5M72A

Structure of the human srp68-72 protein-binding domain complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
150
structure length
150
Chain Sequence
SVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Signal recognition particle subunit SRP72
publication title Structures of human SRP72 complexes provide insights into SRP RNA remodeling and ribosome interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17004 SRP_TPR_like Putative TPR-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5m72A00
5JJ6A 3MV2B 4GYWA 3QWVA 3RJVA 5LCWJ 2UY1A 3ZHEA 2XGOA 5HQ8A 3ULQA 4YNDA 3S7DA 3ASGA 4H7YA 3Q15A 4N39A 5KJMA 2PL2A 5G05C 3ZN3A 2HO1A 4BTBA 3Q5MA 2C0MA 4RG9A 4XI9A 1IYGA 4NQ0A 2GW1A 4N3CA 4GA1A 4J8FA 4G23A 3LY8A 2E2EA 4WNDA 1ZBPA 3OXLA 3Q4AB 2KCKA 2FI7A 4N2SA 3RO2A 2VQ2A 2XGMA 2VGXB 4NRHB 3Q49B 3Q47B 1TJCA 5D0QD 4UQZA 3PE3A 4W9RA 4HOSA 4AY5A 3ASFA 5ARGA 4APOA 5G04J 5D0OD 4F3VA 5FJYA 4J8DA 2I6HA 2C2LA 3CVPA 3GZ2A 3KAEA 3MKRA 4HOUA 2VSNA 1KT1A 4LEUA 1FCHA 4IN3B 5BW8C 1W3BA 3LKUA 4JA7A 4I1AA 4UI9J 3GZ1A 3AS5A 5FZSA 2KC7A 4RG6A 5DIZA 5CCLA 3ASDA 2YQ8A 3CK9A 4XI0A 2P58C 5A7DB 3NF1A 5KJLA 3MEKA 4U07A 3MA5A 3QWPA 2JLBA 4J0UA 2J9QA 4UQXA 4BTAA 4KBQA 4YVQC 2WPVA 1P5QA 4GYYA 5EKQD 5JJTA 5M72A 1NA0A 4N3AA 3CK7A 4Y6WA 3FFLA 4WNGA 3FWVA 4GZ3A 2FBNA 3CVLA 4ME2A 2YHCA 1ELWA 2LSVA 3ZFWA 4H7XA 3PE4A 4ABNA 1Y8MA 3RU0A 4WNEA 5CCMA 4CGVA 4BWRA 2IF4A 4HORA 2V5FA 5G05J 5KJKA 3QWWA 3AS4A 3VTYA 1QQEA 2KCVA 3K9IA 2PQNA 1ELRA 3CVQA 3EDTB 2PZIA 5JJ7A 4U0SA 5HI7A 2WQHA 5BT1A 2XCBA 1PC2A 3KS2A 4JL0A 5EX3A 2KATA 4EQFA 4G1TA 3CV0A 1HZ4A 4O6FA 1OUVA 4I9CA 3UPVA 4JA9A 2LNIA 3R9AB 5FZQA 4I9EA 2QFCA 2UY1B 3ZHEB 4AM9A 3SZ7A 2Q7FA 3OXGA 4GPKA 1HH8A 2L6JA 2KCLA 4G26A 3LY9A 4GA2A 2ONDA 4GYOA 3JYSA 1WAO1 3ASHA 3LY7A 4AY6A 1NA3A 3ZPJA 2VGXA 1A17A 3LCAA 4GA0A 3SF4A 4I17A 5DBKA 3QDNA 4BT9A 3U4TA 4N2QA 4GZ6A 5FT9A 3BEEA 4Y6CA 4N5CA 5LCWC 2UWJG 4HOTA 4HOQA 3VTXA 1IHGA 2NC9A 3UUXA 2R5SA 1E96B 2VYIA 2DBAA 4J8EA 4U0UA 4UI9K 2IFUA 4N3BA 4G24A 1NZNA 3ZGQA 2XGSA 3QOUA 3TG4A 4WNFA 4CGWA 4A1SA 4KXKB 3ESKA 3LYAA 3TAXA 3TG5A 4GCOA 2Y4UA 3GYZA 4KYOB 2FEZA 2MHKA 3S7FA 4I2WA 5EX0A 2XPIA 4YVOA 2LSUA 3MV3B 3UQ3A 3QKYA 3GW4A 3U3WA 3OXFA 2FF4A 2Y4TA 4BT8A 3FP3A 3WXXA 4GZ5A 3RO3A 2VSYA 5KJNA 2HR2A 5BNWA 3N71A 1QZ2A 4B94A 5G04C 2FO7A 5FZRA 5AYWD 1YA0A 3CK8A 3HYMB 4UQYA 3PDNA 3IEGA 1KT0A 3CKCA 3RIBA 3S7JA 5C1DA 2XCCA 2VGYA 2BUGA 4JHRA 4UI9C 3KD7A 5ARFA 4AIFA 3RKVA 5FTPA 1B89A 4I2ZA 3CEQA 2OOEA 5A6CA 4WUYA 3S7BA 2XEVA 3E4BA 3O48A 4CDRA 3TGOA 3URZA 2PQRA 5CHEE 2HYZA 3AS8A 3CVNA 4U04A 4XIFA 1KLXA 1WM5A 4GCNA 4U0ZA 1ZU2A 3LPZA 4G2VA 1HXIA 2AVPA 2C0LA 3CKBA 4G25A 1XNFA
chains in the Genus database with same CATH superfamily
5JJ6A 2DYSE 5AIJA 2PM6A 3GZSA 3FTUA 2XZDG 1TN8A 2OV8A 3DSWA 3B7UX 1HO8A 3CLJA 5EDSA 5LX8A 3PUKA 3UM0A 4V3IA 1TNZA 3C5RA 5KJMA 3F6QA 3T5XA 1MX6A 1K1BA 2IJGX 3VLEA 3QARA 5ENOD 2NYJA 4OAVB 1BPOA 3QK0A 1O1TA 2X3MA 1QNFA 1HG5A 3ZYKA 4N3CA 4PH4B 3FTSA 5E76A 2BKKB 2KCKA 3G2WA 2FI7A 1UN8A 1X81A 4N2SA 1JUQA 3V2XA 3Q49B 2X6JA 1MX4A 3CR3A 4DX1A 1LD8A 5ARGA 4MBGA 3PZDA 5CBOA 5D0OD 5J08A 5FJYA 2IOLA 3UX4A 1IXVA 3G2TA 3AG3E 2C2LA 3CVPA 5EILA 4DPRA 3IXEA 1FCHA 3OAWA 3UIPC 4JW1A 1TNBA 3HHMA 4LNGA 2KC7A 3IHYA 5CCLA 3DSXA 4RLYA 4TXRA 3NZSA 2P9NG 5D2MC 5JMND 2WXGA 4LG6A 1IKND 1QBQA 2Y1LE 5KJLA 3MEKA 3UM3A 3D9LA 4KZCA 1BU9A 2JLBA 4YVQC 4C0EA 2V5QC 4O60A 1P5QA 3CGHA 3ABME 5EKQD 3CK7A 3FFLA 3PZ1A 3FWVA 2WQ7A 2IO3C 4YDOA 2P9LG 2YHCA 3JCKC 1ELWA 3ZFWA 3LDZA 4ABNA 1Y8MA 3CVWA 1TNYA 3RU0A 3AG4E 4WNEA 4YDWA 1EF1C 5G05J 2B0OE 5KJKA 2YNQA 3UKUG 1YYHA 3DEPA 3EJNA 1AP7A 3CQCB 5ITZF 3LVQE 1QQEA 2P9IG 2KCVA 5G2NA 5AAOA 3S2AA 2PQNA 1ELRA 1HU3A 3EDTB 4JVSA 4GU5A 2AXUA 3Q78A 5ENQD 4TUMA 1PC2A 3C3RA 5B1BE 2ZGGA 1TEZA 4Z68A 5EX3A 4ANXA 3V30A 1HG2A 2F37A 1SZAA 3ZKJA 3L22A 1KPSB 1RZ4A 4HVBA 4BEPA 3R9AB 3OTNA 4UWFA 1OCRE 2L6BA 2QFCA 2UY1B 3SZ7A 1SZ9A 2Q7FA 4G8KA 1UN9A 4ZFHA 2KCLA 3FUIA 3LY9A 2IU1A 2ONDA 2DWZA 3FU6A 4AY6A 4OAUC 3ZPJA 3CVYA 2P9UG 4HBDA 4AOFA 4XX5A 1SW6A 4I6GA 4GTPA 2PM7A 5AQAA 2ZISA 4U96D 4GA0A 4JEHA 1H2VC 2CHWA 5DBKA 4O1PA 3AU5A 4BT9A 4N2QA 2PNNA 5FINA 4N5CA 4HOTA 4JD2G 2J07A 3RRUA 2J49A 4U63A 3MGBA 3TWWA 2NC9A 3UUXA 4DX2A 1HF8A 2VYIA 4JEUA 4A3VA 4J8EA 2IFUA 4N3BA 1NL4A 4G24A 3ENEA 3QOUA 3TG4A 2XHEA 3QB2A 2RKKA 4RQIA 4CT4A 3GYZA 2FEZA 3S7FA 3EUVA 2XPIA 3LEWA 4YVOA 3TL5A 1N0QA 4CDMA 2WXHA 3FUJA 1N11A 4JC8A 3NAWA 2Y4TA 2A4ZA 3BQOA 3FP3A 4GZ5A 3RO3A 2VSYA 1LTXA 1K1AA 3ZYLA 4B94A 2EINE 3SY2A 3CK8A 3HYMB 3W9FA 3HXFA 3CKCA 3RIBA 4LSZE 3UMVA 4HLLA 3UINC 4IULA 1Y6IA 3D9JA 3FTYA 4ZHBA 2MRIA 3PZ2A 4JHRA 4UI9C 3SFYA 2F8XK 4GMLA 3ML8A 1TNOA 3ZYMA 3FUEA 3MX3A 1A5EA 2RFAA 1N4RA 1B89A 3FY4A 1OWPA 2OOEA 3O48A 2NSZA 2EIJE 1N4PA 3PNTB 2HYZA 3RRNB 3CVNA 2DYRE 3Q9NC 1G3NB 4XIFA 2R17C 4U0ZA 3B7TA 3IBEA 4L9PA 3L17A 5EIDA 3HDXA 3ULYA 2XPZA 2C0LA 1XNFA 4F7AA 3W9GA 1OWNA 4B8AA 3AU4A 4URKA 3RJVA 5LCWJ 2UY1A 4YDEA 4LUNU 4YNDA 4AV7A 3S7DA 3L9TA 2RFMA 4H7YA 3V79K 2RG8A 3MYVA 1E7UA 3HVEB 3C98A 3DBSA 2BEDA 3APFA 3HXCA 3VLFA 2EQXA 2H6GA 2HO1A 4BSXA 2C0MA 3PEUB 1Z3YA 3IHVA 2J8SD 4B93B 4XI9A 1IYGA 4K5BA 4XZ4A 5JA4D 4J6IA 4GA1A 2XEHA 4PS8A 3FEYA 4G23A 3LY8A 2E2EA 2CFUA 2RD0A 4GTSA 3X2QE 3Q75A 1JWFA 4B0ZA 3FU3A 4UQZA 3PE3A 1DCEA 4AY5A 5FQ8A 1DCQA 5G04J 3FUFA 4F3VA 4J8DA 2ETAA 2XS1A 2XENA 3LXUX 3BUAA 3L54A 