1TNZA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a rrcvll peptide derived from cdc42 splice isoform-2
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 128
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnzA00
4YDEA 3EUVA 1TNUA 2ZISA 4EHMA 1JCRA 3E34A 3DSUA 3DSSA 3Q78A 1O1RA 3EU5A 2IEJA 1S63A 2H6IA 1O1SA 1N4PA 2H6HA 3DRAA 1X81A 1N94A 3Q75A 1NI1A 1KZPA 3Q79A 1TNOA 3E37A 4GTVA 4GTSA 1LD8A 1TN8A 3Q7FA 3PZ1A 4GTTA 3PZ2A 2ZIRA 2BEDA 1JCSA 1S64A 1TN6A 3DSVA 1TNZA 3SFXA 4LNBA 1N9AA 1LD7A 1MZCA 1JCQA 1FT2A 3HXEA 3PZ3A 3HXDA 3PZ4A 3C72A 2R2LA 1N4RA 1O5MA 2H6FA 1SA4A 1DCEA 3DSTA 1TNBA 3HXFA 1FT1A 4GTRA 4L9PA 1QBQA 3SFYA 3E33A 4LNGA 2H6GA 3HXCA 3Q7AA 1SA5A 4GTOA 1O1TA 4GTQA 1KZOA 1TN7A 4YDOA 4GTMA 1D8DA 3E30A 3DSXA 3KSLA 1N4SA 1D8EA 4MBGA 1NL4A 3Q73A 2F0YA 3KSQA 3DSWA 1TNYA 1FPPA 1LTXA 3HXBA 4GTPA 3DPYA 1N4QA 3E32A 1N95A
chains in the Genus database with same CATH superfamily
3NZSA 3EUVA 3NQPA 1OWMA 3RO2A 1UW4B 3SBSA 5ARGA 3EDTB 3BQOA 2IU1A 3L16A 1N54A 2IJGX 4ANVA 3DSUA 3DWLG 2IONA 2CG2A 3I5PA 4K5CA 3PH0C 3FULA 4ACLA 1HG5A 1E96B 1JWFA 2YHEA 4GYWA 1YA0A 3G2WA 5HS0A 4XI0A 3Q47B 1DCQA 4J8FA 3ML8A 1TN6A 1DC2A 3AG2E 3UT4A 5AN8A 1U3DA 3ABME 4H7XA 4FLBA 5FJYA 4UUCA 1ZU2A 4U8VD 3D3MA 3IKOB 1UOHA 4I1AA 4LUNU 5FQ6A 3S7FA 4J8DA 3SO8A 4F3VA 1E8XA 4HLLA 4BTBA 4F6RD 2WVIA 4A55A 2XGMA 1HS6A 2CFZA 5EYPF 4LNGA 5BNWA 4KVMA 1H6PA 4C48B 4XX5A 2L6BA 2UWJG 4U07A 2OV8A 3UIOC 3TGOA 3ZW3A 4MS6A 1SQMA 1G3NB 3B95A 3AG4E 3KS2A 5AENA 4YDEA 5HKPA 3RKVA 2P9PG 4I1OB 3RRMB 4OVUA 3FY4A 3QKYA 4FU3A 4JA7A 3FTSA 4TUMA 4C9BB 3CKBA 1OCCE 3VLFA 3U64A 3EU5A 2P9NG 5BV0A 3C5RA 1OWLA 3FWVA 4WNDA 3FH7A 3TJPA 3PS6A 4ABNA 2WXNA 3RJVA 4HRNA 1H19A 2WM9A 3PNLB 1TN8A 4RVBA 2PL2A 3IEGA 2AW6A 3PZ2A 2NYJA 1HX8A 3GYZA 2PQNA 2I9CA 3RSEG 5ANLA 4U96D 3QDNA 3LVRE 3SGHA 5D0QD 4CT4A 4JPSA 4LNUD 4LG6A 1HXIA 5DIZA 3R7RA 2BTDA 2DZOA 3QWPA 2X6HA 2UY1A 3ZN3A 5A7DB 3F6QA 3QAQA 3NZUA 3CHMA 4CCAA 2J09A 5D0OD 2VYIA 1VDYA 1BI7B 5EN5D 1E8WA 3J5PA 4DX6D 5J08A 4N3AA 1D8EA 2VGXA 3JYSA 3G2SA 4JD2G 2XCBA 3FTUA 2KBXA 5BPPA 5FTPA 4KZCA 2XRZA 1BLXB 4BT9A 4W9RA 4RG6A 2LO6A 3I3NA 4FC8A 3ULYA 3T5VA 3DEOA 4PH4B 3S7BA 3TXMA 3ONKA 3L13A 4G25A 4KT6B 5BW8C 2KXPC 3P1UA 2J4DA 1QZ2A 4GB9A 2X38A 5AYWD 4GZDA 1ELKA 4LNBA 2VQ2A 4U7EB 3UPVA 1WY6A 1LD7A 2IF4A 3CQCB 4DPRA 3TL5A 3ZGQA 4DI4A 2QC9A 4K5BA 5HI7A 3RIBA 1UJJA 1K3ZD 1MQSA 4DJAA 3CV0A 4U8HA 4HFGA 4JL0A 1BU9A 4WNFA 3JXIA 4F53A 3PDNA 5CCMA 3MCXA 3CVXA 1S70B 4RLYA 4BFRA 4IYPA 1XNFA 3ZHEA 2OOEA 2OVBA 1D8DA 2B0OE 1N4SA 4Z68A 3ZNGA 5DBKA 3FUIA 3SI5A 4APFA 4BWRA 4UI9C 2XQ0A 3PE3A 4Y6WA 5JA4D 1IXVA 3MZLB 3NBNB 1PY1A 3QJZA 3R7QA 3OTNA 4GCOA 2Y1LE 4AM9A 3QWWA 4BSZB 5KJLA 1W3BA 1E8ZA 5JJ7A 1JUQA 2RG8A 3JQ0A 2FULA 2EIKE 3UT7A 3AU5A 3LJ3A 2QYJA 4UWLA 4I9EA 3SFZA 2RKKA 3APCA 5KCMA 1LF8A 3LXUX 1MJ0A 2GRRB 3MA5A 4JXTA 3FH5A 3B7RL 2QY7A 2XENA 4EQFA 2DIWA 5AIJA 3T5XA 2WXHA 3URZA 3FTVA 3CR3A 1TNBA 2CHXA 3FEXA 2J49A 2WXMA 4GMJA 4GTRA 4L23A 4EZJA 2WXJA 2P9SG 4N2SA 4GTOA 4GTQA 3HYMB 1HO8A 4GTMA 1Q2ZA 3KSLA 2LNIA 4OAVB 1OWOA 3X2QE 4X8QA 1GW6A 3D9PA 4FHKA 3PREA 5B1AE 4TUUA 2J9QA 4UI9K 4GA2A 2DWZA 1TNUA 5JMND 1UN8A 3CVNA 3WXXA 4BEPA 3VLDA 4TXQA 3DRAA 4B8CB 