4XI0A

Mama 41-end from desulfovibrio magneticus rs-1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
177
structure length
177
Chain Sequence
b'AMGDKAKLYRNISQRCLRRGSPEEALRYLKEWARHEKNDPEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTAAEHFTKVMELERSQDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnetosome protein MamA
publication title MamA as a Model Protein for Structure-Based Insight into the Evolutionary Origins of Magnetotactic Bacteria.
pubmed doi rcsb
source organism Desulfovibrio magneticus rs-1
molecule tags Protein binding
total genus 71
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi0A00
3QWPA 3ULQA 1OUVA 4I1AA 3CKBA 3QWWA 4YVQC 2Y4UA 4UQZA 3AS8A 4HOTA 2JLBA 3QOUA 2XCBA 3VTYA 5A7DB 3TG4A 5JJ6A 3KS2A 4W9RA 2C2LA 1KT1A 4NQ0A 5AYWD 3O48A 4G23A 4XIFA 4U07A 1W3BA 2KC7A 4I9EA 2HO1A 4G1TA 3Q5MA 2PZIA 3GYZA 1KLXA 2IF4A 1HXIA 4HOUA 2UY1B 4GCOA 4U0SA 3LPZA 3ZPJA 1HZ4A 2WQHA 3E4BA 4UI9C 5CHEE 3FWVA 4U0ZA 5LCWC 4EQFA 4AM9A 3ASGA 1ELRA 4GA0A 5G04J 3AS5A 3R9AB 1B89A 2FF4A 1E96B 3UUXA 2Q7FA 3MEKA 4I17A 4BT8A 2QFCA 4HOQA 5HQ8A 3Q49B 4J8FA 5FT9A 2XGMA 4JL0A 5KJMA 4F3VA 4G24A 4BT9A 3S7FA 3MA5A 4N3CA 2PL2A 4I9CA 4UI9K 3K9IA 2PQRA 3SZ7A 3CVQA 3LY9A 3TG5A 4N2SA 2HYZA 3MV2B 4IN3B 2XCCA 3JYSA 4J8EA 4CGWA 2VSNA 2XPIA 5JJ7A 5FTPA 2VGXB 1NA0A 4O6FA 3LKUA 2C0LA 3U4TA 2FI7A 3PDNA 2KCLA 5M72A 2E2EA 4CGVA 3ZHEA 4B94A 2P58C 4AIFA 2AVPA 4G2VA 4LEUA 1IHGA 1TJCA 3CK9A 4JA7A 2VGYA 3EDTB 4J0UA 4UI9J 4GZ6A 2NC9A 5CCLA 4BWRA 5LCWJ 1IYGA 2FBNA 4GYYA 3OXFA 3ZFWA 5CCMA 1NA3A 3VTXA 3PE3A 2UWJG 5KJNA 5FZRA 2I6HA 3GW4A 3UQ3A 5D0QD 3CV0A 1HH8A 1FCHA 3Q4AB 2LNIA 2YQ8A 2PQNA 4GA1A 3GZ1A 3ASDA 2WPVA 3U3WA 1KT0A 2KCVA 3Q47B 5FZSA 3RJVA 4A1SA 3RU0A 2V5FA 3IEGA 4UQXA 3QKYA 2VSYA 3PE4A 3OXLA 5EX3A 4KXKB 3RKVA 2XGSA 4Y6WA 3LY8A 3CVNA 3RO2A 4ABNA 5KJKA 3RO3A 3QWVA 4GZ3A 4XI9A 3ZGQA 4N3AA 3BEEA 1ELWA 3S7DA 4APOA 2OOEA 3FP3A 3S7BA 5DIZA 2MHKA 4AY6A 3QDNA 1WAO1 3MKRA 3CK8A 3GZ2A 5G05C 5JJTA 1WM5A 4WNGA 2XEVA 5KJLA 5HI7A 5BNWA 2VQ2A 2BUGA 5BT1A 5EKQD 5D0OD 4BTBA 3NF1A 2C0MA 1A17A 4H7YA 4I2ZA 4YVOA 5ARGA 3RIBA 4AY5A 4WNDA 2Y4TA 3MV3B 3CKCA 3ASHA 4GYWA 2R5SA 2L6JA 1QZ2A 1YA0A 4GYOA 4GA2A 4KYOB 4N2QA 2GW1A 4Y6CA 4BTAA 4J8DA 4KBQA 3WXXA 4WNEA 1QQEA 4GPKA 4U04A 4HORA 4RG6A 2YHCA 3LYAA 5C1DA 4WNFA 2DBAA 5ARFA 2VYIA 3AS4A 4N5CA 4HOSA 4CDRA 4GZ5A 4YNDA 3UPVA 2KCKA 1PC2A 3Q15A 2HR2A 2IFUA 3CEQA 4XI0A 2VGXA 2ONDA 4WUYA 3FFLA 3CVLA 4RG9A 4G26A 3KAEA 5BW8C 3CVPA 3HYMB 2LSVA 3KD7A 2KATA 3N71A 3ZHEB 4N39A 1Y8MA 1ZBPA 1NZNA 5G04C 5FJYA 4UQYA 2J9QA 4U0UA 2FO7A 4JHRA 5FZQA 3SF4A 3LY7A 5G05J 2UY1A 2FEZA 3S7JA 1XNFA 3ESKA 3ASFA 3CK7A 3TGOA 4G25A 2LSUA 1ZU2A 4H7XA 4ME2A 3TAXA 5DBKA 2XGOA 5EX0A 4N3BA 4GCNA 5A6CA 3OXGA 3URZA 4JA9A 3LCAA 4I2WA 4NRHB 3ZN3A 1P5QA
chains in the Genus database with same CATH superfamily
1OUVA 3ZYKA 5HS0A 4ILGA 1SZAA 1IKND 3DSVA 5G2NA 5FQ7A 2XCBA 3VTYA 2CG3A 3D9KA 1JPLA 3L54A 3TG4A 3PH0C 2C2LA 5AYWD 4G23A 1E8YA 5BV0A 1N54A 4I9EA 2H6HA 3PZDA 2XZDG 1S0PA 3WG7E 1KLXA 5E75A 3I4RB 1E8XA 3PZ4A 1OWPA 3CSFA 3TWWA 4BERA 3PRZA 5CERB 3LPZA 3FTUA 4GMLA 3L16A 4MBGA 3TWSA 1HU3A 4UWGA 3UM3A 3FWVA 3R9MA 2XS8A 4AM9A 3ASGA 2B6CA 3UINC 1OWMA 3FULA 2VTBB 5G04J 5G55A 3HXEA 4C9BB 3CHOA 3R9AB 4UWFA 3X2QE 3UT4A 2WB2A 3JUEA 2VSXE 3UUXA 2Q7FA 4ATGA 1N11A 3APFA 1LD7A 4JXTA 3B7SA 3AG1E 2R17C 3MJWA 1JCRA 3SHFA 4B93B 2HM8A 2IQCA 3ABME 3S7FA 1SA5A 4N3CA 4GMJA 3C72A 3IXEA 3ZW3A 1BI8B 2P2CP 1H6OA 2JEKA 4A1GA 2YINA 3QARA 2J4DA 3TG5A 1DCEA 3ZYLA 3ZKJA 5KCMA 2MYOA 1Z3XA 4ACKA 2V5QC 4IN3B 4J8EA 4Z68A 4TUMA 2MOWA 2C0LA 4LNBA 2FI7A 1TR4A 4HLLA 3ZIMA 2E2EA 2EILE 4JZYA 2GRPB 3DEOA 4UWHA 1HG2A 5JHAA 4LNGA 1Y6IA 4LEUA 1IHGA 4JA7A 2VGYA 3C98A 4J0UA 4GZ6A 2WXQA 3BUAA 5EYLA 3G2WA 2ETAA 4U63A 3PE3A 2UWJG 2WVIA 4CYMD 3UQ3A 1AWCB 2PQNA 4JHKA 4DUIA 1KPSB 3MGBA 2WXJA 4CDMA 4GMRA 2P9NG 4PDXA 1FVHA 1INZA 4K5CA 4MS6A 4MLPA 4U7EB 3RJVA 2WXHA 4U96D 3JQ1A 4CDNA 2L6BA 4B8CB 4CT0A 1TNBA 2IEJA 3RKVA 