3AG1E

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag1E00
2ZXWE 2OCCE 3AG4E 3AG2E 3X2QE 3AG3E 3ABLE 3ABME 3ABKE 3ASNE 3ASOE 1OCOE 1OCRE 2EIKE 5B1AE 2Y69E 5B3SE 2EINE 3WG7E 2EIJE 1OCZE 1V55E 5B1BE 1V54E 2EILE 2DYRE 5IY5E 3AG1E 2EIME 2DYSE 1OCCE
chains in the Genus database with same CATH superfamily
3CQGB 1BI7B 2J4DA 5HQ8A 4Z68A 3I5PA 3OXGA 1OCRE 1BPOA 4BSXA 1Z3XA 2KCLA 4HOUA 3C3OA 2NSZA 4K5CA 3Q9UC 2WPVA 3QB2A 4I1MA 3CVVA 2VSXE 3E4BA 3S7DA 1JCRA 4LERA 3S2AA 4DX6D 2VSOE 3BUAA 1E8YA 4U8VD 1OWNA 3FULA 2RG8A 4AOFA 3FDHA 1P5QA 1TYQG 5BUZA 3G2TA 3SI5A 3Q78A 3CSFA 3NOGD 4HRMB 4GZ3A 3ZW3A 3SHFA 4CDMA 4FLBA 4GZ6A 1YA0A 2X6HA 2XRZA 3SFZA 4HS2A 3TWUA 1SA5A 2JABA 3U66A 4F1SA 1MHQA 3FH5A 5HRYA 5EN5D 3L17A 3PUKA 1JWFA 4TRQA 2GRLA 3V2OA 3B7TA 4HOTA 1KLXA 3SZ7A 4JEHA 3PNTB 2ILRA 1OT8A 3TWTA 2WXFA 1HH8A 5DIZA 3JQ1A 3WXXA 3JUEA 1SQMA 1E8XA 4ILGA 4W9RA 3FY4A 2R5SA 5EX0A 2KCVA 3APFA 3CHPA 3MJWA 2IJGX 3CHOA 4G23A 1UW4B 4HI9A 4GB9A 2XGSA 2ZU6B 3PNLB 3RRUA 3MKRA 3TWSA 4U63A 2P9UG 3Q4AB 2PM6A 3KSLA 1N4SA 1K1BA 5ENTD 2OVBA 5CMYA 4ACKA 4KZ0A 4BT9A 1PAQA 4JA7A 4ACLA 1KZPA 1H6KA 2HR2A 3I4GA 4IRUA 4XKBA 4TV3A 1HZ4A 2IOSA 1ZBPA 4IN3B 5FIOA 1H19A 3PZ3A 4OVUA 3PE3A 4L2YA 3X2QE 2QYJA 1K3ZD 5AIJA 4HVBA 3ASNE 3ZYMA 1TEZA 4DX7D 4ANXA 5BV1A 5EILA 2QC9A 4I43A 2R2LA 3AAAC 3OXLA 1FT1A 3ONKA 3V79K 4U96D 3SQVA 2WXRA 3T8MA 1N4PA 2LXMA 5HKPA 5KJNA 1BU9A 2IQCA 3P1UA 3UMVA 2X6IA 2R17C 4U8YD 1JPLA 3APCA 2XHEA 1SW6A 3DSVA 3LCAA 3CQCB 3FTZA 3UPVA 2A5EA 4ILIA 1TR4A 4DX5D 3LY8A 3RRMB 5KJMA 4F1PA 5LOZA 1N9AA 3AU4A 4KZCA 1HE8A 3FU0A 2AXVA 4G25A 4APOA 5JJ7A 4YDYA 1YCSB 2WMOA 2FEZA 3GZSA 3EHQA 3JQ0A 4ABNA 4OYSA 3AS4A 5AYWD 2XS8A 3VLFA 1IQRA 3U64A 4XE0A 2PQNA 2XQ0A 3DBSA 1IXVA 2B0OE 2E2EA 2X38A 5B1BE 3CK8A 3MZLB 3FU3A 3MYVA 5A23A 5G04C 1Q2ZA 5G2NA 1IYGA 2XGMA 5KBAA 2AVPA 5CBNA 5LP0A 2GRPB 2LAIA 4U0SA 2PQRA 4UQZA 4DJAA 1OCOE 1QBQA 4JPSA 3DXMG 3ML9A 3RU0A 2NXPA 3EHMA 3D9NA 3PRZA 3CK7A 3RAUA 1TNBA 5CERB 3ASDA 4B93B 2VYIA 1JWGA 3MGBA 3FWVA 2KATA 3ZHEB 2L6JA 4GA0A 4FHJA 4DUIA 4EECA 3IBEA 1TN6A 1N52A 5EX3A 1EF1C 3D9LA 3JYSA 4CGVA 5BXOA 4BSZB 4F3VA 1H2VC 3LY7A 2DWZA 2F8XK 4G11A 1PY1A 3SY2A 5C1DA 2X6KA 5CEDB 3BG0B 1FPPA 2AXZA 4L1BA 2YHCA 3BQOA 3W9GA 5E76A 1NA0A 2FI7A 4EPZA 1O5MA 1KT0A 1OWPA 3TWWA 2WXNA 1O1SA 3FTVA 1E8ZA 1BD8A 5IY5E 1FVFA 4I6JA 4RG6A 3AS8A 3S7JA 5JJ6A 2XZDG 2XS1A 4Y6WA 5G05C 4AP2A 5AN8A 3V31A 2OCCE 4EHMA 3FUKA 2V5QC 3IEGA 2LSVA 4NIKA 4YVOA 2RD0A 3QC1A 4U8HA 4B8CB 4G2VA 1BLXB 3CVQA 4RG9A 4GZCA 2J07A 3LVQE 4GTOA 2KZTB 4G24A 2P58C 4DI3A 3FEYA 3ESKA 5KJLA 2RFMA 3IKOB 3ULQA 4NRHB 5AARA 2QYUA 4XZ4A 5ARFA 3ESLA 3MV2B 5D0QD 2WXGA 3CKBA 2VQ2A 3SNXA 1QZ2A 4G8KA 3ABME 5JHAA 1JCSA 4A63B 2H6GA 4G1TA 4FADA 1TNZA 5FINA 3L16A 2GRRB 5FQ7A 2WM9A 3FH7A 3T5XA 3DPDA 2P9SG 3JXJA 3ZIMA 4E85A 4AV7A 4JZYA 4KT6B 2ETBA 5CBOA 3QWWA 4PDXA 2KZTA 3UXGA 1N95A 1QYMA 4XI0A 1V54E 4UQXA 4GTRA 