3AG1E

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag1E00
3AG2E 5IY5E 3AG1E 2ZXWE 1V54E 3ASOE 1OCOE 3WG7E 5B3SE 5B1AE 1OCRE 2EINE 2EILE 3AG3E 1OCCE 2DYSE 3ASNE 3ABME 2EIJE 1V55E 3ABLE 2EIKE 3ABKE 2Y69E 3AG4E 5B1BE 2OCCE 3X2QE 2EIME 2DYRE 1OCZE
chains in the Genus database with same CATH superfamily
2Y4UA 3Q47B 1Y6IA 2XGOA 4G25A 3PZ1A 2A5UA 4JA9A 1K1AA 3ABME 5LOZA 3PUKA 1PY1A 4YDWA 1OWOA 3SGHA 3TG5A 4JEHA 5IY5E 2XPIA 1G3NB 3S7FA 1OWLA 3MKQA 1OWPA 3G2UA 3E32A 2DYSE 3BUAA 3Q15A 1TYQG 1FPPA 5FZRA 5EILA 3Q75A 1H2VC 1HXIA 3RAUA 2RFAA 3EHMA 3ESKA 3NAWA 2X6IA 3MKRA 3TWQA 1OCOE 2X3MA 3MV3B 3SI5A 1O1RA 3FU6A 4XX5A 3B7SA 3IEGA 3KSQA 4ABNA 1SA4A 5FTPA 3I5PA 1WG0A 4GTMA 3Q7AA 3C3QA 3D9OA 1N4RA 4AEZC 4JVSA 1WDYA 4HRMB 1IHBA 2VJ8A 4IRUA 4BSZB 3IXEA 4B0ZA 4BX8A 1QYMA 4AIFA 3QDNA 3LY8A 3SFYA 3PZ2A 2ZISA 3ASFA 2X6HA 3CSFA 3HDXA 3NF1A 4HLEA 4G26A 5JMND 3FTVA 3IV0A 2IONA 4WNDA 2CHXA 3IHVA 2A4ZA 4GTPA 4UQYA 2XZDG 4JZYA 4KYOB 2XCBA 1FVHA 4FADA 4I6GA 1HF8A 5ENOD 3MYVA 4QQIA 4EBAG 2WQ7A 2EQXA 4B8CB 2XQ0A 1S63A 3B7BA 1SZ9A 4XKCA 3CHRA 3PZ3A 4UWKA 5AJLA 1P5QA 2XS1A 1MJ0A 2LUHA 4U7EB 3QARA 3DSTA 1V55E 4MRUA 4HI9A 4C48B 3ZXSA 3S7JA 4GB9A 2KCKA 4CGVA 4GYYA 3LEWA 2DVWA 4L1BA 2BKGA 4CT0A 2PL2A 4F3VA 5ENSD 3CVQA 4EBAA 3DBSA 1OT8A 4YVQC 1Z5SC 5AN8A 5FQ4A 1PC2A 2WMOA 3UINC 4CT4A 4P29A 3BQOA 3ZYQA 3G2VA 3D9KA 4GPKA 5A6CA 4U0UA 4GCNA 4HLLA 5AQBA 1OWMA 2GW1A 3UM0A 2X38A 4GZ3A 2XCCA 5BXUA 3L13A 4GU5A 2NC9A 4CYMD 4HFGA 2J08A 5BXOA 2B0OE 2ZXWE 3EU5A 4EQFA 5CMYA 3JQ0A 3RRMB 3HYMB 1Z6TA 2P58C 3SO8A 4GPMA 3ONLA 4GA2A 3S2AA 2L0IA 4FA6A 4HBDA 3UIOC 1ZBPA 2X6JA 2HR2A 2WQ6A 1LD8A 3SFZA 3KAEA 3C3OA 4I9EA 4XI0A 5CERB 1E8YA 4JD2G 5ITZF 3IBEA 4CZ2D 1HE8A 4Q69A 2JLBA 3JXJA 4CDMA 4M3OA 2J4BA 1LF8A 2L0TB 1H0AA 3ZHEA 3L9TA 3LS8A 5E75A 4RQIA 4KBQA 3E30A 3CEQA 1AWCB 2PM7A 3PREA 4KMOA 3VTYA 4XI9A 3UT7A 3MKQB 5AENA 2RKKA 4DLQA 5BNWA 3CK7A 3U3WA 3ZNGA 3TWRA 4G2VA 2WMNA 1YA0A 2DIWA 4HNAD 2NSZA 4YVOA 3PZ4A 1JPLA 4LCTA 1QBQA 2YINA 1E90A 4UQZA 3V30A 3ZYMA 3UUXA 4U95D 3FTWA 4ACKA 4B89A 1EYHA 3CV0A 5JHAA 5HKPA 3SHFA 4E6HA 4EHMA 2PZIA 5HQ8A 2VGEA 3E4BA 1U3DA 4HB5A 2WXRA 3MV2B 4GZDA 3SZ7A 3UM3A 1KZOA 3RSEG 2C0LA 5BT1A 3AG3E 1MX6A 3JUIA 1U2VG 4I17A 1UOHA 4F6RD 2RD0A 4J8FA 2Y0BG 2WXNA 3UKRG 3Q79A 2I6HA 3ZVVA 3PEVB 4I1AA 4UUCA 5LCWJ 1QQEA 3URZA 4CDRA 4K5AB 3FEXA 3APDA 3ML8A 3OXGA 3KEAA 4KVOA 1N54A 3KS2A 4DLOA 4LUNU 2XRZA 3R9AB 3DWLG 3NZUA 2WXHA 2Y3AA 3UTMA 5C1DA 4F53A 4NIKA 1HX8A 3CLJA 1HO8A 4QFVA 2IFUA 4HS2A 2KM4A 5LX8A 2WM9A 5EX0A 3ABKE 4JC8A 3ZN3A 3ZEFA 4U0ZA 4MBGA 2ZGDA 2KC7A 3D9LA 1LD7A 2WXGA 3OTNA 3PH0C 4HOQA 4A3VA 4I1MA 4GAAA 3L08A 2DZOA 2V4HC 1WAO1 1PAQA 3LPZA 2WXFA 3FUFA 2R05A 3I4RB 4C9BB 4G8LA 5CBNA 1H6OA 2B6CA 5JJ6A 3FEYA 1FCHA 4X8QA 1SA5A 2CFZA 1IKND 3T9KA 4DI3A 2WXQA 3FTUA 4JW1A 2H6HA 4HXIA 3HXBA 2H6GA 4C0MA 1MYOA 3NB2A 1TJCA 2OV8A 2YQ8A 3N71A 2V4LA 4XE0A 2GRQB 4AXHA 