I9CA 2VGXA 4DUIA 1OWLA 4GA2A 3T5VA 1N94A 1TN7A 2WM9A 4WNFA 1SA5A 2IU1A 4TV3A 3HVEA 4APFA 3FTVA 3R9MA 4GTOA 3E30A 3PVLA 1RZ4A 5FT9A 2VSYA 5BV0A 4GCOA 1KT0A 4UWGA 4WWOA 3UKUG 4DLOA 5AARA 5C1DA 1PY1A 2CG3A 2YHEA 4Q94A 4AVXA 2YINA 2QFCA 3UINC 1NFIE 3ZU7B 1YYHA 2P9NG 1DCQA 1N9AA 1H2UA 5DIZA 3TWVA 3DWLG 5KJKA 4JHRA 1H6OA 3ONKA 4PS8A 4JA7A 4X8QA 3ZGQA 5IY5E 4BERA 5LP0A 2AW6A 3CGHA 1HE8A 2ZXWE 3SQVA 3IXEA 4EZKA 3ASGA 3ULYA 4GTQA 3FU6A 4TUUA 2Y3AA 2WXPA 2WPVA 2DZOA 2J4BA 4LNUD 3FUKA 5JA4D 3CEQA 5AYWD 1EPUA 3AU4A 4B8CB 1NZNA 2ETAA 4FU3A 3JUEA 3MV3B 3CLJA 2IQCA 4EBAA 1UOHA 4F3VA 4GCNA 4HI8A 2MOWA 1N54A 1S70B 4V3IA 3SFZA 5A23A 3CR3A 4L2YA 4O6FA 3TGOA 4ATGA 3EU9A 2J9QA 3MYVA 3AG3E 5JJTA 2UY1A 4G1TA 2WXGA 3UXGA 4DX1A 3SBTB 4GPMA 2DYSE 4BT9A 3C3QA 3ZRHA 3ZXPA 2WXKA 4OVVA 1U3DA 2RFAA 2P9KG 2WXOA 3OAWA 4GZ6A 3J5PA 2M63A 1K1BA 3MJWA 4FJYA 3MGBA 4UI9K 2OEWA 1DNPA 3QJZA 1N4RA 2HM8A 5D0OD 2I1KA 3IHYA 1N4SA 4U8VD 1FT2A 3FU3A 1UW4B 3L08A 3C3RA 2A5UA 3G2WA 1JCSA 3SNXA 1TEZA 3TWQA 4EPZA 4BSXA 2CFUA 4AY5A 3HYMB 1FCHA 2IF4A 4NRHB 3TWWA 2VGEA 1EYHA 3ISMC 4HOTA 2C2LA 5AQ7A 1OWNA 4ILGA 4GYWA 4EBAG 1ELRA 3DXMG 3MKQB 4MRUA 5LX8A 5J90A 4HI9A 3Q73A 4I6EA 1OWOA 3SO8A 3KD7A 3L6AA 2P9PG 4WNDA 3PNTB 3C5RA 4F53A 3APDA 2J09A 5CMYA 3QWVA 5T3RA 3FUJA 1TN8A 3CVUA 2FI7A 3L13A 1D8EA 3P2BA 2XCBA 4KBQA 3HXCA 3D9PA 2P9SG 5CRVA 4ANWA 1HG5A 1MX6A 4ATZD 4F1PA 2ETBA 3CVPA 2VSXE 4I9EA 2R03A 4KXKB 3ZN3A 1A17A 4UWKA 3R7RA 4J8YA 3V31A 5AJDA 2Y0BG 2J8SD 3I3NA 3S7DA 3LXUX 3X2QE 1NA0A 4LG6A 1JCQA 5ENNA 4JPSA 2XEHA 3ZYKA 4U07A 4CT4A 3JUIA 3OXFA 2I2OA 5CBNA 1E7UA 3LKUA 4GA1A 4EECA 1D8DA 5LCWJ 4JEUA 3C3OA 2V5QC 3ZYQA 2WB2A 3DEOA 3AAAC 1IYGA 4G24A 4K5AB 4HRMB 1XGWA 1DVPA 1N95A 3PZ1A 1NI1A 2VSNA 2DZNA 3DSWA 4D10C 4GYOA 3FTYA 4O1OA 1Z3YA 3J5QB 4HB5A 5CERB 2I6HA 3CSTA 4UQXA 3PUKA 3BQOA 2AXVA 3CVVA 3ZUVB 4NIKA 3SFXA 1WY6A 3ASDA 5CHEE 2WXIA 4CRWA 3BUAA 2AVPA 1NA3A 4L23A 1YMPA 3LYAA 4O60A 2DYRE 3ZIMA 1Y6IA 3NQPA 3CVWA 3VLEA 2GRPB 1UJJA 5CMWA 2NYJA 4A3TA 4P29A 2OCCE 3TWSA 2WXFA 2QC9A 1G3NB 4DI4A 3B7BA 4JXTA 3UT4A 4CZ2D 2FF4A 3C72A 4G26A 5EN5D 3CK7A 4NQ0A 1HFAA 3TXMA 5FJYA 2V4HC 1OUVA 3F6QA 1UJKA 2RFMA 2LAHA 3PEUB 3TWTA 2WQHA 1Z5SC 3DRAA 4UI9C 4BFRA 1GW6A 5LFAA 4HORA 4BSZB 3L9TA 2ZGGA 2LXLA 3HXFA 3ULEG 3ASHA 2P2CP 3E33A 5FQ8A 4TUMA 3LS8A 3LJNA 1MX4A 5CCMA 2L0TB 4URKA 4U0ZA 4N5QA 4R7LA 3CK8A 3APFA 3FUFA 3TWXA 2WXQA 3V2XA 3IV0A 4DX7D 3U66A 4L2LA 4ANUA 3RSEG 5HKPA 1IKND 4KZCA 2HE0A 2R05A 5AQ9A 3URZA 2FBNA 1BU9A 4FHJA 2VGYA 3DSXA 4O1PA 4GB9A 4JB8P 2OVFA 