4HB5A 2VSNA 1KT1A 1BI7B 3D9HA 2LAIA 2GRLA 1E8YA 3L82A 3GZ1A 2IQCA 3AS5A 2IY0C 4RG6A 2A5UA 2WVIA 2CFZA 2YQ8A 4XI0A 2X6FA 2P58C 3UT7A 4FULA 5FIOA 1MYOA 3J5PA 2WXOA 2JABA 4HQDA 3QWPA 2I2OA 5EYPF 2J9QA 1JCRA 4WWOA 1SA5A 3SHFA 5FWQA 4L1BA 5JJTA 2EIKE 5M72A 1NA0A 4U95D 3MKQB 4FHKA 5CERB 4GZ3A 3T5VA 3I3NA 3FHEA 3UI2A 3RRMB 2M63A 3T8MA 2GRNB 4PDXA 2DZOA 2AXVA 3B7BA 4APFA 5CCMA 3FTVA 4CGVA 3I5PA 1U2VG 4BWRA 2I1JA 3QWWA 3EIJA 3FUKA 3AS4A 4ACLA 5EIBE 1LD7A 3K9IA 2Y0BG 2LXMA 3T9KA 3SBTB 1N9AA 2IONA 3PREA 5JJ7A 4LNBA 4C48B 1PAQA 3VLDA 3QNKA 5BT1A 3G2SA 5ENNA 3D9IA 3CSTA 4JL0A 4EQFA 3CQGB 3U9WA 4F1SA 1OUVA 4I9CA 2OVFA 1UG3A 1XGWA 1UW4B 3UPVA 2QYUA 4WWPA 3HVEA 4GAAA 4GTQA 3CVXA 2I9CA 5A23A 3OXGA 3E37A 4GPKA 4BY6A 3NBNB 2V8SE 4G26A 5BXUA 5LP0A 4GA2A 1OCCE 3PVLA 4GYOA 2F0YA 3JXIA 2VTBB 1WAO1 2R03A 3Q73A 5CECB 5JHAA 1UOHA 3D9KA 3ZU7B 1A17A 2R02A 3UT8A 3D3MA 4I17A 3QDNA 3L08A 4BFRA 4XE0A 4HFGA 2WXMA 4DX6D 4GZ6A 2LXLA 2WXIA 3UIOC 2UWJG 2EILE 5JHBA 2L9BA 2KBXA 1S64A 4AVXA 2WXKA 3SD5A 3FUHA 4B8CB 2H6HA 4DUIA 4UI9K 5J90A 3B7SA 1ZB1A 4JHKA 2GRPB 5D66A 5AQ7A 3ONLA 1U3DA 1X5BA 2L0TB 4KXKB 3ABLE 3ESKA 1Z6TA 4GPMA 4KYOB 3Q79A 2MHKA 3T8KA 2X6HA 4XKBA 1OT8A 4IRUA 3QKYA 3GW4A 3OXFA 4K5AB 3RAUA 5C2YA 2FF4A 1KZOA 3DSVA 3AG2E 2LO6A 3MKQA 2HR2A 1RW2A 3TWRA 1QZ2A 2ZXWE 4TUUA 3PRZA 1UJKA 4YDYA 5FZRA 4JZYA 4GTOA 1MX2A 1YA0A 4K5CA 4GTMA 1BD8A 1N4QA 3FH8A 1JCSA 3PDNA 2B6CA 1VDYA 4TXPA 3ZXSA 3S7JA 5C1DA 2XCCA 4CDNA 2BUGA 5LFAA 1OCOE 4L23A 2V0PA 3KD7A 4BESA 4EPZA 2WXNA 4AIFA 4NURA 1EYHA 3TJPA 1IHBA 1JCQA 5FTPA 2H6IA 3APCA 2R2LA 4I2ZA 1TYQG 3JQ1A 3EIQC 4CDRA 3E4BA 3HXEA 4F6RD 2PQRA 4FHJA 5CHEE 4G11A 1WG0A 1HFAA 4GMJA 3PS6A 4I6EA 3DPDA 5ENTD 4GCNA 4I6JA 5HS0A 1L5JA 3FH5A 3MZLB 5EN5D 2GRRB 3LPZA 3LS8A 4GYWA 1YMPA 3QWVA 1WY6A 4GTVA 2FULA 2J4DA 3ULQA 4FADA 5CMYA 4KZ0A 4HLEA 3ZNGA 4DX5D 1TN7A 3Q15A 2WXQA 4N39A 3LJNA 1N4SA 1O5MA 1N95A 3ZN3A 2X6IA 3KSLA 2VTBA 4JXTA 3PZ3A 3Q5MA 3E33A 1FVFA 3B13A 2NXPA 3P2BA 4NACA 4UWKA 4NQ0A 5KBAA 2GW1A 2Y69E 3E30A 4WNDA 1E7VA 3RK6A 5CBNA 2VGEA 2VQ2A 2XGMA 2VGXB 4J8YA 4BERA 5G55A 3Q47B 1N54A 1TJCA 5D0QD 1OWLA 3EHRA 3NQPA 3U66A 4HOSA 4LRZA 4ILHB 2GGFA 1O1SA 4OVUA 2I6HA 3MKRA 3SNXA 1DNPA 3FUMA 5BV1A 1H19A 4XEIG 2OVBA 5BW8C 4TRQA 3LKUA 4JA7A 3ZVVA 4I1AA 3CHPA 4UI9J 4XKCA 5FZSA 4C9BB 1S70B 3FULA 5DIZA 2HE0A 3ASDA 4CEMA 2IOSA 1JPLA 5CMWA 1Z3XA 5A7DB 4EBAG 4WAFA 2LUHA 3ABKE 3B95A 3FTXA 4GTTA 4J0UA 2WPVA 3J5QB 1N0RA 2DCPA 3CHSA 4L2LA 5T8IA 4F1PA 4N3AA 3V31A 4WNGA 2DZNA 4JB8P 3QJZA 4ANVA 2BKGA 3CVLA 4TV3A 3DRAA 2FO1E 5CEDB 2OEWA 1MZCA 2LSVA 5BUZA 4H7XA 2AJAA 3PE4A 1OWOA 3C3OA 1SVXA 5LOZA 4AP2A 3DSUA 3AAAC 4GMRA 5AARA 4L2YA 4U8HA 4M3OA 3I4GA 1MJ0A 4DI3A 1H2TC 3EHQA 4U8VD 4K03A 1K8KG 1OY3D 4FLHA 2F8YA 2WQ6A 4A55A 4Q96A 1S0PA 3DSSA 3TWVA 2WQHA 2XCBA 2KATA 4E6HA 3CV0A 5AQ9A 4OYSA 1PY1A 3SFXA 3MCXA 4DJAA 1BLXB 2P2CP 3ML9A 2LNIA 4P29A 3ZHEB 4AM9A 3BG1B 1INZA 5ANLA 3IKOB 2L6JA 3SI5A 1E90A 3ESLA 2L0IA 4GZDA 5ENRD 3I4RB 3JUIA 5KCMA 3C3QA 4AXHA 3QAQA 2WMOA 3ZIMA 2VGXA 5T4YA 2X6KA 5AJDA 5FQ7A 3LCAA 3KEZA 4HXIA 1EDUA 3SF4A 4N5QA 5AQBA 2OCCE 3ZYQA 2BTDA 4U8YD 3R9MA 4I1MA 3EU5A 5BPPA 3Q9UC 4HOQA 3VTXA 2AXZA 1IHGA 2R5SA 3EHMA 2DIWA 2DBAA 4U0UA 5HKPA 2CHXA 3TXMA 1U3CA 3NOGD 4Q94A 2XGSA 3D9MA 4WNFA 4CGWA 3HRAA 3DXMG 5B1AE 3CHMA 1YCSB 3TG5A 2Y4UA 3ULEG 3D9PA 3ONKA 4I2WA 5EX0A 3EHNA 3SO8A 3MV3B 4QQIA 3UQ3A 5KNHD 1OXJA 2CG3A 3DWLG 1LF8A 4FJYA 3UM2A 3EU9A 1JWGA 1KZPA 4M7CA 3WXXA 5KJNA 3PEVB 1ELKA 2R05A 5BNWA 1FVHA 4F53A 4WWNA 4EBAA 1H6PA 4HRLA 5AJLA 5AYWD 4E85A 2OEVA 4AEZC 1V54E 3DPYA 2WXRA 2AWIA 4CT0A 4TXQA 2ZU6B 2J09A 1E8WA 2XRZA 2J4BA 2WXLA 5ARFA 3D9OA 2ZGDA 3FH7A 4EZJA 2AW6A 2P9PG 1Q2ZA 4DX7D 1DVPA 3TGOA 3URZA 2A5EA 4I43A 4PS7A 2QZAA 4RSYA 1SA4A 4I1OB 3WG7E 1NFIE 1OCZE 4QFVA 5ANRA 3P1UA 1KLXA 1WM5A 4JHJA 1ZU2A 3APDA 3R7RA 4G2VA 2I1KA 4BSZB 1FPPA 4DLOA 1HXIA 1Z5SC 4G25A 2J08A 4UWGA 2QC9A 3MV2B 1V55E 3BG0B 2MOWA 2KM4A 3ZHEA 3HXDA 2ETBA 1FT2A 2XGOA 5HQ8A 4CCAA 1AWCB 3ASGA 3LJ3A 4U7EB 2V4HC 2E0IA 3ISMC 3TWTA 2PL2A 5G05C 5B3SE 1GW6A 3DEOA 1OWMA 3ZRHA 4BTBA 4J8SA 3FUNA 4G8LA 4ACKA 4RG9A 4FJZA 3UKRG 3BU8A 3JXJA 1D8DA 5CEAA 2YINA 4DK5A 4GZCA 4J8FA 3RSEG 4DRXE 1ZBPA 3OXLA 3Q4AB 3G2UA 4MKTA 3C72A 3RO2A 2ILRA 2WXFA 2KZTB 4NRHB 4BX9A 2H6FA 2CG2A 4L7TA 1K3ZD 4W9RA 3D9NA 3ASFA 3FU0A 4APOA 3PNLB 2WXPA 4Q69A 5FQ6A 4A63B 1H6OA 3GZ2A 4DLQA 3KAEA 4HOUA 2WXJA 3L16A 4LEUA 4A1GA 3ASNE 1HS6A 4IN3B 1H2UA 4PS3A 3O4ZA 4UWLA 1W3BA 1D8EA 2YHEA 1SQMA 2XQ0A 3UT4A 5IY5E 2KXPC 2P9KG 3CK9A 3Q7FA 3U64A 3B7RL 2Y3AA 4D10C 4KT6B 3NF1A 1HX8A 5AENA 4U07A 2XS8A 3MA5A 3CVVA 4ANUA 4BETA 5EYLA 4UQXA 4BTAA 2WMNA 4KBQA 1HE8A 2DVWA 3JUEA 4MLPA 5H7PA 3KEAA 3Q7AA 4GYYA 4Y6WA 5AN8A 1QYMA 2FBNA 4ILIA 4ME2A 5ENSD 2HM8A 3PZ4A 3HIZA 4FP7A 3TXNA 3FTWA 3FU5A 1TR4A 1BI8B 4OVVA 4AJWA 1IQUA 3PUJA 4BX8A 2IF4A 4HORA 1NP7A 2V5FA 1H0AA 2X38A 3CIAA 4LNUD 4MS6A 2XPYA 4HI8A 4R7LA 3E32A 3CHQA 4JPSA 3VTYA 3CSFA 3KSQA 3CHOA 3IV0A 4LERA 3CVQA 2PZIA 1N52A 4HNAD 4KVMA 4U0SA 4ILGA 2MYOA 5ENPD 4LCTA 5HI7A 2GROB 3TWSA 3KS2A 5HRYA 3UM1A 4G1TA 4A3TA 2IO2C 1HZ4A 4O6FA 3L13A 4X8QA 5KWDA 4JA9A 3FUDA 3DXKG 5FZQA 4I9EA 1WDYA 2P9SG 4CYMD 2R59A 1HH8A 2ZIRA 4J7WA 2IEJA 4EZKA 4FA6A 4ATZD 1DC2A 3ZXPA 2XEEA 4GTRA 3TWXA 3ZUVB 4IYPA 1MQSA 3JYSA 5BV0A 1O1RA 4PUCA 3ASHA 4CRWA 3LY7A 3PH0C 4K0RA 1NA3A 4O1OA 3G2VA 2KZTA 4NIKA 3SQVA 2XRYA 3DSTA 3CHRA 5T3RA 5E75A 3SFZA 3U4TA 3UXGA 1D9SA 5FT9A 3BEEA 1E8XA 4Y6CA 5LCWC 1IQRA 2LAHA 2WM9A 3NOCD 5KNGA 4UUCA 4MRUA 4EZLA 4UWHA 1E96B 3ASOE 4B89A 2V4LA 3FEXA 4EECA 1NZNA 2XZTG 3ZGQA 2GRMA 3UTMA 4FU3A 3HXBA 3FDHA 4A1SA 4RVBA 3TWUA 3LYAA 3MJWA 4GB9A 3TAXA 4CZ2D 1S63A 4GCOA 2LSUA 1EPUA 3TWQA 2QYJA 3NZUA 3U3WA 1FT1A 3AG1E 3ZEFA 4BT8A 5BXOA 2VSXE 2JEKA 1TN6A 1H6KA 2GRQB 4FLBA 3N71A 2BF0X 5G04C 2WB2A 1UJJA 3SBSA 2FO7A 4HRNA 3R7QA 4EHMA 3JQ0A 4UQYA 3E34A 5FQ4A 3IEGA 1KT0A 2ETCA 3LVRE 1N94A 4HI9A 3L6AA 2VGYA 4C0MA 4FC8A 3QC1A 4HRMB 1E8ZA 2QY7A 5CRUA 3RKVA 2VSOE 3V2OA 4ATGA 2EIME 4KVOA 1MHQA 3CEQA 5A6CA 4WUYA 3S7BA 2XEVA 3SGHA 3FTZA 4DI4A 2CHZA 3AS8A 3NB2A 1TNUA 4U04A 3HG0D 2VJ8A 3AJIA 1NI1A 3CVUA 4KMOA 4HS2A 2AVPA 3CKBA 4ANWA 1TJFA 3ZW3A 5CRVA
