2GRNB

Crystal structure of human rangap1-ubc9
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 58
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grnB00
3UINC 3UIOC 2IO2C 1Z5SC 5D2MC 2GRQB 3UIPC 2GRPB 2IO3C 2IY0C 2GRNB 1KPSB 2GRRB 2GROB
chains in the Genus database with same CATH superfamily
2XENA 3HXDA 3DSXA 3L13A 3IHYA 2DVWA 1YMPA 2CHXA 4X8QA 4G1TA 2XEEA 2GRMA 1E7VA 1YYHA 4LNBA 3ENEA 1ELWA 2WMOA 3AJIA 2ETAA 3NBNB 3CVNA 4N3BA 2ILRA 1E8WA 3FU5A 4JEUA 4A3TA 3T8MA 3FTUA 1N4RA 3LEWA 4XKBA 1U3DA 3DEOA 1L5JA 3MKRA 5AARA 3CQCB 3CVQA 1S64A 3TXNA 5AQBA 1TNZA 3C72A 4UQXA 3BG0B 3E34A 2HO1A 4WNEA 3ISMC 3TGOA 4KT6B 4RQIA 4C0EA 3IBEA 2XS8A 4A63B 1Z3YA 3R7RA 3FTXA 2P9UG 2X6JA 3UX4A 2E0IA 1YA0A 2QZAA 4I9CA 3ZUVB 3F6QA 5LCWJ 2KCLA 4HNAD 3JXIA 3OAWA 3UXGA 4XE0A 2VGXA 3UKRG 3FDHA 4J8YA 3JXJA 3X2QE 1HG2A 3B7TA 3V31A 3NB2A 1NZNA 4LNGA 3DPDA 4UQYA 4ILIA 3LDZA 1H19A 2ZGDA 2IFUA 3T5VA 2WXQA 3APCA 3ZXSA 1PY1A 5CBNA 2WPVA 3RIBA 4ANUA 3BQOA 4JHJA 1BD8A 4TXPA 4JA9A 1SZAA 3MZLB 2WXOA 2RFMA 2I1KA 4O6FA 3FEYA 2KZTB 1OWOA 1H2TC 4I6GA 4V3IA 2NXPA 3FHEA 3MX3A 1KT1A 3ZGQA 4XI9A 5T8IA 4GA0A 2XPZA 1BPOA 2LXMA 3FWVA 3Q7AA 3C98A 4QQIA 2X3MA 1JWGA 4HI9A 1X5BA 4WWNA 2BEDA 4E6HA 3CSTA 5C2YA 3UM1A 1ELKA 3TWVA 4DI3A 2L6BA 3PNLB 3G2VA 4K03A 3CVPA 1K1AA 3FUMA 1N95A 2AW6A 3PZ2A 4DJAA 2VQ2A 4IULA 3LJNA 4GU5A 2BKKB 2PNNA 2VGXB 2Y69E 1H6KA 2VSNA 3ASFA 3LY7A 1QBQA 1IHGA 2HM8A 3DEPA 3QKYA 3CVXA 4WWPA 3TG4A 3Q73A 4GTRA 2J8SD 3SI5A 2J49A 3BEEA 3UPVA 2BF0X 3UIOC 5G05J 3UMVA 4AM9A 3Q9UC 3EJNA 1MJ0A 1Y8MA 2WXNA 2R17C 3PUJA 3V2XA 1N4PA 4GCOA 5AN8A 3K9IA 3ZN3A 1IHBA 5AYWD 4N2SA 1S0PA 3CVLA 1HH8A 3APFA 5KNGA 5BXUA 1ELRA 5EDSA 4BESA 5EILA 4JVSA 3ZYKA 3FUIA 1S63A 3AS8A 3G2TA 1A5EA 2R05A 1EF1C 3LYAA 2AWIA 1LF8A 3W9FA 4K5BA 4AXHA 3SO8A 2H6IA 2XPYA 3PS6A 4RG9A 4G24A 1PAQA 3PZ3A 4U04A 2R03A 3DRAA 1EPUA 3ZIMA 2BUGA 1JCQA 4FHJA 4LUNU 2P9SG 1HE8A 2CHZA 1P5QA 3B13A 1BLXB 4YVQC 3ZEFA 5KJKA 4YNDA 5JHAA 4GAAA 1QQEA 4XEIG 1FVFA 1VDYA 3B7BA 4GYWA 2P2CP 4GZCA 3L08A 4ZHBA 4AOFA 4UWGA 4KBQA 2P9LG 4OYSA 4AP2A 1FT2A 3FUEA 1H2UA 4LCTA 4TUUA 3FUDA 3JUEA 3ZW3A 2X38A 5D0OD 2FEZA 4YDEA 3ZHEB 4MLPA 4XX5A 5G04C 2HYZA 2P58C 3FUNA 1HZ4A 4CEMA 3C3RA 4GA2A 2VGEA 4DLQA 5BXOA 2LAHA 3SBSA 3ULQA 3CIAA 1HXIA 5HKPA 2QFCA 4AY5A 3ABKE 3MEKA 3FEXA 1NA3A 4Q94A 4TUMA 3TWQA 3QWWA 1KLXA 3QC1A 3JQ1A 5B3SE 3MV3B 4GMLA 2WXJA 4FU3A 4NQ0A 3RRMB 4I1OB 3BU8A 3JQ0A 3DSTA 4HOQA 3KD7A 4ACLA 2WXHA 3HVEA 2MYOA 5CECB 4U7EB 3S7DA 2LO6A 1UJJA 1V55E 3D9KA 2OV8A 2R2LA 3T5XA 3QOUA 2X6IA 3U4TA 4L7TA 3FUKA 4HOUA 3MGBA 3QNKA 3UKUG 1A17A 1JCRA 3S7JA 3AAAC 1HF8A 1MX6A 4N3CA 4FLBA 4I1AA 1AWCB 1ZB1A 4HB5A 4I6EA 2WXFA 4CGWA 3QAQA 4DX5D 1N11A 4RG6A 5KJMA 4GYOA 4UWLA 4G26A 3FU0A 1N0RA 2VSYA 4DK5A 3Q47B 4JW1A 1RZ4A 2PL2A 5AQAA 4B0ZA 4YVOA 1DC2A 2ZU6B 4CRWA 3HXFA 2UY1A 4WAFA 3CKBA 4G8LA 