2ETCA 3HXCA 3FUJA 3Q9UC 1BPOA 4U0SA 1SVXA 2BEDA 4BT8A 2I1JA 4IYPA 3PNTB 3PZDA 5EN5D 1TR4A 2FI7A 4UI9C 4J7WA 2IOLA 4ANXA 5FWQA 2FULA 5ANRA 1D8EA 2QYJA 4N3CA 3RJVA 4DX2A 2R17C 2GRPB 3CVYA 3U9WA 1E8WA 1JWGA 1NFIE 4JHKA 1UJKA 4GTTA 2P9IG 5FIOA 2OCCE 4TUUA 3EHNA 5JHBA 1NZNA 2MRIA 1TEZA 2R5SA 2XGMA 5CHEE 1WY6A 3FUDA 4U04A 2WQHA 3DSVA 3WXXA 3AG2E 2KATA 1KT0A 3MA5A 4J8DA 3ASHA 3ZKJA 4LNUD 3VTXA 3R9MA 2QC9A 2GRMA 2XPYA 1TN7A 2AJAA 4YDOA 1DCQA 3D3MA 4U07A 3SY2A 1WM5A 5A7DB 4A3TA 3GZSA 3Q9NC 4U96D 3SNXA 2CFUA 4O6FA 4CDNA 5CMWA 3FUEA 4U8HA 5D0QD 1TN8A 3VLEA 3B7TA 1ELWA 5FQ7A 2ZIRA 3ML9A 3ISMC 3FH7A 2BTDA 3TWUA 3C98A 1NA0A 1W3BA 3T5XA 1JCSA 4H7YA 1OCRE 2BKKB 3FTYA 5JA4D 1HG5A 3EJNA 4AVXA 2P9LG 2J8SD 1TNYA 1Z3YA 3RKVA 3ZXPA 4FULA 2LNIA 3PUJA 3FY4A 4EPZA 4EZKA 2HYZA 2Y4TA 4UWLA 2XZTG 4TXRA 1N95A 2L9BA 4O1OA 4DRXE 5CCMA 3ZYKA 3TJPA 1N9AA 3OXFA 4RG9A 3MGBA 2FF4A 3AS8A 3CHQA 4N5QA 3CKCA 1TNUA 2DCPA 4DI4A 3J5PA 5AQ7A 2NXPA 4WAFA 5CRUA 4LSZE 4G8KA 3CK8A 4ATZD 5CEAA 3Q49B 3PRZA 5B3SE 3G2SA 1KZPA 2V5FA 4JEUA 2Y1LE 4UWGA 2IO3C 4N3BA 3DSUA 2KCLA 2WXLA 5T3RA 4WNEA 3D9NA 3PVLA 4N5CA 3PS6A 3FUKA 4AM9A 3ZPJA 1NI1A 3QKYA 2KBXA 4W9RA 3NQPA 2BF0X 1E8ZA 4XZ4A 3FU3A 4J6IA 3JYSA 4ME2A 4GZ6A 4TRQA 1SQMA 1IYGA 2AVPA 1O1TA 3HHMA 1QZ2A 3ZU7B 5H7PA 4WUYA 5BPPA 4NQ0A 3RO3A 2DWZA 3TWSA 5ARFA 5ENPD 5M72A 4J0UA 4F7AA 4BERA 3EIJA 2X6FA 3AS5A 2EIME 4FHJA 1A17A 3CVXA 3FUIA 4I6JA 4O60A 4FC8A 1AP7A 5G55A 3NZSA 5AIJA 2IY0C 4GZCA 5ARGA 2E0IA 2J9QA 3UM1A 2LXMA 5HI7A 4PUCA 2YHEA 4XEIG 2PQNA 4WWOA 3FU5A 2EILE 3JQ1A 5KWDA 3LJNA 1H6PA 1NL4A 5CEDB 3L16A 2YNQA 5ENNA 2J07A 2XEHA 2GRLA 3CK9A 1JCQA 4DX1A 5FZSA 3VLFA 5BV1A 1K3ZD 4PDXA 4JPSA 5AJDA 1OWNA 5KJKA 3CVVA 2CG2A 4L2YA 1FVFA 4OVVA 5ANLA 4J8SA 1NA3A 1GW6A 1E7UA 2XEEA 3AS4A 4GMJA 1ZB1A 1EDUA 3CVPA 1UJJA 5G05J 1UG3A 4APOA 3NBNB 1KPSB 4CRWA 3GW4A 4N2QA 3TL5A 1EPUA 2XEVA 1FT2A 4B8AA 2J09A 5CCLA 3Q78A 5G04J 1N52A 4CCAA 1EF1C 5AQ9A 3T8KA 5ENRD 3B95A 5BW8C 2OOEA 5EIBE 3APCA 1JCRA 4N2SA 5KJNA 3CGHA 3MCXA 4V3IA 4GTOA 2LO6A 4ANVA 3ASNE 4KZ0A 4GYWA 3G2WA 4BESA 2HM8A 2QY7A 1KT1A 2L6BA 2IF4A 2FO7A 3Q5MA 4ILHB 1OY3D 3RU0A 4JHRA 5BUZA 2P2CP 4YNDA 3EIQC 3FTXA 2OVFA 1HG2A 2VTBA 4KVMA 4NRHB 3BU8A 2GROB 5C2YA 3UXGA 3SF4A 1A5EA 3HVEA 2HO1A 4HOUA 4HOSA 4EECA 4XKBA 3BEEA 3L22A 3WG7E 3ZYLA 3UKUG 2IOSA 5J90A 2CHZA 3UQ3A 4I1OB 2EIKE 1H2TC 1E8XA 5B1BE 2IJGX 2I1KA 3LVRE 4WNFA 3BG1B 3CVUA 2OEWA 5LFAA 2NYJA 3AU4A 1K8KG 4WWNA 4BY6A 2LSUA 2IEJA 4GTQA 4A1GA 4GTVA 4K5CA 4YDEA 3UT4A 4GMLA 5KNHD 5EDSA 5FJYA 3Q7FA 4LG6A 5HRYA 3SD5A 4UI9K 3T5VA 2JEKA 2P9NG 4C0EA 3IKOB 3UMVA 4HI8A 5FQ6A 2C2LA 5FQ8A 3CQCB 3ZIMA 3QWPA 3K9IA 3CVNA 3I3NA 4E85A 1VDYA 2P9PG 1OCZE 1BI8B 2P9KG 1N4PA 4TV3A 2LXLA 3P2BA 5J08A 2WVIA 3GZ1A 2WXJA 3LXUX 4U63A 3Q73A 3FULA 4A63B 1S70B 1DCEA 4JB8P 3GZ2A 1N0RA 3LY7A 3FWVA 4L2LA 3V31A 4I43A 2H6FA 3FTSA 3RRNB 2DYRE 1S64A 3DXKG 3E37A 4G11A 4YDYA 4IN3B 