5M72A

Structure of the human srp68-72 protein-binding domain complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
150
structure length
150
Chain Sequence
SVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle subunit SRP72
publication title Structures of human SRP72 complexes provide insights into SRP RNA remodeling and ribosome interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17004 SRP_TPR_like Putative TPR-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5m72A00
1E96B 3PDNA 3GYZA 5DBKA 1A17A 4GPKA 4JA7A 2ONDA 3AS8A 3RJVA 1NA3A 3HYMB 3ZGQA 1WAO1 4GCNA 3TAXA 2KATA 3LCAA 3O48A 3E4BA 3TG4A 2Y4UA 2Q7FA 1QQEA 2C2LA 4HOUA 4U07A 1OUVA 4BTAA 3RO3A 4XIFA 4WNEA 4UQZA 3QKYA 4WUYA 3CEQA 4XI0A 3FP3A 3ASGA 4AY5A 4GA0A 4CDRA 2UWJG 3PE3A 2OOEA 1B89A 3UPVA 2KCLA 4XI9A 4JL0A 4GA1A 1ELWA 1P5QA 4G1TA 4JHRA 4HORA 2XEVA 4WNDA 2XPIA 5A7DB 3OXGA 2FF4A 2QFCA 5EX0A 2JLBA 4BT9A 5DIZA 3LY9A 1W3BA 3VTYA 3PE4A 3LKUA 3RU0A 5JJTA 3MEKA 4BT8A 3GW4A 2C0MA 4UQYA 5BT1A 4GYYA 3LYAA 5G05J 3CK9A 2PQNA 4GA2A 5G05C 2XGOA 3QDNA 5KJMA 4U0ZA 4YVQC 3UUXA 2WQHA 4Y6WA 5CCLA 5LCWJ 4I2ZA 4BWRA 2IFUA 5LCWC 3KD7A 4N2QA 1ZBPA 5JJ7A 3URZA 4WNFA 5D0QD 3RIBA 4N2SA 2BUGA 4YNDA 3CKCA 3ZPJA 1HZ4A 2J9QA 4I9CA 5KJLA 3CVQA 5ARGA 3KAEA 4EQFA 1HH8A 3CVNA 3CKBA 3GZ1A 3EDTB 3GZ2A 4N3CA 2FEZA 4JA9A 3IEGA 2UY1B 2PL2A 5CCMA 2NC9A 3KS2A 4F3VA 3LY7A 4HOTA 2WPVA 5EKQD 3OXFA 4UI9J 2VSNA 2UY1A 4B94A 2KC7A 4UI9C 3NF1A 1HXIA 3FWVA 3Q4AB 3K9IA 5KJKA 5FT9A 3WXXA 3QWPA 2XCCA 4UQXA 4GZ6A 3CVLA 5FTPA 5KJNA 1KLXA 4KYOB 4G25A 1YA0A 5A6CA 2R5SA 2LNIA 4GCOA 3ESKA 3U4TA 4N3BA 4WNGA 3Q49B 4H7XA 3ZHEB 4J8FA 5FJYA 2C0LA 3BEEA 3MV3B 1IYGA 3RO2A 2XGMA 3ZHEA 2VYIA 2VGXA 2V5FA 1TJCA 4KBQA 3JYSA 4KXKB 4APOA 3UQ3A 4I1AA 2XCBA 3CV0A 1PC2A 2DBAA 3MV2B 4YVOA 3ASHA 1NA0A 5JJ6A 3CK8A 5EX3A 4U0UA 4I9EA 4HOQA 5FZRA 5FZQA 2MHKA 3MKRA 2PZIA 2FO7A 1KT1A 4Y6CA 3Q5MA 4N3AA 4GYOA 5AYWD 4U0SA 1KT0A 5BNWA 2L6JA 2FBNA 2I6HA 4W9RA 3S7FA 3Q47B 3TGOA 4ABNA 4UI9K 4LEUA 2FI7A 3SZ7A 5HQ8A 2E2EA 3OXLA 2AVPA 3MA5A 4N5CA 1ZU2A 3QWVA 4CGWA 3S7DA 1IHGA 2LSUA 4GZ5A 4NQ0A 4GZ3A 2XGSA 1NZNA 3QWWA 4G26A 4G23A 5ARFA 3S7BA 2YHCA 3ZN3A 3CK7A 2HR2A 3CVPA 4J8EA 2Y4TA 1XNFA 4ME2A 3ASFA 4G24A 4GYWA 2LSVA 3R9AB 5D0OD 4A1SA 4NRHB 3TG5A 4J8DA 2VGXB 3S7JA 3ASDA 1Y8MA 2VQ2A 2VSYA 3AS4A 3LPZA 4U04A 4HOSA 1FCHA 3AS5A 1ELRA 2IF4A 2HYZA 2VGYA 3VTXA 5HI7A 4RG6A 4AM9A 1WM5A 2YQ8A 3ZFWA 2P58C 2KCKA 5M72A 5CHEE 3U3WA 5FZSA 4AIFA 5C1DA 3LY8A 2PQRA 4G2VA 4O6FA 4H7YA 3N71A 4I17A 2GW1A 3Q15A 4J0UA 3RKVA 4IN3B 3SF4A 3ULQA 3QOUA 4N39A 4RG9A 4AY6A 4I2WA 5G04J 2HO1A 2KCVA 5G04C 1QZ2A 3FFLA 5BW8C 4CGVA 4BTBA
chains in the Genus database with same CATH superfamily
2A5EA 4RVBA 1JWGA 5AQAA 3GYZA 3SFXA 3PREA 4UWHA 4JA7A 3C5RA 5ANRA 2L0IA 1S0PA 3ESLA 4DLOA 1FT1A 1FVFA 1NA3A 4Q69A 4GCNA 3O48A 5BV1A 3RK6A 2XEHA 4APFA 5JMND 3VLEA 2P9KG 2C2LA 3MGBA 3AU5A 4DI3A 4HOUA 4U07A 4QQIA 2F8XK 3G2VA 3C3RA 4WNEA 4WUYA 4XI0A 3FP3A 3DSUA 4A3VA 1WY6A 4CDRA 3AG2E 5EDSA 4GMLA 4K5AB 4TRQA 4XI9A 4C0EA 2LUHA 3D9KA 3Q9NC 4G1TA 4B93B 3PS6A 4JHKA 5CRUA 3OXGA 3AU4A 5ENSD 2FF4A 5EX0A 3FTYA 4BT9A 1HF8A 3IXEA 1E8XA 3ABKE 3VTYA 4R7LA 5J08A 5LP0A 3B7SA 4YDYA 5JJTA 5JHBA 2C0MA 3DWLG 4HXIA 3LYAA 3D9JA 3DPYA 3FU6A 3IBEA 1S70B 4EPZA 4YVQC 2AXVA 4FJZA 2DYSE 2WQHA 4Y6WA 3SY2A 1YMPA 5LCWJ 3R9MA 2P9SG 5LCWC 3CLJA 3RIBA 3FUJA 4AVXA 2WB2A 5D2MC 3UT4A 1HZ4A 4I9CA 5D66A 1YCSB 4GMRA 4LNGA 3APDA 5ANLA 4EQFA 3CKBA 1X81A 4BX8A 3FTXA 3NZUA 3IEGA 1N4RA 2UY1B 3B7RL 1DVPA 2PL2A 2NC9A 5CCMA 1MX2A 1SZAA 3I3NA 2BKKB 5EKQD 4RLYA 3FUIA 1K1AA 1NL4A 1RW2A 4DX2A 1Z5SC 2VSNA 2WXOA 3CSFA 2UY1A 4XE0A 2KC7A 4G8LA 3NF1A 2V8SE 3IHYA 4ANWA 2I9CA 3DSXA 4UUCA 3QNKA 5KJKA 2X6KA 3FTWA 3JXIA 5AQBA 2XCCA 5AJLA 3TXMA 3ZKJA 3G2SA 4U95D 3HVEB 5FTPA 1HG5A 1KLXA 4DJAA 3D9IA 3CVUA 4EHMA 3LJNA 4KYOB 4G25A 5AIJA 2R5SA 1TNUA 1U2VG 4A63B 3FULA 3U4TA 2PNNA 4DI4A 3Q49B 3FU0A 4ANVA 4E85A 3FDHA 3MJWA 4GMJA 3SFZA 3BEEA 4J7WA 4WWPA 2VYIA 4WWOA 2V5FA 4KXKB 3LEWA 1V54E 4Q94A 5EYPF 4YVOA 2WMNA 5JJ6A 2BEDA 4LERA 3EHMA 3Q7AA 4LUNU 2MRIA 2L9BA 5CMWA 4FU3A 2CG2A 4FP7A 3ASOE 4P29A 1HX8A 2NXPA 4A55A 5ITZF 1N52A 2DZNA 3ULYA 1N4SA 1V55E 3Q5MA 4N3AA 5AYWD 4U0SA 4TXPA 3Q7FA 4L23A 1HFAA 2L6JA 4HRMB 3PEUB 2HE0A 2I6HA 4W9RA 5G2NA 3BG1B 4CRWA 1IQRA 1E8ZA 2FI7A 3Q9UC 2E2EA 4BESA 2AVPA 2H6HA 2L0TB 3IHVA 4BSZB 3W9FA 4N5CA 1JCQA 1ZU2A 3FUFA 3QWVA 4KZCA 3TXNA 3ZYQA 1IHGA 3PZ2A 1G3NB 2LSUA 4GZ3A 2XGSA 4K5CA 1NZNA 2ETBA 3EJNA 4PS3A 1LD7A 3CHQA 3QWWA 4HFGA 4G23A 4EZKA 3S7BA 4JC8A 2ETCA 2AW6A 2X6HA 3ZW3A 2BKGA 3D9PA 4C9BB 1KZPA 3L6AA 2CHWA 3S7JA 1OWMA 2VSYA 3FU5A 3T9KA 2Y0BG 2LXLA 3ASNE 4B0ZA 1D8DA 1NFIE 1FCHA 4WAFA 1ELRA 3FUEA 3VTXA 3IKOB 4F1SA 5T8IA 3PZ4A 3U3WA 4FHKA 5C1DA 2WXMA 2PQRA 3QC1A 3N71A 4E6HA 3PZ1A 3Q15A 3ML9A 4LCTA 2WMOA 1BI8B 5EIBE 4MBGA 3SF4A 3ULQA 3CVVA 3QOUA 2CHZA 2DYRE 2EQXA 3CHOA 4OAVB 2J49A 3E34A 1K8KG 3BG0B 2B6CA 5CECB 3KEAA 5BW8C 5T3RA 3QAQA 2H6FA 2GRMA 3JUIA 3JQ1A 2ZGGA 1E8WA 1X5BA 4FHJA 3ABME 2GROB 3FTZA 3PZDA 4U8VD 3DPDA 4CT4A 2ONDA 3MX3A 1N4PA 2HM8A 3ZUVB 4A3TA 2IO3C 3HYMB 1INZA 3CHPA 3LCAA 3E4BA 3D9MA 3TG4A 2Q7FA 1QQEA 1HU3A 2RG8A 1E7VA 1OCOE 1L5JA 4XIFA 4K03A 4KT6B 3QKYA 3CEQA 1MX4A 4AY5A 4B8AA 3D9HA 3ENEA 1EDUA 4CEMA 1B89A 3FUNA 3L16A 3S2AA 3UPVA 2KCLA 2V4LA 1LF8A 3D9LA 3SD5A 5AQ9A 3ULEG 2FO1E 3SO8A 4G11A 5B1AE 4HS2A 