2JEKA 3UM0A 4EHMA 5KJLA 4JEHA 3TWXA 3PZ1A 4BTBA 2VTBA 4L1BA 5ARFA 5LCWC 3C5RA 4NACA 2KC7A 3EIJA 3ZYQA 4UWKA 4F6RD 5BUZA 4CT0A 2PZIA 4F1SA 2KM4A 1IQUA 5EYPF 4FJYA 3LY9A 2A5EA 5T4YA 3CR3A 3LVRE 2Q7FA 4C0MA 4EZJA 4PDXA 4N3AA 4M3OA 4LG6A 1BI7B 2DWZA 2E2EA 5FQ6A 3EHMA 4GTPA 3ONLA 4OAUC 1TNUA 2GW1A 3ZRHA 4JZYA 4U95D 1DCQA 2XQ0A 2V4LA 3CHRA 3DPYA 2DIWA 4BWRA 2V4HC 4F53A 4F1PA 1TR4A 5G2NA 1TNYA 3CVVA 4BFRA 2V8SE 3D9PA 3Q4AB 4FC8A 3AG2E 3MA5A 1TN6A 4FP7A 4NRHB 4BSXA 3IV0A 2NSZA 2ONDA 4MRUA 3EU9A 4JPSA 1U2VG 4URKA 3FUJA 3PE3A 2J4BA 4PS3A 5JMND 3D9LA 4HVBA 4D10C 3PEUB 3RKVA 4N2QA 4ANWA 3AS4A 5ENTD 3N71A 3D9JA 4BT9A 2F8YA 2L0IA 4JA7A 2F8XK 2AXVA 1TNOA 3ZXPA 5IY5E 3S7BA 3KEZA 5M72A 2FF4A 2ZGGA 3QARA 2YHCA 3GW4A 3SZ7A 5CBOA 2IU1A 3U9WA 2P9IG 4EBAA 2XRYA 5G05C 3D9NA 5FTPA 3NF1A 4DUIA 3CK7A 3URZA 2EQXA 4G11A 5B1BE 3Q9NC 3UINC 5JJTA 3DXKG 5EYLA 3VLFA 3FU6A 1S70B 3SFXA 3KS2A 4U96D 4BETA 2C0LA 3U66A 3U3WA 3MJWA 3MKQA 2J08A 2J07A 5LX8A 3IHVA 1JUQA 4EQFA 4J8FA 4HQDA 1Z3XA 4APFA 3SFZA 2QC9A 3QJZA 4FLHA 3KSLA 3B95A 3CHPA 1NFIE 4HBDA 3PREA 5EKQD 2V0PA 1TYQG 4GTQA 4FADA 3CQGB 3FTVA 1JCSA 3FTYA 2OVBA 3OTNA 4DRXE 3ABME 2J4DA 1X81A 3I4RB 2CG3A 4GTVA 1LTXA 3FFLA 3LPZA 4LSZE 2DZOA 4GZ3A 4H7XA 5FQ7A 4HS2A 4AJWA 1UN8A 2H6HA 4FJZA 3WXXA 2IO2C 3FTSA 3TL5A 4U0SA 5BT1A 1K8KG 2I1JA 5BNWA 4ANVA 2WVIA 2OOEA 3DSUA 4L9PA 2ETBA 1BI8B 5KJNA 1ZBPA 3PRZA 4BX9A 2OVFA 3FU3A 4K5CA 3HXCA 4B89A 4DX2A 2KCVA 4LERA 3EDTB 3ML9A 5A23A 1W3BA 5CEAA 3BG1B 3L6AA 3ZKJA 1NI1A 4Y6CA 2AXZA 4U8HA 1XGWA 1GW6A 4DX1A 2WM9A 2YHEA 1FT1A 4GYYA 2WXRA 2V5QC 3G2UA 3FY4A 4Q69A 2F37A 3P1UA 4R7LA 3PVLA 3CVYA 3FULA 3TAXA 4U0ZA 1N9AA 3ZVVA 4CYMD 4U8VD 3R7QA 3LVQE 4C9BB 5KCMA 1DNPA 3J5PA 4HRNA 4O60A 2QY7A 1IYGA 2L0TB 2KXPC 1HS6A 3RU0A 3AU4A 4G2VA 3UQ3A 2WMNA 2LNIA 1E7UA 5FINA 4AVXA 2KCKA 5D66A 2IONA 4HXIA 2CFUA 4EECA 4LEUA 2RFAA 5EIDA 4JXTA 3MCXA 3PDNA 3CGHA 4DPRA 4U0UA 4UI9J 4HRMB 3PUKA 2GGFA 4HRLA 5T3RA 2ZIRA 4NURA 2R59A 3IEGA 3O4ZA 4I9EA 1HO8A 1UJKA 2QYJA 1XNFA 4JHRA 3AS5A 3VLEA 5G55A 1N4SA 2MOWA 1OCZE 3ZPJA 4HFGA 4BY6A 1D9SA 3OXLA 1TN8A 1WM5A 2BTDA 4WUYA 5FZQA 3JCKC 2PM6A 3LKUA 1N94A 3QWVA 3QK0A 3O48A 2GROB 2WQ6A 2CG2A 3T8KA 1H6OA 3LS8A 3UT4A 3EIQC 2WXIA 2C0MA 1KZPA 5JA4D 1Z5SC 1OWMA 5J08A 4K0RA 4PH4B 3CEQA 4CGVA 2WXMA 1UOHA 5CMYA 4U07A 3CVWA 4O1OA 4KYOB 5BW8C 3SBTB 3NQPA 4GZDA 4KZ0A 2X6KA 4GMJA 5LFAA 2XHEA 3ESKA 4GTTA 2J09A 2I6HA 1WG0A 1OUVA 2R5SA 5E76A 2C2LA 2OCCE 3LXUX 3Q75A 1QYMA 2LSVA 4GZ5A 4PUCA 2IEJA 2LUHA 1LD8A 1WAO1 5CMWA 3ASHA 4DLOA 5CHEE 4TV3A 4B94A 3OXGA 2YQ8A 3LCAA 5ENNA 1LD7A 2A5UA 1OWNA 3ZFWA 3G2SA 1RW2A 4B93B 1OCCE 2I9CA 5ENQD 5FT9A 4PS8A 4P29A 4CDNA 3ABLE 1JWFA 4EZKA 5CEDB 2UWJG 2B6CA 3DBSA 3ZU7B 1U3CA 3EHRA 2JLBA 4GZ6A 4HI8A 4FULA 2PQRA 3QWPA 3RRNB 3L16A 1IKND 5KWDA 1TN7A 4OVUA 3Q78A 4GPKA 1K1BA 4KMOA 1Z6TA 1O5MA 4XKCA 4L23A 3HVEB 