3I3NA 3MV3B 2VGXB 3EDTB 1TNYA 2QZAA 3QWVA 4KVMA 1MX4A 4FULA 2P9LG 4BY6A 4RLYA 2XEEA 5FJYA 4N5QA 3RKVA 4BERA 2F8YA 5EYLA 4UWLA 2Y4UA 5T4YA 4DPRA 3MKQB 2EIJE 2WXOA 4IYPA 1H2TC 2I1JA 3L82A 1L5JA 3ZUVB 3C98A 4I2ZA 4KVOA 3NZUA 4K03A 2KCKA 4UI9C 3JXIA 3L08A 3B7SA 4CYMD 4LSZE 5FQ6A 4C0EA 3UM3A 3FTWA 2EILE 1FT2A 2WXHA 3EU9A 4GPKA 1LF8A 4V3IA 1NL4A 1DCEA 3ONLA 5ENRD 2VSYA 4CDNA 4KBQA 5E75A 1HG2A 4ILHB 4RVBA 2FBNA 3T8KA 3ULYA 4PS7A 2NYJA 1K1AA 2EIME 4CDRA 4BT8A 3FFLA 3MKQA 3DWLG 4NQ0A 1MQSA 2WQ7A 2DZOA 3QNKA 4CEMA 3R9MA 5EDSA 4N2SA 4PUCA 2I1KA 2IOLA 3C5RA 3Q5MA 2FULA 1K8KG 4AM9A 3D9MA 4DRXE 3FTXA 4GTPA 2Y69E 3UM2A 2ZGGA 1AWCB 3D9KA 1HF8A 4Q94A 2FO7A 3EUVA 1E8WA 4OAUC 2L0TB 4MKTA 2IEJA 4AJWA 1TJCA 4J8EA 4MRUA 3ZNGA 1N0QA 4FC8A 4GZ5A 5FZRA 5ENOD 3GW4A 5FWQA 3U3WA 2X3MA 3UM1A 4GPMA 2RKKA 3HXFA 4ANWA 2HM8A 3G2VA 2DYSE 1DNPA 2DZNA 1NFIE 2GGFA 3PDNA 4CRWA 4BTAA 1Y8MA 1TJFA 4A3VA 2Q7FA 4FP7A 3LPZA 2J9QA 3LDZA 2V4HC 2XZTG 4U04A 4GTVA 4PS3A 4GMRA 4BETA 2I6HA 3W9FA 3V2XA 1OCZE 3URZA 3LEWA 3R7QA 5JA4D 5KNGA 4ZHBA 3RK6A 3NBNB 4CCAA 1D8DA 2KC7A 1TN8A 2WXLA 2WXIA 3FP3A 2J49A 3CLJA 2PNNA 3HDXA 3HXCA 4HLEA 2XEVA 3ASOE 4KYOB 4EQFA 2WXQA 4AXHA 3PUJA 2WVIA 3FEXA 3MX3A 5AQ7A 4U07A 4K5AB 3QWPA 2M63A 1D8EA 5CRUA 2GROB 4K5BA 2OEWA 4JHKA 4EBAG 2DCPA 4N3AA 3CVLA 3D3MA 5D66A 2CG2A 3T5VA 2XCCA 3CVPA 3Q47B 4C48B 2FO1E 2BTDA 2PL2A 3E33A 1H6OA 4DX1A 3ABKE 5ENQD 2IY0C 4N3BA 1SA4A 2BKKB 2ONDA 4BWRA 2H6HA 3OXFA 3RSEG 3N71A 3NF1A 3QAQA 3AG4E 4HNAD 3SO8A 3AJIA 5ITZF 3HIZA 3IV0A 5FT9A 4JB8P 1S70B 4I2WA 1A17A 2XEHA 3DRAA 3KSQA 5KJKA 3PS6A 3SBSA 3CK9A 3UUXA 1HS6A 1EDUA 1KPSB 3CVNA 5B1AE 3Q75A 4WAFA 1N4QA 3UT8A 3GYZA 2E0IA 2XRYA 4WNGA 4AY5A 4CT4A 1H0AA 2A4ZA 4FJYA 1ELKA 2XENA 3ZYLA 3FUDA 3ZFWA 4O1OA 2OV8A 3SGHA 1DCQA 4WWPA 1UJJA 3I4RB 2Y1LE 5A7DB 3RO3A 3DEOA 4DX2A 4M3OA 4ANVA 2YHEA 3RJVA 3ISMC 1OXJA 1QQEA 3AG3E 4KMOA 2VTBB 2WXMA 3F6QA 4C0MA 3S7FA 2I2OA 2UWJG 2UY1B 2MOWA 2KBXA 4F7AA 2XPIA 4WNEA 4JHJA 4J8SA 1U3DA 5ARGA 3RIBA 2JLBA 1NA3A 3HXEA 2LAHA 2MYOA 1X5BA 4ATZD 5EKQD 2L9BA 2H6IA 3NAWA 4XI9A 5FZQA 4GCNA 4YDEA 1U2VG 4BX9A 5M72A 1JCQA 4HQDA 1A5EA 3D9PA 3EU5A 5CECB 4DLQA 4B94A 3CGHA 2WB2A 1IKND 3LJNA 1O1TA 4EBAA 2GW1A 4HLLA 4A3TA 3KD7A 2WXJA 3ZXSA 4IULA 3OAWA 4U0UA 1V55E 4GCOA 3GZ2A 2VTBA 3CVXA 3ASFA 1WDYA 2A5UA 3CEQA 3ZHEA 3IHVA 4J8FA 1N4RA 4BEPA 2GRQB 1UJKA 5AQ9A 3DEPA 3ASHA 2AJAA 2J08A 3ZPJA 1HX8A 5AJDA 3HRAA 4GZDA 2V5FA 3LYAA 1GW6A 3FUIA 4I1AA 2WQ6A 2VGEA 2BKGA 3FUMA 2R05A 3AG1E 2CFZA 1B89A 3BG1B 5CCLA 2IF4A 3FUEA 4JL0A 3E34A 4FA6A 3UIOC 2ZIRA 4MS6A 1H6PA 2IFUA 3LY9A 3TWRA 4JA9A 2DIWA 3RRNB 4MLPA 1HO8A 2J8SD 3PZ1A 4O60A 3CHMA 3CVUA 3PEVB 3RO2A 5CMWA 1MX2A 5AQBA 5HS0A 3ZGQA 4GYOA 1OY3D 3G2UA 1SVXA 3Q15A 2F37A 3TL5A 4J7WA 3DPYA 4ATGA 3TGOA 2C0MA 2L0IA 3ZYKA 4I6GA 1MJ0A 2MRIA 3LJ3A 2NC9A 1AP7A 1WY6A 2WXKA 3LKUA 2C2LA 3HVEB 4I1OB 2B6CA 4HFGA 5AAOA 1LD7A 3U9WA 5FQ8A 4B89A 