chains in the Genus database with same CATH topology
5JJ6A 3MV2B 4GYWA 1OWNA 4B8AA 5KJKA 3AU4A 3BG0B 5AIJA 2MOWA 3QWVA 4URKA 2PM6A 1WY6A 2KM4A 3RJVA 3GZSA 2UY1A 3ZHEA 3FTUA 5LCWJ 2FULA 4LUNU 2J4DA 2XGOA 5HQ8A 4CCAA 3ULQA 4FADA 4YNDA 4AV7A 3S7DA 2OV8A 3B7UX 5CMYA 3ASGA 1HO8A 3CLJA 3LJ3A 4H7YA 4KZ0A 4HLEA 5EDSA 5LX8A 3PUKA 2E0IA 2RG8A 3MYVA 1E7UA 3HVEB 2WXQA 3Q15A 4N39A 4V3IA 5KJMA 3C98A 3DBSA 3T5XA 2PL2A 3APFA 5G05C 3ZN3A 1GW6A 2X6IA 1OWMA 2VTBA 2IJGX 3VLFA 2EQXA 2HO1A 4JXTA 3VLEA 3ZRHA 4BTBA 4J8SA 3Q5MA 4BSXA 3QARA 1FVFA 3FUNA 3B13A 2C0MA 3PEUB 2NXPA 3P2BA 4RG9A 4FJZA 4ACKA 1Z3YA 3IHVA 1BPOA 3QK0A 4XI9A 4NACA 4UWKA 1IYGA 2X3MA 1QNFA 1HG5A 4NQ0A 4XZ4A 3ZW3A 3ZYKA 2YINA 4J6IA 2GW1A 4N3CA 4DK5A 4GA1A 4PS8A 4GZCA 4PH4B 3FEYA 3FTSA 4J8FA 4G23A 5E76A 3LY8A 2E2EA 2CFUA 4WNDA 1ZBPA 3OXLA 3Q4AB 2KCKA 3G2WA 3G2UA 2FI7A 4MKTA 2RD0A 1E7VA 3RK6A 1UN8A 4N2SA 3RO2A 2VQ2A 2XGMA 2ILRA 2VGXB 1JWFA 2WXFA 2KZTB 4NRHB 1JUQA 5G55A 4B0ZA 3Q49B 3Q47B 4BX9A 1N54A 1TJCA 3FU3A 2CG2A 4L7TA 5D0QD 1OWLA 2X6JA 3NQPA 3PE3A 4UQZA 4W9RA 3U66A 4HOSA 4AY5A 3D9NA 5FQ8A 4LRZA 3ASFA 3CR3A 4ILHB 5ARGA 3FU0A 4APOA 5G04J 3FUFA 3PZDA 2GGFA 3PNLB 5D0OD 4F3VA 5J08A 5FJYA 2WXPA 2IOLA 4Q69A 4J8DA 5FQ6A 3UX4A 4OVUA 2I6HA 3G2TA 2C2LA 3LXUX 3CVPA 3GZ2A 4DLQA 3KAEA 3MKRA 3SNXA 1DNPA 4HOUA 3L54A 2WXJA 3FUMA 2VSNA 5BV1A 1KT1A 3L16A 4LEUA 4DPRA 4A1GA 1H19A 1HS6A 1FCHA 3OAWA 4IN3B 1H2UA 2LAIA 2OVBA 3O4ZA 4PS3A 4UWLA 4TRQA 5BW8C 1W3BA 2GRLA 2YHEA 1SQMA 2XQ0A 3LKUA 4JA7A 3ZVVA 4I1AA 1E8YA 3UT4A 4JW1A 3CHPA 4UI9J 3GZ1A 2IQCA 3HHMA 3AS5A 4XKCA 5FZSA 4C9BB 2KC7A 3IHYA 3FULA 4RG6A 2A5UA 5DIZA 5CCLA 3ASDA 4CEMA 2IOSA 2YQ8A 2CFZA 2WVIA 3CK9A 3U64A 4XI0A 3B7RL 1JPLA 5CMWA 1Z3XA 2X6FA 2P58C 3NZSA 2Y3AA 2WXGA 4D10C 4KT6B 5A7DB 3UT7A 3NF1A 4FULA 5KJLA 3MEKA 2WXOA 3D9LA 4WAFA 1HX8A 4EBAG 5AENA 4KZCA 4U07A 3MA5A 3QWPA 3CVVA 2I2OA 2JLBA 3FTXA 4ANUA 4J0UA 2J9QA 4UQXA 4BTAA 2WMNA 4KBQA 4YVQC 1HE8A 4WWOA 4C0EA 4MLPA 2WPVA 3SHFA 2DCPA 5FWQA 1P5QA 3CGHA 3CHSA 4GYYA 4L2LA 5EKQD 4L1BA 5T8IA 5JJTA 5M72A 1NA0A 4N3AA 3CK7A 4Y6WA 3FFLA 4WNGA 3MKQB 4FHKA 3FWVA 3QJZA 4GZ3A 2WQ7A 4ANVA 3T5VA 2FBNA 3CVLA 4ILIA 4ME2A 3I3NA 4TV3A 2HM8A 3FHEA 3RRMB 2YHCA 3JCKC 3HIZA 4FP7A 2M63A 3TXNA 1ELWA 2LSVA 3T8MA 5BUZA 3ZFWA 3LDZA 4H7XA 4PDXA 3FTWA 3PE4A 2AXVA 4ABNA 3FU5A 1Y8MA 3CVWA 1OWOA 4OVVA 4AJWA 1IQUA 5LOZA 3RU0A 4WNEA 4APFA 5CCMA 3FTVA 4CGVA 3PUJA 4AP2A 4BX8A 3I5PA 4BWRA 2IF4A 4HORA 1NP7A 1EF1C 2V5FA 1H0AA 2X38A 3CIAA 4L2YA 5G05J 2I1JA 4U8HA 4M3OA 3I4GA 2XPYA 3QWWA 4MS6A 4DI3A 3EIJA 3FUKA 2YNQA 4R7LA 3EJNA 3CQCB 3CHQA 1H2TC 3AS4A 4JPSA 3VTYA 3LVQE 4ACLA 1QQEA 2KCVA 4K03A 5G2NA 3CSFA 3K9IA 3S2AA 2PQNA 3CHOA 3SBTB 1ELRA 3IV0A 4FLHA 1HU3A 4LERA 3CVQA 2WQ6A 3EDTB 2IONA 4JVSA 4A55A 2PZIA 3PREA 4GU5A 5JJ7A 4Q96A 1N52A 4KVMA 1PAQA 2AXUA 4ILGA 4U0SA 1S0PA 4LCTA 3VLDA 3QNKA 5HI7A 2WQHA 5BT1A 2XCBA 3G2SA 5ENNA 3D9IA 3CSTA 1PC2A 3KS2A 1TEZA 4JL0A 5EX3A 2KATA 4ANXA 4EQFA 4G1TA 4E6HA 4A3TA 1HG2A 3CQGB 1SZAA 3CV0A 3U9WA 4F7AA 4OYSA 1HZ4A 4O6FA 4F1SA 1PY1A 3L13A 1OUVA 3L22A 4I9CA 2OVFA 1UG3A 1XGWA 3MCXA 1UW4B 3UPVA 4DJAA 4HVBA 4WWPA 3ML9A 3HVEA 4JA9A 3FUDA 4GAAA 3CVXA 2I9CA 2LNIA 3R9AB 3OTNA 5FZQA 4UWFA 4I9EA 2QFCA 2UY1B 4P29A 3ZHEB 4AM9A 5A23A 3BG1B 3SZ7A 1SZ9A 1INZA 2Q7FA 3OXGA 5ANLA 4GPKA 3IKOB 2R59A 1HH8A 2L6JA 1UN9A 4BY6A 3SI5A 1E90A 2KCLA 3FUIA 3ESLA 4EZKA 2V8SE 4G26A 3LY9A 4FA6A 2L0IA 5LP0A 2IU1A 4GZDA 4GA2A 2ONDA 3I4RB 3PVLA 4IYPA 3JUIA 5KCMA 1MQSA 4GYOA 3JYSA 4AXHA 5BV0A 4PUCA 3FU6A 3QAQA 2VTBB 1WAO1 3ASHA 4CRWA 3LY7A 2WMOA 3ZIMA 4AY6A 3PH0C 4K0RA 1NA3A 3ZPJA 3CVYA 2VGXA 5JHAA 3D9KA 3G2VA 5T4YA 1A17A 2KZTA 2X6KA 5AJDA 2XRYA 5FQ7A 4XX5A 4AOFA 3LCAA 3CHRA 4I6GA 5T3RA 2PM7A 3KEZA 4HXIA 3UT8A 3D3MA 4GA0A 5E75A 4JEHA 1H2VC 1EDUA 3SF4A 2CHWA 4I17A 5DBKA 3SFZA 3QDNA 3AU5A 4BT9A 3U4TA 3L08A 4N2QA 4BFRA 4XE0A 4HFGA 2WXMA 4GZ6A 5FT9A 2WXIA 3BEEA 1E8XA 4N5CA 4Y6CA 2BTDA 2UWJG 3ZYQA 5LCWC 4HOTA 4I1MA 1IQRA 2LAHA 5JHBA 2WM9A 5BPPA 2J07A 3RRUA 2L9BA 4HOQA 4AVXA 3VTXA 2J49A 4MRUA 4EZLA 2AXZA 1IHGA 4UWHA 4U63A 2WXKA 3MGBA 2NC9A 3SD5A 3UUXA 2R5SA 3FUHA 3EHMA 1HF8A 2DIWA 4B8CB 1E96B 2VYIA 2DBAA 4JEUA 4A3VA 4J8EA 4U0UA 4UI9K 5J90A 2IFUA 4N3BA 4B89A 2V4LA 3B7SA 2CHXA 3FEXA 4G24A 3TXMA 4JHKA 4EECA 1U3CA 1NZNA 3ZGQA 4Q94A 2GRMA 2XGSA 3ENEA 3QOUA 3D9MA 3TG4A 3ONLA 4WNFA 4CGWA 2XHEA 4FU3A 1U3DA 3FDHA 1X5BA 2L0TB 4A1SA 3CHMA 3QB2A 4KXKB 4RVBA 3ESKA 1Z6TA 3LYAA 3MJWA 4GB9A 3TAXA 3TG5A 4GCOA 4CT4A 2Y4UA 3GYZA 4KYOB 2FEZA 3D9PA 2MHKA 3ONKA 4I2WA 2X6HA 2XPIA 5EX0A 3EHNA 3LEWA 4YVOA 3S7FA 2LSUA 