3CSFA 4BTAA 5EX3A 2XZTG 5ENPD 2JABA 3NAWA 4YDOA 3UUXA 2I2OA 2HE0A 4A1SA 4G25A 2P9NG 3TXMA 2Y4UA 2X6FA 3D3MA 2CHWA 4CDMA 4AEZC 5FQ4A 2RD0A 1UG3A 4N5CA 1UW4B 4IN3B 4PS7A 5HRYA 4I6JA 2CFZA 3RO3A 3GYZA 3IKOB 2XPIA 2WQHA 2F0YA 4TRQA 4ANXA 1D8EA 2Y3AA 1QZ2A 1BU9A 3E33A 1SZ9A 4NIKA 3HHMA 3TWSA 3GZ2A 3ZNGA 5AQ7A 2L6JA 3RJVA 4J7WA 4JHKA 5ANRA 5C1DA 1O1RA 1O1SA 1AP7A 3HXBA 4F3VA 4JD2G 2LSUA 2UY1B 5AAOA 3ULYA 3NZSA 4CCAA 3FH7A 2VTBB 3P2BA 4GTSA 4CT4A 1H6PA 3L82A 3L22A 4M7CA 4UI9K 5LP0A 3ML8A 4AV7A 4WWOA 2KZTA 3GZ1A 1SVXA 3E30A 4O1PA 1FVHA 3D9IA 4U63A 2VSOE 1YCSB 3QDNA 3U64A 3R9AB 2XCBA 3Q79A 5DIZA 1IQRA 2IO3C 2R02A 3J5QB 3PE4A 5D2MC 2B0OE 2GRNB 4H7YA 2OEVA 3UI2A 3E4BA 5B1AE 5H7PA 3TG5A 4LRZA 3BUAA 1H2VC 4HORA 3NOGD 3LY8A 2GRLA 1MX2A 2P9KG 3TWWA 5FJYA 3UM2A 2BKGA 4UQZA 4B8CB 5AENA 3CK8A 4JB8P 2KATA 4GPMA 4GTOA 3L17A 4XIFA 3CVUA 3ASGA 4MS6A 2AXUA 2X6HA 2XEVA 4J8SA 3SFYA 1E90A 2XGSA 2Y4TA 3DWLG 1WDYA 4FHKA 4UI9C 5ITZF 4GA1A 4JL0A 4XI0A 3PNTB 4YDWA 3ULEG 3R9MA 2WB2A 4ATZD 2ETCA 3OXFA 1OCOE 3L9TA 1E8YA 4TXQA 2WXKA 1FCHA 2H6FA 5D0QD 1N52A 3VTXA 3JUIA 3VTYA 3NOCD 3APDA 4IYPA 4I2WA 1HFAA 5AJDA 4F7AA 3LJ3A 3FH8A 5AIJA 1N0QA 2Y1LE 3GZSA 2A4ZA 1MQSA 4A55A 3AU5A 5ENOD 4L2LA 2GRQB 1HX8A 1Q2ZA 4W9RA 5KNHD 2IJGX 3CK9A 4I2ZA 5BPPA 5FZRA 3Q7FA 4A3VA 3CHSA 1SA4A 3MKQB 1INZA 2P9PG 1IXVA 3HXEA 4A1GA 4RSYA 4Y6WA 3UT7A 3IXEA 5CCMA 2DCPA 1KZOA 1OWPA 5ENSD 4IRUA 2VSXE 3G2WA 3JYSA 2NYJA 3KEAA 5ENRD 1OCRE 1FPPA 4HLLA 3HIZA 5EIBE 4WNFA 1ZU2A 4XZ4A 2YNQA 3FTWA 5JJ7A 1K3ZD 4OVVA 1E96B 3SQVA 3ZHEA 2V5FA 4L2YA 2XGMA 4BERA 1H0AA 2VYIA 3UT8A 3PEVB 4OAVB 5HS0A 2EIME 4UWHA 3ASNE 3Q5MA 3RSEG 2DZNA 2GRPB 4RVBA 3E32A 3L54A 4KZCA 3HYMB 1N54A 3D9HA 1JPLA 1PC2A 3KSQA 4ATGA 4E85A 3RRUA 5CERB 2ZISA 2WXLA 3RAUA 3SD5A 3FUHA 4ZFHA 5JHBA 5FWQA 3ZYMA 3FH5A 2XRZA 3C3OA 4B8AA 3PZDA 3HRAA 1KT0A 3D9MA 4DX6D 4DI4A 4GTMA 2FO7A 3S2AA 4HOSA 3V30A 2DYSE 2WQ7A 4ABNA 2MHKA 4KXKB 5HQ8A 5AQ9A 3EHNA 1EDUA 2XEHA 4EBAG 4BEPA 3NZUA 3T9KA 1SQMA 4UWFA 5A6CA 4FA6A 2RG8A 4ACKA 4TXRA 4CZ2D 3DSWA 3KAEA 3Q49B 5ANLA 4G23A 4UUCA 3CLJA 5EX0A 4RLYA 3DSVA 4MBGA 3I4GA 5EN5D 2IF4A 1TJCA 4APOA 3ONKA 4HLEA 1N4QA 3ASOE 3EUVA 4AY6A 2IOSA 2FO1E 5E75A 2VJ8A 2LXLA 2OEWA 5CCLA 2PM7A 2XGOA 4QFVA 2VGYA 1HG5A 1SA5A 3HDXA 3UTMA 2EILE 1MX4A 1WY6A 3FTZA 2IY0C 3Q15A 2HR2A 2AJAA 5FIOA 4HOTA 4N5QA 2RKKA 5CRUA 5HI7A 1OXJA 3DXMG 4DX7D 1KPSB 1G3NB 4I1MA 1D8DA 1V54E 3SHFA 1NA0A 4ILHB 1UN9A 4K5AB 5CRVA 3PH0C 5AJLA 1E8XA 4J8EA 3CV0A 1B89A 3EHQA 3CKCA 4YDYA 4BT8A 2FBNA 3UM3A 2J9QA 5FZSA 2Y0BG 3UIPC 3E37A 2QYUA 3FUFA 3FP3A 1HU3A 3W9GA 5LOZA 4GMRA 2KBXA 2FI7A 5KBAA 4MKTA 2H6GA 3AG1E 3D9OA 2XCCA 3CHMA 5JJ6A 2WXGA 1OT8A 2DBAA 3WG7E 2GRRB 2YINA 2AVPA 4Q96A 2L9BA 5A7DB 3QB2A 3SF4A 2DYRE 3TWRA 4J8DA 1DVPA 1Y6IA 3TWTA 4ILGA 2EINE 1TJFA 3VLDA 4EPZA 3C3QA 1NL4A 4I43A 3CHOA 4GCNA 1MHQA 3AG3E 