1TNZA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a rrcvll peptide derived from cdc42 splice isoform-2
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
total genus 128
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnzA00
1JCRA 1NL4A 1N95A 1O5MA 3SFXA 1JCQA 4YDOA 3HXEA 1JCSA 1O1TA 2IEJA 4GTVA 1N4QA 1NI1A 3E37A 3Q78A 1S63A 1TNZA 2H6GA 3PZ4A 1TN7A 1N94A 1DCEA 1KZPA 1FT2A 4GTSA 4L9PA 3Q7FA 2R2LA 4GTRA 2H6FA 1O1SA 3KSLA 3DSVA 4LNGA 2H6HA 1LD7A 2H6IA 3Q73A 1N9AA 1QBQA 1X81A 3E32A 3PZ3A 1TNYA 3EUVA 3PZ1A 3EU5A 3DSWA 3E33A 1D8DA 1SA5A 3Q79A 3E30A 4GTTA 1N4SA 3DSSA 1N4PA 2BEDA 4GTQA 3HXFA 4EHMA 2ZIRA 1D8EA 4YDEA 1S64A 1FT1A 3DSTA 3HXCA 1O1RA 3DPYA 4MBGA 2F0YA 1KZOA 3Q7AA 1TNOA 1TN8A 4GTPA 1TN6A 4LNBA 2ZISA 3KSQA 3DSUA 1TNBA 4GTOA 3Q75A 1FPPA 3PZ2A 1N4RA 3DRAA 1SA4A 1LD8A 4GTMA 3HXDA 1LTXA 1TNUA 3C72A 3E34A 3DSXA 3SFYA 1MZCA 3HXBA
chains in the Genus database with same CATH superfamily
3SBTB 4A55A 5KWDA 2FO1E 3I5PA 2VQ2A 5JJ7A 1OXJA 2VYIA 3ASGA 3F6QA 2GRLA 5EIBE 2VSOE 4EBAA 3L22A 2ETAA 3Q9UC 5CHEE 3PZ4A 3PNTB 3CK9A 3VLEA 2WXHA 4KZ0A 4R7LA 3MKQB 4UI9J 3TWSA 1SVXA 5E75A 2L6JA 4U07A 3TWWA 4DLQA 4JXTA 1LD7A 5DBKA 2L0TB 2RKKA 4RVBA 4IN3B 4EPZA 3CK8A 3FUKA 3L6AA 4NACA 4DK5A 3FY4A 3LVRE 1X5BA 4MS6A 2I1KA 3FEXA 3DSSA 1IQUA 3CVLA 3PS6A 2QFCA 3CVUA 2UWJG 3ML8A 3DBSA 3KEZA 4GYYA 3RRUA 2EIME 2WQ6A 1YCSB 3LPZA 4AXHA 2V5QC 1E8ZA 3Q15A 2I9CA 1RZ4A 4N3AA 3MKQA 4RQIA 1FVHA 2DZOA 4AP2A 3D9JA 4DPRA 3RO3A 3EJNA 1OCOE 2PZIA 3LJNA 3UIOC 4ANXA 1JCRA 1NL4A 1N95A 4I2ZA 3L16A 4U8HA 4YNDA 4K0RA 2X6FA 3TWRA 4GZDA 3ZU7B 2XHEA 3CVNA 2IO2C 4DLOA 4A3VA 5AYWD 1N94A 1GW6A 4F53A 3FUHA 4G11A 1BU9A 2WPVA 2OEVA 2J8SD 4GTSA 3TWUA 5ANRA 2WM9A 4DX6D 3QWVA 3V79K 3FTXA 2OV8A 2HO1A 4L2LA 4LRZA 1QNFA 2WQ7A 3PZ1A 3EU5A 3WG7E 4J8EA 2UY1A 3IKOB 3SF4A 4I17A 2XRYA 3CVVA 1N4SA 4GPKA 3SBSA 3N71A 3CVQA 3LJ3A 2ZXWE 1HX8A 2P9LG 2DBAA 4BESA 3LDZA 4QQIA 3SNXA 3FTWA 4G23A 4PH4B 2GRPB 2AJAA 4C48B 2AVPA 3DXMG 3GZSA 1TNOA 2X6KA 2A4ZA 3K9IA 3PREA 2WXIA 1HFAA 1DNPA 3U4TA 4J8FA 3MEKA 4IYPA 2XPIA 3PE4A 4F1PA 2XGMA 1TR4A 2DVWA 2WXLA 1TNUA 3PE3A 4ZHBA 3V31A 4PS8A 3FHEA 2WB2A 3QOUA 4B89A 5EKQD 1ELWA 3RIBA 3OXGA 3AG1E 4U0SA 2H6GA 4FC8A 2IF4A 4JW1A 1UN9A 5FJYA 3SFZA 2XPYA 2R2LA 3ZYLA 3FTYA 1YMPA 1O1SA 1Q2ZA 5AJLA 2LXLA 3ZUVB 4G26A 3JXJA 3U9WA 2FI7A 3NF1A 2L0IA 2RFAA 4ANUA 2LAHA 2KM4A 4GTTA 4ATGA 4CDRA 4GZ6A 4GA0A 1N4PA 3AU4A 3NZSA 2KATA 3PNLB 4O60A 2PQRA 3FU3A 3GZ1A 2JABA 1ELRA 1D8EA 3D9IA 3GZ2A 4WUYA 3UQ3A 3HXCA 2C0MA 3QK0A 3RRMB 4RG6A 3NZUA 4KT6B 4I9EA 3MCXA 2J08A 1SQMA 2I1JA 4LEUA 3D9KA 3FUDA 3DSUA 3QWPA 3VTYA 2ZGDA 3TL5A 4GB9A 1LD8A 1LTXA 1LF8A 4KXKB 2HE0A 2YINA 3QDNA 3SY2A 4Q94A 5JMND 4UWFA 1WG0A 5EYPF 5CEAA 3Q5MA 1N4QA 3R9AB 2OEWA 1Y8MA 4GA2A 4BSZB 3TAXA 4UQZA 1H0AA 4I6JA 1EF1C 4UWHA 3ZYKA 3D9LA 2WQHA 5JA4D 3MV3B 3KSLA 4HRNA 3ZW3A 4DUIA 4TXQA 3PUJA 1N54A 4PS3A 5G05J 4G2VA 3EHQA 3E30A 1U3CA 2X3MA 4U95D 5J08A 2B6CA 2X6IA 4UUCA 1E8XA 4UWKA 5AQ9A 2Y3AA 5ENPD 5G05C 2ZIRA 4I9CA 3OXLA 4DX2A 4TV3A 2P9PG 4E6HA 3MX3A 4WWOA 4Q69A 5B3SE 5AQBA 2P58C 4BFRA 1KZOA 3I3NA 2WVIA 1Z3YA 5BV0A 3I4RB 4IULA 5J90A 3UINC 3LS8A 3W9GA 1OWLA 3AS8A 3OXFA 3B13A 5G04C 3HXDA 4BSXA 3U66A 