4XKBA 3TL5A 3MV3B 4CDMA 2WXHA 1EPUA 3FUJA 3UQ3A 4IRUA 4JC8A 3QKYA 2CG3A 3NZUA 3GW4A 1LF8A 3OXFA 4FJYA 3U3WA 5C2YA 2FF4A 2Y4TA 1JWGA 3ZEFA 2A4ZA 4BT8A 2LO6A 3FP3A 3WXXA 4GZ5A 2VSXE 2JEKA 3RO3A 2VSYA 5KJNA 3MKQA 1H6KA 3PEVB 2HR2A 1ELKA 5BNWA 4FLBA 3N71A 1QZ2A 3ZYLA 2BF0X 5G04C 4B94A 2WB2A 1FVHA 1UJJA 4TUUA 4WWNA 3SBSA 4F53A 4EBAA 2FO7A 3PRZA 3R7QA 5AJLA 1UJKA 5FZRA 5AYWD 4JZYA 1YA0A 3CK8A 3HYMB 3JQ0A 4UQYA 3FH8A 3PDNA 5FQ4A 3IEGA 1KT0A 3CKCA 3RIBA 1VDYA 3UMVA 4E85A 4AEZC 3LVRE 3ZXSA 3S7JA 5C1DA 4IULA 1Y6IA 2XCCA 3D9JA 3FTYA 2MRIA 2WXRA 2AWIA 2VGYA 3L6AA 4CDNA 4CT0A 4C0MA 2BUGA 4JHRA 5LFAA 2ZU6B 2J09A 4UI9C 1E8WA 2XRZA 4L23A 2V0PA 3KD7A 4EPZA 4FC8A 2J4BA 2WXNA 2WXLA 3QC1A 4GMLA 5ARFA 4AIFA 3ML8A 4NURA 1EYHA 3TJPA 3D9OA 1E8ZA 3ZYMA 2QY7A 3FH7A 3RKVA 3FUEA 3MX3A 4EZJA 2VSOE 2AW6A 5FTPA 4ATGA 1B89A 3APCA 3FY4A 1OWPA 4I2ZA 4KVOA 1MHQA 3JQ1A 3CEQA 2OOEA 5A6CA 4WUYA 3EIQC 3S7BA 1DVPA 2XEVA 2NSZA 3E4BA 3O48A 3SGHA 4CDRA 3URZA 3TGOA 3FTZA 2PQRA 3PNTB 4I43A 4FHJA 4PS7A 4DI4A 2CHZA 4RSYA 2HYZA 5CHEE 3AS8A 4G11A 3CVNA 1HFAA 4GMJA 4I1OB 4U04A 4QFVA 3PS6A 4I6EA 3RRNB 5ANRA 3DPDA 4XIFA 2R17C 3P1UA 1KLXA 1WM5A 4GCNA 4I6JA 4JHJA 4U0ZA 3B7TA 3IBEA 3L17A 1L5JA 3FH5A 3MZLB 2VJ8A 1ZU2A 3APDA 3R7RA 3HDXA 3CVUA 4KMOA 2XPZA 3LPZA 2I1KA 4G2VA 4HS2A 4DLOA 1HXIA 2AVPA 2C0LA 3CKBA 4ANWA 4G25A 2J08A 3LS8A 1TJFA 1XNFA 4UWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ6 A;  3MV2 B;  4GYW A;  3QWV A;  3RJV A;  5LCW J;  2UY1 A;  3ZHE A;  2XGO A;  5HQ8 A;  3ULQ A;  4YND A;  3S7D A;  3ASG A;  4H7Y A;  3Q15 A;  4N39 A;  5KJM A;  2PL2 A;  5G05 C;  3ZN3 A;  2HO1 A;  4BTB A;  3Q5M A;  2C0M A;  4RG9 A;  4XI9 A;  1IYG A;  4NQ0 A;  2GW1 A;  4N3C A;  4GA1 A;  4J8F A;  4G23 A;  3LY8 A;  2E2E A;  4WND A;  1ZBP A;  3OXL A;  3Q4A B;  2KCK A;  2FI7 A;  4N2S A;  3RO2 A;  2VQ2 A;  2XGM A;  2VGX B;  4NRH B;  3Q49 B;  3Q47 B;  1TJC A;  5D0Q D;  4UQZ A;  3PE3 A;  4W9R A;  4HOS A;  4AY5 A;  3ASF A;  5ARG A;  4APO A;  5G04 J;  5D0O D;  4F3V A;  5FJY A;  4J8D A;  2I6H A;  2C2L A;  3CVP A;  3GZ2 A;  3KAE A;  3MKR A;  4HOU A;  2VSN A;  1KT1 A;  4LEU A;  1FCH A;  4IN3 B;  5BW8 C;  1W3B A;  3LKU A;  4JA7 A;  4I1A A;  4UI9 J;  3GZ1 A;  3AS5 A;  5FZS A;  2KC7 A;  4RG6 A;  5DIZ A;  5CCL A;  3ASD A;  2YQ8 A;  3CK9 A;  4XI0 A;  2P58 C;  5A7D B;  3NF1 A;  5KJL A;  3MEK A;  4U07 A;  3MA5 A;  3QWP A;  2JLB A;  4J0U A;  2J9Q A;  4UQX A;  4BTA A;  4KBQ A;  4YVQ C;  2WPV A;  1P5Q A;  4GYY A;  5EKQ D;  5JJT A;  5M72 A;  1NA0 A;  4N3A A;  3CK7 A;  4Y6W A;  3FFL A;  4WNG A;  3FWV A;  4GZ3 A;  2FBN A;  3CVL A;  4ME2 A;  2YHC A;  1ELW A;  2LSV A;  3ZFW A;  4H7X A;  3PE4 A;  4ABN A;  1Y8M A;  3RU0 A;  4WNE A;  5CCM A;  4CGV A;  4BWR A;  2IF4 A;  4HOR A;  2V5F A;  5G05 J;  5KJK A;  3QWW A;  3AS4 A;  3VTY A;  1QQE A;  2KCV A;  3K9I A;  2PQN A;  1ELR A;  3CVQ A;  3EDT B;  2PZI A;  5JJ7 A;  4U0S A;  5HI7 A;  2WQH A;  5BT1 A;  2XCB A;  1PC2 A;  3KS2 A;  4JL0 A;  5EX3 A;  2KAT A;  4EQF A;  4G1T A;  3CV0 A;  1HZ4 A;  4O6F A;  1OUV A;  4I9C A;  3UPV A;  4JA9 A;  2LNI A;  3R9A B;  5FZQ A;  4I9E A;  2QFC A;  2UY1 B;  3ZHE B;  4AM9 A;  3SZ7 A;  2Q7F A;  3OXG A;  4GPK A;  1HH8 A;  2L6J A;  2KCL A;  4G26 A;  3LY9 A;  4GA2 A;  2OND A;  4GYO A;  3JYS A;  1WAO 1;  3ASH A;  3LY7 A;  4AY6 A;  1NA3 A;  3ZPJ A;  2VGX A;  1A17 A;  3LCA A;  4GA0 A;  3SF4 A;  4I17 A;  5DBK A;  3QDN A;  4BT9 A;  3U4T A;  4N2Q A;  4GZ6 A;  5FT9 A;  3BEE A;  4Y6C A;  4N5C A;  5LCW C;  2UWJ G;  4HOT A;  4HOQ A;  3VTX A;  1IHG A;  2NC9 A;  3UUX A;  2R5S A;  1E96 B;  2VYI A;  2DBA A;  4J8E A;  4U0U A;  4UI9 K;  2IFU A;  4N3B A;  4G24 A;  1NZN A;  3ZGQ A;  2XGS A;  3QOU A;  3TG4 A;  4WNF A;  4CGW A;  4A1S A;  4KXK B;  3ESK A;  3LYA A;  3TAX A;  3TG5 A;  4GCO A;  2Y4U A;  3GYZ A;  4KYO B;  2FEZ A;  2MHK A;  3S7F A;  4I2W A;  5EX0 A;  2XPI A;  4YVO A;  2LSU A;  3MV3 B;  3UQ3 A;  3QKY A;  3GW4 A;  3U3W A;  3OXF A;  2FF4 A;  2Y4T A;  4BT8 A;  3FP3 A;  3WXX A;  4GZ5 A;  3RO3 A;  2VSY A;  5KJN A;  2HR2 A;  5BNW A;  3N71 A;  1QZ2 A;  4B94 A;  5G04 C;  2FO7 A;  5FZR A;  5AYW D;  1YA0 A;  3CK8 A;  3HYM B;  4UQY A;  3PDN A;  3IEG A;  1KT0 A;  3CKC A;  3RIB A;  3S7J A;  5C1D A;  2XCC A;  2VGY A;  2BUG A;  4JHR A;  4UI9 C;  3KD7 A;  5ARF A;  4AIF A;  3RKV A;  5FTP A;  1B89 A;  4I2Z A;  3CEQ A;  2OOE A;  5A6C A;  4WUY A;  3S7B A;  2XEV A;  3E4B A;  3O48 A;  4CDR A;  3TGO A;  3URZ A;  2PQR A;  5CHE E;  2HYZ A;  3AS8 A;  3CVN A;  4U04 A;  4XIF A;  1KLX A;  1WM5 A;  4GCN A;  4U0Z A;  1ZU2 A;  3LPZ A;  4G2V A;  1HXI A;  2AVP A;  2C0L A;  3CKB A;  4G25 A;  1XNF A; 
#chains in the Genus database with same CATH topology