4Y6WA 4GZCA 2WXLA 3LVRE 2NSZA 3JXIA 3DXKG 2CFZA 3MKQA 4AV7A 4GZ3A 4XI9A 3HRAA 3G2TA 2OOEA 4GTQA 3S7BA 5DIZA 3EHNA 4A63B 3APCA 2MHKA 4LG6A 1RZ4A 2ZGDA 3QDNA 4C0MA 3MKRA 3GZ2A 1AP7A 4EPZA 3QB2A 5KJLA 4GTRA 4O1OA 1GW6A 5HKPA 4BTBA 1A17A 4H7YA 4I2ZA 5CRVA 5ARGA 3RIBA 4GB9A 4ILIA 1E8WA 4AY5A 4WNDA 2WQ7A 3CVVA 2WXGA 2XEEA 4GYWA 2XEHA 3T8KA 3V2XA 1N4SA 4DI3A 4YDWA 4EZJA 4LUNU 3ENEA 4DI4A 3CHQA 4KBQA 3FTVA 3HIZA 3ULEG 2RG8A 4JPSA 5B1BE 3TWUA 4ZHBA 3E33A 1ELKA 5AQAA 3IV0A 3IKOB 3SQVA 2PM6A 1LTXA 4ATZD 2V4LA 2AW6A 3AS4A 5LFAA 2X6IA 1DCQA 4TXPA 1OXJA 4L7TA 2IFUA 2ZU6B 4QFVA 2VGXA 2QZAA 4B89A 4RG9A 4PS8A 2L0TB 3KAEA 3CVPA 3C5RA 3KD7A 3DSXA 2I2OA 2KATA 3NAWA 3ZHEB 5AQBA 1BPOA 1ZBPA 1NZNA 4X8QA 1Z5SC 4UQYA 1KZOA 2J9QA 4L2YA 5FZQA 3LJNA 2UY1A 2FEZA 2IO2C 4HRLA 4PUCA 3ESLA 1N94A 3C3OA 2Y3AA 2R05A 3CK7A 3TGOA 5EIBE 4IRUA 1UOHA 1D9SA 4RVBA 4U95D 4Q96A 4CRWA 1ZU2A 4H7XA 3TAXA 3B95A 2LO6A 3DBSA 3SFZA 1HG5A 5AJLA 1V54E 3MX3A 5BXUA 4BETA 4JD2G 4WWPA 4NRHB 1OCCE 4I1AA 3JXJA 3CKBA 2Y69E 4NACA 2Y4UA 3AS8A 3W9GA 3DSSA 2J08A 2F8XK 2GRNB 2P9SG 4XX5A 2ZIRA 1FPPA 5JJ6A 2WXMA 3TWXA 1BD8A 2AXUA 2XPYA 4HRMB 3UM2A 4U07A 3FH8A 5JHBA 4G1TA 2BTDA 4I1OB 2IF4A 4GPMA 1TNZA 1S70B 4QQIA 4RLYA 3QC1A 1QNFA 4HOUA 2UY1B 3FUHA 2EINE 3ZU7B 4HRNA 4JVSA 1BLXB 5LX8A 2WQHA 4UI9C 3SBSA 4EQFA 1N4RA 3D9HA 4JEHA 3PEUB 1UN9A 1H2VC 2MRIA 2GRQB 3TWQA 1E96B 3B13A 1JUQA 3T5XA 5D2MC 4I17A 3SI5A 5HQ8A 2PM7A 1SQMA 4XZ4A 2QYJA 2XGMA 3Q78A 1H6KA 4ILHB 1OCRE 4L1BA 1YMPA 4BEPA 1E90A 5AARA 2R59A 3UM0A 2PL2A 5CEAA 4I9CA 3Q73A 5AN8A 3G2UA 5EDSA 3DXMG 2OV8A 2Y1LE 4BFRA 1H19A 1UJJA 4N2SA 4GAAA 2J07A 3MV2B 2JABA 1EPUA 3FU3A 3FU0A 4CGWA 2XPIA 2XPZA 5FTPA 4AVXA 4LERA 2IU1A 3TWVA 1Z6TA 1LD8A 5EN5D 3IHYA 4GZDA 1IQUA 4B94A 2P58C 3UIPC 3CHPA 2X3MA 5ENPD 2B0OE 2RKKA 3EDTB 4N5QA 4UI9J 2AWIA 2P9IG 4BWRA 1U3CA 1JWGA 2FBNA 2QC9A 2CFUA 3OXFA 3ZFWA 3FEYA 3T8MA 2CHXA 1EYHA 5FIOA 5FZRA 3R7QA 3ZRHA 3CVYA 4F1SA 5D0QD 1FCHA 3KSLA 2LNIA 1DNPA 2YQ8A 2OCCE 3GZ1A 4GA1A 2WPVA 3FU5A 3AG3E 4PH4B 3O4ZA 5AJDA 3U3WA 2KCVA 3VLFA 4GTPA 5FZSA 5KWDA 3PZ3A 5ITZF 4F7AA 3Q75A 4R7LA 3SFXA 2DYRE 2V5FA 3IEGA 4UQXA 3ZYMA 1TYQG 3ULYA 3I4GA 2CG2A 2WXOA 2WXKA 2IOSA 3PE4A 5EX3A 4U8VD 1TJFA 3DSWA 5T3RA 4M3OA 5AQ9A 3LY8A 3RO2A 3CQGB 3RO3A 4KT6B 4BESA 3AG4E 3ZGQA 3BEEA 3FU6A 1ELWA 3B7UX 3S7DA 3FP3A 2R2LA 2J8SD 4AY6A 3VLDA 5JJTA 2DZOA 4WNGA 2XHEA 4URKA 3EIJA 4F6RD 3ZVVA 5EKQD 2C0MA 3SFYA 2L9BA 4E85A 2ILRA 4DK5A 4I6EA 3NB2A 4HLEA 3ASHA 1MJ0A 1YA0A 4C48B 4J8YA 4GA2A 4KYOB 3G2SA 1JCQA 4J8DA 4JB8P 5KBAA 1QQEA 2KM4A 5FQ4A 4WWOA 4JW1A 4RG6A 2YHCA 3Q79A 5C1DA 1E7UA 3EHMA 2KXPC 4WNFA 2DBAA 3HXBA 2VJ8A 3D9NA 4GTSA 4N5CA 4HOSA 3HXDA 4CDRA 3D3MA 3FUMA 2WMOA 2I9CA 2WMNA 1OCOE 3LVQE 2NXPA 5FWQA 4JEUA 1NFIE 3CEQA 4MRUA 1SVXA 3BQOA 3E32A 4BY6A 4DJAA 3AAAC 4L9PA 2EQXA 3ZXPA 4DX7D 4JC8A 1S64A 4KZCA 2WQ6A 4CEMA 4O1PA 4N39A 1IQRA 4UWLA 3BU8A 3FUJA 4GTVA 1O1SA 3PNLB 4JHRA 2YHEA 3SF4A 4OVVA 2WXNA 4I6GA 3PNTB 3ZUVB 2BKGA 4A3TA 3CIAA 3EJNA 3QNKA 3FTXA 4G25A 2LSUA 1MX2A 2AXVA 2J09A 3D9OA 3SBTB 4K03A 4B0ZA 2XGOA 2OEWA 1QYMA 1IHBA 5EX0A 5A6CA 3URZA 1TN7A 1K1BA 3PZ2A 3NOGD 2BEDA 5ENSD 4PS7A 4JA9A 3LCAA 2Y0BG 2QY7A 2WXRA 4L2LA 3NZUA 3QWPA 3ULQA 3PUKA 4Q69A 4HS2A 5AIJA 3QWWA 3NOCD 5J08A 4FLBA 3FHEA 2X6HA 4A55A 1SA4A 4HOTA 1N52A 2XQ0A 4LRZA 3AG2E 2JLBA 3J5QB 4FJZA 3IBEA 3EHQA 1YYHA 3KS2A 3UM1A 2XENA 4XIFA 3APDA 1OWLA 2V0PA 3ZXSA 3LEWA 2HO1A 3Q5MA 3FDHA 2PZIA 4XEIG 2J4BA 3GYZA 2L0IA 1HXIA 3MKQB 3DRAA 4AXHA 1HFAA 3ASNE 3KEAA 3DEPA 1TNYA 3ABLE 3ZPJA 4K5AB 1MX6A 1HZ4A 3E4BA 4KVOA 5CHEE 4AJWA 4EECA 4A3VA 4FADA 4U0ZA 1BI7B 3NQPA 3ZNGA 4GA0A 3CVWA 3AS5A 1UG3A 1O5MA 3ONLA 3ML8A 4HB5A 3RSEG 3HVEA 3UXGA 3MEKA 1A5EA 5C2YA 3FUNA 3FTZA 4J8FA 1YCSB 5FT9A 4JL0A 1K3ZD 2RFMA 2WXIA 1O1RA 4G24A 4BT9A 3L6AA 3MA5A 5FQ6A 4APFA 2XRYA 4CT4A 4L23A 5ANLA 3QK0A 3TWRA 3K9IA 4Q94A 5CECB 2M63A 1NI1A 3HXFA 3CVQA 3B7RL 3LY9A 4PS3A 5B1AE 2GRRB 2XCCA 3JYSA 1BU9A 1DC2A 2VGXB 3C3RA 5FINA 3PDNA 5M72A 4FLHA 