2ZGGA 4DK5A 1HZ4A 5FZQA 2WPVA 4TUMA 1N4QA 5AQAA 2IU1A 3DPDA 1MX2A 1TNOA 2J4DA 1JUQA 3HIZA 4AV7A 3SFXA 1X5BA 3NOGD 1YCSB 2VGYA 3G2TA 5EX3A 1ELRA 2EINE 4MKTA 3LVQE 4FJYA 3QJZA 1TJFA 2R02A 4FLBA 2Y69E 3FUMA 3OAWA 3TGOA 4A1SA 3APFA 3ASOE 3P1UA 3ZGQA 3FTZA 3FDHA 4GCOA 4H7XA 3D9IA 1OXJA 3QC1A 4BTBA 4HVBA 1H6KA 4OAUC 3JXIA 3RRUA 4UI9J 3LY9A 1H2UA 3UT8A 2ILRA 2MYOA 5JJ7A 2R2LA 4HRNA 3S7BA 4U8VD 3HXEA 3KSLA 5CBOA 2AXUA 1X81A 3PE3A 4PS7A 1RZ4A 2H6IA 4AJWA 2QYUA 2ZU6B 4JA7A 4DUIA 1FT1A 5E76A 4JL0A 3D9HA 4DPRA 2LAIA 3V2OA 1YMPA 3ZFWA 3R7QA 2VTBB 1N11A 3PNLB 1S0PA 3KD7A 2VGXB 4FP7A 2KXPC 3B7UX 3FFLA 1D9SA 3CVLA 5ENQD 4RLYA 3HVEB 3UIPC 5B1AE 3RO2A 3OXLA 4GTSA 4LERA 4PS3A 1OCCE 3QOUA 5BV0A 2XGSA 3EUVA 2UY1B 5DIZA 4N39A 3CSTA 5D66A 4G1TA 2DZNA 2OEVA 5HS0A 3J5QB 3DPYA 3EDTB 1UW4B 2V0PA 4LNGA 3PE4A 2ONDA 3FH5A 3CR3A 3MEKA 1SW6A 2VSOE 3CHOA 5T8IA 3B7RL 2AWIA 4JXTA 4HORA 1MZCA 4N3AA 3U66A 3CHMA 2J49A 5AYWD 3ASGA 4EZJA 3ULQA 1HFAA 3AG4E 2PNNA 3D9JA 3E34A 4LNBA 3SBSA 4DX5D 2P9SG 1DVPA 3QAQA 1JWFA 4WNGA 3L17A 3LCAA 3L6AA 3CVWA 5JJTA 2EIJE 4BT9A 4B93B 4DX7D 4CGWA 2AXVA 2WXIA 4ANWA 5CECB 3DSSA 3V2XA 4LEUA 5T4YA 1DNPA 3BG0B 1D8DA 5KBAA 2GGFA 3ABLE 3ZW3A 3PEUB 3TXMA 5FT9A 4HOTA 3KEZA 1E96B 3LDZA 3LYAA 3TXNA 3C3RA 1KLXA 3CHPA 4I9CA 1E7VA 5G2NA 4B94A 5CRVA 3JUEA 1L5JA 3QB2A 4GMRA 4UQXA 4GA1A 2OVBA 1BD8A 1IXVA 4Z68A 4BWRA 2QFCA 1B89A 4I2WA 4IULA 1IQUA 4CEMA 4KT6B 5KCMA 1O1SA 1IHGA 4Y6WA 3DEPA 3V79K 4OYSA 4KZCA 4K03A 1DC2A 3EU9A 1UN9A 2WXKA 2VSNA 2L6JA 1N4SA 4Q96A 1TNBA 2RFMA 1UN8A 4AOFA 4GYOA 2GRNB 4R7LA 4BETA 2KZTA 4UWHA 4Q94A 3UM2A 3LKUA 3FHEA 2F37A 2XS8A 3AG1E 1XNFA 3ZUVB 2VSYA 1N0QA 2IQCA 4BX9A 4I2ZA 2R03A 3ZRHA 2AXZA 5ENTD 4G23A 4J8EA 2VSXE 1SZAA 1LTXA 4TXQA 4NACA 4TXPA 4Y6CA 4BSXA 3F6QA 1MHQA 1Z3XA 2F8XK 3QNKA 3AAAC 3VLDA 4GZ5A 3NOCD 3O48A 1OUVA 4A55A 2CHWA 5G05C 3R7RA 1K1BA 4ATGA 1RW2A 2C0MA 3UPVA 2WXPA 3T8MA 5G04C 4FLHA 3EHRA 4FHKA 3X2QE 3HRAA 3C5RA 1ELKA 3FH8A 2E2EA 4F1PA 3CIAA 3E33A 4MS6A 4O1PA 2VYIA 3QWWA 1O5MA 4XIFA 4AP2A 4L7TA 2HE0A 4K5BA 4BTAA 1MX4A 4GA0A 2V5QC 3UI2A 4NURA 3HG0D 1Y8MA 2UWJG 1TNZA 2I2OA 4RG6A 4URKA 3CKBA 5EIDA 4HQDA 2VGXA 4BFRA 4ILGA 4U8YD 4ZFHA 3Q4AB 3L54A 2FBNA 2XRYA 4LRZA 1V54E 4G24A 4DJAA 2R59A 2UY1A 3CHSA 3ULEG 3RK6A 3TWTA 2WXOA 3D9MA 1BI7B 3ASDA 5EYLA 1H19A 4RSYA 3I4GA 4KXKB 5FINA 5LCWC 4WWPA 3MJWA 4ZHBA 3C72A 2P9UG 1BLXB 3ONKA 5EKQD 2VQ2A 2F8YA 4OVUA 2MOWA 4APFA 3AJIA 4ILIA 2IO2C 4EZLA 4D10C 4DX6D 2XENA 2JABA 3MZLB 4RVBA 3FUHA 2WXMA 3FP3A 3PDNA 3RIBA 1Q2ZA 3DRAA 2GRRB 1U3CA 3W9FA 2F0YA 3SQVA 4OAVB 2M63A 1XGWA 4ACLA 2Q7FA 1ZU2A 1IQRA 2CG3A 2YHCA 3QWVA 3EHQA 2LAHA 5D2MC 3S7DA 3D9PA 5DBKA 1QNFA 5AARA 2DBAA 4L9PA 2MHKA 4PH4B 3TWXA 2A5EA 3MX3A 4ANUA 3SBTB 3U4TA 3ULYA 3FUNA 2LSVA 2KZTB 5KJLA 4K0RA 2XPZA 2WB2A 4FU3A 2KCVA 5D0OD 2X6KA 2BUGA 3ENEA 3HXDA 4HRLA 4PS8A 3TG4A 2ETBA 1N94A 1MQSA 3IHYA 1BU9A 2QZAA 4L23A 1HU3A 3GYZA 4I6EA 5A23A 3W9GA 5LP0A 2V8SE 1INZA 2PM6A 5KNGA 1HS6A 5KJMA 2ETAA 3B13A 4F1SA 4AY6A 1NP7A 3ZHEB 2FEZA 3JCKC 3TAXA 4M7CA 5EYPF 3O4ZA 3DSWA 3DSXA 2PQRA 1TN6A 3U64A 3FU0A 4J8YA 3UX4A 4AY5A 2XHEA 3AU5A 3HXFA 4FJZA 4JHJA 3CQGB 4BEPA 2RG8A 3DXMG 3TWVA 4MLPA 5AAOA 3TWWA 1HH8A 2AW6A 4GTRA 2I9CA 3QK0A 2FO1E 3L82A 1YYHA 3LJ3A 4UWFA 3DEOA 3ESLA