4PUCA 1OCRE 2XPYA 3QC1A 4UWFA 2X6FA 3D9KA 4GYYA 1MJ0A 4AXHA 1HXIA 4KT6B 2HR2A 1TYQG 1SVXA 3Q47B 4ZFHA 2IJGX 2V5FA 3SI5A 3G2TA 4BTBA 2XCCA 4WAFA 2FO1E 5EX0A 4C0EA 5HS0A 1DC2A 4K5CA 4HLEA 2V8SE 1U2VG 4GTSA 3HRAA 3AJIA 2Y1LE 3QNKA 3GZ1A 4HVBA 3ASFA 3FEYA 1AP7A 4BY6A 1X5BA 2XS8A 3FULA 2QYUA 3EUVA 1BI8B 4FHKA 5ANRA 3G2UA 1YCSB 3TG5A 2OOEA 4ACLA 3ABME 5EIDA 2R17C 1H0AA 5FQ6A 3TG4A 3D9NA 4YDOA 2BF0X 1OCOE 2ZGDA 3RJVA 3CK9A 2QY7A 3BU8A 3GZ2A 3OXLA 2RKKA 3E37A 3LVQE 4BTAA 1N0RA 2BTDA 2HYZA 4XZ4A 5T8IA 1FVHA 1MYOA 3UIPC 5KJMA 3IHVA 3ESKA 4U8HA 5KNGA 4MS6A 5JHBA 4G8KA 4J7WA 1HX8A 1L5JA 1HS6A 3HIZA 1BI7B 4LEUA 5AN8A 1TNOA 3ESLA 1QBQA 2PQRA 3ENEA 2X3MA 2OV8A 2DVWA 2CHZA 2WXJA 3UM1A 1N4PA 3I4RB 2CG2A 4A55A 1YA0A 2XRZA 4UWHA 5AQAA 4B8AA 4PDXA 3FTXA 5CRUA 2CFZA 3Q79A 3Q15A 3HG0D 3PNLB 4FADA 5D0QD 4LUNU 4KZ0A 2R2LA 5EX3A 1TJFA 2VGXB 3TAXA 5JJ6A 4FLBA 1OCZE 3ZEFA 4DX6D 1N4QA 3TJPA 2C0LA 1S63A 1B89A 4QQIA 3VTYA 4KVOA 4DPRA 1LTXA 3HVEB 2KC7A 2EINE 3CHMA 3T8MA 2VTBB 5BXUA 4XE0A 3MCXA 4F6RD 4N2SA 1HH8A 4UQZA 4JZYA 1OCCE 1E8ZA 3B13A 2WXHA 3WXXA 4ME2A 3PRZA 2L9BA 4HOUA 3Q49B 3PE3A 3B7SA 4YDEA 4M3OA 4YVOA 3SD5A 1SZ9A 1HU3A 4A1SA 3EHNA 5BV1A 3PREA 4LRZA 2QYJA 3D9IA 3CHQA 4Z68A 2X6JA 4YDWA 2PZIA 3NZSA 3LY8A 3U64A 4LSZE 3NBNB 4APOA 4WNEA 3ABKE 5KBAA 4GZCA 3S7FA 5ARFA 5G2NA 3AG4E 1BPOA 5FTPA 4FULA 4YVQC 4W9RA 4U7EB 1JCRA 1HF8A 1Q2ZA 2WMOA 1MX2A 3FUMA 4HBDA 2KZTB 4GMLA 2KCVA 2WVIA 4PS3A 3W9FA 2MYOA 2H6GA 1WDYA 3FUNA 3CVQA 5T4YA 3BG0B 4GZ3A 2XQ0A 2WXNA 3JQ1A 4LNGA 2IO2C 4UI9J 3PS6A 1VDYA 3TL5A 3G2VA 4I17A 3LJ3A 3SBSA 3FDHA 3DSSA 3L17A 1MHQA 5FQ7A 1QZ2A 5ITZF 2NSZA 4M7CA 4N2QA 1LD8A 3HXEA 4GZDA 4WUYA 3AG2E 3PDNA 3QOUA 5FQ4A 2OEVA 2RD0A 3PE4A 4FLHA 5EYPF 4E6HA 1SW6A 1AWCB 5G04C 4AP2A 3CVXA 2GRMA 4GA0A 2H6HA 3ABLE 2V0PA 3RRUA 2JLBA 2HO1A 5JMND 3L22A 3CSFA 4JC8A 3ZW3A 3DPYA 1O1TA 3RIBA 3FY4A 3AU5A 2XGOA 4I6GA 2J08A 3FU5A 1H19A 5B1AE 4YDYA 2KXPC 4I1AA 1SA4A 2C0MA 1TNUA 3PUJA 1NL4A 3TWRA 4J8EA 4EZLA 3FH7A 3MKRA 5H7PA 3MV2B 2F0YA 4CDRA 4OAVB 2P9UG 2VYIA 1NP7A 2IEJA 4IYPA 3L16A 2MRIA 3ZKJA 4Q96A 2FULA 4XKBA 3KAEA 1UG3A 3UQ3A 2MHKA 4EQFA 1E90A 3VLFA 2OVBA 1OWPA 3MX3A 1PAQA 2GW1A 5BNWA 3Q4AB 4YNDA 3CKCA 3UM3A 2XPZA 3MEKA 1WAO1 4H7YA 3UX4A 1ZBPA 4U0SA 3AS8A 1ZU2A 3ML9A 3R9AB 2XGSA 4BX8A 4F7AA 4UQYA 5ENPD 3FP3A 1EF1C 4K03A 1KPSB 4LERA 4GTRA 3TXNA 5B1BE 2DBAA 4RSYA 2E0IA 4JVSA 2CHXA 5B3SE 3ZHEB 1ELKA 3CIAA 2XS1A 4RG9A 2X6HA 2KBXA 5CEAA 3RO2A 4BWRA 1RW2A 2H6IA 5C2YA 2KM4A 3B7TA 5CBOA 3RRMB 4GMJA 3HHMA 3NZUA 4NURA 3T5XA 1JWFA 