3PS6A 3DSTA 2H6IA 4AIFA 1N0RA 4GTMA 3PUJA 3E30A 3HVEB 3CK9A 5HRYA 1MYOA 2NC9A 2WXPA 2EIME 2GRLA 1JWFA 4I1MA 1JCSA 4GYYA 4LSZE 3FH5A 2IO3C 5CCMA 3HXCA 5KJNA 3CHMA 4DLOA 3Q7FA 2I6HA 4HBDA 4HFGA 4BX8A 3QJZA 4F53A 1H0AA 3U66A 4HQDA 5CRUA 1QBQA 1WDYA 5CBOA 1L5JA 4YDYA 4P29A 3Q9NC 1DVPA 1H2UA 4A1SA 4DRXE 3RU0A 1NP7A 1HF8A 2HE0A 3QKYA 3L22A 2VSYA 2LXLA 3OXLA 4KXKB 1OY3D 3U9WA 2XGSA 3F6QA 2KBXA 3CHRA 5T4YA 3NBNB 3ISMC 2VSOE 3W9FA 4ABNA 3QWVA 3UMVA 5CBNA 3HDXA 4G8LA 4N3AA 3G2VA 3PZ1A 3R7RA 1TNOA 3RAUA 4HXIA 3MZLB 1VDYA 3ML9A 4LCTA 2BKKB 2OVFA 5ENOD 4YDOA 3CK8A 5G05C 2IONA 2XEVA 2VTBA 2VQ2A 2BUGA 3SNXA 4EZKA 5BT1A 5D0OD 2QYUA 3L13A 4I43A 2LXMA 2Y4TA 3MV3B 3CKCA 5J90A 4RSYA 2L6JA 3D9IA 1O1TA 3FUDA 1QZ2A 2A4ZA 4HI9A 1SZ9A 4Y6CA 4V3IA 4WNEA 5ENNA 3CVUA 3TJPA 4TXQA 5ENRD 5ENTD 1U2VG 1MHQA 4LNUD 3LYAA 3J5PA 4GTTA 1OCZE 4ZFHA 2DIWA 2DWZA 3L82A 3T9KA 4E6HA 3KEZA 1N0QA 4M7CA 2E0IA 1HE8A 2KCKA 3FUKA 3ZYQA 3FEXA 3EU9A 3Q15A 3JCKC 4KMOA 4DPRA 5T8IA 2RFAA 1OT8A 4WUYA 3E37A 3CVLA 3LJ3A 4EZLA 2P9UG 4G26A 5A23A 5BXOA 2I1JA 1MZCA 3AU5A 2LSVA 3CQCB 2P9KG 1U3DA 1V55E 3PREA 1HO8A 3UT8A 3TXNA 1D8EA 3FUEA 3L9TA 1Y8MA 3GZSA 2AJAA 4U0UA 2FO7A 5G05J 2F0YA 3ZEFA 3AU4A 3HHMA 4TXRA 4NURA 1PY1A 5LOZA 5EIDA 3IHVA 3ESKA 3PVLA 4K5BA 3ASFA 4G8KA 4KZ0A 4HNAD 4D10C 2VGEA 3TXMA 4XKCA 4ME2A 5DBKA 3UI2A 3U64A 3B7BA 3OXGA 2LUHA 3S2AA 2ETBA 5ENQD 4XE0A 3PEVB 4U8YD 1P5QA 3MCXA 1N4PA 4BSXA 4YVQC 1UJKA 4DX5D 2DZNA 1FT2A 4UQZA 1UN8A 1WY6A 3DSUA 1H6PA 2CHZA 2FO1E 3QOUA 1PAQA 3RRUA 5A7DB 2ETCA 2OVBA 2R03A 4W9RA 2IOLA 1KT1A 3OTNA 4NQ0A 3O48A 3EIQC 4IYPA 3FUIA 1X5BA 4RQIA 1W3BA 3E34A 2KC7A 3JQ0A 2EIJE 3SO8A 4KVMA 4ACLA 4EBAG 3DWLG 4GCOA 3MYVA 2J49A 4DX1A 4I6JA 3V31A 4U0SA 1TEZA 2NYJA 2DVWA 3SY2A 5LCWC 3EHRA 5ANRA 1ELRA 5BV1A 4JHJA 3CHSA 3P1UA 3RK6A 4CZ2D 1B89A 2FF4A 3I3NA 3NZSA 2BF0X 2RD0A 1E7VA 5BUZA 1H2TC 5IY5E 4BT8A 3ONKA 4ANWA 2QFCA 4HOQA 1TN8A 3Q49B 3LXUX 4G11A 5KJMA 2A5UA 4F3VA 1RW2A 2XRZA 2WXFA 2ZISA 4OYSA 1D8DA 4TUUA 3C3QA 1Z3YA 1N95A 4UI9K 4TRQA 3D9JA 2X38A 1NL4A 2DCPA 5BPPA 2F37A 2PQRA 3SZ7A 3Q9UC 4C0EA 3ABKE 1FVFA 2HYZA 4U8HA 2XS1A 2VSNA 3BG0B 5JJ7A 1NA0A 3FTYA 4O6FA 3TWTA 3LKUA 1SW6A 4DX6D 3U4TA 2OEVA 4FHKA 2KCLA 2R02A 2F8YA 4OAVB 4CGVA 3ZHEA 1K8KG 5AAOA 3P2BA 2AVPA 4G2VA 4IULA 5AENA 3L17A 5FQ8A 1TJCA 4DLQA 4FP7A 2V4HC 3L08A 3D9PA 3FTSA 2H6GA 5CCLA 3UIOC 5LCWJ 1IYGA 3FTWA 1S63A 1OWNA 4HI8A 1G3NB 2FULA 4AEZC 4TV3A 3RRMB 1NA3A 5AQ7A 4WWNA 3VTXA 1HS6A 4FHJA 3KSQA 5CEDB 3GW4A 3UTMA 1MQSA 3SD5A 3CV0A 1HH8A 3FUFA 3Q4AB 5EILA 2CHWA 2GROB 3LS8A 4K0RA 4FA6A 2P9LG 3ASDA 1EDUA 1N4QA 4YDEA 3DPDA 2AXZA 1KT0A 2KZTA 3Q47B 5KNHD 2ZGGA 2LAIA 5H7PA 2IJGX 3JUIA 3V2OA 1KZPA 1MX4A 2IY0C 3ASOE 4FC8A 1XGWA 5EYPF 3AJIA 4NIKA 4CCAA 3HG0D 5LP0A 3UKUG 3CVNA 5CMWA 5KJKA 2V8SE 2PNNA 4O60A 3V30A 4APOA 1X81A 4HVBA 1WAO1 4ANVA 3QAQA 1OWOA 4DX2A 4AOFA 1WM5A 1K1AA 3FY4A 5HI7A 5BNWA 2ZXWE 3NF1A 4FU3A 2DYSE 4YVOA 3OAWA 3D9MA 2KZTB 4J7WA 2H6FA 3CLJA 4FJYA 1E8ZA 2R5SA 1TNUA 5E76A 4GYOA 4N2QA 5D66A 2GW1A 3V79K 4BTAA 3EUVA 3WXXA 5B3SE 3VLEA 4GPKA 1ZB1A 3SGHA 3FH7A 5JA4D 4MKTA 4U04A 3TL5A 4EHMA 4HORA 3B7TA 2A5EA 1WG0A 3I5PA 4OVUA 3LDZA 2X6FA 4FULA 2LAHA 5ARFA 2VYIA 5KNGA 2GRMA 3D9LA 1EF1C 2WM9A 1UW4B 4GZ5A 2GGFA 4YNDA 3UPVA 1PC2A 2P9PG 3BG1B 2HR2A 3CGHA 4XI0A 4F1PA 4BSZB 2ONDA 3FFLA 3UX4A 1TN6A 2EIKE 4UUCA 3UT7A 5BW8C 1LF8A 4XKBA 4AP2A 2XZTG 4WAFA 3HYMB 4OAUC 3N71A 3CVXA 1FT1A 5G04C 4EBAA 5FJYA 2YNQA 3DPYA 2X6JA 3RRNB 1HX8A 3Q7AA 3LY7A 1IXVA 4B8AA 4ANUA 3CSTA 3S7JA 1XNFA 1N9AA 3CR3A 5CMYA 1Q2ZA 4N3BA 4GCNA 3T5VA 4UWKA 4GTOA 4BX9A 3UKRG 3EU5A 2X6KA 4I2WA 4J8SA 2I1KA 4GU5A 4J6IA 4ANXA 3ZN3A 5JMND
chains in the Genus database with same CATH topology
