2GRNB

Crystal structure of human rangap1-ubc9
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grnB00
2IO2C 3UIOC 5D2MC 2GRNB 2GROB 1KPSB 2GRQB 1Z5SC 2IY0C 3UIPC 3UINC 2IO3C 2GRPB 2GRRB
chains in the Genus database with same CATH superfamily
2P9UG 1N94A 5LX8A 4UI9C 2VGYA 1IHGA 2A4ZA 4EQFA 3NBNB 3HYMB 2KCKA 5ENRD 3AAAC 3QB2A 4ZHBA 1SQMA 2AXZA 4F1PA 1IYGA 2I6HA 2DZOA 3O4ZA 3BG1B 2LAHA 3DXMG 2YHEA 4YDOA 5FJYA 4GA1A 3JYSA 4GCOA 2JLBA 4HXIA 2Y1LE 4FU3A 3LJ3A 4UWLA 2X6IA 1X81A 3P1UA 2R02A 3G2TA 5KWDA 3ZFWA 3FUDA 3TWXA 3PZ1A 2IQCA 4ANWA 4JVSA 3PEUB 4GTOA 4B0ZA 4GZ6A 4TXQA 4X8QA 3CGHA 5EIBE 3UIOC 3CSFA 4GTMA 1Z6TA 3ASHA 4AY5A 5CBOA 2DCPA 4G2VA 3VLFA 3ULEG 4BESA 2ILRA 3FFLA 4AV7A 2I1KA 2VTBB 4GZ3A 4KT6B 5BV1A 3VLDA 2WXFA 4HRNA 3ESKA 3ULQA 3ABLE 3LEWA 4I1AA 4Q69A 4ILHB 4BFRA 2NXPA 5KJLA 4CT4A 1AWCB 1NZNA 4AP2A 4GMLA 5BV0A 3RRUA 4EHMA 5HQ8A 4JEHA 3PH0C 2XQ0A 1H6OA 1VDYA 3EJNA 4HS2A 4F1SA 3GZ1A 2V0PA 5KJNA 2KZTA 3KEAA 4BTAA 1H2TC 4FLHA 4HOTA 4BX8A 3TXNA 3AG1E 1BPOA 2WXQA 3LPZA 4Z68A 4UI9J 4UWHA 3D3MA 2ONDA 4F7AA 5T4YA 2VGXB 3HG0D 1K8KG 2XGMA 4KXKB 3NF1A 4NIKA 2YNQA 3HVEA 3ONKA 2L0IA 4TV3A 3EU9A 1FPPA 1FVFA 2FF4A 5HRYA 4CGVA 2KXPC 3LCAA 4PS3A 4IN3B 1HFAA 1NA3A 3U9WA 3PRZA 3FH5A 4UI9K 4LNGA 1QNFA 4OAUC 2X3MA 2VSXE 4U04A 1HE8A 2DIWA 2IY0C 4MBGA 3UPVA 3V79K 4BX9A 2UWJG 3OXGA 1UW4B 4EPZA 3UX4A 2WXHA 4JHRA 4XIFA 3UM0A 3G2WA 3KS2A 5CCMA 5CMYA 4IYPA 5D2MC 3UM2A 4DI3A 4B94A 1H2UA 4MLPA 4J8EA 3TWTA 3HXBA 1N0QA 3FDHA 1G3NB 3MEKA 1TEZA 4I43A 4OAVB 2P9KG 4AEZC 3CR3A 3HIZA 3GZ2A 2EQXA 4B89A 2LO6A 4Y6WA 4YNDA 3PZ3A 2OCCE 2ZXWE 3FY4A 3UM3A 5CECB 3HDXA 3FU0A 4C48B 2GRQB 2ETBA 3MV3B 2VYIA 3JXIA 5EYLA 1UJKA 3S7FA 2C0MA 1OCZE 2PL2A 2LXMA 4GMJA 3ASFA 4JC8A 3R9AB 2V4HC 3UTMA 1OWPA 4AOFA 4G24A 3ZGQA 4TUUA 3QKYA 4BSXA 1HH8A 3FUEA 1HG2A 3FH7A 1QQEA 4LSZE 1H2VC 1TNBA 2QYJA 5FZSA 4KVMA 2I1JA 4I17A 5G04C 5G55A 4I6EA 3LDZA 2OEVA 3MKRA 5C2YA 1IHBA 4UUCA 3JQ1A 5D0OD 4QQIA 3R7RA 3DRAA 3IHVA 2Y0BG 4GA2A 2XS8A 4IRUA 4GA0A 3QWPA 4ACKA 1Y6IA 3SF4A 1PC2A 3FU6A 3E34A 3PE4A 4JB8P 1IXVA 2R03A 1H6KA 3ZVVA 3Q79A 4UWGA 3Q5MA 3DPDA 3ONLA 4H7YA 2F37A 2ZGDA 3SD5A 3G2SA 5HKPA 4A1GA 3ZHEA 2VSOE 3UUXA 4XE0A 4BEPA 4A3TA 3ZYQA 5LOZA 3CLJA 3SZ7A 3C72A 4N3BA 2AXUA 3CK7A 4DX1A 4ANXA 4AXHA 2R17C 3GYZA 3EHMA 5CEDB 4EBAA 5G2NA 1EDUA 2WMOA 3BG0B 3AG3E 3QWVA 3LY9A 5BXOA 1BU9A 4O1PA 2J09A 4FULA 1JPLA 1TN7A 1Z3YA 5D0QD 4XI0A 2P9NG 1INZA 3FEYA 4CZ2D 4YDEA 3SI5A 3Q7FA 4JXTA 3T5VA 2GGFA 4JZYA 4DX7D 2PZIA 2FO1E 4JL0A 1N4QA 5CRVA 2P2CP 4DX5D 4I6GA 3SQVA 5G04J 2GRPB 4NQ0A 2B0OE 2L6JA 3JXJA 5AJDA 3E30A 3AU4A 5AJLA 4MRUA 2E2EA 3R7QA 4AIFA 4LG6A 2KATA 3HRAA 3QK0A 2DYRE 2PM6A 3QDNA 2PM7A 2V8SE 5BPPA 4U8VD 3ML9A 2XZTG 2CHXA 4CDMA 5B3SE 5CRUA 3EHQA 2FO7A 5ENNA 4GTQA 1QYMA 2R2LA 3VTXA 1OWNA 3MV2B 3IKOB 2UY1A 2OOEA 1BLXB 3Q49B 3RKVA 4WUYA 3CK9A 