 5JJ6 A;  2DYS E;  5AIJ A;  2PM6 A;  3GZS A;  3FTU A;  2XZD G;  1TN8 A;  2OV8 A;  3DSW A;  3B7U X;  1HO8 A;  3CLJ A;  5EDS A;  5LX8 A;  3PUK A;  3UM0 A;  4V3I A;  1TNZ A;  3C5R A;  5KJM A;  3F6Q A;  3T5X A;  1MX6 A;  1K1B A;  2IJG X;  3VLE A;  3QAR A;  5ENO D;  2NYJ A;  4OAV B;  1BPO A;  3QK0 A;  1O1T A;  2X3M A;  1QNF A;  1HG5 A;  3ZYK A;  4N3C A;  4PH4 B;  3FTS A;  5E76 A;  2BKK B;  2KCK A;  3G2W A;  2FI7 A;  1UN8 A;  1X81 A;  4N2S A;  1JUQ A;  3V2X A;  3Q49 B;  2X6J A;  1MX4 A;  3CR3 A;  4DX1 A;  1LD8 A;  5ARG A;  4MBG A;  3PZD A;  5CBO A;  5D0O D;  5J08 A;  5FJY A;  2IOL A;  3UX4 A;  1IXV A;  3G2T A;  3AG3 E;  2C2L A;  3CVP A;  5EIL A;  4DPR A;  3IXE A;  1FCH A;  3OAW A;  3UIP C;  4JW1 A;  1TNB A;  3HHM A;  4LNG A;  2KC7 A;  3IHY A;  5CCL A;  3DSX A;  4RLY A;  4TXR A;  3NZS A;  2P9N G;  5D2M C;  5JMN D;  2WXG A;  4LG6 A;  1IKN D;  1QBQ A;  2Y1L E;  5KJL A;  3MEK A;  3UM3 A;  3D9L A;  4KZC A;  1BU9 A;  2JLB A;  4YVQ C;  4C0E A;  2V5Q C;  4O60 A;  1P5Q A;  3CGH A;  3ABM E;  5EKQ D;  3CK7 A;  3FFL A;  3PZ1 A;  3FWV A;  2WQ7 A;  2IO3 C;  4YDO A;  2P9L G;  2YHC A;  3JCK C;  1ELW A;  3ZFW A;  3LDZ A;  4ABN A;  1Y8M A;  3CVW A;  1TNY A;  3RU0 A;  3AG4 E;  4WNE A;  4YDW A;  1EF1 C;  5G05 J;  2B0O E;  5KJK A;  2YNQ A;  3UKU G;  1YYH A;  3DEP A;  3EJN A;  1AP7 A;  3CQC B;  5ITZ F;  3LVQ E;  1QQE A;  2P9I G;  2KCV A;  5G2N A;  5AAO A;  3S2A A;  2PQN A;  1ELR A;  1HU3 A;  3EDT B;  4JVS A;  4GU5 A;  2AXU A;  3Q78 A;  5ENQ D;  4TUM A;  1PC2 A;  3C3R A;  5B1B E;  2ZGG A;  1TEZ A;  4Z68 A;  5EX3 A;  4ANX A;  3V30 A;  1HG2 A;  2F37 A;  1SZA A;  3ZKJ A;  3L22 A;  1KPS B;  1RZ4 A;  4HVB A;  4BEP A;  3R9A B;  3OTN A;  4UWF A;  1OCR E;  2L6B A;  2QFC A;  2UY1 B;  3SZ7 A;  1SZ9 A;  2Q7F A;  4G8K A;  1UN9 A;  4ZFH A;  2KCL A;  3FUI A;  3LY9 A;  2IU1 A;  2OND A;  2DWZ A;  3FU6 A;  4AY6 A;  4OAU C;  3ZPJ A;  3CVY A;  2P9U G;  4HBD A;  4AOF A;  4XX5 A;  1SW6 A;  4I6G A;  4GTP A;  2PM7 A;  5AQA A;  2ZIS A;  4U96 D;  4GA0 A;  4JEH A;  1H2V C;  2CHW A;  5DBK A;  4O1P A;  3AU5 A;  4BT9 A;  4N2Q A;  2PNN A;  5FIN A;  4N5C A;  4HOT A;  4JD2 G;  2J07 A;  3RRU A;  2J49 A;  4U63 A;  3MGB A;  3TWW A;  2NC9 A;  3UUX A;  4DX2 A;  1HF8 A;  2VYI A;  4JEU A;  4A3V A;  4J8E A;  2IFU A;  4N3B A;  1NL4 A;  4G24 A;  3ENE A;  3QOU A;  3TG4 A;  2XHE A;  3QB2 A;  2RKK A;  4RQI A;  4CT4 A;  3GYZ A;  2FEZ A;  3S7F A;  3EUV A;  2XPI A;  3LEW A;  4YVO A;  3TL5 A;  1N0Q A;  4CDM A;  2WXH A;  3FUJ A;  1N11 A;  4JC8 A;  3NAW A;  2Y4T A;  2A4Z A;  3BQO A;  3FP3 A;  4GZ5 A;  3RO3 A;  2VSY A;  1LTX A;  1K1A A;  3ZYL A;  4B94 A;  2EIN E;  3SY2 A;  3CK8 A;  3HYM B;  3W9F A;  3HXF A;  3CKC A;  3RIB A;  4LSZ E;  3UMV A;  4HLL A;  3UIN C;  4IUL A;  1Y6I A;  3D9J A;  3FTY A;  4ZHB A;  2MRI A;  3PZ2 A;  4JHR A;  4UI9 C;  3SFY A;  2F8X K;  4GML A;  3ML8 A;  1TNO A;  3ZYM A;  3FUE A;  3MX3 A;  1A5E A;  2RFA A;  1N4R A;  1B89 A;  3FY4 A;  1OWP A;  2OOE A;  3O48 A;  2NSZ A;  2EIJ E;  1N4P A;  3PNT B;  2HYZ A;  3RRN B;  3CVN A;  2DYR E;  3Q9N C;  1G3N B;  4XIF A;  2R17 C;  4U0Z A;  3B7T A;  3IBE A;  4L9P A;  3L17 A;  5EID A;  3HDX A;  3ULY A;  2XPZ A;  2C0L A;  1XNF A;  4F7A A;  3W9G A;  1OWN A;  4B8A A;  3AU4 A;  4URK A;  3RJV A;  5LCW J;  2UY1 A;  4YDE A;  4LUN U;  4YND A;  4AV7 A;  3S7D A;  3L9T A;  2RFM A;  4H7Y A;  3V79 K;  2RG8 A;  3MYV A;  1E7U A;  3HVE B;  3C98 A;  3DBS A;  2BED A;  3APF A;  3HXC A;  3VLF A;  2EQX A;  2H6G A;  2HO1 A;  4BSX A;  2C0M A;  3PEU B;  1Z3Y A;  3IHV A;  2J8S D;  4B93 B;  4XI9 A;  1IYG A;  4K5B A;  4XZ4 A;  5JA4 D;  4J6I A;  4GA1 A;  2XEH A;  4PS8 A;  3FEY A;  4G23 A;  3LY8 A;  2E2E A;  2CFU A;  2RD0 A;  4GTS A;  3X2Q E;  3Q75 A;  1JWF A;  4B0Z A;  3FU3 A;  4UQZ A;  3PE3 A;  1DCE A;  4AY5 A;  5FQ8 A;  1DCQ A;  5G04 J;  3FUF A;  4F3V A;  4J8D A;  2ETA A;  2XS1 A;  2XEN A;  3LXU X;  3BUA A;  3L54 A;  4HB5 A;  2VSN A;  1KT1 A;  1BI7 B;  3D9H A;  2LAI A;  2GRL A;  1E8Y A;  3L82 A;  3GZ1 A;  2IQC A;  3AS5 A;  2IY0 C;  4RG6 A;  2A5U A;  2WVI A;  2CFZ A;  2YQ8 A;  4XI0 A;  2X6F A;  2P58 C;  3UT7 A;  4FUL A;  5FIO A;  1MYO A;  3J5P A;  2WXO A;  2JAB A;  4HQD A;  3QWP A;  2I2O A;  5EYP F;  2J9Q A;  1JCR A;  4WWO A;  1SA5 A;  3SHF A;  5FWQ A;  4L1B A;  5JJT A;  2EIK E;  5M72 A;  1NA0 A;  4U95 D;  3MKQ B;  4FHK A;  5CER B;  4GZ3 A;  3T5V A;  3I3N A;  3FHE A;  3UI2 A;  3RRM B;  2M63 A;  3T8M A;  2GRN B;  4PDX A;  2DZO A;  2AXV A;  3B7B A;  4APF A;  5CCM A;  3FTV A;  4CGV A;  3I5P A;  1U2V G;  4BWR A;  2I1J A;  3QWW A;  3EIJ A;  3FUK A;  3AS4 A;  4ACL A;  5EIB E;  1LD7 A;  3K9I A;  2Y0B G;  2LXM A;  3T9K A;  3SBT B;  1N9A A;  2ION A;  3PRE A;  5JJ7 A;  4LNB A;  4C48 B;  1PAQ A;  3VLD A;  3QNK A;  5BT1 A;  3G2S A;  5ENN A;  3D9I A;  3CST A;  4JL0 A;  4EQF A;  3CQG B;  3U9W A;  4F1S A;  1OUV A;  4I9C A;  2OVF A;  1UG3 A;  1XGW A;  1UW4 B;  3UPV A;  2QYU A;  4WWP A;  3HVE A;  4GAA A;  4GTQ A;  3CVX A;  2I9C A;  5A23 A;  3OXG A;  3E37 A;  4GPK A;  4BY6 A;  3NBN B;  2V8S E;  4G26 A;  5BXU A;  5LP0 A;  4GA2 A;  1OCC E;  3PVL A;  4GYO A;  2F0Y A;  3JXI A;  2VTB B;  1WAO 1;  2R03 A;  3Q73 A;  5CEC B;  5JHA A;  1UOH A;  3D9K A;  3ZU7 B;  1A17 A;  2R02 A;  3UT8 A;  3D3M A;  4I17 A;  3QDN A;  3L08 A;  4BFR A;  4XE0 A;  4HFG A;  2WXM A;  4DX6 D;  4GZ6 A;  2LXL A;  2WXI A;  3UIO C;  2UWJ G;  2EIL E;  5JHB A;  2L9B A;  2KBX A;  1S64 A;  4AVX A;  2WXK A;  3SD5 A;  3FUH A;  4B8C B;  2H6H A;  4DUI A;  4UI9 K;  5J90 A;  3B7S A;  1ZB1 A;  4JHK A;  2GRP B;  5D66 A;  5AQ7 A;  3ONL A;  1U3D A;  1X5B A;  2L0T B;  4KXK B;  3ABL E;  3ESK A;  1Z6T A;  4GPM A;  4KYO B;  3Q79 A;  2MHK A;  3T8K A;  2X6H A;  4XKB A;  1OT8 A;  4IRU A;  3QKY A;  3GW4 A;  3OXF A;  4K5A B;  3RAU A;  5C2Y A;  2FF4 A;  1KZO A;  3DSV A;  3AG2 E;  2LO6 A;  3MKQ A;  2HR2 A;  1RW2 A;  3TWR A;  1QZ2 A;  2ZXW E;  4TUU A;  3PRZ A;  1UJK A;  4YDY A;  5FZR A;  4JZY A;  4GTO A;  1MX2 A;  1YA0 A;  4K5C A;  4GTM A;  1BD8 A;  1N4Q A;  