3MCXA 3QWPA 3ULQA 1OUVA 3ZYKA 3PUKA 4I1AA 4Q69A 4HS2A 3CKBA 4BSXA 5AIJA 4ILGA 3QWWA 1SZAA 4YVQC 5J08A 1UJKA 4NACA 5G2NA 4FLBA 3FHEA 2Y4UA 2X6HA 4A55A 4UQZA 3AS8A 1UN8A 1WY6A 5FQ7A 4HOTA 2J08A 1N52A 2XQ0A 4LRZA 2CHZA 2JLBA 3QOUA 2XCBA 1PAQA 4FJZA 3IBEA 3VTYA 2CG3A 4XX5A 3D9KA 3RRUA 1JPLA 3L54A 5A7DB 3TG4A 2OVBA 3PH0C 2WXMA 3KS2A 4W9RA 5JJ6A 2IOLA 2C2LA 1KT1A 3OTNA 4NQ0A 5AYWD 3O48A 4G23A 4XIFA 3EIQC 2AXUA 4IYPA 2XPYA 1X5BA 3FUIA 3APDA 4U07A 1E8YA 1OWLA 3FH8A 1W3BA 2V0PA 5BV0A 3ZXSA 1N54A 3LEWA 2KC7A 5JHBA 4I9EA 2HO1A 4G1TA 3JQ0A 3PZDA 3Q5MA 3FDHA 2PZIA 1S0PA 2BTDA 4I1OB 2J4BA 4KVMA 3GYZA 1KLXA 5E75A 2IF4A 3I4RB 2L0IA 3QC1A 1E8XA 1HXIA 4ACLA 4EBAG 1OWPA 1QNFA 3MKQB 4HOUA 2UY1B 4GCOA 3MYVA 3CSFA 4AXHA 3FUHA 2J49A 3PRZA 1HFAA 4I6JA 4U0SA 3LPZA 4JVSA 3FTUA 3ZPJA 1TEZA 4GMLA 3L16A 1HZ4A 1HU3A 5LX8A 2WQHA 3E4BA 4KVOA 4UI9C 4UWGA 5CHEE 4AJWA 3FWVA 4EECA 4A3VA 3SBSA 4U0ZA 4FADA 5LCWC 4EQFA 4AM9A 3ASGA 3NQPA 4JEHA 3PEUB 1ELRA 5ANRA 1OWMA 3FULA 2VTBB 5BV1A 1UN9A 4GA0A 3CVWA 4JHJA 3CHSA 5G04J 3AS5A 1H2VC 3P1UA 3RK6A 5G55A 4C9BB 1UG3A 3CHOA 3R9AB 1B89A 3ONLA 2MRIA 3ML8A 2FF4A 4UWFA 3UT4A 2WB2A 3I3NA 1E96B 2VSXE 3NZSA 3UUXA 2BF0X 2RD0A 1E7VA 5BUZA 3B13A 2Q7FA 3HVEA 4ATGA 1H2TC 1JUQA 3T5XA 3MEKA 4I17A 4BT8A 3ONKA 4ANWA 3SI5A 2QFCA 4HOQA 3APFA 5HQ8A 2PM7A 5C2YA 3Q49B 3FUNA 4JXTA 3B7SA 2R17C 3FTZA 3MJWA 4J8FA 1SQMA 4XZ4A 3SHFA 3LXUX 2HM8A 2IQCA 4G11A 5FT9A 2XGMA 4JL0A 5KJMA 2WXIA 2A5UA 4F3VA 1H6KA 4ILHB 4L1BA 4G24A 4BT9A 2XRZA 1E90A 2WXFA 2R59A 3S7FA 3L6AA 3MA5A 4OYSA 5FQ6A 4APFA 2XRYA 4CT4A 4TUUA 4N3CA 4L23A 4GMJA 2PL2A 5ANLA 1Z3YA 3QK0A 3ZW3A 4I9CA 2JEKA 4UI9K 3K9IA 4TRQA 3D9JA 4Q94A 4A1GA 2X38A 3G2UA 5EDSA 2DCPA 5BPPA 2M63A 2YINA 2OV8A 2PQRA 4BFRA 3SZ7A 3CVQA 3QARA 3B7RL 3LY9A 4PS3A 2J4DA 3TG5A 4C0EA 1FVFA 1H19A 1UJJA 4N2SA 3ZYLA 5KCMA 4GAAA 2HYZA 4U8HA 1Z3XA 2J07A 4ACKA 3MV2B 4IN3B 2XCCA 1EPUA 3FU3A 3JYSA 3FU0A 4J8EA 2VSNA 4CGWA 3BG0B 2XPIA 2XPZA 5JJ7A 5FTPA 2VGXB 1NA0A 3FTYA 4O6FA 3LKUA 2MOWA 2C0LA 3U4TA 4AVXA 4LERA 4FHKA 2FI7A 3PDNA 2IU1A 3ZIMA 2KCLA 5M72A 2E2EA 4FLHA 1Z6TA 3PS6A 3IHYA 4GZDA 4CGVA 4JZYA 1IQUA 3ZHEA 4B94A 2P58C 4AIFA 4UWHA 3P2BA 1HG2A 2AVPA 4G2VA 5JHAA 3CHPA 1Y6IA 3PUJA 4IULA 4LEUA 2X3MA 5AENA 3L17A 1IHGA 5FQ8A 1TJCA 3HVEB 4DLQA 3CK9A 4JA7A 4FP7A 2VGYA 3C98A 3EDTB 3L08A 3D9PA 4J0UA 4UI9J 4GZ6A 2NC9A 2WXQA 2WXPA 2AWIA 3FTSA 2GRLA 5CCLA 1JWFA 4BWRA 5LCWJ 4I1MA 1IYGA 1U3CA 3FTWA 1JWGA 1OWNA 2FBNA 4GYYA 2CFUA 2FULA 3FH5A 3OXFA 4AEZC 4TV3A 3G2WA 3ZFWA 3FEYA 5CCMA 3RRMB 1NA3A 4U63A 3T8MA 2CHXA 1EYHA 4WWNA 3VTXA 3PE3A 2UWJG 1HS6A 5KJNA 5FZRA 4FHJA 2WVIA 3CHMA 3R7QA 4DLOA 3ZRHA 2I6HA 3GW4A 1MQSA 3SD5A 3CVYA 3UQ3A 4F1SA 5D0QD 3CV0A 1HH8A 3FUFA 1FCHA 4HFGA 3Q4AB 4BX8A 2CHWA 1DNPA 2LNIA 3LS8A 2YQ8A 4K0RA 2PQNA 3QJZA 4JHKA 4F53A 4FA6A 1H0AA 4GA1A 3GZ1A 3U66A 3ASDA 1EDUA 2WPVA 3FU5A 4PH4B 3MGBA 3DPDA 2WXJA 3O4ZA 5AJDA 2AXZA 4CDMA 3U3WA 1KT0A 2KZTA 2KCVA 3Q47B 3VLFA 4PDXA 1FVHA 5FZSA 1L5JA 1INZA 4P29A 4MS6A 4MLPA 4F7AA 4R7LA 1DVPA 1H2UA 2WXHA 3RJVA 4A1SA 3RU0A 1NP7A 2V5FA 2LAIA 3IEGA 4UQXA 3ZYMA 1HF8A 2IJGX 3JUIA 3JQ1A 3I4GA 4FC8A 4CDNA 3QKYA 4B8CB 4CT0A 2CG2A 2WXOA 3L22A 2VSYA 1XGWA 2IOSA 2WXKA 3PE4A 3OXLA 5EX3A 4KXKB 3RKVA 3U9WA 2XGSA 1TJFA 4CCAA 4Y6WA 4GZCA 5T3RA 3CHRA 5T4YA 4M3OA 2WXLA 5LP0A 3LVRE 2NSZA 2VSOE 3LY8A 3CVNA 3RO2A 3CQGB 4ABNA 5CMWA 5KJKA 2V8SE 3RO3A 3QWVA 4KT6B 2CFZA 3UMVA 3MKQA 4AV7A 4GZ3A 3HDXA 4XI9A 3ZGQA 4N3AA 3BEEA 3G2VA 3FU6A 3R7RA 1ELWA 3B7UX 3G2TA 3S7DA 4APOA 2OOEA 3FP3A 4HXIA 3S7BA 5DIZA 3EHNA 3MZLB 3APCA 1VDYA 3ML9A 2MHKA 4LCTA 4HVBA 4AY6A 3QDNA 1WAO1 4C0MA 2OVFA 3VLDA 4ANVA 3MKRA 3CK8A 3GZ2A 1OWOA 3QAQA 5G05C 2IONA 4AOFA 4EPZA 3QB2A 5JJTA 1WM5A 3FY4A 4WNGA 2XEVA 5KJLA 2VTBA 5HI7A 2XHEA 5BNWA 2VQ2A 2BUGA 3SNXA 4EZKA 5BT1A 3EIJA 4URKA 3ZVVA 5EKQD 1GW6A 5D0OD 3NF1A 2C0MA 1A17A 4FU3A 4H7YA 4I2ZA 4L2LA 4BTBA 2L9BA 3L13A 4YVOA 4I43A 5ARGA 3RIBA 4GB9A 4ILIA 3OAWA 1E8WA 2ILRA 3D9MA 4AY5A 4E85A 4WNDA 4DK5A 2KZTB 4I6EA 2Y4TA 3MV3B 3CKCA 4HLEA 2WQ7A 3ASHA 3CLJA 4FJYA 5J90A 3CVVA 2WXGA 1E8ZA 4RSYA 4GYWA 2R5SA 2L6JA 3D9IA 3FUDA 1QZ2A 1YA0A 5E76A 2A4ZA 4DI3A 4EZJA 4GYOA 4GA2A 4KYOB 4LUNU 4N2QA 1SZ9A 3ENEA 2GW1A 3G2SA 4Y6CA 4BTAA 4J8DA 4DI4A 3CHQA 4KBQA 4V3IA 3WXXA 4WNEA 5ENNA 3CVUA 