3SFZA 4I2WA 4G8KA 3DSWA 4BTBA 4N2SA 3PNLB 4LNBA 5LFAA 2VGEA 3AS8A 2QC9A 2MRIA 2KCLA 2DYSE 2OVFA 4L9PA 1Z5SC 2EIME 1IQUA 4U95D 3T5XA 2CFUA 4IULA 2AW6A 3SBTB 3B13A 3ZN3A 4FP7A 3ASNE 4M3OA 4I9EA 1ELWA 3FUKA 3RO2A 2WXPA 3BQOA 3ZYKA 1MYOA 4GYYA 2FEZA 3PZ4A 4CEMA 3FUFA 4PDXA 3ENEA 4GYWA 2CHZA 1OWLA 3C3OA 4ATZD 4DX6D 3ISMC 2CG3A 5JJTA 3OXLA 2WXGA 2GW1A 3BU8A 5JHAA 3F6QA 3FWVA 3ZNGA 3S7BA 2CFZA 3FHEA 5AAOA 4DPRA 5FT9A 1SW6A 3ZEFA 5AENA 3CHRA 1MQSA 1TNUA 4BWRA 3TXMA 3EIQC 3I3NA 3UT4A 3TWWA 3NB2A 1LD8A 3L22A 5DIZA 2ZGGA 1SA5A 2P58C 3GW4A 3UKUG 2AWIA 4J8SA 2MHKA 4ILIA 1B89A 3VTYA 2IONA 4BT8A 5FTPA 2WVIA 5CHEE 3ZW3A 2P9PG 2IOSA 2HM8A 3D9MA 5LCWC 2BTDA 4GZCA 4GPKA 2VSNA 3E33A 5B1AE 2WQ6A 1WAO1 4QFVA 1E8ZA 4GCNA 3DEPA 1QBQA 1TR4A 2QZAA 4I1OB 4CGWA 3LYAA 4J0UA 3CHQA 1YA0A 3Q7AA 2DZNA 4TXRA 3MYVA 1JCSA 5JJ7A 4XX5A 2EIJE 2WB2A 3IHYA 1N9AA 3C3QA 2X6KA 1S63A 2AXVA 4HLLA 2EINE 5ANLA 5A23A 2QYUA 1DCQA 3V31A 2WMNA 3Q9UC 2GRRB 3FTWA 1HZ4A 3JUIA 4U0UA 5M72A 5AN8A 1NA0A 2A5EA 3LY8A 4WWPA 5AARA 5KBAA 4HOQA 4TRQA 5FZRA 1H0AA 5AQAA 3FUNA 5E76A 4HI9A 3G2VA 3CHSA 2VSYA 1E8YA 2H6FA 3Q4AB 1D8DA 1UOHA 2MYOA 5T8IA 3I5PA 3N71A 4JA9A 2X6HA 1KT0A 3L08A 3FTYA 3NQPA 5KNHD 3CHOA 1OCOE 3ASDA 1HO8A 5EKQD 3LXUX 2HE0A 3E37A 1PY1A 2VQ2A 4PUCA 1DC2A 5DBKA 4Q96A 2BEDA 1UN8A 2CG2A 4KZ0A 5B1BE 4P29A 4N39A 4E85A 4ANVA 1ZBPA 2FBNA 3PDNA 4HVBA 1OT8A 1QZ2A 2XPIA 3ZPJA 3X2QE 1WG0A 3LS8A 4C9BB 3PZ2A 5FQ7A 2BF0X 4F53A 5LCWJ 2NSZA 2WXJA 3ULYA 2JABA 4B8CB 4BT9A 4EZKA 4YDWA 2Y4TA 3D9OA 3ABME 1JCRA 2Y3AA 4FHKA 3AG2E 4JD2G 3EUVA 2XEEA 1V54E 2NYJA 3Q15A 2V5QC 3FTUA 3KAEA 3CK8A 2H6GA 3FTSA 3Q47B 4L7TA 4RLYA 3TWQA 2A5UA 1DVPA 1Q2ZA 3HXEA 4DI4A 5CBNA 3C3RA 5ITZF 4I6JA 4UWKA 1E90A 4A55A 3Q78A 2R59A 3Q9NC 1OCCE 3UM1A 4LERA 1TNZA 2PQNA 4AY6A 4UQYA 4FADA 4GAAA 3B7UX 1PAQA 2L6BA 3FU5A 3ASOE 3CVWA 1LF8A 1N4SA 2XZDG 3B7TA 5A7DB 1K1BA 3RIBA 5BT1A 4BSZB 5FIOA 3FUMA 3K9IA 5A6CA 2KCVA 5T3RA 3Q75A 2I9CA 4RSYA 3LKUA 3JCKC 3SGHA 1OWMA 1S64A 4N5CA 1EF1C 3SO8A 2WXKA 1SA4A 5KJMA 4JA7A 4HNAD 3CIAA 4GZDA 3KEZA 3R9MA 3ML8A 4WAFA 4JHJA 1OCRE 1BI7B 1V55E 4PH4B 2EIKE 3MKQB 1S0PA 4U63A 1LTXA 4ME2A 1AP7A 1KZOA 1BD8A 4DRXE 3FU3A 3D9JA 4XKCA 5BW8C 3S7JA 4K5AB 1TJCA 4M7CA 1XGWA 4K0RA 2XHEA 4GMRA 2AVPA 2P9IG 3OTNA 2R5SA 2IEJA 4NRHB 4KMOA 4G26A 3ZIMA 2LSUA 2VGXA 3DSUA 1UJJA 4ACLA 5FWQA 4C0MA 3CVVA 4WWNA 5AYWD 3S2AA 4CCAA 3TL5A 3RK6A 3W9FA 3SFXA 5HS0A 4TXPA 4HBDA 1NI1A 5HI7A 4O6FA 3AS4A 2WXLA 3AU5A 3FP3A 3QARA 4RVBA 2J4BA 4BETA 3D9KA 4GTSA 2KM4A 3EHNA 1EPUA 1TNOA 4DJAA 3CVYA 3CHPA 4NACA 3CVPA 3FULA 1N11A 1N54A 1U3DA 4OYSA 4HRMB 2YINA 4FLBA 3V2XA 2WQ7A 5EIDA 4AM9A 2FULA 2XPYA 4HI8A 3ZUVB 1RW2A 3DBSA 5G05J 5EX0A 3CEQA 2LUHA 4AJWA 2XRYA 3UI2A 1N0RA 2IO3C 4WNDA 1NL4A 1N95A 3RO3A 1A17A 5D66A 4CDRA 1FT2A 5CEAA 1JWGA 1MX4A 4MS6A 3G2UA 4I9CA 4U96D 3ABKE 3T8KA 2KZTB 