3SGHA 5AENA 4L1BA 3AG4E 4HORA 5A7DB 4C9BB 3G2VA 5D2MC 4HLLA 4I1OB 1TNZA 4CCAA 3UM0A 4A1SA 2LXMA 2KCVA 3X2QE 3LKUA 3W9FA 2VGXB 3DEPA 3S7JA 2OVFA 2VTBB 4PS7A 3RO2A 3CVYA 4F7AA 3GW4A 2H6IA 5BNWA 1N9AA 5FTPA 1IHBA 3FH7A 4TUMA 5CCLA 1H6KA 4N3CA 1E7VA 5FZRA 2YQ8A 3B7UX 3ZFWA 5CECB 3SHFA 5FT9A 5CERB 2LO6A 3RU0A 1P5QA 3DWLG 1INZA 4WAFA 5FZQA 4F3VA 1MHQA 3QKYA 3FTUA 5AIJA 4EZJA 3VLFA 3DPYA 4BT8A 5FZSA 1PC2A 2F0YA 4MBGA 5BT1A 1IQRA 5M72A 2I6HA 4DX7D 4KVMA 3MKRA 2QYUA 4FLBA 3ZYQA 5KNGA 3J5PA 5B1AE 3D9OA 1NA0A 3Q75A 4MKTA 1SA4A 2DYRE 1K1BA 4UQYA 1KT0A 3BG1B 3G2UA 3FUIA 4JC8A 5IY5E 3CVWA 4ATZD 3BUAA 4KMOA 5LX8A 5LFAA 1XGWA 2R03A 4EQFA 3T5XA 3Q78A 4CDNA 3CLJA 1DCEA 3O4ZA 4HI8A 2V4LA 5JJTA 3CEQA 1HS6A 2QY7A 3ASDA 4C0EA 4L2YA 4XKCA 1ELKA 2CHWA 3B7SA 1QBQA 2BF0X 4GAAA 3Q9NC 4N2SA 1SA5A 2KZTA 4DX1A 4CDMA 5KNHD 5EYLA 3ZN3A 4N5QA 1JWGA 3EU9A 4ILGA 4D10C 3C3RA 4B8CB 4YDYA 1QYMA 4EBAG 4U96D 1TN8A 3QNKA 2ZISA 4G8LA 2X6HA 4K5BA 1U3DA 4GTOA 4WNDA 2HM8A 2LAIA 4HOUA 1D9SA 1UW4B 5ENRD 1N4RA 3CSTA 3FH8A 2Y4TA 1FCHA 4AM9A 3JYSA 3NAWA 2PQNA 3QB2A 2JLBA 1L5JA 4F1SA 3HXBA 5LCWC 3MV2B 1OY3D 3HIZA 2PNNA 3ASFA 1V55E 3T8MA 3FFLA 4A1GA 2P9NG 3LVQE 4JEUA 5JHAA 4DX5D 1MX2A 1ZU2A 4J8DA 5BXUA 2XQ0A 2CHZA 4U63A 2DCPA 2IOLA 3CQGB 5CRVA 1YA0A 3DSWA 5BXOA 2J4DA 3Q79A 2BKGA 4YDWA 1V54E 2WXOA 3G2TA 4RSYA 3MA5A 5KCMA 2CHXA 5T8IA 3UT7A 3QWWA 4CEMA 2BEDA 5A23A 4O6FA 4M3OA 2F8XK 3PVLA 2JEKA 1HF8A 3RK6A 5HI7A 4PUCA 2DZNA 3EHNA 3FTSA 4JHRA 4AOFA 3DPDA 4WWNA 3KSQA 5AQAA 1MQSA 2WXFA 1TNBA 2HR2A 5FQ6A 2F37A 2P9SG 3FU6A 3PZ2A 3BU8A 4H7XA 3DEOA 4HS2A 5ANLA 3JXIA 1NA3A 1WAO1 3FUNA 4GCNA 4G8KA 1Z3XA 2IJGX 1Z6TA 4HOQA 3FUJA 4XIFA 2GRMA 4GTVA 3TXNA 3E37A 4FHKA 4M7CA 1JWFA 5EILA 5C1DA 2BKKB 3C3OA 3FH5A 4FHJA 3L9TA 4HRLA 3ASNE 2XS8A 3UM1A 3BQOA 2KBXA 2VGXA 3Q73A 4LNUD 4DI4A 4HFGA 4HI9A 1SZ9A 3Q4AB 4UQXA 1QQEA 2J9QA 3G2SA 4GTQA 3ASOE 4QFVA 3ESKA 1HG2A 3Q47B 4KVOA 3KAEA 5AAOA 2NYJA 3IBEA 2GRRB 5CRUA 3CSFA 5CEDB 4U0ZA 3ASHA 4F6RD 2P9KG 1YYHA 4BY6A 4GTMA 3HYMB 2VJ8A 3AG2E 4NIKA 4U7EB 4CT4A 2Q7FA 5EIDA 2VTBA 2BTDA 2WMNA 1O1TA 4A3TA 5LP0A 4CRWA 3UIPC 2ETCA 3ZXSA 3UT4A 3PDNA 1BLXB 2ETBA 2IOSA 4LUNU 2P2CP 4CZ2D 3TJPA 5D0QD 5AARA 3ENEA 1OCZE 1N52A 1OWPA 5AN8A 4GPMA 3QARA 3FEYA 4HXIA 4HRMB 1EDUA 2WXQA 3EUVA 3E33A 3FU5A 4XI9A 3ISMC 3ZVVA 3FWVA 2AXUA 2DIWA 5ARGA 3DXKG 2EINE 4FLHA 4N3BA 4K5CA 5ENSD 2R05A 3VTXA 3AG3E 4JPSA 2FF4A 4EHMA 5BV1A 1S64A 2YHEA 2IY0C 4HBDA 5B1BE 3HVEB 2Y0BG 3EHMA 2V4HC 2RFMA 1UOHA 5JHBA 1JUQA 3S2AA 4A63B 4XE0A 3CVXA 2GROB 3RSEG 4GA1A 1E8YA 4KYOB 3FUFA 1HU3A 3V2OA 4YVQC 3HVEA 3UM3A 4K03A 3FTVA 3IV0A 4JD2G 3IEGA 3V30A 3S7FA 3ABKE 4U0UA 2DWZA 3ZHEA 4GZ5A 4DJAA 5C2YA 4N5CA 4GMJA 4Z68A 1BPOA 1UJJA 3AAAC 4GTRA 4ANWA 1WY6A 5ENTD 5AQ7A 3IXEA 5BUZA 4WWPA 3L13A 1H2VC 5KJLA 3SQVA 3PUKA 1X81A 3C5RA 3PZ3A 2XS1A 4FJZA 1KPSB 1UG3A 4O1PA 3SO8A 4FA6A 4GZCA 3ONKA 2R59A 2MYOA 1DCQA 1OWNA 1E90A 1IYGA 1BI7B 2V0PA 3D9PA 1HXIA 3P1UA 2P9UG 3CQCB 2A5EA 3BG0B 4YVOA 1H19A 1SZAA 4BWRA 3V2XA 3Q7AA 4GTPA 2FO7A 3B95A 5CMYA 2LNIA 4LNBA 3ZHEB 4B93B 3JCKC 4BT9A 3ZPJA 4GMLA 2VGEA 2NSZA 5CBNA 4N39A 2XCCA 3UT8A 3HHMA 4N2QA 3SFYA 4L7TA 1OWOA 3LCAA 3SFXA 3TWXA 1JCSA 1G3NB 4PDXA 2IU1A 2OOEA 1AWCB 