1NI1A 1H2UA 4NQ0A 4ACKA 3EHRA 1TR4A 4E85A 2KCLA 2GRLA 1U2VG 3ZYMA 3MX3A 5ENTD 3FUNA 3D9KA 4GTTA 3U66A 1RW2A 4HQDA 4JZYA 4ATZD 1K8KG 3CK7A 3BU8A 3ENEA 5EX0A 4WWOA 3DBSA 3ASGA 3HXDA 4DX1A 4HS2A 2H6FA 3VTYA 1DCEA 2XPZA 1H0AA 2EQXA 4ILGA 3ISMC 3ZXSA 4GZCA 5KWDA 2E0IA 2ILRA 1SVXA 5LFAA 3DSXA 3IV0A 1A17A 5ENSD 4JC8A 4IULA 4DX7D 3T8MA 3OXFA 3CK9A 3MGBA 4CDMA 2C0LA 1N4QA 3S7JA 1N95A 3D9NA 3GZ2A 2ZISA 4Q96A 3D9MA 2LSUA 3QK0A 3HVEB 1IYGA 5CBOA 2OEVA 5EILA 3LDZA 2LXMA 4FP7A 2R02A 3LJNA 3LY7A 2XPYA 3U3WA 3ULQA 1YMPA 3SY2A 1S63A 2EIJE 2PZIA 2GRQB 4BSXA 1YCSB 5LX8A 2KCVA 2WXIA 3CVQA 3FUHA 4XKBA 4UWKA 4GYYA 3MKRA 1NA3A 4HB5A 2YNQA 3ASOE 2WXLA 4GMLA 3S2AA 3CSTA 3HXEA 3IXEA 3Q9UC 1N11A 2QZAA 2R5SA 3LY8A 3DSTA 3CKCA 4G2VA 3SFYA 4B94A 3GZSA 5E76A 3PZDA 3V31A 2XGSA 2JABA 1ZBPA 4U04A 1E90A 4MKTA 5ITZF 1TN7A 3EU9A 4O60A 3B7SA 4CGVA 2PQRA 1IKND 2XHEA 2ETCA 2RD0A 4ATGA 4HVBA 3G2UA 2WXQA 3G2VA 4OAUC 2C2LA 2WXKA 3KEZA 4Q94A 4ANWA 5CMWA 4CGWA 4RSYA 4MRUA 3V2OA 5IY5E 3ESKA 4K5AB 3JXJA 2QFCA 4P29A 2GRPB 2R17C 2RFAA 3MV3B 2ZXWE 2HM8A 3OXGA 4I9CA 3CGHA 3U9WA 5G05C 2PM6A 1IHBA 4WAFA 3FU3A 4JHKA 2CG3A 4XI9A 3AJIA 2WXFA 1RZ4A 3JCKC 3UM2A 4YDWA 3ZVVA 4M3OA 1MX6A 5HRYA 5BV1A 4YVOA 2OEWA 3HHMA 5KBAA 1H6KA 1S0PA 4LRZA 4FA6A 2X6JA 3EHQA 5J90A 1D9SA 2RFMA 3B7TA 5FT9A 2VTBB 3UINC 2IY0C 1MX2A 4A3VA 1IHGA 5CEAA 2VSXE 1HG2A 2AXVA 4N3CA 2Y4TA 5CERB 4KXKB 3PE4A 2WPVA 5EKQD 2XEVA 4UQZA 2Y0BG 4DX2A 5EIDA 4JVSA 2GRMA 1OCRE 3AG1E 3JQ1A 3UX4A 3UMVA 4CT0A 4TXPA 4GPMA 1V54E 2IO3C 5H7PA 1NP7A 5A23A 4CEMA 2FO1E 2ONDA 1WM5A 4Q69A 2JLBA 5CHEE 4QFVA 2MYOA 4ANXA 2J8SD 5G04C 3SD5A 5LOZA 2L9BA 3HIZA 4U8YD 4PS3A 2MRIA 1N4PA 3L08A 2NC9A 2DYSE 5ENNA 2FI7A 3FUEA 4G1TA 2P9IG 1S64A 3ZPJA 1JPLA 4TXRA 1L5JA 1FVFA 4IRUA 3CK8A 3D9LA 2MOWA 3MYVA 4PDXA 4G24A 4BX9A 4AIFA 5CRVA 4B0ZA 1FT1A 4J8SA 4HOUA 1OUVA 4FHJA 4EPZA 3E33A 1P5QA 4MLPA 3PUKA 3C3OA 3UQ3A 3KEAA 2HR2A 3RRNB 2DVWA 2I1KA 3V30A 4HRMB 1PAQA 4I6GA 3ASHA 4A1SA 4K03A 4HI9A 4F7AA 4PS8A 2NXPA 3HVEA 2WQ7A 2P2CP 4WNGA 3DPYA 1ELRA 4HXIA 1OCZE 3D9IA 2WB2A 3CVPA 2WQHA 2GGFA 4N2QA 3CHOA 4J8EA 4AY6A 3FUMA 4C0MA 1OCOE 4KBQA 2I1JA 1X5BA 3QC1A 2IOLA 1N0QA 1QQEA 3FTYA 1OY3D 4JA9A 2Y3AA 4NRHB 1BI8B 4G26A 2OVFA 3TG4A 3FU6A 4JW1A 3DXMG 4I6JA 5ANRA 2HYZA 2J07A 3CLJA 3L22A 4ILHB 5KJNA 2X6IA 2L6JA 2B6CA 1O5MA 3MKQB 3Q49B 4EZLA 4EZKA 4WNEA 5AARA 3UKRG 3B7BA 4AJWA 5FZRA 4A3TA 3UXGA 4LERA 4DK5A 1Z3YA 4JHJA 4PUCA 4I6EA 2HO1A 3Q7AA 3L54A 2IO2C 2E2EA 2GROB 2A5UA 4YDOA 3TG5A 4DRXE 4CZ2D 3E30A 4AP2A 3ZIMA 2AXUA 1NFIE 3KSQA 3RU0A 1TNYA 3APDA 5JJTA 1AP7A 3ESLA 2VGEA 2PM7A 5ARFA 3PNTB 4JEUA 5ENOD 3NB2A 3RAUA 3AG3E 2KC7A 2XPIA 3FUJA 3VTXA 5AAOA 4I2WA 2HE0A 4HOTA 1EF1C 3FUKA 5AJDA 2IEJA 3AS4A 2H6IA 1N94A 4ZFHA 5BUZA 4XE0A 2FF4A 3DEPA 1WG0A 1HZ4A 4E6HA 2Q7FA 2R59A 1TEZA 5B1BE 1YYHA 4GTVA 4GTSA 4N5QA 5A6CA 3OXLA 2DCPA 4LSZE 3QB2A 3CVVA 3CEQA 3EHNA 4ME2A 3SHFA 3UKUG 5JHBA 2KM4A 4N39A 2KZTB 1FT2A 1DVPA 3PZ4A 4G23A 2VTBA 3AS8A 4GZ6A 2X3MA 1SZ9A 2A5EA 2BUGA 2P58C 5FZSA 4D10C 1KLXA 2XZDG 2YQ8A 1H2TC 1NZNA 3ASDA 2VSNA 4GMRA 1FVHA 1XGWA 2F37A 3OAWA 3W9GA 2V0PA 4HRLA 2OCCE 2ZGGA 1EYHA 5C1DA 1FPPA 2WMNA 2BKKB 3TAXA 3ABKE 3D9OA 2CFUA 3CHRA 4NACA 3MJWA 3BG0B 5D2MC 