3VLEA 3FTVA 3TJPA 1QQEA 4GPKA 3HIZA 3SGHA 3FH7A 2KM4A 4MKTA 4U04A 3TL5A 5FQ4A 1MHQA 4HORA 2RG8A 3B7TA 4JPSA 4WWOA 4JW1A 4RG6A 3I5PA 4OVUA 2YHCA 3LYAA 1E7UA 3EHMA 5C1DA 3LDZA 1ELKA 2X6FA 4FULA 2DIWA 3IV0A 4WNFA 2DBAA 3IKOB 2LAHA 4E6HA 5ARFA 2PM6A 2VYIA 2V4LA 2GRMA 3KEZA 2AW6A 3AS4A 3D9LA 1EF1C 5LFAA 2VJ8A 3D9NA 4N5CA 4HOSA 2WM9A 2X6IA 4CDRA 1UW4B 3D3MA 2E0IA 3FUMA 4GZ5A 1HE8A 2GGFA 2WMOA 4YNDA 3UPVA 2I9CA 2KCKA 2WMNA 3FUKA 3LVQE 3ZYQA 1PC2A 2NXPA 3FEXA 5FWQA 4JEUA 3Q15A 3BG1B 3JCKC 2HR2A 4KMOA 4L7TA 2IFUA 2ZU6B 3CEQA 3CGHA 4XI0A 4MRUA 4DPRA 5T8IA 4QFVA 2VGXA 2ONDA 4WUYA 3FFLA 3UX4A 4B89A 3CVLA 3LJ3A 3UT7A 4RG9A 4EZLA 4PS8A 4BY6A 4DJAA 2L0TB 4G26A 5A23A 2I1JA 2EQXA 3KAEA 5BW8C 1LF8A 4XKBA 4AP2A 3AU5A 4WAFA 3CVPA 3HYMB 2LSVA 4JC8A 4KZCA 3CQCB 3KD7A 2WQ6A 4CEMA 2I2OA 2KATA 1U3DA 3PREA 3N71A 1HO8A 3UT8A 3ZHEB 4N39A 3TXNA 1IQRA 3FUEA 4UWLA 1BPOA 1Y8MA 3CVXA 3GZSA 1ZBPA 1NZNA 5G04C 3FUJA 4EBAA 5FJYA 2YNQA 4UQYA 2J9QA 2X6JA 3RRNB 3PNLB 4L2YA 4U0UA 2FO7A 1HX8A 4JHRA 5FZQA 2YHEA 3SF4A 4OVVA 3LY7A 4B8AA 5G05J 3ZEFA 3AU4A 2UY1A 2WXNA 3PNTB 3HHMA 4I6GA 4ANUA 3CSTA 2FEZA 4NURA 4PUCA 3CIAA 1PY1A 3EJNA 3ESLA 3S7JA 1XNFA 4A3TA 5LOZA 3QNKA 3IHVA 3ESKA 2Y3AA 3FTXA 3PVLA 3ASFA 3CK7A 3TGOA 4KZ0A 4IRUA 4RVBA 4G25A 4D10C 2LSUA 3TXMA 3CR3A 4Q96A 4CRWA 1ZU2A 2AXVA 2J09A 4XKCA 3D9OA 5CMYA 4H7XA 4ME2A 3TAXA 3SFZA 2LO6A 3DBSA 5DBKA 1HG5A 3SBTB 4K03A 4B0ZA 2XGOA 5AJLA 5EX0A 4N3BA 3U64A 4GCNA 5A6CA 3OXGA 3T5VA 3MX3A 3URZA 4UWKA 3S2AA 4BX9A 4XE0A 2X6KA 3PEVB 4PS7A 4JA9A 3LCAA 4I2WA 4J8SA 4WWPA 2QY7A 2I1KA 4GU5A 4J6IA 4NRHB 4ANXA 3ZN3A 1P5QA 2WXRA 3NZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWP A;  3ULQ A;  1OUV A;  4I1A A;  3CKB A;  3QWW A;  4YVQ C;  2Y4U A;  4UQZ A;  3AS8 A;  4HOT A;  2JLB A;  3QOU A;  2XCB A;  3VTY A;  5A7D B;  3TG4 A;  5JJ6 A;  3KS2 A;  4W9R A;  2C2L A;  1KT1 A;  4NQ0 A;  5AYW D;  3O48 A;  4G23 A;  4XIF A;  4U07 A;  1W3B A;  2KC7 A;  4I9E A;  2HO1 A;  4G1T A;  3Q5M A;  2PZI A;  3GYZ A;  1KLX A;  2IF4 A;  1HXI A;  4HOU A;  2UY1 B;  4GCO A;  4U0S A;  3LPZ A;  3ZPJ A;  1HZ4 A;  2WQH A;  3E4B A;  4UI9 C;  5CHE E;  3FWV A;  4U0Z A;  5LCW C;  4EQF A;  4AM9 A;  3ASG A;  1ELR A;  4GA0 A;  5G04 J;  3AS5 A;  3R9A B;  1B89 A;  2FF4 A;  1E96 B;  3UUX A;  2Q7F A;  3MEK A;  4I17 A;  4BT8 A;  2QFC A;  4HOQ A;  5HQ8 A;  3Q49 B;  4J8F A;  5FT9 A;  2XGM A;  4JL0 A;  5KJM A;  4F3V A;  4G24 A;  4BT9 A;  3S7F A;  3MA5 A;  4N3C A;  2PL2 A;  4I9C A;  4UI9 K;  3K9I A;  2PQR A;  3SZ7 A;  3CVQ A;  3LY9 A;  3TG5 A;  4N2S A;  2HYZ A;  3MV2 B;  4IN3 B;  2XCC A;  3JYS A;  4J8E A;  4CGW A;  2VSN A;  2XPI A;  5JJ7 A;  5FTP A;  2VGX B;  1NA0 A;  4O6F A;  3LKU A;  2C0L A;  3U4T A;  2FI7 A;  3PDN A;  2KCL A;  5M72 A;  2E2E A;  4CGV A;  3ZHE A;  4B94 A;  2P58 C;  4AIF A;  2AVP A;  4G2V A;  4LEU A;  1IHG A;  1TJC A;  3CK9 A;  4JA7 A;  2VGY A;  3EDT B;  4J0U A;  4UI9 J;  4GZ6 A;  2NC9 A;  5CCL A;  4BWR A;  5LCW J;  1IYG A;  2FBN A;  4GYY A;  3OXF A;  3ZFW A;  5CCM A;  1NA3 A;  3VTX A;  3PE3 A;  2UWJ G;  5KJN A;  5FZR A;  2I6H A;  3GW4 A;  3UQ3 A;  5D0Q D;  3CV0 A;  1HH8 A;  1FCH A;  3Q4A B;  2LNI A;  2YQ8 A;  2PQN A;  4GA1 A;  3GZ1 A;  3ASD A;  2WPV A;  3U3W A;  1KT0 A;  2KCV A;  3Q47 B;  5FZS A;  3RJV A;  4A1S A;  3RU0 A;  2V5F A;  3IEG A;  4UQX A;  3QKY A;  2VSY A;  3PE4 A;  3OXL A;  5EX3 A;  4KXK B;  3RKV A;  2XGS A;  4Y6W A;  3LY8 A;  3CVN A;  3RO2 A;  4ABN A;  5KJK A;  3RO3 A;  3QWV A;  4GZ3 A;  4XI9 A;  3ZGQ A;  4N3A A;  3BEE A;  1ELW A;  3S7D A;  4APO A;  2OOE A;  3FP3 A;  3S7B A;  5DIZ A;  2MHK A;  4AY6 A;  3QDN A;  1WAO 1;  3MKR A;  3CK8 A;  3GZ2 A;  5G05 C;  5JJT A;  1WM5 A;  4WNG A;  2XEV A;  5KJL A;  5HI7 A;  5BNW A;  2VQ2 A;  2BUG A;  5BT1 A;  5EKQ D;  5D0O D;  4BTB A;  3NF1 A;  2C0M A;  1A17 A;  4H7Y A;  4I2Z A;  4YVO A;  5ARG A;  3RIB A;  4AY5 A;  4WND A;  2Y4T A;  3MV3 B;  3CKC A;  3ASH A;  4GYW A;  2R5S A;  2L6J A;  1QZ2 A;  1YA0 A;  4GYO A;  