5HRYA 2EIKE 4L23A 5LCWJ 1TYQG 1XNFA 2H6FA 3LY8A 3T8KA 2EILE 3UM2A 3IHVA 2XGSA 3PZDA 1EYHA 3MZLB 2WMOA 2IQCA 5DIZA 4GU5A 4FP7A 3JUIA 4URKA 1W3BA 4Y6CA 3RAUA 5EDSA 4XEIG 1WDYA 4AEZC 3FDHA 4DRXE 2CG2A 5LOZA 2NXPA 4Q96A 2EIJE 1BD8A 1UN8A 2LSVA 3BEEA 3ESLA 3UTMA 2XEEA 3NQPA 2ILRA 4U04A 2GRQB 4ZFHA 3L08A 1TN6A 4OAVB 3APFA 2L9BA 2CG3A 4AV7A 3ULYA 3ZGQA 4U8YD 1FVFA 3L82A 1HG5A 5T3RA 3APCA 3DSXA 2PM7A 4NURA 4GYOA 1O5MA 3LYAA 3P2BA 1NI1A 1E8WA 5CMWA 1BI8B 4W9RA 4JA9A 2J4BA 4JHKA 3G2WA 3QC1A 4I6GA 3FUMA 4LSZE 2F8YA 4TXRA 3UUXA 2R5SA 4JZYA 1H2TC 3OTNA 4TRQA 3ABME 3ML9A 4Y6WA 5KJNA 5G04J 3GYZA 4BTAA 2VSXE 3D9NA 2XENA 4WNEA 3CHPA 2RG8A 4EECA 3L17A 4HOSA 2R02A 4TUUA 3LY9A 1D8DA 2AWIA 1HO8A 4HOTA 2OVBA 4G24A 3MYVA 5EN5D 3D9MA 4EZLA 4BX8A 1ZBPA 3JUEA 4TXPA 4X8QA 3AJIA 1HZ4A 4YDEA 5CCMA 3DSTA 2GRNB 1O1RA 3TXMA 3EIQC 4J7WA 3APDA 3UKUG 3WXXA 4ANVA 4XKBA 4O1OA 3UXGA 3B7TA 4MRUA 4CGVA 4C0MA 2CFUA 4ACKA 1S0PA 3DRAA 2KCKA 4I1MA 4ILIA 5JJ6A 4ILHB 3CGHA 1IHGA 3E34A 3J5QB 2WXJA 3ULQA 1H2UA 1NFIE 3JQ1A 4YDOA 1JPLA 3RKVA 5HQ8A 2GW1A 3KEAA 5D0OD 1E7UA 4JB8P 1RW2A 4L9PA 5FWQA 2WXGA 1K1AA 3KS2A 1HE8A 1OT8A 2YHCA 2KC7A 3DSVA 4LNGA 4BERA 1K3ZD 3PEUB 3UPVA 2HYZA 1TEZA 4KBQA 3PH0C 1AP7A 4JHJA 1H6PA 5KJMA 1S70B 4LG6A 4G1TA 3CHOA 1EPUA 2ONDA 1A17A 3B7RL 1MYOA 5HKPA 3CK7A 3CHQA 4XZ4A 1N11A 1A5EA 2XRZA 3SI5A 2J49A 3CHSA 4MLPA 1VDYA 4J0UA 4G25A 2MHKA 5G55A 4HNAD 4FULA 2FBNA 4GZ3A 1PAQA 3QJZA 3AS5A 3R7QA 4JL0A 2A5UA 2Y69E 5H7PA 4AY5A 3D9HA 4WNFA 2AXZA 4I1AA 4ME2A 4ACLA 3TWVA 1SW6A 3CHRA 2GGFA 4APOA 1FPPA 4AJWA 2J07A 4AVXA 3C72A 2V8SE 5FQ4A 2VSYA 4B0ZA 4V3IA 1JCQA 2MRIA 1DVPA 3HXEA 5EX3A 2EQXA 3S7DA 3VLDA 3ZKJA 1OCRE 4B94A 4OVUA 1ZB1A 1DC2A 2B0OE 3R9MA 5ENOD 2XEVA 1FT2A 3FULA 3U64A 2ZU6B 3Q7FA 3ONLA 2OCCE 5E76A 2QZAA 4RLYA 3C3QA 3PRZA 2RD0A 5ENQD 4E85A 5BPPA 3UMVA 3CKCA 3MGBA 3S7BA 2AW6A 1N0RA 2X6JA 1TJCA 4J8SA 3R7RA 4OVVA 5FIOA 5FINA 4K5AB 3TWTA 2R17C 4UWLA 1KT1A 4EZKA 3OAWA 2FEZA 4CGWA 4GYWA 3FUEA 2XPZA 4DI3A 4BTBA 3E4BA 3NOGD 4LERA 3ZRHA 3LXUX 3QAQA 5BW8C 3SZ7A 4BX9A 2XCBA 4HQDA 4J6IA 3UKRG 3NOCD 3TGOA 4FJYA 2V5FA 3ABLE 2Y1LE 3URZA 1MX4A 4NQ0A 1PY1A 2MOWA 2E0IA 3KD7A 4CYMD 3LEWA 4JEHA 3EIJA 3AU5A 4GMRA 4GCOA 5T4YA 4OAUC 2M63A 4I2WA 1HH8A 2VSNA 4I43A 3CKBA 4UI9C 3UX4A 2KXPC 4J8YA 5KBAA 2WXKA 4I6EA 3U3WA 5FQ8A 1S63A 1TN7A 2IONA 1KZPA 3ZYMA 1N0QA 2KZTB 2WXRA 3CHMA 4AIFA 3RRNB 3HG0D 3I4GA 4BETA 2H6HA 3CR3A 3PEVB 1TNYA 3NB2A 2IFUA 2LUHA 1MJ0A 3FTZA 3ULEG 1QZ2A 5ITZF 3CVPA 3B7BA 1OCCE 3EDTB 1U2VG 4JVSA 3T5VA 2XZDG 3HXFA 2AXVA 3FP3A 4NRHB 1FT1A 2PM6A 1OWMA 4KZCA 2NC9A 2DYSE 2YNQA 1MX6A 4HLEA 4APFA 2WXPA 2WXMA 3T9KA 4U8VD 3CV0A 2P9IG 3FU0A 3UI2A 3TWQA 1NP7A 4HVBA 1MZCA 2QYJA 4RG9A 3JQ0A 4HB5A 1OUVA 2QC9A 5FQ7A 1KLXA 3CIAA 2IEJA 5EX0A 2Y4UA 5AJDA 2LSUA 1B89A 3ZXPA 1K8KG 1IXVA 2C2LA 2BUGA 1UJKA 2PL2A 2XGOA 4CT0A 3NBNB 5A6CA 4AY6A 3HDXA 3TG5A 4XI0A 3E32A 5D66A 2J09A 2WXNA 5ENNA 3ZNGA 2CFZA 4FU3A 4P29A 3MJWA 1IKND 2L6BA 1Z5SC 3D3MA 2XZTG 1E96B 4UWGA 3IHYA 4XX5A 4B8AA 3TG4A 1H6OA 4WNGA 3AS4A 5CBOA 3LY7A 5ARFA 2KCLA 4LCTA 3O48A 2E2EA 1TJFA 2UY1B 3RJVA 4UI9K 3SD5A 4ABNA 1Y6IA 2I2OA 2IO3C 2X38A 4FADA 1WM5A 2FULA 3ZEFA 2VGYA 2XEHA 3HRAA 3EHRA 3L54A 3ZIMA 3Q49B 4OYSA 2C0LA 4H7YA 4BEPA 5HS0A 4IRUA 1NZNA 5G2NA 4JA7A 3C98A 5KJKA 2ZGGA