3UINC 4KYOB 1NFIE 1L5JA 1P5QA 2AJAA 2I2OA 4XKBA 4WNFA 4U07A 3PEVB 4AVXA 5J08A 2WXOA 5EX3A 3KD7A 4HORA 3HVEB 1N4PA 1IKND 3UQ3A 2FI7A 1MJ0A 4YDYA 4BERA 3SNXA 2J07A 4DLQA 4F6RD 4XZ4A 4RG9A 3QC1A 2HR2A 1D9SA 1H19A 1YMPA 3T9KA 3CHMA 3MJWA 2CHWA 3CSTA 3EU5A 1KT1A 2JEKA 4DK5A 2WXNA 3KSQA 4L1BA 5JJ6A 3U64A 3CVNA 4E6HA 1U2VG 2WM9A 3EHRA 4U0ZA 1UG3A 4L2LA 5AQBA 3FUIA 3C5RA 2RG8A 1XNFA 3WXXA 3L54A 4LUNU 3AG4E 5C1DA 2VJ8A 4JW1A 4DLOA 4ZFHA 2NC9A 4GYOA 3APFA 3HXCA 3TWRA 3DWLG 2DVWA 1H6PA 4APOA 3PE3A 4BY6A 4MKTA 2BKGA 2J9QA 4YVQC 3PS6A 4DUIA 4HB5A 5FZQA 3NOCD 2BKKB 3PUKA 1N4RA 5J90A 3DSVA 2J08A 5AIJA 4J8YA 3TWSA 3VLEA 4G23A 3APDA 4GTRA 1KZPA 3Q73A 4U0SA 2E0IA 2GROB 1MX6A 4UWFA 3I4RB 1OXJA 2LAIA 2X6JA 1E7UA 4KBQA 4Y6CA 3TAXA 4PS7A 1WDYA 1EYHA 4LEUA 4W9RA 3CQGB 4ABNA 2IFUA 3IXEA 2L0TB 3OAWA 4ANUA 3QNKA 1FCHA 3LY7A 3PVLA 1ZU2A 1E8WA 3J5PA 2RD0A 3B7RL 4NURA 3OXFA 5EYPF 3ZYLA 4K5BA 4CT0A 3TGOA 3NZUA 3MX3A 1YYHA 3ASGA 4ILGA 5ARGA 2HO1A 2L9BA 4CYMD 3TJPA 4GB9A 4U7EB 3NOGD 5LP0A 1HXIA 3HHMA 5ENQD 3V30A 3BEEA 3ZHEB 1TYQG 3PREA 3RSEG 1TN6A 4I2ZA 2RKKA 4O60A 4CRWA 1DNPA 3ZU7B 3PNTB 3IBEA 2IO2C 4OVUA 3IV0A 3HXFA 2F8XK 3I4GA 5FQ6A 2C2LA 5ENTD 3UIPC 4B8AA 3APCA 5JHBA 1MHQA 3ZKJA 5ARFA 4FA6A 1NP7A 3O48A 4C0EA 4WNGA 2H6IA 1MZCA 1WM5A 4O1OA 3V2OA 1HS6A 2Q7FA 3TWVA 4U8YD 3ZRHA 3LVQE 3HXDA 4N3AA 3RU0A 2XCCA 1OWOA 2LNIA 3DSXA 3L17A 1E7VA 4HQDA 5H7PA 4APFA 1FT1A 3L82A 4RG6A 1KPSB 3JUEA 5IY5E 2OEWA 3ESLA 3MCXA 5ANRA 4FJZA 3JQ0A 2IJGX 1K1AA 2LXLA 3E32A 2WXMA 4WWOA 3TG5A 1LD7A 2WQHA 4F3VA 4GU5A 3UKRG 5BUZA 2XS1A 4A1SA 2H6HA 3ZXPA 3UT8A 3FEXA 5EILA 4J8FA 2V5FA 3AS5A 3AJIA 4Q94A 2XEHA 3QJZA 4GTVA 2PNNA 3U3WA 5CCLA 3DEOA 1TNYA 1TN8A 3FTXA 2J49A 2UY1B 3B7SA 3SY2A 5KCMA 4A3VA 5FQ4A 2X6FA 1RZ4A 1DCEA 1E96B 4L2YA 3BUAA 2XENA 1JCQA 3WG7E 2IF4A 1MX2A 5ENPD 3B95A 4K03A 5KJKA 2RFAA 3CVQA 5G05C 4HOUA 2X38A 2XGOA 4G11A 2IOLA 3W9GA 2VTBA 3PUJA 3SFYA 3D9LA 2ETCA 5ENOD 3KSLA 3RJVA 2LSVA 4EECA 2XCBA 4K5CA 3CVXA 5FINA 4FJYA 1GW6A 3J5QB 5CMWA 1YCSB 4HRLA 4TUMA 4GTTA 3LJNA 3TWUA 1O1RA 4L23A 2WPVA 4G25A 3L16A 1W3BA 3DSSA 4R7LA 3CKCA 3L9TA 3CQCB 4J6IA 3NAWA 3SHFA 2XRZA 5JMND 5KNGA 2R05A 4DX2A 2GRLA 4HLEA 1FVHA 3QAQA 4YVOA 2KBXA 3RAUA 4G1TA 3UT7A 3D9HA 2M63A 4N3CA 2B6CA 4KVOA 3S7DA 3GZSA 4V3IA 2XGSA 3FUJA 1O1SA 4CDNA 2GRMA 5EN5D 3FH8A 3L6AA 1HF8A 2ZU6B 1O5MA 1E8XA 2C0LA 1U3CA 2HYZA 2WXRA 4UQXA 4A63B 5AQ7A 1OY3D 3U4TA 2DBAA 1BI8B 3CKBA 2F0YA 1N52A 2XEVA 3NZSA 5BXUA 1SVXA 3MA5A 3UMVA 3SBSA 3E4BA 4WNEA 2Y69E 3TG4A 4EZLA 4UQZA 1Y8MA 3QOUA 1D8EA 1WY6A 1SZAA 4J8DA 2EILE 2P9LG 2PQRA 4GPMA 3L13A 4GTPA 4XEIG 1SZ9A 3U66A 4I1MA 3D9NA 1K3ZD 5CERB 2OVBA 1UN9A 2XPZA 3P2BA 2BUGA 4D10C 3CVUA 2QY7A 3ZYMA 4LNUD 5EDSA 3RRMB 4LRZA 3URZA 1KLXA 4FC8A 3EDTB 4LCTA 1ZB1A 3D9IA 4JEUA 5JA4D 2V4LA 3FTZA 2KC7A 4G8LA 2OV8A 4N2QA 2J4DA 4GZ5A 5ENSD 4RQIA 