2OEVA 4EZKA 3WG7E 1OWMA 3ZEFA 4GTQA 3K9IA 2QFCA 3J5QB 4I17A 3SFYA 2Y0BG 4WWNA 4LUNU 5BV0A 4HI8A 3PREA 3SD5A 4NURA 2XPYA 5FZSA 1W3BA 4K0RA 1HFAA 5ANLA 5AENA 2H6FA 4QQIA 3MCXA 1OCCE 5CCMA 1Z5SC 1EPUA 1KT1A 5JJTA 4HORA 1Y6IA 5FTPA 3UM0A 1IHGA 2VGXA 4YDWA 3S7BA 5KCMA 3CKCA 2CHXA 2AW6A 4J0UA 1UN9A 4FHKA 1HG5A 3LXUX 4H7YA 3NQPA 3CVYA 3KEZA 2C0LA 2P9KG 2BEDA 5CEAA 3DXKG 3U4TA 3CR3A 2FF4A 4AEZC 2P9PG 4GYYA 1ZB1A 4A1GA 3L13A 4NACA 3NZSA 4ME2A 2EINE 1FVHA 3MA5A 3ZVVA 2X6JA 1Z3YA 3D9HA 3UX4A 4TUUA 2P2CP 2ZXWE 2OOEA 4P29A 5JMND 3VLDA 3TG4A 5EYPF 3HXDA 1TN7A 2YINA 1E7UA 4AVXA 2EIKE 4UWGA 4U7EB 1OUVA 3IXEA 2WQHA 4HB5A 5AQAA 1NI1A 2WXPA 3HYMB 2LO6A 4LG6A 5T8IA 3Q7FA 1N54A 4HOQA 3ZKJA 4Q69A 4CGWA 3OTNA 3UQ3A 2J4BA 5LCWJ 3FHEA 2GRMA 3ZRHA 4GTMA 2P9IG 4B8AA 3Q9NC 1ELWA 3MEKA 3PEUB 3UIPC 3DSXA 1DC2A 3B95A 3GZ1A 5ENPD 5G04J 3TWXA 3UTMA 4GMJA 3SBTB 1UG3A 3R9AB 4GA1A 3E30A 1G3NB 1OWLA 5ENNA 3JCKC 1D9SA 3UT7A 4FLHA 4EZLA 1E96B 4FU3A 1LD8A 2J09A 4U95D 3TG5A 4J8YA 1UN8A 3ASGA 4YNDA 2ZISA 5EIDA 1OWOA 3AU5A 3QOUA 4C9BB 3FTYA 4N5CA 3UKRG 4TXQA 5DBKA 1ZU2A 2VJ8A 3DSUA 1TNOA 2XPZA 4DI4A 2ZGDA 4GTSA 5LX8A 1Z6TA 5G55A 4I9CA 3KEAA 3ZU7B 1RZ4A 3CV0A 4UI9K 2XCBA 4HRLA 4GYWA 4B0ZA 2IONA 3ULEG 3D9JA 1MZCA 5B3SE 4JXTA 4OVVA 4BESA 3TAXA 1NZNA 3CSTA 2QY7A 2CHZA 4HRNA 4U0ZA 5BT1A 3C3QA 2LNIA 3BEEA 5G05J 3G2WA 4L9PA 4UWFA 3L22A 3SFXA 4UWKA 2ETAA 4YVQC 3VTXA 3SF4A 5EIBE 2AWIA 4XIFA 4CT0A 5J08A 3Q73A 4N3CA 3AG2E 4I6EA 1SZ9A 4X8QA 3ENEA 1VDYA 1DVPA 4GA2A 4J6IA 3R7RA 2HO1A 4WWOA 1S63A 3PH0C 2EQXA 4GTTA 5LCWC 4F6RD 4QFVA 4JHRA 1X81A 4RSYA 3P2BA 3T9KA 4RQIA 4TXRA 2DBAA 2IO3C 1TNUA 1WAO1 3CHQA 1N11A 5D2MC 3KS2A 4BX8A 3FUHA 2YQ8A 1QNFA 2VSNA 5CRVA 3HXBA 2R02A 4HOSA 3PZ2A 3FTUA 1INZA 3KAEA 2CG3A 1HU3A 3C72A 3QDNA 3APDA 1N0RA 1RW2A 3LS8A 4L2LA 5BXUA 3FUFA 3NB2A 4N2QA 1MYOA 2LXLA 4OAVB 4JD2G 2X6FA 2IO2C 4HBDA 2BF0X 3L9TA 2HE0A 3VLEA 2IU1A 4BTBA 2CFUA 4TUMA 4PS8A 3TWVA 1XNFA 2V4LA 4E6HA 4ANUA 4G26A 4D10C 4GAAA 5JHBA 4JVSA 4O6FA 3IHYA 4BFRA 4MBGA 3Q79A 4G8LA 1N94A 3ZXPA 5T3RA 5KWDA 2PM7A 2I9CA 3FU6A 2F0YA 3E37A 1HXIA 4UI9J 1EYHA 2DVWA 5FQ4A 2MHKA 3TJPA 2VGYA 2R03A 2JEKA 3L54A 4WNFA 3CHSA 4DLOA 5J90A 3Q49B 3DSWA 3EHRA 2BUGA 3C3RA 3HG0D 2UY1A 2GRNB 2V8SE 4F53A 2RFAA 3E32A 3UKUG 3NOCD 5ENSD 4HXIA 4R7LA 1E90A 2CHWA 2Y4TA 3L6AA 3ML8A 3FTSA 3PE4A 3BU8A 2KM4A 4UUCA 1H2UA 3QK0A 4GU5A 3PZDA 5AJLA 3QKYA 5BW8C 3EIQC 1U3CA 4A1SA 3J5PA 4UWHA 3QARA 5BPPA 1MX6A 3G2SA 3B7BA 2V0PA 1YYHA 3EJNA 3ABLE 3D9IA 1UOHA 3PVLA 3EHNA 4O1PA 1IQUA 4I9EA 4ZFHA 3FU5A 4Q96A 2LSUA 3FUJA 1JUQA 3O4ZA 1BI8B 3EIJA 3PZ4A 3ZN3A 3CHRA 3CIAA 4LEUA 4XEIG 3JUIA 1O1RA 2PZIA 3V30A 4AIFA 4XX5A 4TXPA 1IHBA 3FH8A 3LVRE 3DSTA 3VTYA 3ZYQA 3HHMA 2Y3AA 5A6CA 4APFA 1NP7A 1S64A 4N39A 2L6BA 3Q7AA 4EZJA 1FCHA 3B7RL 4WNDA 3O48A 4GMLA 2AXUA 3B13A 4JEUA 4LNGA 3QJZA 1LTXA 2LUHA 2R59A 3TWQA 4WUYA 3DSSA 2HYZA 2WMNA 4AY6A 2YNQA 4KXKB 4YDOA 5ANRA 1WM5A 2ETCA 5BNWA 3CVWA 4FJZA 5LFAA 4JW1A 4LCTA 1KZOA 4UQYA 3UINC 3UT4A 4Y6CA 1ELRA 4LRZA 4L23A 5HI7A 2XGOA 3B7UX 5D0OD 5KNHD 4M7CA 2OVFA 4PH4B 3D9OA 4URKA 3AS5A 5CHEE 3TXNA 4A55A 4LNUD 2P9NG 1XGWA 4H7XA 3TXMA 1SZAA 4JC8A 1WG0A 1E7VA 3HVEA 4L7TA 4XKCA 4J8DA 3FUNA 4LNBA 4CZ2D 1YMPA 2DYRE 2KXPC 1PC2A 4DK5A 5H7PA 1S0PA 5C2YA 3UI2A