4UWHA 3E34A 3IHVA 4B89A 4DLQA 1KPSB 4GA1A 4YNDA 4YDYA 1UJKA 1TYQG 4GCNA 4QQIA 4CYMD 1KZPA 3J5QB 3V79K 1UN9A 4AOFA 4H7YA 5FQ4A 2EILE 4U0UA 5CMYA 3RO3A 1BPOA 2ZIRA 4RG9A 3UM0A 5EIBE 2ZU6B 1V55E 3TWRA 4YVQC 2EIME 5B3SE 3FDHA 4TRQA 4KYOB 5AQBA 4A63B 3V2XA 5JHAA 2R2LA 2XGOA 4KVOA 3CHPA 1Y8MA 3NF1A 3NOGD 4UI9J 4I2ZA 1WDYA 3D9JA 3O48A 1DNPA 1ZB1A 3C98A 3ZKJA 4C0EA 4K0RA 2VGYA 2YHCA 2L0IA 2H6GA 4JEHA 5ENRD 1HE8A 2WQ6A 2X6FA 2DZNA 3NOCD 3FTZA 1UG3A 3ASFA 1EPUA 3FEYA 2VSOE 4G8KA 3EJNA 3L17A 4Y6CA 4CRWA 3RK6A 3TWVA 3BG1B 4GZ5A 1HFAA 5E75A 3E32A 1E7VA 2WMOA 4HOQA 5D66A 2I2OA 1OWNA 1K1AA 2WXRA 3C3RA 4KZ0A 3TWSA 2VSYA 4HORA 4AVXA 1N52A 4ANUA 2F8YA 3TWXA 4J0UA 4U0SA 2CHZA 5BXUA 2EINE 3JUIA 2LXLA 4N3BA 3EIQC 2J08A 5CECB 1TNOA 3Q5MA 4LCTA 3PZ1A 5LCWJ 2V5FA 4NIKA 4BY6A 4CDRA 5KJKA 1JCSA 2P9UG 1SW6A 4B8AA 2GRNB 2JEKA 3SFXA 2XS8A 4I17A 3MKQA 1INZA 1B89A 3T9KA 1HU3A 4HLEA 3WG7E 4O1OA 2ZGDA 1ELWA 2V4LA 3MEKA 4GA0A 4I43A 4GPKA 5FINA 3JUEA 1QBQA 5CCLA 5AJLA 3VLEA 3KD7A 4PS7A 3UIPC 4XEIG 3EHMA 3Q4AB 2XEHA 3LVQE 3ASNE 1NL4A 2WXPA 3L6AA 4EBAA 2IFUA 5KJMA 3U4TA 3HRAA 4M7CA 4IN3B 4B93B 4APOA 2IOSA 4UQYA 3E4BA 1O1RA 2H6HA 5M72A 1X81A 1H6OA 4OVVA 5EDSA 3Q79A 4L1BA 4FLHA 5CBNA 4L7TA 1MYOA 3TWWA 2KZTA 3PUJA 3O4ZA 2BKGA 4R7LA 5FQ8A 1OWPA 2V4HC 1AWCB 1EDUA 3CIAA 4ILIA 4WUYA 4BTAA 2FO7A 4G8LA 2CHWA 4FADA 2R03A 3MV2B 5EYLA 3ZXPA 3L9TA 4UQXA 4JHRA 3FTXA 3P2BA 3FP3A 4AV7A 2A4ZA 4BESA 3RRUA 5ENPD 3UT8A 3AU4A 3QNKA 5FIOA 1SA5A 1K1BA 2P9KG 4WWNA 4HOSA 4OYSA 4XIFA 3Q73A 3FH8A 3CSFA 1PC2A 3ZFWA 1LTXA 1Y6IA 4HNAD 3B13A 4F1SA 3ML9A 1JCRA 1IQUA 3LCAA 4EECA 3ZEFA 2V8SE 1WAO1 3DSSA 3ZYKA 4L2LA 4ZHBA 3I4GA 1E7UA 1Z3XA 1O1SA 4J7WA 3UUXA 3Q75A 3SZ7A 3LS8A 3FU5A 2DYRE 3R9AB 1E8YA 1TJCA 1SZAA 1LD8A 2ETAA 5CEDB 3Q7FA 4KMOA 3UTMA 3PEVB 3DPDA 3SBTB 4AY5A 1TNZA 3IHYA 3ABLE 4DLOA 2Y4UA 2FBNA 3TWQA 5FWQA 3PZ3A 2AJAA 5C2YA 3K9IA 2GW1A 3CVWA 5EX3A 3D9HA 1A5EA 2BF0X 1NA0A 3CVUA 3PRZA 4L9PA 2KATA 4HBDA 3APFA 4TV3A 3ONLA 3FTWA 4CDNA 2P9LG 3TWTA 1O1TA 1KT1A 4O6FA 2DBAA 2QYUA 1KZOA 1TJFA 3CQGB 4URKA 2ETBA 4LEUA 4I1MA 3ZYLA 3CVYA 3PVLA 5G05J 2LUHA 4FJYA 4GTPA 4RQIA 5T3RA 3SF4A 3HG0D 4AEZC 4EHMA 2AXZA 3ZRHA 3CVLA 3Q78A 3T8KA 4GYOA 3QWVA 4O1PA 2J4BA 3IBEA 4XZ4A 3TXNA 5G55A 3FHEA 3N71A 4F1PA 4BX8A 1OXJA 2YINA 3E37A 3DXKG 3TWUA 3I4RB 5FZQA 3W9FA 3L82A 2M63A 2BEDA 4J6IA 4U0ZA 5G2NA 5LCWC 2AWIA 1N9AA 4WWPA 5KNGA 1JCQA 3B7UX 1FCHA 2KCKA 3LKUA 1BD8A 1JWGA 1N4RA 3SNXA 4FULA 5AQAA 3LYAA 2R05A 1SA4A 3LPZA 2XS1A 2VJ8A 5KNHD 3QOUA 2X6KA 2WXOA 2XCCA 5BT1A 4J8YA 4XKCA 4GU5A 4BT8A 3AS5A 1HH8A 2F8XK 4NURA 5G04J 3SQVA 2UY1B 4DI3A 3AAAC 4HI8A 3LY9A 4FJZA 5BXOA 4EBAG 3DSWA 4L2YA 3UM1A 4BETA 2LAIA 1QYMA 2V5QC 3ZYQA 4BERA 2VGXB 2I6HA 4GZ3A 3FU0A 5AQ9A 4DUIA 3GW4A 4V3IA 5AQ7A 1MX4A 3EIJA 4U63A 2XZTG 4G11A 4A1GA 2NSZA 1HF8A 3ULEG 3LEWA 3ZUVB 2LAHA 3BEEA 1U3CA 2XRYA 4UWGA 4GAAA 3G2TA 1N0RA 1OT8A 2C0MA 4JB8P 3Q15A 3UM3A 3C3QA 2IQCA 1Z5SC 3DSVA 5FQ7A 2AVPA 2Y69E 1MZCA 3FUFA 2LSVA 3Q9NC 5HQ8A 1KT0A 2MHKA 5T8IA 1Z6TA 3QARA 3C72A 3CHSA 1H2VC 3FUDA 2XEEA 3HXFA 2PNNA 3S7DA 5LP0A 3ZU7B 3HDXA 3KAEA 4DX5D 1IQRA 3HXCA 4UWFA 1QNFA 5CRUA 3FFLA 3GZ1A 4N5CA 1MHQA 2L0TB 3R9MA 3UI2A 3NAWA 5T4YA 5JJ6A 4MBGA 2FEZA 4U95D 2F0YA 2WXGA 3ZHEB 3HXBA 5ENQD 3BUAA 3PEUB 4AXHA 3CHQA