3CHQA 4JC8A 3TWUA 4J6IA 1MZCA 3RK6A 3I3NA 4C48B 5J90A 1OWLA 2NC9A 4WNGA 5DBKA 5BV1A 4KVOA 4GB9A 2XS1A 1QNFA 2M63A 1NP7A 3V2OA 4J0UA 4ME2A 3SGHA 4BSZB 4KVMA 1SW6A 4U8YD 3B7UX 2IQCA 3ESLA 2PQNA 3AG4E 3MYVA 3B7RL 5G04J 4WNDA 3TJPA 3ASDA 1O1TA 2XZDG 4EZLA 1TNBA 3ZYLA 2LAIA 3S7FA 3DSSA 2ZXWE 4Z68A 2EIKE 1DCEA 2FULA 3B7SA 5BV0A 3SY2A 4N39A 1TEZA 4I17A 1MYOA 2WXPA 1EYHA 2IOLA 3MV2B 1OY3D 4CDRA 3PZ4A 1E8ZA 4G8KA 5FQ8A 3V79K 3I5PA 5ARGA 4AIFA 2EIJE 2MRIA 4BX8A 3SNXA 3HG0D 4LNUD 3EU5A 3RO2A
chains in the Genus database with same CATH topology
3UINC 3UIOC 2IO2C 1Z5SC 5D2MC 2GRQB 3UIPC 2GRPB 2IO3C 2IY0C 2GRNB 1KPSB 2GRRB 2GROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIN C;  3UIO C;  2IO2 C;  1Z5S C;  5D2M C;  2GRQ B;  3UIP C;  2GRP B;  2IO3 C;  2IY0 C;  2GRN B;  1KPS B;  2GRR B;  2GRO B; 
#chains in the Genus database with same CATH topology
 2XEN A;  3HXD A;  3DSX A;  3L13 A;  3IHY A;  2DVW A;  1YMP A;  2CHX A;  4X8Q A;  4G1T A;  2XEE A;  2GRM A;  1E7V A;  1YYH A;  4LNB A;  3ENE A;  1ELW A;  2WMO A;  3AJI A;  2ETA A;  3NBN B;  3CVN A;  4N3B A;  2ILR A;  1E8W A;  3FU5 A;  4JEU A;  4A3T A;  3T8M A;  3FTU A;  1N4R A;  3LEW A;  4XKB A;  1U3D A;  3DEO A;  1L5J A;  3MKR A;  5AAR A;  3CQC B;  3CVQ A;  1S64 A;  3TXN A;  5AQB A;  1TNZ A;  3C72 A;  4UQX A;  3BG0 B;  3E34 A;  2HO1 A;  4WNE A;  3ISM C;  3TGO A;  4KT6 B;  4RQI A;  4C0E A;  3IBE A;  2XS8 A;  4A63 B;  1Z3Y A;  3R7R A;  3FTX A;  2P9U G;  2X6J A;  3UX4 A;  2E0I A;  1YA0 A;  2QZA A;  4I9C A;  3ZUV B;  3F6Q A;  5LCW J;  2KCL A;  4HNA D;  3JXI A;  3OAW A;  3UXG A;  4XE0 A;  2VGX A;  3UKR G;  3FDH A;  4J8Y A;  3JXJ A;  3X2Q E;  1HG2 A;  3B7T A;  3V31 A;  3NB2 A;  1NZN A;  4LNG A;  3DPD A;  4UQY A;  4ILI A;  3LDZ A;  1H19 A;  2ZGD A;  2IFU A;  3T5V A;  2WXQ A;  3APC A;  3ZXS A;  1PY1 A;  5CBN A;  2WPV A;  3RIB A;  4ANU A;  3BQO A;  4JHJ A;  1BD8 A;  4TXP A;  4JA9 A;  1SZA A;  3MZL B;  2WXO A;  2RFM A;  2I1K A;  4O6F A;  3FEY A;  2KZT B;  1OWO A;  1H2T C;  4I6G A;  4V3I A;  2NXP A;  3FHE A;  3MX3 A;  1KT1 A;  3ZGQ A;  4XI9 A;  5T8I A;  4GA0 A;  2XPZ A;  1BPO A;  2LXM A;  3FWV A;  3Q7A A;  3C98 A;  4QQI A;  2X3M A;  1JWG A;  4HI9 A;  1X5B A;  4WWN A;  2BED A;  4E6H A;  3CST A;  5C2Y A;  3UM1 A;  1ELK A;  3TWV A;  4DI3 A;  2L6B A;  3PNL B;  3G2V A;  4K03 A;  3CVP A;  1K1A A;  3FUM A;  1N95 A;  2AW6 A;  3PZ2 A;  4DJA A;  2VQ2 A;  4IUL A;  3LJN A;  4GU5 A;  2BKK B;  2PNN A;  2VGX B;  2Y69 E;  1H6K A;  2VSN A;  3ASF A;  3LY7 A;  1QBQ A;  1IHG A;  2HM8 A;  3DEP A;  3QKY A;  3CVX A;  4WWP A;  3TG4 A;  3Q73 A;  4GTR A;  2J8S D;  3SI5 A;  2J49 A;  3BEE A;  3UPV A;  2BF0 X;  3UIO C;  5G05 J;  3UMV A;  4AM9 A;  3Q9U C;  3EJN A;  1MJ0 A;  1Y8M A;  2WXN A;  2R17 C;  3PUJ A;  3V2X A;  1N4P A;  4GCO A;  5AN8 A;  3K9I A;  3ZN3 A;  1IHB A;  