chains in the Genus database with same CATH topology
3AG2E 5IY5E 3AG1E 2ZXWE 1V54E 3ASOE 1OCOE 3WG7E 5B3SE 5B1AE 1OCRE 2EINE 2EILE 3AG3E 1OCCE 2DYSE 3ASNE 3ABME 2EIJE 1V55E 3ABLE 2EIKE 3ABKE 2Y69E 3AG4E 5B1BE 2OCCE 3X2QE 2EIME 2DYRE 1OCZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG2 E;  5IY5 E;  3AG1 E;  2ZXW E;  1V54 E;  3ASO E;  1OCO E;  3WG7 E;  5B3S E;  5B1A E;  1OCR E;  2EIN E;  2EIL E;  3AG3 E;  1OCC E;  2DYS E;  3ASN E;  3ABM E;  2EIJ E;  1V55 E;  3ABL E;  2EIK E;  3ABK E;  2Y69 E;  3AG4 E;  5B1B E;  2OCC E;  3X2Q E;  2EIM E;  2DYR E;  1OCZ E; 
#chains in the Genus database with same CATH topology
 2Y4U A;  3Q47 B;  1Y6I A;  2XGO A;  4G25 A;  3PZ1 A;  2A5U A;  4JA9 A;  1K1A A;  3ABM E;  5LOZ A;  3PUK A;  1PY1 A;  4YDW A;  1OWO A;  3SGH A;  3TG5 A;  4JEH A;  5IY5 E;  2XPI A;  1G3N B;  3S7F A;  1OWL A;  3MKQ A;  1OWP A;  3G2U A;  3E32 A;  2DYS E;  3BUA A;  3Q15 A;  1TYQ G;  1FPP A;  5FZR A;  5EIL A;  3Q75 A;  1H2V C;  1HXI A;  3RAU A;  2RFA A;  3EHM A;  3ESK A;  3NAW A;  2X6I A;  3MKR A;  3TWQ A;  1OCO E;  2X3M A;  3MV3 B;  3SI5 A;  1O1R A;  3FU6 A;  4XX5 A;  3B7S A;  3IEG A;  3KSQ A;  4ABN A;  1SA4 A;  5FTP A;  3I5P A;  1WG0 A;  4GTM A;  3Q7A A;  3C3Q A;  3D9O A;  1N4R A;  4AEZ C;  4JVS A;  1WDY A;  4HRM B;  1IHB A;  2VJ8 A;  4IRU A;  4BSZ B;  3IXE A;  4B0Z A;  4BX8 A;  1QYM A;  4AIF A;  3QDN A;  3LY8 A;  3SFY A;  3PZ2 A;  2ZIS A;  3ASF A;  2X6H A;  3CSF A;  3HDX A;  3NF1 A;  4HLE A;  4G26 A;  5JMN D;  3FTV A;  3IV0 A;  2ION A;  4WND A;  2CHX A;  3IHV A;  2A4Z A;  4GTP A;  4UQY A;  2XZD G;  4JZY A;  4KYO B;  2XCB A;  1FVH A;  4FAD A;  4I6G A;  1HF8 A;  5ENO D;  3MYV A;  4QQI A;  4EBA G;  2WQ7 A;  2EQX A;  4B8C B;  2XQ0 A;  1S63 A;  3B7B A;  1SZ9 A;  4XKC A;  3CHR A;  3PZ3 A;  4UWK A;  5AJL A;  1P5Q A;  2XS1 A;  1MJ0 A;  2LUH A;  4U7E B;  3QAR A;  3DST A;  1V55 E;  4MRU A;  4HI9 A;  4C48 B;  3ZXS A;  3S7J A;  4GB9 A;  2KCK A;  4CGV A;  4GYY A;  3LEW A;  2DVW A;  4L1B A;  2BKG A;  4CT0 A;  2PL2 A;  4F3V A;  5ENS D;  3CVQ A;  4EBA A;  3DBS A;  1OT8 A;  4YVQ C;  1Z5S C;  5AN8 A;  5FQ4 A;  1PC2 A;  2WMO A;  3UIN C;  4CT4 A;  4P29 A;  3BQO A;  3ZYQ A;  3G2V A;  3D9K A;  4GPK A;  5A6C A;  4U0U A;  4GCN A;  4HLL A;  5AQB A;  1OWM A;  2GW1 A;  3UM0 A;  2X38 A;  4GZ3 A;  2XCC A;  5BXU A;  3L13 A;  4GU5 A;  2NC9 A;  4CYM D;  4HFG A;  2J08 A;  5BXO A;  2B0O E;  2ZXW E;  3EU5 A;  4EQF A;  5CMY A;  3JQ0 A;  3RRM B;  3HYM B;  1Z6T A;  2P58 C;  3SO8 A;  4GPM A;  3ONL A;  4GA2 A;  3S2A A;  2L0I