5FQ8A 1HG5A 3LVRE 4URKA 4XI9A 2F8YA 2IU1A 4ATGA 3ZXSA 1S70B 4EZJA 1IQRA 4EBAG 2GRNB 2J8SD 1OUVA 4JHKA 5E75A 1ELRA 4FHJA 1JWFA 4U8HA 4PS8A 3UXGA 2ZIRA 2Y4UA 2ETAA 3C98A 2DWZA 3CV0A 3MGBA 5BNWA 2YHCA 3QWWA 1O1TA 4HFGA 3IEGA 4HOSA 4B93B 4KZCA 4OVVA 3CVLA 1HX8A 3D9PA 3DPYA 2QFCA 4JPSA 3DSTA 2RFMA 1HU3A 2MOWA 4H7XA 3DXKG 3T8MA 5AQ9A 2WXIA 3EIJA 3RRNB 4N5QA 2P9SG 3B7BA 1ELKA 3MZLB 1X5BA 2ZISA 3FUHA 1TJFA 1Z3XA 3MKQA 3PZDA 1A5EA 2YQ8A 3FTVA 1JUQA 4J7WA
chains in the Genus database with same CATH topology
2IO2C 3UIOC 5D2MC 2GRNB 2GROB 1KPSB 2GRQB 1Z5SC 2IY0C 3UIPC 3UINC 2IO3C 2GRPB 2GRRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO2 C;  3UIO C;  5D2M C;  2GRN B;  2GRO B;  1KPS B;  2GRQ B;  1Z5S C;  2IY0 C;  3UIP C;  3UIN C;  2IO3 C;  2GRP B;  2GRR B; 
#chains in the Genus database with same CATH topology
 2P9U G;  1N94 A;  5LX8 A;  4UI9 C;  2VGY A;  1IHG A;  2A4Z A;  4EQF A;  3NBN B;  3HYM B;  2KCK A;  5ENR D;  3AAA C;  3QB2 A;  4ZHB A;  1SQM A;  2AXZ A;  4F1P A;  1IYG A;  2I6H A;  2DZO A;  3O4Z A;  3BG1 B;  2LAH A;  3DXM G;  2YHE A;  4YDO A;  5FJY A;  4GA1 A;  3JYS A;  4GCO A;  2JLB A;  4HXI A;  2Y1L E;  4FU3 A;  3LJ3 A;  4UWL A;  2X6I A;  1X81 A;  3P1U A;  2R02 A;  3G2T A;  5KWD A;  3ZFW A;  3FUD A;  3TWX A;  3PZ1 A;  2IQC A;  4ANW A;  4JVS A;  3PEU B;  4GTO A;  4B0Z A;  4GZ6 A;  4TXQ A;  4X8Q A;  3CGH A;  5EIB E;  3UIO C;  3CSF A;  4GTM A;  1Z6T A;  3ASH A;  4AY5 A;  5CBO A;  2DCP A;  4G2V A;  3VLF A;  3ULE G;  4BES A;  2ILR A;  3FFL A;  4AV7 A;  2I1K A;  2VTB B;  4GZ3 A;  4KT6 B;  5BV1 A;  3VLD A;  2WXF A;  4HRN A;  3ESK A;  3ULQ A;  3ABL E;  3LEW A;  4I1A A;  4Q69 A;  4ILH B;  4BFR A;  2NXP A;  5KJL A;  4CT4 A;  1AWC B;  1NZN A;  4AP2 A;  4GML A;  5BV0 A;  3RRU A;  4EHM A;  5HQ8 A;  4JEH A;  3PH0 C;  2XQ0 A;  1H6O A;  1VDY A;  3EJN A;  4HS2 A;  4F1S A;  3GZ1 A;  2V0P A;  5KJN A;  2KZT A;  3KEA A;  4BTA A;  1H2T C;  4FLH A;  4HOT A;  4BX8 A;  3TXN A;  3AG1 E;  1BPO A;  2WXQ A;  3LPZ A;  4Z68 A;  4UI9 J;  4UWH A;  3D3M A;  2OND A;  4F7A A;  5T4Y A;  2VGX B;  3HG0 D;  1K8K G;  2XGM A;  4KXK B;  3NF1 A;  4NIK A;  2YNQ A;  3HVE A;  3ONK A;  2L0I A;  4TV3 A;  3EU9 A;  1FPP A;  1FVF A;  2FF4 A;  5HRY A;  4CGV A;  2KXP C;  3LCA A;  4PS3 A;  4IN3 B;  1HFA A;  1NA3 A;  3U9W A;  3PRZ A;  3FH5 A;  4UI9 K;  4LNG A;  1QNF A;  4OAU C;  2X3M A;  2VSX E;  4U04 A;  1HE8 A;  2DIW A;  2IY0 C;  4MBG A;  3UPV A;  3V79 K;  4BX9 A;  2UWJ G;  3OXG A;  1UW4 B;  4EPZ A;  3UX4 A;  2WXH A;  4JHR A;  4XIF A;  3UM0 A;  3G2W A;  3KS2 A;  5CCM A;  5CMY A;  4IYP A;  5D2M C;  3UM2 A;  4DI3 A;  4B94 A;  1H2U A;  4MLP A;  4J8E A;  3TWT A;  3HXB A;  1N0Q A;  3FDH A;  1G3N B;  3MEK A;  1TEZ A;  4I43 A;  4OAV B;  2P9K G;  4AEZ C;  3CR3 A;  3HIZ A;  3GZ2 A;  2EQX A;  4B89 A;  2LO6 A;  4Y6W A;  4YND