3KEAA 3E34A 3D9OA 4C0MA 3EHMA 1KZOA 5AAOA 1TNZA 3U9WA 4E85A 1SZAA 3LPZA 5FINA 5FZQA 3EHQA 1K3ZD 4J8SA 4FP7A 3VLDA 1ZB1A 5D2MC 1JWGA 4ILHB 2E2EA 4I43A 2P9LG 4TXPA 4GU5A 4HRNA 1FPPA 3JQ0A 4JEHA 1TNBA 1Z6TA 1H2VC 1N0QA 4MLPA 5A7DB 3JCKC 3DPDA 1HZ4A 2R02A 5D66A 4ANXA 4RQIA 4K5BA 2CHWA 4AM9A 1IHGA 5AJLA 3U3WA 5JHAA 2BKGA 3P1UA 3HDXA 1IHBA 2A5EA 2EIJE 4WWNA 4U63A 1QQEA 3Q78A 2DWZA 3AG1E 2L6JA 4L7TA 5JJ7A 2LAIA 5DBKA 2R59A 3Q7FA 4CEMA 3CKBA 4AIFA 5EYLA 3I5PA 3K9IA 4J0UA 4AJWA 1PC2A 4ZHBA 5EKQD 3ZVVA 5KNHD 5LOZA 4I2ZA 4OYSA 3FUEA 4B89A 5BUZA 4AOFA 4IRUA 2ONDA 2GRQB 4MBGA 4DK5A 2XPIA 3CQCB 2LO6A 1K1AA 3B7RL 3G2SA 1Y8MA 1OXJA 3O4ZA 4JL0A 3JXIA 4A1GA 4BT8A 2YHCA 3BEEA 2XEVA 2IOLA 2GROB 2PM6A 3UT8A 5FWQA 4XIFA 5ENTD 2ZIRA 5M72A 4ABNA 1E7VA 3SY2A 4F1SA 2LXMA 4GAAA 2XRYA 4BETA 3OXGA 1UN8A 3SFYA 4CYMD 5FIOA 4TXRA 1O1RA 3FTSA 2WXLA 2H6FA 2FO7A 1LD7A 5FZRA 3ZPJA 4BESA 3APCA 1WG0A 4G2VA 1EDUA 4XX5A 3FH8A 2VTBA 2Q7FA 1X81A 4HNAD 2VSOE 4XI0A 2IO3C 3ZFWA 4CGVA 2XGMA 1H6KA 2BKKB 2LSVA 1H6PA 1ELWA 1P5QA 3DBSA 2F8XK 5AQBA 4CDMA
chains in the Genus database with same CATH topology
2DYRE 3WG7E 2ZXWE 3ASNE 5B1BE 5B1AE 1OCZE 1OCRE 3ABLE 1V54E 2Y69E 3AG2E 1OCOE 2EIJE 3AG3E 1OCCE 5B3SE 2EIKE 3X2QE 3AG1E 2EILE 3ASOE 2OCCE 3ABKE 2EINE 5IY5E 2DYSE 3ABME 1V55E 2EIME 3AG4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR E;  3WG7 E;  2ZXW E;  3ASN E;  5B1B E;  5B1A E;  1OCZ E;  1OCR E;  3ABL E;  1V54 E;  2Y69 E;  3AG2 E;  1OCO E;  2EIJ E;  3AG3 E;  1OCC E;  5B3S E;  2EIK E;  3X2Q E;  3AG1 E;  2EIL E;  3ASO E;  2OCC E;  3ABK E;  2EIN E;  5IY5 E;  2DYS E;  3ABM E;  1V55 E;  2EIM E;  3AG4 E; 
#chains in the Genus database with same CATH topology
 1IXV A;  2XEE A;  4Q69 A;  3RKV A;  5HRY A;  5G04 J;  4OAU C;  3L54 A;  3RRN B;  3FTZ A;  3RK6 A;  4K0R A;  2IOS A;  3CV0 A;  3TWU A;  3V79 K;  3ASO E;  1DCE A;  4WNG A;  1OWM A;  5EIL A;  3UTM A;  1S0P A;  2A4Z A;  3AS5 A;  3SGH A;  4A63 B;  2GRL A;  4JW1 A;  1IQU A;  3FFL A;  3UKR G;  2Y4U A;  3D9J A;  2KZT A;  2P58 C;  4HFG A;  3LEW A;  3EJN A;  1BD8 A;  1A5E A;  3GZS A;  4DRX E;  5A6C A;  1Z3X A;  2ZIS A;  4N3A A;  3PZD A;  1BLX B;  3MKQ A;  3Q5M A;  3E4B A;  3PZ2 A;  2PM7 A;  5KJL A;  2LNI A;  3FH5 A;  3B7U X;  1SQM A;  4G8L A;  2V4L A;  2P9I G;  4H7X A;  3LY7 A;  4GTV A;  1E96 B;  3FEX A;  2B0O E;  3RO3 A;  3NOC D;  3IBE A;  3PEV B;  5E75 A;  3FU0 A;  1D9S A;  3UT7 A;  2Y69 E;  1U3C A;  2AXZ A;  2WMN A;  2EIL E;  2FEZ A;  1KLX A;  5KJN A;  3AS4 A;  3IKO B;  4N3C