5AYW D;  4N2S A;  1S0P A;  3CVL A;  1HH8 A;  3APF A;  5KNG A;  5BXU A;  1ELR A;  5EDS A;  4BES A;  5EIL A;  4JVS A;  3ZYK A;  3FUI A;  1S63 A;  3AS8 A;  3G2T A;  1A5E A;  2R05 A;  1EF1 C;  3LYA A;  2AWI A;  1LF8 A;  3W9F A;  4K5B A;  4AXH A;  3SO8 A;  2H6I A;  2XPY A;  3PS6 A;  4RG9 A;  4G24 A;  1PAQ A;  3PZ3 A;  4U04 A;  2R03 A;  3DRA A;  1EPU A;  3ZIM A;  2BUG A;  1JCQ A;  4FHJ A;  4LUN U;  2P9S G;  1HE8 A;  2CHZ A;  1P5Q A;  3B13 A;  1BLX B;  4YVQ C;  3ZEF A;  5KJK A;  4YND A;  5JHA A;  4GAA A;  1QQE A;  4XEI G;  1FVF A;  1VDY A;  3B7B A;  4GYW A;  2P2C P;  4GZC A;  3L08 A;  4ZHB A;  4AOF A;  4UWG A;  4KBQ A;  2P9L G;  4OYS A;  4AP2 A;  1FT2 A;  3FUE A;  1H2U A;  4LCT A;  4TUU A;  3FUD A;  3JUE A;  3ZW3 A;  2X38 A;  5D0O D;  2FEZ A;  4YDE A;  3ZHE B;  4MLP A;  4XX5 A;  5G04 C;  2HYZ A;  2P58 C;  3FUN A;  1HZ4 A;  4CEM A;  3C3R A;  4GA2 A;  2VGE A;  4DLQ A;  5BXO A;  2LAH A;  3SBS A;  3ULQ A;  3CIA A;  1HXI A;  5HKP A;  2QFC A;  4AY5 A;  3ABK E;  3MEK A;  3FEX A;  1NA3 A;  4Q94 A;  4TUM A;  3TWQ A;  3QWW A;  1KLX A;  3QC1 A;  3JQ1 A;  5B3S E;  3MV3 B;  4GML A;  2WXJ A;  4FU3 A;  4NQ0 A;  3RRM B;  4I1O B;  3BU8 A;  3JQ0 A;  3DST A;  4HOQ A;  3KD7 A;  4ACL A;  2WXH A;  3HVE A;  2MYO A;  5CEC B;  4U7E B;  3S7D A;  2LO6 A;  1UJJ A;  1V55 E;  3D9K A;  2OV8 A;  2R2L A;  3T5X A;  3QOU A;  2X6I A;  3U4T A;  4L7T A;  3FUK A;  4HOU A;  3MGB A;  3QNK A;  3UKU G;  1A17 A;  1JCR A;  3S7J A;  3AAA C;  1HF8 A;  1MX6 A;  4N3C A;  4FLB A;  4I1A A;  1AWC B;  1ZB1 A;  4HB5 A;  4I6E A;  2WXF A;  4CGW A;  3QAQ A;  4DX5 D;  1N11 A;  4RG6 A;  5KJM A;  4GYO A;  4UWL A;  4G26 A;  3FU0 A;  1N0R A;  2VSY A;  4DK5 A;  3Q47 B;  4JW1 A;  1RZ4 A;  2PL2 A;  5AQA A;  4B0Z A;  4YVO A;  1DC2 A;  2ZU6 B;  4CRW A;  3HXF A;  2UY1 A;  4WAF A;  3CKB A;  4G8L A;  2JEK A;  3UM0 A;  4EHM A;  5KJL A;  4JEH A;  3TWX A;  3PZ1 A;  4BTB A;  2VTB A;  4L1B A;  5ARF A;  5LCW C;  3C5R A;  4NAC A;  2KC7 A;  3EIJ A;  3ZYQ A;  4UWK A;  4F6R D;  5BUZ A;  4CT0 A;  2PZI A;  4F1S A;  2KM4 A;  1IQU A;  5EYP F;  4FJY A;  3LY9 A;  2A5E A;  5T4Y A;  3CR3 A;  3LVR E;  2Q7F A;  4C0M A;  4EZJ A;  4PDX A;  4N3A A;  4M3O A;  4LG6 A;  1BI7 B;  2DWZ A;  2E2E A;  5FQ6 A;  3EHM A;  4GTP A;  3ONL A;  4OAU C;  1TNU A;  2GW1 A;  3ZRH A;  4JZY A;  4U95 D;  1DCQ A;  2XQ0 A;  2V4L A;  3CHR A;  3DPY A;  2DIW A;  4BWR A;  2V4H C;  4F53 A;  4F1P A;  1TR4 A;  5G2N A;  1TNY A;  3CVV A;  4BFR A;  2V8S E;  3D9P A;  3Q4A B;  4FC8 A;  3AG2 E;  3MA5 A;  1TN6 A;  4FP7 A;  4NRH B;  4BSX A;  3IV0 A;  2NSZ A;  2OND A;  4MRU A;  3EU9 A;  4JPS A;  1U2V G;  4URK A;  3FUJ A;  3PE3 A;  2J4B A;  4PS3 A;  5JMN D;  3D9L A;  4HVB A;  4D10 C;  3PEU B;  3RKV A;  4N2Q A;  4ANW A;  3AS4 A;  5ENT D;  3N71 A;  3D9J A;  4BT9 A;  2F8Y A;  2L0I A;  4JA7 A;  2F8X K;  2AXV A;  1TNO