A;  4FA6 A;  4HBD A;  3UIO C;  1ZBP A;  2X6J A;  2HR2 A;  2WQ6 A;  1LD8 A;  3SFZ A;  3KAE A;  3C3O A;  4I9E A;  4XI0 A;  5CER B;  1E8Y A;  4JD2 G;  5ITZ F;  3IBE A;  4CZ2 D;  1HE8 A;  4Q69 A;  2JLB A;  3JXJ A;  4CDM A;  4M3O A;  2J4B A;  1LF8 A;  2L0T B;  1H0A A;  3ZHE A;  3L9T A;  3LS8 A;  5E75 A;  4RQI A;  4KBQ A;  3E30 A;  3CEQ A;  1AWC B;  2PM7 A;  3PRE A;  4KMO A;  3VTY A;  4XI9 A;  3UT7 A;  3MKQ B;  5AEN A;  2RKK A;  4DLQ A;  5BNW A;  3CK7 A;  3U3W A;  3ZNG A;  3TWR A;  4G2V A;  2WMN A;  1YA0 A;  2DIW A;  4HNA D;  2NSZ A;  4YVO A;  3PZ4 A;  1JPL A;  4LCT A;  1QBQ A;  2YIN A;  1E90 A;  4UQZ A;  3V30 A;  3ZYM A;  3UUX A;  4U95 D;  3FTW A;  4ACK A;  4B89 A;  1EYH A;  3CV0 A;  5JHA A;  5HKP A;  3SHF A;  4E6H A;  4EHM A;  2PZI A;  5HQ8 A;  2VGE A;  3E4B A;  1U3D A;  4HB5 A;  2WXR A;  3MV2 B;  4GZD A;  3SZ7 A;  3UM3 A;  1KZO A;  3RSE G;  2C0L A;  5BT1 A;  3AG3 E;  1MX6 A;  3JUI A;  1U2V G;  4I17 A;  1UOH A;  4F6R D;  2RD0 A;  4J8F A;  2Y0B G;  2WXN A;  3UKR G;  3Q79 A;  2I6H A;  3ZVV A;  3PEV B;  4I1A A;  4UUC A;  5LCW J;  1QQE A;  3URZ A;  4CDR A;  4K5A B;  3FEX A;  3APD A;  3ML8 A;  3OXG A;  3KEA A;  4KVO A;  1N54 A;  3KS2 A;  4DLO A;  4LUN U;  2XRZ A;  3R9A B;  3DWL G;  3NZU A;  2WXH A;  2Y3A A;  3UTM A;  5C1D A;  4F53 A;  4NIK A;  1HX8 A;  3CLJ A;  1HO8 A;  4QFV A;  2IFU A;  4HS2 A;  2KM4 A;  5LX8 A;  2WM9 A;  5EX0 A;  3ABK E;  4JC8 A;  3ZN3 A;  3ZEF A;  4U0Z A;  4MBG A;  2ZGD A;  2KC7 A;  3D9L A;  1LD7 A;  2WXG A;  3OTN A;  3PH0 C;  4HOQ A;  4A3V A;  4I1M A;  4GAA A;  3L08 A;  2DZO A;  2V4H C;  1WAO 1;  1PAQ A;  3LPZ A;  2WXF A;  3FUF A;  2R05 A;  3I4R B;  4C9B B;  4G8L A;  5CBN A;  1H6O A;  2B6C A;  5JJ6 A;  3FEY A;  1FCH A;  4X8Q A;  1SA5 A;  2CFZ A;  1IKN D;  3T9K A;  4DI3 A;  2WXQ A;  3FTU A;  4JW1 A;  2H6H A;  4HXI A;  3HXB A;  2H6G A;  4C0M A;  1MYO A;  3NB2 A;  1TJC A;  2OV8 A;  2YQ8 A;  3N71 A;  2V4L A;  4XE0 A;  2GRQ B;  4AXH A;  2ETC A;  3HXC A;  3FUJ A;  3Q9U C;  1BPO A;  4U0S A;  1SVX A;  2BED A;  4BT8 A;  2I1J A;  4IYP A;  3PNT B;  3PZD A;  5EN5 D;  1TR4 A;  2FI7 A;  4UI9 C;  4J7W A;  2IOL A;  4ANX A;  5FWQ A;  2FUL A;  5ANR A;  1D8E A;  2QYJ A;  4N3C A;  3RJV A;  4DX2 A;  2R17 C;  2GRP B;  3CVY A;  3U9W A;  1E8W A;  1JWG A;  1NFI E;  4JHK A;  1UJK A;  4GTT A;  2P9I G;  5FIO A;  2OCC E;  4TUU A;  3EHN A;  5JHB A;  1NZN A;  2MRI A;  1TEZ A;  2R5S A;  2XGM A;  5CHE E;  1WY6 A;  3FUD A;  4U04 A;  2WQH A;  3DSV A;  3WXX A;  3AG2 E;  2KAT A;  1KT0 A;  3MA5 A;  4J8D A;  3ASH A;  3ZKJ A;  4LNU D;  3VTX A;  3R9M A;  2QC9 A;  2GRM A;  2XPY A;  1TN7 A;  2AJA A;  4YDO A;  1DCQ A;  3D3M A;  4U07 A;  3SY2 A;  1WM5 A;  5A7D B;  4A3T A;  3GZS A;  3Q9N C;  4U96 D;  3SNX A;  2CFU A;  4O6F A;  4CDN A;  5CMW A;  3FUE A;  4U8H A;  5D0Q D;  1TN8 A;  3VLE A;  3B7T A;  1ELW A;  5FQ7 A;  2ZIR A;  3ML9 A;  3ISM C;  3FH7 A;  