5M72A

Structure of the human srp68-72 protein-binding domain complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
150
structure length
150
Chain Sequence
SVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle subunit SRP72
publication title Structures of human SRP72 complexes provide insights into SRP RNA remodeling and ribosome interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17004 SRP_TPR_like Putative TPR-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5m72A00
4U04A 3ASGA 4GPKA 4JHRA 2FI7A 5LCWC 3ULQA 3KD7A 2JLBA 4HORA 2C2LA 4AY5A 2XGOA 3MKRA 5FJYA 3OXLA 4U0ZA 1KT1A 4HOSA 3QWWA 2XPIA 3LY9A 4GYOA 3OXFA 2C0MA 4GCOA 3GZ1A 3OXGA 3LKUA 5DBKA 4RG9A 4XI9A 3Q5MA 4G26A 3LYAA 3O48A 2YHCA 4GYWA 4Y6WA 4YNDA 4UI9K 4LEUA 3LCAA 2KCLA 2KC7A 3VTXA 3RO3A 2XGSA 4HOUA 1IYGA 3MV2B 5FZQA 4J8EA 3ZHEA 3ZN3A 4I1AA 4N3CA 3CVNA 4A1SA 3RJVA 4CDRA 4F3VA 5BNWA 5G05J 4B94A 4N3BA 4N39A 3Q4AB 4U0UA 1YA0A 4IN3B 4EQFA 4YVOA 1OUVA 4JA9A 3CVQA 5G04J 4H7YA 3CKBA 2KCKA 2HR2A 4U07A 3JYSA 4GA2A 4UQYA 2WQHA 3QWVA 4N5CA 4KYOB 3VTYA 4BWRA 5JJTA 3KAEA 3CK9A 2UWJG 2C0LA 1HZ4A 2J9QA 5JJ7A 3HYMB 5G05C 3AS8A 4G2VA 5EX0A 2L6JA 3S7BA 5CHEE 3S7DA 5C1DA 5G04C 5AYWD 4AIFA 1QZ2A 5M72A 5KJMA 1FCHA 3ZHEB 3E4BA 2KATA 4APOA 4GA0A 1W3BA 3UQ3A 4HOTA 2FBNA 2DBAA 1ZU2A 2VSNA 4G1TA 3ZFWA 4ME2A 2XCCA 2VGXA 4NRHB 5ARGA 3Q49B 1Y8MA 4KBQA 3Q47B 5HQ8A 3RKVA 2GW1A 3GYZA 3CEQA 3S7JA 1ZBPA 3AS5A 2PQNA 2Y4TA 1TJCA 4H7XA 5CCMA 3FWVA 3MV3B 4I2WA 2P58C 3K9IA 4I17A 3AS4A 3UUXA 4G25A 2FEZA 4GZ3A 5KJKA 3RU0A 3ZGQA 5FT9A 3U4TA 4CGWA 4BT8A 4J0UA 2YQ8A 4UI9J 2NC9A 4NQ0A 3URZA 5KJNA 1P5QA 4ABNA 1XNFA 4BTBA 1A17A 3RIBA 1NA3A 4AY6A 3GZ2A 3MA5A 4J8DA 2WPVA 3PDNA 4WNEA 2VGXB 4U0SA 4GYYA 3QDNA 2PQRA 3ASHA 5D0QD 3TAXA 1WM5A 5FZRA 4WNDA 2R5SA 2Q7FA 4I2ZA 3QKYA 4UI9C 5JJ6A 5A6CA 1B89A 3Q15A 4CGVA 4N3AA 4GA1A 5CCLA 4BTAA 3LPZA 4W9RA 4XIFA 3EDTB 2ONDA 2QFCA 3FP3A 4J8FA 4YVQC 2VGYA 2IFUA 4N2SA 4AM9A 3IEGA 2OOEA 2VYIA 2KCVA 3ASDA 1QQEA 2Y4UA 2I6HA 4UQZA 3CKCA 3UPVA 2E2EA 5ARFA 3ZPJA 3LY8A 2AVPA 4KXKB 1NZNA 1ELRA 1IHGA 3CK7A 3RO2A 1ELWA 3CVLA 3QWPA 3LY7A 4Y6CA 3GW4A 4JL0A 1E96B 4JA7A 4GZ6A 3S7FA 4WNFA 3PE3A 3CV0A 1WAO1 2UY1A 2HO1A 2PZIA 3N71A 4G23A 3WXXA 5BT1A 3QOUA 5KJLA 1NA0A 3MEKA 5DIZA 3TGOA 2MHKA 4I9CA 2XEVA 3TG5A 2XGMA 4HOQA 2FO7A 3PE4A 2LSUA 4UQXA 3CK8A 1HXIA 2VSYA 3BEEA 3ESKA 2LSVA 4N2QA 2BUGA 2HYZA 2IF4A 2V5FA 5D0OD 4BT9A 1PC2A 4WNGA 4GCNA 3FFLA 5A7DB 5EKQD 5LCWJ 2FF4A 5FTPA 5HI7A 2PL2A 2VQ2A 5EX3A 5FZSA 1KLXA 4WUYA 4XI0A 2UY1B 4I9EA 2XCBA 3U3WA 3ASFA 3SZ7A 4GZ5A 3NF1A 5BW8C 3KS2A 1HH8A 4G24A 3R9AB 4O6FA 3CVPA 1KT0A 4RG6A 2LNIA 3SF4A 3TG4A
chains in the Genus database with same CATH superfamily
1K1BA 4C0EA 1DVPA 2VTBA 4DRXE 4GPKA 2QC9A 2FI7A 2ZXWE 3FUIA 3KD7A 4J8YA 1WY6A 4XKBA 2AWIA 4JW1A 1E7VA 3ONKA 5J90A 2HE0A 5EIDA 1TNBA 1N4PA 3SHFA 4HRLA 1U3CA 3EU9A 3CVVA 4HOSA 1IHBA 3QWWA 2LXMA 2XS1A 5AJLA 3AJIA 4DX6D 2WMNA 1OT8A 3LYAA 1DC2A 2YHCA 4GYWA 1KZPA 1MHQA 3PRZA 4LEUA 3G2VA 3UM0A 3FU3A 2WXPA 3PZ2A 4HOUA 2X38A 1O1TA 3C5RA 2NSZA 1YMPA 5BPPA 2BTDA 4J8EA 5AENA 2ETAA 3ZN3A 1SA4A 3G2UA 3W9FA 3RJVA 4A1SA 4CDRA 1IKND 4F3VA 1Z5SC 4TUUA 2DZOA 5E76A 3D9PA 5JMND 3UTMA 1OWMA 3TWSA 2WQHA 4KZ0A 4KYOB 4DX2A 2GRPB 3BG1B 2X6JA 2J09A 4ANVA 2BKGA 5JJTA 3EHQA 3TJPA 3CK9A 2P9KG 1HZ4A 4FJZA 4RQIA 3L17A 2RG8A 4QFVA 3IHVA 2R05A 5C2YA 2J08A 5CMYA 4BX8A 5IY5E 5CERB 4XKCA 2R17C 3ABKE 4AIFA 1HO8A 2CFZA 3EJNA 2MRIA 2EIME 3U9WA 2J07A 3UM2A 3E4BA 2KATA 4YDYA 1NP7A 1W3BA 3Q75A 3UINC 4GZCA 5G55A 2FBNA 2DBAA 1MYOA 4G1TA 4UWGA 1RZ4A 5KNGA 1HG5A 4J8SA 4MRUA 4YDOA 1U3DA 4NRHB 1N54A 1WDYA 4MKTA 1O1RA 3ZUVB 3S2AA 3I4GA 2Y0BG 1MJ0A 1Y8MA 3FEXA 2GW1A 3CEQA 2PQNA 2Y4TA 3APFA 5CCMA 3FWVA 1N0QA 2P58C 2EINE 3E33A 1TNUA 2FEZA 4GZ3A 3AU4A 2F8XK 2RFMA 2X6IA 2V5QC 1LD7A 3HVEB 3ENEA 4OVVA 1BD8A 4I1MA 5AAOA 3URZA 4GZDA 3R7QA 5KCMA 3TXNA 4ABNA 3HIZA 4A63B 4KT6B 1N11A 4HLEA 3DEOA 3DRAA 3EHMA 5KNHD 2J4DA 4ACLA 4FJYA 3ULEG 3MA5A 4UWHA 1OWNA 3L22A 5KBAA 4GYYA 2B6CA 4GTTA 1UN8A 2B0OE 4MLPA 1QNFA 3QB2A 4A1GA 4DI3A 2AXUA 2IY0C 3ABLE 5FIOA 4HRNA 1TNZA 3QKYA 2GGFA 2AJAA 3Q15A 1E8YA 3DSTA 4OYSA 1Y6IA 3Q78A 4JHJA 4W9RA 3EDTB 2QFCA 2P9NG 2VGYA 4MBGA 2GRRB 4AM9A 2RD0A 4IYPA 4WAFA 3IEGA 4BETA 1OWLA 4AJWA 2PNNA 4ATGA 4PS3A 3CVWA 4LRZA 4GMJA 1NL4A 3L16A 4CZ2D 3HHMA 2WB2A 4KZCA 2XEEA 2I1KA 3ZPJA 3LY8A 4FLHA 1NZNA 4KXKB 4GTPA 4RVBA 5BXUA 1IHGA 3FTUA 1ELWA 4M7CA 4I43A 4JL0A 3ZYLA 1E96B 2WXRA 4WNFA 1OWOA 3CV0A 3RRUA 3CSFA 3RRNB 2DIWA 1E7UA 4TXRA 2WXFA 3B13A 3VLEA 3EUVA 4KVOA 3GZSA 3WXXA 3NZUA 3CQCB 4UWLA 1NA0A 1N4RA 1S63A 1IQRA 1INZA 5DIZA 3DWLG 3TGOA 3FU0A 3JQ0A 2XGMA 3IKOB 4HOQA 1O5MA 1MZCA 2QY7A 3F6QA 5B3SE 4OAUC 3FUEA 4DX1A 4K5AB 3TWWA 4BSXA 2VSYA 1L5JA 3NOGD 2BKKB 5AQ7A 3I5PA 3JXIA 2BUGA 3SFXA 2V5FA 5D0OD 1AP7A 5EYLA 3JUEA 1PC2A 2OEVA 5HS0A 4ACKA 5A7DB 3CVUA 3UXGA 5LCWJ 2OEWA 2E0IA 2FF4A 2A4ZA 4DI4A 1BI8B 2PL2A 1MX6A 3FUNA 3CLJA 3UT8A 4FADA 4XI0A 3DEPA 2GRMA 3CGHA 4EBAA 4WWNA 2IO2C 1FPPA 1N9AA 2OV8A 2YNQA 3AAAC 1KT0A 1DCQA 3B7UX 3SF4A 4GPMA 3HXEA 1MX4A 3TG4A 4U04A 2ZISA 3C3OA 4G8KA 5AQAA 4LNGA 2WXOA 3LJ3A 3P2BA 2X6FA 5EILA 5LCWC 3RRMB 3FTZA 3AG1E 4HORA 2C2LA 3FY4A 4AOFA 3Q73A 3FUDA 4EECA 5CECB 3ASNE 2ZU6B 2BEDA 3JCKC 3OXGA 4U8YD 2WM9A 2IEJA 2DYSE 2EIJE 3V31A 1H6OA 4B8AA 4E85A 1N52A 3LCAA 2KCLA 3IXEA 2XGSA 3DXKG 5AN8A 4XZ4A 5AQ9A 