A;  3SZ7 A;  4MKT A;  4J8F A;  4HXI A;  4GPK A;  4CCA A;  2WQ6 A;  3KS2 A;  3NB2 A;  3KSQ A;  5ENO D;  3EHR A;  3CVL A;  1LF8 A;  3PZ4 A;  2DCP A;  4EZJ A;  1TJC A;  4EHM A;  2X6I A;  1INZ A;  3UM0 A;  4QFV A;  2PL2 A;  4IN3 B;  4GTT A;  1TNY A;  5BT1 A;  4L1B A;  3UM2 A;  2Y4T A;  1UN9 A;  3D3M A;  1O5M A;  4KMO A;  5G55 A;  3ASN E;  2ILR A;  5G05 C;  3T8K A;  5KCM A;  2BUG A;  3CHR A;  2XHE A;  4WWP A;  2X6K A;  3HXB A;  3I4G A;  4ANV A;  4J8D A;  4I1M A;  4U95 D;  3ZXS A;  3FTU A;  5FZS A;  3DSV A;  4FA6 A;  3GW4 A;  3S7B A;  1W3B A;  1OY3 D;  3CHS A;  4AY6 A;  1N11 A;  4HOS A;  2UY1 B;  1XNF A;  1O1S A;  5E76 A;  2QZA A;  2J07 A;  5BXO A;  1N52 A;  3ZNG A;  4HRL A;  4PS7 A;  3D9H A;  4DI3 A;  2XZD G;  5ANL A;  3LCA A;  3DSU A;  3T9K A;  3FUD A;  4G23 A;  2IFU A;  2NXP A;  3PH0 C;  2VQ2 A;  2LSU A;  4I2W A;  3ZHE A;  3ONL A;  2L0I A;  2L6B A;  4UUC A;  3Q9U C;  4XEI G;  5BW8 C;  4OVU A;  2KCL A;  1JPL A;  2KAT A;  4C48 B;  2WXR A;  2PQN A;  2F8Y A;  4AV7 A;  2JEK A;  2AWI A;  3FUI A;  5KWD A;  3R7Q A;  5J08 A;  3PZ3 A;  3Q9N C;  5EDS A;  4NAC A;  4GTM A;  2X38 A;  2BED A;  4DJA A;  2IY0 C;  1FVF A;  3KEZ A;  1IQR A;  3FHE A;  3LDZ A;  3CVY A;  4JD2 G;  5EIB E;  4U8Y D;  2GRR B;  2UWJ G;  2R5S A;  4BEP A;  2ION A;  1WM5 A;  2XZT G;  2GRN B;  2JAB A;  2PNN A;  3FUH A;  4XKC A;  1OT8 A;  2KCK A;  3NAW A;  3QWP A;  4BX9 A;  3OTN A;  3EIQ C;  4PH4 B;  2DIW A;  4ACK A;  3Q7A A;  3DXK G;  4TXQ A;  3FWV A;  3JXJ A;  4U0U A;  2B6C A;  4HQD A;  3UPV A;  4DX2 A;  4B93 B;  3EDT B;  4HS2 A;  3LY9 A;  3KSL A;  3QK0 A;  4GZ5 A;  4N3B A;  3MA5 A;  2J49 A;  3GYZ A;  3CHO A;  4RVB A;  1H2T C;  5BPP A;  4XI9 A;  3BG1 B;  4RLY A;  3VTX A;  2VJ8 A;  3QDN A;  4Y6C A;  3ML8 A;  3L82 A;  2YNQ A;  1V55 E;  3CQG B;  3UUX A;  1MQS A;  4I1O B;  3UI2 A;  1E8W A;  3ZYM A;  3E32 A;  4JHJ A;  3C98 A;  1TN6 A;  3QB2 A;  5AIJ A;  5ENR D;  1KT1 A;  1E8Y A;  1KZP A;  3NF1 A;  4L9P A;  4N39 A;  1TR4 A;  2EIM E;  4Y6W A;  3UIO C;  4HOQ A;  3B95 A;  2ETC A;  4KVM A;  4KYO B;  3N71 A;  3O48 A;  4U96 D;  4U04 A;  1K8K G;  3D9M A;  5HI7 A;  3V2O A;  3NOG D;  5ENS D;  5CED B;  4G25 A;  3CHP A;  2AXU A;  2RG8 A;  4FJZ A;  4HLL A;  4TRQ A;  3S7J A;  4A3V A;  5AEN A;  4FC8 A;  4B0Z A;  4ILI A;  3U4T A;  4G11 A;  3RU0 A;  3FTW A;  1FT1 A;  4GTP A;  1E8X A;  1JUQ A;  3SF4 A;  2EIK E;  4LCT A;  3LVR E;  5ARG A;  3CVN A;  5ENQ D;  3MZL B;  1HO8 A;  5HQ8 A;  2WXM A;  3EIJ A;  2WQ7 A;  2ZU6 B;  4B94 A;  3QWW A;  1QYM A;  2AJA A;  