2VTBB 5FIOA 3IV0A 2AJAA 3VLFA 4O60A 4CZ2D 2VTBA 3FEXA 2ILRA 4FA6A 2XEEA 1W3BA 1E7UA 4HLEA 2IOSA 3LKUA 3MEKA 4GYYA 4EBAA 1AP7A 2PQNA 5KJMA 4XZ4A 2XS1A 1BI7B 2FULA 2AXZA 4U0ZA 3LVRE 3UUXA 2B0OE 2RFMA 3FUHA 5KWDA 5ENRD 3CGHA 5JJ7A 2AXUA 3URZA 3G2TA 1WG0A 2X6JA 4WNFA 4L9PA 4N2SA 2WXLA 1TNZA 3CKCA 4DX7D 4BERA 3ZPJA 5KJLA 3ZNGA 3LXUX 3AG1E 4XKBA 1OCZE 1HH8A 3EDTB 3ONKA 3KEZA 2I2OA 3GZ2A 4JHJA 3PUJA 3JQ0A 2VGEA 3Q75A 2A5UA 2WPVA 2ZU6B 3CHMA 4M7CA 3OXFA 4UI9J 1OXJA 1O1TA 4UI9C 3ZEFA 2LXMA 3FWVA 2A4ZA 3UMVA 2YNQA 4C48B 3WXXA 3QWPA 4HBDA 2XENA 4CYMD 3P1UA 4TUUA 5FQ6A 4U8YD 3E33A 3FTVA 1DC2A 3RAUA 1S64A 1A5EA 1AWCB 3ZVVA 5A6CA 2LNIA 4GCOA 3UTMA 4B89A 2R17C 4F7AA 3Q79A 3G2WA 2WXPA 3MV3B 3APCA 1IYGA 2XGMA 3RRMB 2J09A 4U7EB 4TXQA 3GZSA 4K0RA 3SNXA 4KBQA 4IRUA 1LD8A 4JB8P 3NOGD 3VLDA 1Q2ZA 2XCBA 4M3OA 3ZRHA 1SQMA 3FH8A 2WXRA 3E37A 1PC2A 5CBNA 2DBAA 3ASHA 3DBSA 2I1KA 1NA0A 2KXPC 4YDOA 3CQCB 5EX3A 4U0UA 1UW4B 4HOQA 2R03A 1OWOA 5FZQA 2YINA 1N94A 3T8MA 2PZIA 1UG3A 2XPYA 3V79K 3CVYA 3ZIMA 2FO7A 4J8YA 3HXEA 3L9TA 5ENOD 2CFZA 5B3SE 2KM4A 2WXIA 3Q47B 4UI9K 1XGWA 4LEUA 1H0AA 2KBXA 5E76A 3SZ7A 4JEUA 3V2OA 1MHQA 3PUKA 5AN8A 3FTUA 2PM6A 2F8YA 4PDXA 4CGWA 3S7DA 4URKA 4NQ0A 3UT7A 4JEHA 5AARA 4MLPA 2J08A 5ARFA 3B7BA 4HI9A 5CBOA 2WXFA 3ZYLA 3PNTB 1UJKA 1XNFA 3ASFA 2WXKA 3TJPA 4GYWA 3T8KA 3JUEA 3L13A 4A1SA 1IQUA 4NRHB 3CQGB 3TG5A 4J8DA 2VQ2A 4GB9A 4U04A 2F37A 3ZYMA 1UOHA 5CEDB 3EUVA 5E75A 3MYVA 2VGYA 4HQDA 3AJIA 3UXGA 2QYUA 4RG6A 4AM9A 5FINA 4DX6D 2DZOA 1WDYA 2QC9A 3OTNA 2QY7A 4DRXE 5CHEE 4G2VA 5HS0A 4I17A 3AG3E 3BQOA 4HRLA 3MZLB 1IHBA 3SBSA 3EIJA 4I1OB 4U8HA 4PS7A 1H2UA 3D9NA 1DCEA 3U66A 3FUKA 5EYLA 3V30A 2CHXA 4KMOA 4BTBA 1O5MA 3DSSA 4FLBA 4PS8A 4GPKA 4DUIA 1OWPA 3TWWA 1N4QA 3L17A 1WAO1 3TAXA 3SBTB 1D9SA 2IONA 2IQCA 3C3OA 1OUVA 1BLXB 4BTAA 3RO3A 2OCCE 1D8EA 2F0YA 1U3CA 1OT8A 4NACA 2DWZA 1JUQA 2EIME 5KBAA 3ASGA 4MRUA 1SZ9A 2UWJG 3PE3A 4G8KA 2J4DA 4OVUA 5HRYA 2E0IA 4FADA 2BTDA 3UKRG 3B7TA 1NP7A 5ENPD 4GA1A 1N9AA 1P5QA 4HORA 3DEPA 3FTSA 4AJWA 2GRNB 4WNDA 2XRZA 2XPIA 3NQPA 4KZ0A 3CVWA 1H6OA 2QFCA 1HE8A 3DXKG 2P9LG 5BXOA 5DIZA 1JWFA 2ZXWE 5H7PA 3RU0A 4GZDA 3QK0A 3CIAA 3CVXA 4BT8A 3GW4A 4GTOA 3PH0C 3NBNB 5BT1A 3QARA 4UQYA 5LFAA 5G05J 4V3IA 4MS6A 5G05C 2XGOA 2IO2C 1H19A 5CMYA 2J8SD 4L1BA 5CCLA 3L08A 1QYMA 2RD0A 2NYJA 4BWRA 2WXJA 3FY4A 3KD7A 4N2QA 4ZFHA 2I1JA 5A23A 4I43A 4YNDA 1H6PA 2P9PG 3BUAA 4EECA 1EPUA 4BEPA 3CVNA 1EYHA 3I4GA 3UM1A 4TV3A 4FULA 1DNPA 3PRZA 5J90A 4N3CA 2FEZA 4X8QA 4GZCA 2QZAA 5KNHD 4IYPA 3KS2A 1SA4A 2DIWA 2WXNA 3L82A 4HOTA 2J4BA 4D10C 2BF0X 1HXIA 1Z6TA 1TNYA 2WVIA 2KZTB 2V4HC 3Q4AB 2OEWA 3SQVA 5BV0A 4I6GA 3FUDA 2KZTA 1H2TC 3B7UX 4UQXA 4HI8A 3CVLA 4B8CB 2R05A 2ZIRA 5KJNA 3E30A 1EF1C 3TWSA 3HIZA 2WXQA 4JW1A 4N3BA 3J5QB 2P9UG 3ZHEB 4J8FA 5AENA 4K5BA 4BFRA 4GAAA 2XZDG 3ZHEA 2VGXA 4L2LA 5CRVA 3FHEA 1IKND 3LJ3A 4APOA 3UQ3A 4I1AA 5KNGA 3B13A 1UJJA 4UWGA 3MV2B 1E90A 3ZYKA 3KSQA 1K1BA 2MOWA 3NAWA 3C98A 4LG6A 4I9EA 4ILGA 1N0RA 3DRAA 3PEVB 2CG3A 5FZRA 4MKTA 2MHKA 1TN6A 3SI5A 3UINC 3MKRA 3JXJA 4AV7A 3UM3A 5EILA 4EZJA 5C2YA 4XKCA 3I5PA 4LSZE 3CSTA 3AG4E 1N54A 2WQ7A 1KT0A 4U96D 4A1GA 4YDWA 2FBNA 3S7FA 1PAQA 3T5VA 3J5PA 1FVHA 3WG7E 5HQ8A 2QYJA 3OXLA 5AJDA 2GRQB 1SVXA 4GZ5A 2ETAA 1FT2A 3RRNB 3EHQA 5B1BE 4G26A 5FWQA 1BPOA 2YHCA 4ATGA 3NZSA 3ZN3A 3CK7A 2HR2A 3ISMC 5JHAA 3EHRA 4ME2A 2OVFA 2IY0C 2IOLA 3R9AB 4F53A 3ASDA 3UKUG 2GGFA 3D9OA 3LPZA 4HOSA 3TWXA 3AS5A 3DSWA 1TNBA 4GTRA 1ZB1A 3HXFA 4O1OA 3E32A 3UIPC 4GTMA 4EZLA 1SW6A 3R7RA 4HLLA 2YQ8A 2P58C 5ENQD 2X3MA 5M72A 3W9GA 5FZSA 4ATZD 2GRPB 3EIQC 3LY8A 4AEZC 4OAUC 4FLHA 4J0UA 3RKVA 4FJYA 5HKPA 1BU9A 3O4ZA 5FQ8A 4CDNA 2J07A 4N39A 3JCKC 2Y3AA 1MYOA 4I2WA 1KZOA 2XQ0A 1HS6A 2WXGA 3FEYA 3HDXA 1PY1A 1QZ2A 3FFLA 4JPSA 2GRRB 4UWLA 4O1PA 4CGVA 1N11A 1E96B 1VDYA 1KPSB 3PDNA 4UWFA 5DBKA 1A17A 4JD2G 2H6GA 3UIOC 3AS8A 3ONLA 3RJVA 3TWUA 4AP2A 2JABA 3ZGQA 3CR3A 5ENTD 2KATA 4DX1A 3LVQE 4WWNA 3FH7A 1QNFA 3BU8A 5FQ7A 2Y4UA 4BX9A 4BETA 4GU5A 3QJZA 1MQSA 3PVLA 3F6QA 4UQZA 3ZU7B 1OWNA 4PUCA 2VSOE 3HHMA 4GTPA 3UM2A 4GA0A 3UM0A 2OOEA 2EIKE 4AXHA 4NIKA 3DEOA 5T4YA 2ZISA 4JL0A 2V0PA 5JA4D 1ELWA 4JHRA 2XEVA 3CHRA 3FU3A 3HVEA 2EILE 4GTVA 2MYOA 4I6JA 3FUMA 1HO8A 4NURA 5A7DB 3APFA 1K3ZD 2NSZA 2R2LA 4U63A 3X2QE 2JLBA 1BD8A 4Q96A 3UI2A 2GRLA 3ABLE 3LY9A 3HXCA 2ZGDA 3PE4A 2XZTG 3RRUA 2CFUA 2X6IA 3NOCD 1UN9A 2DCPA 3CK9A 5CEAA 2XS8A 4GA2A 3U64A 4GTTA 3QDNA 3TWQA 2VSXE 2LO6A 2M63A 3U9WA 3R7QA 2RKKA 4DPRA 3C3QA 3OAWA 2LAHA 1SA5A 4I2ZA 3TWVA 2IFUA 1U3DA 1ZBPA 5D0QD 4YDEA 4I6EA 2BUGA 3UX4A 3PNLB 5LX8A 2J9QA 3CVQA 2WM9A 2XPZA 1TNOA 5ARGA 1Z3YA 1TR4A 3KAEA 2R59A 5EN5D 4HNAD 3GZ1A 2YHEA 2OEVA 4EBAG 4PH4B 1ELKA 2XHEA 2OVBA 4JA9A 3V31A 3HXBA 4F3VA 2EIJE 3LY7A 3TWTA 4DX5D 1Y6IA 3ML8A 3TWRA 4IULA 4B94A 4ACLA 2P9NG 1TJFA 4ZHBA 1TEZA 3DSVA 3K9IA 3I4RB 2V5QC 4Z68A 5FT9A 5BUZA 1RZ4A 3LDZA 4GZ6A 5BXUA 3L54A 4LNUD 4LNBA 2IU1A 2P9IG 3AAAC 2AWIA 3B95A 5AQ7A 1YA0A 3EHNA 4L2YA 4CDMA 3SFYA 3ESKA 4ACKA 4WNGA 4H7XA 1N0QA 3QB2A 1H6KA 5FJYA 2C0LA 3SGHA 5EIDA 3RO2A 1OWLA 4RSYA 1MZCA 4DLQA 1S63A 3HG0D 4JVSA 1TYQG 1H2VC 4F6RD 1TJCA 3JYSA 2X6FA 3CV0A 2Y69E 1MX6A 1LTXA 2H6IA 2P2CP 4GTSA 4C0MA 4CT0A 5ENNA 1JCRA 3CK8A 1OCRE 3RSEG 4TXRA 4JXTA 4FC8A 2X38A 3Q73A 4OYSA 3DXMG 2DVWA 5G55A 2R02A 2L6BA 4JZYA 1JPLA 1YYHA 1GW6A 1KT1A 4Y6CA 4GTQA 4GPMA 4ILIA 4GYOA 2WQ6A 3EU9A 1IXVA 3DSTA 5BNWA 1OCCE 1FPPA 3KSLA 4AOFA 2IEJA 3TGOA 4KVMA 4ABNA 3CHSA 3P2BA 3MKQB 3SHFA 3MA5A 1DCQA 2WXHA 5BPPA 3Q78A 3MKQA 2VJ8A 1JCSA 4CCAA 4TUMA 1HG2A 3EU5A 1OY3D 2EINE 4F1PA 4BY6A 4DK5A 1MJ0A 2XRYA 3FH5A 4UWKA 3ZXPA 1O1RA 3D3MA 3CVPA 5AAOA 4J8EA 4KVOA 2Y4TA 4G24A 1UN8A 5FQ4A 3UT8A 2LSVA 4LRZA 5D0OD 3C72A 3HRAA 4J6IA 4XEIG 2VGXB 3PZ3A 1Y8MA 3AS4A 2JEKA 2LAIA 3HXDA 1E8YA 3L22A 4OVVA 2IF4A 3G2UA 1N95A 2HYZA 3T5XA 5KCMA 5HI7A 1WM5A 3ZFWA 4J8SA 1TN8A 2KCKA 4XX5A 4ANXA 1QBQA 4RQIA 4AIFA 4O6FA 4H7YA 5CERB 2PM7A 2GW1A 4QFVA 3LS8A 3TL5A 5IY5E 4ANUA 4I1MA 4N5QA 4IN3B 1TN7A 2IJGX 3ZXSA 2Y1LE 4RG9A 5LOZA 4AY6A 4BSXA 1NI1A 3NB2A 2RFAA 5G04J 4L7TA 2HO1A 1Z3XA 4HRNA 2OV8A 3V2XA 2KCVA 5G04C 4ILHB 4HB5A 4HVBA 1O1SA 3MCXA