2GRQB 3FHEA 2KM4A 3D9JA 3ML8A 2EILE 4A55A 3NZSA 5EDSA 1KZOA 1LTXA 3V30A 4N3CA 2CHXA 5BNWA 1YA0A 4GTOA 1N4SA 3EHNA 4YVOA 1QBQA 4JA9A 5G04J 1GW6A 3CHMA 4H7YA 3CKBA 2QYJA 2HR2A 4U07A 4E6HA 2YINA 3PUKA 4L2LA 5ENPD 1OCOE 3SGHA 1RW2A 4HBDA 1FVHA 4O1PA 3DSXA 3Q79A 1HU3A 3DPDA 3HYMB 4NURA 1K1AA 4CEMA 4LCTA 5B1AE 3BU8A 3FUFA 1H6KA 4PS7A 5EX0A 3S7BA 5G04C 1SVXA 3HVEA 2OCCE 4U96D 2A5EA 3R9MA 3DSVA 3E37A 3TWUA 1DNPA 1JPLA 4XE0A 4GA0A 3B7TA 4UUCA 3IHYA 4HLLA 5J08A 1LF8A 4HXIA 4I6GA 4FP7A 2LAIA 4X8QA 1YYHA 4CT0A 5B1BE 3PEUB 4AXHA 1OWPA 2J49A 4KBQA 4CDNA 1FT1A 3GYZA 5EIBE 4O1OA 3CR3A 4BSZB 4O60A 4KVMA 4H7XA 4JD2G 3C3QA 3MV3B 3SFZA 4I2WA 3K9IA 2CHZA 3AS4A 4HQDA 5BXOA 3UUXA 4G25A 1D8EA 3ZGQA 5FT9A 1IXVA 3U4TA 3ZU7B 3AG3E 4U8VD 3TWVA 5BV1A 5CMWA 3QARA 5ITZF 2J4BA 4NQ0A 2XS8A 5KJNA 4JZYA 1SZAA 3E30A 4B93B 2ETBA 3TWTA 1P5QA 1XNFA 2XHEA 3PNTB 3Q7FA 1VDYA 4AY6A 3PNLB 3X2QE 5FQ7A 4J8DA 4HNAD 4U0SA 5LX8A 3QDNA 2L9BA 3TAXA 1TJFA 3SO8A 2GRLA 2R2LA 1WM5A 4F1SA 5AIJA 3D9OA 2XRYA 1HG2A 2R5SA 1H2TC 3E34A 5A6CA 4U8HA 5ENQD 3PZ3A 3D9MA 3T8KA 3LPZA 4BTAA 4YVQC 3Q9NC 3B95A 3CHRA 3QC1A 2NXPA 4BERA 4UWKA 4UWFA 1JCSA 1EDUA 2VYIA 4IRUA 3W9GA 2KCVA 1N95A 1E8ZA 4WWOA 4N5QA 3UPVA 3ZYMA 4JEHA 2J8SD 1TYQG 1BPOA 2MOWA 4FULA 1ELRA 3ZEFA 3DSWA 3LEWA 4NACA 4DLOA 1MQSA 3CK7A 3RO2A 2WQ6A 3CVLA 2VJ8A 3V79K 3UKUG 2X6HA 3AG4E 5D2MC 3UT7A 1X81A 4JA7A 5ANRA 1WAO1 2XPYA 3CVYA 4GTRA 3ISMC 3QJZA 3ML9A 5LFAA 3FDHA 3LVQE 3QOUA 5KJLA 3FTYA 1ELKA 4HFGA 4B8CB 3FULA 3MEKA 1BI7B 4ANXA 2XEVA 4XX5A 4LUNU 1UJKA 3D3MA 1A5EA 4ILGA 3CK8A 4L7TA 1HXIA 3PUJA 4L1BA 4L9PA 2LSVA 3JUIA 3MKQB 4N2QA 4ANWA 3TL5A 2ZGGA 4I6JA 2HYZA 5FQ8A 4BT9A 3D9NA 4AP2A 1AWCB 3UX4A 3G2TA 4WNGA 4GMLA 5ENOD 3MX3A 3L6AA 4JXTA 5HI7A 4Q69A 3HXFA 2XZDG 4FHJA 2F37A 3C72A 1E90A 4I9EA 3ASFA 3CHSA 3NF1A 5BW8C 1OY3D 3KS2A 2XENA 3CVPA 2IO3C 3OAWA 3CVXA 2LNIA 3RK6A 4R7LA 3NAWA 4U63A 4DUIA 3J5QB 1N0RA 5G2NA 5ANLA 1HE8A 2R03A 4ANUA 4B89A 1O1SA 2KZTB 3BG0B 4K0RA 3SY2A 1EPUA 2XGOA 3MKRA 5FJYA 3OXLA 4CCAA 4U0ZA 4C9BB 1PY1A 1KT1A 4ZHBA 3R7RA 4GYOA 3OXFA 4GCOA 1TNYA 3GZ1A 1YCSB 3L13A 5JHAA 3L9TA 3SI5A 4HRMB 3APDA 3I4RB 1JUQA 4Y6WA 4UI9K 3UI2A 2NYJA 3LVRE 2KC7A 3VTXA 3RO3A 4OAVB 3KEZA 2LUHA 5EYPF 3UM1A 1IYGA 5FWQA 3P1UA 5CEDB 4ZFHA 1K8KG 4I1AA 3CVNA 3Q7AA 3UM3A 3JXJA 3FUMA 5JA4D 5G05J 4AVXA 4QQIA 4N3BA 4U0UA 4IN3B 3PZ4A 2QYUA 3DXMG 1MX2A 3FU5A 1OUVA 3CVQA 5T8IA 2WXMA 3JQ1A 2WQ7A 4DX7D 3JYSA 2ETCA 4ILIA 4GA2A 1NFIE 5A23A 2WXGA 2Y3AA 3QWVA 3PVLA 2LAHA 3SQVA 3T8MA 2EIKE 3RAUA 2OVBA 4AEZC 3I3NA 4PDXA 5CRUA 2AXZA 2UWJG 2C0LA 5JJ7A 5G05C 3DPYA 3AS8A 4G2VA 4U7EB 2L6JA 3MYVA 5HKPA 3S7DA 1N94A 5AYWD 1UW4B 3MCXA 3ZHEB 4YDWA 5AARA 2A5UA 3NBNB 3AU5A 3UQ3A 4HOTA 1S0PA 1ZU2A 3EIQC 3AG2E 1K3ZD 5LOZA 3ZFWA 2I1JA 1NI1A 2L6BA 1S64A 5ARGA 3J5PA 2KBXA 3Q49B 5EN5D 2WXIA 3C98A 1SA5A 2CG2A 3Q47B 4HI8A 3KEAA 3RKVA 3KSQA 2F0YA 4FU3A 3NOCD 4JHKA 3L08A 3AS5A 1TJCA 5HRYA 3B7RL 4NIKA 3LDZA 4BFRA 5KJKA 4BESA 5H7PA 3RU0A 4BY6A 2Y1LE 4CGWA 2WMOA 3ZW3A 4FA6A 2KXPC 4J0UA 2YQ8A 2NC9A 2LXLA 4PS8A 3EHRA 2RKKA 4JEUA 2XRZA 4BTBA 4TRQA 1A17A 2WXNA 3RIBA 2WXHA 2DVWA 3PZDA 4CRWA 2FULA 4LG6A 2V8SE 2WPVA 2VGXB 1XGWA 2XQ0A 3CSTA 5CBOA 1H2UA 1UN9A 4D10C 4LNBA 3D9HA 4PUCA 3SBTB 2Q7FA 3LS8A 3IV0A 1B89A 2L0TB 4GU5A 4YDEA 5CCLA 4XIFA 3FP3A 2ONDA 4J8FA 4HB5A 2H6FA 3CIAA 2IFUA 1HF8A 2MYOA 3G2WA 3CHOA 1Z3YA 3APCA 3ZYQA 1S70B 2HM8A 1QQEA 2Y4UA 1H0AA 2I6HA 3CKCA 4FHKA 4GB9A 3SNXA 3MKQA 4GTVA 3HXDA 3U64A 4DPRA 1EYHA 4L23A 5LP0A 4CDMA 3QWPA 3LY7A 4Y6CA 2WVIA 1Q2ZA 3ZIMA 4LERA 2ILRA 3S7FA 3C3RA 1JCQA 5ENTD 3D9IA 2HO1A 3G2SA 4FLBA 2PZIA 4G23A 1IQUA 3PREA 3ULYA 2P9SG 5ENRD 4F6RD 2OVFA 1D8DA 4XEIG 2H6HA 2P9PG 2CHWA 2IQCA 4I9CA 4DJAA 2FO7A 3B7BA 3LXUX 4UQXA 3LJNA 3BUAA 3NB2A 2KZTA 3WG7E 1UOHA 3U66A 3FUHA 2IONA 2V4HC 2DZNA 3FFLA 3TWRA 2IJGX 5EKQD 3DBSA 4JVSA 2IOLA 5FTPA 4GTMA 2VQ2A 1OXJA 5EX3A 4BX9A 5FZSA 2XZTG 3V2XA 1KLXA 3KSLA 4WUYA 3HG0D 4EZKA 1D9SA 2UY1B 2XCBA 3U3WA 4EPZA 4I6EA 4LSZE 3V2OA 4GZ5A 2H6GA 4B0ZA 4TV3A 1HH8A 3T9KA 1WG0A 2IOSA 4F1PA 4V3IA 4IULA 4JB8P 5D66A 3PS6A 4RG6A 1TN8A 2CFUA 3QNKA 1TN7A 4GTSA 2IU1A 3TWQA 3ASGA 1OCZE 4G11A 4KMOA 4JHRA 4HVBA 3B7SA 3EU5A 3ULQA 2PM7A 3ZVVA 2JLBA 1E8WA 3DSUA 3OTNA 3CHQA 2XEHA 4AY5A 1UJJA 2QZAA 1U2VG 1TR4A 2P9LG 5FQ4A 1G3NB 3ZNGA 3VLFA 1H2VC 2XPIA 3LY9A 4EZLA 2C0MA 1OCRE 3MJWA 3T5XA 4J7WA 3LKUA 5DBKA 4DK5A 4RG9A 3SD5A 4F53A 4XI9A 3Q5MA 4G26A 2ZIRA 3O48A 1PAQA 4YNDA 3UKRG 4K5BA 4PH4B 2JABA 3TXMA 5BUZA 1EF1C 3MV2B 5FZQA 3EIJA 3ZHEA 1BLXB 3FH7A 3FTVA 2FO1E 2VSXE 3PEVB 2I9CA 1FT2A 3BQOA 3SFYA 2X3MA 4B94A 2VTBB 4N39A 3Q4AB 3ZXPA 4EQFA 3FTXA 2ZGDA 2KCKA 2L0IA 2H6IA 2AW6A 1X5BA 1JCRA 2VSOE 4UQYA 4Z68A 4N5CA 3VTYA 5CBNA 1UG3A 2BF0X 4BWRA 1HFAA 2AXVA 2I2OA 5FINA 4L2YA 3KAEA 3IBEA 2J9QA 4CT4A 4AV7A 5ENNA 2P9IG 2P2CP 5CHEE 5C1DA 2PM6A 2XPZA 3Q9UC 3ZKJA 1QZ2A 1TN6A 5M72A 5KJMA 1FCHA 2EQXA 3L82A 3UMVA 2R02A 3UIOC 4APOA 2JEKA 1V54E 2VSNA 4GAAA 5E75A 4ME2A 4Q94A 3ZXSA 1SZ9A 1TEZA 2XCCA 1E8XA 2VGXA 1H19A 3PH0C 3FH8A 5HQ8A 4ATZD 4J6IA 2LO6A 1N4QA 4ILHB 4K03A 1ZBPA 3S7JA 5AJDA 4C48B 3ABME 1ZB1A 3ONLA 3T5VA 5T3RA 4TUMA 4I17A 4JC8A 2GROB 5FQ6A 5CRVA 4URKA 4G8LA 3D9LA 2Y69E 5BV0A 2DWZA 4BT8A 4BEPA 4EZJA 4UI9J 3ASOE 1JWFA 1H6PA 4RLYA 1FVFA 1JWGA 4C0MA 1NA3A 3GZ2A 3QAQA 3PDNA 1SQMA 1QYMA 5AQBA 4WNEA 4WWPA 5CEAA 3SBSA 4LNUD 4APFA 3HDXA 2PQRA 3ASHA 5D0QD 3FUJA 3MGBA 5FZRA 4WNDA 4A3VA 4EBAG 3FU6A 4I2ZA 1LD8A 4UI9C 5JJ6A 1Z6TA 2VGEA 4CGVA 2WXKA 4N3AA 4GA1A 2X6KA 3DSSA 5T4YA 4N2SA 4I1OB 2P9UG 1Z3XA 2OOEA 1V55E 3D9KA 4TXQA 4P29A 3ASDA 1BU9A 3TWXA 4UQZA 3HXBA 2V0PA 2E2EA 5ARFA 5KWDA 2WXQA 3FUKA 2WXLA 1HS6A 1SW6A 2RFAA 4HI9A 2AVPA 4HS2A 3RSEG 4Q96A 4DX5D 1OCCE 3CQGB 4GTQA 3PZ1A 3GW4A 1TNOA 3FTSA 2CG3A 4MS6A 2DYRE 2F8YA 3MZLB 4GZ6A 3PE3A 3VLDA 2UY1A 5JHBA 3N71A 1KPSB 4FC8A 5BT1A 2M63A 3E32A 3O4ZA 3HRAA 4TXPA 3FEYA 2MHKA 3TG5A 4CYMD 3FTWA 3ZRHA 4JPSA 3PE4A 2V4LA 3L54A 4OVUA 2R59A 3ESLA 2LSUA 5ENSD 2WXJA 3CHPA 3BEEA 4U95D 3ESKA 3NQPA 4K5CA 3QK0A 2YHEA 2IF4A 4GMRA 2DCPA 4EHMA 4GCNA 4DLQA 3HXCA 4F7AA 3FH5A 2GRNB 1DCEA 4RSYA 1HX8A 3SZ7A 4M3OA 4G24A 3UIPC 3R9AB 3UT4A 4O6FA 4A3TA 3ZYKA