4GA2 A;  4KYO B;  4N2Q A;  2GW1 A;  4Y6C A;  4BTA A;  4J8D A;  4KBQ A;  3WXX A;  4WNE A;  1QQE A;  4GPK A;  4U04 A;  4HOR A;  4RG6 A;  2YHC A;  3LYA A;  5C1D A;  4WNF A;  2DBA A;  5ARF A;  2VYI A;  3AS4 A;  4N5C A;  4HOS A;  4CDR A;  4GZ5 A;  4YND A;  3UPV A;  2KCK A;  1PC2 A;  3Q15 A;  2HR2 A;  2IFU A;  3CEQ A;  4XI0 A;  2VGX A;  2OND A;  4WUY A;  3FFL A;  3CVL A;  4RG9 A;  4G26 A;  3KAE A;  5BW8 C;  3CVP A;  3HYM B;  2LSV A;  3KD7 A;  2KAT A;  3N71 A;  3ZHE B;  4N39 A;  1Y8M A;  1ZBP A;  1NZN A;  5G04 C;  5FJY A;  4UQY A;  2J9Q A;  4U0U A;  2FO7 A;  4JHR A;  5FZQ A;  3SF4 A;  3LY7 A;  5G05 J;  2UY1 A;  2FEZ A;  3S7J A;  1XNF A;  3ESK A;  3ASF A;  3CK7 A;  3TGO A;  4G25 A;  2LSU A;  1ZU2 A;  4H7X A;  4ME2 A;  3TAX A;  5DBK A;  2XGO A;  5EX0 A;  4N3B A;  4GCN A;  5A6C A;  3OXG A;  3URZ A;  4JA9 A;  3LCA A;  4I2W A;  4NRH B;  3ZN3 A;  1P5Q A; 
#chains in the Genus database with same CATH topology
 1OUV A;  3ZYK A;  5HS0 A;  4ILG A;  1SZA A;  1IKN D;  3DSV A;  5G2N A;  5FQ7 A;  2XCB A;  3VTY A;  2CG3 A;  3D9K A;  1JPL A;  3L54 A;  3TG4 A;  3PH0 C;  2C2L A;  5AYW D;  4G23 A;  1E8Y A;  5BV0 A;  1N54 A;  4I9E A;  2H6H A;  3PZD A;  2XZD G;  1S0P A;  3WG7 E;  1KLX A;  5E75 A;  3I4R B;  1E8X A;  3PZ4 A;  1OWP A;  3CSF A;  3TWW A;  4BER A;  3PRZ A;  5CER B;  3LPZ A;  3FTU A;  4GML A;  3L16 A;  4MBG A;  3TWS A;  1HU3 A;  4UWG A;  3UM3 A;  3FWV A;  3R9M A;  2XS8 A;  4AM9 A;  3ASG A;  2B6C A;  3UIN C;  1OWM A;  3FUL A;  2VTB B;  5G04 J;  5G55 A;  3HXE A;  4C9B B;  3CHO A;  3R9A B;  4UWF A;  3X2Q E;  3UT4 A;  2WB2 A;  3JUE A;  2VSX E;  3UUX A;  2Q7F A;  4ATG A;  1N11 A;  3APF A;  1LD7 A;  4JXT A;  3B7S A;  3AG1 E;  2R17 C;  3MJW A;  1JCR A;  3SHF A;  4B93 B;  2HM8 A;  2IQC A;  3ABM E;  3S7F A;  1SA5 A;  4N3C A;  4GMJ A;  3C72 A;  3IXE A;  3ZW3 A;  1BI8 B;  2P2C P;  1H6O A;  2JEK A;  4A1G A;  2YIN A;  3QAR A;  2J4D A;  3TG5 A;  1DCE A;  3ZYL A;  3ZKJ A;  5KCM A;  2MYO A;  1Z3X A;  4ACK A;  2V5Q C;  4IN3 B;  4J8E A;  4Z68 A;  4TUM A;  2MOW A;  2C0L A;  4LNB A;  2FI7 A;  1TR4 A;  4HLL A;  3ZIM A;  2E2E A;  2EIL E;  4JZY A;  2GRP B;  3DEO A;  4UWH A;  1HG2 A;  5JHA A;  4LNG A;  1Y6I A;  4LEU A;  1IHG A;  4JA7 A;  2VGY A;  3C98 A;  4J0U A;  4GZ6 A;  2WXQ A;  3BUA A;  5EYL A;  3G2W A;  2ETA A;  4U63 A;  3PE3 A;  2UWJ G;  2WVI A;  4CYM D;  3UQ3 A;  1AWC B;  2PQN A;  4JHK A;  4DUI A;  1KPS B;  3MGB A;  2WXJ A;  4CDM A;  4GMR A;  2P9N G;  4PDX A;  1FVH A;  1INZ A;  4K5C A;  4MS6 A;  4MLP A;  4U7E B;  3RJV A;  2WXH A;  4U96 D;  3JQ1 A;  4CDN A;  2L6B A;  4B8C B;  4CT0 A;  1TNB A;  2IEJ A;  3RKV A;  4Y6W A;  4GZC A;  2WXL A;  3LVR E;  2NSZ A;  3JXI A;  3DXK G;  2CFZ A;  3MKQ A;  4AV7 A;  4GZ3 A;  4XI9 A;  3HRA A;  3G2T A;  2OOE A;  4GTQ A;  3S7B A;  5DIZ A;  3EHN A;  4A63 B;  3APC A;  2MHK A;  4LG6 A;  1RZ4 A;  2ZGD A;  3QDN A;  4C0M A;  3MKR A;  3GZ2 A;  1AP7 A;  4EPZ A;  3QB2 A;  5KJL A;  4GTR A;  4O1O A;  1GW6 A;  5HKP A;  4BTB A;  1A17 A;  4H7Y A;  4I2Z A;  5CRV A;  5ARG A;  3RIB A;  4GB9 A;  4ILI A;  1E8W A;  4AY5 A;  4WND A;  2WQ7 A;  3CVV A;  2WXG A;  2XEE A;  4GYW A;  2XEH A;  3T8K A;  3V2X A;  1N4S A;  4DI3 A;  4YDW A;  4EZJ A;  4LUN U;  3ENE A;  4DI4 A;  3CHQ A;  4KBQ A;  3FTV A;  3HIZ A;  3ULE G;  2RG8 A;  4JPS A;  5B1B E;  3TWU A;  4ZHB A;  3E33 A;  1ELK A;  5AQA A;  3IV0 A;  3IKO B;  3SQV A;  2PM6 A;  1LTX A;  4ATZ D;  2V4L A;  2AW6 A;  3AS4 A;  5LFA A;  2X6I A;  1DCQ A;  4TXP A;  1OXJ A;  4L7T A;  2IFU A;  2ZU6 B;  4QFV A;  2VGX A;  2QZA A;  4B89 A;  4RG9 A;  4PS8 A;  2L0T B;  3KAE A;  3CVP A;  3C5R A;  3KD7 A;  3DSX A;  2I2O A;  2KAT A;  3NAW A;  3ZHE B;  5AQB A;  1BPO A;  1ZBP A;  1NZN A;  4X8Q A;  1Z5S C;  4UQY A;  1KZO A;  2J9Q A;  4L2Y A;  5FZQ A;  3LJN A;  2UY1 A;  2FEZ A;  2IO2 C;  4HRL A;  4PUC A;  3ESL A;  1N94 A;  3C3O A;  2Y3A A;  2R05 A;  3CK7 A;  3TGO A;  5EIB E;  4IRU A;  1UOH A;  1D9S A;  4RVB A;  4U95 D;  4Q96 A;  4CRW