chains in the Genus database with same CATH topology
2ZXWE 2OCCE 3AG4E 3AG2E 3X2QE 3AG3E 3ABLE 3ABME 3ABKE 3ASNE 3ASOE 1OCOE 1OCRE 2EIKE 5B1AE 2Y69E 5B3SE 2EINE 3WG7E 2EIJE 1OCZE 1V55E 5B1BE 1V54E 2EILE 2DYRE 5IY5E 3AG1E 2EIME 2DYSE 1OCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXW E;  2OCC E;  3AG4 E;  3AG2 E;  3X2Q E;  3AG3 E;  3ABL E;  3ABM E;  3ABK E;  3ASN E;  3ASO E;  1OCO E;  1OCR E;  2EIK E;  5B1A E;  2Y69 E;  5B3S E;  2EIN E;  3WG7 E;  2EIJ E;  1OCZ E;  1V55 E;  5B1B E;  1V54 E;  2EIL E;  2DYR E;  5IY5 E;  3AG1 E;  2EIM E;  2DYS E;  1OCC E; 
#chains in the Genus database with same CATH topology
 3CQG B;  1BI7 B;  2J4D A;  5HQ8 A;  4Z68 A;  3I5P A;  3OXG A;  1OCR E;  1BPO A;  4BSX A;  1Z3X A;  2KCL A;  4HOU A;  3C3O A;  2NSZ A;  4K5C A;  3Q9U C;  2WPV A;  3QB2 A;  4I1M A;  3CVV A;  2VSX E;  3E4B A;  3S7D A;  1JCR A;  4LER A;  3S2A A;  4DX6 D;  2VSO E;  3BUA A;  1E8Y A;  4U8V D;  1OWN A;  3FUL A;  2RG8 A;  4AOF A;  3FDH A;  1P5Q A;  1TYQ G;  5BUZ A;  3G2T A;  3SI5 A;  3Q78 A;  3CSF A;  3NOG D;  4HRM B;  4GZ3 A;  3ZW3 A;  3SHF A;  4CDM A;  4FLB A;  4GZ6 A;  1YA0 A;  2X6H A;  2XRZ A;  3SFZ A;  4HS2 A;  3TWU A;  1SA5 A;  2JAB A;  3U66 A;  4F1S A;  1MHQ A;  3FH5 A;  5HRY A;  5EN5 D;  3L17 A;  3PUK A;  1JWF A;  4TRQ A;  2GRL A;  3V2O A;  3B7T A;  4HOT A;  1KLX A;  3SZ7 A;  4JEH A;  3PNT B;  2ILR A;  1OT8 A;  3TWT A;  2WXF A;  1HH8 A;  5DIZ A;  3JQ1 A;  3WXX A;  3JUE A;  1SQM A;  1E8X A;  4ILG A;  4W9R A;  3FY4 A;  2R5S A;  5EX0 A;  2KCV A;  3APF A;  3CHP A;  3MJW A;  2IJG X;  3CHO A;  4G23 A;  1UW4 B;  4HI9 A;  4GB9 A;  2XGS A;  2ZU6 B;  3PNL B;  3RRU A;  3MKR A;  3TWS A;  4U63 A;  2P9U G;  3Q4A B;  2PM6 A;  3KSL A;  1N4S A;  1K1B A;  5ENT D;  2OVB A;  5CMY A;  4ACK A;  4KZ0 A;  4BT9 A;  1PAQ A;  4JA7 A;  4ACL A;  1KZP A;  1H6K A;  2HR2 A;  3I4G A;  4IRU A;  4XKB A;  4TV3 A;  1HZ4 A;  2IOS A;  1ZBP A;  4IN3 B;  5FIO A;  1H19 A;  3PZ3 A;  4OVU A;  3PE3 A;  4L2Y A;  3X2Q E;  2QYJ A;  1K3Z D;  5AIJ A;  4HVB A;  3ASN E;  3ZYM A;  1TEZ A;  4DX7 D;  4ANX A;  5BV1 A;  5EIL A;  2QC9 A;  4I43 A;  2R2L A;  3AAA C;  3OXL A;  1FT1 A;  3ONK A;  3V79 K;  4U96 D;  3SQV A;  2WXR A;  3T8M A;  1N4P A;  2LXM A;  5HKP A;  5KJN A;  1BU9 A;  2IQC A;  3P1U A;  3UMV A;  2X6I A;  2R17 C;  4U8Y D;  1JPL A;  3APC A;  2XHE A;  1SW6 A;  3DSV A;  3LCA A;  3CQC B;  3FTZ A;  3UPV A;  2A5E A;  4ILI A;  1TR4 A;  4DX5 D;  3LY8 A;  3RRM B;  5KJM A;  4F1P A;  5LOZ A;  1N9A A;  3AU4 A;  4KZC A;  1HE8 A;  3FU0 A;  2AXV