chains in the Genus database with same CATH topology
4YDEA 3EUVA 1TNUA 2ZISA 4EHMA 1JCRA 3E34A 3DSUA 3DSSA 3Q78A 1O1RA 3EU5A 2IEJA 1S63A 2H6IA 1O1SA 1N4PA 2H6HA 3DRAA 1X81A 1N94A 3Q75A 1NI1A 1KZPA 3Q79A 1TNOA 3E37A 4GTVA 4GTSA 1LD8A 1TN8A 3Q7FA 3PZ1A 4GTTA 3PZ2A 2ZIRA 2BEDA 1JCSA 1S64A 1TN6A 3DSVA 1TNZA 3SFXA 4LNBA 1N9AA 1LD7A 1MZCA 1JCQA 1FT2A 3HXEA 3PZ3A 3HXDA 3PZ4A 3C72A 2R2LA 1N4RA 1O5MA 2H6FA 1SA4A 1DCEA 3DSTA 1TNBA 3HXFA 1FT1A 4GTRA 4L9PA 1QBQA 3SFYA 3E33A 4LNGA 2H6GA 3HXCA 3Q7AA 1SA5A 4GTOA 1O1TA 4GTQA 1KZOA 1TN7A 4YDOA 4GTMA 1D8DA 3E30A 3DSXA 3KSLA 1N4SA 1D8EA 4MBGA 1NL4A 3Q73A 2F0YA 3KSQA 3DSWA 1TNYA 1FPPA 1LTXA 3HXBA 4GTPA 3DPYA 1N4QA 3E32A 1N95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDE A;  3EUV A;  1TNU A;  2ZIS A;  4EHM A;  1JCR A;  3E34 A;  3DSU A;  3DSS A;  3Q78 A;  1O1R A;  3EU5 A;  2IEJ A;  1S63 A;  2H6I A;  1O1S A;  1N4P A;  2H6H A;  3DRA A;  1X81 A;  1N94 A;  3Q75 A;  1NI1 A;  1KZP A;  3Q79 A;  1TNO A;  3E37 A;  4GTV A;  4GTS A;  1LD8 A;  1TN8 A;  3Q7F A;  3PZ1 A;  4GTT A;  3PZ2 A;  2ZIR A;  2BED A;  1JCS A;  1S64 A;  1TN6 A;  3DSV A;  1TNZ A;  3SFX A;  4LNB A;  1N9A A;  1LD7 A;  1MZC A;  1JCQ A;  1FT2 A;  3HXE A;  3PZ3 A;  3HXD A;  3PZ4 A;  3C72 A;  2R2L A;  1N4R A;  1O5M A;  2H6F A;  1SA4 A;  1DCE A;  3DST A;  1TNB A;  3HXF A;  1FT1 A;  4GTR A;  4L9P A;  1QBQ A;  3SFY A;  3E33 A;  4LNG A;  2H6G A;  3HXC A;  3Q7A A;  1SA5 A;  4GTO A;  1O1T A;  4GTQ A;  1KZO A;  1TN7 A;  4YDO A;  4GTM A;  1D8D A;  3E30 A;  3DSX A;  3KSL A;  1N4S A;  1D8E A;  4MBG A;  1NL4 A;  3Q73 A;  2F0Y A;  3KSQ A;  3DSW A;  1TNY A;  1FPP A;  1LTX A;  3HXB A;  4GTP A;  3DPY A;  1N4Q A;  3E32 A;  1N95 A; 
#chains in the Genus database with same CATH topology
 3NZS A;  3EUV A;  3NQP A;  1OWM A;  3RO2 A;  1UW4 B;  3SBS A;  5ARG A;  3EDT B;  3BQO A;  2IU1 A;  3L16 A;  1N54 A;  2IJG X;  4ANV A;  3DSU A;  3DWL G;  2ION A;  2CG2 A;  3I5P A;  4K5C A;  3PH0 C;  3FUL A;  4ACL A;  1HG5 A;  1E96 B;  1JWF A;  2YHE A;  4GYW A;  1YA0 A;  3G2W A;  5HS0 A;  4XI0 A;  3Q47 B;  1DCQ A;  4J8F A;  3ML8 A;  1TN6 A;  1DC2 A;  3AG2 E;  3UT4 A;  5AN8 A;  1U3D A;  3ABM E;  4H7X A;  4FLB A;  5FJY A;  4UUC A;  1ZU2 A;  4U8V D;  3D3M A;  3IKO B;  1UOH A;  4I1A A;  4LUN U;  5FQ6 A;  3S7F A;  4J8D A;  3SO8 A;  4F3V A;  1E8X A;  4HLL A;  4BTB A;  4F6R D;  2WVI A;  4A55 A;  2XGM A;  1HS6 A;  2CFZ A;  5EYP F;  4LNG A;  5BNW A;  4KVM A;  1H6P A;  4C48 B;  4XX5 A;  2L6B A;  2UWJ G;  4U07 A;  2OV8 A;  3UIO C;  3TGO A;  3ZW3 A;  4MS6 A;  1SQM A;  1G3N B;  3B95 A;  3AG4 E;  3KS2 A;  5AEN A;  4YDE A;  5HKP A;  3RKV A;  2P9P G;  4I1O B;  3RRM B;  4OVU A;  3FY4 A;  3QKY A;  4FU3 A;  4JA7 A;  3FTS A;  4TUM A;  4C9B B;  3CKB A;  1OCC E;  3VLF A;  3U64 A;  3EU5 A;  2P9N G;  5BV0 A;  3C5R A;  1OWL A;  3FWV A;  4WND A;  3FH7 A;  3TJP A;  3PS6 A;  4ABN A;  2WXN A;  3RJV A;  4HRN A;  1H19 A;  2WM9 A;  3PNL B;  1TN8 A;  4RVB A;  2PL2 A;  3IEG A;  2AW6 A;  3PZ2 A;  2NYJ A;  1HX8 A;  3GYZ A;  2PQN A;  2I9C A;  3RSE G;  5ANL A;  4U96 D;  3QDN A;  3LVR E;  3SGH A;  5D0Q D;  4CT4 A;  4JPS A;  