A;  3ZXP A;  5IY5 E;  3S7B A;  3KEZ A;  5M72 A;  2FF4 A;  2ZGG A;  3QAR A;  2YHC A;  3GW4 A;  3SZ7 A;  5CBO A;  2IU1 A;  3U9W A;  2P9I G;  4EBA A;  2XRY A;  5G05 C;  3D9N A;  5FTP A;  3NF1 A;  4DUI A;  3CK7 A;  3URZ A;  2EQX A;  4G11 A;  5B1B E;  3Q9N C;  3UIN C;  5JJT A;  3DXK G;  5EYL A;  3VLF A;  3FU6 A;  1S70 B;  3SFX A;  3KS2 A;  4U96 D;  4BET A;  2C0L A;  3U66 A;  3U3W A;  3MJW A;  3MKQ A;  2J08 A;  2J07 A;  5LX8 A;  3IHV A;  1JUQ A;  4EQF A;  4J8F A;  4HQD A;  1Z3X A;  4APF A;  3SFZ A;  2QC9 A;  3QJZ A;  4FLH A;  3KSL A;  3B95 A;  3CHP A;  1NFI E;  4HBD A;  3PRE A;  5EKQ D;  2V0P A;  1TYQ G;  4GTQ A;  4FAD A;  3CQG B;  3FTV A;  1JCS A;  3FTY A;  2OVB A;  3OTN A;  4DRX E;  3ABM E;  2J4D A;  1X81 A;  3I4R B;  2CG3 A;  4GTV A;  1LTX A;  3FFL A;  3LPZ A;  4LSZ E;  2DZO A;  4GZ3 A;  4H7X A;  5FQ7 A;  4HS2 A;  4AJW A;  1UN8 A;  2H6H A;  4FJZ A;  3WXX A;  2IO2 C;  3FTS A;  3TL5 A;  4U0S A;  5BT1 A;  1K8K G;  2I1J A;  5BNW A;  4ANV A;  2WVI A;  2OOE A;  3DSU A;  4L9P A;  2ETB A;  1BI8 B;  5KJN A;  1ZBP A;  3PRZ A;  4BX9 A;  2OVF A;  3FU3 A;  4K5C A;  3HXC A;  4B89 A;  4DX2 A;  2KCV A;  4LER A;  3EDT B;  3ML9 A;  5A23 A;  1W3B A;  5CEA A;  3BG1 B;  3L6A A;  3ZKJ A;  1NI1 A;  4Y6C A;  2AXZ A;  4U8H A;  1XGW A;  1GW6 A;  4DX1 A;  2WM9 A;  2YHE A;  1FT1 A;  4GYY A;  2WXR A;  2V5Q C;  3G2U A;  3FY4 A;  4Q69 A;  2F37 A;  3P1U A;  4R7L A;  3PVL A;  3CVY A;  3FUL A;  3TAX A;  4U0Z A;  1N9A A;  3ZVV A;  4CYM D;  4U8V D;  3R7Q A;  3LVQ E;  4C9B B;  5KCM A;  1DNP A;  3J5P A;  4HRN A;  4O60 A;  2QY7 A;  1IYG A;  2L0T B;  2KXP C;  1HS6 A;  3RU0 A;  3AU4 A;  4G2V A;  3UQ3 A;  2WMN A;  2LNI A;  1E7U A;  5FIN A;  4AVX A;  2KCK A;  5D66 A;  2ION A;  4HXI A;  2CFU A;  4EEC A;  4LEU A;  2RFA A;  5EID A;  4JXT A;  3MCX A;  3PDN A;  3CGH A;  4DPR A;  4U0U A;  4UI9 J;  4HRM B;  3PUK A;  2GGF A;  4HRL A;  5T3R A;  2ZIR A;  4NUR A;  2R59 A;  3IEG A;  3O4Z A;  4I9E A;  1HO8 A;  1UJK A;  2QYJ A;  1XNF A;  4JHR A;  3AS5 A;  3VLE A;  5G55 A;  1N4S A;  2MOW A;  1OCZ E;  3ZPJ A;  4HFG A;  4BY6 A;  1D9S A;  3OXL A;  1TN8 A;  1WM5 A;  2BTD A;  4WUY A;  5FZQ A;  3JCK C;  2PM6 A;  3LKU A;  1N94 A;  3QWV A;  3QK0 A;  3O48 A;  2GRO B;  2WQ6 A;  2CG2 A;  3T8K A;  1H6O A;  3LS8 A;  3UT4 A;  3EIQ C;  2WXI A;  2C0M A;  1KZP A;  5JA4 D;  1Z5S C;  1OWM A;  5J08 A;  4K0R A;  4PH4 B;  3CEQ A;  4CGV A;  2WXM A;  1UOH A;  5CMY A;  4U07 A;  3CVW A;  4O1O A;  4KYO B;  5BW8 C;  3SBT B;  3NQP A;  4GZD A;  4KZ0 A;  2X6K A;  4GMJ A;  5LFA A;  2XHE A;  3ESK A;  4GTT A;  2J09 A;  2I6H A;  1WG0 A;  1OUV A;  2R5S A;  5E76 A;  2C2L A;  2OCC E;  3LXU X;  3Q75 A;  1QYM A;  2LSV A;  4GZ5 A;  4PUC A;  2IEJ A;  2LUH A;  1LD8 A;  1WAO 1;  5CMW A;  3ASH A;  4DLO A;  5CHE E;  4TV3 A;  4B94 A;  3OXG A;  2YQ8 A;  3LCA A;  5ENN A;  1LD7 