chains in the Genus database with same CATH topology
4R7LA 4U04A 4U63A 4C0EA 1DVPA 2IU1A 2VTBA 3ASGA 4G11A 4GPKA 4KMOA 2WXOA 2FI7A 3LJ3A 4JHRA 1HE8A 2X6FA 3P2BA 5ANLA 3FUIA 5G2NA 4HVBA 3RRMB 5LCWC 3B7SA 3FTZA 3ULQA 2PM7A 3KD7A 3ZVVA 2JLBA 4HORA 1E8WA 1WY6A 2C2LA 3FY4A 4XKBA 4AOFA 2AWIA 3OTNA 3CHQA 4ANUA 4B89A 4JW1A 1E7VA 2KZTB 3FUDA 3ONKA 3BG0B 4K0RA 4AY5A 1EPUA 2XGOA 1UJJA 3MKRA 5FJYA 3OXLA 3SHFA 4CCAA 4U0ZA 4C9BB 1PY1A 1KT1A 1U3CA 4EECA 3CVVA 5FQ4A 4HOSA 3QWWA 3VLFA 1H2VC 2XPIA 3LY9A 5AJLA 4GYOA 3R7RA 2ZU6B 3OXFA 4EZLA 2C0MA 4GCOA 3GZ1A 3MJWA 3L13A 3T5XA 5JHAA 3JCKC 3OXGA 3LKUA 5DBKA 4DK5A 2WM9A 4RG9A 3SD5A 4F53A 4XI9A 3Q5MA 2WMNA 3SI5A 4G26A 3LYAA 3O48A 4B8AA 2YHCA 1PAQA 3APDA 4GYWA 3I4RB 1N52A 4E85A 1JUQA 1MHQA 4Y6WA 4YNDA 3PRZA 4UI9K 4LEUA 3G2VA 3LCAA 2KCLA 3LVRE 2KC7A 3VTXA 3FU3A 3RO3A 2XGSA 4PH4B 2WXPA 3KEZA 4XZ4A 5BUZA 3TXMA 1EF1C 4HOUA 2X38A 3FHEA 2KM4A 3D9JA 2NSZA 3MV2B 3ML8A 5FZQA 4A55A 1IYGA 3EIJA 5FWQA 3NZSA 3P1UA 5BPPA 2BTDA 4J8EA 5EDSA 3ZHEA 3FH7A 5AENA 3FTVA 3ZN3A 4I1AA 4N3CA 2VSXE 3CVNA 2I9CA 3G2UA 3PEVB 3RJVA 4A1SA 4CDRA 4F3VA 3FUMA 2X3MA 2CHXA 5G05J 4AVXA 5BNWA 4TUUA 4B94A 2VTBB 4N3BA 4N39A 3Q4AB 4U0UA 1YA0A 4IN3B 5E76A 4EQFA 3FTXA 3EHNA 4YVOA 3D9PA 3FU5A 1OUVA 4JA9A 3CVQA 5G04J 5T8IA 1GW6A 3CHMA 1OWMA 4H7YA 3CKBA 2KCKA 2L0IA 2WXMA 2HR2A 3JQ1A 4U07A 4E6HA 2WQ7A 2YINA 3JYSA 4ILIA 4GA2A 2AW6A 3PUKA 4L2LA 1X5BA 5A23A 2WXGA 2VSOE 4UQYA 2WQHA 2Y3AA 3QWVA 4KZ0A 4KYOB 4N5CA 3VTYA 1UG3A 3PVLA 2BF0X 2LAHA 4BWRA 3SGHA 3T8MA 3BG1B 1HFAA 2AXVA 2X6JA 2OVBA 2J09A 4AEZC 4ANVA 2I2OA 1FVHA 5JJTA 3I3NA 4PDXA 4L2YA 3KAEA 3TJPA 2AXZA 3CK9A 1HU3A 2C0LA 2UWJG 3IBEA 1HZ4A 3DPDA 2J9QA 4FJZA 3HYMB 4NURA 5JJ7A 5G05C 4CT4A 3AS8A 4CEMA 3L17A 2RG8A 4LCTA 4G2VA 4QFVA 4AV7A 3IHVA 3FUFA 1H6KA 4PS7A 5ENNA 5EX0A 2L6JA 3S7BA 5CHEE 3MYVA 3S7DA 5C2YA 2J08A 5CMYA 5G04C 4BX8A 5C1DA 2PM6A 4XKCA 2R17C 2XPZA 3HVEA 5AYWD 4AIFA 1QZ2A 3ZRHA 1HO8A 1UW4B 2CFZA 3EJNA 5M72A 2MRIA 5KJMA 3MCXA 1FCHA 3ZHEB 3U9WA 1DNPA 2J07A 2A5UA 2EQXA 3E4BA 3UMVA 1JPLA 4XE0A 2KATA 4APOA 4GA0A 2JEKA 3B7TA 1NP7A 1W3BA 3AU5A 4GZCA 3IHYA 3UQ3A 5G55A 5J08A 4HOTA 1S0PA 2FBNA 2DBAA 1ZU2A 1LF8A 3EIQC 2VSNA 4GAAA 4G1TA 4UWGA 5LOZA 4HXIA 5E75A 3ZFWA 4ME2A 4Q94A 3ZXSA 1HG5A 1SZ9A 4J8SA 4MRUA 1TEZA 4I6GA 2XCCA 1E8XA 4FP7A 1U3DA 2VGXA 2I1JA 2LAIA 4NRHB 4CT0A 1N54A 5ARGA 1H19A 4MKTA 3Q49B 3PEUB 4AXHA 1OWPA 3S2AA 3I4GA 2WXIA 2J49A 3C98A 1Y8MA 2CG2A 3PH0C 4KBQA 4CDNA 3FH8A 3Q47B 5HQ8A 3FEXA 3RKVA 4J6IA 2GW1A 3GYZA 2LO6A 4FU3A 4JHKA 5AIJA 3L08A 3CEQA 4ILHB 4K03A 3AS5A 1ZBPA 3S7JA 3CR3A 2PQNA 2Y4TA 5AJDA 4KVMA 3ONLA 1TJCA 3APFA 4H7XA 5CCMA 3FWVA 3MV3B 5T3RA 3SFZA 3T5VA 4I2WA 2P58C 3K9IA 4I17A 4JC8A 2CHZA 3AS4A 3B7RL 3UUXA 5FQ6A 4URKA 4G25A 2FEZA 3LDZA 4GZ3A 4BFRA 3AU4A 5KJKA 3RU0A 4BY6A 3ZGQA 2X6IA 3D9LA 5FT9A 3U4TA 3HVEB 4CGWA 2WMOA 5BV0A 3ENEA 4BT8A 4OVVA 3ZW3A 4I1MA 4FA6A 4EZJA 5BV1A 5CMWA 3QARA 4J0UA 4LUNU 2J4BA 2YQ8A 2NC9A 4UI9J 4NQ0A 3URZA 4PS8A 4GZDA 3R7QA 4JZYA 5KJNA 1SZAA 1JWFA 5KCMA 1P5QA 4JEUA 3TXNA 4ABNA 1XNFA 1FVFA 2XRZA 2XHEA 4BTBA 4TRQA 3PNTB 1A17A 1JWGA 2WXNA 3HIZA 3RIBA 2WXHA 4KT6B 3PZDA 4C0MA 4CRWA 2FULA 1NA3A 1VDYA 3EHMA 4HLEA 4AY6A 2J4DA 4ACLA 3PNLB 4FJYA 5FQ7A 3GZ2A 3MA5A 3QAQA 2V8SE 4J8DA 2WPVA 1SQMA 3PDNA 4UWHA 1OWNA 4WNEA 3L22A 4WWPA 2VGXB 4U0SA 4GYYA 1XGWA 3SBSA 5LX8A 4APFA 3QDNA 2L9BA 2PQRA 3ASHA 3HDXA 5D0QD 3TAXA 1TJFA 2XQ0A 2GRLA 3CSTA 3FUJA 1H2UA 1UN9A 1WM5A 4D10C 1UN8A 3MGBA 4MLPA 4F1SA 3D9OA 1QNFA 2XRYA 4WNDA 5FZRA 3QB2A 4A1GA 4DI3A 4PUCA 1HG2A 2AXUA 3SBTB 4A3VA 2R5SA 4EBAG 2Q7FA 3FU6A 1H2TC 4I2ZA 3QKYA 3LS8A 3IV0A 2GGFA 4UI9C 5JJ6A 1Z6TA 5A6CA 1B89A 3Q15A 4CGVA 2L0TB 4GU5A 2WXKA 4U8HA 1E8YA 4N3AA 4GA1A 5CCLA 3D9MA 4BTAA 3LPZA 1Y6IA 4JHJA 4OYSA 4W9RA 4XIFA 3EDTB 2ONDA 2QFCA 2X6KA 3FP3A 4J8FA 4YVQC 2VGYA 3CIAA 3CHRA 2IFUA 5T4YA 1HF8A 3QC1A 4N2SA 2NXPA 2RD0A 4IYPA 4AM9A 4WAFA 3IEGA 4UWKA 3G2WA 4I1OB 1OWLA 3CHOA 4AJWA 1Z3XA 2OOEA 4ATGA 4PS3A 4UWFA 3CVWA 1Z3YA 1EDUA 3D9KA 3APCA 4LRZA 2VYIA 4IRUA 3ZYQA 4P29A 2KCVA 3ASDA 4GMJA 2HM8A 3L16A 1E8ZA 4WWOA 1QQEA 2Y4UA 3HHMA 1H0AA 2I6HA 2WB2A 4UQZA 4KZCA 3CKCA 4FHKA 3UPVA 3ZYMA 2V0PA 2E2EA 5ARFA 4GB9A 2I1KA 2WXQA 3ZPJA 3SNXA 4JEHA 1BPOA 3FUKA 2MOWA 1HS6A 2WXLA 3MKQA 3LY8A 2AVPA 4HS2A 4FLHA 1NZNA 4FULA 4KXKB 4Q96A 4RVBA 1ELRA 3ZEFA 3U64A 3LEWA 1IHGA 4DPRA 4NACA 4DLOA 1EYHA 3FTUA 4L23A 1MQSA 3CK7A 3CQGB 3RO2A 5LP0A 2WQ6A 4CDMA 1ELWA 3CVLA 3QWPA 3LY7A 2VJ8A 4Y6CA 4I43A 3GW4A 2WVIA 3FTSA 4JL0A 2CG3A 2X6HA 4MS6A 1E96B 3UT7A 3ZYLA 3ZIMA 4LERA 2WXRA 3MZLB 2ILRA 4GZ6A 4JA7A 5ANRA 4WNFA 3PE3A 