chains in the Genus database with same CATH topology
1JCRA 1NL4A 1N95A 1O5MA 3SFXA 1JCQA 4YDOA 3HXEA 1JCSA 1O1TA 2IEJA 4GTVA 1N4QA 1NI1A 3E37A 3Q78A 1S63A 1TNZA 2H6GA 3PZ4A 1TN7A 1N94A 1DCEA 1KZPA 1FT2A 4GTSA 4L9PA 3Q7FA 2R2LA 4GTRA 2H6FA 1O1SA 3KSLA 3DSVA 4LNGA 2H6HA 1LD7A 2H6IA 3Q73A 1N9AA 1QBQA 1X81A 3E32A 3PZ3A 1TNYA 3EUVA 3PZ1A 3EU5A 3DSWA 3E33A 1D8DA 1SA5A 3Q79A 3E30A 4GTTA 1N4SA 3DSSA 1N4PA 2BEDA 4GTQA 3HXFA 4EHMA 2ZIRA 1D8EA 4YDEA 1S64A 1FT1A 3DSTA 3HXCA 1O1RA 3DPYA 4MBGA 2F0YA 1KZOA 3Q7AA 1TNOA 1TN8A 4GTPA 1TN6A 4LNBA 2ZISA 3KSQA 3DSUA 1TNBA 4GTOA 3Q75A 1FPPA 3PZ2A 1N4RA 3DRAA 1SA4A 1LD8A 4GTMA 3HXDA 1LTXA 1TNUA 3C72A 3E34A 3DSXA 3SFYA 1MZCA 3HXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCR A;  1NL4 A;  1N95 A;  1O5M A;  3SFX A;  1JCQ A;  4YDO A;  3HXE A;  1JCS A;  1O1T A;  2IEJ A;  4GTV A;  1N4Q A;  1NI1 A;  3E37 A;  3Q78 A;  1S63 A;  1TNZ A;  2H6G A;  3PZ4 A;  1TN7 A;  1N94 A;  1DCE A;  1KZP A;  1FT2 A;  4GTS A;  4L9P A;  3Q7F A;  2R2L A;  4GTR A;  2H6F A;  1O1S A;  3KSL A;  3DSV A;  4LNG A;  2H6H A;  1LD7 A;  2H6I A;  3Q73 A;  1N9A A;  1QBQ A;  1X81 A;  3E32 A;  3PZ3 A;  1TNY A;  3EUV A;  3PZ1 A;  3EU5 A;  3DSW A;  3E33 A;  1D8D A;  1SA5 A;  3Q79 A;  3E30 A;  4GTT A;  1N4S A;  3DSS A;  1N4P A;  2BED A;  4GTQ A;  3HXF A;  4EHM A;  2ZIR A;  1D8E A;  4YDE A;  1S64 A;  1FT1 A;  3DST A;  3HXC A;  1O1R A;  3DPY A;  4MBG A;  2F0Y A;  1KZO A;  3Q7A A;  1TNO A;  1TN8 A;  4GTP A;  1TN6 A;  4LNB A;  2ZIS A;  3KSQ A;  3DSU A;  1TNB A;  4GTO A;  3Q75 A;  1FPP A;  3PZ2 A;  1N4R A;  3DRA A;  1SA4 A;  1LD8 A;  4GTM A;  3HXD A;  1LTX A;  1TNU A;  3C72 A;  3E34 A;  3DSX A;  3SFY A;  1MZC A;  3HXB A; 
#chains in the Genus database with same CATH topology
 3SBT B;  4A55 A;  5KWD A;  2FO1 E;  3I5P A;  2VQ2 A;  5JJ7 A;  1OXJ A;  2VYI A;  3ASG A;  3F6Q A;  2GRL A;  5EIB E;  2VSO E;  4EBA A;  3L22 A;  2ETA A;  3Q9U C;  5CHE E;  3PZ4 A;  3PNT B;  3CK9 A;  3VLE A;  2WXH A;  4KZ0 A;  4R7L A;  3MKQ B;  4UI9 J;  3TWS A;  1SVX A;  5E75 A;  2L6J A;  4U07 A;  3TWW A;  4DLQ A;  4JXT A;  1LD7 A;  5DBK A;  2L0T B;  2RKK A;  4RVB A;  4IN3 B;  4EPZ A;  3CK8 A;  3FUK A;  3L6A A;  4NAC A;  4DK5 A;  3FY4 A;  3LVR E;  1X5B A;  4MS6 A;  2I1K A;  3FEX A;  3DSS A;  1IQU A;  3CVL A;  3PS6 A;  2QFC A;  3CVU A;  2UWJ G;  3ML8 A;  3DBS A;  3KEZ A;  4GYY A;  3RRU A;  2EIM E;  2WQ6 A;  1YCS B;  3LPZ A;  4AXH A;  2V5Q C;  1E8Z A;  3Q15 A;  2I9C A;  1RZ4 A;  4N3A A;  3MKQ A;  4RQI A;  1FVH A;  2DZO A;  4AP2 A;  3D9J A;  4DPR A;  3RO3 A;  3EJN A;  1OCO E;  2PZI A;  3LJN A;  3UIO C;  4ANX A;  1JCR A;  1NL4 A;  1N95 A;  4I2Z A;  3L16 A;  4U8H A;  4YND A;  4K0R A;  2X6F A;  3TWR A;  4GZD A;  3ZU7 B;  2XHE A;  3CVN A;  2IO2 C;  4DLO A;  4A3V A;  5AYW D;  1N94 A;  1GW6 A;  4F53 A;  3FUH A;  4G11 A;  1BU9 A;  2WPV A;  2OEV A;  2J8S D;  4GTS A;  3TWU A;  5ANR A;  2WM9 A;  4DX6 D;  3QWV A;  3V79 K;  3FTX A;  2OV8 A;  2HO1 A;  4L2L A;  4LRZ A;  1QNF A;  2WQ7 A;  3PZ1 A;  3EU5 A;  3WG7 E;  4J8E A;  2UY1 A;  3IKO B;  3SF4 A;  4I17 A;  2XRY A;  3CVV A;  1N4S A;  4GPK A;  3SBS