4LNU D;  4LG6 A;  1HXI A;  5DIZ A;  3R7R A;  2BTD A;  2DZO A;  3QWP A;  2X6H A;  2UY1 A;  3ZN3 A;  5A7D B;  3F6Q A;  3QAQ A;  3NZU A;  3CHM A;  4CCA A;  2J09 A;  5D0O D;  2VYI A;  1VDY A;  1BI7 B;  5EN5 D;  1E8W A;  3J5P A;  4DX6 D;  5J08 A;  4N3A A;  1D8E A;  2VGX A;  3JYS A;  3G2S A;  4JD2 G;  2XCB A;  3FTU A;  2KBX A;  5BPP A;  5FTP A;  4KZC A;  2XRZ A;  1BLX B;  4BT9 A;  4W9R A;  4RG6 A;  2LO6 A;  3I3N A;  4FC8 A;  3ULY A;  3T5V A;  3DEO A;  4PH4 B;  3S7B A;  3TXM A;  3ONK A;  3L13 A;  4G25 A;  4KT6 B;  5BW8 C;  2KXP C;  3P1U A;  2J4D A;  1QZ2 A;  4GB9 A;  2X38 A;  5AYW D;  4GZD A;  1ELK A;  4LNB A;  2VQ2 A;  4U7E B;  3UPV A;  1WY6 A;  1LD7 A;  2IF4 A;  3CQC B;  4DPR A;  3TL5 A;  3ZGQ A;  4DI4 A;  2QC9 A;  4K5B A;  5HI7 A;  3RIB A;  1UJJ A;  1K3Z D;  1MQS A;  4DJA A;  3CV0 A;  4U8H A;  4HFG A;  4JL0 A;  1BU9 A;  4WNF A;  3JXI A;  4F53 A;  3PDN A;  5CCM A;  3MCX A;  3CVX A;  1S70 B;  4RLY A;  4BFR A;  4IYP A;  1XNF A;  3ZHE A;  2OOE A;  2OVB A;  1D8D A;  2B0O E;  1N4S A;  4Z68 A;  3ZNG A;  5DBK A;  3FUI A;  3SI5 A;  4APF A;  4BWR A;  4UI9 C;  2XQ0 A;  3PE3 A;  4Y6W A;  5JA4 D;  1IXV A;  3MZL B;  3NBN B;  1PY1 A;  3QJZ A;  3R7Q A;  3OTN A;  4GCO A;  2Y1L E;  4AM9 A;  3QWW A;  4BSZ B;  5KJL A;  1W3B A;  1E8Z A;  5JJ7 A;  1JUQ A;  2RG8 A;  3JQ0 A;  2FUL A;  2EIK E;  3UT7 A;  3AU5 A;  3LJ3 A;  2QYJ A;  4UWL A;  4I9E A;  3SFZ A;  2RKK A;  3APC A;  5KCM A;  1LF8 A;  3LXU X;  1MJ0 A;  2GRR B;  3MA5 A;  4JXT A;  3FH5 A;  3B7R L;  2QY7 A;  2XEN A;  4EQF A;  2DIW A;  5AIJ A;  3T5X A;  2WXH A;  3URZ A;  3FTV A;  3CR3 A;  1TNB A;  2CHX A;  3FEX A;  2J49 A;  2WXM A;  4GMJ A;  4GTR A;  4L23 A;  4EZJ A;  2WXJ A;  2P9S G;  4N2S A;  4GTO A;  4GTQ A;  3HYM B;  1HO8 A;  4GTM A;  1Q2Z A;  3KSL A;  2LNI A;  4OAV B;  1OWO A;  3X2Q E;  4X8Q A;  1GW6 A;  3D9P A;  4FHK A;  3PRE A;  5B1A E;  4TUU A;  2J9Q A;  4UI9 K;  4GA2 A;  2DWZ A;  1TNU A;  5JMN D;  1UN8 A;  3CVN A;  3WXX A;  4BEP A;  3VLD A;  4TXQ A;  3DRA A;  4B8C B;  1NI1 A;  1H2U A;  4NQ0 A;  4ACK A;  3EHR A;  1TR4 A;  4E85 A;  2KCL A;  2GRL A;  1U2V G;  3ZYM A;  3MX3 A;  5ENT D;  3FUN A;  3D9K A;  4GTT A;  3U66 A;  1RW2 A;  4HQD A;  4JZY A;  4ATZ D;  1K8K G;  3CK7 A;  3BU8 A;  3ENE A;  5EX0 A;  4WWO A;  3DBS A;  3ASG A;  3HXD A;  4DX1 A;  4HS2 A;  2H6F A;  3VTY A;  1DCE A;  2XPZ A;  1H0A A;  2EQX A;  4ILG A;  3ISM C;  3ZXS A;  4GZC A;  5KWD A;  2E0I A;  2ILR A;  1SVX A;  5LFA A;  3DSX A;  3IV0 A;  1A17 A;  5ENS D;  4JC8 A;  4IUL A;  4DX7 D;  3T8M A;  3OXF A;  3CK9 A;  3MGB A;  4CDM A;  2C0L A;  1N4Q A;  3S7J A;  1N95 A;  3D9N A;  3GZ2 A;  2ZIS A;  4Q96 A;  3D9M A;  2LSU A;  3QK0 A;  3HVE B;  1IYG A;  5CBO A;  2OEV A;  5EIL A;  3LDZ A;  2LXM A;  4FP7 A;  2R02 A;  3LJN A;  3LY7 A;  2XPY A;  3U3W A;  3ULQ A;  1YMP A;  3SY2 A;  1S63 A;  2EIJ E;  2PZI A;  2GRQ B;  4BSX A;  1YCS B;  5LX8 A;  2KCV A;  2WXI A;  3CVQ A;  3FUH A;  4XKB A;  4UWK A;  4GYY A;  3MKR A;  1NA3 A;  4HB5 A;  2YNQ A;  3ASO E;  2WXL A;  4GML A;  3S2A A;  3CST A;  3HXE A;  3IXE A;  3Q9U C;  1N11 A;  2QZA A;  2R5S A;  3LY8 A;  3DST A;  3CKC A;  4G2V A;  3SFY A;  4B94 A;  3GZS A;  5E76 A;  3PZD A;  3V31 