3S7FA 1OWOA 3CV0A 1WAO1 3RRUA 3CSFA 3RRNB 3VLDA 2XPYA 3D9IA 2UY1A 2HO1A 3G2SA 2DIWA 2PZIA 1E7UA 4FLBA 5JHBA 3CVYA 2WXFA 3B13A 3N71A 3QJZA 4G23A 3VLEA 1IQUA 4KVOA 3PREA 3ML9A 5LFAA 4FC8A 2OVFA 3GZSA 3WXXA 3FDHA 5BT1A 3NZUA 3CQCB 3LVQE 2M63A 3QOUA 5KJLA 3FTYA 1ELKA 4HFGA 3O4ZA 4UWLA 1NA0A 4B8CB 1IQRA 3FULA 1INZA 3MEKA 5DIZA 3TGOA 3FU0A 3FEYA 2CHWA 2IQCA 2MHKA 4I9CA 4DJAA 4ANXA 2XEVA 3JQ0A 4XX5A 3TG5A 3FTWA 1UJKA 2XGMA 3IKOB 2FO7A 2V4LA 3PE4A 3L54A 4HOQA 2QY7A 3LXUX 4JPSA 4OVUA 2R59A 3ESLA 2LSUA 3D3MA 3FUEA 4BSXA 4UQXA 4ILGA 3CK8A 4L7TA 1HXIA 2WXJA 2VSYA 3PUJA 1L5JA 3CHPA 3BEEA 4L1BA 2KZTA 3ESKA 3NQPA 2LSVA 3JUIA 3QK0A 2YHEA 3MKQB 3U66A 4N2QA 4ANWA 3I5PA 3TL5A 3FUHA 2IONA 4I6JA 2BUGA 2HYZA 2IF4A 2V5FA 5D0OD 2DCPA 5FQ8A 4BT9A 3D9NA 4AP2A 3UX4A 1PC2A 3G2TA 4WNGA 4GCNA 4GMLA 3FFLA 2IJGX 4ACKA 5A7DB 3MX3A 4DLQA 3L6AA 5EKQD 4JXTA 3DBSA 4JVSA 2IOLA 3CVUA 5LCWJ 2E0IA 2FF4A 5FTPA 2A4ZA 4DI4A 5HI7A 2PL2A 2VQ2A 4Q69A 5EX3A 4BX9A 5FZSA 3FUNA 3CLJA 3UT8A 4FHJA 1KLXA 4FADA 4WUYA 4EZKA 4XI0A 2UY1B 4F7AA 1E90A 2XCBA 4I9EA 2GRMA 3FH5A 3U3WA 3CGHA 3ASFA 4EBAA 4I6EA 4WWNA 4EPZA 4RSYA 1HX8A 3CHSA 3SZ7A 4GZ5A 3NF1A 4M3OA 5BW8C 4B0ZA 3KS2A 1HH8A 4G24A 4TV3A 3R9AB 5J90A 3UT4A 4O6FA 2IOSA 3CVPA 4V3IA 4IULA 2OV8A 2YNQA 3OAWA 3PS6A 1KT0A 4RG6A 4A3TA 3B7UX 3CVXA 2LNIA 2CFUA 3SF4A 3QNKA 3ZYKA 3TG4A 3RK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U04 A;  3ASG A;  4GPK A;  4JHR A;  2FI7 A;  5LCW C;  3ULQ A;  3KD7 A;  2JLB A;  4HOR A;  2C2L A;  4AY5 A;  2XGO A;  3MKR A;  5FJY A;  3OXL A;  4U0Z A;  1KT1 A;  4HOS A;  3QWW A;  2XPI A;  3LY9 A;  4GYO A;  3OXF A;  2C0M A;  4GCO A;  3GZ1 A;  3OXG A;  3LKU A;  5DBK A;  4RG9 A;  4XI9 A;  3Q5M A;  4G26 A;  3LYA A;  3O48 A;  2YHC A;  4GYW A;  4Y6W A;  4YND A;  4UI9 K;  4LEU A;  3LCA A;  2KCL A;  2KC7 A;  3VTX A;  3RO3 A;  2XGS A;  4HOU A;  1IYG A;  3MV2 B;  5FZQ A;  4J8E A;  3ZHE A;  3ZN3 A;  4I1A A;  4N3C A;  3CVN A;  4A1S A;  3RJV A;  4CDR A;  4F3V A;  5BNW A;  5G05 J;  4B94 A;  4N3B A;  4N39 A;  3Q4A B;  4U0U A;  1YA0 A;  4IN3 B;  4EQF A;  4YVO A;  1OUV A;  4JA9 A;  3CVQ A;  5G04 J;  4H7Y A;  3CKB A;  2KCK A;  2HR2 A;  4U07 A;  3JYS A;  4GA2 A;  4UQY A;  2WQH A;  3QWV A;  4N5C A;  4KYO B;  3VTY A;  4BWR A;  5JJT A;  3KAE A;  3CK9 A;  2UWJ G;  2C0L A;  1HZ4 A;  2J9Q A;  5JJ7 A;  3HYM B;  5G05 C;  3AS8 A;  4G2V A;  5EX0 A;  2L6J A;  3S7B A;  5CHE E;  3S7D A;  5C1D A;  5G04 C;  5AYW D;  4AIF A;  1QZ2 A;  5M72 A;  5KJM A;  1FCH A;  3ZHE B;  3E4B A;  2KAT A;  4APO A;  4GA0 A;  1W3B A;  3UQ3 A;  4HOT A;  2FBN A;  2DBA A;  1ZU2 A;  2VSN A;  4G1T A;  3ZFW A;  4ME2 A;  2XCC A;  2VGX A;  4NRH B;  5ARG A;  3Q49 B;  1Y8M A;  4KBQ A;  3Q47 B;  5HQ8 A;  3RKV A;  2GW1 A;  3GYZ A;  3CEQ A;  3S7J A;  1ZBP A;  3AS5 A;  2PQN A;  2Y4T A;  1TJC A;  4H7X A;  5CCM A;  3FWV A;  3MV3 B;  4I2W A;  2P58 C;  3K9I A;  4I17 A;  3AS4 A;  3UUX A;  4G25 A;  2FEZ A;  4GZ3 A;  5KJK A;  3RU0 A;  3ZGQ A;  5FT9 A;  3U4T A;  4CGW A;  4BT8 A;  4J0U A;  2YQ8 A;  4UI9 J;  2NC9 A;  4NQ0 A;  3URZ A;  5KJN A;  1P5Q A;  4ABN A;  1XNF A;  4BTB A;  1A17 A;  3RIB A;  1NA3 A;  4AY6 A;  3GZ2 A;  3MA5 A;  4J8D A;  2WPV A;  3PDN A;  4WNE A;  2VGX B;  4U0S A;  4GYY A;  3QDN A;  2PQR A;  3ASH A;  5D0Q D;  3TAX A;  1WM5 A;  5FZR A;  4WND A;  2R5S A;  2Q7F A;  4I2Z A;  3QKY A;  4UI9 C;  5JJ6 A;  5A6C A;  1B89 A;  3Q15 A;  4CGV A;  4N3A A;  4GA1 A;  5CCL A;  4BTA A;  3LPZ A;  4W9R A;  4XIF A;  3EDT B;  2OND A;  2QFC A;  3FP3 A;  4J8F A;  4YVQ C;  2VGY A;  2IFU A;  4N2S A;  4AM9 A;  3IEG A;  2OOE A;  2VYI A;  2KCV A;  3ASD A;  1QQE A;  2Y4U A;  2I6H A;  4UQZ A;  3CKC A;  3UPV A;  2E2E A;  5ARF A;  3ZPJ A;  3LY8 A;  2AVP A;  4KXK B;  1NZN A;  1ELR A;  1IHG A;  3CK7 A;  3RO2 A;  1ELW A;  3CVL A;  3QWP A;  3LY7 A;  4Y6C A;  3GW4 A;  4JL0 A;  1E96 B;  4JA7 A;  4GZ6 A;  3S7F A;  4WNF A;  3PE3 A;  3CV0 A;  1WAO 1;  2UY1 A;  2HO1 A;  2PZI A;  3N71 A;  4G23 A;  3WXX A;  5BT1 A;  3QOU A;  5KJL A;  1NA0 A;  3MEK A;  5DIZ A;  3TGO A;  2MHK A;  4I9C A;  2XEV A;  3TG5 A;  2XGM A;  4HOQ A;  2FO7 A;  3PE4 A;  2LSU A;  4UQX A;  3CK8 A;  1HXI A;  2VSY A;  3BEE A;  3ESK A;  2LSV A;  4N2Q A;  2BUG A;  2HYZ A;  2IF4 A;  2V5F A;  5D0O D;  4BT9 A;  1PC2 A;  4WNG A;  4GCN A;  3FFL A;  5A7D B;  5EKQ D;  5LCW J;  2FF4 A;  5FTP A;  5HI7 A;  2PL2 A;  2VQ2 A;  5EX3 A;  5FZS A;  1KLX A;  4WUY A;  4XI0 A;  2UY1 B;  4I9E A;  2XCB A;  3U3W A;  3ASF A;  3SZ7 A;  4GZ5 A;  3NF1 A;  5BW8 C;  3KS2 A;  1HH8 A;  4G24 A;  3R9A B;  4O6F A;  3CVP A;  1KT0 A;  4RG6 A;  2LNI A;  3SF4 A;  3TG4 A; 
#chains in the Genus database with same CATH topology