chains in the Genus database with same CATH topology
4RVBA 1E96B 1X5BA 1VDYA 4FHJA 1JWGA 3PDNA 4UWFA 3FTZA 3PZDA 3GYZA 5DBKA 1A17A 3DPDA 3PREA 4UWHA 4CT4A 4FLBA 4PS8A 4GPKA 4JA7A 2ONDA 5ANRA 3MX3A 2L0IA 1OWPA 1S0PA 3AS8A 3ESLA 4DLOA 3ONLA 2HM8A 1FVFA 3RJVA 1NA3A 4A3TA 3L17A 3HYMB 4AP2A 4Q69A 1INZA 3ZGQA 1WAO1 4GCNA 3SBTB 3CHPA 3CR3A 3TAXA 2KATA 3LVQE 3LCAA 3O48A 5BV1A 3RK6A 4WWNA 3FH7A 3E4BA 3D9MA 4APFA 1QNFA 3VLEA 3TG4A 5FQ7A 2Y4UA 2Q7FA 1QQEA 2C2LA 4BX9A 3MGBA 3AU5A 4GU5A 4DI3A 2IONA 4HOUA 3QJZA 2IQCA 1MQSA 4U07A 1HU3A 3G2VA 1OUVA 2RG8A 1E7VA 3PVLA 4BTAA 3RO3A 1L5JA 4XIFA 4WNEA 4K03A 4UQZA 4KT6B 1OWNA 1U3CA 3QKYA 4WUYA 3CEQA 4XI0A 4PUCA 3FP3A 2VSOE 3HHMA 4NACA 1JUQA 3ASGA 4AY5A 4B8AA 4MRUA 1SZ9A 1WY6A 4GA0A 3ENEA 2UWJG 4A3VA 4CDRA 3PE3A 1EDUA 2OOEA 1B89A 4CEMA 3FUNA 3L16A 2J4DA 3S2AA 4OVUA 4AXHA 2E0IA 4FADA 5EDSA 3UPVA 2KCLA 2V4LA 4GMLA 5T4YA 1LF8A 4TRQA 2BTDA 3D9LA 4JL0A 4XI9A 2V0PA 3SD5A 4C0EA 3B7TA 1NP7A 3D9KA 1ELWA 4GA1A 1P5QA 4G11A 4G1TA 4JHRA 4HORA 2XEVA 3CHRA 3FU3A 3HVEA 3FTSA 4HS2A 4I6JA 2VTBB 3FUMA 4AJWA 2XRZA 4WNDA 1HO8A 3IV0A 3PS6A 4JHKA 2XPIA 3NQPA 4NURA 5A7DB 4KZ0A 3VLFA 3OXGA 3CVWA 3APFA 3AU4A 2FF4A 2QFCA 5EX0A 2NSZA 1HE8A 3FTYA 4U63A 2VTBA 2JLBA 4BT9A 3FEXA 4Q96A 2GRLA 5DIZA 1HF8A 2ILRA 3LY9A 1JWFA 1E8XA 4FA6A 1W3BA 3VTYA 1E7UA 4R7LA 3PE4A 4HLEA 5J08A 5LP0A 3B7SA 2IOSA 3LKUA 3RU0A 5JJTA 5JHBA 4GZDA 3RRUA 3QK0A 3MEKA 3CIAA 3CVXA 4BT8A 3GW4A 3PH0C 2CFUA 2C0MA 3QARA 4GYYA 4UQYA 4EBAA 2X6IA 4HXIA 5BT1A 1UN9A 5LFAA 2DCPA 3LYAA 3CK9A 5G05J 4V3IA 2PQNA 3D9JA 3FU6A 3IBEA 4GA2A 3U64A 4MS6A 5G05C 2XGOA 3QDNA 4XZ4A 5KJMA 1H19A 2FULA 2AXZA 2VSXE 4U0ZA 5CMYA 4EPZA 2LO6A 2M63A 4L1BA 3U9WA 3LVRE 4YVQC 2AXVA 3R7QA 3UUXA 4FJZA 2WQHA 4Y6WA 3L08A 4DPRA 3FUHA 5CCLA 3OAWA 2LAHA 2RD0A 5LCWJ 4I2ZA 4BWRA 3CGHA 2IFUA 2WXJA 1U3DA 3FY4A 5LCWC 3KD7A 4N2QA 1ZBPA 2I1JA 2AXUA 5JJ7A 3URZA 3G2TA 2X6JA 3CLJA 4WNFA 4I43A 4I6EA 5D0QD 3RIBA 3FUJA 5A23A 2BUGA 4YNDA 4AVXA 2WB2A 2WXLA 4N2SA 3CKCA 4EECA 3UX4A 3PNLB 3UT4A 5LX8A 3ZPJA 1HZ4A 2J9QA 4I9CA 5KJLA 3CVQA 2WM9A 3LXUX 2XPZA 5ARGA 3APDA 5ANLA 1Z3YA 4XKBA 1EPUA 3KAEA 4EQFA 1HH8A 2R59A 3CVNA 1EYHA 3CKBA 3I4GA 3GZ1A 2YHEA 3EDTB 3ONKA 3KEZA 4BX8A 4TV3A 4EBAG 4FULA 1DNPA 3PRZA 3FTXA 3NZUA 1ELKA 2I2OA 4PH4B 2XHEA 2OVBA 5J90A 3GZ2A 4N3CA 2FEZA 4JHJA 3PUJA 3IEGA 4GZCA 2UY1B 3B7RL 1DVPA 2PL2A 2NC9A 4JA9A 5CCMA 3JQ0A 4IYPA 3KS2A 4F3VA 2DIWA 2WXNA 2A5UA 1SZAA 3LY7A 4HOTA 3I3NA 1Y6IA 2WPVA 2ZU6B 3CHMA 5EKQD 2J4BA 3FUIA 3ML8A 4D10C 3OXFA 2BF0X 4UI9J 2VSNA 2WXOA 3CSFA 2UY1A 4XE0A 4IULA 4B94A 2KC7A 4UI9C 3NF1A 1HXIA 2V8SE 1Z6TA 3IHYA 3ZEFA 4ANWA 3FWVA 2I9CA 4ACLA 2WVIA 2A4ZA 2KZTB 1TJFA 3Q4AB 3UMVA 1TEZA 3K9IA 3QNKA 5KJKA 5BV0A 2YNQA 3I4RB 2X6KA 3FTWA 5FT9A 3WXXA 3QWPA 4I6GA 5BUZA 2XCCA 3FUDA 3LDZA 2KZTA 3P1UA 1H2TC 5AJLA 4TUUA 3B7UX 5FQ6A 4UQXA 3TXMA 4GZ6A 3CVLA 3G2SA 4B8CB 3HVEB 5FTPA 3L54A 5KJNA 1HG5A 1EF1C 2IU1A 1KLXA 3FTVA 4DJAA 3D9IA 2AWIA 3CVUA 3ZVVA 3HIZA 4KYOB 4G25A 5AIJA 1YA0A 5A6CA 3EHNA 2R5SA 2LNIA 2WXQA 4GCOA 4L2YA 4JW1A 4CDMA 3FULA 3ESKA 3U4TA 4N3BA 4B89A 4DI4A 4ACKA 3Q49B 4WNGA 3FU0A 4H7XA 4ANVA 3ZHEB 4J8FA 4E85A 3FDHA 1H6KA 2R17C 3QB2A 3MJWA 4F7AA 5AENA 5FJYA 2C0LA 3SGHA 4GMJA 3SFZA 3G2WA 3BEEA 2WXPA 3MV3B 3APCA 1IYGA 3RO2A 1OWLA 4WWPA 4BFRA 2XGMA 4GAAA 4RSYA 3RRMB 3ZHEA 2VYIA 2J09A 2VGXA 4L2LA 4DLQA 4WWOA 3GZSA 4JVSA 3FHEA 4K0RA 1H2VC 2V5FA 3SNXA 1TJCA 3LJ3A 4IRUA 4KBQA 3JYSA 4KXKB 4APOA 2X6FA 3LEWA 3UQ3A 3VLDA 4I1AA 4Q94A 2XCBA 4M3OA 3ZRHA 3CV0A 1SQMA 3FH8A 3B13A 1UJJA 2WXRA 4UWGA 1PC2A 2DBAA 3MV2B 4YVOA 3ASHA 3DBSA 4C0MA 1E90A 1NA0A 2I1KA 3ZYKA 2WMNA 4CT0A 5JJ6A 5ENNA 3CQCB 4LERA 2MOWA 3CK8A 3EHMA 5EX3A 4U0UA 3C98A 4LUNU 2MRIA 4JXTA 4FC8A 4I9EA 4ILGA 2L9BA 1UW4B 4HOQA 5CMWA 3PEVB 2CG3A 2X38A 5FZRA 1OWOA 4MKTA 5FZQA 2MHKA 4FU3A 4OYSA 2CG2A 4FP7A 3SI5A 2YINA 3MKRA 5G55A 4P29A 3T8MA 1HX8A 1UG3A 2PZIA 2XPYA 2NXPA 4A55A 4AV7A 3CVYA 3ZIMA 4JZYA 1JPLA 1N52A 1GW6A 2FO7A 1KT1A 4EZJA 4Y6CA 5C2YA 3Q5MA 4XKCA 4N3AA 3I5PA 4ILIA 4GYOA 3CSTA 1N54A 4U0SA 5AYWD 2WQ6A 2CFZA 1KT0A 2KM4A 4L23A 2WQ7A 4A1GA 5BNWA 1HFAA 2L6JA 2FBNA 2WXIA 3PEUB 2I6HA 4W9RA 3S7FA 4AOFA 1PAQA 3Q47B 5G2NA 3T5VA 4KVMA 4ABNA 3TGOA 3CHSA 3P2BA 4UI9K 3BG1B 1XGWA 4LEUA 4CRWA 1IQRA 1FVHA 1H0AA 1E8ZA 3MKQB 3SHFA 2FI7A 3SZ7A 5E76A 5HQ8A 2E2EA 4JEUA 1MHQA 3OXLA 2AVPA 3MA5A 3PUKA 2L0TB 3IHVA 5AJDA 2WXHA 5BPPA 3FTUA 2PM6A 3FUFA 3MKQA 1ZU2A 3QWVA 4KZCA 4N5CA 2VJ8A 4PDXA 3TXNA 4CGWA 3ZYQA 4CCAA 3S7DA 1IHGA 1HG2A 4URKA 2LSUA 4GZ5A 4NQ0A 3UT7A 4GZ3A 2XGSA 1NZNA 4JEHA 4BY6A 3EJNA 4PS3A 3RRNB 3CHQA 3QWWA 4DK5A 