A;  3PZ3 A;  2OCC E;  2ZXW E;  3FY4 A;  3UM3 A;  5CEC B;  3HDX A;  3FU0 A;  4C48 B;  2GRQ B;  2ETB A;  3MV3 B;  2VYI A;  3JXI A;  5EYL A;  1UJK A;  3S7F A;  2C0M A;  1OCZ E;  2PL2 A;  2LXM A;  4GMJ A;  3ASF A;  4JC8 A;  3R9A B;  2V4H C;  3UTM A;  1OWP A;  4AOF A;  4G24 A;  3ZGQ A;  4TUU A;  3QKY A;  4BSX A;  1HH8 A;  3FUE A;  1HG2 A;  3FH7 A;  1QQE A;  4LSZ E;  1H2V C;  1TNB A;  2QYJ A;  5FZS A;  4KVM A;  2I1J A;  4I17 A;  5G04 C;  5G55 A;  4I6E A;  3LDZ A;  2OEV A;  3MKR A;  5C2Y A;  1IHB A;  4UUC A;  3JQ1 A;  5D0O D;  4QQI A;  3R7R A;  3DRA A;  3IHV A;  2Y0B G;  4GA2 A;  2XS8 A;  4IRU A;  4GA0 A;  3QWP A;  4ACK A;  1Y6I A;  3SF4 A;  1PC2 A;  3FU6 A;  3E34 A;  3PE4 A;  4JB8 P;  1IXV A;  2R03 A;  1H6K A;  3ZVV A;  3Q79 A;  4UWG A;  3Q5M A;  3DPD A;  3ONL A;  4H7Y A;  2F37 A;  2ZGD A;  3SD5 A;  3G2S A;  5HKP A;  4A1G A;  3ZHE A;  2VSO E;  3UUX A;  4XE0 A;  4BEP A;  4A3T A;  3ZYQ A;  5LOZ A;  3CLJ A;  3SZ7 A;  3C72 A;  4N3B A;  2AXU A;  3CK7 A;  4DX1 A;  4ANX A;  4AXH A;  2R17 C;  3GYZ A;  3EHM A;  5CED B;  4EBA A;  5G2N A;  1EDU A;  2WMO A;  3BG0 B;  3AG3 E;  3QWV A;  3LY9 A;  5BXO A;  1BU9 A;  4O1P A;  2J09 A;  4FUL A;  1JPL A;  1TN7 A;  1Z3Y A;  5D0Q D;  4XI0 A;  2P9N G;  1INZ A;  3FEY A;  4CZ2 D;  4YDE A;  3SI5 A;  3Q7F A;  4JXT A;  3T5V A;  2GGF A;  4JZY A;  4DX7 D;  2PZI A;  2FO1 E;  4JL0 A;  1N4Q A;  5CRV A;  2P2C P;  4DX5 D;  4I6G A;  3SQV A;  5G04 J;  2GRP B;  4NQ0 A;  2B0O E;  2L6J A;  3JXJ A;  5AJD A;  3E30 A;  3AU4 A;  5AJL A;  4MRU A;  2E2E A;  3R7Q A;  4AIF A;  4LG6 A;  2KAT A;  3HRA A;  3QK0 A;  2DYR E;  2PM6 A;  3QDN A;  2PM7 A;  2V8S E;  5BPP A;  4U8V D;  3ML9 A;  2XZT G;  2CHX A;  4CDM A;  5B3S E;  5CRU A;  3EHQ A;  2FO7 A;  5ENN A;  4GTQ A;  1QYM A;  2R2L A;  3VTX A;  1OWN A;  3MV2 B;  3IKO B;  2UY1 A;  2OOE A;  1BLX B;  3Q49 B;  3RKV A;  4WUY A;  3CK9 A;  3SFZ A;  4I2W A;  4G8K A;  3DSW A;  4BTB A;  4N2S A;  3PNL B;  4LNB A;  5LFA A;  2VGE A;  3AS8 A;  2QC9 A;  2MRI A;  2KCL A;  2DYS E;  2OVF A;  4L9P A;  1Z5S C;  2EIM E;  1IQU A;  4U95 D;  3T5X A;  2CFU A;  4IUL A;  2AW6 A;  3SBT B;  3B13 A;  3ZN3 A;  4FP7 A;  3ASN E;  4M3O A;  4I9E A;  1ELW A;  3FUK A;  3RO2 A;  2WXP A;  3BQO A;  3ZYK A;  1MYO A;  4GYY A;  2FEZ A;  3PZ4 A;  4CEM A;  3FUF A;  4PDX A;  3ENE A;  4GYW A;  2CHZ A;  1OWL A;  3C3O A;  4ATZ D;  4DX6 D;  3ISM C;  2CG3 A;  5JJT A;  3OXL A;  2WXG A;  2GW1 A;  3BU8 A;  5JHA A;  3F6Q A;  3FWV A;  3ZNG A;  3S7B A;  2CFZ A;  3FHE A;  5AAO A;  4DPR A;  5FT9 A;  1SW6 A;  3ZEF A;  5AEN A;  3CHR A;  1MQS A;  1TNU A;  4BWR A;  3TXM A;  3EIQ C;  3I3N A;  3UT4 A;  3TWW A;  3NB2 A;  1LD8 A;  3L22 A;  5DIZ A;  2ZGG A;  1SA5 A;  2P58 C;  3GW4 A;  3UKU G;  2AWI A;  4J8S A;  2MHK A;  4ILI A;  1B89 A;  3VTY A;  2ION A;  4BT8 A;  5FTP A;  2WVI A;  5CHE