A;  1ZU2 A;  4H7X A;  3TAX A;  3B95 A;  2LO6 A;  3DBS A;  3SFZ A;  1HG5 A;  5AJL A;  1V54 E;  3MX3 A;  5BXU A;  4BET A;  4JD2 G;  4WWP A;  4NRH B;  1OCC E;  4I1A A;  3JXJ A;  3CKB A;  2Y69 E;  4NAC A;  2Y4U A;  3AS8 A;  3W9G A;  3DSS A;  2J08 A;  2F8X K;  2GRN B;  2P9S G;  4XX5 A;  2ZIR A;  1FPP A;  5JJ6 A;  2WXM A;  3TWX A;  1BD8 A;  2AXU A;  2XPY A;  4HRM B;  3UM2 A;  4U07 A;  3FH8 A;  5JHB A;  4G1T A;  2BTD A;  4I1O B;  2IF4 A;  4GPM A;  1TNZ A;  1S70 B;  4QQI A;  4RLY A;  3QC1 A;  1QNF A;  4HOU A;  2UY1 B;  3FUH A;  2EIN E;  3ZU7 B;  4HRN A;  4JVS A;  1BLX B;  5LX8 A;  2WQH A;  4UI9 C;  3SBS A;  4EQF A;  1N4R A;  3D9H A;  4JEH A;  3PEU B;  1UN9 A;  1H2V C;  2MRI A;  2GRQ B;  3TWQ A;  1E96 B;  3B13 A;  1JUQ A;  3T5X A;  5D2M C;  4I17 A;  3SI5 A;  5HQ8 A;  2PM7 A;  1SQM A;  4XZ4 A;  2QYJ A;  2XGM A;  3Q78 A;  1H6K A;  4ILH B;  1OCR E;  4L1B A;  1YMP A;  4BEP A;  1E90 A;  5AAR A;  2R59 A;  3UM0 A;  2PL2 A;  5CEA A;  4I9C A;  3Q73 A;  5AN8 A;  3G2U A;  5EDS A;  3DXM G;  2OV8 A;  2Y1L E;  4BFR A;  1H19 A;  1UJJ A;  4N2S A;  4GAA A;  2J07 A;  3MV2 B;  2JAB A;  1EPU A;  3FU3 A;  3FU0 A;  4CGW A;  2XPI A;  2XPZ A;  5FTP A;  4AVX A;  4LER A;  2IU1 A;  3TWV A;  1Z6T A;  1LD8 A;  5EN5 D;  3IHY A;  4GZD A;  1IQU A;  4B94 A;  2P58 C;  3UIP C;  3CHP A;  2X3M A;  5ENP D;  2B0O E;  2RKK A;  3EDT B;  4N5Q A;  4UI9 J;  2AWI A;  2P9I G;  4BWR A;  1U3C A;  1JWG A;  2FBN A;  2QC9 A;  2CFU A;  3OXF A;  3ZFW A;  3FEY A;  3T8M A;  2CHX A;  1EYH A;  5FIO A;  5FZR A;  3R7Q A;  3ZRH A;  3CVY A;  4F1S A;  5D0Q D;  1FCH A;  3KSL A;  2LNI A;  1DNP A;  2YQ8 A;  2OCC E;  3GZ1 A;  4GA1 A;  2WPV A;  3FU5 A;  3AG3 E;  4PH4 B;  3O4Z A;  5AJD A;  3U3W A;  2KCV A;  3VLF A;  4GTP A;  5FZS A;  5KWD A;  3PZ3 A;  5ITZ F;  4F7A A;  3Q75 A;  4R7L A;  3SFX A;  2DYR E;  2V5F A;  3IEG A;  4UQX A;  3ZYM A;  1TYQ G;  3ULY A;  3I4G A;  2CG2 A;  2WXO A;  2WXK A;  2IOS A;  3PE4 A;  5EX3 A;  4U8V D;  1TJF A;  3DSW A;  5T3R A;  4M3O A;  5AQ9 A;  3LY8 A;  3RO2 A;  3CQG B;  3RO3 A;  4KT6 B;  4BES A;  3AG4 E;  3ZGQ A;  3BEE A;  3FU6 A;  1ELW A;  3B7U X;  3S7D A;  3FP3 A;  2R2L A;  2J8S D;  4AY6 A;  3VLD A;  5JJT A;  2DZO A;  4WNG A;  2XHE A;  4URK A;  3EIJ A;  4F6R D;  3ZVV A;  5EKQ D;  2C0M A;  3SFY A;  2L9B A;  4E85 A;  2ILR A;  4DK5 A;  4I6E A;  3NB2 A;  4HLE A;  3ASH A;  1MJ0 A;  1YA0 A;  4C48 B;  4J8Y A;  4GA2 A;  4KYO B;  3G2S A;  1JCQ A;  4J8D A;  4JB8 P;  5KBA A;  1QQE A;  2KM4 A;  5FQ4 A;  4WWO A;  4JW1 A;  4RG6 A;  2YHC A;  3Q79 A;  5C1D A;  1E7U A;  3EHM A;  2KXP C;  4WNF A;  2DBA A;  3HXB A;  2VJ8 A;  3D9N A;  4GTS A;  4N5C A;  4HOS A;  3HXD A;  4CDR A;  3D3M A;  3FUM A;  2WMO A;  2I9C A;  2WMN A;  1OCO E;  3LVQ E;  2NXP A;  5FWQ A;  4JEU A;  1NFI E;  3CEQ A;  4MRU A;  1SVX A;  3BQO A;  3E32 A;  4BY6 A;  4DJA A;  3AAA C;  4L9P A;  2EQX A;  3ZXP A;  4DX7 D;  4JC8 A;  1S64 A;  4KZC A;  2WQ6 A;  4CEM A;  4O1P A;  4N39 A;  1IQR A;  4UWL A;  3BU8 A;  3FUJ A;  4GTV A;  1O1S A;  3PNL B;  4JHR A;  2YHE A;  3SF4 A;  4OVV A;  2WXN A;  4I6G A;  3PNT B;  3ZUV B;  2BKG A;  4A3T A;  3CIA A;  3EJN A;  3QNK A;  3FTX A;  4G25 A;  2LSU A;  1MX2 A;  2AXV A;  2J09 A;  3D9O A;  3SBT B;  4K03 A;  4B0Z A;  2XGO A;  2OEW A;  1QYM A;  1IHB A;  5EX0 A;  5A6C A;  3URZ A;  1TN7 A;  1K1B A;  3PZ2 A;  3NOG D;  2BED A;  5ENS D;  4PS7 A;  4JA9 A;  3LCA A;  2Y0B G;  2QY7 A;  2WXR A;  4L2L A;  3NZU A;  3QWP A;  3ULQ A;  3PUK A;  4Q69 A;  4HS2 A;  5AIJ A;  3QWW A;  3NOC D;  5J08 A;  4FLB A;  3FHE A;  2X6H A;  4A55 A;  1SA4 A;  4HOT A;  1N52 A;  2XQ0 A;  4LRZ A;  3AG2 E;  2JLB A;  3J5Q B;  4FJZ A;  3IBE A;  3EHQ A;  1YYH A;  3KS2 A;  3UM1 A;  2XEN A;  4XIF A;  3APD A;  1OWL A;  2V0P A;  3ZXS A;  3LEW A;  2HO1 A;  3Q5M A;  3FDH A;  2PZI A;  4XEI G;  2J4B A;  3GYZ A;  2L0I A;  1HXI A;  3MKQ B;  3DRA A;  4AXH A;  1HFA A;  3ASN E;  3KEA A;  3DEP A;  1TNY A;  3ABL E;  3ZPJ A;  4K5A B;  1MX6 A;  1HZ4 