A;  4G25 A;  4APO A;  5JJ7 A;  4YDY A;  1YCS B;  2WMO A;  2FEZ A;  3GZS A;  3EHQ A;  3JQ0 A;  4ABN A;  4OYS A;  3AS4 A;  5AYW D;  2XS8 A;  3VLF A;  1IQR A;  3U64 A;  4XE0 A;  2PQN A;  2XQ0 A;  3DBS A;  1IXV A;  2B0O E;  2E2E A;  2X38 A;  5B1B E;  3CK8 A;  3MZL B;  3FU3 A;  3MYV A;  5A23 A;  5G04 C;  1Q2Z A;  5G2N A;  1IYG A;  2XGM A;  5KBA A;  2AVP A;  5CBN A;  5LP0 A;  2GRP B;  2LAI A;  4U0S A;  2PQR A;  4UQZ A;  4DJA A;  1OCO E;  1QBQ A;  4JPS A;  3DXM G;  3ML9 A;  3RU0 A;  2NXP A;  3EHM A;  3D9N A;  3PRZ A;  3CK7 A;  3RAU A;  1TNB A;  5CER B;  3ASD A;  4B93 B;  2VYI A;  1JWG A;  3MGB A;  3FWV A;  2KAT A;  3ZHE B;  2L6J A;  4GA0 A;  4FHJ A;  4DUI A;  4EEC A;  3IBE A;  1TN6 A;  1N52 A;  5EX3 A;  1EF1 C;  3D9L A;  3JYS A;  4CGV A;  5BXO A;  4BSZ B;  4F3V A;  1H2V C;  3LY7 A;  2DWZ A;  2F8X K;  4G11 A;  1PY1 A;  3SY2 A;  5C1D A;  2X6K A;  5CED B;  3BG0 B;  1FPP A;  2AXZ A;  4L1B A;  2YHC A;  3BQO A;  3W9G A;  5E76 A;  1NA0 A;  2FI7 A;  4EPZ A;  1O5M A;  1KT0 A;  1OWP A;  3TWW A;  2WXN A;  1O1S A;  3FTV A;  1E8Z A;  1BD8 A;  5IY5 E;  1FVF A;  4I6J A;  4RG6 A;  3AS8 A;  3S7J A;  5JJ6 A;  2XZD G;  2XS1 A;  4Y6W A;  5G05 C;  4AP2 A;  5AN8 A;  3V31 A;  2OCC E;  4EHM A;  3FUK A;  2V5Q C;  3IEG A;  2LSV A;  4NIK A;  4YVO A;  2RD0 A;  3QC1 A;  4U8H A;  4B8C B;  4G2V A;  1BLX B;  3CVQ A;  4RG9 A;  4GZC A;  2J07 A;  3LVQ E;  4GTO A;  2KZT B;  4G24 A;  2P58 C;  4DI3 A;  3FEY A;  3ESK A;  5KJL A;  2RFM A;  3IKO B;  3ULQ A;  4NRH B;  5AAR A;  2QYU A;  4XZ4 A;  5ARF A;  3ESL A;  3MV2 B;  5D0Q D;  2WXG A;  3CKB A;  2VQ2 A;  3SNX A;  1QZ2 A;  4G8K A;  3ABM E;  5JHA A;  1JCS A;  4A63 B;  2H6G A;  4G1T A;  4FAD A;  1TNZ A;  5FIN A;  3L16 A;  2GRR B;  5FQ7 A;  2WM9 A;  3FH7 A;  3T5X A;  3DPD A;  2P9S G;  3JXJ A;  3ZIM A;  4E85 A;  4AV7 A;  4JZY A;  4KT6 B;  2ETB A;  5CBO A;  3QWW A;  4PDX A;  2KZT A;  3UXG A;  1N95 A;  1QYM A;  4XI0 A;  1V54 E;  4UQX A;  4GTR A;  3I3N A;  3MV3 B;  2VGX B;  3EDT B;  1TNY A;  2QZA A;  3QWV A;  4KVM A;  1MX4 A;  4FUL A;  2P9L G;  4BY6 A;  4RLY A;  2XEE A;  5FJY A;  4N5Q A;  3RKV A;  4BER A;  2F8Y A;  5EYL A;  4UWL A;  2Y4U A;  5T4Y A;  4DPR A;  3MKQ B;  2EIJ E;  2WXO A;  4IYP A;  1H2T C;  2I1J A;  3L82 A;  1L5J A;  3ZUV B;  3C98 A;  4I2Z A;  4KVO A;  3NZU A;  4K03 A;  2KCK A;  4UI9 C;  3JXI A;  3L08 A;  3B7S A;  4CYM D;  4LSZ E;  5FQ6 A;  4C0E A;  3UM3 A;  3FTW A;  2EIL E;  1FT2 A;  2WXH A;  3EU9 A;  4GPK A;  1LF8 A;  4V3I A;  1NL4 A;  1DCE A;  3ONL A;  5ENR D;  2VSY A;  4CDN A;  4KBQ A;  5E75 A;  1HG2 A;  4ILH B;  4RVB A;  2FBN A;  3T8K A;  3ULY A;  4PS7 A;  2NYJ A;  1K1A A;  2EIM E;  4CDR A;  4BT8 A;  3FFL A;  3MKQ A;  3DWL G;  4NQ0 A;  1MQS A;  2WQ7 A;  2DZO A;  3QNK A;  4CEM A;  3R9M A;  5EDS A;  4N2S A;  4PUC A;  2I1K A;  2IOL A;  3C5R A;  3Q5M A;  2FUL A;  1K8K G;  4AM9 A;  3D9M A;  4DRX E;  3FTX A;  