E;  3ZW3 A;  2P9P G;  2IOS A;  2HM8 A;  3D9M A;  5LCW C;  2BTD A;  4GZC A;  4GPK A;  2VSN A;  3E33 A;  5B1A E;  2WQ6 A;  1WAO 1;  4QFV A;  1E8Z A;  4GCN A;  3DEP A;  1QBQ A;  1TR4 A;  2QZA A;  4I1O B;  4CGW A;  3LYA A;  4J0U A;  3CHQ A;  1YA0 A;  3Q7A A;  2DZN A;  4TXR A;  3MYV A;  1JCS A;  5JJ7 A;  4XX5 A;  2EIJ E;  2WB2 A;  3IHY A;  1N9A A;  3C3Q A;  2X6K A;  1S63 A;  2AXV A;  4HLL A;  2EIN E;  5ANL A;  5A23 A;  2QYU A;  1DCQ A;  3V31 A;  2WMN A;  3Q9U C;  2GRR B;  3FTW A;  1HZ4 A;  3JUI A;  4U0U A;  5M72 A;  5AN8 A;  1NA0 A;  2A5E A;  3LY8 A;  4WWP A;  5AAR A;  5KBA A;  4HOQ A;  4TRQ A;  5FZR A;  1H0A A;  5AQA A;  3FUN A;  5E76 A;  4HI9 A;  3G2V A;  3CHS A;  2VSY A;  1E8Y A;  2H6F A;  3Q4A B;  1D8D A;  1UOH A;  2MYO A;  5T8I A;  3I5P A;  3N71 A;  4JA9 A;  2X6H A;  1KT0 A;  3L08 A;  3FTY A;  3NQP A;  5KNH D;  3CHO A;  1OCO E;  3ASD A;  1HO8 A;  5EKQ D;  3LXU X;  2HE0 A;  3E37 A;  1PY1 A;  2VQ2 A;  4PUC A;  1DC2 A;  5DBK A;  4Q96 A;  2BED A;  1UN8 A;  2CG2 A;  4KZ0 A;  5B1B E;  4P29 A;  4N39 A;  4E85 A;  4ANV A;  1ZBP A;  2FBN A;  3PDN A;  4HVB A;  1OT8 A;  1QZ2 A;  2XPI A;  3ZPJ A;  3X2Q E;  1WG0 A;  3LS8 A;  4C9B B;  3PZ2 A;  5FQ7 A;  2BF0 X;  4F53 A;  5LCW J;  2NSZ A;  2WXJ A;  3ULY A;  2JAB A;  4B8C B;  4BT9 A;  4EZK A;  4YDW A;  2Y4T A;  3D9O A;  3ABM E;  1JCR A;  2Y3A A;  4FHK A;  3AG2 E;  4JD2 G;  3EUV A;  2XEE A;  1V54 E;  2NYJ A;  3Q15 A;  2V5Q C;  3FTU A;  3KAE A;  3CK8 A;  2H6G A;  3FTS A;  3Q47 B;  4L7T A;  4RLY A;  3TWQ A;  2A5U A;  1DVP A;  1Q2Z A;  3HXE A;  4DI4 A;  5CBN A;  3C3R A;  5ITZ F;  4I6J A;  4UWK A;  1E90 A;  4A55 A;  3Q78 A;  2R59 A;  3Q9N C;  1OCC E;  3UM1 A;  4LER A;  1TNZ A;  2PQN A;  4AY6 A;  4UQY A;  4FAD A;  4GAA A;  3B7U X;  1PAQ A;  2L6B A;  3FU5 A;  3ASO E;  3CVW A;  1LF8 A;  1N4S A;  2XZD G;  3B7T A;  5A7D B;  1K1B A;  3RIB A;  5BT1 A;  4BSZ B;  5FIO A;  3FUM A;  3K9I A;  5A6C A;  2KCV A;  5T3R A;  3Q75 A;  2I9C A;  4RSY A;  3LKU A;  3JCK C;  3SGH A;  1OWM A;  1S64 A;  4N5C A;  1EF1 C;  3SO8 A;  2WXK A;  1SA4 A;  5KJM A;  4JA7 A;  4HNA D;  3CIA A;  4GZD A;  3KEZ A;  3R9M A;  3ML8 A;  4WAF A;  4JHJ A;  1OCR E;  1BI7 B;  1V55 E;  4PH4 B;  2EIK E;  3MKQ B;  1S0P A;  4U63 A;  1LTX A;  4ME2 A;  1AP7 A;  1KZO A;  1BD8 A;  4DRX E;  3FU3 A;  3D9J A;  4XKC A;  5BW8 C;  3S7J A;  4K5A B;  1TJC A;  4M7C A;  1XGW A;  4K0R A;  2XHE A;  4GMR A;  2AVP A;  2P9I G;  3OTN A;  2R5S A;  2IEJ A;  4NRH B;  4KMO A;  4G26 A;  3ZIM A;  2LSU A;  2VGX A;  3DSU A;  1UJJ A;  4ACL A;  5FWQ A;  4C0M A;  3CVV A;  4WWN A;  5AYW D;  3S2A A;  4CCA A;  3TL5 A;  3RK6 A;  3W9F A;  3SFX A;  5HS0 A;  4TXP A;  4HBD A;  1NI1 A;  5HI7 A;  4O6F A;  3AS4 A;  2WXL A;  3AU5 A;  3FP3 A;  3QAR A;  4RVB A;  2J4B A;  4BET A;  3D9K A;  4GTS A;  2KM4 A;  3EHN A;  1EPU A;  1TNO A;  