2BTD A;  3TWU A;  3C98 A;  1NA0 A;  1W3B A;  3T5X A;  1JCS A;  4H7Y A;  1OCR E;  2BKK B;  3FTY A;  5JA4 D;  1HG5 A;  3EJN A;  4AVX A;  2P9L G;  2J8S D;  1TNY A;  1Z3Y A;  3RKV A;  3ZXP A;  4FUL A;  2LNI A;  3PUJ A;  3FY4 A;  4EPZ A;  4EZK A;  2HYZ A;  2Y4T A;  4UWL A;  2XZT G;  4TXR A;  1N95 A;  2L9B A;  4O1O A;  4DRX E;  5CCM A;  3ZYK A;  3TJP A;  1N9A A;  3OXF A;  4RG9 A;  3MGB A;  2FF4 A;  3AS8 A;  3CHQ A;  4N5Q A;  3CKC A;  1TNU A;  2DCP A;  4DI4 A;  3J5P A;  5AQ7 A;  2NXP A;  4WAF A;  5CRU A;  4LSZ E;  4G8K A;  3CK8 A;  4ATZ D;  5CEA A;  3Q49 B;  3PRZ A;  5B3S E;  3G2S A;  1KZP A;  2V5F A;  4JEU A;  2Y1L E;  4UWG A;  2IO3 C;  4N3B A;  3DSU A;  2KCL A;  2WXL A;  5T3R A;  4WNE A;  3D9N A;  3PVL A;  4N5C A;  3PS6 A;  3FUK A;  4AM9 A;  3ZPJ A;  1NI1 A;  3QKY A;  2KBX A;  4W9R A;  3NQP A;  2BF0 X;  1E8Z A;  4XZ4 A;  3FU3 A;  4J6I A;  3JYS A;  4ME2 A;  4GZ6 A;  4TRQ A;  1SQM A;  1IYG A;  2AVP A;  1O1T A;  3HHM A;  1QZ2 A;  3ZU7 B;  5H7P A;  4WUY A;  5BPP A;  4NQ0 A;  3RO3 A;  2DWZ A;  3TWS A;  5ARF A;  5ENP D;  5M72 A;  4J0U A;  4F7A A;  4BER A;  3EIJ A;  2X6F A;  3AS5 A;  2EIM E;  4FHJ A;  1A17 A;  3CVX A;  3FUI A;  4I6J A;  4O60 A;  4FC8 A;  1AP7 A;  5G55 A;  3NZS A;  5AIJ A;  2IY0 C;  4GZC A;  5ARG A;  2E0I A;  2J9Q A;  3UM1 A;  2LXM A;  5HI7 A;  4PUC A;  2YHE A;  4XEI G;  2PQN A;  4WWO A;  3FU5 A;  2EIL E;  3JQ1 A;  5KWD A;  3LJN A;  1H6P A;  1NL4 A;  5CED B;  3L16 A;  2YNQ A;  5ENN A;  2J07 A;  2XEH A;  2GRL A;  3CK9 A;  1JCQ A;  4DX1 A;  5FZS A;  3VLF A;  5BV1 A;  1K3Z D;  4PDX A;  4JPS A;  5AJD A;  1OWN A;  5KJK A;  3CVV A;  2CG2 A;  4L2Y A;  1FVF A;  4OVV A;  5ANL A;  4J8S A;  1NA3 A;  1GW6 A;  1E7U A;  2XEE A;  3AS4 A;  4GMJ A;  1ZB1 A;  1EDU A;  3CVP A;  1UJJ A;  5G05 J;  1UG3 A;  4APO A;  3NBN B;  1KPS B;  4CRW A;  3GW4 A;  4N2Q A;  3TL5 A;  1EPU A;  2XEV A;  1FT2 A;  4B8A A;  2J09 A;  5CCL A;  3Q78 A;  5G04 J;  1N52 A;  4CCA A;  1EF1 C;  5AQ9 A;  3T8K A;  5ENR D;  3B95 A;  5BW8 C;  2OOE A;  5EIB E;  3APC A;  1JCR A;  4N2S A;  5KJN A;  3CGH A;  3MCX A;  4V3I A;  4GTO A;  2LO6 A;  4ANV A;  3ASN E;  4KZ0 A;  4GYW A;  3G2W A;  4BES A;  2HM8 A;  2QY7 A;  1KT1 A;  2L6B A;  2IF4 A;  2FO7 A;  3Q5M A;  4ILH B;  1OY3 D;  3RU0 A;  4JHR A;  5BUZ A;  2P2C P;  4YND A;  3EIQ C;  3FTX A;  2OVF A;  1HG2 A;  2VTB A;  4KVM A;  4NRH B;  3BU8 A;  2GRO B;  5C2Y A;  3UXG A;  3SF4 A;  1A5E A;  3HVE A;  2HO1 A;  4HOU A;  4HOS A;  4EEC A;  4XKB A;  3BEE A;  3L22 A;  3WG7 E;  3ZYL A;  3UKU G;  2IOS A;  5J90 A;  2CHZ A;  3UQ3 A;  4I1O B;  2EIK E;  1H2T C;  1E8X A;  5B1B E;  2IJG X;  2I1K A;  3LVR E;  4WNF A;  3BG1 B;  3CVU A;  2OEW A;  5LFA A;  2NYJ A;  3AU4 A;  1K8K G;  4WWN A;  4BY6 A;  2LSU A;  2IEJ A;  4GTQ A;  4A1G A;  4GTV A;  4K5C A;  4YDE A;  3UT4 A;  4GML A;  5KNH D;  5EDS A;  5FJY A;  3Q7F A;  4LG6 A;  5HRY A;  3SD5 A;  4UI9 K;  