A;  3N71 A;  3CVQ A;  3LJ3 A;  2ZXW E;  1HX8 A;  2P9L G;  2DBA A;  4BES A;  3LDZ A;  4QQI A;  3SNX A;  3FTW A;  4G23 A;  4PH4 B;  2GRP B;  2AJA A;  4C48 B;  2AVP A;  3DXM G;  3GZS A;  1TNO A;  2X6K A;  2A4Z A;  3K9I A;  3PRE A;  2WXI A;  1HFA A;  1DNP A;  3U4T A;  4J8F A;  3MEK A;  4IYP A;  2XPI A;  3PE4 A;  4F1P A;  2XGM A;  1TR4 A;  2DVW A;  2WXL A;  1TNU A;  3PE3 A;  4ZHB A;  3V31 A;  4PS8 A;  3FHE A;  2WB2 A;  3QOU A;  4B89 A;  5EKQ D;  1ELW A;  3RIB A;  3OXG A;  3AG1 E;  4U0S A;  2H6G A;  4FC8 A;  2IF4 A;  4JW1 A;  1UN9 A;  5FJY A;  3SFZ A;  2XPY A;  2R2L A;  3ZYL A;  3FTY A;  1YMP A;  1O1S A;  1Q2Z A;  5AJL A;  2LXL A;  3ZUV B;  4G26 A;  3JXJ A;  3U9W A;  2FI7 A;  3NF1 A;  2L0I A;  2RFA A;  4ANU A;  2LAH A;  2KM4 A;  4GTT A;  4ATG A;  4CDR A;  4GZ6 A;  4GA0 A;  1N4P A;  3AU4 A;  3NZS A;  2KAT A;  3PNL B;  4O60 A;  2PQR A;  3FU3 A;  3GZ1 A;  2JAB A;  1ELR A;  1D8E A;  3D9I A;  3GZ2 A;  4WUY A;  3UQ3 A;  3HXC A;  2C0M A;  3QK0 A;  3RRM B;  4RG6 A;  3NZU A;  4KT6 B;  4I9E A;  3MCX A;  2J08 A;  1SQM A;  2I1J A;  4LEU A;  3D9K A;  3FUD A;  3DSU A;  3QWP A;  3VTY A;  2ZGD A;  3TL5 A;  4GB9 A;  1LD8 A;  1LTX A;  1LF8 A;  4KXK B;  2HE0 A;  2YIN A;  3QDN A;  3SY2 A;  4Q94 A;  5JMN D;  4UWF A;  1WG0 A;  5EYP F;  5CEA A;  3Q5M A;  1N4Q A;  3R9A B;  2OEW A;  1Y8M A;  4GA2 A;  4BSZ B;  3TAX A;  4UQZ A;  1H0A A;  4I6J A;  1EF1 C;  4UWH A;  3ZYK A;  3D9L A;  2WQH A;  5JA4 D;  3MV3 B;  3KSL A;  4HRN A;  3ZW3 A;  4DUI A;  4TXQ A;  3PUJ A;  1N54 A;  4PS3 A;  5G05 J;  4G2V A;  3EHQ A;  3E30 A;  1U3C A;  2X3M A;  4U95 D;  5J08 A;  2B6C A;  2X6I A;  4UUC A;  1E8X A;  4UWK A;  5AQ9 A;  2Y3A A;  5ENP D;  5G05 C;  2ZIR A;  4I9C A;  3OXL A;  4DX2 A;  4TV3 A;  2P9P G;  4E6H A;  3MX3 A;  4WWO A;  4Q69 A;  5B3S E;  5AQB A;  2P58 C;  4BFR A;  1KZO A;  3I3N A;  2WVI A;  1Z3Y A;  5BV0 A;  3I4R B;  4IUL A;  5J90 A;  3UIN C;  3LS8 A;  3W9G A;  1OWL A;  3AS8 A;  3OXF A;  3B13 A;  5G04 C;  3HXD A;  4BSX A;  3U66 A;  3SGH A;  5AEN A;  4L1B A;  3AG4 E;  4HOR A;  5A7D B;  4C9B B;  3G2V A;  5D2M C;  4HLL A;  4I1O B;  1TNZ A;  4CCA A;  3UM0 A;  4A1S A;  2LXM A;  2KCV A;  3X2Q E;  3LKU A;  3W9F A;  2VGX B;  3DEP A;  3S7J A;  2OVF A;  2VTB B;  4PS7 A;  3RO2 A;  3CVY A;  4F7A A;  3GW4 A;  2H6I A;  5BNW A;  1N9A A;  5FTP A;  1IHB A;  3FH7 A;  4TUM A;  5CCL A;  1H6K A;  4N3C A;  1E7V A;  5FZR A;  2YQ8 A;  3B7U X;  3ZFW A;  5CEC B;  3SHF A;  5FT9 A;  5CER B;  2LO6 A;  3RU0 A;  1P5Q A;  3DWL G;  1INZ A;  4WAF A;  5FZQ A;  4F3V A;  1MHQ A;  3QKY A;  3FTU A;  5AIJ A;  4EZJ A;  3VLF A;  3DPY A;  4BT8 A;  5FZS A;  1PC2 A;  2F0Y A;  4MBG A;  5BT1 A;  1IQR A;  5M72 A;  2I6H A;  4DX7 D;  4KVM A;  3MKR A;  2QYU A;  4FLB A;  3ZYQ A;  5KNG A;  3J5P A;  5B1A E;  3D9O A;  1NA0 A;  3Q75 A;  4MKT A;  1SA4 A;  2DYR E;  1K1B A;  4UQY A;  1KT0 A;  3BG1 B;  3G2U A;  3FUI A;  4JC8 A;  5IY5 E;  3CVW A;  4ATZ D;  3BUA A;  4KMO A;  5LX8 A;  5LFA A;  1XGW A;  2R03 A;  4EQF A;  3T5X A;  3Q78 A;  4CDN A;  3CLJ A;  1DCE A;  3O4Z A;  4HI8 A;  2V4L A;  5JJT A;  3CEQ A;  1HS6 A;  2QY7 A;  3ASD A;  4C0E A;  4L2Y A;  4XKC A;  1ELK A;  2CHW A;  3B7S A;  1QBQ A;  2BF0 X;  