4DJA A;  3CVY A;  3CHP A;  4NAC A;  3CVP A;  3FUL A;  1N11 A;  1N54 A;  1U3D A;  4OYS A;  4HRM B;  2YIN A;  4FLB A;  3V2X A;  2WQ7 A;  5EID A;  4AM9 A;  2FUL A;  2XPY A;  4HI8 A;  3ZUV B;  1RW2 A;  3DBS A;  5G05 J;  5EX0 A;  3CEQ A;  2LUH A;  4AJW A;  2XRY A;  3UI2 A;  1N0R A;  2IO3 C;  4WND A;  1NL4 A;  1N95 A;  3RO3 A;  1A17 A;  5D66 A;  4CDR A;  1FT2 A;  5CEA A;  1JWG A;  1MX4 A;  4MS6 A;  3G2U A;  4I9C A;  4U96 D;  3ABK E;  3T8K A;  2KZT B;  3UIN C;  4KYO B;  1NFI E;  1L5J A;  1P5Q A;  2AJA A;  2I2O A;  4XKB A;  4WNF A;  4U07 A;  3PEV B;  4AVX A;  5J08 A;  2WXO A;  5EX3 A;  3KD7 A;  4HOR A;  3HVE B;  1N4P A;  1IKN D;  3UQ3 A;  2FI7 A;  1MJ0 A;  4YDY A;  4BER A;  3SNX A;  2J07 A;  4DLQ A;  4F6R D;  4XZ4 A;  4RG9 A;  3QC1 A;  2HR2 A;  1D9S A;  1H19 A;  1YMP A;  3T9K A;  3CHM A;  3MJW A;  2CHW A;  3CST A;  3EU5 A;  1KT1 A;  2JEK A;  4DK5 A;  2WXN A;  3KSQ A;  4L1B A;  5JJ6 A;  3U64 A;  3CVN A;  4E6H A;  1U2V G;  2WM9 A;  3EHR A;  4U0Z A;  1UG3 A;  4L2L A;  5AQB A;  3FUI A;  3C5R A;  2RG8 A;  1XNF A;  3WXX A;  3L54 A;  4LUN U;  3AG4 E;  5C1D A;  2VJ8 A;  4JW1 A;  4DLO A;  4ZFH A;  2NC9 A;  4GYO A;  3APF A;  3HXC A;  3TWR A;  3DWL G;  2DVW A;  1H6P A;  4APO A;  3PE3 A;  4BY6 A;  4MKT A;  2BKG A;  2J9Q A;  4YVQ C;  3PS6 A;  4DUI A;  4HB5 A;  5FZQ A;  3NOC D;  2BKK B;  3PUK A;  1N4R A;  5J90 A;  3DSV A;  2J08 A;  5AIJ A;  4J8Y A;  3TWS A;  3VLE A;  4G23 A;  3APD A;  4GTR A;  1KZP A;  3Q73 A;  4U0S A;  2E0I A;  2GRO B;  1MX6 A;  4UWF A;  3I4R B;  1OXJ A;  2LAI A;  2X6J A;  1E7U A;  4KBQ A;  4Y6C A;  3TAX A;  4PS7 A;  1WDY A;  1EYH A;  4LEU A;  4W9R A;  3CQG B;  4ABN A;  2IFU A;  3IXE A;  2L0T B;  3OAW A;  4ANU A;  3QNK A;  1FCH A;  3LY7 A;  3PVL A;  1ZU2 A;  1E8W A;  3J5P A;  2RD0 A;  3B7R L;  4NUR A;  3OXF A;  5EYP F;  3ZYL A;  4K5B A;  4CT0 A;  3TGO A;  3NZU A;  3MX3 A;  1YYH A;  3ASG A;  4ILG A;  5ARG A;  2HO1 A;  2L9B A;  4CYM D;  3TJP A;  4GB9 A;  4U7E B;  3NOG D;  5LP0 A;  1HXI A;  3HHM A;  5ENQ D;  3V30 A;  3BEE A;  3ZHE B;  1TYQ G;  3PRE A;  3RSE G;  1TN6 A;  4I2Z A;  2RKK A;  4O60 A;  4CRW A;  1DNP A;  3ZU7 B;  3PNT B;  3IBE A;  2IO2 C;  4OVU A;  3IV0 A;  3HXF A;  2F8X K;  3I4G A;  5FQ6 A;  2C2L A;  5ENT D;  3UIP C;  4B8A A;  3APC A;  5JHB A;  1MHQ A;  3ZKJ A;  5ARF A;  4FA6 A;  1NP7 A;  3O48 A;  4C0E A;  4WNG A;  2H6I A;  1MZC A;  1WM5 A;  4O1O A;  3V2O A;  1HS6 A;  2Q7F A;  3TWV A;  4U8Y D;  3ZRH A;  3LVQ E;  3HXD A;  4N3A A;  3RU0 A;  2XCC A;  1OWO A;  2LNI A;  3DSX A;  3L17 A;  1E7V A;  4HQD A;  5H7P A;  4APF A;  1FT1 A;  3L82 A;  4RG6 A;  1KPS B;  3JUE A;  5IY5 E;  2OEW A;  3ESL A;  3MCX A;  5ANR A;  4FJZ A;  3JQ0 A;  2IJG X;  1K1A A;  2LXL A;  3E32 A;  2WXM A;  4WWO A;  3TG5 A;  1LD7 A;  2WQH A;  4F3V A;  4GU5 A;  3UKR G;  5BUZ A;  2XS1 A;  4A1S A;  2H6H A;  3ZXP A;  3UT8 A;  3FEX A;  5EIL A;  4J8F A;  2V5F A;  3AS5 A;  3AJI A;  4Q94 A;  2XEH A;  3QJZ A;  4GTV A;  2PNN A;  3U3W A;  5CCL A;  3DEO A;  1TNY A;  1TN8 A;  3FTX A;  2J49 A;  2UY1 B;  3B7S A;  3SY2 A;  5KCM A;  4A3V A;  5FQ4 A;  2X6F A;  1RZ4 A;  1DCE A;  1E96 B;  4L2Y A;  3BUA A;  2XEN A;  1JCQ A;  3WG7 E;  2IF4 A;  1MX2 A;  5ENP D;  3B95 A;  4K03 A;  5KJK A;  2RFA A;  3CVQ A;  5G05 C;  4HOU A;  2X38 A;  2XGO A;  4G11 A;  2IOL A;  3W9G A;  2VTB A;  3PUJ A;  3SFY A;  3D9L A;  2ETC A;  5ENO D;  3KSL A;  3RJV A;  2LSV A;  4EEC A;  2XCB A;  4K5C A;  3CVX A;  5FIN A;  4FJY A;  1GW6 A;  3J5Q B;  5CMW A;  1YCS B;  4HRL A;  4TUM A;  4GTT A;  3LJN A;  3TWU A;  1O1R A;  4L23 A;  2WPV A;  4G25 A;  3L16 A;  1W3B A;  3DSS A;  4R7L A;  3CKC A;  3L9T A;  3CQC B;  4J6I A;  3NAW A;  3SHF A;  2XRZ A;  5JMN D;  5KNG A;  2R05 A;  4DX2 A;  2GRL A;  4HLE A;  1FVH A;  3QAQ A;  4YVO A;  2KBX A;  3RAU A;  4G1T A;  3UT7 A;  3D9H A;  2M63 A;  4N3C A;  2B6C A;  4KVO A;  3S7D A;  3GZS A;  4V3I A;  2XGS A;  3FUJ A;  1O1S A;  4CDN A;  2GRM A;  5EN5 D;  3FH8 A;  3L6A A;  1HF8 A;  2ZU6 B;  1O5M A;  1E8X A;  2C0L A;  1U3C A;  2HYZ A;  2WXR A;  4UQX A;  4A63 B;  5AQ7 A;  1OY3 D;  3U4T A;  2DBA A;  1BI8 B;  3CKB A;  2F0Y A;  1N52 A;  2XEV A;  3NZS A;  5BXU A;  1SVX A;  3MA5 A;  3UMV A;  3SBS A;  3E4B A;  4WNE A;  2Y69 E;  3TG4 A;  4EZL A;  4UQZ A;  1Y8M A;  3QOU A;  1D8E A;  1WY6 A;  1SZA A;  4J8D A;  2EIL E;  2P9L G;  2PQR A;  4GPM A;  3L13 A;  4GTP A;  4XEI G;  1SZ9 A;  3U66 A;  4I1M A;  3D9N A;  1K3Z D;  5CER B;  2OVB A;  1UN9 A;  2XPZ A;  3P2B A;  2BUG A;  4D10 C;  3CVU A;  2QY7 A;  3ZYM A;  4LNU D;  5EDS A;  3RRM B;  4LRZ A;  3URZ A;  1KLX A;  4FC8 A;  3EDT B;  4LCT A;  1ZB1 A;  3D9I A;  4JEU A;  5JA4 D;  2V4L A;  3FTZ A;  2KC7 A;  4G8L A;  2OV8 A;  4N2Q A;  2J4D A;  4GZ5 A;  5ENS D;  4RQI A;  5FQ8 A;  1HG5 A;  3LVR E;  4URK A;  4XI9 A;  2F8Y A;  2IU1 A;  4ATG A;  3ZXS A;  1S70 B;  4EZJ A;  1IQR A;  4EBA G;  2GRN B;  2J8S D;  1OUV A;  4JHK A;  5E75 A;  1ELR A;  4FHJ A;  1JWF A;  4U8H A;  4PS8 A;  3UXG A;  2ZIR A;  2Y4U A;  2ETA A;  3C98 A;  2DWZ A;  3CV0 A;  3MGB A;  5BNW A;  2YHC A;  3QWW A;  1O1T A;  4HFG A;  3IEG A;  4HOS A;  4B93 B;  4KZC A;  4OVV A;  3CVL A;  1HX8 A;  3D9P A;  3DPY A;  2QFC A;  4JPS A;  3DST A;  2RFM A;  1HU3 A;  2MOW A;  4H7X A;  3DXK G;  3T8M A;  5AQ9 A;  2WXI A;  3EIJ A;  3RRN B;  4N5Q A;  2P9S G;  3B7B A;  1ELK A;  3MZL B;  1X5B A;  2ZIS A;  3FUH A;  1TJF A;  1Z3X A;  3MKQ A;  3PZD A;  1A5E A;  2YQ8 A;  3FTV A;  1JUQ A;  4J7W A; 
#chains in the Genus database with same CATH homology
 2IO2 C;  3UIO C;  5D2M C;  2GRN B;  2GRO B;  1KPS B;  2GRQ B;  1Z5S C;  2IY0 C;  3UIP C;  3UIN C;  2IO3 C;  2GRP B;  2GRR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...