A;  2A5U A;  1OWN A;  3ZFW A;  3G2S A;  1RW2 A;  4B93 B;  1OCC E;  2I9C A;  5ENQ D;  5FT9 A;  4PS8 A;  4P29 A;  4CDN A;  3ABL E;  1JWF A;  4EZK A;  5CED B;  2UWJ G;  2B6C A;  3DBS A;  3ZU7 B;  1U3C A;  3EHR A;  2JLB A;  4GZ6 A;  4HI8 A;  4FUL A;  2PQR A;  3QWP A;  3RRN B;  3L16 A;  1IKN D;  5KWD A;  1TN7 A;  4OVU A;  3Q78 A;  4GPK A;  1K1B A;  4KMO A;  1Z6T A;  1O5M A;  4XKC A;  4L23 A;  3HVE B;  3CSF A;  4BTA A;  5EX3 A;  2XZT G;  5ENP D;  2JAB A;  3NAW A;  4YDO A;  3UUX A;  2I2O A;  2HE0 A;  4A1S A;  4G25 A;  2P9N G;  3TXM A;  2Y4U A;  2X6F A;  3D3M A;  2CHW A;  4CDM A;  4AEZ C;  5FQ4 A;  2RD0 A;  1UG3 A;  4N5C A;  1UW4 B;  4IN3 B;  4PS7 A;  5HRY A;  4I6J A;  2CFZ A;  3RO3 A;  3GYZ A;  3IKO B;  2XPI A;  2WQH A;  2F0Y A;  4TRQ A;  4ANX A;  1D8E A;  2Y3A A;  1QZ2 A;  1BU9 A;  3E33 A;  1SZ9 A;  4NIK A;  3HHM A;  3TWS A;  3GZ2 A;  3ZNG A;  5AQ7 A;  2L6J A;  3RJV A;  4J7W A;  4JHK A;  5ANR A;  5C1D A;  1O1R A;  1O1S A;  1AP7 A;  3HXB A;  4F3V A;  4JD2 G;  2LSU A;  2UY1 B;  5AAO A;  3ULY A;  3NZS A;  4CCA A;  3FH7 A;  2VTB B;  3P2B A;  4GTS A;  4CT4 A;  1H6P A;  3L82 A;  3L22 A;  4M7C A;  4UI9 K;  5LP0 A;  3ML8 A;  4AV7 A;  4WWO A;  2KZT A;  3GZ1 A;  1SVX A;  3E30 A;  4O1P A;  1FVH A;  3D9I A;  4U63 A;  2VSO E;  1YCS B;  3QDN A;  3U64 A;  3R9A B;  2XCB A;  3Q79 A;  5DIZ A;  1IQR A;  2IO3 C;  2R02 A;  3J5Q B;  3PE4 A;  5D2M C;  2B0O E;  2GRN B;  4H7Y A;  2OEV A;  3UI2 A;  3E4B A;  5B1A E;  5H7P A;  3TG5 A;  4LRZ A;  3BUA A;  1H2V C;  4HOR A;  3NOG D;  3LY8 A;  2GRL A;  1MX2 A;  2P9K G;  3TWW A;  5FJY A;  3UM2 A;  2BKG A;  4UQZ A;  4B8C B;  5AEN A;  3CK8 A;  4JB8 P;  2KAT A;  4GPM A;  4GTO A;  3L17 A;  4XIF A;  3CVU A;  3ASG A;  4MS6 A;  2AXU A;  2X6H A;  2XEV A;  4J8S A;  3SFY A;  1E90 A;  2XGS A;  2Y4T A;  3DWL G;  1WDY A;  4FHK A;  4UI9 C;  5ITZ F;  4GA1 A;  4JL0 A;  4XI0 A;  3PNT B;  4YDW A;  3ULE G;  3R9M A;  2WB2 A;  4ATZ D;  2ETC A;  3OXF A;  1OCO E;  3L9T A;  1E8Y A;  4TXQ A;  2WXK A;  1FCH A;  2H6F A;  5D0Q D;  1N52 A;  3VTX A;  3JUI A;  3VTY A;  3NOC D;  3APD A;  4IYP A;  4I2W A;  1HFA A;  5AJD A;  4F7A A;  3LJ3 A;  3FH8 A;  5AIJ A;  1N0Q A;  2Y1L E;  3GZS A;  2A4Z A;  1MQS A;  4A55 A;  3AU5 A;  5ENO D;  4L2L A;  2GRQ B;  1HX8 A;  1Q2Z A;  4W9R A;  5KNH D;  2IJG X;  3CK9 A;  4I2Z A;  5BPP A;  5FZR A;  3Q7F A;  4A3V A;  3CHS A;  1SA4 A;  3MKQ B;  1INZ A;  2P9P G;  1IXV A;  3HXE A;  4A1G A;  4RSY A;  4Y6W A;  3UT7 A;  3IXE A;  5CCM A;  2DCP A;  1KZO A;  1OWP A;  5ENS D;  4IRU A;  2VSX E;  3G2W A;  3JYS A;  2NYJ A;  3KEA A;  5ENR D;  1OCR E;  1FPP A;  4HLL A;  3HIZ A;  5EIB E;  4WNF A;  1ZU2 A;  4XZ4 A;  2YNQ A;  3FTW A;  5JJ7 A;  1K3Z D;  4OVV A;  1E96 B;  3SQV A;  3ZHE A;  2V5F A;  4L2Y A;  2XGM A;  4BER A;  1H0A A;  2VYI A;  3UT8 A;  3PEV B;  4OAV B;  5HS0 A;  2EIM