4GAA A;  3Q9N C;  4N2S A;  1SA5 A;  2KZT A;  4DX1 A;  4CDM A;  5KNH D;  5EYL A;  3ZN3 A;  4N5Q A;  1JWG A;  3EU9 A;  4ILG A;  4D10 C;  3C3R A;  4B8C B;  4YDY A;  1QYM A;  4EBA G;  4U96 D;  1TN8 A;  3QNK A;  2ZIS A;  4G8L A;  2X6H A;  4K5B A;  1U3D A;  4GTO A;  4WND A;  2HM8 A;  2LAI A;  4HOU A;  1D9S A;  1UW4 B;  5ENR D;  1N4R A;  3CST A;  3FH8 A;  2Y4T A;  1FCH A;  4AM9 A;  3JYS A;  3NAW A;  2PQN A;  3QB2 A;  2JLB A;  1L5J A;  4F1S A;  3HXB A;  5LCW C;  3MV2 B;  1OY3 D;  3HIZ A;  2PNN A;  3ASF A;  1V55 E;  3T8M A;  3FFL A;  4A1G A;  2P9N G;  3LVQ E;  4JEU A;  5JHA A;  4DX5 D;  1MX2 A;  1ZU2 A;  4J8D A;  5BXU A;  2XQ0 A;  2CHZ A;  4U63 A;  2DCP A;  2IOL A;  3CQG B;  5CRV A;  1YA0 A;  3DSW A;  5BXO A;  2J4D A;  3Q79 A;  2BKG A;  4YDW A;  1V54 E;  2WXO A;  3G2T A;  4RSY A;  3MA5 A;  5KCM A;  2CHX A;  5T8I A;  3UT7 A;  3QWW A;  4CEM A;  2BED A;  5A23 A;  4O6F A;  4M3O A;  2F8X K;  3PVL A;  2JEK A;  1HF8 A;  3RK6 A;  5HI7 A;  4PUC A;  2DZN A;  3EHN A;  3FTS A;  4JHR A;  4AOF A;  3DPD A;  4WWN A;  3KSQ A;  5AQA A;  1MQS A;  2WXF A;  1TNB A;  2HR2 A;  5FQ6 A;  2F37 A;  2P9S G;  3FU6 A;  3PZ2 A;  3BU8 A;  4H7X A;  3DEO A;  4HS2 A;  5ANL A;  3JXI A;  1NA3 A;  1WAO 1;  3FUN A;  4GCN A;  4G8K A;  1Z3X A;  2IJG X;  1Z6T A;  4HOQ A;  3FUJ A;  4XIF A;  2GRM A;  4GTV A;  3TXN A;  3E37 A;  4FHK A;  4M7C A;  1JWF A;  5EIL A;  5C1D A;  2BKK B;  3C3O A;  3FH5 A;  4FHJ A;  3L9T A;  4HRL A;  3ASN E;  2XS8 A;  3UM1 A;  3BQO A;  2KBX A;  2VGX A;  3Q73 A;  4LNU D;  4DI4 A;  4HFG A;  4HI9 A;  1SZ9 A;  3Q4A B;  4UQX A;  1QQE A;  2J9Q A;  3G2S A;  4GTQ A;  3ASO E;  4QFV A;  3ESK A;  1HG2 A;  3Q47 B;  4KVO A;  3KAE A;  5AAO A;  2NYJ A;  3IBE A;  2GRR B;  5CRU A;  3CSF A;  5CED B;  4U0Z A;  3ASH A;  4F6R D;  2P9K G;  1YYH A;  4BY6 A;  4GTM A;  3HYM B;  2VJ8 A;  3AG2 E;  4NIK A;  4U7E B;  4CT4 A;  2Q7F A;  5EID A;  2VTB A;  2BTD A;  2WMN A;  1O1T A;  4A3T A;  5LP0 A;  4CRW A;  3UIP C;  2ETC A;  3ZXS A;  3UT4 A;  3PDN A;  1BLX B;  2ETB A;  2IOS A;  4LUN U;  2P2C P;  4CZ2 D;  3TJP A;  5D0Q D;  5AAR A;  3ENE A;  1OCZ E;  1N52 A;  1OWP A;  5AN8 A;  4GPM A;  3QAR A;  3FEY A;  4HXI A;  4HRM B;  1EDU A;  2WXQ A;  3EUV A;  3E33 A;  3FU5 A;  4XI9 A;  3ISM C;  3ZVV A;  3FWV A;  2AXU A;  2DIW A;  5ARG A;  3DXK G;  2EIN E;  4FLH A;  4N3B A;  4K5C A;  5ENS D;  2R05 A;  3VTX A;  3AG3 E;  4JPS A;  2FF4 A;  4EHM A;  5BV1 A;  1S64 A;  2YHE A;  2IY0 C;  4HBD A;  5B1B E;  3HVE B;  2Y0B G;  3EHM A;  2V4H C;  2RFM A;  1UOH A;  5JHB A;  1JUQ A;  3S2A A;  4A63 B;  4XE0 A;  3CVX A;  2GRO B;  3RSE G;  4GA1 A;  1E8Y A;  4KYO B;  3FUF A;  1HU3 A;  3V2O A;  4YVQ C;  3HVE A;  3UM3 A;  4K03 A;  3FTV A;  3IV0 A;  4JD2 G;  3IEG A;  3V30 A;  3S7F A;  3ABK E;  4U0U A;  2DWZ A;  3ZHE A;  4GZ5 A;  4DJA A;  5C2Y A;  4N5C A;  4GMJ A;  4Z68 A;  1BPO A;  1UJJ A;  3AAA C;  4GTR A;  4ANW A;  1WY6 A;  5ENT D;  5AQ7 A;  3IXE A;  5BUZ A;  4WWP A;  3L13 A;  1H2V C;  5KJL A;  3SQV A;  3PUK A;  1X81 A;  3C5R A;  3PZ3 A;  2XS1 A;  4FJZ A;  1KPS B;  1UG3 A;  4O1P A;  3SO8 A;  4FA6 A;  4GZC A;  3ONK A;  2R59 A;  2MYO A;  1DCQ A;  1OWN A;  1E90 A;  1IYG A;  1BI7 B;  2V0P A;  3D9P A;  