A;  2XGS A;  2JAB A;  1ZBP A;  4U04 A;  1E90 A;  4MKT A;  5ITZ F;  1TN7 A;  3EU9 A;  4O60 A;  3B7S A;  4CGV A;  2PQR A;  1IKN D;  2XHE A;  2ETC A;  2RD0 A;  4ATG A;  4HVB A;  3G2U A;  2WXQ A;  3G2V A;  4OAU C;  2C2L A;  2WXK A;  3KEZ A;  4Q94 A;  4ANW A;  5CMW A;  4CGW A;  4RSY A;  4MRU A;  3V2O A;  5IY5 E;  3ESK A;  4K5A B;  3JXJ A;  2QFC A;  4P29 A;  2GRP B;  2R17 C;  2RFA A;  3MV3 B;  2ZXW E;  2HM8 A;  3OXG A;  4I9C A;  3CGH A;  3U9W A;  5G05 C;  2PM6 A;  1IHB A;  4WAF A;  3FU3 A;  4JHK A;  2CG3 A;  4XI9 A;  3AJI A;  2WXF A;  1RZ4 A;  3JCK C;  3UM2 A;  4YDW A;  3ZVV A;  4M3O A;  1MX6 A;  5HRY A;  5BV1 A;  4YVO A;  2OEW A;  3HHM A;  5KBA A;  1H6K A;  1S0P A;  4LRZ A;  4FA6 A;  2X6J A;  3EHQ A;  5J90 A;  1D9S A;  2RFM A;  3B7T A;  5FT9 A;  2VTB B;  3UIN C;  2IY0 C;  1MX2 A;  4A3V A;  1IHG A;  5CEA A;  2VSX E;  1HG2 A;  2AXV A;  4N3C A;  2Y4T A;  5CER B;  4KXK B;  3PE4 A;  2WPV A;  5EKQ D;  2XEV A;  4UQZ A;  2Y0B G;  4DX2 A;  5EID A;  4JVS A;  2GRM A;  1OCR E;  3AG1 E;  3JQ1 A;  3UX4 A;  3UMV A;  4CT0 A;  4TXP A;  4GPM A;  1V54 E;  2IO3 C;  5H7P A;  1NP7 A;  5A23 A;  4CEM A;  2FO1 E;  2OND A;  1WM5 A;  4Q69 A;  2JLB A;  5CHE E;  4QFV A;  2MYO A;  4ANX A;  2J8S D;  5G04 C;  3SD5 A;  5LOZ A;  2L9B A;  3HIZ A;  4U8Y D;  4PS3 A;  2MRI A;  1N4P A;  3L08 A;  2NC9 A;  2DYS E;  5ENN A;  2FI7 A;  3FUE A;  4G1T A;  2P9I G;  1S64 A;  3ZPJ A;  1JPL A;  4TXR A;  1L5J A;  1FVF A;  4IRU A;  3CK8 A;  3D9L A;  2MOW A;  3MYV A;  4PDX A;  4G24 A;  4BX9 A;  4AIF A;  5CRV A;  4B0Z A;  1FT1 A;  4J8S A;  4HOU A;  1OUV A;  4FHJ A;  4EPZ A;  3E33 A;  1P5Q A;  4MLP A;  3PUK A;  3C3O A;  3UQ3 A;  3KEA A;  2HR2 A;  3RRN B;  2DVW A;  2I1K A;  3V30 A;  4HRM B;  1PAQ A;  4I6G A;  3ASH A;  4A1S A;  4K03 A;  4HI9 A;  4F7A A;  4PS8 A;  2NXP A;  3HVE A;  2WQ7 A;  2P2C P;  4WNG A;  3DPY A;  1ELR A;  4HXI A;  1OCZ E;  3D9I A;  2WB2 A;  3CVP A;  2WQH A;  2GGF A;  4N2Q A;  3CHO A;  4J8E A;  4AY6 A;  3FUM A;  4C0M A;  1OCO E;  4KBQ A;  2I1J A;  1X5B A;  3QC1 A;  2IOL A;  1N0Q A;  1QQE A;  3FTY A;  1OY3 D;  4JA9 A;  2Y3A A;  4NRH B;  1BI8 B;  4G26 A;  2OVF A;  3TG4 A;  3FU6 A;  4JW1 A;  3DXM G;  4I6J A;  5ANR A;  2HYZ A;  2J07 A;  3CLJ A;  3L22 A;  4ILH B;  5KJN A;  2X6I A;  2L6J A;  2B6C A;  1O5M A;  3MKQ B;  3Q49 B;  4EZL A;  4EZK A;  4WNE A;  5AAR A;  3UKR G;  3B7B A;  4AJW A;  5FZR A;  4A3T A;  3UXG A;  4LER A;  4DK5 A;  1Z3Y A;  4JHJ A;  4PUC A;  4I6E A;  2HO1 A;  3Q7A A;  3L54 A;  2IO2 C;  2E2E A;  2GRO B;  2A5U A;  4YDO A;  3TG5 A;  4DRX E;  4CZ2 D;  3E30 A;  4AP2 A;  3ZIM A;  2AXU A;  1NFI E;  3KSQ A;  3RU0 A;  1TNY A;  3APD A;  5JJT A;  1AP7 A;  3ESL A;  2VGE A;  2PM7 A;  5ARF A;  3PNT B;  4JEU A;  5ENO D;  3NB2 A;  3RAU A;  3AG3 E;  2KC7 A;  2XPI A;  3FUJ A;  3VTX A;  5AAO A;  4I2W A;  2HE0 A;  4HOT A;  1EF1 C;  3FUK A;  5AJD A;  2IEJ A;  3AS4 A;  2H6I A;  1N94 A;  4ZFH A;  5BUZ A;  4XE0 A;  2FF4 A;  3DEP A;  1WG0 A;  1HZ4 A;  4E6H A;  2Q7F A;  2R59 A;  1TEZ A;  5B1B E;  1YYH A;  4GTV A;  4GTS A;  4N5Q A;  5A6C A;  3OXL A;  2DCP A;  4LSZ E;  3QB2 A;  3CVV A;  3CEQ A;  3EHN A;  4ME2 A;  3SHF A;  3UKU G;  5JHB A;  2KM4 A;  4N39 A;  2KZT