1V54 E;  1MZC A;  3RAU A;  5CCL A;  3V30 A;  3JYS A;  2EQX A;  3D9L A;  3QKY A;  4LNB A;  4RG6 A;  4I6J A;  4J6I A;  2I1J A;  3SHF A;  4CGW A;  1S64 A;  2NC9 A;  4N5C A;  3EU5 A;  3DST A;  4I9C A;  4AEZ C;  3S2A A;  3DEP A;  4DX5 D;  3IEG A;  4JHK A;  4GMR A;  3Q75 A;  3QAR A;  4UWL A;  2YQ8 A;  2F37 A;  2GGF A;  3ULQ A;  3HXD A;  1QNF A;  3UMV A;  2XEN A;  4JA9 A;  5CEC B;  4CDN A;  5LCW C;  4C9B B;  2LUH A;  1HG2 A;  3ZYL A;  4CT0 A;  3W9G A;  3QAQ A;  4DLQ A;  2J4D A;  4IUL A;  3WG7 E;  5G05 J;  2I9C A;  2VGX A;  4DUI A;  1OWL A;  4GA2 A;  3T5V A;  1N94 A;  1TN7 A;  2WM9 A;  4WNF A;  1SA5 A;  2IU1 A;  4TV3 A;  3HVE A;  4APF A;  3FTV A;  3R9M A;  4GTO A;  3E30 A;  3PVL A;  1RZ4 A;  5FT9 A;  2VSY A;  5BV0 A;  4GCO A;  1KT0 A;  4UWG A;  4WWO A;  3UKU G;  4DLO A;  5AAR A;  5C1D A;  1PY1 A;  2CG3 A;  2YHE A;  4Q94 A;  4AVX A;  2YIN A;  2QFC A;  3UIN C;  1NFI E;  3ZU7 B;  1YYH A;  2P9N G;  1DCQ A;  1N9A A;  1H2U A;  5DIZ A;  3TWV A;  3DWL G;  5KJK A;  4JHR A;  1H6O A;  3ONK A;  4PS8 A;  4JA7 A;  4X8Q A;  3ZGQ A;  5IY5 E;  4BER A;  5LP0 A;  2AW6 A;  3CGH A;  1HE8 A;  2ZXW E;  3SQV A;  3IXE A;  4EZK A;  3ASG A;  3ULY A;  4GTQ A;  3FU6 A;  4TUU A;  2Y3A A;  2WXP A;  2WPV A;  2DZO A;  2J4B A;  4LNU D;  3FUK A;  5JA4 D;  3CEQ A;  5AYW D;  1EPU A;  3AU4 A;  4B8C B;  1NZN A;  2ETA A;  4FU3 A;  3JUE A;  3MV3 B;  3CLJ A;  2IQC A;  4EBA A;  1UOH A;  4F3V A;  4GCN A;  4HI8 A;  2MOW A;  1N54 A;  1S70 B;  4V3I A;  3SFZ A;  5A23 A;  3CR3 A;  4L2Y A;  4O6F A;  3TGO A;  4ATG A;  3EU9 A;  2J9Q A;  3MYV A;  3AG3 E;  5JJT A;  2UY1 A;  4G1T A;  2WXG A;  3UXG A;  4DX1 A;  3SBT B;  4GPM A;  2DYS E;  4BT9 A;  3C3Q A;  3ZRH A;  3ZXP A;  2WXK A;  4OVV A;  1U3D A;  2RFA A;  2P9K G;  2WXO A;  3OAW A;  4GZ6 A;  3J5P A;  2M63 A;  1K1B A;  3MJW A;  4FJY A;  3MGB A;  4UI9 K;  2OEW A;  1DNP A;  3QJZ A;  1N4R A;  2HM8 A;  5D0O D;  2I1K A;  3IHY A;  1N4S A;  4U8V D;  1FT2 A;  3FU3 A;  1UW4 B;  3L08 A;  3C3R A;  2A5U A;  3G2W A;  1JCS A;  3SNX A;  1TEZ A;  3TWQ A;  4EPZ A;  4BSX A;  2CFU A;  4AY5 A;  3HYM B;  1FCH A;  2IF4 A;  4NRH B;  3TWW A;  2VGE A;  1EYH A;  3ISM C;  4HOT A;  2C2L A;  5AQ7 A;  1OWN A;  4ILG A;  4GYW A;  4EBA G;  1ELR A;  3DXM G;  3MKQ B;  4MRU A;  5LX8 A;  5J90 A;  4HI9 A;  3Q73 A;  4I6E A;  1OWO A;  3SO8 A;  3KD7 A;  3L6A A;  2P9P G;  4WND A;  3PNT B;  3C5R A;  4F53 A;  3APD A;  2J09 A;  5CMY A;  3QWV A;  5T3R A;  3FUJ A;  1TN8 A;  3CVU A;  2FI7 A;  3L13 A;  1D8E A;  3P2B A;  2XCB A;  4KBQ A;  