4HFGA 2XRYA 4G26A 4G23A 4MLPA 5FWQA 2J08A 4EZKA 3FH5A 5ARFA 1BPOA 4UWKA 3S7BA 2YHCA 4ATGA 3NZSA 4JC8A 3ZN3A 3CK7A 2HR2A 3D3MA 5JHAA 3CVPA 2AW6A 2WXFA 3ZYLA 4J8EA 2X6HA 4KVOA 3ZW3A 3D9PA 3PNTB 1UJKA 2Y4TA 1XNFA 4ME2A 3ASFA 4C9BB 2WXKA 4G24A 1UN8A 5FQ4A 3UT8A 2OVFA 3TJPA 4GYWA 2LSVA 3L13A 2IOLA 4LRZA 1IQUA 5D0OD 3L6AA 4NRHB 3CQGB 3R9AB 3TG5A 4A1SA 4F53A 2CHWA 4J6IA 4J8DA 2VGXB 3S7JA 3ASDA 1Y8MA 1OWMA 2GGFA 2VQ2A 2VSYA 2JEKA 3AS4A 3D9OA 3FU5A 2LAIA 3LPZA 4GB9A 4U04A 4HOSA 3ZYMA 4B0ZA 1E8YA 3L22A 4OVVA 5E75A 1FCHA 3AS5A 4WAFA 3MYVA 1ELRA 2IF4A 3G2UA 2HYZA 2VGYA 3T5XA 3FUEA 5KCMA 4EZLA 3VTXA 3IKOB 5HI7A 4RG6A 3R7RA 4F1SA 4AM9A 5T8IA 1WM5A 2YQ8A 3ZFWA 2P58C 4J8SA 3OTNA 2QY7A 2KCKA 4XX5A 2X3MA 4ANXA 5M72A 5CHEE 3U3WA 4FHKA 5FZSA 4AIFA 5C1DA 3EIQC 2WXMA 2PQRA 3LY8A 4AEZC 3QC1A 4G2VA 4O6FA 4H7YA 3N71A 4I17A 2PM7A 4E6HA 2GW1A 4QFVA 3Q15A 3LS8A 3ML9A 4FLHA 4J0UA 4LCTA 3TL5A 2WMOA 4ANUA 4I1MA 3RKVA 3MZLB 4IN3B 4FJYA 2IJGX 3SBSA 3SF4A 3ULQA 3ZXSA 3O4ZA 3EIJA 4I1OB 3QOUA 2CHZA 5FQ8A 4CDNA 3CVVA 2EQXA 2J07A 4N39A 3CHOA 3JCKC 4RG9A 4U8HA 2J49A 4PS7A 2Y3AA 5LOZA 4BSXA 4AY6A 1H2UA 4I2WA 2XQ0A 3D9NA 2HO1A 1HS6A 1Z3XA 4L7TA 2WXGA 5G04J 2OV8A 3U66A 3BG0B 3FEYA 3FUKA 2KCVA 5G04C 3HDXA 1PY1A 1QZ2A 3FFLA 4JPSA 4ILHB 5BW8C 2CHXA 4UWLA 4CGVA 5T3RA 3QAQA 4HVBA 2GRMA 4KMOA 3JUIA 3JQ1A 3MCXA 4BTBA 1E8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E96 B;  3PDN A;  3GYZ A;  5DBK A;  1A17 A;  4GPK A;  4JA7 A;  2OND A;  3AS8 A;  3RJV A;  1NA3 A;  3HYM B;  3ZGQ A;  1WAO 1;  4GCN A;  3TAX A;  2KAT A;  3LCA A;  3O48 A;  3E4B A;  3TG4 A;  2Y4U A;  2Q7F A;  1QQE A;  2C2L A;  4HOU A;  4U07 A;  1OUV A;  4BTA A;  3RO3 A;  4XIF A;  4WNE A;  4UQZ A;  3QKY A;  4WUY A;  3CEQ A;  4XI0 A;  3FP3 A;  3ASG A;  4AY5 A;  4GA0 A;  4CDR A;  2UWJ G;  3PE3 A;  2OOE A;  1B89 A;  3UPV A;  2KCL A;  4XI9 A;  4JL0 A;  4GA1 A;  1ELW A;  1P5Q A;  4G1T A;  4JHR A;  4HOR A;  2XEV A;  4WND A;  2XPI A;  5A7D B;  3OXG A;  2FF4 A;  2QFC A;  5EX0 A;  2JLB A;  4BT9 A;  5DIZ A;  3LY9 A;  1W3B A;  3VTY A;  3PE4 A;  3LKU A;  3RU0 A;  5JJT A;  3MEK A;  4BT8 A;  3GW4 A;  2C0M A;  4UQY A;  5BT1 A;  4GYY A;  3LYA A;  5G05 J;  3CK9 A;  2PQN A;  4GA2 A;  5G05 C;  2XGO A;  3QDN A;  5KJM A;  4U0Z A;  4YVQ C;  3UUX A;  2WQH A;  4Y6W A;  5CCL A;  5LCW J;  4I2Z A;  4BWR A;  2IFU A;  5LCW C;  3KD7 A;  4N2Q A;  1ZBP A;  5JJ7 A;  3URZ A;  4WNF A;  5D0Q D;  3RIB A;  4N2S A;  2BUG A;  4YND A;  3CKC A;  3ZPJ A;  1HZ4 A;  2J9Q A;  4I9C A;  5KJL A;  3CVQ A;  5ARG A;  3KAE A;  4EQF A;  1HH8 A;  3CVN A;  3CKB A;  3GZ1 A;  3EDT B;  3GZ2 A;  4N3C A;  2FEZ A;  4JA9 A;  3IEG A;  2UY1 B;  2PL2 A;  5CCM A;  2NC9 A;  3KS2 A;  4F3V A;  3LY7 A;  4HOT A;  2WPV A;  5EKQ D;  3OXF A;  4UI9 J;  2VSN A;  2UY1 A;  4B94 A;  2KC7 A;  4UI9 C;  3NF1 A;  1HXI A;  3FWV A;  3Q4A B;  3K9I A;  5KJK A;  5FT9 A;  3WXX A;  3QWP A;  2XCC A;  4UQX A;  4GZ6 A;  3CVL A;  5FTP A;  5KJN A;  1KLX A;  4KYO B;  4G25 A;  1YA0 A;  5A6C A;  2R5S A;  2LNI A;  4GCO A;  3ESK A;  3U4T A;  4N3B A;  4WNG A;  3Q49 B;  4H7X A;  3ZHE B;  4J8F A;  5FJY A;  2C0L A;  3BEE A;  3MV3 B;  1IYG A;  3RO2 A;  2XGM A;  3ZHE A;  2VYI A;  2VGX A;  2V5F A;  1TJC A;  4KBQ A;  3JYS A;  4KXK B;  4APO A;  3UQ3 A;  4I1A A;  2XCB A;  3CV0 A;  1PC2 A;  2DBA A;  3MV2 B;  4YVO A;  3ASH A;  1NA0 A;  5JJ6 A;  3CK8 A;  5EX3 A;  4U0U A;  4I9E A;  4HOQ A;  5FZR A;  5FZQ A;  2MHK A;  3MKR A;  2PZI A;  2FO7 A;  1KT1 A;  4Y6C A;  3Q5M A;  4N3A A;  4GYO A;  5AYW D;  4U0S A;  1KT0 A;  5BNW A;  2L6J A;  2FBN A;  2I6H A;  4W9R A;  3S7F A;  3Q47 B;  3TGO A;  4ABN A;  4UI9 K;  4LEU A;  2FI7 A;  3SZ7 A;  5HQ8 A;  2E2E A;  3OXL A;  2AVP A;  3MA5 A;  4N5C A;  1ZU2 A;  3QWV A;  4CGW A;  3S7D A;  1IHG A;  2LSU A;  4GZ5 A;  4NQ0 A;  4GZ3 A;  2XGS A;  1NZN A;  3QWW A;  4G26 A;  4G23 A;  5ARF A;  3S7B A;  2YHC A;  3ZN3 A;  3CK7 A;  2HR2 A;  3CVP A;  4J8E A;  2Y4T A;  1XNF A;  4ME2 A;  3ASF A;  4G24 A;  4GYW A;  2LSV A;  3R9A B;  5D0O D;  4A1S A;  4NRH B;  3TG5 A;  4J8D A;  2VGX B;  3S7J A;  3ASD A;  1Y8M A;  2VQ2 A;  2VSY A;  3AS4 A;  3LPZ A;  4U04 A;  4HOS A;  1FCH A;  3AS5 A;  1ELR A;  2IF4 A;  2HYZ A;  2VGY A;  3VTX A;  5HI7 A;  4RG6 A;  4AM9 A;  1WM5 A;  2YQ8 A;  3ZFW A;  2P58 C;  2KCK A;  5M72 A;  5CHE E;  3U3W A;  5FZS A;  4AIF A;  5C1D A;  3LY8 A;  2PQR A;  4G2V A;  4O6F A;  4H7Y A;  3N71 A;  4I17 A;  2GW1 A;  3Q15 A;  4J0U A;  3RKV A;  4IN3 B;  3SF4 A;  3ULQ A;  3QOU A;  4N39 A;  4RG9 A;  4AY6 A;  4I2W A;  5G04 J;  2HO1 A;  2KCV A;  5G04 C;  1QZ2 A;  3FFL A;  5BW8 C;  4CGV A;  4BTB A; 
#chains in the Genus database with same CATH topology
