1TNZA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a rrcvll peptide derived from cdc42 splice isoform-2
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 128
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnzA00
3DSTA 3E30A 1DCEA 3HXDA 1TNBA 1LD7A 1QBQA 4GTTA 3PZ4A 3C72A 4MBGA 2BEDA 1NL4A 3EU5A 1D8DA 1N94A 1N4RA 1TN7A 2H6IA 1N95A 1KZOA 3E33A 2H6HA 3SFXA 1KZPA 3DSXA 4GTQA 2F0YA 4YDEA 1FPPA 3Q79A 1JCQA 1TN6A 3KSQA 3HXBA 2ZIRA 1LD8A 3DSWA 1TNZA 4L9PA 3KSLA 4GTRA 1FT2A 3E37A 3HXEA 1N4SA 3Q75A 1O5MA 1SA4A 1FT1A 4YDOA 4LNGA 3Q73A 1SA5A 1LTXA 1TNUA 1N4PA 1TNYA 1TN8A 3PZ2A 1MZCA 2H6FA 1O1RA 4GTSA 3Q7AA 3DPYA 1D8EA 3SFYA 1N4QA 1X81A 4EHMA 1S64A 3PZ3A 3PZ1A 4LNBA 3E34A 2ZISA 3DSSA 4GTVA 3E32A 4GTMA 3Q78A 3Q7FA 3DRAA 3DSVA 2R2LA 3HXFA 1NI1A 1JCRA 3DSUA 1S63A 1N9AA 1TNOA 3HXCA 2H6GA 1O1SA 1O1TA 2IEJA 4GTPA 3EUVA 4GTOA 1JCSA
chains in the Genus database with same CATH superfamily
2VSYA 3FEYA 3L6AA 4JHJA 1BPOA 4RG9A 2CFUA 3ONKA 2NXPA 5EN5D 4APOA 3ZW3A 4GCNA 5BNWA 5E76A 5BXUA 1NA0A 3CHOA 3DSXA 4GA1A 1BLXB 4G23A 2BKGA 3FULA 1OWMA 1XNFA 3DEPA 1JWGA 5CECB 3CQGB 3FU6A 1LF8A 2XPIA 2CG2A 2CHWA 5FTPA 1TNZA 3WG7E 2XGMA 5KCMA 3JXJA 1JWFA 2L0IA 3VTXA 3U9WA 3GZ1A 1TYQG 3OAWA 3TWTA 4BTBA 4N5QA 4U8YD 3UPVA 3FY4A 1HE8A 1DVPA 1MJ0A 3ZYMA 4Y6WA 4LRZA 3CR3A 3Q78A 4EBAA 2JLBA 3ZXPA 3AG4E 4GA2A 3KS2A 2J49A 3SBTB 3AAAC 3NF1A 3J5QB 1E8WA 4HOUA 5LP0A 3CSTA 3ABLE 2WQ7A 3U3WA 4URKA 5ENPD 3C72A 2DIWA 3Q49B 3FFLA 3NZSA 2HR2A 5BUZA 3LYAA 3ZHEB 2ILRA 4GZCA 3SFXA 4FADA 3AS5A 2J09A 2WB2A 3EHMA 4XIFA 4TV3A 4IYPA 1U3DA 2IJGX 1A5EA 1D9SA 3Q79A 2V4HC 5FT9A 3VTYA 3MV2B 4UI9C 2VGYA 2ETCA 5HI7A 5JHBA 2L6BA 4NURA 2IY0C 2M63A 4KXKB 3G2UA 3S2AA 3KSLA 4MS6A 1A17A 4DX6D 3ASOE 4FLHA 1YCSB 3EU9A 1IXVA 3BUAA 3ZHEA 4RSYA 1SZ9A 1TN8A 5BPPA 3SF4A 1YMPA 2P9LG 2B0OE 1OWPA 4GYOA 3QWVA 3SFYA 2ZGDA 3OXLA 3RRUA 2J07A 1GW6A 4ZHBA 4PS7A 1H2VC 2DBAA 4UUCA 3LEWA 3UX4A 5CMYA 4KYOB 2H6GA 1X5BA 5G04J 5KJKA 3EHRA 2X38A 2VSXE 4J6IA 4R7LA 3LVQE 2VTBB 4GTTA 5EKQD 3QOUA 3RJVA 3ZRHA 5CHEE 4UWKA 2BKKB 4DX1A 3PVLA 3ZPJA 4DUIA 5FQ7A 4FA6A 4P29A 2HE0A 3FTSA 1H6OA 3R7QA 4HBDA 3L22A 2F0YA 4WWOA 3ZU7B 2GROB 3HHMA 3LJ3A 4WAFA 4YDYA 2VTBA 2WXKA 3FP3A 2OVFA 3JUIA 3LPZA 5ENQD 4X8QA 3MEKA 1HO8A 4I43A 3U4TA 2MOWA 3DBSA 1N4PA 2WXNA 2XRZA 3PZ2A 1QNFA 4CZ2D 2GRLA 3T5XA 4KVMA 1UJJA 1PY1A 5AAOA 4CCAA 1FCHA 2MYOA 5ENOD 1X81A 2LXLA 1IKND 1IHGA 3DSSA 4UQXA 3Q7FA 4GZ6A 3Q15A 4G2VA 4AV7A 4EECA 4BT8A 3I3NA 1P5QA 5ENNA 4LG6A 2IEJA 1N11A 3AU5A 3NB2A 4FHJA 2IQCA 3ZIMA 4U95D 2P9IG 1K3ZD 2KCKA 3CVVA 3MX3A 1YYHA 4BFRA 4FU3A 2IONA 4K0RA 1OWOA 2FO1E 4WNEA 1N4RA 3EDTB 3APFA 1H6KA 4CGVA 3UIPC 4DK5A 5JJTA 1MX6A 3GYZA 3L13A 2Y69E 3PREA 4JB8P 5CMWA 3KEZA 4F3VA 2WXRA 2AJAA 1BI7B 3B7UX 4HI9A 2EQXA 5AQBA 3TAXA 4J8DA 3FUNA 4BTAA 4KZ0A 1EPUA 3ZFWA 3D9IA 3O48A 4U8HA 3FH5A 4B8AA 3QB2A 4A1SA 2RFMA 5JHAA 3CVLA 4NQ0A 2WXPA 3D9JA 3PZ3A 4L2LA 4JEHA 4UI9K 5KNGA 4CT0A 4DLOA 4GTMA 4K5BA 4K5CA 2IF4A 4GZDA 3DSVA 3FTWA 5LX8A 2R5SA 2YQ8A 2WMOA 4KZCA 4BSXA 5D0OD 2QFCA 4RG6A 3ML9A 5D0QD 1MX4A 3I4GA 3TG4A 3UT4A 1DCEA 1TR4A 4O1PA 3TJPA 3L08A 3ENEA 4A1GA 4MLPA 4D10C 1XGWA 1UOHA 1Q2ZA 4CGWA 3F6QA 1HG5A 2AXUA 3CQCB 3DPDA 2DZNA 