1HXI A;  3P1U A;  2P9U G;  3CQC B;  2A5E A;  3BG0 B;  4YVO A;  1H19 A;  1SZA A;  4BWR A;  3V2X A;  3Q7A A;  4GTP A;  2FO7 A;  3B95 A;  5CMY A;  2LNI A;  4LNB A;  3ZHE B;  4B93 B;  3JCK C;  4BT9 A;  3ZPJ A;  4GML A;  2VGE A;  2NSZ A;  5CBN A;  4N39 A;  2XCC A;  3UT8 A;  3HHM A;  4N2Q A;  3SFY A;  4L7T A;  1OWO A;  3LCA A;  3SFX A;  3TWX A;  1JCS A;  1G3N B;  4PDX A;  2IU1 A;  2OOE A;  1AWC B;  5HRY A;  2EIK E;  4L23 A;  5LCW J;  1TYQ G;  1XNF A;  2H6F A;  3LY8 A;  3T8K A;  2EIL E;  3UM2 A;  3IHV A;  2XGS A;  3PZD A;  1EYH A;  3MZL B;  2WMO A;  2IQC A;  5DIZ A;  4GU5 A;  4FP7 A;  3JUI A;  4URK A;  1W3B A;  4Y6C A;  3RAU A;  5EDS A;  4XEI G;  1WDY A;  4AEZ C;  3FDH A;  4DRX E;  2CG2 A;  5LOZ A;  2NXP A;  4Q96 A;  2EIJ E;  1BD8 A;  1UN8 A;  2LSV A;  3BEE A;  3ESL A;  3UTM A;  2XEE A;  3NQP A;  2ILR A;  4U04 A;  2GRQ B;  4ZFH A;  3L08 A;  1TN6 A;  4OAV B;  3APF A;  2L9B A;  2CG3 A;  4AV7 A;  3ULY A;  3ZGQ A;  4U8Y D;  1FVF A;  3L82 A;  1HG5 A;  5T3R A;  3APC A;  3DSX A;  2PM7 A;  4NUR A;  4GYO A;  1O5M A;  3LYA A;  3P2B A;  1NI1 A;  1E8W A;  5CMW A;  1BI8 B;  4W9R A;  4JA9 A;  2J4B A;  4JHK A;  3G2W A;  3QC1 A;  4I6G A;  3FUM A;  4LSZ E;  2F8Y A;  4TXR A;  3UUX A;  2R5S A;  4JZY A;  1H2T C;  3OTN A;  4TRQ A;  3ABM E;  3ML9 A;  4Y6W A;  5KJN A;  5G04 J;  3GYZ A;  4BTA A;  2VSX E;  3D9N A;  2XEN A;  4WNE A;  3CHP A;  2RG8 A;  4EEC A;  3L17 A;  4HOS A;  2R02 A;  4TUU A;  3LY9 A;  1D8D A;  2AWI A;  1HO8 A;  4HOT A;  2OVB A;  4G24 A;  3MYV A;  5EN5 D;  3D9M A;  4EZL A;  4BX8 A;  1ZBP A;  3JUE A;  4TXP A;  4X8Q A;  3AJI A;  1HZ4 A;  4YDE A;  5CCM A;  3DST A;  2GRN B;  1O1R A;  3TXM A;  3EIQ C;  4J7W A;  3APD A;  3UKU G;  3WXX A;  4ANV A;  4XKB A;  4O1O A;  3UXG A;  3B7T A;  4MRU A;  4CGV A;  4C0M A;  2CFU A;  4ACK A;  1S0P A;  3DRA A;  2KCK A;  4I1M A;  4ILI A;  5JJ6 A;  4ILH B;  3CGH A;  1IHG A;  3E34 A;  3J5Q B;  2WXJ A;  3ULQ A;  1H2U A;  1NFI E;  3JQ1 A;  4YDO A;  1JPL A;  3RKV A;  5HQ8 A;  2GW1 A;  3KEA A;  5D0O D;  1E7U A;  4JB8 P;  1RW2 A;  4L9P A;  5FWQ A;  2WXG A;  1K1A A;  3KS2 A;  1HE8 A;  1OT8 A;  2YHC A;  2KC7 A;  3DSV A;  4LNG A;  4BER A;  1K3Z D;  3PEU B;  3UPV A;  2HYZ A;  1TEZ A;  4KBQ A;  3PH0 C;  1AP7 A;  4JHJ A;  1H6P A;  5KJM A;  1S70 B;  4LG6 A;  4G1T A;  3CHO A;  1EPU A;  2OND A;  1A17 A;  3B7R L;  1MYO A;  5HKP A;  3CK7 A;  3CHQ A;  4XZ4 A;  1N11 A;  1A5E A;  2XRZ A;  3SI5 A;  2J49 A;  3CHS A;  4MLP A;  1VDY A;  4J0U A;  4G25 A;  2MHK A;  5G55 A;  4HNA D;  4FUL A;  2FBN A;  4GZ3 A;  1PAQ A;  3QJZ A;  3AS5 A;  3R7Q A;  4JL0 A;  2A5U A;  2Y69 E;  5H7P A;  4AY5 A;  3D9H A;  4WNF A;  2AXZ A;  4I1A A;  4ME2 A;  4ACL A;  3TWV A;  1SW6 A;  3CHR A;  2GGF A;  4APO A;  1FPP A;  4AJW A;  2J07 A;  4AVX A;  3C72 A;  2V8S E;  5FQ4 A;  2VSY A;  4B0Z A;  4V3I A;  1JCQ A;  2MRI A;  1DVP A;  3HXE A;  5EX3 A;  2EQX A;  3S7D A;  3VLD A;  3ZKJ A;  1OCR E;  4B94 A;  4OVU A;  1ZB1 A;  1DC2 A;  2B0O E;  3R9M A;  5ENO D;  2XEV A;  1FT2 A;  3FUL A;  3U64 A;  2ZU6 B;  3Q7F A;  3ONL A;  2OCC E;  5E76 A;  2QZA A;  4RLY A;  3C3Q A;  3PRZ A;  2RD0 A;  5ENQ D;  4E85 A;  5BPP A;  3UMV A;  3CKC A;  3MGB A;  3S7B A;  2AW6 A;  