 1K1B A;  4C0E A;  1DVP A;  2VTB A;  4DRX E;  4GPK A;  2QC9 A;  2FI7 A;  2ZXW E;  3FUI A;  3KD7 A;  4J8Y A;  1WY6 A;  4XKB A;  2AWI A;  4JW1 A;  1E7V A;  3ONK A;  5J90 A;  2HE0 A;  5EID A;  1TNB A;  1N4P A;  3SHF A;  4HRL A;  1U3C A;  3EU9 A;  3CVV A;  4HOS A;  1IHB A;  3QWW A;  2LXM A;  2XS1 A;  5AJL A;  3AJI A;  4DX6 D;  2WMN A;  1OT8 A;  3LYA A;  1DC2 A;  2YHC A;  4GYW A;  1KZP A;  1MHQ A;  3PRZ A;  4LEU A;  3G2V A;  3UM0 A;  3FU3 A;  2WXP A;  3PZ2 A;  4HOU A;  2X38 A;  1O1T A;  3C5R A;  2NSZ A;  1YMP A;  5BPP A;  2BTD A;  4J8E A;  5AEN A;  2ETA A;  3ZN3 A;  1SA4 A;  3G2U A;  3W9F A;  3RJV A;  4A1S A;  4CDR A;  1IKN D;  4F3V A;  1Z5S C;  4TUU A;  2DZO A;  5E76 A;  3D9P A;  5JMN D;  3UTM A;  1OWM A;  3TWS A;  2WQH A;  4KZ0 A;  4KYO B;  4DX2 A;  2GRP B;  3BG1 B;  2X6J A;  2J09 A;  4ANV A;  2BKG A;  5JJT A;  3EHQ A;  3TJP A;  3CK9 A;  2P9K G;  1HZ4 A;  4FJZ A;  4RQI A;  3L17 A;  2RG8 A;  4QFV A;  3IHV A;  2R05 A;  5C2Y A;  2J08 A;  5CMY A;  4BX8 A;  5IY5 E;  5CER B;  4XKC A;  2R17 C;  3ABK E;  4AIF A;  1HO8 A;  2CFZ A;  3EJN A;  2MRI A;  2EIM E;  3U9W A;  2J07 A;  3UM2 A;  3E4B A;  2KAT A;  4YDY A;  1NP7 A;  1W3B A;  3Q75 A;  3UIN C;  4GZC A;  5G55 A;  2FBN A;  2DBA A;  1MYO A;  4G1T A;  4UWG A;  1RZ4 A;  5KNG A;  1HG5 A;  4J8S A;  4MRU A;  4YDO A;  1U3D A;  4NRH B;  1N54 A;  1WDY A;  4MKT A;  1O1R A;  3ZUV B;  3S2A A;  3I4G A;  2Y0B G;  1MJ0 A;  1Y8M A;  3FEX A;  2GW1 A;  3CEQ A;  2PQN A;  2Y4T A;  3APF A;  5CCM A;  3FWV A;  1N0Q A;  2P58 C;  2EIN E;  3E33 A;  1TNU A;  2FEZ A;  4GZ3 A;  3AU4 A;  2F8X K;  2RFM A;  2X6I A;  2V5Q C;  1LD7 A;  3HVE B;  3ENE A;  4OVV A;  1BD8 A;  4I1M A;  5AAO A;  3URZ A;  4GZD A;  3R7Q A;  5KCM A;  3TXN A;  4ABN A;  3HIZ A;  4A63 B;  4KT6 B;  1N11 A;  4HLE A;  3DEO A;  3DRA A;  3EHM A;  5KNH D;  2J4D A;  4ACL A;  4FJY A;  3ULE G;  3MA5 A;  4UWH A;  1OWN A;  3L22 A;  5KBA A;  4GYY A;  2B6C A;  4GTT A;  1UN8 A;  2B0O E;  4MLP A;  1QNF A;  3QB2 A;  4A1G A;  4DI3 A;  2AXU A;  2IY0 C;  3ABL E;  5FIO A;  4HRN A;  1TNZ A;  3QKY A;  2GGF A;  2AJA A;  3Q15 A;  1E8Y A;  3DST A;  4OYS A;  1Y6I A;  3Q78 A;  4JHJ A;  4W9R A;  3EDT B;  2QFC A;  2P9N G;  2VGY A;  4MBG A;  2GRR B;  4AM9 A;  2RD0 A;  4IYP A;  4WAF A;  3IEG A;  4BET A;  1OWL A;  4AJW A;  2PNN A;  4ATG A;  4PS3 A;  3CVW A;  4LRZ A;  4GMJ A;  1NL4 A;  3L16 A;  4CZ2 D;  3HHM A;  2WB2 A;  4KZC A;  2XEE A;  2I1K A;  3ZPJ A;  3LY8 A;  4FLH A;  1NZN A;  4KXK B;  4GTP A;  4RVB A;  5BXU A;  1IHG A;  3FTU A;  1ELW A;  4M7C A;  4I43 A;  4JL0 A;  3ZYL A;  1E96 B;  2WXR A;  4WNF A;  1OWO A;  3CV0 A;  3RRU A;  3CSF A;  3RRN B;  2DIW A;  1E7U A;  4TXR A;  2WXF A;  3B13 A;  3VLE A;  3EUV A;  4KVO A;  3GZS A;  3WXX A;  3NZU A;  3CQC B;  4UWL A;  1NA0 A;  1N4R A;  1S63 A;  1IQR A;  1INZ A;  5DIZ A;  3DWL G;  3TGO A;  3FU0 A;  3JQ0 A;  2XGM A;  3IKO B;  4HOQ A;  1O5M A;  1MZC A;  2QY7 A;  3F6Q A;  5B3S E;  4OAU C;  3FUE A;  4DX1 A;  4K5A B;  3TWW A;  4BSX A;  2VSY A;  1L5J A;  3NOG D;  2BKK B;  5AQ7 A;  3I5P A;  3JXI A;  2BUG A;  3SFX A;  2V5F A;  5D0O D;  1AP7 A;  5EYL A;  3JUE A;  1PC2 A;  2OEV A;  5HS0 A;  4ACK A;  5A7D B;  3CVU A;  3UXG A;  5LCW J;  2OEW A;  2E0I A;  2FF4 A;  2A4Z A;  4DI4 A;  1BI8 B;  2PL2 A;  1MX6 A;  3FUN A;  3CLJ A;  3UT8 A;  4FAD A;  4XI0 A;  3DEP A;  2GRM A;  3CGH A;  4EBA A;  4WWN A;  2IO2 C;  1FPP A;  1N9A A;  2OV8 A;  2YNQ A;  3AAA C;  1KT0 A;  1DCQ A;  3B7U X;  3SF4 A;  4GPM A;  3HXE A;  1MX4 A;  3TG4 A;  4U04 A;  2ZIS A;  3C3O A;  4G8K A;  5AQA A;  4LNG A;  2WXO A;  3LJ3 A;  3P2B A;  2X6F A;  5EIL A;  5LCW C;  3RRM B;  3FTZ A;  3AG1 E;  4HOR A;  2C2L A;  3FY4 A;  4AOF A;  3Q73 A;  3FUD A;  4EEC A;  5CEC B;  3ASN E;  2ZU6 B;  2BED A;  3JCK C;  3OXG A;  4U8Y D;  2WM9 A;  2IEJ A;  2DYS E;  2EIJ E;  3V31 A;  1H6O A;  4B8A A;  4E85 A;  1N52 A;  3LCA A;  2KCL A;  3IXE A;  2XGS A;  3DXK G;  5AN8 A;  4XZ4 A;  5AQ9 A;  2GRQ B;  3FHE A;  2KM4 A;  3D9J A;  3ML8 A;  2EIL E;  4A55 A;  3NZS A;  5EDS A;  1KZO A;  1LTX A;  3V30 A;  4N3C A;  2CHX A;  5BNW A;  1YA0 A;  4GTO A;  1N4S A;  3EHN A;  4YVO A;  1QBQ A;  4JA9 A;  5G04 J;  1GW6 A;  3CHM A;  4H7Y A;  3CKB A;  2QYJ A;  2HR2 A;  4U07 A;  4E6H A;  2YIN A;  3PUK A;  4L2L A;  5ENP D;  1OCO E;  3SGH A;  1RW2 A;  4HBD A;  1FVH A;  4O1P A;  3DSX A;  3Q79 A;  1HU3 A;  3DPD A;  3HYM B;  4NUR A;  1K1A A;  4CEM A;  4LCT A;  5B1A E;  3BU8 A;  3FUF A;  1H6K A;  4PS7 A;  5EX0 A;  3S7B A;  5G04 C;  1SVX A;  3HVE A;  2OCC E;  4U96 D;  2A5E A;  3R9M A;  3DSV A;  3E37 A;  3TWU A;  1DNP A;  1JPL A;  4XE0 A;  4GA0 A;  3B7T A;  4UUC A;  3IHY A;  4HLL A;  5J08 A;  1LF8 A;  4HXI A;  4I6G A;  4FP7 A;  2LAI A;  4X8Q A;  1YYH A;  4CT0 A;  5B1B E;  3PEU B;  4AXH A;  1OWP A;  2J49 A;  4KBQ A;  4CDN A;  1FT1 A;  3GYZ A;  5EIB E;  4O1O A;  3CR3 A;  4BSZ B;  4O60 A;  4KVM A;  4H7X A;  4JD2 G;  3C3Q A;  3MV3 B;  3SFZ A;  4I2W A;  3K9I A;  2CHZ A;  3AS4 A;  4HQD A;  5BXO A;  3UUX A;  4G25 A;  1D8E A;  3ZGQ A;  5FT9 A;  1IXV A;  3U4T A;  3ZU7 B;  3AG3 E;  4U8V D;  3TWV A;  5BV1 A;  5CMW A;  3QAR A;  5ITZ F;  2J4B A;  4NQ0 A;  2XS8 A;  5KJN A;  4JZY A;  1SZA A;  3E30 A;  4B93 B;  2ETB A;  3TWT A;  1P5Q A;  1XNF A;  2XHE A;  3PNT B;  3Q7F A;  1VDY A;  4AY6 A;  3PNL B;  3X2Q E;  5FQ7 A;  4J8D A;  4HNA D;  4U0S A;  5LX8 A;  3QDN A;  2L9B A;  3TAX A;  1TJF A;  3SO8 A;  2GRL A;  2R2L A;  1WM5 A;  4F1S A;  5AIJ A;  3D9O A;  2XRY A;  1HG2 A;  2R5S A;  1H2T C;  3E34 A;  5A6C A;  4U8H A;  5ENQ D;  3PZ3 A;  3D9M A;  3T8K A;  3LPZ A;  4BTA A;  4YVQ C;  3Q9N C;  3B95 A;  3CHR A;  3QC1 A;  2NXP A;  4BER A;  4UWK A;  4UWF A;  1JCS A;  1EDU A;  2VYI A;  4IRU A;  3W9G A;  2KCV A;  1N95 A;  1E8Z A;  4WWO A;  4N5Q A;  3UPV A;  3ZYM A;  4JEH A;  2J8S D;  1TYQ G;  1BPO A;  2MOW A;  4FUL A;  1ELR A;  3ZEF A;  3DSW A;  3LEW A;  4NAC A;  4DLO A;  1MQS A;  3CK7 A;  3RO2 A;  2WQ6 A;  3CVL A;  2VJ8 A;  3V79 K;  3UKU G;  2X6H A;  3AG4 E;  5D2M C;  3UT7 A;  1X81 A;  