3HXC A;  3D9P A;  2P9S G;  5CRV A;  4ANW A;  1HG5 A;  1MX6 A;  4ATZ D;  4F1P A;  2ETB A;  3CVP A;  2VSX E;  4I9E A;  2R03 A;  4KXK B;  3ZN3 A;  1A17 A;  4UWK A;  3R7R A;  4J8Y A;  3V31 A;  5AJD A;  2Y0B G;  2J8S D;  3I3N A;  3S7D A;  3LXU X;  3X2Q E;  1NA0 A;  4LG6 A;  1JCQ A;  5ENN A;  4JPS A;  2XEH A;  3ZYK A;  4U07 A;  4CT4 A;  3JUI A;  3OXF A;  2I2O A;  5CBN A;  1E7U A;  3LKU A;  4GA1 A;  4EEC A;  1D8D A;  5LCW J;  4JEU A;  3C3O A;  2V5Q C;  3ZYQ A;  2WB2 A;  3DEO A;  3AAA C;  1IYG A;  4G24 A;  4K5A B;  4HRM B;  1XGW A;  1DVP A;  1N95 A;  3PZ1 A;  1NI1 A;  2VSN A;  2DZN A;  3DSW A;  4D10 C;  4GYO A;  3FTY A;  4O1O A;  1Z3Y A;  3J5Q B;  4HB5 A;  5CER B;  2I6H A;  3CST A;  4UQX A;  3PUK A;  3BQO A;  2AXV A;  3CVV A;  3ZUV B;  4NIK A;  3SFX A;  1WY6 A;  3ASD A;  5CHE E;  2WXI A;  4CRW A;  3BUA A;  2AVP A;  1NA3 A;  4L23 A;  1YMP A;  3LYA A;  4O60 A;  2DYR E;  3ZIM A;  1Y6I A;  3NQP A;  3CVW A;  3VLE A;  2GRP B;  1UJJ A;  5CMW A;  2NYJ A;  4A3T A;  4P29 A;  2OCC E;  3TWS A;  2WXF A;  2QC9 A;  1G3N B;  4DI4 A;  3B7B A;  4JXT A;  3UT4 A;  4CZ2 D;  2FF4 A;  3C72 A;  4G26 A;  5EN5 D;  3CK7 A;  4NQ0 A;  1HFA A;  3TXM A;  5FJY A;  2V4H C;  1OUV A;  3F6Q A;  1UJK A;  2RFM A;  2LAH A;  3PEU B;  3TWT A;  2WQH A;  1Z5S C;  3DRA A;  4UI9 C;  4BFR A;  1GW6 A;  5LFA A;  4HOR A;  4BSZ B;  3L9T A;  2ZGG A;  2LXL A;  3HXF A;  3ULE G;  3ASH A;  2P2C P;  3E33 A;  5FQ8 A;  4TUM A;  3LS8 A;  3LJN A;  1MX4 A;  5CCM A;  2L0T B;  4URK A;  4U0Z A;  4N5Q A;  4R7L A;  3CK8 A;  3APF A;  3FUF A;  3TWX A;  2WXQ A;  3V2X A;  3IV0 A;  4DX7 D;  3U66 A;  4L2L A;  4ANU A;  3RSE G;  5HKP A;  1IKN D;  4KZC A;  2HE0 A;  2R05 A;  5AQ9 A;  3URZ A;  2FBN A;  1BU9 A;  4FHJ A;  2VGY A;  3DSX A;  4O1P A;  4GB9 A;  4JB8 P;  2OVF A;  4PUC A;  1OCR E;  2XPY A;  3QC1 A;  4UWF A;  2X6F A;  3D9K A;  4GYY A;  1MJ0 A;  4AXH A;  1HXI A;  4KT6 B;  2HR2 A;  1TYQ G;  1SVX A;  3Q47 B;  4ZFH A;  2IJG X;  2V5F A;  3SI5 A;  3G2T A;  4BTB A;  2XCC A;  4WAF A;  2FO1 E;  5EX0 A;  4C0E A;  5HS0 A;  1DC2 A;  4K5C A;  4HLE A;  2V8S E;  1U2V G;  4GTS A;  3HRA A;  3AJI A;  2Y1L E;  3QNK A;  3GZ1 A;  4HVB A;  3ASF A;  3FEY A;  1AP7 A;  4BY6 A;  1X5B A;  2XS8 A;  3FUL A;  2QYU A;  3EUV A;  1BI8 B;  4FHK A;  5ANR A;  3G2U A;  1YCS B;  3TG5 A;  2OOE A;  4ACL A;  3ABM E;  5EID A;  2R17 C;  1H0A A;  5FQ6 A;  3TG4 A;  3D9N A;  4YDO A;  2BF0 X;  1OCO E;  2ZGD A;  3RJV A;  3CK9 A;  2QY7 A;  3BU8 A;  3GZ2 A;  3OXL A;  2RKK A;  3E37 A;  3LVQ E;  4BTA A;  1N0R