3FH8 A;  1JCS A;  3PDN A;  2B6C A;  1VDY A;  4TXP A;  3ZXS A;  3S7J A;  5C1D A;  2XCC A;  4CDN A;  2BUG A;  5LFA A;  1OCO E;  4L23 A;  2V0P A;  3KD7 A;  4BES A;  4EPZ A;  2WXN A;  4AIF A;  4NUR A;  1EYH A;  3TJP A;  1IHB A;  1JCQ A;  5FTP A;  2H6I A;  3APC A;  2R2L A;  4I2Z A;  1TYQ G;  3JQ1 A;  3EIQ C;  4CDR A;  3E4B A;  3HXE A;  4F6R D;  2PQR A;  4FHJ A;  5CHE E;  4G11 A;  1WG0 A;  1HFA A;  4GMJ A;  3PS6 A;  4I6E A;  3DPD A;  5ENT D;  4GCN A;  4I6J A;  5HS0 A;  1L5J A;  3FH5 A;  3MZL B;  5EN5 D;  2GRR B;  3LPZ A;  3LS8 A;  4GYW A;  1YMP A;  3QWV A;  1WY6 A;  4GTV A;  2FUL A;  2J4D A;  3ULQ A;  4FAD A;  5CMY A;  4KZ0 A;  4HLE A;  3ZNG A;  4DX5 D;  1TN7 A;  3Q15 A;  2WXQ A;  4N39 A;  3LJN A;  1N4S A;  1O5M A;  1N95 A;  3ZN3 A;  2X6I A;  3KSL A;  2VTB A;  4JXT A;  3PZ3 A;  3Q5M A;  3E33 A;  1FVF A;  3B13 A;  2NXP A;  3P2B A;  4NAC A;  4UWK A;  4NQ0 A;  5KBA A;  2GW1 A;  2Y69 E;  3E30 A;  4WND A;  1E7V A;  3RK6 A;  5CBN A;  2VGE A;  2VQ2 A;  2XGM A;  2VGX B;  4J8Y A;  4BER A;  5G55 A;  3Q47 B;  1N54 A;  1TJC A;  5D0Q D;  1OWL A;  3EHR A;  3NQP A;  3U66 A;  4HOS A;  4LRZ A;  4ILH B;  2GGF A;  1O1S A;  4OVU A;  2I6H A;  3MKR A;  3SNX A;  1DNP A;  3FUM A;  5BV1 A;  1H19 A;  4XEI G;  2OVB A;  5BW8 C;  4TRQ A;  3LKU A;  4JA7 A;  3ZVV A;  4I1A A;  3CHP A;  4UI9 J;  4XKC A;  5FZS A;  4C9B B;  1S70 B;  3FUL A;  5DIZ A;  2HE0 A;  3ASD A;  4CEM A;  2IOS A;  1JPL A;  5CMW A;  1Z3X A;  5A7D B;  4EBA G;  4WAF A;  2LUH A;  3ABK E;  3B95 A;  3FTX A;  4GTT A;  4J0U A;  2WPV A;  3J5Q B;  1N0R A;  2DCP A;  3CHS A;  4L2L A;  5T8I A;  4F1P A;  4N3A A;  3V31 A;  4WNG A;  2DZN A;  4JB8 P;  3QJZ A;  4ANV A;  2BKG A;  3CVL A;  4TV3 A;  3DRA A;  2FO1 E;  5CED B;  2OEW A;  1MZC A;  2LSV A;  5BUZ A;  4H7X A;  2AJA A;  3PE4 A;  1OWO A;  3C3O A;  1SVX A;  5LOZ A;  4AP2 A;  3DSU A;  3AAA C;  4GMR A;  5AAR A;  4L2Y A;  4U8H A;  4M3O A;  3I4G A;  1MJ0 A;  4DI3 A;  1H2T C;  3EHQ A;  4U8V D;  4K03 A;  1K8K G;  1OY3 D;  4FLH A;  2F8Y A;  2WQ6 A;  4A55 A;  4Q96 A;  1S0P A;  3DSS A;  3TWV A;  2WQH A;  2XCB A;  2KAT A;  4E6H A;  3CV0 A;  5AQ9 A;  4OYS A;  1PY1 A;  3SFX A;  3MCX A;  4DJA A;  1BLX B;  2P2C P;  3ML9 A;  2LNI A;  4P29 A;  3ZHE B;  4AM9 A;  3BG1 B;  1INZ A;  5ANL A;  3IKO B;  2L6J A;  3SI5 A;  1E90 A;  3ESL A;  2L0I A;  4GZD A;  5ENR D;  3I4R B;  3JUI A;  5KCM A;  3C3Q A;  4AXH A;  3QAQ A;  2WMO A;  3ZIM A;  2VGX A;  5T4Y A;  2X6K A;  5AJD A;  5FQ7 A;  3LCA A;  3KEZ A;  4HXI A;  1EDU A;  3SF4 A;  4N5Q A;  5AQB A;  2OCC E;  3ZYQ A;  2BTD A;  4U8Y D;  3R9M A;  4I1M A;  3EU5 A;  5BPP A;  3Q9U C;  4HOQ A;  3VTX A;  2AXZ A;  1IHG A;  2R5S A;  3EHM A;  2DIW A;  2DBA A;  4U0U A;  5HKP A;  2CHX A;  3TXM A;  1U3C A;  3NOG D;  4Q94 A;  2XGS A;  3D9M A;  4WNF A;  4CGW A;  3HRA A;  3DXM G;  5B1A E;  3CHM A;  1YCS B;  3TG5 A;  2Y4U A;  3ULE G;  3D9P A;  3ONK A;  4I2W A;  5EX0 A;  3EHN A;  3SO8 A;  3MV3 B;  4QQI A;  3UQ3 A;  5KNH D;  1OXJ A;  2CG3 A;  3DWL G;  1LF8 A;  4FJY A;  3UM2 A;  3EU9 A;  1JWG A;  1KZP A;  4M7C A;  3WXX A;  5KJN A;  3PEV B;  1ELK A;  2R05 A;  5BNW A;  1FVH A;  4F53 A;  4WWN A;  4EBA A;  1H6P A;  4HRL A;  5AJL A;  5AYW D;  4E85 A;  2OEV A;  4AEZ C;  1V54 E;  3DPY A;  2WXR A;  2AWI A;  4CT0 A;  4TXQ A;  2ZU6 B;  2J09 A;  1E8W A;  2XRZ A;  2J4B A;  2WXL A;  5ARF A;  3D9O A;  2ZGD A;  3FH7 A;  4EZJ A;  2AW6 A;  2P9P G;  1Q2Z A;  4DX7 D;  1DVP A;  3TGO A;  3URZ A;  2A5E A;  4I43 A;  4PS7 A;  2QZA A;  4RSY A;  1SA4 A;  4I1O B;  3WG7 E;  1NFI E;  1OCZ E;  4QFV A;  5ANR A;  3P1U A;  1KLX A;  1WM5 A;  4JHJ A;  1ZU2 A;  3APD A;  3R7R A;  4G2V A;  2I1K A;  4BSZ B;  1FPP A;  4DLO A;  1HXI A;  1Z5S C;  4G25 A;  2J08 A;  4UWG A;  2QC9 A;  3MV2 B;  1V55 E;  3BG0 B;  2MOW A;  2KM4 A;  3ZHE A;  3HXD A;  2ETB A;  1FT2 A;  2XGO A;  5HQ8 A;  4CCA A;  1AWC B;  3ASG A;  3LJ3 A;  4U7E B;  2V4H C;  2E0I A;  3ISM C;  3TWT A;  2PL2 A;  5G05 C;  5B3S E;  1GW6 A;  3DEO A;  1OWM A;  3ZRH A;  4BTB A;  4J8S A;  3FUN A;  4G8L A;  4ACK A;  4RG9 A;  4FJZ A;  3UKR G;  3BU8 A;  3JXJ A;  1D8D A;  5CEA A;  2YIN A;  4DK5 A;  4GZC A;  4J8F A;  3RSE G;  4DRX E;  1ZBP A;  3OXL A;  3Q4A B;  3G2U A;  4MKT A;  3C72 A;  3RO2 A;  2ILR A;  2WXF A;  2KZT B;  4NRH B;  4BX9 A;  2H6F A;  2CG2 A;  4L7T A;  1K3Z D;  4W9R A;  3D9N A;  3ASF A;  3FU0 A;  4APO A;  3PNL B;  2WXP A;  4Q69 A;  5FQ6 A;  4A63 B;  1H6O A;  3GZ2 A;  4DLQ A;  3KAE A;  4HOU A;  2WXJ A;  3L16 A;  4LEU A;  4A1G A;  3ASN E;  1HS6 A;  4IN3 B;  1H2U A;  4PS3 A;  3O4Z A;  4UWL A;  1W3B A;  1D8E A;  2YHE A;  1SQM A;  2XQ0 A;  3UT4 A;  5IY5 E;  2KXP C;  2P9K G;  3CK9 A;  3Q7F A;  3U64 A;  3B7R L;  2Y3A A;  4D10 C;  4KT6 B;  3NF1 A;  1HX8 A;  5AEN A;  4U07 A;  2XS8 A;  3MA5 A;  3CVV A;  4ANU A;  4BET A;  5EYL A;  4UQX A;  4BTA A;  2WMN A;  4KBQ A;  1HE8 A;  2DVW A;  3JUE A;  4MLP A;  5H7P A;  3KEA A;  3Q7A A;  4GYY A;  4Y6W A;  5AN8 A;  1QYM A;  2FBN A;  4ILI A;  4ME2 A;  5ENS D;  2HM8 A;  3PZ4 A;  3HIZ A;  4FP7 A;  3TXN A;  3FTW A;  3FU5 A;  1TR4 A;  1BI8 B;  4OVV A;  4AJW A;  1IQU A;  3PUJ A;  4BX8 A;  2IF4 A;  4HOR A;  1NP7 A;  2V5F A;  1H0A A;  2X38 A;  3CIA A;  4LNU D;  4MS6 A;  2XPY A;  4HI8 A;  4R7L A;  3E32 A;  3CHQ A;  4JPS A;  3VTY A;  3CSF A;  3KSQ A;  3CHO A;  3IV0 A;  4LER A;  3CVQ A;  2PZI A;  1N52 