E;  4UWH A;  3ASN E;  3Q5M A;  3RSE G;  2DZN A;  2GRP B;  4RVB A;  3E32 A;  3L54 A;  4KZC A;  3HYM B;  1N54 A;  3D9H A;  1JPL A;  1PC2 A;  3KSQ A;  4ATG A;  4E85 A;  3RRU A;  5CER B;  2ZIS A;  2WXL A;  3RAU A;  3SD5 A;  3FUH A;  4ZFH A;  5JHB A;  5FWQ A;  3ZYM A;  3FH5 A;  2XRZ A;  3C3O A;  4B8A A;  3PZD A;  3HRA A;  1KT0 A;  3D9M A;  4DX6 D;  4DI4 A;  4GTM A;  2FO7 A;  3S2A A;  4HOS A;  3V30 A;  2DYS E;  2WQ7 A;  4ABN A;  2MHK A;  4KXK B;  5HQ8 A;  5AQ9 A;  3EHN A;  1EDU A;  2XEH A;  4EBA G;  4BEP A;  3NZU A;  3T9K A;  1SQM A;  4UWF A;  5A6C A;  4FA6 A;  2RG8 A;  4ACK A;  4TXR A;  4CZ2 D;  3DSW A;  3KAE A;  3Q49 B;  5ANL A;  4G23 A;  4UUC A;  3CLJ A;  5EX0 A;  4RLY A;  3DSV A;  4MBG A;  3I4G A;  5EN5 D;  2IF4 A;  1TJC A;  4APO A;  3ONK A;  4HLE A;  1N4Q A;  3ASO E;  3EUV A;  4AY6 A;  2IOS A;  2FO1 E;  5E75 A;  2VJ8 A;  2LXL A;  2OEW A;  5CCL A;  2PM7 A;  2XGO A;  4QFV A;  2VGY A;  1HG5 A;  1SA5 A;  3HDX A;  3UTM A;  2EIL E;  1MX4 A;  1WY6 A;  3FTZ A;  2IY0 C;  3Q15 A;  2HR2 A;  2AJA A;  5FIO A;  4HOT A;  4N5Q A;  2RKK A;  5CRU A;  5HI7 A;  1OXJ A;  3DXM G;  4DX7 D;  1KPS B;  1G3N B;  4I1M A;  1D8D A;  1V54 E;  3SHF A;  1NA0 A;  4ILH B;  1UN9 A;  4K5A B;  5CRV A;  3PH0 C;  5AJL A;  1E8X A;  4J8E A;  3CV0 A;  1B89 A;  3EHQ A;  3CKC A;  4YDY A;  4BT8 A;  2FBN A;  3UM3 A;  2J9Q A;  5FZS A;  2Y0B G;  3UIP C;  3E37 A;  2QYU A;  3FUF A;  3FP3 A;  1HU3 A;  3W9G A;  5LOZ A;  4GMR A;  2KBX A;  2FI7 A;  5KBA A;  4MKT A;  2H6G A;  3AG1 E;  3D9O A;  2XCC A;  3CHM A;  5JJ6 A;  2WXG A;  1OT8 A;  2DBA A;  3WG7 E;  2GRR B;  2YIN A;  2AVP A;  4Q96 A;  2L9B A;  5A7D B;  3QB2 A;  3SF4 A;  2DYR E;  3TWR A;  4J8D A;  1DVP A;  1Y6I A;  3TWT A;  4ILG A;  2EIN E;  1TJF A;  3VLD A;  4EPZ A;  3C3Q A;  1NL4 A;  4I43 A;  3CHO A;  4GCN A;  1MHQ A;  3AG3 E;  3CHQ A;  4JC8 A;  3TWU A;  4J6I A;  1MZC A;  3RK6 A;  3I3N A;  4C48 B;  5J90 A;  1OWL A;  2NC9 A;  4WNG A;  5DBK A;  5BV1 A;  4KVO A;  4GB9 A;  2XS1 A;  1QNF A;  2M63 A;  1NP7 A;  3V2O A;  4J0U A;  4ME2 A;  3SGH A;  4BSZ B;  4KVM A;  1SW6 A;  4U8Y D;  3B7U X;  2IQC A;  3ESL A;  2PQN A;  3AG4 E;  3MYV A;  3B7R L;  5G04 J;  4WND A;  3TJP A;  3ASD A;  1O1T A;  2XZD G;  4EZL A;  1TNB A;  3ZYL A;  2LAI A;  3S7F A;  3DSS A;  2ZXW E;  4Z68 A;  2EIK E;  1DCE A;  2FUL A;  3B7S A;  5BV0 A;  3SY2 A;  4N39 A;  1TEZ A;  4I17 A;  1MYO A;  2WXP A;  1EYH A;  2IOL A;  3MV2 B;  1OY3 D;  4CDR A;  3PZ4 A;  1E8Z A;  4G8K A;  5FQ8 A;  3V79 K;  3I5P A;  5ARG A;  4AIF A;  2EIJ E;  2MRI A;  4BX8 A;  3SNX A;  3HG0 D;  4LNU D;  3EU5 A;  3RO2 A; 
#chains in the Genus database with same CATH homology
 3UIN C;  3UIO C;  2IO2 C;  1Z5S C;  5D2M C;  2GRQ B;  3UIP C;  2GRP B;  2IO3 C;  2IY0 C;  2GRN B;  1KPS B;  2GRR B;  2GRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...