B;  1FT2 A;  1DVP A;  3PZ4 A;  4G23 A;  2VTB A;  3AS8 A;  4GZ6 A;  2X3M A;  1SZ9 A;  2A5E A;  2BUG A;  2P58 C;  5FZS A;  4D10 C;  1KLX A;  2XZD G;  2YQ8 A;  1H2T C;  1NZN A;  3ASD A;  2VSN A;  4GMR A;  1FVH A;  1XGW A;  2F37 A;  3OAW A;  3W9G A;  2V0P A;  4HRL A;  2OCC E;  2ZGG A;  1EYH A;  5C1D A;  1FPP A;  2WMN A;  2BKK B;  3TAX A;  3ABK E;  3D9O A;  2CFU A;  3CHR A;  4NAC A;  3MJW A;  3BG0 B;  5D2M C;  4UWH A;  3E34 A;  3IHV A;  4B89 A;  4DLQ A;  1KPS B;  4GA1 A;  4YND A;  4YDY A;  1UJK A;  1TYQ G;  4GCN A;  4QQI A;  4CYM D;  1KZP A;  3J5Q B;  3V79 K;  1UN9 A;  4AOF A;  4H7Y A;  5FQ4 A;  2EIL E;  4U0U A;  5CMY A;  3RO3 A;  1BPO A;  2ZIR A;  4RG9 A;  3UM0 A;  5EIB E;  2ZU6 B;  1V55 E;  3TWR A;  4YVQ C;  2EIM E;  5B3S E;  3FDH A;  4TRQ A;  4KYO B;  5AQB A;  4A63 B;  3V2X A;  5JHA A;  2R2L A;  2XGO A;  4KVO A;  3CHP A;  1Y8M A;  3NF1 A;  3NOG D;  4UI9 J;  4I2Z A;  1WDY A;  3D9J A;  3O48 A;  1DNP A;  1ZB1 A;  3C98 A;  3ZKJ A;  4C0E A;  4K0R A;  2VGY A;  2YHC A;  2L0I A;  2H6G A;  4JEH A;  5ENR D;  1HE8 A;  2WQ6 A;  2X6F A;  2DZN A;  3NOC D;  3FTZ A;  1UG3 A;  3ASF A;  1EPU A;  3FEY A;  2VSO E;  4G8K A;  3EJN A;  3L17 A;  4Y6C A;  4CRW A;  3RK6 A;  3TWV A;  3BG1 B;  4GZ5 A;  1HFA A;  5E75 A;  3E32 A;  1E7V A;  2WMO A;  4HOQ A;  5D66 A;  2I2O A;  1OWN A;  1K1A A;  2WXR A;  3C3R A;  4KZ0 A;  3TWS A;  2VSY A;  4HOR A;  4AVX A;  1N52 A;  4ANU A;  2F8Y A;  3TWX A;  4J0U A;  4U0S A;  2CHZ A;  5BXU A;  2EIN E;  3JUI A;  2LXL A;  4N3B A;  3EIQ C;  2J08 A;  5CEC B;  1TNO A;  3Q5M A;  4LCT A;  3PZ1 A;  5LCW J;  2V5F A;  4NIK A;  4BY6 A;  4CDR A;  5KJK A;  1JCS A;  2P9U G;  1SW6 A;  4B8A A;  2GRN B;  2JEK A;  3SFX A;  2XS8 A;  4I17 A;  3MKQ A;  1INZ A;  1B89 A;  3T9K A;  1HU3 A;  4HLE A;  3WG7 E;  4O1O A;  2ZGD A;  1ELW A;  2V4L A;  3MEK A;  4GA0 A;  4I43 A;  4GPK A;  5FIN A;  3JUE A;  1QBQ A;  5CCL A;  5AJL A;  3VLE A;  3KD7 A;  4PS7 A;  3UIP C;  4XEI G;  3EHM A;  3Q4A B;  2XEH A;  3LVQ E;  3ASN E;  1NL4 A;  2WXP A;  3L6A A;  4EBA A;  2IFU A;  5KJM A;  3U4T A;  3HRA A;  4M7C A;  4IN3 B;  4B93 B;  4APO A;  2IOS A;  4UQY A;  3E4B A;  1O1R A;  2H6H A;  5M72 A;  1X81 A;  1H6O A;  4OVV A;  5EDS A;  3Q79 A;  4L1B A;  4FLH A;  5CBN A;  4L7T A;  1MYO A;  3TWW A;  2KZT A;  3PUJ A;  3O4Z A;  2BKG A;  4R7L A;  5FQ8 A;  1OWP A;  2V4H C;  1AWC B;  1EDU A;  3CIA A;  4ILI A;  4WUY A;  4BTA A;  2FO7 A;  4G8L A;  2CHW A;  4FAD A;  2R03 A;  3MV2 B;  5EYL A;  3ZXP A;  3L9T A;  4UQX A;  4JHR A;  3FTX A;  3P2B A;  3FP3 A;  4AV7 A;  2A4Z A;  4BES A;  3RRU A;  5ENP D;  3UT8 A;  3AU4 A;  3QNK A;  5FIO A;  1SA5 A;  1K1B A;  2P9K G;  4WWN A;  4HOS A;  4OYS A;  4XIF A;  3Q73 A;  3FH8 A;  3CSF A;  1PC2 A;  3ZFW A;  1LTX A;  1Y6I A;  4HNA D;  3B13 A;  4F1S A;  3ML9 A;  1JCR A;  1IQU A;  3LCA A;  4EEC A;  3ZEF A;  2V8S E;  1WAO 1;  3DSS A;  3ZYK A;  4L2L A;  4ZHB A;  3I4G A;  1E7U A;  1Z3X A;  1O1S A;  4J7W A;  3UUX A;  3Q75 A;  3SZ7 A;  3LS8 A;  3FU5 A;  2DYR E;  3R9A B;  1E8Y A;  1TJC A;  1SZA A;  1LD8 A;  2ETA A;  5CED B;  3Q7F A;  4KMO A;  3UTM A;  3PEV B;  3DPD A;  3SBT B;  4AY5 A;  1TNZ A;  3IHY A;  3ABL E;  4DLO A;  2Y4U A;  2FBN A;  