4GTP A;  2Y69 E;  3UM2 A;  2ZGG A;  1AWC B;  3D9K A;  1HF8 A;  4Q94 A;  2FO7 A;  3EUV A;  1E8W A;  4OAU C;  2L0T B;  4MKT A;  2IEJ A;  4AJW A;  1TJC A;  4J8E A;  4MRU A;  3ZNG A;  1N0Q A;  4FC8 A;  4GZ5 A;  5FZR A;  5ENO D;  3GW4 A;  5FWQ A;  3U3W A;  2X3M A;  3UM1 A;  4GPM A;  2RKK A;  3HXF A;  4ANW A;  2HM8 A;  3G2V A;  2DYS E;  1DNP A;  2DZN A;  1NFI E;  2GGF A;  3PDN A;  4CRW A;  4BTA A;  1Y8M A;  1TJF A;  4A3V A;  2Q7F A;  4FP7 A;  3LPZ A;  2J9Q A;  3LDZ A;  2V4H C;  2XZT G;  4U04 A;  4GTV A;  4PS3 A;  4GMR A;  4BET A;  2I6H A;  3W9F A;  3V2X A;  1OCZ E;  3URZ A;  3LEW A;  3R7Q A;  5JA4 D;  5KNG A;  4ZHB A;  3RK6 A;  3NBN B;  4CCA A;  1D8D A;  2KC7 A;  1TN8 A;  2WXL A;  2WXI A;  3FP3 A;  2J49 A;  3CLJ A;  2PNN A;  3HDX A;  3HXC A;  4HLE A;  2XEV A;  3ASO E;  4KYO B;  4EQF A;  2WXQ A;  4AXH A;  3PUJ A;  2WVI A;  3FEX A;  3MX3 A;  5AQ7 A;  4U07 A;  4K5A B;  3QWP A;  2M63 A;  1D8E A;  5CRU A;  2GRO B;  4K5B A;  2OEW A;  4JHK A;  4EBA G;  2DCP A;  4N3A A;  3CVL A;  3D3M A;  5D66 A;  2CG2 A;  3T5V A;  2XCC A;  3CVP A;  3Q47 B;  4C48 B;  2FO1 E;  2BTD A;  2PL2 A;  3E33 A;  1H6O A;  4DX1 A;  3ABK E;  5ENQ D;  2IY0 C;  4N3B A;  1SA4 A;  2BKK B;  2OND A;  4BWR A;  2H6H A;  3OXF A;  3RSE G;  3N71 A;  3NF1 A;  3QAQ A;  3AG4 E;  4HNA D;  3SO8 A;  3AJI A;  5ITZ F;  3HIZ A;  3IV0 A;  5FT9 A;  4JB8 P;  1S70 B;  4I2W A;  1A17 A;  2XEH A;  3DRA A;  3KSQ A;  5KJK A;  3PS6 A;  3SBS A;  3CK9 A;  3UUX A;  1HS6 A;  1EDU A;  1KPS B;  3CVN A;  5B1A E;  3Q75 A;  4WAF A;  1N4Q A;  3UT8 A;  3GYZ A;  2E0I A;  2XRY A;  4WNG A;  4AY5 A;  4CT4 A;  1H0A A;  2A4Z A;  4FJY A;  1ELK A;  2XEN A;  3ZYL A;  3FUD A;  3ZFW A;  4O1O A;  2OV8 A;  3SGH A;  1DCQ A;  4WWP A;  1UJJ A;  3I4R B;  2Y1L E;  5A7D B;  3RO3 A;  3DEO A;  4DX2 A;  4M3O A;  4ANV A;  2YHE A;  3RJV A;  3ISM C;  1OXJ A;  1QQE A;  3AG3 E;  4KMO A;  2VTB B;  2WXM A;  3F6Q A;  4C0M A;  3S7F A;  2I2O A;  2UWJ G;  2UY1 B;  2MOW A;  2KBX A;  4F7A A;  2XPI A;  4WNE A;  4JHJ A;  4J8S A;  1U3D A;  5ARG A;  3RIB A;  2JLB A;  1NA3 A;  3HXE A;  2LAH A;  2MYO A;  1X5B A;  4ATZ D;  5EKQ D;  2L9B A;  2H6I A;  3NAW A;  4XI9 A;  5FZQ A;  4GCN A;  4YDE A;  1U2V G;  4BX9 A;  5M72 A;  1JCQ A;  4HQD A;  1A5E A;  3D9P A;  3EU5 A;  5CEC B;  4DLQ A;  4B94 A;  3CGH A;  2WB2 A;  1IKN D;  3LJN A;  1O1T A;  4EBA A;  2GW1 A;  4HLL A;  4A3T A;  3KD7 A;  2WXJ A;  3ZXS A;  4IUL A;  3OAW A;  4U0U A;  1V55 E;  4GCO A;  3GZ2 A;  2VTB A;  3CVX A;  3ASF A;  1WDY A;  2A5U A;  3CEQ A;  3ZHE A;  3IHV A;  4J8F A;  1N4R A;  4BEP A;  2GRQ B;  1UJK A;  5AQ9 A;  3DEP A;  3ASH A;  2AJA A;  2J08 A;  3ZPJ A;  1HX8 A;  5AJD A;  3HRA A;  4GZD A;  2V5F A;  3LYA A;  1GW6 A;  3FUI A;  4I1A A;  2WQ6 A;  2VGE A;  2BKG A;  3FUM A;  2R05 A;  3AG1 E;  2CFZ A;  1B89 A;  3BG1 B;  5CCL A;  2IF4 A;  3FUE A;  4JL0 A;  3E34 A;  4FA6 A;  3UIO C;  2ZIR A;  