1OUVA 1NFIE 3FTVA 4YDEA 3NOGD 3TG5A 4XE0A 1FPPA 2AXVA 4F1SA 4I6GA 2GRNB 1JCQA 3SGHA 3WXXA 4OVUA 1IYGA 3JYSA 5KNHD 4JXTA 3AS4A 4GAAA 4UWHA 1O5MA 4LNGA 4GPKA 5D66A 3DWLG 4HOQA 4LCTA 4U7EB 2I1JA 3I5PA 4K5AB 5EX3A 3HRAA 4HRNA 4Q69A 3FUHA 4ANXA 2P9UG 4J8SA 4L1BA 4LNBA 5CRVA 3TWVA 4BSZB 1IQRA 3CV0A 4CYMD 1TJFA 3RIBA 2FBNA 4JA7A 5ENRD 5AQ9A 1TNOA 1Z3XA 5G2NA 4GB9A 5KJLA 1O1SA 5C2YA 3LS8A 4I2ZA 4U8VD 4K03A 4TRQA 3PS6A 4V3IA 2DCPA 3TWRA 3MYVA 2XZDG 4AOFA 4L23A 1N94A 1HZ4A 1UN8A 2WXQA 5H7PA 2ETAA 5AIJA 4HS2A 4ATGA 3CSFA 3CVXA 3HYMB 1RW2A 3NQPA 3FTUA 3Q47B 1LD8A 4YVOA 4F53A 3C98A 1H2TC 5CERB 4Y6CA 2J4DA 2A5EA 4JL0A 3SY2A 5BW8C 3RAUA 1SA4A 3T8KA 3SQVA 4M3OA 2J9QA 1KT0A 3DXKG 2FI7A 2WXOA 3HIZA 2UY1B 3HG0D 4JD2G 4F1PA 4BEPA 5AQ7A 4DI4A 4FP7A 2WVIA 3CVQA 3VLDA 3ISMC 4GMRA 4PS3A 3X2QE 4FLBA 5ITZF 2YNQA 2I1KA 2ZISA 3JUEA 4B94A 4C0EA 4QFVA 3EHNA 2EIKE 2X6HA 3T9KA 2QYUA 3ASNE 2UY1A 3LKUA 4IRUA 1Y8MA 2X6KA 2IO3C 4G1TA 4N3AA 2KC7A 2XCCA 2F37A 4GYYA 1JCSA 1TNBA 1LD7A 4RQIA 1OXJA 3NAWA 2JABA 4HOSA 2V8SE 4U0SA 1D8DA 5KBAA 5IY5E 5KJNA 4BWRA 3UKRG 1KLXA 1E8XA 3D9KA 3J5PA 2L9BA 4JW1A 5J08A 4G8LA 1VDYA 1RZ4A 3KSQA 1HG2A 1HFAA 3CEQA 3Q5MA 3UM3A 2DYSE 5C1DA 2V0PA 1N4SA 4FULA 1PC2A 4F6RD 4LSZE 2VGXB 4DX5D 2Y1LE 4ATZD 4TUUA 4TXPA 2ZU6B 1U3CA 4JPSA 4OAUC 2HYZA 3L82A 3RO3A 4PUCA 4KBQA 2XPYA 1D8EA 3PZDA 2V5FA 2PQRA 1N4QA 2XCBA 3UKUG 2WXMA 5HS0A 4UQZA 3G2WA 2YHCA 4GTVA 3QDNA 3E32A 3IKOB 3LDZA 2VGXA 3FH7A 3FU5A 3N71A 5EYLA 3O4ZA 4HVBA 4XZ4A 2WXFA 3TWWA 4AJWA 1S70B 3W9GA 3KAEA 1HX8A 3OXFA 1HH8A 4AM9A 3JQ0A 2KXPC 2FO7A 3IHVA 3V79K 4GMLA 2WPVA 1N95A 1NP7A 3IXEA 1UG3A 4GTQA 5AENA 3LY8A 3HVEB 2BUGA 4JC8A 4DRXE 3I4RB 4I1OB 1WM5A 1TN6A 2CHXA 3FUMA 4ANUA 5A23A 4AY6A 3CHPA 3SD5A 1ELWA 3HXEA 1G3NB 1SA5A 4UWGA 2EILE 4OYSA 4PH4B 2C0MA 2C0LA 3HVEA 5CEAA 5B1BE 1HU3A 3ZKJA 4XI0A 2FF4A 3CHRA 3BG0B 1FVHA 4IN3B 2LSVA 4AEZC 3UXGA 4H7YA 4C48B 1OWNA 3DRAA 3FH8A 2UWJG 5AJLA 3FHEA 1B89A 2KBXA 1N9AA 2BTDA 3ZN3A 3ASGA 2WXJA 2X6IA 2KATA 4ME2A 3EUVA 3BG1B 4O6FA 3FUIA 4XX5A 3RO2A 5G05J 2DVWA 4EPZA 3P1UA 2H6HA 2LSUA 1MQSA 3C3OA 2VYIA 4ILHB 2EIJE 1TEZA 3FUJA 2RFAA 1N54A 5BXOA 4BX9A 5T4YA 2PM6A 4U63A 1W3BA 4CT4A 2XEVA 2OEVA 2E0IA 3D9HA 4RVBA 5JJ6A 3AJIA 4APFA 2P9KG 3TXMA 3FUFA 1H2UA 5B1AE 2LUHA 5JA4D 3EIQC 2PL2A 1Z5SC 4DX2A 3SO8A 4E6HA 4ZFHA 1S64A 4U0UA 3CVWA 3D9LA 3SBSA 3ZYLA 3QJZA 4N3BA 2WXGA 4I6JA 1E90A 5HKPA 4TXRA 1WDYA 3EIJA 3CVPA 4RLYA 5BV1A 2GRPB 4U04A 1SVXA 2GW1A 3DSTA 2XS1A 3HXDA 4BY6A 2VJ8A 4B89A 1BU9A 3CKBA 4DLQA 4ANVA 3P2BA 4J8FA 2AW6A 4JZYA 3CK9A 3TL5A 1KZPA 4J0UA 2VQ2A 1WG0A 5BV0A 4HOTA 3D9MA 4Z68A 4N2QA 5AARA 3AS8A 3UUXA 4O60A 3ONLA 3RSEG 1OT8A 3MGBA 1SW6A 3FU0A 4LUNU 5AJDA 3CK8A 2WM9A 3ZVVA 3Q4AB 1NZNA 2QZAA 5G04C 1BD8A 5E75A 1TNYA 1V54E 3ULYA 1H19A 5FINA 4J8EA 3SI5A 2WXIA 2IO2C 2AXZA 1ZBPA 2IOLA 2I6HA 4AP2A 2V4LA 5KWDA 1OCZE 3D9NA 4UI9J 1INZA 3IBEA 3RRMB 2AWIA 4Q96A 2R17C 4FC8A 2X3MA 1DC2A 4IULA 1O1TA 1K1AA 3FTXA 4WWPA 3EHQA 2F8XK 3S7BA 1E8ZA 2F8YA 5ARGA 4GYWA 2RKKA 2LXMA 5FJYA 5AYWD 5T3RA 3Q9UC 2BEDA 1N52A 1NL4A 2V5QC 3PEUB 3KD7A 1IQUA 4CRWA 2L6JA 2JEKA 4AVXA 5JJ7A 2NC9A 2OEWA 5ANLA 3FUDA 2PM7A 3QNKA 3UM1A 3Q9NC 3T8MA 1MYOA 3TWSA 2DYRE 2KCVA 3IEGA 3PH0C 