3TWQ A;  5FWQ A;  3PZ3 A;  2AJA A;  5C2Y A;  3K9I A;  2GW1 A;  3CVW A;  5EX3 A;  3D9H A;  1A5E A;  2BF0 X;  1NA0 A;  3CVU A;  3PRZ A;  4L9P A;  2KAT A;  4HBD A;  3APF A;  4TV3 A;  3ONL A;  3FTW A;  4CDN A;  2P9L G;  3TWT A;  1O1T A;  1KT1 A;  4O6F A;  2DBA A;  2QYU A;  1KZO A;  1TJF A;  3CQG B;  4URK A;  2ETB A;  4LEU A;  4I1M A;  3ZYL A;  3CVY A;  3PVL A;  5G05 J;  2LUH A;  4FJY A;  4GTP A;  4RQI A;  5T3R A;  3SF4 A;  3HG0 D;  4AEZ C;  4EHM A;  2AXZ A;  3ZRH A;  3CVL A;  3Q78 A;  3T8K A;  4GYO A;  3QWV A;  4O1P A;  2J4B A;  3IBE A;  4XZ4 A;  3TXN A;  5G55 A;  3FHE A;  3N71 A;  4F1P A;  4BX8 A;  1OXJ A;  2YIN A;  3E37 A;  3DXK G;  3TWU A;  3I4R B;  5FZQ A;  3W9F A;  3L82 A;  2M63 A;  2BED A;  4J6I A;  4U0Z A;  5G2N A;  5LCW C;  2AWI A;  1N9A A;  4WWP A;  5KNG A;  1JCQ A;  3B7U X;  1FCH A;  2KCK A;  3LKU A;  1BD8 A;  1JWG A;  1N4R A;  3SNX A;  4FUL A;  5AQA A;  3LYA A;  2R05 A;  1SA4 A;  3LPZ A;  2XS1 A;  2VJ8 A;  5KNH D;  3QOU A;  2X6K A;  2WXO A;  2XCC A;  5BT1 A;  4J8Y A;  4XKC A;  4GU5 A;  4BT8 A;  3AS5 A;  1HH8 A;  2F8X K;  4NUR A;  5G04 J;  3SQV A;  2UY1 B;  4DI3 A;  3AAA C;  4HI8 A;  3LY9 A;  4FJZ A;  5BXO A;  4EBA G;  3DSW A;  4L2Y A;  3UM1 A;  4BET A;  2LAI A;  1QYM A;  2V5Q C;  3ZYQ A;  4BER A;  2VGX B;  2I6H A;  4GZ3 A;  3FU0 A;  5AQ9 A;  4DUI A;  3GW4 A;  4V3I A;  5AQ7 A;  1MX4 A;  3EIJ A;  4U63 A;  2XZT G;  4G11 A;  4A1G A;  2NSZ A;  1HF8 A;  3ULE G;  3LEW A;  3ZUV B;  2LAH A;  3BEE A;  1U3C A;  2XRY A;  4UWG A;  4GAA A;  3G2T A;  1N0R A;  1OT8 A;  2C0M A;  4JB8 P;  3Q15 A;  3UM3 A;  3C3Q A;  2IQC A;  1Z5S C;  3DSV A;  5FQ7 A;  2AVP A;  2Y69 E;  1MZC A;  3FUF A;  2LSV A;  3Q9N C;  5HQ8 A;  1KT0 A;  2MHK A;  5T8I A;  1Z6T A;  3QAR A;  3C72 A;  3CHS A;  1H2V C;  3FUD A;  2XEE A;  3HXF A;  2PNN A;  3S7D A;  5LP0 A;  3ZU7 B;  3HDX A;  3KAE A;  4DX5 D;  1IQR A;  3HXC A;  4UWF A;  1QNF A;  5CRU A;  3FFL A;  3GZ1 A;  4N5C A;  1MHQ A;  2L0T B;  3R9M A;  3UI2 A;  3NAW A;  5T4Y A;  5JJ6 A;  4MBG A;  2FEZ A;  4U95 D;  2F0Y A;  2WXG A;  3ZHE B;  3HXB A;  5ENQ D;  3BUA A;  3PEU B;  4AXH A;  3CHQ A; 
#chains in the Genus database with same CATH homology
 4YDE A;  3EUV A;  1TNU A;  2ZIS A;  4EHM A;  1JCR A;  3E34 A;  3DSU A;  3DSS A;  3Q78 A;  1O1R A;  3EU5 A;  2IEJ A;  1S63 A;  2H6I A;  1O1S A;  1N4P A;  2H6H A;  3DRA A;  1X81 A;  1N94 A;  3Q75 A;  1NI1 A;  1KZP A;  3Q79 A;  1TNO A;  3E37 A;  4GTV A;  4GTS A;  1LD8 A;  1TN8 A;  3Q7F A;  3PZ1 A;  4GTT A;  3PZ2 A;  2ZIR A;  2BED A;  1JCS A;  1S64 A;  1TN6 A;  3DSV A;  1TNZ A;  3SFX A;  4LNB A;  1N9A A;  1LD7 A;  1MZC A;  1JCQ A;  1FT2 A;  3HXE A;  3PZ3 A;  3HXD A;  3PZ4 A;  3C72 A;  2R2L A;  1N4R A;  1O5M A;  2H6F A;  1SA4 A;  1DCE A;  3DST A;  1TNB A;  3HXF A;  1FT1 A;  4GTR A;  4L9P A;  1QBQ A;  3SFY A;  3E33 A;  4LNG A;  2H6G A;  3HXC A;  3Q7A A;  1SA5 A;  4GTO A;  1O1T A;  4GTQ A;  1KZO A;  1TN7 A;  4YDO A;  4GTM A;  1D8D A;  3E30 A;  3DSX A;  3KSL A;  1N4S A;  1D8E A;  4MBG A;  1NL4 A;  3Q73 A;  2F0Y A;  3KSQ A;  3DSW A;  1TNY A;  1FPP A;  1LTX A;  3HXB A;  4GTP A;  3DPY A;  1N4Q A;  3E32 A;  1N95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...