3T5V A;  2JEK A;  2P9N G;  4C0E A;  3IKO B;  3UMV A;  4HI8 A;  5FQ6 A;  2C2L A;  5FQ8 A;  3CQC B;  3ZIM A;  3QWP A;  3K9I A;  3CVN A;  3I3N A;  4E85 A;  1VDY A;  2P9P G;  1OCZ E;  1BI8 B;  2P9K G;  1N4P A;  4TV3 A;  2LXL A;  3P2B A;  5J08 A;  2WVI A;  3GZ1 A;  2WXJ A;  3LXU X;  4U63 A;  3Q73 A;  3FUL A;  4A63 B;  1S70 B;  1DCE A;  4JB8 P;  3GZ2 A;  1N0R A;  3LY7 A;  3FWV A;  4L2L A;  3V31 A;  4I43 A;  2H6F A;  3FTS A;  3RRN B;  2DYR E;  1S64 A;  3DXK G;  3E37 A;  4G11 A;  4YDY A;  4IN3 B;  2ZGG A;  4DK5 A;  1HZ4 A;  5FZQ A;  2WPV A;  4TUM A;  1N4Q A;  5AQA A;  2IU1 A;  3DPD A;  1MX2 A;  1TNO A;  2J4D A;  1JUQ A;  3HIZ A;  4AV7 A;  3SFX A;  1X5B A;  3NOG D;  1YCS B;  2VGY A;  3G2T A;  5EX3 A;  1ELR A;  2EIN E;  4MKT A;  3LVQ E;  4FJY A;  3QJZ A;  1TJF A;  2R02 A;  4FLB A;  2Y69 E;  3FUM A;  3OAW A;  3TGO A;  4A1S A;  3APF A;  3ASO E;  3P1U A;  3ZGQ A;  3FTZ A;  3FDH A;  4GCO A;  4H7X A;  3D9I A;  1OXJ A;  3QC1 A;  4BTB A;  4HVB A;  1H6K A;  4OAU C;  3JXI A;  3RRU A;  4UI9 J;  3LY9 A;  1H2U A;  3UT8 A;  2ILR A;  2MYO A;  5JJ7 A;  2R2L A;  4HRN A;  3S7B A;  4U8V D;  3HXE A;  3KSL A;  5CBO A;  2AXU A;  1X81 A;  3PE3 A;  4PS7 A;  1RZ4 A;  2H6I A;  4AJW A;  2QYU A;  2ZU6 B;  4JA7 A;  4DUI A;  1FT1 A;  5E76 A;  4JL0 A;  3D9H A;  4DPR A;  2LAI A;  3V2O A;  1YMP A;  3ZFW A;  3R7Q A;  2VTB B;  1N11 A;  3PNL B;  1S0P A;  3KD7 A;  2VGX B;  4FP7 A;  2KXP C;  3B7U X;  3FFL A;  1D9S A;  3CVL A;  5ENQ D;  4RLY A;  3HVE B;  3UIP C;  5B1A E;  3RO2 A;  3OXL A;  4GTS A;  4LER A;  4PS3 A;  1OCC E;  3QOU A;  5BV0 A;  2XGS A;  3EUV A;  2UY1 B;  5DIZ A;  4N39 A;  3CST A;  5D66 A;  4G1T A;  2DZN A;  2OEV A;  5HS0 A;  3J5Q B;  3DPY A;  3EDT B;  1UW4 B;  2V0P A;  4LNG A;  3PE4 A;  2OND A;  3FH5 A;  3CR3 A;  3MEK A;  1SW6 A;  2VSO E;  3CHO A;  5T8I A;  3B7R L;  2AWI A;  4JXT A;  4HOR A;  1MZC A;  4N3A A;  3U66 A;  3CHM A;  2J49 A;  5AYW D;  3ASG A;  4EZJ A;  3ULQ A;  1HFA A;  3AG4 E;  2PNN A;  3D9J A;  3E34 A;  4LNB A;  3SBS A;  4DX5 D;  2P9S G;  1DVP A;  3QAQ A;  1JWF A;  4WNG A;  3L17 A;  3LCA A;  3L6A A;  3CVW A;  5JJT A;  2EIJ E;  4BT9 A;  4B93 B;  4DX7 D;  4CGW A;  2AXV A;  2WXI A;  4ANW A;  5CEC B;  3DSS A;  3V2X A;  4LEU A;  5T4Y A;  1DNP A;  3BG0 B;  1D8D A;  5KBA A;  2GGF A;  3ABL E;  3ZW3 A;  3PEU B;  3TXM A;  5FT9 A;  4HOT A;  3KEZ A;  1E96 B;  3LDZ A;  3LYA A;  3TXN A;  3C3R A;  1KLX A;  3CHP A;  4I9C A;  1E7V A;  5G2N A;  4B94 A;  5CRV A;  3JUE A;  1L5J A;  3QB2 A;  4GMR A;  4UQX A;  4GA1 A;  2OVB A;  1BD8 A;  1IXV A;  4Z68 A;  4BWR A;  2QFC A;  1B89 A;  4I2W A;  4IUL A;  1IQU A;  4CEM A;  4KT6 B;  5KCM A;  1O1S A;  1IHG A;  4Y6W A;  3DEP A;  3V79 K;  4OYS A;  4KZC A;  4K03 A;  1DC2 A;  3EU9 A;  1UN9 A;  2WXK A;  2VSN A;  2L6J A;  1N4S A;  4Q96 A;  1TNB A;  2RFM A;  1UN8 A;  4AOF A;  4GYO A;  2GRN B;  4R7L A;  4BET A;  2KZT A;  4UWH A;  