4JA7 A;  5ANR A;  1WAO 1;  2XPY A;  3CVY A;  4GTR A;  3ISM C;  3QJZ A;  3ML9 A;  5LFA A;  3FDH A;  3LVQ E;  3QOU A;  5KJL A;  3FTY A;  1ELK A;  4HFG A;  4B8C B;  3FUL A;  3MEK A;  1BI7 B;  4ANX A;  2XEV A;  4XX5 A;  4LUN U;  1UJK A;  3D3M A;  1A5E A;  4ILG A;  3CK8 A;  4L7T A;  1HXI A;  3PUJ A;  4L1B A;  4L9P A;  2LSV A;  3JUI A;  3MKQ B;  4N2Q A;  4ANW A;  3TL5 A;  2ZGG A;  4I6J A;  2HYZ A;  5FQ8 A;  4BT9 A;  3D9N A;  4AP2 A;  1AWC B;  3UX4 A;  3G2T A;  4WNG A;  4GML A;  5ENO D;  3MX3 A;  3L6A A;  4JXT A;  5HI7 A;  4Q69 A;  3HXF A;  2XZD G;  4FHJ A;  2F37 A;  3C72 A;  1E90 A;  4I9E A;  3ASF A;  3CHS A;  3NF1 A;  5BW8 C;  1OY3 D;  3KS2 A;  2XEN A;  3CVP A;  2IO3 C;  3OAW A;  3CVX A;  2LNI A;  3RK6 A;  4R7L A;  3NAW A;  4U63 A;  4DUI A;  3J5Q B;  1N0R A;  5G2N A;  5ANL A;  1HE8 A;  2R03 A;  4ANU A;  4B89 A;  1O1S A;  2KZT B;  3BG0 B;  4K0R A;  3SY2 A;  1EPU A;  2XGO A;  3MKR A;  5FJY A;  3OXL A;  4CCA A;  4U0Z A;  4C9B B;  1PY1 A;  1KT1 A;  4ZHB A;  3R7R A;  4GYO A;  3OXF A;  4GCO A;  1TNY A;  3GZ1 A;  1YCS B;  3L13 A;  5JHA A;  3L9T A;  3SI5 A;  4HRM B;  3APD A;  3I4R B;  1JUQ A;  4Y6W A;  4UI9 K;  3UI2 A;  2NYJ A;  3LVR E;  2KC7 A;  3VTX A;  3RO3 A;  4OAV B;  3KEZ A;  2LUH A;  5EYP F;  3UM1 A;  1IYG A;  5FWQ A;  3P1U A;  5CED B;  4ZFH A;  1K8K G;  4I1A A;  3CVN A;  3Q7A A;  3UM3 A;  3JXJ A;  3FUM A;  5JA4 D;  5G05 J;  4AVX A;  4QQI A;  4N3B A;  4U0U A;  4IN3 B;  3PZ4 A;  2QYU A;  3DXM G;  1MX2 A;  3FU5 A;  1OUV A;  3CVQ A;  5T8I A;  2WXM A;  3JQ1 A;  2WQ7 A;  4DX7 D;  3JYS A;  2ETC A;  4ILI A;  4GA2 A;  1NFI E;  5A23 A;  2WXG A;  2Y3A A;  3QWV A;  3PVL A;  2LAH A;  3SQV A;  3T8M A;  2EIK E;  3RAU A;  2OVB A;  4AEZ C;  3I3N A;  4PDX A;  5CRU A;  2AXZ A;  2UWJ G;  2C0L A;  5JJ7 A;  5G05 C;  3DPY A;  3AS8 A;  4G2V A;  4U7E B;  2L6J A;  3MYV A;  5HKP A;  3S7D A;  1N94 A;  5AYW D;  1UW4 B;  3MCX A;  3ZHE B;  4YDW A;  5AAR A;  2A5U A;  3NBN B;  3AU5 A;  3UQ3 A;  4HOT A;  1S0P A;  1ZU2 A;  3EIQ C;  3AG2 E;  1K3Z D;  5LOZ A;  3ZFW A;  2I1J A;  1NI1 A;  2L6B A;  1S64 A;  5ARG A;  3J5P A;  2KBX A;  3Q49 B;  5EN5 D;  2WXI A;  3C98 A;  1SA5 A;  2CG2 A;  3Q47 B;  4HI8 A;  3KEA A;  3RKV A;  3KSQ A;  2F0Y A;  4FU3 A;  3NOC D;  4JHK A;  3L08 A;  3AS5 A;  1TJC A;  5HRY A;  3B7R L;  4NIK A;  3LDZ A;  4BFR A;  5KJK A;  4BES A;  5H7P A;  3RU0 A;  4BY6 A;  2Y1L E;  4CGW A;  2WMO A;  3ZW3 A;  4FA6 A;  2KXP C;  4J0U A;  2YQ8 A;  2NC9 A;  2LXL A;  4PS8 A;  3EHR A;  2RKK A;  4JEU A;  2XRZ A;  4BTB A;  4TRQ A;  1A17 A;  2WXN A;  3RIB A;  2WXH A;  2DVW A;  3PZD A;  4CRW A;  2FUL A;  4LG6 A;  2V8S E;  2WPV A;  2VGX B;  1XGW A;  2XQ0 A;  3CST A;  5CBO A;  1H2U A;  1UN9 A;  4D10 C;  4LNB A;  3D9H A;  4PUC A;  3SBT B;  2Q7F A;  3LS8 A;  3IV0 A;  1B89 A;  2L0T B;  4GU5 A;  4YDE A;  5CCL A;  4XIF A;  3FP3 A;  2OND A;  4J8F A;  4HB5 A;  2H6F A;  3CIA A;  2IFU A;  1HF8 A;  2MYO A;  3G2W A;  3CHO A;  1Z3Y A;  3APC A;  3ZYQ A;  1S70 B;  2HM8 A;  1QQE A;  2Y4U A;  1H0A A;  2I6H A;  3CKC A;  4FHK A;  4GB9 A;  3SNX A;  3MKQ A;  4GTV A;  3HXD A;  3U64 A;  4DPR A;  1EYH A;  4L23 A;  5LP0 A;  4CDM A;  3QWP A;  3LY7 A;  4Y6C A;  2WVI A;  1Q2Z A;  3ZIM A;  4LER A;  2ILR A;  3S7F A;  3C3R A;  1JCQ A;  5ENT D;  3D9I A;  2HO1 A;  3G2S A;  4FLB A;  2PZI A;  4G23 A;  1IQU A;  3PRE A;  3ULY A;  2P9S G;  5ENR D;  4F6R D;  2OVF A;  1D8D A;  4XEI G;  2H6H A;  2P9P G;  2CHW A;  2IQC A;  4I9C A;  4DJA A;  2FO7 A;  3B7B A;  3LXU X;  4UQX A;  3LJN A;  3BUA A;  3NB2 A;  2KZT A;  3WG7 E;  1UOH A;  3U66 A;  3FUH A;  2ION A;  2V4H C;  2DZN A;  3FFL A;  3TWR A;  2IJG X;  5EKQ D;  3DBS A;  4JVS A;  2IOL A;  5FTP A;  4GTM A;  2VQ2 A;  1OXJ A;  5EX3 A;  4BX9 A;  5FZS A;  2XZT G;  3V2X A;  1KLX A;  3KSL A;  4WUY A;  3HG0 D;  4EZK A;  1D9S A;  2UY1 B;  2XCB A;  3U3W A;  4EPZ A;  4I6E A;  4LSZ E;  3V2O A;  4GZ5 A;  2H6G A;  4B0Z A;  4TV3 A;  1HH8 A;  3T9K A;  1WG0 A;  2IOS A;  4F1P A;  4V3I A;  4IUL A;  4JB8 P;  5D66 A;  3PS6 A;  4RG6 A;  1TN8 A;  2CFU A;  3QNK A;  1TN7 A;  4GTS A;  2IU1 A;  3TWQ A;  3ASG A;  1OCZ E;  4G11 A;  4KMO A;  4JHR A;  4HVB A;  3B7S A;  3EU5 A;  3ULQ A;  2PM7 A;  3ZVV A;  2JLB A;  1E8W A;  3DSU A;  3OTN A;  3CHQ A;  2XEH A;  4AY5 A;  1UJJ A;  2QZA A;  1U2V G;  1TR4 A;  2P9L G;  5FQ4 A;  1G3N B;  3ZNG A;  3VLF A;  1H2V C;  2XPI A;  3LY9 A;  4EZL A;  2C0M A;  1OCR E;  3MJW A;  3T5X A;  4J7W A;  3LKU A;  5DBK A;  4DK5 A;  4RG9 A;  3SD5 A;  4F53 A;  4XI9 A;  3Q5M A;  4G26 A;  2ZIR A;  3O48 A;  1PAQ A;  4YND A;  3UKR G;  4K5B A;  4PH4 B;  2JAB A;  3TXM A;  5BUZ A;  1EF1 C;  3MV2 B;  5FZQ A;  3EIJ A;  3ZHE A;  1BLX B;  3FH7 A;  3FTV A;  2FO1 E;  2VSX E;  3PEV B;  2I9C A;  1FT2 A;  3BQO A;  3SFY A;  2X3M A;  4B94 A;  2VTB B;  4N39 A;  3Q4A B;  3ZXP A;  4EQF A;  3FTX A;  2ZGD A;  2KCK A;  2L0I A;  2H6I A;  2AW6 A;  1X5B A;  1JCR A;  2VSO E;  4UQY A;  4Z68 A;  4N5C A;  3VTY A;  5CBN A;  1UG3 A;  2BF0 X;  4BWR A;  1HFA A;  2AXV A;  2I2O A;  5FIN A;  4L2Y A;  3KAE A;  3IBE A;  2J9Q A;  4CT4 A;  4AV7 A;  5ENN A;  2P9I G;  2P2C P;  5CHE E;  5C1D A;  2PM6 A;  2XPZ A;  3Q9U C;  3ZKJ A;  1QZ2 A;  1TN6 A;  5M72 A;  5KJM A;  1FCH A;  2EQX A;  3L82 A;  3UMV A;  2R02 A;  3UIO C;  4APO A;  2JEK A;  1V54 E;  2VSN A;  4GAA A;  5E75 A;  4ME2 A;  4Q94 A;  3ZXS A;  