A;  4HNA D;  4KVM A;  4U0S A;  4ILG A;  2MYO A;  5ENP D;  4LCT A;  5HI7 A;  2GRO B;  3TWS A;  3KS2 A;  5HRY A;  3UM1 A;  4G1T A;  4A3T A;  2IO2 C;  1HZ4 A;  4O6F A;  3L13 A;  4X8Q A;  5KWD A;  4JA9 A;  3FUD A;  3DXK G;  5FZQ A;  4I9E A;  1WDY A;  2P9S G;  4CYM D;  2R59 A;  1HH8 A;  2ZIR A;  4J7W A;  2IEJ A;  4EZK A;  4FA6 A;  4ATZ D;  1DC2 A;  3ZXP A;  2XEE A;  4GTR A;  3TWX A;  3ZUV B;  4IYP A;  1MQS A;  3JYS A;  5BV0 A;  1O1R A;  4PUC A;  3ASH A;  4CRW A;  3LY7 A;  3PH0 C;  4K0R A;  1NA3 A;  4O1O A;  3G2V A;  2KZT A;  4NIK A;  3SQV A;  2XRY A;  3DST A;  3CHR A;  5T3R A;  5E75 A;  3SFZ A;  3U4T A;  3UXG A;  1D9S A;  5FT9 A;  3BEE A;  1E8X A;  4Y6C A;  5LCW C;  1IQR A;  2LAH A;  2WM9 A;  3NOC D;  5KNG A;  4UUC A;  4MRU A;  4EZL A;  4UWH A;  1E96 B;  3ASO E;  4B89 A;  2V4L A;  3FEX A;  4EEC A;  1NZN A;  2XZT G;  3ZGQ A;  2GRM A;  3UTM A;  4FU3 A;  3HXB A;  3FDH A;  4A1S A;  4RVB A;  3TWU A;  3LYA A;  3MJW A;  4GB9 A;  3TAX A;  4CZ2 D;  1S63 A;  4GCO A;  2LSU A;  1EPU A;  3TWQ A;  2QYJ A;  3NZU A;  3U3W A;  1FT1 A;  3AG1 E;  3ZEF A;  4BT8 A;  5BXO A;  2VSX E;  2JEK A;  1TN6 A;  1H6K A;  2GRQ B;  4FLB A;  3N71 A;  2BF0 X;  5G04 C;  2WB2 A;  1UJJ A;  3SBS A;  2FO7 A;  4HRN A;  3R7Q A;  4EHM A;  3JQ0 A;  4UQY A;  3E34 A;  5FQ4 A;  3IEG A;  1KT0 A;  2ETC A;  3LVR E;  1N94 A;  4HI9 A;  3L6A A;  2VGY A;  4C0M A;  4FC8 A;  3QC1 A;  4HRM B;  1E8Z A;  2QY7 A;  5CRU A;  3RKV A;  2VSO E;  3V2O A;  4ATG A;  2EIM E;  4KVO A;  1MHQ A;  3CEQ A;  5A6C A;  4WUY A;  3S7B A;  2XEV A;  3SGH A;  3FTZ A;  4DI4 A;  2CHZ A;  3AS8 A;  3NB2 A;  1TNU A;  4U04 A;  3HG0 D;  2VJ8 A;  3AJI A;  1NI1 A;  3CVU A;  4KMO A;  4HS2 A;  2AVP A;  3CKB A;  4ANW A;  1TJF A;  3ZW3 A;  5CRV A; 
#chains in the Genus database with same CATH homology
 5JJ6 A;  3MV2 B;  4GYW A;  1OWN A;  4B8A A;  5KJK A;  3AU4 A;  3BG0 B;  5AIJ A;  2MOW A;  3QWV A;  4URK A;  2PM6 A;  1WY6 A;  2KM4 A;  3RJV A;  3GZS A;  2UY1 A;  3ZHE A;  3FTU A;  5LCW J;  2FUL A;  4LUN U;  2J4D A;  2XGO A;  5HQ8 A;  4CCA A;  3ULQ A;  4FAD A;  4YND A;  4AV7 A;  3S7D A;  2OV8 A;  3B7U X;  5CMY A;  3ASG A;  1HO8 A;  3CLJ A;  3LJ3 A;  4H7Y A;  4KZ0 A;  4HLE A;  5EDS A;  5LX8 A;  3PUK A;  2E0I A;  2RG8 A;  3MYV A;  1E7U A;  3HVE B;  2WXQ A;  3Q15 A;  4N39 A;  4V3I A;  5KJM A;  3C98 A;  3DBS A;  3T5X A;  2PL2 A;  3APF A;  5G05 C;  3ZN3 A;  1GW6 A;  2X6I A;  1OWM A;  2VTB A;  2IJG X;  3VLF A;  2EQX A;  2HO1 A;  4JXT A;  3VLE A;  3ZRH A;  4BTB A;  4J8S A;  3Q5M A;  4BSX A;  3QAR A;  1FVF A;  3FUN A;  3B13 A;  2C0M A;  3PEU B;  2NXP A;  3P2B A;  4RG9 A;  4FJZ A;  4ACK A;  1Z3Y A;  3IHV A;  1BPO A;  3QK0 A;  4XI9 A;  4NAC A;  4UWK A;  1IYG A;  2X3M A;  1QNF A;  1HG5 A;  4NQ0 A;  4XZ4 A;  3ZW3 A;  3ZYK A;  2YIN A;  4J6I A;  2GW1 A;  4N3C A;  4DK5 A;  4GA1 A;  4PS8 A;  4GZC A;  4PH4 B;  3FEY A;  3FTS A;  4J8F A;  4G23 A;  5E76 A;  3LY8 A;  2E2E A;  2CFU A;  4WND A;  1ZBP A;  3OXL A;  3Q4A B;  2KCK A;  3G2W A;  3G2U A;  2FI7 A;  4MKT A;  2RD0 A;  1E7V A;  3RK6 A;  1UN8 A;  4N2S A;  3RO2 A;  2VQ2 A;  2XGM A;  2ILR A;  2VGX B;  1JWF A;  2WXF A;  2KZT B;  4NRH B;  1JUQ A;  5G55 A;  4B0Z A;  3Q49 B;  3Q47 B;  4BX9 A;  1N54 A;  1TJC A;  3FU3 A;  2CG2 A;  4L7T A;  5D0Q D;  1OWL A;  2X6J A;  3NQP A;  3PE3 A;  4UQZ A;  4W9R A;  3U66 A;  4HOS A;  4AY5 A;  3D9N A;  5FQ8 A;  4LRZ A;  3ASF A;  3CR3 A;  4ILH B;  5ARG A;  3FU0 A;  4APO A;  5G04 J;  3FUF A;  3PZD A;  2GGF A;  3PNL B;  5D0O D;  4F3V A;  5J08 A;  5FJY A;  2WXP A;  2IOL A;  4Q69 A;  4J8D A;  5FQ6 A;  3UX4 A;  4OVU A;  2I6H A;  3G2T A;  2C2L A;  3LXU X;  3CVP A;  3GZ2 A;  4DLQ A;  3KAE A;  3MKR A;  3SNX A;  1DNP A;  4HOU A;  3L54 A;  2WXJ A;  3FUM A;  2VSN A;  5BV1 A;  1KT1 A;  3L16 A;  4LEU A;  4DPR A;  4A1G A;  1H19 A;  1HS6 A;  1FCH A;  3OAW A;  4IN3 B;  1H2U A;  2LAI A;  2OVB A;  3O4Z A;  4PS3 A;  4UWL A;  4TRQ A;  5BW8 C;  1W3B A;  2GRL A;  2YHE A;  1SQM A;  2XQ0 A;  3LKU A;  4JA7 A;  3ZVV A;  4I1A A;  1E8Y A;  3UT4 A;  4JW1 A;  3CHP A;  4UI9 J;  3GZ1 A;  2IQC A;  3HHM A;  3AS5 A;  4XKC A;  5FZS A;  4C9B B;  2KC7 A;  3IHY A;  3FUL A;  4RG6 A;  2A5U A;  5DIZ A;  5CCL A;  3ASD A;  4CEM A;  2IOS A;  2YQ8 A;  2CFZ A;  2WVI A;  3CK9 A;  3U64 A;  4XI0 A;  3B7R L;  1JPL A;  5CMW A;  1Z3X A;  2X6F A;  2P58 C;  3NZS A;  2Y3A A;  2WXG A;  4D10 C;  4KT6 B;  5A7D B;  3UT7 A;  3NF1 A;  4FUL A;  5KJL A;  3MEK A;  2WXO A;  3D9L A;  4WAF A;  1HX8 A;  4EBA G;  5AEN A;  4KZC A;  4U07 A;  3MA5 A;  3QWP A;  3CVV A;  2I2O A;  2JLB A;  3FTX A;  4ANU A;  4J0U A;  2J9Q A;  4UQX A;  4BTA A;  2WMN A;  4KBQ A;  4YVQ C;  1HE8 A;  4WWO A;  4C0E A;  4MLP A;  2WPV A;  3SHF A;  2DCP A;  5FWQ A;  1P5Q A;  3CGH A;  3CHS A;  4GYY A;  4L2L A;  5EKQ D;  4L1B A;  5T8I A;  5JJT A;  5M72 A;  1NA0 A;  4N3A A;  3CK7 A;  4Y6W A;  3FFL A;  4WNG A;  3MKQ B;  4FHK A;  3FWV A;  3QJZ A;  4GZ3 A;  2WQ7 A;  4ANV A;  3T5V A;  2FBN A;  3CVL A;  4ILI A;  4ME2 A;  3I3N A;  4TV3 A;  2HM8 A;  3FHE A;  3RRM B;  2YHC A;  3JCK C;  3HIZ A;  4FP7 A;  2M63 A;  3TXN A;  1ELW A;  2LSV A;  3T8M A;  5BUZ A;  3ZFW A;  3LDZ A;  4H7X A;  4PDX A;  3FTW A;  3PE4 A;  2AXV A;  4ABN A;  3FU5 A;  1Y8M A;  3CVW A;  1OWO A;  4OVV A;  4AJW A;  1IQU A;  5LOZ A;  3RU0 A;  4WNE A;  4APF A;  5CCM A;  3FTV A;  4CGV A;  3PUJ A;  