A;  2BTD A;  2HYZ A;  4XZ4 A;  5T8I A;  1FVH A;  1MYO A;  3UIP C;  5KJM A;  3IHV A;  3ESK A;  4U8H A;  5KNG A;  4MS6 A;  5JHB A;  4G8K A;  4J7W A;  1HX8 A;  1L5J A;  1HS6 A;  3HIZ A;  1BI7 B;  4LEU A;  5AN8 A;  1TNO A;  3ESL A;  1QBQ A;  2PQR A;  3ENE A;  2X3M A;  2OV8 A;  2DVW A;  2CHZ A;  2WXJ A;  3UM1 A;  1N4P A;  3I4R B;  2CG2 A;  4A55 A;  1YA0 A;  2XRZ A;  4UWH A;  5AQA A;  4B8A A;  4PDX A;  3FTX A;  5CRU A;  2CFZ A;  3Q79 A;  3Q15 A;  3HG0 D;  3PNL B;  4FAD A;  5D0Q D;  4LUN U;  4KZ0 A;  2R2L A;  5EX3 A;  1TJF A;  2VGX B;  3TAX A;  5JJ6 A;  4FLB A;  1OCZ E;  3ZEF A;  4DX6 D;  1N4Q A;  3TJP A;  2C0L A;  1S63 A;  1B89 A;  4QQI A;  3VTY A;  4KVO A;  4DPR A;  1LTX A;  3HVE B;  2KC7 A;  2EIN E;  3CHM A;  3T8M A;  2VTB B;  5BXU A;  4XE0 A;  3MCX A;  4F6R D;  4N2S A;  1HH8 A;  4UQZ A;  4JZY A;  1OCC E;  1E8Z A;  3B13 A;  2WXH A;  3WXX A;  4ME2 A;  3PRZ A;  2L9B A;  4HOU A;  3Q49 B;  3PE3 A;  3B7S A;  4YDE A;  4M3O A;  4YVO A;  3SD5 A;  1SZ9 A;  1HU3 A;  4A1S A;  3EHN A;  5BV1 A;  3PRE A;  4LRZ A;  2QYJ A;  3D9I A;  3CHQ A;  4Z68 A;  2X6J A;  4YDW A;  2PZI A;  3NZS A;  3LY8 A;  3U64 A;  4LSZ E;  3NBN B;  4APO A;  4WNE A;  3ABK E;  5KBA A;  4GZC A;  3S7F A;  5ARF A;  5G2N A;  3AG4 E;  1BPO A;  5FTP A;  4FUL A;  4YVQ C;  4W9R A;  4U7E B;  1JCR A;  1HF8 A;  1Q2Z A;  2WMO A;  1MX2 A;  3FUM A;  4HBD A;  2KZT B;  4GML A;  2KCV A;  2WVI A;  4PS3 A;  3W9F A;  2MYO A;  2H6G A;  1WDY A;  3FUN A;  3CVQ A;  5T4Y A;  3BG0 B;  4GZ3 A;  2XQ0 A;  2WXN A;  3JQ1 A;  4LNG A;  2IO2 C;  4UI9 J;  3PS6 A;  1VDY A;  3TL5 A;  3G2V A;  4I17 A;  3LJ3 A;  3SBS A;  3FDH A;  3DSS A;  3L17 A;  1MHQ A;  5FQ7 A;  1QZ2 A;  5ITZ F;  2NSZ A;  4M7C A;  4N2Q A;  1LD8 A;  3HXE A;  4GZD A;  4WUY A;  3AG2 E;  3PDN A;  3QOU A;  5FQ4 A;  2OEV A;  2RD0 A;  3PE4 A;  4FLH A;  5EYP F;  4E6H A;  1SW6 A;  1AWC B;  5G04 C;  4AP2 A;  3CVX A;  2GRM A;  4GA0 A;  2H6H A;  3ABL E;  2V0P A;  3RRU A;  2JLB A;  2HO1 A;  5JMN D;  3L22 A;  3CSF A;  4JC8 A;  3ZW3 A;  3DPY A;  1O1T A;  3RIB A;  3FY4 A;  3AU5 A;  2XGO A;  4I6G A;  2J08 A;  3FU5 A;  1H19 A;  5B1A E;  4YDY A;  2KXP C;  4I1A A;  1SA4 A;  2C0M A;  1TNU A;  3PUJ A;  1NL4 A;  3TWR A;  4J8E A;  4EZL A;  3FH7 A;  3MKR A;  5H7P A;  3MV2 B;  2F0Y A;  4CDR A;  4OAV B;  2P9U G;  2VYI A;  1NP7 A;  2IEJ A;  4IYP A;  3L16 A;  2MRI A;  3ZKJ A;  4Q96 A;  2FUL A;  4XKB A;  3KAE A;  1UG3 A;  3UQ3 A;  2MHK A;  4EQF A;  1E90 A;  3VLF A;  2OVB A;  1OWP A;  3MX3 A;  1PAQ A;  2GW1 A;  5BNW A;  3Q4A