1SZ9 A;  1TEZ A;  2XCC A;  1E8X A;  2VGX A;  1H19 A;  3PH0 C;  3FH8 A;  5HQ8 A;  4ATZ D;  4J6I A;  2LO6 A;  1N4Q A;  4ILH B;  4K03 A;  1ZBP A;  3S7J A;  5AJD A;  4C48 B;  3ABM E;  1ZB1 A;  3ONL A;  3T5V A;  5T3R A;  4TUM A;  4I17 A;  4JC8 A;  2GRO B;  5FQ6 A;  5CRV A;  4URK A;  4G8L A;  3D9L A;  2Y69 E;  5BV0 A;  2DWZ A;  4BT8 A;  4BEP A;  4EZJ A;  4UI9 J;  3ASO E;  1JWF A;  1H6P A;  4RLY A;  1FVF A;  1JWG A;  4C0M A;  1NA3 A;  3GZ2 A;  3QAQ A;  3PDN A;  1SQM A;  1QYM A;  5AQB A;  4WNE A;  4WWP A;  5CEA A;  3SBS A;  4LNU D;  4APF A;  3HDX A;  2PQR A;  3ASH A;  5D0Q D;  3FUJ A;  3MGB A;  5FZR A;  4WND A;  4A3V A;  4EBA G;  3FU6 A;  4I2Z A;  1LD8 A;  4UI9 C;  5JJ6 A;  1Z6T A;  2VGE A;  4CGV A;  2WXK A;  4N3A A;  4GA1 A;  2X6K A;  3DSS A;  5T4Y A;  4N2S A;  4I1O B;  2P9U G;  1Z3X A;  2OOE A;  1V55 E;  3D9K A;  4TXQ A;  4P29 A;  3ASD A;  1BU9 A;  3TWX A;  4UQZ A;  3HXB A;  2V0P A;  2E2E A;  5ARF A;  5KWD A;  2WXQ A;  3FUK A;  2WXL A;  1HS6 A;  1SW6 A;  2RFA A;  4HI9 A;  2AVP A;  4HS2 A;  3RSE G;  4Q96 A;  4DX5 D;  1OCC E;  3CQG B;  4GTQ A;  3PZ1 A;  3GW4 A;  1TNO A;  3FTS A;  2CG3 A;  4MS6 A;  2DYR E;  2F8Y A;  3MZL B;  4GZ6 A;  3PE3 A;  3VLD A;  2UY1 A;  5JHB A;  3N71 A;  1KPS B;  4FC8 A;  5BT1 A;  2M63 A;  3E32 A;  3O4Z A;  3HRA A;  4TXP A;  3FEY A;  2MHK A;  3TG5 A;  4CYM D;  3FTW A;  3ZRH A;  4JPS A;  3PE4 A;  2V4L A;  3L54 A;  4OVU A;  2R59 A;  3ESL A;  2LSU A;  5ENS D;  2WXJ A;  3CHP A;  3BEE A;  4U95 D;  3ESK A;  3NQP A;  4K5C A;  3QK0 A;  2YHE A;  2IF4 A;  4GMR A;  2DCP A;  4EHM A;  4GCN A;  4DLQ A;  3HXC A;  4F7A A;  3FH5 A;  2GRN B;  1DCE A;  4RSY A;  1HX8 A;  3SZ7 A;  4M3O A;  4G24 A;  3UIP C;  3R9A B;  3UT4 A;  4O6F A;  4A3T A;  3ZYK A; 
#chains in the Genus database with same CATH homology
 4R7L A;  4U04 A;  4U63 A;  4C0E A;  1DVP A;  2IU1 A;  2VTB A;  3ASG A;  4G11 A;  4GPK A;  4KMO A;  2WXO A;  2FI7 A;  3LJ3 A;  4JHR A;  1HE8 A;  2X6F A;  3P2B A;  5ANL A;  3FUI A;  5G2N A;  4HVB A;  3RRM B;  5LCW C;  3B7S A;  3FTZ A;  3ULQ A;  2PM7 A;  3KD7 A;  3ZVV A;  2JLB A;  4HOR A;  1E8W A;  1WY6 A;  2C2L A;  3FY4 A;  4XKB A;  4AOF A;  2AWI A;  3OTN A;  3CHQ A;  4ANU A;  4B89 A;  4JW1 A;  1E7V A;  2KZT B;  3FUD A;  3ONK A;  3BG0 B;  4K0R A;  4AY5 A;  1EPU A;  2XGO A;  1UJJ A;  3MKR A;  5FJY A;  3OXL A;  3SHF A;  4CCA A;  4U0Z A;  4C9B B;  1PY1 A;  1KT1 A;  1U3C A;  4EEC A;  3CVV A;  5FQ4 A;  4HOS A;  3QWW A;  3VLF A;  1H2V C;  2XPI A;  3LY9 A;  5AJL A;  4GYO A;  3R7R A;  2ZU6 B;  3OXF A;  4EZL A;  2C0M A;  4GCO A;  3GZ1 A;  3MJW A;  3L13 A;  3T5X A;  5JHA A;  3JCK C;  3OXG A;  3LKU A;  5DBK A;  4DK5 A;  2WM9 A;  4RG9 A;  3SD5 A;  4F53 A;  4XI9 A;  3Q5M A;  2WMN A;  3SI5 A;  4G26 A;  3LYA A;  3O48 A;  4B8A A;  2YHC A;  1PAQ A;  3APD A;  4GYW A;  3I4R B;  1N52 A;  4E85 A;  1JUQ A;  1MHQ A;  4Y6W A;  4YND A;  3PRZ A;  4UI9 K;  4LEU A;  3G2V A;  3LCA A;  2KCL A;  3LVR E;  2KC7 A;  3VTX A;  3FU3 A;  3RO3 A;  2XGS A;  4PH4 B;  2WXP A;  3KEZ A;  4XZ4 A;  5BUZ A;  3TXM A;  1EF1 C;  4HOU A;  2X38 A;  3FHE A;  2KM4 A;  3D9J A;  2NSZ A;  3MV2 B;  3ML8 A;  5FZQ A;  4A55 A;  1IYG A;  3EIJ A;  5FWQ A;  3NZS A;  3P1U A;  5BPP A;  2BTD A;  4J8E A;  5EDS A;  3ZHE A;  3FH7 A;  5AEN A;  3FTV A;  3ZN3 A;  4I1A A;  4N3C A;  2VSX E;  3CVN A;  2I9C A;  3G2U A;  3PEV B;  3RJV A;  4A1S A;  4CDR A;  4F3V A;  3FUM A;  2X3M A;  2CHX A;  5G05 J;  4AVX A;  5BNW A;  4TUU A;  4B94 A;  2VTB B;  4N3B A;  4N39 A;  3Q4A B;  4U0U A;  1YA0 A;  4IN3 B;  5E76 A;  4EQF A;  3FTX A;  3EHN A;  4YVO A;  3D9P A;  3FU5 A;  1OUV A;  4JA9 A;  3CVQ A;  5G04 J;  5T8I A;  1GW6 A;  3CHM A;  1OWM A;  4H7Y A;  3CKB A;  2KCK A;  2L0I A;  2WXM A;  2HR2 A;  3JQ1 A;  4U07 A;  4E6H A;  2WQ7 A;  2YIN A;  3JYS A;  4ILI A;  4GA2 A;  2AW6 A;  3PUK A;  4L2L A;  1X5B A;  5A23 A;  2WXG A;  2VSO E;  4UQY A;  2WQH A;  2Y3A A;  3QWV A;  4KZ0 A;  4KYO B;  4N5C A;  3VTY A;  1UG3 A;  3PVL A;  2BF0 X;  2LAH A;  4BWR A;  3SGH A;  3T8M A;  3BG1 B;  1HFA A;  2AXV A;  2X6J A;  2OVB A;  2J09 A;  4AEZ C;  4ANV A;  2I2O A;  1FVH A;  5JJT A;  3I3N A;  4PDX A;  4L2Y A;  3KAE A;  3TJP A;  2AXZ A;  3CK9 A;  1HU3 A;  2C0L A;  2UWJ G;  3IBE A;  1HZ4 A;  3DPD A;  2J9Q A;  4FJZ A;  3HYM B;  4NUR A;  5JJ7 A;  5G05 C;  4CT4 A;  3AS8 A;  4CEM A;  3L17 A;  2RG8 A;  4LCT A;  4G2V A;  4QFV A;  4AV7 A;  3IHV A;  3FUF A;  1H6K A;  4PS7 A;  5ENN A;  5EX0 A;  2L6J A;  3S7B A;  5CHE E;  3MYV A;  3S7D A;  5C2Y A;  2J08 A;  5CMY A;  5G04 C;  4BX8 A;  5C1D A;  2PM6 A;  4XKC A;  2R17 C;  2XPZ A;  3HVE A;  5AYW D;  4AIF A;  1QZ2 A;  3ZRH A;  1HO8 A;  1UW4 B;  2CFZ A;  3EJN A;  5M72 A;  2MRI A;  5KJM A;  3MCX A;  1FCH A;  3ZHE B;  3U9W A;  1DNP A;  2J07 A;  2A5U A;  2EQX A;  3E4B A;  3UMV A;  1JPL A;  4XE0 A;  2KAT A;  4APO A;  4GA0 A;  2JEK A;  3B7T A;  1NP7 A;  1W3B A;  3AU5 A;  4GZC A;  3IHY A;  3UQ3 A;  5G55 A;  5J08 A;  4HOT A;  1S0P A;  2FBN A;  2DBA A;  1ZU2 A;  1LF8 A;  3EIQ C;  2VSN A;  4GAA A;  4G1T A;  4UWG A;  5LOZ A;  4HXI A;  5E75 A;  3ZFW A;  4ME2 A;  4Q94 A;  3ZXS A;  1HG5 A;  1SZ9 A;  4J8S A;  4MRU A;  1TEZ A;  4I6G A;  2XCC A;  1E8X A;  4FP7 A;  1U3D A;  2VGX A;  2I1J A;  2LAI A;  4NRH B;  4CT0 A;  1N54 A;  5ARG A;  1H19 A;  4MKT A;  3Q49 B;  3PEU B;  4AXH A;  1OWP A;  3S2A A;  3I4G A;  2WXI