4MS6 A;  1H6P A;  2IFU A;  3LY9 A;  3TWR A;  4JA9 A;  2DIW A;  3RRN B;  4MLP A;  1HO8 A;  2J8S D;  3PZ1 A;  4O60 A;  3CHM A;  3CVU A;  3PEV B;  3RO2 A;  5CMW A;  1MX2 A;  5AQB A;  5HS0 A;  3ZGQ A;  4GYO A;  1OY3 D;  3G2U A;  1SVX A;  3Q15 A;  2F37 A;  3TL5 A;  4J7W A;  3DPY A;  4ATG A;  3TGO A;  2C0M A;  2L0I A;  3ZYK A;  4I6G A;  1MJ0 A;  2MRI A;  3LJ3 A;  2NC9 A;  1AP7 A;  1WY6 A;  2WXK A;  3LKU A;  2C2L A;  3HVE B;  4I1O B;  2B6C A;  4HFG A;  5AAO A;  1LD7 A;  3U9W A;  5FQ8 A;  4B89 A;  2OEV A;  4EZK A;  3WG7 E;  1OWM A;  3ZEF A;  4GTQ A;  3K9I A;  2QFC A;  3J5Q B;  4I17 A;  3SFY A;  2Y0B G;  4WWN A;  4LUN U;  5BV0 A;  4HI8 A;  3PRE A;  3SD5 A;  4NUR A;  2XPY A;  5FZS A;  1W3B A;  4K0R A;  1HFA A;  5ANL A;  5AEN A;  2H6F A;  4QQI A;  3MCX A;  1OCC E;  5CCM A;  1Z5S C;  1EPU A;  1KT1 A;  5JJT A;  4HOR A;  1Y6I A;  5FTP A;  3UM0 A;  1IHG A;  2VGX A;  4YDW A;  3S7B A;  5KCM A;  3CKC A;  2CHX A;  2AW6 A;  4J0U A;  1UN9 A;  4FHK A;  1HG5 A;  3LXU X;  4H7Y A;  3NQP A;  3CVY A;  3KEZ A;  2C0L A;  2P9K G;  2BED A;  5CEA A;  3DXK G;  3U4T A;  3CR3 A;  2FF4 A;  4AEZ C;  2P9P G;  4GYY A;  1ZB1 A;  4A1G A;  3L13 A;  4NAC A;  3NZS A;  4ME2 A;  2EIN E;  1FVH A;  3MA5 A;  3ZVV A;  2X6J A;  1Z3Y A;  3D9H A;  3UX4 A;  4TUU A;  2P2C P;  2ZXW E;  2OOE A;  4P29 A;  5JMN D;  3VLD A;  3TG4 A;  5EYP F;  3HXD A;  1TN7 A;  2YIN A;  1E7U A;  4AVX A;  2EIK E;  4UWG A;  4U7E B;  1OUV A;  3IXE A;  2WQH A;  4HB5 A;  5AQA A;  1NI1 A;  2WXP A;  3HYM B;  2LO6 A;  4LG6 A;  5T8I A;  3Q7F A;  1N54 A;  4HOQ A;  3ZKJ A;  4Q69 A;  4CGW A;  3OTN A;  3UQ3 A;  2J4B A;  5LCW J;  3FHE A;  2GRM A;  3ZRH A;  4GTM A;  2P9I G;  4B8A A;  3Q9N C;  1ELW A;  3MEK A;  3PEU B;  3UIP C;  3DSX A;  1DC2 A;  3B95 A;  3GZ1 A;  5ENP D;  5G04 J;  3TWX A;  3UTM A;  4GMJ A;  3SBT B;  1UG3 A;  3R9A B;  4GA1 A;  3E30 A;  1G3N B;  1OWL A;  5ENN A;  3JCK C;  1D9S A;  3UT7 A;  4FLH A;  4EZL A;  1E96 B;  4FU3 A;  1LD8 A;  2J09 A;  4U95 D;  3TG5 A;  4J8Y A;  1UN8 A;  3ASG A;  4YND A;  2ZIS A;  5EID A;  1OWO A;  3AU5 A;  3QOU A;  4C9B B;  3FTY A;  4N5C A;  3UKR G;  4TXQ A;  5DBK A;  1ZU2 A;  2VJ8 A;  3DSU A;  1TNO A;  2XPZ A;  4DI4 A;  2ZGD A;  4GTS A;  5LX8 A;  1Z6T A;  5G55 A;  4I9C A;  3KEA A;  3ZU7 B;  1RZ4 A;  3CV0 A;  4UI9 K;  2XCB A;  4HRL A;  4GYW A;  4B0Z A;  2ION A;  3ULE G;  3D9J A;  1MZC A;  5B3S E;  4JXT A;  4OVV A;  4BES A;  3TAX A;  1NZN A;  3CST A;  2QY7 A;  2CHZ A;  4HRN A;  4U0Z A;  5BT1 A;  3C3Q A;  2LNI A;  3BEE A;  5G05 J;  3G2W A;  4L9P A;  4UWF A;  3L22 A;  3SFX A;  4UWK A;  2ETA A;  4YVQ C;  3VTX A;  3SF4 A;  5EIB E;  2AWI A;  4XIF A;  4CT0 A;  5J08 A;  3Q73 A;  4N3C A;  3AG2 E;  4I6E A;  1SZ9 A;  4X8Q A;  3ENE A;  1VDY A;  1DVP A;  4GA2 A;  4J6I A;  3R7R A;  2HO1 A;  4WWO A;  1S63 A;  3PH0 C;  2EQX A;  4GTT A;  5LCW C;  4F6R D;  4QFV A;  4JHR A;  1X81 A;  4RSY A;  