 2A5E A;  4RVB A;  1JWG A;  5AQA A;  3GYZ A;  3SFX A;  3PRE A;  4UWH A;  4JA7 A;  3C5R A;  5ANR A;  2L0I A;  1S0P A;  3ESL A;  4DLO A;  1FT1 A;  1FVF A;  1NA3 A;  4Q69 A;  4GCN A;  3O48 A;  5BV1 A;  3RK6 A;  2XEH A;  4APF A;  5JMN D;  3VLE A;  2P9K G;  2C2L A;  3MGB A;  3AU5 A;  4DI3 A;  4HOU A;  4U07 A;  4QQI A;  2F8X K;  3G2V A;  3C3R A;  4WNE A;  4WUY A;  4XI0 A;  3FP3 A;  3DSU A;  4A3V A;  1WY6 A;  4CDR A;  3AG2 E;  5EDS A;  4GML A;  4K5A B;  4TRQ A;  4XI9 A;  4C0E A;  2LUH A;  3D9K A;  3Q9N C;  4G1T A;  4B93 B;  3PS6 A;  4JHK A;  5CRU A;  3OXG A;  3AU4 A;  5ENS D;  2FF4 A;  5EX0 A;  3FTY A;  4BT9 A;  1HF8 A;  3IXE A;  1E8X A;  3ABK E;  3VTY A;  4R7L A;  5J08 A;  5LP0 A;  3B7S A;  4YDY A;  5JJT A;  5JHB A;  2C0M A;  3DWL G;  4HXI A;  3LYA A;  3D9J A;  3DPY A;  3FU6 A;  3IBE A;  1S70 B;  4EPZ A;  4YVQ C;  2AXV A;  4FJZ A;  2DYS E;  2WQH A;  4Y6W A;  3SY2 A;  1YMP A;  5LCW J;  3R9M A;  2P9S G;  5LCW C;  3CLJ A;  3RIB A;  3FUJ A;  4AVX A;  2WB2 A;  5D2M C;  3UT4 A;  1HZ4 A;  4I9C A;  5D66 A;  1YCS B;  4GMR A;  4LNG A;  3APD A;  5ANL A;  4EQF A;  3CKB A;  1X81 A;  4BX8 A;  3FTX A;  3NZU A;  3IEG A;  1N4R A;  2UY1 B;  3B7R L;  1DVP A;  2PL2 A;  2NC9 A;  5CCM A;  1MX2 A;  1SZA A;  3I3N A;  2BKK B;  5EKQ D;  4RLY A;  3FUI A;  1K1A A;  1NL4 A;  1RW2 A;  4DX2 A;  1Z5S C;  2VSN A;  2WXO A;  3CSF A;  2UY1 A;  4XE0 A;  2KC7 A;  4G8L A;  3NF1 A;  2V8S E;  3IHY A;  4ANW A;  2I9C A;  3DSX A;  4UUC A;  3QNK A;  5KJK A;  2X6K A;  3FTW A;  3JXI A;  5AQB A;  2XCC A;  5AJL A;  3TXM A;  3ZKJ A;  3G2S A;  4U95 D;  3HVE B;  5FTP A;  1HG5 A;  1KLX A;  4DJA A;  3D9I A;  3CVU A;  4EHM A;  3LJN A;  4KYO B;  4G25 A;  5AIJ A;  2R5S A;  1TNU A;  1U2V G;  4A63 B;  3FUL A;  3U4T A;  2PNN A;  4DI4 A;  3Q49 B;  3FU0 A;  4ANV A;  4E85 A;  3FDH A;  3MJW A;  4GMJ A;  3SFZ A;  3BEE A;  4J7W A;  4WWP A;  2VYI A;  4WWO A;  2V5F A;  4KXK B;  3LEW A;  1V54 E;  4Q94 A;  5EYP F;  4YVO A;  2WMN A;  5JJ6 A;  2BED A;  4LER A;  3EHM A;  3Q7A A;  4LUN U;  2MRI A;  2L9B A;  5CMW A;  4FU3 A;  2CG2 A;  4FP7 A;  3ASO E;  4P29 A;  1HX8 A;  2NXP A;  4A55 A;  5ITZ F;  1N52 A;  2DZN A;  3ULY A;  1N4S A;  1V55 E;  3Q5M A;  4N3A A;  5AYW D;  4U0S A;  4TXP A;  3Q7F A;  4L23 A;  1HFA A;  2L6J A;  4HRM B;  3PEU B;  2HE0 A;  2I6H A;  4W9R A;  5G2N A;  3BG1 B;  4CRW A;  1IQR A;  1E8Z A;  2FI7 A;  3Q9U C;  2E2E A;  4BES A;  2AVP A;  2H6H A;  2L0T B;  3IHV A;  4BSZ B;  3W9F A;  4N5C A;  1JCQ A;  1ZU2 A;  3FUF A;  3QWV A;  4KZC A;  3TXN A;  3ZYQ A;  1IHG A;  3PZ2 A;  1G3N B;  2LSU A;  4GZ3 A;  2XGS A;  4K5C A;  1NZN A;  2ETB A;  3EJN A;  4PS3 A;  1LD7 A;  3CHQ A;  3QWW A;  4HFG A;  4G23 A;  4EZK A;  3S7B A;  4JC8 A;  2ETC A;  2AW6 A;  2X6H A;  3ZW3 A;  2BKG A;  3D9P A;  4C9B B;  1KZP A;  3L6A A;  2CHW A;  3S7J A;  1OWM A;  2VSY A;  3FU5 A;  3T9K A;  2Y0B G;  2LXL A;  3ASN E;  4B0Z A;  1D8D A;  1NFI E;  1FCH A;  4WAF A;  1ELR A;  3FUE A;  3VTX A;  3IKO B;  4F1S A;  5T8I A;  3PZ4 A;  3U3W A;  4FHK A;  5C1D A;  2WXM A;  2PQR A;  3QC1 A;  3N71 A;  4E6H A;  3PZ1 A;  3Q15 A;  3ML9 A;  4LCT A;  2WMO A;  1BI8 B;  5EIB E;  4MBG A;  3SF4 A;  3ULQ A;  3CVV A;  3QOU A;  2CHZ A;  2DYR E;  2EQX A;  3CHO A;  4OAV B;  2J49 A;  3E34 A;  1K8K G;  3BG0 B;  2B6C A;  5CEC B;  3KEA A;  5BW8 C;  5T3R A;  3QAQ A;  2H6F A;  2GRM A;  3JUI A;  3JQ1 A;  2ZGG A;  1E8W A;  1X5B A;  4FHJ A;  3ABM E;  2GRO B;  3FTZ A;  3PZD A;  4U8V D;  3DPD A;  4CT4 A;  2OND A;  3MX3 A;  1N4P A;  2HM8 A;  3ZUV B;  4A3T A;  2IO3 C;  3HYM B;  1INZ A;  3CHP A;  3LCA A;  3E4B A;  3D9M A;  3TG4 A;  2Q7F A;  1QQE A;  1HU3 A;  2RG8 A;  1E7V A;  1OCO E;  1L5J A;  4XIF A;  4K03 A;  4KT6 B;  3QKY A;  3CEQ A;  1MX4 A;  4AY5 A;  4B8A A;  3D9H A;  3ENE A;  1EDU A;  4CEM A;  1B89 A;  3FUN A;  3L16 A;  3S2A A;  3UPV A;  2KCL A;  2V4L A;  1LF8 A;  3D9L A;  3SD5 A;  5AQ9 A;  3ULE G;  2FO1 E;  3SO8 A;  4G11 A;  5B1A E;  4HS2 A;  2VTB B;  5FIO A;  3IV0 A;  2AJA A;  3VLF A;  4O60 A;  4CZ2 D;  2VTB A;  3FEX A;  2ILR A;  4FA6 A;  2XEE A;  1W3B A;  1E7U A;  4HLE A;  2IOS A;  3LKU A;  3MEK A;  4GYY A;  4EBA A;  1AP7 A;  2PQN A;  5KJM A;  4XZ4 A;  2XS1 A;  1BI7 B;  2FUL A;  2AXZ A;  4U0Z A;  3LVR E;  3UUX A;  2B0O E;  2RFM A;  3FUH A;  5KWD A;  5ENR D;  3CGH A;  5JJ7 A;  2AXU A;  3URZ A;  3G2T A;  1WG0 A;  2X6J A;  4WNF A;  4L9P A;  4N2S A;  2WXL A;  1TNZ A;  3CKC A;  4DX7 D;  4BER A;  3ZPJ A;  5KJL A;  3ZNG A;  3LXU X;  3AG1 E;  4XKB A;  1OCZ E;  1HH8 A;  3EDT B;  3ONK A;  3KEZ A;  2I2O A;  3GZ2 A;  4JHJ A;  3PUJ A;  3JQ0 A;  2VGE A;  3Q75 A;  2A5U A;  2WPV A;  2ZU6 B;  3CHM A;  4M7C A;  3OXF A;  4UI9 J;  1OXJ A;  1O1T A;  4UI9 C;  3ZEF A;  2LXM A;  3FWV A;  2A4Z A;  3UMV A;  2YNQ A;  4C48 B;  3WXX A;  3QWP A;  4HBD A;  2XEN A;  4CYM D;  3P1U A;  4TUU A;  5FQ6 A;  4U8Y D;  3E33 A;  3FTV A;  1DC2 A;  3RAU A;  1S64 A;  1A5E A;  1AWC B;  3ZVV A;  5A6C A;  2LNI A;  4GCO A;  3UTM A;  4B89 A;  2R17 C;  4F7A A;  3Q79 A;  3G2W A;  2WXP A;  3MV3 B;  3APC A;  1IYG A;  2XGM A;  3RRM B;  2J09 A;  4U7E B;  4TXQ A;  3GZS A;  4K0R A;  3SNX A;  4KBQ A;  4IRU A;  1LD8 A;  4JB8 P;  3NOG D;  3VLD A;  1Q2Z A;  2XCB A;  4M3O A;  3ZRH A;  1SQM A;  3FH8 A;  2WXR A;  3E37 A;  1PC2 A;  5CBN A;  2DBA A;  3ASH A;  3DBS A;  2I1K A;  1NA0 A;  2KXP C;  4YDO A;  3CQC B;  5EX3 A;  4U0U A;  1UW4 B;  4HOQ A;  2R03 A;  1OWO A;  5FZQ A;  2YIN A;  1N94 A;  3T8M A;  2PZI A;  1UG3 A;  2XPY A;  3V79 K;  3CVY A;  3ZIM A;  2FO7 A;  4J8Y A;  3HXE A;  3L9T A;  5ENO D;  2CFZ A;  5B3S E;  2KM4 A;  2WXI A;  3Q47 B;  4UI9 K;  1XGW A;  4LEU A;  1H0A A;  2KBX A;  5E76 A;  3SZ7 A;  4JEU A;  3V2O A;  1MHQ A;  3PUK A;  5AN8 A;  3FTU A;  2PM6 A;  2F8Y A;  4PDX A;  4CGW A;  3S7D A;  4URK A;  4NQ0 A;  3UT7 A;  4JEH A;  5AAR A;  4MLP A;  2J08 A;  5ARF A;  3B7B A;  4HI9 A;  5CBO A;  2WXF A;  3ZYL A;  3PNT B;  1UJK A;  1XNF A;  3ASF A;  2WXK A;  3TJP A;  4GYW A;  3T8K A;  3JUE A;  3L13 A;  4A1S A;  1IQU A;  4NRH B;  3CQG B;  