1ZB1A 1UN9A 3ABKE 2XPZA 1QQEA 4LERA 5G05C 3ESLA 4HFGA 2P9NG 4GTRA 4HLEA 5CEDB 4I2WA 4YDOA 4Q94A 5EDSA 2CG3A 3QK0A 3QWPA 4G11A 2H6FA 5DBKA 3Q7AA 3ASFA 4OVVA 2X6JA 1Z6TA 3SFZA 3ML8A 5FQ6A 4BERA 3UT8A 2VSNA 3PZ1A 2Y0BG 3B7BA 2WMNA 2R03A 3LY9A 3W9FA 4JHKA 3CK7A 4TXQA 3ULQA 2I9CA 3B95A 4I1MA 3OXGA 3CLJA 3MA5A 2WQHA 5FZSA 2OOEA 5A6CA 5KJMA 4FHKA 5EILA 1H0AA 3GZ2A 1WAO1 4GTPA 2QYJA 4A3TA 5ANRA 3HDXA 4BETA 3TWQA 2P58C 1OCCE 4A63B 4MKTA 4BX8A 5EYPF 3MKRA 2XGSA 4JA9A 3V31A 4MBGA 3CKCA 3EU5A 4GMJA 2R02A 5DIZA 2H6IA 3BEEA 4XI9A 2RG8A 4LNUD 2VSOE 4HORA 2P9PG 4L2YA 1QZ2A 2IOSA 2YINA 3CHMA 2X6FA 3E4BA 2KM4A 3B7SA 4W9RA 4YDWA 2QC9A 2PNNA 1FT2A 2NYJA 3JXIA 4NRHB 3Q75A 2CHZA 2J08A 3APCA 3ASHA 1SQMA 5AQAA 1JPLA 1KPSB 5FQ4A 1IHBA 2XZTG 2XQ0A 3CHSA 2DZOA 3TWUA 3K9IA 4N2SA 4CEMA 3V2XA 4EHMA 3FUKA 4CDRA 3MZLB 3E34A 2MHKA 2XGOA 3AU4A 2XEEA 4KVOA 4MRUA 3GZSA 4N3CA 4U07A 1EDUA 4KMOA 2LAHA 4HQDA 3D3MA 3G2SA 4FJYA 1DNPA 4ABNA 2R05A 2A4ZA 2GRRB 2WQ6A 4B8CB 2AVPA 3CVUA 2Y3AA 4JHRA 2KZTB 3QAQA 5FZQA 3E30A 3CHQA 1QBQA 1L5JA 3PZ4A 3V2OA 2GGFA 3LJNA 3PE3A 1ZU2A 3D9OA 4CDNA 5FWQA 1TN7A 4UQYA 1OCRE 3R9AB 3ZXSA 3UI2A 3CIAA 5AN8A 3L17A 1HS6A 4GU5A 2P9SG 4PS8A 3C5RA 3SZ7A 3FDHA 4ACLA 2KZTA 4GPMA 4ANWA 4WWNA 5B3SE 4L9PA 3JCKC 5CCLA 1Z3YA 1ELRA 4JVSA 3QKYA 1KT1A 1E8YA 3NZUA 2GRMA 2HM8A 3DEOA 3D9PA 4B93B 1U2VG 3S7JA 3ZYKA 1O1RA 4GTSA 1YA0A 4AXHA 1HF8A 2LAIA 2YHEA 1N0RA 4G26A 4JEUA 4H7XA 5M72A 4N5CA 2FULA 2PZIA 4KT6B 1QYMA 5FQ8A 4HB5A 4I9EA 3ABME 3PUJA 4NIKA 5J90A 3B7RL 4U96D 1UJKA 1NI1A 3DSUA 3PNTB 5JMND 4ILIA 5LFAA 1MHQA 5EIDA 3ZEFA 3G2TA 4HRMB 1EF1C 5LOZA 3VLEA 3U66A 4PDXA 2Y4UA 5BT1A 1UW4B 5CRUA 2OCCE 3FUEA 4N39A 3ULEG 3JQ1A 3UIOC 2XS8A 2HO1A 2I2OA 4BESA 3UM0A 3U64A 2A5UA 3E33A 1OWLA 4HLLA 4XEIG 2L0TB 4O1OA 4WUYA 3TGOA 3PRZA 4HXIA 3B13A 3NBNB 2ZGGA 3L16A 3UMVA 1PAQA 2LO6A 5D2MC 2ZIRA 4GA0A 3CGHA 3R9MA 5CBNA 3AG1E 3C3QA 4WNFA 1K8KG 3ASDA 3PUKA 3Q73A 3MCXA 3MJWA 4G24A 1LTXA 3AG2E 4U0ZA 2CFZA 2IFUA 1S0PA 1E7UA 5LCWJ 4EBAG 1BI8B 2VGEA 2EIME 4ACKA 5FZRA 2C2LA 5CCMA 5ARFA 2J8SD 3VLFA 4AIFA 4G8KA 1EYHA 4DX7D 4UWFA 2R2LA 3HXFA 2LNIA 4TUMA 4A55A 2ZXWE 2MRIA 4A3VA 1AP7A 1NA3A 4EZKA 2EINE 2PQNA 1FVFA 4DPRA 3RK6A 1E7VA 3DXMG 1KZOA 3QWWA 2OVBA 4EQFA 1JUQA 3G2VA 3UT7A 3APDA 3S7FA 4L7TA 3ESKA 4E85A 3EJNA 5HRYA 1DCQA 4DI3A 5EX0A 2WXLA 1HXIA 2B6CA 3B7TA 3FTZA 4YNDA 3NOCD 3R7RA 3MKQB 4XKCA 3TWXA 3BQOA 4ILGA 3PNLB 2FEZA 4HRLA 3RU0A 2P2CP 4I17A 4FJZA 3DPYA 3RKVA 4GZ3A 3SHFA 2DWZA 3ZNGA 3LCAA 4LEUA 1V55E 2NSZA 4I6EA 3T5VA 3CVYA 3FEXA 3GW4A 2XENA 2KCLA 3IV0A 3LXUX 2R59A 3OTNA 1S63A 2Q7FA 1TJCA 1MX2A 3MKQA 3PDNA 3C3RA 4EZLA 3PE4A 4OAVB 3AG3E 3LY7A 3ZUVB 4CDMA 3SNXA 3TXNA 2OV8A 3LVRE 4YVQC 4AY5A 2XHEA 4NACA 3RRNB 4HNAD 3ZYQA 3QARA 4WNDA 5HQ8A 3PEVB 3FTYA 1ELKA 4HI8A 1H6PA 2Y4TA 2IU1A 3IHYA 4C0MA 2QY7A 4WNGA 3UINC 1AWCB 4G25A 4F7AA 1SZAA 3HXBA 3V30A 3CVNA 3DSWA 2ONDA 2WXHA 3L9TA 2GRQB 4UWLA 3E37A 3KEAA 1FT1A 1Y6IA 3BU8A 2XRYA 5FIOA 5A7DB 1K1BA 1TNUA 3UTMA 3UQ3A 1E96B 5T8IA 3MV3B 1MZCA 3ZGQA 4B0ZA 1N0QA 3QC1A 5ENSD 2E2EA 1OY3D 4GCOA 4DJAA 4J7WA 4M7CA 3FWVA 4J8YA 3URZA 2J4BA 3FU3A 4XKBA 4I1AA 5LCWC 2ETBA 1OCOE 5EIBE 1JCRA 1WY6A 5G55A 5ENTD 3L54A 3S7DA 3HXCA 4EZJA 2RD0A 4I9CA 2BF0X 5CBOA 3UM2A 4C9BB 4GTOA 4BT9A 4QQIA 2XEHA 4GZ5A