B;  4YND A;  3CKC A;  3UM3 A;  2XPZ A;  3MEK A;  1WAO 1;  4H7Y A;  3UX4 A;  1ZBP A;  4U0S A;  3AS8 A;  1ZU2 A;  3ML9 A;  3R9A B;  2XGS A;  4BX8 A;  4F7A A;  4UQY A;  5ENP D;  3FP3 A;  1EF1 C;  4K03 A;  1KPS B;  4LER A;  4GTR A;  3TXN A;  5B1B E;  2DBA A;  4RSY A;  2E0I A;  4JVS A;  2CHX A;  5B3S E;  3ZHE B;  1ELK A;  3CIA A;  2XS1 A;  4RG9 A;  2X6H A;  2KBX A;  5CEA A;  3RO2 A;  4BWR A;  1RW2 A;  2H6I A;  5C2Y A;  2KM4 A;  3B7T A;  5CBO A;  3RRM B;  4GMJ A;  3HHM A;  3NZU A;  4NUR A;  3T5X A;  1JWF A;  3KEA A;  3E34 A;  3D9O A;  4C0M A;  3EHM A;  1KZO A;  5AAO A;  1TNZ A;  3U9W A;  4E85 A;  1SZA A;  3LPZ A;  5FIN A;  5FZQ A;  3EHQ A;  1K3Z D;  4J8S A;  4FP7 A;  3VLD A;  1ZB1 A;  5D2M C;  1JWG A;  4ILH B;  2E2E A;  4I43 A;  2P9L G;  4TXP A;  4GU5 A;  4HRN A;  1FPP A;  3JQ0 A;  4JEH A;  1TNB A;  1Z6T A;  1H2V C;  1N0Q A;  4MLP A;  5A7D B;  3JCK C;  3DPD A;  1HZ4 A;  2R02 A;  5D66 A;  4ANX A;  4RQI A;  4K5B A;  2CHW A;  4AM9 A;  1IHG A;  5AJL A;  3U3W A;  5JHA A;  2BKG A;  3P1U A;  3HDX A;  1IHB A;  2A5E A;  2EIJ E;  4WWN A;  4U63 A;  1QQE A;  3Q78 A;  2DWZ A;  3AG1 E;  2L6J A;  4L7T A;  5JJ7 A;  2LAI A;  5DBK A;  2R59 A;  3Q7F A;  4CEM A;  3CKB A;  4AIF A;  5EYL A;  3I5P A;  3K9I A;  4J0U A;  4AJW A;  1PC2 A;  4ZHB A;  5EKQ D;  3ZVV A;  5KNH D;  5LOZ A;  4I2Z A;  4OYS A;  3FUE A;  4B89 A;  5BUZ A;  4AOF A;  4IRU A;  2OND A;  2GRQ B;  4MBG A;  4DK5 A;  2XPI A;  3CQC B;  2LO6 A;  1K1A A;  3B7R L;  3G2S A;  1Y8M A;  1OXJ A;  3O4Z A;  4JL0 A;  3JXI A;  4A1G A;  4BT8 A;  2YHC A;  3BEE A;  2XEV A;  2IOL A;  2GRO B;  2PM6 A;  3UT8 A;  5FWQ A;  4XIF A;  5ENT D;  2ZIR A;  5M72 A;  4ABN A;  1E7V A;  3SY2 A;  4F1S A;  2LXM A;  4GAA A;  2XRY A;  4BET A;  3OXG A;  1UN8 A;  3SFY A;  4CYM D;  5FIO A;  4TXR A;  1O1R A;  3FTS A;  2WXL A;  2H6F A;  2FO7 A;  1LD7 A;  5FZR A;  3ZPJ A;  4BES A;  3APC A;  1WG0 A;  4G2V A;  1EDU A;  4XX5 A;  3FH8 A;  2VTB A;  2Q7F A;  1X81 A;  4HNA D;  2VSO E;  4XI0 A;  2IO3 C;  3ZFW A;  4CGV A;  2XGM A;  1H6K A;  2BKK B;  2LSV A;  1H6P A;  1ELW A;  1P5Q A;  3DBS A;  2F8X K;  5AQB A;  4CDM A; 
#chains in the Genus database with same CATH homology
 2DYR E;  3WG7 E;  2ZXW E;  3ASN E;  5B1B E;  5B1A E;  1OCZ E;  1OCR E;  3ABL E;  1V54 E;  2Y69 E;  3AG2 E;  1OCO E;  2EIJ E;  3AG3 E;  1OCC E;  5B3S E;  2EIK E;  3X2Q E;  3AG1 E;  2EIL E;  3ASO E;  2OCC E;  3ABK E;  2EIN E;  5IY5 E;  2DYS E;  3ABM E;  1V55 E;  2EIM E;  3AG4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...