3TG5 A;  4J8D A;  2VQ2 A;  4GB9 A;  4U04 A;  2F37 A;  3ZYM A;  1UOH A;  5CED B;  3EUV A;  5E75 A;  3MYV A;  2VGY A;  4HQD A;  3AJI A;  3UXG A;  2QYU A;  4RG6 A;  4AM9 A;  5FIN A;  4DX6 D;  2DZO A;  1WDY A;  2QC9 A;  3OTN A;  2QY7 A;  4DRX E;  5CHE E;  4G2V A;  5HS0 A;  4I17 A;  3AG3 E;  3BQO A;  4HRL A;  3MZL B;  1IHB A;  3SBS A;  3EIJ A;  4I1O B;  4U8H A;  4PS7 A;  1H2U A;  3D9N A;  1DCE A;  3U66 A;  3FUK A;  5EYL A;  3V30 A;  2CHX A;  4KMO A;  4BTB A;  1O5M A;  3DSS A;  4FLB A;  4PS8 A;  4GPK A;  4DUI A;  1OWP A;  3TWW A;  1N4Q A;  3L17 A;  1WAO 1;  3TAX A;  3SBT B;  1D9S A;  2ION A;  2IQC A;  3C3O A;  1OUV A;  1BLX B;  4BTA A;  3RO3 A;  2OCC E;  1D8E A;  2F0Y A;  1U3C A;  1OT8 A;  4NAC A;  2DWZ A;  1JUQ A;  2EIM E;  5KBA A;  3ASG A;  4MRU A;  1SZ9 A;  2UWJ G;  3PE3 A;  4G8K A;  2J4D A;  4OVU A;  5HRY A;  2E0I A;  4FAD A;  2BTD A;  3UKR G;  3B7T A;  1NP7 A;  5ENP D;  4GA1 A;  1N9A A;  1P5Q A;  4HOR A;  3DEP A;  3FTS A;  4AJW A;  2GRN B;  4WND A;  2XRZ A;  2XPI A;  3NQP A;  4KZ0 A;  3CVW A;  1H6O A;  2QFC A;  1HE8 A;  3DXK G;  2P9L G;  5BXO A;  5DIZ A;  1JWF A;  2ZXW E;  5H7P A;  3RU0 A;  4GZD A;  3QK0 A;  3CIA A;  3CVX A;  4BT8 A;  3GW4 A;  4GTO A;  3PH0 C;  3NBN B;  5BT1 A;  3QAR A;  4UQY A;  5LFA A;  5G05 J;  4V3I A;  4MS6 A;  5G05 C;  2XGO A;  2IO2 C;  1H19 A;  5CMY A;  2J8S D;  4L1B A;  5CCL A;  3L08 A;  1QYM A;  2RD0 A;  2NYJ A;  4BWR A;  2WXJ A;  3FY4 A;  3KD7 A;  4N2Q A;  4ZFH A;  2I1J A;  5A23 A;  4I43 A;  4YND A;  1H6P A;  2P9P G;  3BUA A;  4EEC A;  1EPU A;  4BEP A;  3CVN A;  1EYH A;  3I4G A;  3UM1 A;  4TV3 A;  4FUL A;  1DNP A;  3PRZ A;  5J90 A;  4N3C A;  2FEZ A;  4X8Q A;  4GZC A;  2QZA A;  5KNH D;  4IYP A;  3KS2 A;  1SA4 A;  2DIW A;  2WXN A;  3L82 A;  4HOT A;  2J4B A;  4D10 C;  2BF0 X;  1HXI A;  1Z6T A;  1TNY A;  2WVI A;  2KZT B;  2V4H C;  3Q4A B;  2OEW A;  3SQV A;  5BV0 A;  4I6G A;  3FUD A;  2KZT A;  1H2T C;  3B7U X;  4UQX A;  4HI8 A;  3CVL A;  4B8C B;  2R05 A;  2ZIR A;  5KJN A;  3E30 A;  1EF1 C;  3TWS A;  3HIZ A;  2WXQ A;  4JW1 A;  4N3B A;  3J5Q B;  2P9U G;  3ZHE B;  4J8F A;  5AEN A;  4K5B A;  4BFR A;  4GAA A;  2XZD G;  3ZHE A;  2VGX A;  4L2L A;  5CRV A;  3FHE A;  1IKN D;  3LJ3 A;  4APO A;  3UQ3 A;  4I1A A;  5KNG A;  3B13 A;  1UJJ A;  4UWG A;  3MV2 B;  1E90 A;  3ZYK A;  3KSQ A;  1K1B A;  2MOW A;  3NAW A;  3C98 A;  4LG6 A;  4I9E A;  4ILG A;  1N0R A;  3DRA A;  3PEV B;  2CG3 A;  5FZR A;  4MKT A;  2MHK A;  1TN6 A;  3SI5 A;  3UIN C;  3MKR A;  3JXJ A;  4AV7 A;  3UM3 A;  5EIL A;  4EZJ A;  5C2Y A;  4XKC A;  3I5P A;  4LSZ E;  3CST A;  3AG4 E;  1N54 A;  2WQ7 A;  1KT0 A;  4U96 D;  4A1G A;  4YDW A;  2FBN A;  3S7F A;  1PAQ A;  3T5V A;  3J5P A;  1FVH A;  3WG7 E;  5HQ8 A;  2QYJ A;  3OXL A;  5AJD A;  2GRQ B;  1SVX A;  4GZ5 A;  2ETA A;  1FT2 A;  3RRN B;  3EHQ A;  5B1B E;  4G26 A;  5FWQ A;  1BPO A;  2YHC A;  4ATG A;  3NZS A;  3ZN3 A;  3CK7 A;  2HR2 A;  3ISM C;  5JHA A;  3EHR A;  4ME2 A;  2OVF A;  2IY0 C;  2IOL A;  3R9A B;  4F53 A;  3ASD A;  3UKU G;  2GGF A;  3D9O A;  3LPZ A;  4HOS A;  3TWX A;  3AS5 A;  3DSW A;  1TNB A;  4GTR A;  1ZB1 A;  3HXF A;  4O1O A;  3E32 A;  3UIP C;  4GTM A;  4EZL A;  1SW6 A;  3R7R A;  4HLL A;  2YQ8 A;  2P58 C;  5ENQ D;  2X3M A;  5M72 A;  3W9G A;  5FZS A;  4ATZ D;  2GRP B;  3EIQ C;  3LY8 A;  4AEZ C;  4OAU C;  4FLH A;  4J0U A;  3RKV A;  4FJY A;  5HKP A;  1BU9 A;  3O4Z A;  5FQ8 A;  4CDN A;  2J07 A;  4N39 A;  3JCK C;  2Y3A A;  1MYO A;  4I2W A;  1KZO A;  2XQ0 A;  1HS6 A;  2WXG A;  3FEY A;  3HDX A;  1PY1 A;  1QZ2 A;  3FFL A;  4JPS A;  2GRR B;  4UWL A;  4O1P A;  4CGV A;  1N11 A;  1E96 B;  1VDY A;  1KPS B;  3PDN A;  4UWF A;  5DBK A;  1A17 A;  4JD2 G;  2H6G A;  3UIO C;  3AS8 A;  3ONL A;  3RJV A;  3TWU A;  4AP2 A;  2JAB A;  3ZGQ A;  3CR3 A;  5ENT D;  2KAT A;  4DX1 A;  3LVQ E;  4WWN A;  3FH7 A;  1QNF A;  3BU8 A;  5FQ7 A;  2Y4U A;  4BX9 A;  4BET A;  4GU5 A;  3QJZ A;  1MQS A;  3PVL A;  3F6Q A;  4UQZ A;  3ZU7 B;  1OWN A;  4PUC A;  2VSO E;  3HHM A;  4GTP A;  3UM2 A;  4GA0 A;  3UM0 A;  2OOE A;  2EIK E;  4AXH A;  4NIK A;  3DEO A;  5T4Y A;  2ZIS A;  4JL0 A;  2V0P A;  5JA4 D;  1ELW A;  4JHR A;  2XEV A;  3CHR A;  3FU3 A;  3HVE A;  2EIL E;  4GTV A;  2MYO A;  4I6J A;  3FUM A;  1HO8 A;  4NUR A;  5A7D B;  3APF A;  1K3Z D;  2NSZ A;  2R2L A;  4U63 A;  3X2Q E;  2JLB A;  1BD8 A;  4Q96 A;  3UI2 A;  2GRL A;  3ABL E;  3LY9 A;  3HXC A;  2ZGD A;  3PE4 A;  2XZT G;  3RRU A;  2CFU A;  2X6I A;  3NOC D;  1UN9 A;  2DCP A;  3CK9 A;  5CEA A;  2XS8 A;  4GA2 A;  3U64 A;  4GTT A;  3QDN A;  3TWQ A;  2VSX E;  2LO6 A;  2M63 A;  3U9W A;  3R7Q A;  2RKK A;  4DPR A;  3C3Q A;  3OAW A;  2LAH A;  1SA5 A;  4I2Z A;  3TWV A;  2IFU A;  1U3D A;  1ZBP A;  5D0Q D;  4YDE A;  4I6E A;  2BUG A;  3UX4 A;  3PNL B;  5LX8 A;  2J9Q A;  3CVQ A;  2WM9 A;  2XPZ A;  1TNO A;  5ARG A;  1Z3Y A;  1TR4 A;  3KAE A;  2R59 A;  5EN5 D;  4HNA D;  3GZ1 A;  2YHE A;  2OEV A;  4EBA G;  4PH4 B;  1ELK A;  2XHE A;  2OVB A;  4JA9 A;  3V31 A;  3HXB A;  4F3V A;  2EIJ E;  3LY7 A;  3TWT A;  4DX5 D;  1Y6I A;  3ML8 A;  3TWR A;  4IUL A;  4B94 A;  4ACL A;  2P9N G;  1TJF A;  4ZHB A;  1TEZ A;  3DSV A;  3K9I A;  3I4R B;  2V5Q C;  4Z68 A;  5FT9 A;  5BUZ A;  1RZ4 A;  3LDZ A;  4GZ6 A;  5BXU A;  3L54 A;  4LNU D;  4LNB A;  2IU1 A;  2P9I G;  3AAA C;  2AWI A;  3B95 A;  5AQ7 A;  1YA0 A;  