1N0R A;  2X6J A;  1TJC A;  4J8S A;  3R7R A;  4OVV A;  5FIO A;  5FIN A;  4K5A B;  3TWT A;  2R17 C;  4UWL A;  1KT1 A;  4EZK A;  3OAW A;  2FEZ A;  4CGW A;  4GYW A;  3FUE A;  2XPZ A;  4DI3 A;  4BTB A;  3E4B A;  3NOG D;  4LER A;  3ZRH A;  3LXU X;  3QAQ A;  5BW8 C;  3SZ7 A;  4BX9 A;  2XCB A;  4HQD A;  4J6I A;  3UKR G;  3NOC D;  3TGO A;  4FJY A;  2V5F A;  3ABL E;  2Y1L E;  3URZ A;  1MX4 A;  4NQ0 A;  1PY1 A;  2MOW A;  2E0I A;  3KD7 A;  4CYM D;  3LEW A;  4JEH A;  3EIJ A;  3AU5 A;  4GMR A;  4GCO A;  5T4Y A;  4OAU C;  2M63 A;  4I2W A;  1HH8 A;  2VSN A;  4I43 A;  3CKB A;  4UI9 C;  3UX4 A;  2KXP C;  4J8Y A;  5KBA A;  2WXK A;  4I6E A;  3U3W A;  5FQ8 A;  1S63 A;  1TN7 A;  2ION A;  1KZP A;  3ZYM A;  1N0Q A;  2KZT B;  2WXR A;  3CHM A;  4AIF A;  3RRN B;  3HG0 D;  3I4G A;  4BET A;  2H6H A;  3CR3 A;  3PEV B;  1TNY A;  3NB2 A;  2IFU A;  2LUH A;  1MJ0 A;  3FTZ A;  3ULE G;  1QZ2 A;  5ITZ F;  3CVP A;  3B7B A;  1OCC E;  3EDT B;  1U2V G;  4JVS A;  3T5V A;  2XZD G;  3HXF A;  2AXV A;  3FP3 A;  4NRH B;  1FT1 A;  2PM6 A;  1OWM A;  4KZC A;  2NC9 A;  2DYS E;  2YNQ A;  1MX6 A;  4HLE A;  4APF A;  2WXP A;  2WXM A;  3T9K A;  4U8V D;  3CV0 A;  2P9I G;  3FU0 A;  3UI2 A;  3TWQ A;  1NP7 A;  4HVB A;  1MZC A;  2QYJ A;  4RG9 A;  3JQ0 A;  4HB5 A;  1OUV A;  2QC9 A;  5FQ7 A;  1KLX A;  3CIA A;  2IEJ A;  5EX0 A;  2Y4U A;  5AJD A;  2LSU A;  1B89 A;  3ZXP A;  1K8K G;  1IXV A;  2C2L A;  2BUG A;  1UJK A;  2PL2 A;  2XGO A;  4CT0 A;  3NBN B;  5A6C A;  4AY6 A;  3HDX A;  3TG5 A;  4XI0 A;  3E32 A;  5D66 A;  2J09 A;  2WXN A;  5ENN A;  3ZNG A;  2CFZ A;  4FU3 A;  4P29 A;  3MJW A;  1IKN D;  2L6B A;  1Z5S C;  3D3M A;  2XZT G;  1E96 B;  4UWG A;  3IHY A;  4XX5 A;  4B8A A;  3TG4 A;  1H6O A;  4WNG A;  3AS4 A;  5CBO A;  3LY7 A;  5ARF A;  2KCL A;  4LCT A;  3O48 A;  2E2E A;  1TJF A;  2UY1 B;  3RJV A;  4UI9 K;  3SD5 A;  4ABN A;  1Y6I A;  2I2O A;  2IO3 C;  2X38 A;  4FAD A;  1WM5 A;  2FUL A;  3ZEF A;  2VGY A;  2XEH A;  3HRA A;  3EHR A;  3L54 A;  3ZIM A;  3Q49 B;  4OYS A;  2C0L A;  4H7Y A;  4BEP A;  5HS0 A;  4IRU A;  1NZN A;  5G2N A;  4JA7 A;  3C98 A;  5KJK A;  2ZGG A; 
#chains in the Genus database with same CATH homology
 1JCR A;  1NL4 A;  1N95 A;  1O5M A;  3SFX A;  1JCQ A;  4YDO A;  3HXE A;  1JCS A;  1O1T A;  2IEJ A;  4GTV A;  1N4Q A;  1NI1 A;  3E37 A;  3Q78 A;  1S63 A;  1TNZ A;  2H6G A;  3PZ4 A;  1TN7 A;  1N94 A;  1DCE A;  1KZP A;  1FT2 A;  4GTS A;  4L9P A;  3Q7F A;  2R2L A;  4GTR A;  2H6F A;  1O1S A;  3KSL A;  3DSV A;  4LNG A;  2H6H A;  1LD7 A;  2H6I A;  3Q73 A;  1N9A A;  1QBQ A;  1X81 A;  3E32 A;  3PZ3 A;  1TNY A;  3EUV A;  3PZ1 A;  3EU5 A;  3DSW A;  3E33 A;  1D8D A;  1SA5 A;  3Q79 A;  3E30 A;  4GTT A;  1N4S A;  3DSS A;  1N4P A;  2BED A;  4GTQ A;  3HXF A;  4EHM A;  2ZIR A;  1D8E A;  4YDE A;  1S64 A;  1FT1 A;  3DST A;  3HXC A;  1O1R A;  3DPY A;  4MBG A;  2F0Y A;  1KZO A;  3Q7A A;  1TNO A;  1TN8 A;  4GTP A;  1TN6 A;  4LNB A;  2ZIS A;  3KSQ A;  3DSU A;  1TNB A;  4GTO A;  3Q75 A;  1FPP A;  3PZ2 A;  1N4R A;  3DRA A;  1SA4 A;  1LD8 A;  4GTM A;  3HXD A;  1LTX A;  1TNU A;  3C72 A;  3E34 A;  3DSX A;  3SFY A;  1MZC A;  3HXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...