4AP2 A;  4BX8 A;  3I5P A;  4BWR A;  2IF4 A;  4HOR A;  1NP7 A;  1EF1 C;  2V5F A;  1H0A A;  2X38 A;  3CIA A;  4L2Y A;  5G05 J;  2I1J A;  4U8H A;  4M3O A;  3I4G A;  2XPY A;  3QWW A;  4MS6 A;  4DI3 A;  3EIJ A;  3FUK A;  2YNQ A;  4R7L A;  3EJN A;  3CQC B;  3CHQ A;  1H2T C;  3AS4 A;  4JPS A;  3VTY A;  3LVQ E;  4ACL A;  1QQE A;  2KCV A;  4K03 A;  5G2N A;  3CSF A;  3K9I A;  3S2A A;  2PQN A;  3CHO A;  3SBT B;  1ELR A;  3IV0 A;  4FLH A;  1HU3 A;  4LER A;  3CVQ A;  2WQ6 A;  3EDT B;  2ION A;  4JVS A;  4A55 A;  2PZI A;  3PRE A;  4GU5 A;  5JJ7 A;  4Q96 A;  1N52 A;  4KVM A;  1PAQ A;  2AXU A;  4ILG A;  4U0S A;  1S0P A;  4LCT A;  3VLD A;  3QNK A;  5HI7 A;  2WQH A;  5BT1 A;  2XCB A;  3G2S A;  5ENN A;  3D9I A;  3CST A;  1PC2 A;  3KS2 A;  1TEZ A;  4JL0 A;  5EX3 A;  2KAT A;  4ANX A;  4EQF A;  4G1T A;  4E6H A;  4A3T A;  1HG2 A;  3CQG B;  1SZA A;  3CV0 A;  3U9W A;  4F7A A;  4OYS A;  1HZ4 A;  4O6F A;  4F1S A;  1PY1 A;  3L13 A;  1OUV A;  3L22 A;  4I9C A;  2OVF A;  1UG3 A;  1XGW A;  3MCX A;  1UW4 B;  3UPV A;  4DJA A;  4HVB A;  4WWP A;  3ML9 A;  3HVE A;  4JA9 A;  3FUD A;  4GAA A;  3CVX A;  2I9C A;  2LNI A;  3R9A B;  3OTN A;  5FZQ A;  4UWF A;  4I9E A;  2QFC A;  2UY1 B;  4P29 A;  3ZHE B;  4AM9 A;  5A23 A;  3BG1 B;  3SZ7 A;  1SZ9 A;  1INZ A;  2Q7F A;  3OXG A;  5ANL A;  4GPK A;  3IKO B;  2R59 A;  1HH8 A;  2L6J A;  1UN9 A;  4BY6 A;  3SI5 A;  1E90 A;  2KCL A;  3FUI A;  3ESL A;  4EZK A;  2V8S E;  4G26 A;  3LY9 A;  4FA6 A;  2L0I A;  5LP0 A;  2IU1 A;  4GZD A;  4GA2 A;  2OND A;  3I4R B;  3PVL A;  4IYP A;  3JUI A;  5KCM A;  1MQS A;  4GYO A;  3JYS A;  4AXH A;  5BV0 A;  4PUC A;  3FU6 A;  3QAQ A;  2VTB B;  1WAO 1;  3ASH A;  4CRW A;  3LY7 A;  2WMO A;  3ZIM A;  4AY6 A;  3PH0 C;  4K0R A;  1NA3 A;  3ZPJ A;  3CVY A;  2VGX A;  5JHA A;  3D9K A;  3G2V A;  5T4Y A;  1A17 A;  2KZT A;  2X6K A;  5AJD A;  2XRY A;  5FQ7 A;  4XX5 A;  4AOF A;  3LCA A;  3CHR A;  4I6G A;  5T3R A;  2PM7 A;  3KEZ A;  4HXI A;  3UT8 A;  3D3M A;  4GA0 A;  5E75 A;  4JEH A;  1H2V C;  1EDU A;  3SF4 A;  2CHW A;  4I17 A;  5DBK A;  3SFZ A;  3QDN A;  3AU5 A;  4BT9 A;  3U4T A;  3L08 A;  4N2Q A;  4BFR A;  4XE0 A;  4HFG A;  2WXM A;  4GZ6 A;  5FT9 A;  2WXI A;  3BEE A;  1E8X A;  4N5C A;  4Y6C A;  2BTD A;  2UWJ G;  3ZYQ A;  5LCW C;  4HOT A;  4I1M A;  1IQR A;  2LAH A;  5JHB A;  2WM9 A;  5BPP A;  2J07 A;  3RRU A;  2L9B A;  4HOQ A;  4AVX A;  3VTX A;  2J49 A;  4MRU A;  4EZL A;  2AXZ A;  1IHG A;  4UWH A;  4U63 A;  2WXK A;  3MGB A;  2NC9 A;  3SD5 A;  3UUX A;  2R5S A;  3FUH A;  3EHM A;  1HF8 A;  2DIW A;  4B8C B;  1E96 B;  2VYI A;  2DBA A;  4JEU A;  4A3V A;  4J8E A;  4U0U A;  4UI9 K;  5J90 A;  2IFU A;  4N3B A;  4B89 A;  2V4L A;  3B7S A;  2CHX A;  3FEX A;  4G24 A;  3TXM A;  4JHK A;  4EEC A;  1U3C A;  1NZN A;  3ZGQ A;  4Q94 A;  2GRM A;  2XGS A;  3ENE A;  3QOU A;  3D9M A;  3TG4 A;  3ONL A;  4WNF A;  4CGW A;  2XHE A;  4FU3 A;  1U3D A;  3FDH A;  1X5B A;  2L0T B;  4A1S A;  3CHM A;  3QB2 A;  4KXK B;  4RVB A;  3ESK A;  1Z6T A;  3LYA A;  3MJW A;  4GB9 A;  3TAX A;  3TG5 A;  4GCO A;  4CT4 A;  2Y4U A;  3GYZ A;  4KYO B;  2FEZ A;  3D9P A;  2MHK A;  3ONK A;  4I2W A;  2X6H A;  2XPI A;  5EX0 A;  3EHN A;  3LEW A;  4YVO A;  3S7F A;  2LSU A;  4XKB A;  3TL5 A;  3MV3 B;  4CDM A;  2WXH A;  1EPU A;  3FUJ A;  3UQ3 A;  4IRU A;  4JC8 A;  3QKY A;  2CG3 A;  3NZU A;  3GW4 A;  1LF8 A;  3OXF A;  4FJY A;  3U3W A;  5C2Y A;  2FF4 A;  2Y4T A;  1JWG A;  3ZEF A;  2A4Z A;  4BT8 A;  2LO6 A;  3FP3 A;  3WXX A;  4GZ5 A;  2VSX E;  2JEK A;  3RO3 A;  2VSY A;  5KJN A;  3MKQ A;  1H6K A;  3PEV B;  2HR2 A;  1ELK A;  5BNW A;  4FLB A;  3N71 A;  1QZ2 A;  3ZYL A;  2BF0 X;  5G04 C;  4B94 A;  2WB2 A;  1FVH A;  1UJJ A;  4TUU A;  4WWN A;  3SBS A;  4F53 A;  4EBA A;  2FO7 A;  3PRZ A;  3R7Q A;  5AJL A;  1UJK A;  5FZR A;  5AYW D;  4JZY A;  1YA0 A;  3CK8 A;  3HYM B;  3JQ0 A;  4UQY A;  3FH8 A;  3PDN A;  5FQ4 A;  3IEG A;  1KT0 A;  3CKC A;  3RIB A;  1VDY A;  3UMV A;  4E85 A;  4AEZ C;  3LVR E;  3ZXS A;  3S7J A;  5C1D A;  4IUL A;  1Y6I A;  2XCC A;  3D9J A;  3FTY A;  2MRI A;  2WXR A;  2AWI A;  2VGY A;  3L6A A;  4CDN A;  4CT0 A;  4C0M A;  2BUG A;  4JHR A;  5LFA A;  2ZU6 B;  2J09 A;  4UI9 C;  1E8W A;  2XRZ A;  4L23 A;  2V0P A;  3KD7 A;  4EPZ A;  4FC8 A;  2J4B A;  2WXN A;  2WXL A;  3QC1 A;  4GML A;  5ARF A;  4AIF A;  3ML8 A;  4NUR A;  1EYH A;  3TJP A;  3D9O A;  1E8Z A;  3ZYM A;  2QY7 A;  3FH7 A;  3RKV A;  3FUE A;  3MX3 A;  4EZJ A;  2VSO E;  2AW6 A;  5FTP A;  4ATG A;  1B89 A;  3APC A;  3FY4 A;  1OWP A;  4I2Z A;  4KVO A;  1MHQ A;  3JQ1 A;  3CEQ A;  2OOE A;  5A6C A;  4WUY A;  3EIQ C;  3S7B A;  1DVP A;  2XEV A;  2NSZ A;  3E4B A;  3O48 A;  3SGH A;  4CDR A;  3URZ A;  3TGO A;  3FTZ A;  2PQR A;  3PNT B;  4I43 A;  4FHJ A;  4PS7 A;  4DI4 A;  2CHZ A;  4RSY A;  2HYZ A;  5CHE E;  3AS8 A;  4G11 A;  3CVN A;  1HFA A;  4GMJ A;  4I1O B;  4U04 A;  4QFV A;  3PS6 A;  4I6E A;  3RRN B;  5ANR A;  3DPD A;  4XIF A;  2R17 C;  3P1U A;  1KLX A;  1WM5 A;  4GCN A;  4I6J A;  4JHJ A;  4U0Z A;  3B7T A;  3IBE A;  3L17 A;  1L5J A;  3FH5 A;  3MZL B;  2VJ8 A;  1ZU2 A;  3APD A;  3R7R A;  3HDX A;  3CVU A;  4KMO A;  2XPZ A;  3LPZ A;  2I1K A;  4G2V A;  4HS2 A;  4DLO A;  1HXI A;  2AVP A;  2C0L A;  3CKB A;  4ANW A;  4G25 A;  2J08 A;  3LS8 A;  1TJF A;  1XNF A;  4UWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...