3EHN A;  4L2Y A;  4CDM A;  3SFY A;  3ESK A;  4ACK A;  4WNG A;  4H7X A;  1N0Q A;  3QB2 A;  1H6K A;  5FJY A;  2C0L A;  3SGH A;  5EID A;  3RO2 A;  1OWL A;  4RSY A;  1MZC A;  4DLQ A;  1S63 A;  3HG0 D;  4JVS A;  1TYQ G;  1H2V C;  4F6R D;  1TJC A;  3JYS A;  2X6F A;  3CV0 A;  2Y69 E;  1MX6 A;  1LTX A;  2H6I A;  2P2C P;  4GTS A;  4C0M A;  4CT0 A;  5ENN A;  1JCR A;  3CK8 A;  1OCR E;  3RSE G;  4TXR A;  4JXT A;  4FC8 A;  2X38 A;  3Q73 A;  4OYS A;  3DXM G;  2DVW A;  5G55 A;  2R02 A;  2L6B A;  4JZY A;  1JPL A;  1YYH A;  1GW6 A;  1KT1 A;  4Y6C A;  4GTQ A;  4GPM A;  4ILI A;  4GYO A;  2WQ6 A;  3EU9 A;  1IXV A;  3DST A;  5BNW A;  1OCC E;  1FPP A;  3KSL A;  4AOF A;  2IEJ A;  3TGO A;  4KVM A;  4ABN A;  3CHS A;  3P2B A;  3MKQ B;  3SHF A;  3MA5 A;  1DCQ A;  2WXH A;  5BPP A;  3Q78 A;  3MKQ A;  2VJ8 A;  1JCS A;  4CCA A;  4TUM A;  1HG2 A;  3EU5 A;  1OY3 D;  2EIN E;  4F1P A;  4BY6 A;  4DK5 A;  1MJ0 A;  2XRY A;  3FH5 A;  4UWK A;  3ZXP A;  1O1R A;  3D3M A;  3CVP A;  5AAO A;  4J8E A;  4KVO A;  2Y4T A;  4G24 A;  1UN8 A;  5FQ4 A;  3UT8 A;  2LSV A;  4LRZ A;  5D0O D;  3C72 A;  3HRA A;  4J6I A;  4XEI G;  2VGX B;  3PZ3 A;  1Y8M A;  3AS4 A;  2JEK A;  2LAI A;  3HXD A;  1E8Y A;  3L22 A;  4OVV A;  2IF4 A;  3G2U A;  1N95 A;  2HYZ A;  3T5X A;  5KCM A;  5HI7 A;  1WM5 A;  3ZFW A;  4J8S A;  1TN8 A;  2KCK A;  4XX5 A;  4ANX A;  1QBQ A;  4RQI A;  4AIF A;  4O6F A;  4H7Y A;  5CER B;  2PM7 A;  2GW1 A;  4QFV A;  3LS8 A;  3TL5 A;  5IY5 E;  4ANU A;  4I1M A;  4N5Q A;  4IN3 B;  1TN7 A;  2IJG X;  3ZXS A;  2Y1L E;  4RG9 A;  5LOZ A;  4AY6 A;  4BSX A;  1NI1 A;  3NB2 A;  2RFA A;  5G04 J;  4L7T A;  2HO1 A;  1Z3X A;  4HRN A;  2OV8 A;  3V2X A;  2KCV A;  5G04 C;  4ILH B;  4HB5 A;  4HVB A;  1O1S A;  3MCX A; 
#chains in the Genus database with same CATH homology
 4RVB A;  1E96 B;  1X5B A;  1VDY A;  4FHJ A;  1JWG A;  3PDN A;  4UWF A;  3FTZ A;  3PZD A;  3GYZ A;  5DBK A;  1A17 A;  3DPD A;  3PRE A;  4UWH A;  4CT4 A;  4FLB A;  4PS8 A;  4GPK A;  4JA7 A;  2OND A;  5ANR A;  3MX3 A;  2L0I A;  1OWP A;  1S0P A;  3AS8 A;  3ESL A;  4DLO A;  3ONL A;  2HM8 A;  1FVF A;  3RJV A;  1NA3 A;  4A3T A;  3L17 A;  3HYM B;  4AP2 A;  4Q69 A;  1INZ A;  3ZGQ A;  1WAO 1;  4GCN A;  3SBT B;  3CHP A;  3CR3 A;  3TAX A;  2KAT A;  3LVQ E;  3LCA A;  3O48 A;  5BV1 A;  3RK6 A;  4WWN A;  3FH7 A;  3E4B A;  3D9M A;  4APF A;  1QNF A;  3VLE A;  3TG4 A;  5FQ7 A;  2Y4U A;  2Q7F A;  1QQE A;  2C2L A;  4BX9 A;  3MGB A;  3AU5 A;  4GU5 A;  4DI3 A;  2ION A;  4HOU A;  3QJZ A;  2IQC A;  1MQS A;  4U07 A;  1HU3 A;  3G2V A;  1OUV A;  2RG8 A;  1E7V A;  3PVL A;  4BTA A;  3RO3 A;  1L5J A;  4XIF A;  4WNE A;  4K03 A;  4UQZ A;  4KT6 B;  1OWN A;  1U3C A;  3QKY A;  4WUY A;  3CEQ A;  4XI0 A;  4PUC A;  3FP3 A;  2VSO E;  3HHM A;  4NAC A;  1JUQ A;  3ASG A;  4AY5 A;  4B8A A;  4MRU A;  1SZ9 A;  1WY6 A;  4GA0 A;  3ENE A;  2UWJ G;  4A3V A;  4CDR A;  3PE3 A;  1EDU A;  2OOE A;  1B89 A;  4CEM A;  3FUN A;  3L16 A;  2J4D A;  3S2A A;  4OVU A;  4AXH A;  2E0I A;  4FAD A;  5EDS A;  3UPV A;  2KCL A;  2V4L A;  4GML A;  5T4Y A;  1LF8 A;  4TRQ A;  2BTD A;  3D9L A;  4JL0 A;  4XI9 A;  2V0P A;  3SD5 A;  4C0E A;  3B7T A;  1NP7 A;  3D9K A;  1ELW A;  4GA1 A;  1P5Q A;  4G11 A;  4G1T A;  4JHR A;  4HOR A;  2XEV A;  3CHR A;  3FU3 A;  3HVE A;  3FTS A;  4HS2 A;  4I6J A;  2VTB B;  3FUM A;  4AJW A;  2XRZ A;  4WND A;  1HO8 A;  3IV0 A;  3PS6 A;  4JHK A;  2XPI A;  3NQP A;  4NUR A;  5A7D B;  4KZ0 A;  3VLF A;  3OXG A;  3CVW A;  3APF A;  3AU4 A;  2FF4 A;  2QFC A;  5EX0 A;  2NSZ A;  1HE8 A;  3FTY A;  4U63 A;  2VTB A;  2JLB A;  4BT9 A;  3FEX A;  4Q96 A;  2GRL A;  5DIZ A;  1HF8 A;  2ILR A;  3LY9 A;  1JWF A;  1E8X A;  4FA6 A;  1W3B A;  3VTY A;  1E7U A;  4R7L A;  3PE4 A;  4HLE A;  5J08 A;  5LP0 A;  3B7S A;  2IOS A;  3LKU A;  3RU0 A;  5JJT A;  5JHB A;  4GZD A;  3RRU A;  3QK0 A;  3MEK A;  3CIA A;  3CVX A;  4BT8 A;  3GW4 A;  3PH0 C;  2CFU A;  2C0M A;  3QAR A;  4GYY A;  4UQY A;  4EBA A;  2X6I A;  4HXI A;  5BT1 A;  1UN9 A;  5LFA A;  2DCP A;  3LYA A;  3CK9 A;  5G05 J;  4V3I A;  2PQN A;  3D9J A;  3FU6 A;  3IBE A;  4GA2 A;  3U64 A;  4MS6 A;  5G05 C;  2XGO A;  3QDN A;  4XZ4 A;  5KJM A;  1H19 A;  2FUL A;  2AXZ A;  2VSX E;  4U0Z A;  5CMY A;  4EPZ A;  2LO6 A;  2M63 A;  4L1B A;  3U9W A;  3LVR E;  4YVQ C;  2AXV A;  3R7Q A;  3UUX A;  4FJZ A;  2WQH A;  4Y6W A;  3L08 A;  4DPR A;  3FUH A;  5CCL A;  3OAW A;  2LAH A;  2RD0 A;  5LCW J;  4I2Z A;  4BWR A;  3CGH A;  2IFU A;  2WXJ A;  1U3D A;  3FY4 A;  5LCW C;  3KD7 A;  4N2Q A;  1ZBP A;  2I1J A;  2AXU A;  5JJ7 A;  3URZ A;  3G2T A;  2X6J A;  3CLJ A;  4WNF A;  4I43 A;  4I6E A;  5D0Q D;  3RIB A;  3FUJ A;  5A23 A;  2BUG A;  4YND A;  4AVX A;  2WB2 A;  2WXL A;  4N2S A;  3CKC A;  4EEC A;  3UX4 A;  3PNL B;  3UT4 A;  5LX8 A;  3ZPJ A;  1HZ4 A;  2J9Q A;  4I9C A;  5KJL A;  3CVQ A;  2WM9 A;  3LXU X;  2XPZ A;  5ARG A;  3APD A;  5ANL A;  1Z3Y A;  4XKB A;  1EPU A;  3KAE A;  4EQF A;  1HH8 A;  2R59 A;  3CVN A;  1EYH A;  3CKB A;  3I4G A;  3GZ1 A;  2YHE A;  3EDT B;  3ONK A;  3KEZ A;  4BX8 A;  4TV3 A;  4EBA G;  4FUL A;  1DNP A;  3PRZ A;  3FTX A;  3NZU A;  1ELK A;  2I2O A;  4PH4 B;  2XHE A;  2OVB A;  5J90 A;  3GZ2 A;  4N3C A;  2FEZ A;  4JHJ A;  3PUJ A;  3IEG A;  4GZC A;  2UY1 B;  3B7R L;  1DVP A;  2PL2 A;  2NC9 A;  4JA9 A;  5CCM A;  3JQ0 A;  4IYP A;  3KS2 A;  4F3V A;  2DIW