chains in the Genus database with same CATH topology
3DSTA 3E30A 1DCEA 3HXDA 1TNBA 1LD7A 1QBQA 4GTTA 3PZ4A 3C72A 4MBGA 2BEDA 1NL4A 3EU5A 1D8DA 1N94A 1N4RA 1TN7A 2H6IA 1N95A 1KZOA 3E33A 2H6HA 3SFXA 1KZPA 3DSXA 4GTQA 2F0YA 4YDEA 1FPPA 3Q79A 1JCQA 1TN6A 3KSQA 3HXBA 2ZIRA 1LD8A 3DSWA 1TNZA 4L9PA 3KSLA 4GTRA 1FT2A 3E37A 3HXEA 1N4SA 3Q75A 1O5MA 1SA4A 1FT1A 4YDOA 4LNGA 3Q73A 1SA5A 1LTXA 1TNUA 1N4PA 1TNYA 1TN8A 3PZ2A 1MZCA 2H6FA 1O1RA 4GTSA 3Q7AA 3DPYA 1D8EA 3SFYA 1N4QA 1X81A 4EHMA 1S64A 3PZ3A 3PZ1A 4LNBA 3E34A 2ZISA 3DSSA 4GTVA 3E32A 4GTMA 3Q78A 3Q7FA 3DRAA 3DSVA 2R2LA 3HXFA 1NI1A 1JCRA 3DSUA 1S63A 1N9AA 1TNOA 3HXCA 2H6GA 1O1SA 1O1TA 2IEJA 4GTPA 3EUVA 4GTOA 1JCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DST A;  3E30 A;  1DCE A;  3HXD A;  1TNB A;  1LD7 A;  1QBQ A;  4GTT A;  3PZ4 A;  3C72 A;  4MBG A;  2BED A;  1NL4 A;  3EU5 A;  1D8D A;  1N94 A;  1N4R A;  1TN7 A;  2H6I A;  1N95 A;  1KZO A;  3E33 A;  2H6H A;  3SFX A;  1KZP A;  3DSX A;  4GTQ A;  2F0Y A;  4YDE A;  1FPP A;  3Q79 A;  1JCQ A;  1TN6 A;  3KSQ A;  3HXB A;  2ZIR A;  1LD8 A;  3DSW A;  1TNZ A;  4L9P A;  3KSL A;  4GTR A;  1FT2 A;  3E37 A;  3HXE A;  1N4S A;  3Q75 A;  1O5M A;  1SA4 A;  1FT1 A;  4YDO A;  4LNG A;  3Q73 A;  1SA5 A;  1LTX A;  1TNU A;  1N4P A;  1TNY A;  1TN8 A;  3PZ2 A;  1MZC A;  2H6F A;  1O1R A;  4GTS A;  3Q7A A;  3DPY A;  1D8E A;  3SFY A;  1N4Q A;  1X81 A;  4EHM A;  1S64 A;  3PZ3 A;  3PZ1 A;  4LNB A;  3E34 A;  2ZIS A;  3DSS A;  4GTV A;  3E32 A;  4GTM A;  3Q78 A;  3Q7F A;  3DRA A;  3DSV A;  2R2L A;  3HXF A;  1NI1 A;  1JCR A;  3DSU A;  1S63 A;  1N9A A;  1TNO A;  3HXC A;  2H6G A;  1O1S A;  1O1T A;  2IEJ A;  4GTP A;  3EUV A;  4GTO A;  1JCS A; 
#chains in the Genus database with same CATH topology
 2VSY A;  3FEY A;  3L6A A;  4JHJ A;  1BPO A;  4RG9 A;  2CFU A;  3ONK A;  2NXP A;  5EN5 D;  4APO A;  3ZW3 A;  4GCN A;  5BNW A;  5E76 A;  5BXU A;  1NA0 A;  3CHO A;  3DSX A;  4GA1 A;  1BLX B;  4G23 A;  2BKG A;  3FUL A;  1OWM A;  1XNF A;  3DEP A;  1JWG A;  5CEC B;  3CQG B;  3FU6 A;  1LF8 A;  2XPI A;  2CG2 A;  2CHW A;  5FTP A;  1TNZ A;  3WG7 E;  2XGM A;  5KCM A;  3JXJ A;  1JWF A;  2L0I A;  3VTX A;  3U9W A;  3GZ1 A;  1TYQ G;  3OAW A;  3TWT A;  4BTB A;  4N5Q A;  4U8Y D;  3UPV A;  3FY4 A;  1HE8 A;  1DVP A;  1MJ0 A;  3ZYM A;  4Y6W A;  4LRZ A;  3CR3 A;  3Q78 A;  4EBA A;  2JLB A;  3ZXP A;  3AG4 E;  4GA2 A;  3KS2 A;  2J49 A;  3SBT B;  3AAA C;  3NF1 A;  3J5Q B;  1E8W A;  4HOU A;  5LP0 A;  3CST A;  3ABL E;  2WQ7 A;  3U3W A;  4URK A;  5ENP D;  3C72 A;  2DIW A;  3Q49 B;  3FFL A;  3NZS A;  2HR2 A;  5BUZ A;  3LYA A;  3ZHE B;  2ILR A;  4GZC A;  3SFX A;  4FAD A;  3AS5 A;  2J09 A;  2WB2 A;  3EHM A;  4XIF A;  4TV3 A;  4IYP A;  1U3D A;  2IJG X;  1A5E A;  1D9S A;  3Q79 A;  2V4H C;  5FT9 A;  3VTY A;  3MV2 B;  4UI9 C;  2VGY A;  2ETC A;  5HI7 A;  5JHB A;  2L6B A;  4NUR A;  2IY0 C;  2M63 A;  4KXK B;  3G2U A;  3S2A A;  3KSL A;  4MS6 A;  1A17 A;  4DX6 D;  3ASO E;  4FLH A;  1YCS B;  3EU9 A;  1IXV A;  3BUA A;  3ZHE A;  4RSY A;  1SZ9 A;  1TN8 A;  5BPP A;  3SF4 A;  1YMP A;  2P9L G;  2B0O E;  1OWP A;  4GYO A;  3QWV A;  