A;  2J49 A;  3C98 A;  1Y8M A;  2CG2 A;  3PH0 C;  4KBQ A;  4CDN A;  3FH8 A;  3Q47 B;  5HQ8 A;  3FEX A;  3RKV A;  4J6I A;  2GW1 A;  3GYZ A;  2LO6 A;  4FU3 A;  4JHK A;  5AIJ A;  3L08 A;  3CEQ A;  4ILH B;  4K03 A;  3AS5 A;  1ZBP A;  3S7J A;  3CR3 A;  2PQN A;  2Y4T A;  5AJD A;  4KVM A;  3ONL A;  1TJC A;  3APF A;  4H7X A;  5CCM A;  3FWV A;  3MV3 B;  5T3R A;  3SFZ A;  3T5V A;  4I2W A;  2P58 C;  3K9I A;  4I17 A;  4JC8 A;  2CHZ A;  3AS4 A;  3B7R L;  3UUX A;  5FQ6 A;  4URK A;  4G25 A;  2FEZ A;  3LDZ A;  4GZ3 A;  4BFR A;  3AU4 A;  5KJK A;  3RU0 A;  4BY6 A;  3ZGQ A;  2X6I A;  3D9L A;  5FT9 A;  3U4T A;  3HVE B;  4CGW A;  2WMO A;  5BV0 A;  3ENE A;  4BT8 A;  4OVV A;  3ZW3 A;  4I1M A;  4FA6 A;  4EZJ A;  5BV1 A;  5CMW A;  3QAR A;  4J0U A;  4LUN U;  2J4B A;  2YQ8 A;  2NC9 A;  4UI9 J;  4NQ0 A;  3URZ A;  4PS8 A;  4GZD A;  3R7Q A;  4JZY A;  5KJN A;  1SZA A;  1JWF A;  5KCM A;  1P5Q A;  4JEU A;  3TXN A;  4ABN A;  1XNF A;  1FVF A;  2XRZ A;  2XHE A;  4BTB A;  4TRQ A;  3PNT B;  1A17 A;  1JWG A;  2WXN A;  3HIZ A;  3RIB A;  2WXH A;  4KT6 B;  3PZD A;  4C0M A;  4CRW A;  2FUL A;  1NA3 A;  1VDY A;  3EHM A;  4HLE A;  4AY6 A;  2J4D A;  4ACL A;  3PNL B;  4FJY A;  5FQ7 A;  3GZ2 A;  3MA5 A;  3QAQ A;  2V8S E;  4J8D A;  2WPV A;  1SQM A;  3PDN A;  4UWH A;  1OWN A;  4WNE A;  3L22 A;  4WWP A;  2VGX B;  4U0S A;  4GYY A;  1XGW A;  3SBS A;  5LX8 A;  4APF A;  3QDN A;  2L9B A;  2PQR A;  3ASH A;  3HDX A;  5D0Q D;  3TAX A;  1TJF A;  2XQ0 A;  2GRL A;  3CST A;  3FUJ A;  1H2U A;  1UN9 A;  1WM5 A;  4D10 C;  1UN8 A;  3MGB A;  4MLP A;  4F1S A;  3D9O A;  1QNF A;  2XRY A;  4WND A;  5FZR A;  3QB2 A;  4A1G A;  4DI3 A;  4PUC A;  1HG2 A;  2AXU A;  3SBT B;  4A3V A;  2R5S A;  4EBA G;  2Q7F A;  3FU6 A;  1H2T C;  4I2Z A;  3QKY A;  3LS8 A;  3IV0 A;  2GGF A;  4UI9 C;  5JJ6 A;  1Z6T A;  5A6C A;  1B89 A;  3Q15 A;  4CGV A;  2L0T B;  4GU5 A;  2WXK A;  4U8H A;  1E8Y A;  4N3A A;  4GA1 A;  5CCL A;  3D9M A;  4BTA A;  3LPZ A;  1Y6I A;  4JHJ A;  4OYS A;  4W9R A;  4XIF A;  3EDT B;  2OND A;  2QFC A;  2X6K A;  3FP3 A;  4J8F A;  4YVQ C;  2VGY A;  3CIA A;  3CHR A;  2IFU A;  5T4Y A;  1HF8 A;  3QC1 A;  4N2S A;  2NXP A;  2RD0 A;  4IYP A;  4AM9 A;  4WAF A;  3IEG A;  4UWK A;  3G2W A;  4I1O B;  1OWL A;  3CHO A;  4AJW A;  1Z3X A;  2OOE A;  4ATG A;  4PS3 A;  4UWF A;  3CVW A;  1Z3Y A;  1EDU A;  3D9K A;  3APC A;  4LRZ A;  2VYI A;  4IRU A;  3ZYQ A;  4P29 A;  2KCV A;  3ASD A;  4GMJ A;  2HM8 A;  3L16 A;  1E8Z A;  4WWO A;  1QQE A;  2Y4U A;  3HHM A;  1H0A A;  2I6H A;  2WB2 A;  4UQZ A;  4KZC A;  3CKC A;  4FHK A;  3UPV A;  3ZYM A;  2V0P A;  2E2E A;  5ARF A;  4GB9 A;  2I1K A;  2WXQ A;  3ZPJ A;  3SNX A;  4JEH A;  1BPO A;  3FUK A;  2MOW A;  1HS6 A;  2WXL A;  3MKQ A;  3LY8 A;  2AVP A;  4HS2 A;  4FLH A;  1NZN A;  4FUL A;  4KXK B;  4Q96 A;  4RVB A;  1ELR A;  3ZEF A;  3U64 A;  3LEW A;  1IHG A;  4DPR A;  4NAC A;  4DLO A;  1EYH A;  3FTU A;  4L23 A;  1MQS A;  3CK7 A;  3CQG B;  3RO2 A;  5LP0 A;  2WQ6 A;  4CDM A;  1ELW A;  3CVL A;  3QWP A;  3LY7 A;  2VJ8 A;  4Y6C A;  4I43 A;  3GW4 A;  2WVI A;  3FTS A;  4JL0 A;  2CG3 A;  2X6H A;  4MS6 A;  1E96 B;  3UT7 A;  3ZYL A;  3ZIM A;  4LER A;  2WXR A;  3MZL B;  2ILR A;  4GZ6 A;  4JA7 A;  5ANR A;  4WNF A;  3PE3 A;  3S7F A;  1OWO A;  3CV0 A;  1WAO 1;  3RRU A;  3CSF A;  3RRN B;  3VLD A;  2XPY A;  3D9I A;  2UY1 A;  2HO1 A;  3G2S A;  2DIW A;  2PZI A;  1E7U A;  4FLB A;  5JHB A;  3CVY A;  2WXF A;  3B13 A;  3N71 A;  3QJZ A;  4G23 A;  3VLE A;  1IQU A;  4KVO A;  3PRE A;  3ML9 A;  5LFA A;  4FC8 A;  2OVF A;  3GZS A;  3WXX A;  3FDH A;  5BT1 A;  3NZU A;  3CQC B;  3LVQ E;  2M63 A;  3QOU A;  5KJL A;  3FTY A;  1ELK A;  4HFG A;  3O4Z A;  4UWL A;  1NA0 A;  4B8C B;  1IQR A;  3FUL A;  1INZ A;  3MEK A;  5DIZ A;  3TGO A;  3FU0 A;  3FEY A;  2CHW A;  2IQC A;  2MHK A;  4I9C A;  4DJA A;  4ANX A;  2XEV A;  3JQ0 A;  4XX5 A;  3TG5 A;  3FTW A;  1UJK A;  2XGM A;  3IKO B;  2FO7 A;  2V4L A;  3PE4 A;  3L54 A;  4HOQ A;  2QY7 A;  3LXU X;  4JPS A;  4OVU A;  2R59 A;  3ESL A;  2LSU A;  3D3M A;  3FUE A;  4BSX A;  4UQX A;  4ILG A;  3CK8 A;  4L7T A;  1HXI A;  2WXJ A;  2VSY A;  3PUJ A;  1L5J A;  3CHP A;  3BEE A;  4L1B A;  2KZT A;  3ESK A;  3NQP A;  2LSV A;  3JUI A;  3QK0 A;  2YHE A;  3MKQ B;  3U66 A;  4N2Q A;  4ANW A;  3I5P A;  3TL5 A;  3FUH A;  2ION A;  4I6J A;  2BUG A;  2HYZ A;  2IF4 A;  2V5F A;  5D0O D;  2DCP A;  5FQ8 A;  4BT9 A;  3D9N A;  4AP2 A;  3UX4 A;  1PC2 A;  3G2T A;  4WNG A;  4GCN A;  4GML A;  3FFL A;  2IJG X;  4ACK A;  5A7D B;  3MX3 A;  4DLQ A;  3L6A A;  5EKQ D;  4JXT A;  3DBS A;  4JVS A;  2IOL A;  3CVU A;  5LCW J;  2E0I A;  2FF4 A;  5FTP A;  2A4Z A;  4DI4 A;  5HI7 A;  2PL2 A;  2VQ2 A;  4Q69 A;  5EX3 A;  4BX9 A;  5FZS A;  3FUN A;  3CLJ A;  3UT8 A;  4FHJ A;  1KLX A;  4FAD A;  4WUY A;  4EZK A;  4XI0 A;  2UY1 B;  4F7A A;  1E90 A;  2XCB A;  4I9E A;  2GRM A;  3FH5 A;  3U3W A;  3CGH A;  3ASF A;  4EBA A;  4I6E A;  4WWN A;  4EPZ A;  4RSY A;  1HX8 A;  3CHS A;  3SZ7 A;  4GZ5 A;  3NF1 A;  4M3O A;  5BW8 C;  4B0Z A;  3KS2 A;  1HH8 A;  4G24 A;  4TV3 A;  3R9A B;  5J90 A;  3UT4 A;  4O6F A;  2IOS A;  3CVP A;  4V3I A;  4IUL A;  2OV8 A;  2YNQ A;  3OAW A;  3PS6 A;  1KT0 A;  4RG6 A;  4A3T A;  3B7U X;  3CVX A;  2LNI A;  2CFU A;  3SF4 A;  3QNK A;  3ZYK A;  3TG4 A;  3RK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...