A;  2WXN A;  2A5U A;  1SZA A;  3LY7 A;  4HOT A;  3I3N A;  1Y6I A;  2WPV A;  2ZU6 B;  3CHM A;  5EKQ D;  2J4B A;  3FUI A;  3ML8 A;  4D10 C;  3OXF A;  2BF0 X;  4UI9 J;  2VSN A;  2WXO A;  3CSF A;  2UY1 A;  4XE0 A;  4IUL A;  4B94 A;  2KC7 A;  4UI9 C;  3NF1 A;  1HXI A;  2V8S E;  1Z6T A;  3IHY A;  3ZEF A;  4ANW A;  3FWV A;  2I9C A;  4ACL A;  2WVI A;  2A4Z A;  2KZT B;  1TJF A;  3Q4A B;  3UMV A;  1TEZ A;  3K9I A;  3QNK A;  5KJK A;  5BV0 A;  2YNQ A;  3I4R B;  2X6K A;  3FTW A;  5FT9 A;  3WXX A;  3QWP A;  4I6G A;  5BUZ A;  2XCC A;  3FUD A;  3LDZ A;  2KZT A;  3P1U A;  1H2T C;  5AJL A;  4TUU A;  3B7U X;  5FQ6 A;  4UQX A;  3TXM A;  4GZ6 A;  3CVL A;  3G2S A;  4B8C B;  3HVE B;  5FTP A;  3L54 A;  5KJN A;  1HG5 A;  1EF1 C;  2IU1 A;  1KLX A;  3FTV A;  4DJA A;  3D9I A;  2AWI A;  3CVU A;  3ZVV A;  3HIZ A;  4KYO B;  4G25 A;  5AIJ A;  1YA0 A;  5A6C A;  3EHN A;  2R5S A;  2LNI A;  2WXQ A;  4GCO A;  4L2Y A;  4JW1 A;  4CDM A;  3FUL A;  3ESK A;  3U4T A;  4N3B A;  4B89 A;  4DI4 A;  4ACK A;  3Q49 B;  4WNG A;  3FU0 A;  4H7X A;  4ANV A;  3ZHE B;  4J8F A;  4E85 A;  3FDH A;  1H6K A;  2R17 C;  3QB2 A;  3MJW A;  4F7A A;  5AEN A;  5FJY A;  2C0L A;  3SGH A;  4GMJ A;  3SFZ A;  3G2W A;  3BEE A;  2WXP A;  3MV3 B;  3APC A;  1IYG A;  3RO2 A;  1OWL A;  4WWP A;  4BFR A;  2XGM A;  4GAA A;  4RSY A;  3RRM B;  3ZHE A;  2VYI A;  2J09 A;  2VGX A;  4L2L A;  4DLQ A;  4WWO A;  3GZS A;  4JVS A;  3FHE A;  4K0R A;  1H2V C;  2V5F A;  3SNX A;  1TJC A;  3LJ3 A;  4IRU A;  4KBQ A;  3JYS A;  4KXK B;  4APO A;  2X6F A;  3LEW A;  3UQ3 A;  3VLD A;  4I1A A;  4Q94 A;  2XCB A;  4M3O A;  3ZRH A;  3CV0 A;  1SQM A;  3FH8 A;  3B13 A;  1UJJ A;  2WXR A;  4UWG A;  1PC2 A;  2DBA A;  3MV2 B;  4YVO A;  3ASH A;  3DBS A;  4C0M A;  1E90 A;  1NA0 A;  2I1K A;  3ZYK A;  2WMN A;  4CT0 A;  5JJ6 A;  5ENN A;  3CQC B;  4LER A;  2MOW A;  3CK8 A;  3EHM A;  5EX3 A;  4U0U A;  3C98 A;  4LUN U;  2MRI A;  4JXT A;  4FC8 A;  4I9E A;  4ILG A;  2L9B A;  1UW4 B;  4HOQ A;  5CMW A;  3PEV B;  2CG3 A;  2X38 A;  5FZR A;  1OWO A;  4MKT A;  5FZQ A;  2MHK A;  4FU3 A;  4OYS A;  2CG2 A;  4FP7 A;  3SI5 A;  2YIN A;  3MKR A;  5G55 A;  4P29 A;  3T8M A;  1HX8 A;  1UG3 A;  2PZI A;  2XPY A;  2NXP A;  4A55 A;  4AV7 A;  3CVY A;  3ZIM A;  4JZY A;  1JPL A;  1N52 A;  1GW6 A;  2FO7 A;  1KT1 A;  4EZJ A;  4Y6C A;  5C2Y A;  3Q5M A;  4XKC A;  4N3A A;  3I5P A;  4ILI A;  4GYO A;  3CST A;  1N54 A;  4U0S A;  5AYW D;  2WQ6 A;  2CFZ A;  1KT0 A;  2KM4 A;  4L23 A;  2WQ7 A;  4A1G A;  5BNW A;  1HFA A;  2L6J A;  2FBN A;  2WXI A;  3PEU B;  2I6H A;  4W9R A;  3S7F A;  4AOF A;  1PAQ A;  3Q47 B;  5G2N A;  3T5V A;  4KVM A;  4ABN A;  3TGO A;  3CHS A;  3P2B A;  4UI9 K;  3BG1 B;  1XGW A;  4LEU A;  4CRW A;  1IQR A;  1FVH A;  1H0A A;  1E8Z A;  3MKQ B;  3SHF A;  2FI7 A;  3SZ7 A;  5E76 A;  5HQ8 A;  2E2E A;  4JEU A;  1MHQ A;  3OXL A;  2AVP A;  3MA5 A;  3PUK A;  2L0T B;  3IHV A;  5AJD A;  2WXH A;  5BPP A;  3FTU A;  2PM6 A;  3FUF A;  3MKQ A;  1ZU2 A;  3QWV A;  4KZC A;  4N5C A;  2VJ8 A;  4PDX A;  3TXN A;  4CGW A;  3ZYQ A;  4CCA A;  3S7D A;  1IHG A;  1HG2 A;  4URK A;  2LSU A;  4GZ5 A;  4NQ0 A;  3UT7 A;  4GZ3 A;  2XGS A;  1NZN A;  4JEH A;  4BY6 A;  3EJN A;  4PS3 A;  3RRN B;  3CHQ A;  3QWW A;  4DK5 A;  4HFG A;  2XRY A;  4G26 A;  4G23 A;  4MLP A;  5FWQ A;  2J08 A;  4EZK A;  3FH5 A;  5ARF A;  1BPO A;  4UWK A;  3S7B A;  2YHC A;  4ATG A;  3NZS A;  4JC8 A;  3ZN3 A;  3CK7 A;  2HR2 A;  3D3M A;  5JHA A;  3CVP A;  2AW6 A;  2WXF A;  3ZYL A;  4J8E A;  2X6H A;  4KVO A;  3ZW3 A;  3D9P A;  3PNT B;  1UJK A;  2Y4T A;  1XNF A;  4ME2 A;  3ASF A;  4C9B B;  2WXK A;  4G24 A;  1UN8 A;  5FQ4 A;  3UT8 A;  2OVF A;  3TJP A;  4GYW A;  2LSV A;  3L13 A;  2IOL A;  4LRZ A;  1IQU A;  5D0O D;  3L6A A;  4NRH B;  3CQG B;  3R9A B;  3TG5 A;  4A1S A;  4F53 A;  2CHW A;  4J6I A;  4J8D A;  2VGX B;  3S7J A;  3ASD A;  1Y8M A;  1OWM A;  2GGF A;  2VQ2 A;  2VSY A;  2JEK A;  3AS4 A;  3D9O A;  3FU5 A;  2LAI A;  3LPZ A;  4GB9 A;  4U04 A;  4HOS A;  3ZYM A;  4B0Z A;  1E8Y A;  3L22 A;  4OVV A;  5E75 A;  1FCH A;  3AS5 A;  4WAF A;  3MYV A;  1ELR A;  2IF4 A;  3G2U A;  2HYZ A;  2VGY A;  3T5X A;  3FUE A;  5KCM A;  4EZL A;  3VTX A;  3IKO B;  5HI7 A;  4RG6 A;  3R7R A;  4F1S A;  4AM9 A;  5T8I A;  1WM5 A;  2YQ8 A;  3ZFW A;  2P58 C;  4J8S A;  3OTN A;  2QY7 A;  2KCK A;  4XX5 A;  2X3M A;  4ANX A;  5M72 A;  5CHE E;  3U3W A;  4FHK A;  5FZS A;  4AIF A;  5C1D A;  3EIQ C;  2WXM A;  2PQR A;  3LY8 A;  4AEZ C;  3QC1 A;  4G2V A;  4O6F A;  4H7Y A;  3N71 A;  4I17 A;  2PM7 A;  4E6H A;  2GW1 A;  4QFV A;  3Q15 A;  3LS8 A;  3ML9 A;  4FLH A;  4J0U A;  4LCT A;  3TL5 A;  2WMO A;  4ANU A;  4I1M A;  3RKV A;  3MZL B;  4IN3 B;  4FJY A;  2IJG X;  3SBS A;  3SF4 A;  3ULQ A;  3ZXS A;  3O4Z A;  3EIJ A;  4I1O B;  3QOU A;  2CHZ A;  5FQ8 A;  4CDN A;  3CVV A;  2EQX A;  2J07 A;  4N39 A;  3CHO A;  3JCK C;  4RG9 A;  4U8H A;  2J49 A;  4PS7 A;  2Y3A A;  5LOZ A;  4BSX A;  4AY6 A;  1H2U A;  4I2W A;  2XQ0 A;  3D9N A;  2HO1 A;  1HS6 A;  1Z3X A;  4L7T A;  2WXG A;  5G04 J;  2OV8 A;  3U66 A;  3BG0 B;  3FEY A;  3FUK A;  2KCV A;  5G04 C;  3HDX A;  1PY1 A;  1QZ2 A;  3FFL A;  4JPS A;  4ILH B;  5BW8 C;  2CHX A;  4UWL A;  4CGV A;  5T3R A;  3QAQ A;  4HVB A;  2GRM A;  4KMO A;  3JUI A;  3JQ1 A;  3MCX A;  4BTB A;  1E8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...