3SFY A;  2ZGD A;  3OXL A;  3RRU A;  2J07 A;  1GW6 A;  4ZHB A;  4PS7 A;  1H2V C;  2DBA A;  4UUC A;  3LEW A;  3UX4 A;  5CMY A;  4KYO B;  2H6G A;  1X5B A;  5G04 J;  5KJK A;  3EHR A;  2X38 A;  2VSX E;  4J6I A;  4R7L A;  3LVQ E;  2VTB B;  4GTT A;  5EKQ D;  3QOU A;  3RJV A;  3ZRH A;  5CHE E;  4UWK A;  2BKK B;  4DX1 A;  3PVL A;  3ZPJ A;  4DUI A;  5FQ7 A;  4FA6 A;  4P29 A;  2HE0 A;  3FTS A;  1H6O A;  3R7Q A;  4HBD A;  3L22 A;  2F0Y A;  4WWO A;  3ZU7 B;  2GRO B;  3HHM A;  3LJ3 A;  4WAF A;  4YDY A;  2VTB A;  2WXK A;  3FP3 A;  2OVF A;  3JUI A;  3LPZ A;  5ENQ D;  4X8Q A;  3MEK A;  1HO8 A;  4I43 A;  3U4T A;  2MOW A;  3DBS A;  1N4P A;  2WXN A;  2XRZ A;  3PZ2 A;  1QNF A;  4CZ2 D;  2GRL A;  3T5X A;  4KVM A;  1UJJ A;  1PY1 A;  5AAO A;  4CCA A;  1FCH A;  2MYO A;  5ENO D;  1X81 A;  2LXL A;  1IKN D;  1IHG A;  3DSS A;  4UQX A;  3Q7F A;  4GZ6 A;  3Q15 A;  4G2V A;  4AV7 A;  4EEC A;  4BT8 A;  3I3N A;  1P5Q A;  5ENN A;  4LG6 A;  2IEJ A;  1N11 A;  3AU5 A;  3NB2 A;  4FHJ A;  2IQC A;  3ZIM A;  4U95 D;  2P9I G;  1K3Z D;  2KCK A;  3CVV A;  3MX3 A;  1YYH A;  4BFR A;  4FU3 A;  2ION A;  4K0R A;  1OWO A;  2FO1 E;  4WNE A;  1N4R A;  3EDT B;  3APF A;  1H6K A;  4CGV A;  3UIP C;  4DK5 A;  5JJT A;  1MX6 A;  3GYZ A;  3L13 A;  2Y69 E;  3PRE A;  4JB8 P;  5CMW A;  3KEZ A;  4F3V A;  2WXR A;  2AJA A;  1BI7 B;  3B7U X;  4HI9 A;  2EQX A;  5AQB A;  3TAX A;  4J8D A;  3FUN A;  4BTA A;  4KZ0 A;  1EPU A;  3ZFW A;  3D9I A;  3O48 A;  4U8H A;  3FH5 A;  4B8A A;  3QB2 A;  4A1S A;  2RFM A;  5JHA A;  3CVL A;  4NQ0 A;  2WXP A;  3D9J A;  3PZ3 A;  4L2L A;  4JEH A;  4UI9 K;  5KNG A;  4CT0 A;  4DLO A;  4GTM A;  4K5B A;  4K5C A;  2IF4 A;  4GZD A;  3DSV A;  3FTW A;  5LX8 A;  2R5S A;  2YQ8 A;  2WMO A;  4KZC A;  4BSX A;  5D0O D;  2QFC A;  4RG6 A;  3ML9 A;  5D0Q D;  1MX4 A;  3I4G A;  3TG4 A;  3UT4 A;  1DCE A;  1TR4 A;  4O1P A;  3TJP A;  3L08 A;  3ENE A;  4A1G A;  4MLP A;  4D10 C;  1XGW A;  1UOH A;  1Q2Z A;  4CGW A;  3F6Q A;  1HG5 A;  2AXU A;  3CQC B;  3DPD A;  2DZN A;  1OUV A;  1NFI E;  3FTV A;  4YDE A;  3NOG D;  3TG5 A;  4XE0 A;  1FPP A;  2AXV A;  4F1S A;  4I6G A;  2GRN B;  1JCQ A;  3SGH A;  3WXX A;  4OVU A;  1IYG A;  3JYS A;  5KNH D;  4JXT A;  3AS4 A;  4GAA A;  4UWH A;  1O5M A;  4LNG A;  4GPK A;  5D66 A;  3DWL G;  4HOQ A;  4LCT A;  4U7E B;  2I1J A;  3I5P A;  4K5A B;  5EX3 A;  3HRA A;  4HRN A;  4Q69 A;  3FUH A;  4ANX A;  2P9U G;  4J8S A;  4L1B A;  4LNB A;  5CRV A;  3TWV A;  4BSZ B;  1IQR A;  3CV0 A;  4CYM D;  1TJF A;  3RIB A;  2FBN A;  4JA7 A;  5ENR D;  5AQ9 A;  1TNO A;  1Z3X A;  5G2N A;  4GB9 A;  5KJL A;  1O1S A;  5C2Y A;  3LS8 A;  4I2Z A;  4U8V D;  4K03 A;  4TRQ A;  3PS6 A;  4V3I A;  2DCP A;  3TWR A;  3MYV A;  2XZD G;  4AOF A;  4L23 A;  1N94 A;  1HZ4 A;  1UN8 A;  2WXQ A;  5H7P A;  2ETA A;  5AIJ A;  4HS2 A;  4ATG A;  3CSF A;  3CVX A;  3HYM B;  1RW2 A;  3NQP A;  3FTU A;  3Q47 B;  1LD8 A;  4YVO A;  4F53 A;  3C98 A;  1H2T C;  5CER B;  4Y6C A;  2J4D A;  2A5E A;  4JL0 A;  3SY2 A;  5BW8 C;  3RAU A;  1SA4 A;  3T8K A;  3SQV A;  4M3O A;  2J9Q A;  1KT0 A;  3DXK G;  2FI7 A;  2WXO A;  3HIZ A;  2UY1 B;  3HG0 D;  4JD2 G;  4F1P A;  4BEP A;  5AQ7 A;  4DI4 A;  4FP7 A;  2WVI A;  3CVQ A;  3VLD A;  3ISM C;  4GMR A;  4PS3 A;  3X2Q E;  4FLB A;  5ITZ F;  2YNQ A;  2I1K A;  2ZIS A;  3JUE A;  4B94 A;  4C0E A;  4QFV A;  3EHN A;  2EIK E;  2X6H A;  3T9K A;  2QYU A;  3ASN E;  2UY1 A;  3LKU A;  4IRU A;  1Y8M A;  2X6K A;  2IO3 C;  4G1T A;  4N3A A;  2KC7 A;  2XCC A;  2F37 A;  4GYY A;  1JCS A;  1TNB A;  1LD7 A;  4RQI A;  1OXJ A;  3NAW A;  2JAB A;  4HOS A;  2V8S E;  4U0S A;  1D8D A;  5KBA A;  5IY5 E;  5KJN A;  4BWR A;  3UKR G;  1KLX A;  1E8X A;  3D9K A;  3J5P A;  2L9B A;  4JW1 A;  5J08 A;  4G8L A;  1VDY A;  1RZ4 A;  3KSQ A;  1HG2 A;  1HFA A;  3CEQ A;  3Q5M A;  3UM3 A;  2DYS E;  5C1D A;  2V0P A;  1N4S A;  4FUL A;  1PC2 A;  4F6R D;  4LSZ E;  2VGX B;  4DX5 D;  2Y1L E;  4ATZ D;  4TUU A;  4TXP A;  2ZU6 B;  1U3C A;  4JPS A;  4OAU C;  2HYZ A;  3L82 A;  3RO3 A;  4PUC A;  4KBQ A;  2XPY A;  1D8E A;  3PZD A;  2V5F A;  2PQR A;  1N4Q A;  2XCB A;  3UKU G;  2WXM A;  5HS0 A;  4UQZ A;  3G2W A;  2YHC A;  4GTV A;  3QDN A;  3E32 A;  3IKO B;  3LDZ A;  2VGX A;  3FH7 A;  3FU5 A;  3N71 A;  5EYL A;  3O4Z A;  4HVB A;  4XZ4 A;  2WXF A;  3TWW A;  4AJW A;  1S70 B;  3W9G A;  3KAE A;  1HX8 A;  3OXF A;  1HH8 A;  4AM9 A;  3JQ0 A;  2KXP C;  2FO7 A;  3IHV A;  3V79 K;  4GML A;  2WPV A;  1N95 A;  1NP7 A;  3IXE A;  1UG3 A;  4GTQ A;  5AEN A;  3LY8 A;  3HVE B;  2BUG A;  4JC8 A;  4DRX E;  3I4R B;  4I1O B;  1WM5 A;  1TN6 A;  2CHX A;  3FUM A;  4ANU A;  5A23 A;  4AY6 A;  3CHP A;  3SD5 A;  1ELW A;  3HXE A;  1G3N B;  1SA5 A;  4UWG A;  2EIL E;  4OYS A;  4PH4 B;  2C0M A;  2C0L A;  3HVE A;  5CEA A;  5B1B E;  1HU3 A;  3ZKJ A;  4XI0 A;  2FF4 A;  3CHR A;  3BG0 B;  1FVH A;  4IN3 B;  2LSV A;  4AEZ C;  3UXG A;  4H7Y A;  4C48 B;  1OWN A;  3DRA A;  3FH8 A;  2UWJ G;  5AJL A;  3FHE A;  1B89 A;  2KBX A;  1N9A A;  2BTD A;  3ZN3 A;  3ASG A;  2WXJ A;  2X6I A;  2KAT A;  4ME2 A;  3EUV A;  3BG1 B;  4O6F A;  3FUI A;  4XX5 A;  3RO2 A;  5G05 J;  2DVW A;  4EPZ A;  3P1U A;  2H6H A;  2LSU A;  1MQS A;  3C3O A;  2VYI A;  4ILH B;  2EIJ E;  1TEZ A;  3FUJ A;  2RFA A;  1N54 A;  5BXO A;  4BX9 A;  5T4Y A;  2PM6 A;  4U63 A;  1W3B A;  4CT4 A;  2XEV A;  2OEV A;  2E0I A;  3D9H A;  4RVB A;  5JJ6 A;  3AJI A;  4APF A;  2P9K G;  3TXM A;  3FUF A;  1H2U A;  5B1A E;  2LUH A;  5JA4 D;  3EIQ C;  2PL2 A;  1Z5S C;  4DX2 A;  3SO8 A;  4E6H A;  4ZFH A;  1S64 A;  4U0U A;  3CVW A;  3D9L A;  3SBS A;  3ZYL A;  3QJZ A;  4N3B A;  2WXG A;  4I6J A;  1E90 A;  5HKP A;  4TXR A;  1WDY A;  3EIJ A;  3CVP A;  4RLY A;  5BV1 A;  2GRP B;  4U04 A;  1SVX A;  2GW1 A;  3DST A;  2XS1 A;  3HXD A;  4BY6 A;  2VJ8 A;  4B89 A;  1BU9 A;  3CKB A;  4DLQ A;  4ANV A;  3P2B A;  4J8F A;  2AW6 A;  4JZY A;  3CK9 A;  3TL5 A;  1KZP A;  4J0U A;  2VQ2 A;  1WG0 A;  5BV0 A;  4HOT A;  3D9M A;  4Z68 A;  4N2Q A;  5AAR A;  3AS8 A;  3UUX A;  4O60 A;  3ONL A;  3RSE G;  1OT8 A;  3MGB A;  1SW6 A;  3FU0 A;  4LUN U;  5AJD A;  3CK8 A;  2WM9 A;  3ZVV A;  3Q4A B;  1NZN A;  2QZA A;  5G04 C;  1BD8 A;  5E75 A;  1TNY A;  1V54 E;  3ULY A;  1H19 A;  5FIN A;  4J8E A;  3SI5 A;  2WXI A;  2IO2 C;  2AXZ A;  1ZBP A;  2IOL A;  2I6H A;  4AP2 A;  2V4L A;  5KWD A;  1OCZ E;  3D9N A;  4UI9 J;  1INZ A;  3IBE A;  3RRM B;  2AWI A;  4Q96 A;  2R17 C;  4FC8 A;  2X3M A;  1DC2 