4Q94 A;  3UM2 A;  3LKU A;  3FHE A;  2F37 A;  2XS8 A;  3AG1 E;  1XNF A;  3ZUV B;  2VSY A;  1N0Q A;  2IQC A;  4BX9 A;  4I2Z A;  2R03 A;  3ZRH A;  2AXZ A;  5ENT D;  4G23 A;  4J8E A;  2VSX E;  1SZA A;  1LTX A;  4TXQ A;  4NAC A;  4TXP A;  4Y6C A;  4BSX A;  3F6Q A;  1MHQ A;  1Z3X A;  2F8X K;  3QNK A;  3AAA C;  3VLD A;  4GZ5 A;  3NOC D;  3O48 A;  1OUV A;  4A55 A;  2CHW A;  5G05 C;  3R7R A;  1K1B A;  4ATG A;  1RW2 A;  2C0M A;  3UPV A;  2WXP A;  3T8M A;  5G04 C;  4FLH A;  3EHR A;  4FHK A;  3X2Q E;  3HRA A;  3C5R A;  1ELK A;  3FH8 A;  2E2E A;  4F1P A;  3CIA A;  3E33 A;  4MS6 A;  4O1P A;  2VYI A;  3QWW A;  1O5M A;  4XIF A;  4AP2 A;  4L7T A;  2HE0 A;  4K5B A;  4BTA A;  1MX4 A;  4GA0 A;  2V5Q C;  3UI2 A;  4NUR A;  3HG0 D;  1Y8M A;  2UWJ G;  1TNZ A;  2I2O A;  4RG6 A;  4URK A;  3CKB A;  5EID A;  4HQD A;  2VGX A;  4BFR A;  4ILG A;  4U8Y D;  4ZFH A;  3Q4A B;  3L54 A;  2FBN A;  2XRY A;  4LRZ A;  1V54 E;  4G24 A;  4DJA A;  2R59 A;  2UY1 A;  3CHS A;  3ULE G;  3RK6 A;  3TWT A;  2WXO A;  3D9M A;  1BI7 B;  3ASD A;  5EYL A;  1H19 A;  4RSY A;  3I4G A;  4KXK B;  5FIN A;  5LCW C;  4WWP A;  3MJW A;  4ZHB A;  3C72 A;  2P9U G;  1BLX B;  3ONK A;  5EKQ D;  2VQ2 A;  2F8Y A;  4OVU A;  2MOW A;  4APF A;  3AJI A;  4ILI A;  2IO2 C;  4EZL A;  4D10 C;  4DX6 D;  2XEN A;  2JAB A;  3MZL B;  4RVB A;  3FUH A;  2WXM A;  3FP3 A;  3PDN A;  3RIB A;  1Q2Z A;  3DRA A;  2GRR B;  1U3C A;  3W9F A;  2F0Y A;  3SQV A;  4OAV B;  2M63 A;  1XGW A;  4ACL A;  2Q7F A;  1ZU2 A;  1IQR A;  2CG3 A;  2YHC A;  3QWV A;  3EHQ A;  2LAH A;  5D2M C;  3S7D A;  3D9P A;  5DBK A;  1QNF A;  5AAR A;  2DBA A;  4L9P A;  2MHK A;  4PH4 B;  3TWX A;  2A5E A;  3MX3 A;  4ANU A;  3SBT B;  3U4T A;  3ULY A;  3FUN A;  2LSV A;  2KZT B;  5KJL A;  4K0R A;  2XPZ A;  2WB2 A;  4FU3 A;  2KCV A;  5D0O D;  2X6K A;  2BUG A;  3ENE A;  3HXD A;  4HRL A;  4PS8 A;  3TG4 A;  2ETB A;  1N94 A;  1MQS A;  3IHY A;  1BU9 A;  2QZA A;  4L23 A;  1HU3 A;  3GYZ A;  4I6E A;  5A23 A;  3W9G A;  5LP0 A;  2V8S E;  1INZ A;  2PM6 A;  5KNG A;  1HS6 A;  5KJM A;  2ETA A;  3B13 A;  4F1S A;  4AY6 A;  1NP7 A;  3ZHE B;  2FEZ A;  3JCK C;  3TAX A;  4M7C A;  5EYP F;  3O4Z A;  3DSW A;  3DSX A;  2PQR A;  1TN6 A;  3U64 A;  3FU0 A;  4J8Y A;  3UX4 A;  4AY5 A;  2XHE A;  3AU5 A;  3HXF A;  4FJZ A;  4JHJ A;  3CQG B;  4BEP A;  2RG8 A;  3DXM G;  3TWV A;  4MLP A;  5AAO A;  3TWW A;  1HH8 A;  2AW6 A;  4GTR A;  2I9C A;  3QK0 A;  2FO1 E;  3L82 A;  1YYH A;  3LJ3 A;  4UWF A;  3DEO A;  3ESL A; 
#chains in the Genus database with same CATH homology
 3AG2 E;  5IY5 E;  3AG1 E;  2ZXW E;  1V54 E;  3ASO E;  1OCO E;  3WG7 E;  5B3S E;  5B1A E;  1OCR E;  2EIN E;  2EIL E;  3AG3 E;  1OCC E;  2DYS E;  3ASN E;  3ABM E;  2EIJ E;  1V55 E;  3ABL E;  2EIK E;  3ABK E;  2Y69 E;  3AG4 E;  5B1B E;  2OCC E;  3X2Q E;  2EIM E;  2DYR E;  1OCZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...