3P2B A;  3T9K A;  4RQI A;  4TXR A;  2DBA A;  2IO3 C;  1TNU A;  1WAO 1;  3CHQ A;  1N11 A;  5D2M C;  3KS2 A;  4BX8 A;  3FUH A;  2YQ8 A;  1QNF A;  2VSN A;  5CRV A;  3HXB A;  2R02 A;  4HOS A;  3PZ2 A;  3FTU A;  1INZ A;  3KAE A;  2CG3 A;  1HU3 A;  3C72 A;  3QDN A;  3APD A;  1N0R A;  1RW2 A;  3LS8 A;  4L2L A;  5BXU A;  3FUF A;  3NB2 A;  4N2Q A;  1MYO A;  2LXL A;  4OAV B;  4JD2 G;  2X6F A;  2IO2 C;  4HBD A;  2BF0 X;  3L9T A;  2HE0 A;  3VLE A;  2IU1 A;  4BTB A;  2CFU A;  4TUM A;  4PS8 A;  3TWV A;  1XNF A;  2V4L A;  4E6H A;  4ANU A;  4G26 A;  4D10 C;  4GAA A;  5JHB A;  4JVS A;  4O6F A;  3IHY A;  4BFR A;  4MBG A;  3Q79 A;  4G8L A;  1N94 A;  3ZXP A;  5T3R A;  5KWD A;  2PM7 A;  2I9C A;  3FU6 A;  2F0Y A;  3E37 A;  1HXI A;  4UI9 J;  1EYH A;  2DVW A;  5FQ4 A;  2MHK A;  3TJP A;  2VGY A;  2R03 A;  2JEK A;  3L54 A;  4WNF A;  3CHS A;  4DLO A;  5J90 A;  3Q49 B;  3DSW A;  3EHR A;  2BUG A;  3C3R A;  3HG0 D;  2UY1 A;  2GRN B;  2V8S E;  4F53 A;  2RFA A;  3E32 A;  3UKU G;  3NOC D;  5ENS D;  4HXI A;  4R7L A;  1E90 A;  2CHW A;  2Y4T A;  3L6A A;  3ML8 A;  3FTS A;  3PE4 A;  3BU8 A;  2KM4 A;  4UUC A;  1H2U A;  3QK0 A;  4GU5 A;  3PZD A;  5AJL A;  3QKY A;  5BW8 C;  3EIQ C;  1U3C A;  4A1S A;  3J5P A;  4UWH A;  3QAR A;  5BPP A;  1MX6 A;  3G2S A;  3B7B A;  2V0P A;  1YYH A;  3EJN A;  3ABL E;  3D9I A;  1UOH A;  3PVL A;  3EHN A;  4O1P A;  1IQU A;  4I9E A;  4ZFH A;  3FU5 A;  4Q96 A;  2LSU A;  3FUJ A;  1JUQ A;  3O4Z A;  1BI8 B;  3EIJ A;  3PZ4 A;  3ZN3 A;  3CHR A;  3CIA A;  4LEU A;  4XEI G;  3JUI A;  1O1R A;  2PZI A;  3V30 A;  4AIF A;  4XX5 A;  4TXP A;  1IHB A;  3FH8 A;  3LVR E;  3DST A;  3VTY A;  3ZYQ A;  3HHM A;  2Y3A A;  5A6C A;  4APF A;  1NP7 A;  1S64 A;  4N39 A;  2L6B A;  3Q7A A;  4EZJ A;  1FCH A;  3B7R L;  4WND A;  3O48 A;  4GML A;  2AXU A;  3B13 A;  4JEU A;  4LNG A;  3QJZ A;  1LTX A;  2LUH A;  2R59 A;  3TWQ A;  4WUY A;  3DSS A;  2HYZ A;  2WMN A;  4AY6 A;  2YNQ A;  4KXK B;  4YDO A;  5ANR A;  1WM5 A;  2ETC A;  5BNW A;  3CVW A;  4FJZ A;  5LFA A;  4JW1 A;  4LCT A;  1KZO A;  4UQY A;  3UIN C;  3UT4 A;  4Y6C A;  1ELR A;  4LRZ A;  4L23 A;  5HI7 A;  2XGO A;  3B7U X;  5D0O D;  5KNH D;  4M7C A;  2OVF A;  4PH4 B;  3D9O A;  4URK A;  3AS5 A;  5CHE E;  3TXN A;  4A55 A;  4LNU D;  2P9N G;  1XGW A;  4H7X A;  3TXM A;  1SZA A;  4JC8 A;  1WG0 A;  1E7V A;  3HVE A;  4L7T A;  4XKC A;  4J8D A;  3FUN A;  4LNB A;  4CZ2 D;  1YMP A;  2DYR E;  2KXP C;  1PC2 A;  4DK5 A;  5H7P A;  1S0P A;  5C2Y A;  3UI2 A; 
#chains in the Genus database with same CATH homology
 2ZXW E;  2OCC E;  3AG4 E;  3AG2 E;  3X2Q E;  3AG3 E;  3ABL E;  3ABM E;  3ABK E;  3ASN E;  3ASO E;  1OCO E;  1OCR E;  2EIK E;  5B1A E;  2Y69 E;  5B3S E;  2EIN E;  3WG7 E;  2EIJ E;  1OCZ E;  1V55 E;  5B1B E;  1V54 E;  2EIL E;  2DYR E;  5IY5 E;  3AG1 E;  2EIM E;  2DYS E;  1OCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...