A;  4IUL A;  1O1T A;  1K1A A;  3FTX A;  4WWP A;  3EHQ A;  2F8X K;  3S7B A;  1E8Z A;  2F8Y A;  5ARG A;  4GYW A;  2RKK A;  2LXM A;  5FJY A;  5AYW D;  5T3R A;  3Q9U C;  2BED A;  1N52 A;  1NL4 A;  2V5Q C;  3PEU B;  3KD7 A;  1IQU A;  4CRW A;  2L6J A;  2JEK A;  4AVX A;  5JJ7 A;  2NC9 A;  2OEW A;  5ANL A;  3FUD A;  2PM7 A;  3QNK A;  3UM1 A;  3Q9N C;  3T8M A;  1MYO A;  3TWS A;  2DYR E;  2KCV A;  3IEG A;  3PH0 C;  1ZB1 A;  1UN9 A;  3ABK E;  2XPZ A;  1QQE A;  4LER A;  5G05 C;  3ESL A;  4HFG A;  2P9N G;  4GTR A;  4HLE A;  5CED B;  4I2W A;  4YDO A;  4Q94 A;  5EDS A;  2CG3 A;  3QK0 A;  3QWP A;  4G11 A;  2H6F A;  5DBK A;  3Q7A A;  3ASF A;  4OVV A;  2X6J A;  1Z6T A;  3SFZ A;  3ML8 A;  5FQ6 A;  4BER A;  3UT8 A;  2VSN A;  3PZ1 A;  2Y0B G;  3B7B A;  2WMN A;  2R03 A;  3LY9 A;  3W9F A;  4JHK A;  3CK7 A;  4TXQ A;  3ULQ A;  2I9C A;  3B95 A;  4I1M A;  3OXG A;  3CLJ A;  3MA5 A;  2WQH A;  5FZS A;  2OOE A;  5A6C A;  5KJM A;  4FHK A;  5EIL A;  1H0A A;  3GZ2 A;  1WAO 1;  4GTP A;  2QYJ A;  4A3T A;  5ANR A;  3HDX A;  4BET A;  3TWQ A;  2P58 C;  1OCC E;  4A63 B;  4MKT A;  4BX8 A;  5EYP F;  3MKR A;  2XGS A;  4JA9 A;  3V31 A;  4MBG A;  3CKC A;  3EU5 A;  4GMJ A;  2R02 A;  5DIZ A;  2H6I A;  3BEE A;  4XI9 A;  2RG8 A;  4LNU D;  2VSO E;  4HOR A;  2P9P G;  4L2Y A;  1QZ2 A;  2IOS A;  2YIN A;  3CHM A;  2X6F A;  3E4B A;  2KM4 A;  3B7S A;  4W9R A;  4YDW A;  2QC9 A;  2PNN A;  1FT2 A;  2NYJ A;  3JXI A;  4NRH B;  3Q75 A;  2CHZ A;  2J08 A;  3APC A;  3ASH A;  1SQM A;  5AQA A;  1JPL A;  1KPS B;  5FQ4 A;  1IHB A;  2XZT G;  2XQ0 A;  3CHS A;  2DZO A;  3TWU A;  3K9I A;  4N2S A;  4CEM A;  3V2X A;  4EHM A;  3FUK A;  4CDR A;  3MZL B;  3E34 A;  2MHK A;  2XGO A;  3AU4 A;  2XEE A;  4KVO A;  4MRU A;  3GZS A;  4N3C A;  4U07 A;  1EDU A;  4KMO A;  2LAH A;  4HQD A;  3D3M A;  3G2S A;  4FJY A;  1DNP A;  4ABN A;  2R05 A;  2A4Z A;  2GRR B;  2WQ6 A;  4B8C B;  2AVP A;  3CVU A;  2Y3A A;  4JHR A;  2KZT B;  3QAQ A;  5FZQ A;  3E30 A;  3CHQ A;  1QBQ A;  1L5J A;  3PZ4 A;  3V2O A;  2GGF A;  3LJN A;  3PE3 A;  1ZU2 A;  3D9O A;  4CDN A;  5FWQ A;  1TN7 A;  4UQY A;  1OCR E;  3R9A B;  3ZXS A;  3UI2 A;  3CIA A;  5AN8 A;  3L17 A;  1HS6 A;  4GU5 A;  2P9S G;  4PS8 A;  3C5R A;  3SZ7 A;  3FDH A;  4ACL A;  2KZT A;  4GPM A;  4ANW A;  4WWN A;  5B3S E;  4L9P A;  3JCK C;  5CCL A;  1Z3Y A;  1ELR A;  4JVS A;  3QKY A;  1KT1 A;  1E8Y A;  3NZU A;  2GRM A;  2HM8 A;  3DEO A;  3D9P A;  4B93 B;  1U2V G;  3S7J A;  3ZYK A;  1O1R A;  4GTS A;  1YA0 A;  4AXH A;  1HF8 A;  2LAI A;  2YHE A;  1N0R A;  4G26 A;  4JEU A;  4H7X A;  5M72 A;  4N5C A;  2FUL A;  2PZI A;  4KT6 B;  1QYM A;  5FQ8 A;  4HB5 A;  4I9E A;  3ABM E;  3PUJ A;  4NIK A;  5J90 A;  3B7R L;  4U96 D;  1UJK A;  1NI1 A;  3DSU A;  3PNT B;  5JMN D;  4ILI A;  5LFA A;  1MHQ A;  5EID A;  3ZEF A;  3G2T A;  4HRM B;  1EF1 C;  5LOZ A;  3VLE A;  3U66 A;  4PDX A;  2Y4U A;  5BT1 A;  1UW4 B;  5CRU A;  2OCC E;  3FUE A;  4N39 A;  3ULE G;  3JQ1 A;  3UIO C;  2XS8 A;  2HO1 A;  2I2O A;  4BES A;  3UM0 A;  3U64 A;  2A5U A;  3E33 A;  1OWL A;  4HLL A;  4XEI G;  2L0T B;  4O1O A;  4WUY A;  3TGO A;  3PRZ A;  4HXI A;  3B13 A;  3NBN B;  2ZGG A;  3L16 A;  3UMV A;  1PAQ A;  2LO6 A;  5D2M C;  2ZIR A;  4GA0 A;  3CGH A;  3R9M A;  5CBN A;  3AG1 E;  3C3Q A;  4WNF A;  1K8K G;  3ASD A;  3PUK A;  3Q73 A;  3MCX A;  3MJW A;  4G24 A;  1LTX A;  3AG2 E;  4U0Z A;  2CFZ A;  2IFU A;  1S0P A;  1E7U A;  5LCW J;  4EBA G;  1BI8 B;  2VGE A;  2EIM E;  4ACK A;  5FZR A;  2C2L A;  5CCM A;  5ARF A;  2J8S D;  3VLF A;  4AIF A;  4G8K A;  1EYH A;  4DX7 D;  4UWF A;  2R2L A;  3HXF A;  2LNI A;  4TUM A;  4A55 A;  2ZXW E;  2MRI A;  4A3V A;  1AP7 A;  1NA3 A;  4EZK A;  2EIN E;  2PQN A;  1FVF A;  4DPR A;  3RK6 A;  1E7V A;  3DXM G;  1KZO A;  3QWW A;  2OVB A;  4EQF A;  1JUQ A;  3G2V A;  3UT7 A;  3APD A;  3S7F A;  4L7T A;  3ESK A;  4E85 A;  3EJN A;  5HRY A;  1DCQ A;  4DI3 A;  5EX0 A;  2WXL A;  1HXI A;  2B6C A;  3B7T A;  3FTZ A;  4YND A;  3NOC D;  3R7R A;  3MKQ B;  4XKC A;  3TWX A;  3BQO A;  4ILG A;  3PNL B;  2FEZ A;  4HRL A;  3RU0 A;  2P2C P;  4I17 A;  4FJZ A;  3DPY A;  3RKV A;  4GZ3 A;  3SHF A;  2DWZ A;  3ZNG A;  3LCA A;  4LEU A;  1V55 E;  2NSZ A;  4I6E A;  3T5V A;  3CVY A;  3FEX A;  3GW4 A;  2XEN A;  2KCL A;  3IV0 A;  3LXU X;  2R59 A;  3OTN A;  1S63 A;  2Q7F A;  1TJC A;  1MX2 A;  3MKQ A;  3PDN A;  3C3R A;  4EZL A;  3PE4 A;  4OAV B;  3AG3 E;  3LY7 A;  3ZUV B;  4CDM A;  3SNX A;  3TXN A;  2OV8 A;  3LVR E;  4YVQ C;  4AY5 A;  2XHE A;  4NAC A;  3RRN B;  4HNA D;  3ZYQ A;  3QAR A;  4WND A;  5HQ8 A;  3PEV B;  3FTY A;  1ELK A;  4HI8 A;  1H6P A;  2Y4T A;  2IU1 A;  3IHY A;  4C0M A;  2QY7 A;  4WNG A;  3UIN C;  1AWC B;  4G25 A;  4F7A A;  1SZA A;  3HXB A;  3V30 A;  3CVN A;  3DSW A;  2OND A;  2WXH A;  3L9T A;  2GRQ B;  4UWL A;  3E37 A;  3KEA A;  1FT1 A;  1Y6I A;  3BU8 A;  2XRY A;  5FIO A;  5A7D B;  1K1B A;  1TNU A;  3UTM A;  3UQ3 A;  1E96 B;  5T8I A;  3MV3 B;  1MZC A;  3ZGQ A;  4B0Z A;  1N0Q A;  3QC1 A;  5ENS D;  2E2E A;  1OY3 D;  4GCO A;  4DJA A;  4J7W A;  4M7C A;  3FWV A;  4J8Y A;  3URZ A;  2J4B A;  3FU3 A;  4XKB A;  4I1A A;  5LCW C;  2ETB A;  1OCO E;  5EIB E;  1JCR A;  1WY6 A;  5G55 A;  5ENT D;  3L54 A;  3S7D A;  3HXC A;  4EZJ A;  2RD0 A;  4I9C A;  2BF0 X;  5CBO A;  3UM2 A;  4C9B B;  4GTO A;  4BT9 A;  4QQI A;  2XEH A;  4GZ5 A; 
#chains in the Genus database with same CATH homology
 3DST A;  3E30 A;  1DCE A;  3HXD A;  1TNB A;  1LD7 A;  1QBQ A;  4GTT A;  3PZ4 A;  3C72 A;  4MBG A;  2BED A;  1NL4 A;  3EU5 A;  1D8D A;  1N94 A;  1N4R A;  1TN7 A;  2H6I A;  1N95 A;  1KZO A;  3E33 A;  2H6H A;  3SFX A;  1KZP A;  3DSX A;  4GTQ A;  2F0Y A;  4YDE A;  1FPP A;  3Q79 A;  1JCQ A;  1TN6 A;  3KSQ A;  3HXB A;  2ZIR A;  1LD8 A;  3DSW A;  1TNZ A;  4L9P A;  3KSL A;  4GTR A;  1FT2 A;  3E37 A;  3HXE A;  1N4S A;  3Q75 A;  1O5M A;  1SA4 A;  1FT1 A;  4YDO A;  4LNG A;  3Q73 A;  1SA5 A;  1LTX A;  1TNU A;  1N4P A;  1TNY A;  1TN8 A;  3PZ2 A;  1MZC A;  2H6F A;  1O1R A;  4GTS A;  3Q7A A;  3DPY A;  1D8E A;  3SFY A;  1N4Q A;  1X81 A;  4EHM A;  1S64 A;  3PZ3 A;  3PZ1 A;  4LNB A;  3E34 A;  2ZIS A;  3DSS A;  4GTV A;  3E32 A;  4GTM A;  3Q78 A;  3Q7F A;  3DRA A;  3DSV A;  2R2L A;  3HXF A;  1NI1 A;  1JCR A;  3DSU A;  1S63 A;  1N9A A;  1TNO A;  3HXC A;  2H6G A;  1O1S A;  1O1T A;  2IEJ A;  4GTP A;  3EUV A;  4GTO A;  1JCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...