A;  3E4B A;  4KVO A;  5CHE E;  4AJW A;  4EEC A;  4A3V A;  4FAD A;  4U0Z A;  1BI7 B;  3NQP A;  3ZNG A;  4GA0 A;  3CVW A;  3AS5 A;  1UG3 A;  1O5M A;  3ONL A;  3ML8 A;  4HB5 A;  3RSE G;  3HVE A;  3UXG A;  3MEK A;  1A5E A;  5C2Y A;  3FUN A;  3FTZ A;  4J8F A;  1YCS B;  5FT9 A;  4JL0 A;  1K3Z D;  2RFM A;  2WXI A;  1O1R A;  4G24 A;  4BT9 A;  3L6A A;  3MA5 A;  5FQ6 A;  4APF A;  2XRY A;  4CT4 A;  4L23 A;  5ANL A;  3QK0 A;  3TWR A;  3K9I A;  4Q94 A;  5CEC B;  2M63 A;  1NI1 A;  3HXF A;  3CVQ A;  3B7R L;  3LY9 A;  4PS3 A;  5B1A E;  2GRR B;  2XCC A;  3JYS A;  1BU9 A;  1DC2 A;  2VGX B;  3C3R A;  5FIN A;  3PDN A;  5M72 A;  4FLH A;  3PS6 A;  3DST A;  2H6I A;  4AIF A;  1N0R A;  4GTM A;  3PUJ A;  3E30 A;  3HVE B;  3CK9 A;  5HRY A;  1MYO A;  2NC9 A;  2WXP A;  2EIM E;  2GRL A;  1JWF A;  4I1M A;  1JCS A;  4GYY A;  4LSZ E;  3FH5 A;  2IO3 C;  5CCM A;  3HXC A;  5KJN A;  3CHM A;  4DLO A;  3Q7F A;  2I6H A;  4HBD A;  4HFG A;  4BX8 A;  3QJZ A;  4F53 A;  1H0A A;  3U66 A;  4HQD A;  5CRU A;  1QBQ A;  1WDY A;  5CBO A;  1L5J A;  4YDY A;  4P29 A;  3Q9N C;  1DVP A;  1H2U A;  4A1S A;  4DRX E;  3RU0 A;  1NP7 A;  1HF8 A;  2HE0 A;  3QKY A;  3L22 A;  2VSY A;  2LXL A;  3OXL A;  4KXK B;  1OY3 D;  3U9W A;  2XGS A;  3F6Q A;  2KBX A;  3CHR A;  5T4Y A;  3NBN B;  3ISM C;  2VSO E;  3W9F A;  4ABN A;  3QWV A;  3UMV A;  5CBN A;  3HDX A;  4G8L A;  4N3A A;  3G2V A;  3PZ1 A;  3R7R A;  1TNO A;  3RAU A;  4HXI A;  3MZL B;  1VDY A;  3ML9 A;  4LCT A;  2BKK B;  2OVF A;  5ENO D;  4YDO A;  3CK8 A;  5G05 C;  2ION A;  2XEV A;  2VTB A;  2VQ2 A;  2BUG A;  3SNX A;  4EZK A;  5BT1 A;  5D0O D;  2QYU A;  3L13 A;  4I43 A;  2LXM A;  2Y4T A;  3MV3 B;  3CKC A;  5J90 A;  4RSY A;  2L6J A;  3D9I A;  1O1T A;  3FUD A;  1QZ2 A;  2A4Z A;  4HI9 A;  1SZ9 A;  4Y6C A;  4V3I A;  4WNE A;  5ENN A;  3CVU A;  3TJP A;  4TXQ A;  5ENR D;  5ENT D;  1U2V G;  1MHQ A;  4LNU D;  3LYA A;  3J5P A;  4GTT A;  1OCZ E;  4ZFH A;  2DIW A;  2DWZ A;  3L82 A;  3T9K A;  4E6H A;  3KEZ A;  1N0Q A;  4M7C A;  2E0I A;  1HE8 A;  2KCK A;  3FUK A;  3ZYQ A;  3FEX A;  3EU9 A;  3Q15 A;  3JCK C;  4KMO A;  4DPR A;  5T8I A;  2RFA A;  1OT8 A;  4WUY A;  3E37 A;  3CVL A;  3LJ3 A;  4EZL A;  2P9U G;  4G26 A;  5A23 A;  5BXO A;  2I1J A;  1MZC A;  3AU5 A;  2LSV A;  3CQC B;  2P9K G;  1U3D A;  1V55 E;  3PRE A;  1HO8 A;  3UT8 A;  3TXN A;  1D8E A;  3FUE A;  3L9T A;  1Y8M A;  3GZS A;  2AJA A;  4U0U A;  2FO7 A;  5G05 J;  2F0Y A;  3ZEF A;  3AU4 A;  3HHM A;  4TXR A;  4NUR A;  1PY1 A;  5LOZ A;  5EID A;  3IHV A;  3ESK A;  3PVL A;  4K5B A;  3ASF A;  4G8K A;  4KZ0 A;  4HNA D;  4D10 C;  2VGE A;  3TXM A;  4XKC A;  4ME2 A;  5DBK A;  3UI2 A;  3U64 A;  3B7B A;  3OXG A;  2LUH A;  3S2A A;  2ETB A;  5ENQ D;  4XE0 A;  3PEV B;  4U8Y D;  1P5Q A;  3MCX A;  1N4P A;  4BSX A;  4YVQ C;  1UJK A;  4DX5 D;  2DZN A;  1FT2 A;  4UQZ A;  1UN8 A;  1WY6 A;  3DSU A;  1H6P A;  2CHZ A;  2FO1 E;  3QOU A;  1PAQ A;  3RRU A;  5A7D B;  2ETC A;  2OVB A;  2R03 A;  4W9R A;  2IOL A;  1KT1 A;  3OTN A;  4NQ0 A;  3O48 A;  3EIQ C;  4IYP A;  3FUI A;  1X5B A;  4RQI A;  1W3B A;  3E34 A;  2KC7 A;  3JQ0 A;  2EIJ E;  3SO8 A;  4KVM A;  4ACL A;  4EBA G;  3DWL G;  4GCO A;  3MYV A;  2J49 A;  4DX1 A;  4I6J A;  3V31 A;  4U0S A;  1TEZ A;  2NYJ A;  2DVW A;  3SY2 A;  5LCW C;  3EHR A;  5ANR A;  1ELR A;  5BV1 A;  4JHJ A;  3CHS A;  3P1U A;  3RK6 A;  4CZ2 D;  1B89 A;  2FF4 A;  3I3N A;  3NZS A;  2BF0 X;  2RD0 A;  1E7V A;  5BUZ A;  1H2T C;  5IY5 E;  4BT8 A;  3ONK A;  4ANW A;  2QFC A;  4HOQ A;  1TN8 A;  3Q49 B;  3LXU X;  4G11 A;  5KJM A;  2A5U A;  4F3V A;  1RW2 A;  2XRZ A;  2WXF A;  2ZIS A;  4OYS A;  1D8D A;  4TUU A;  3C3Q A;  1Z3Y A;  1N95 A;  4UI9 K;  4TRQ A;  3D9J A;  2X38 A;  1NL4 A;  2DCP A;  5BPP A;  2F37 A;  2PQR A;  3SZ7 A;  3Q9U C;  4C0E A;  3ABK E;  1FVF A;  2HYZ A;  4U8H A;  2XS1 A;  2VSN A;  3BG0 B;  5JJ7 A;  1NA0 A;  3FTY A;  4O6F A;  3TWT A;  3LKU A;  1SW6 A;  4DX6 D;  3U4T A;  2OEV A;  4FHK A;  2KCL A;  2R02 A;  2F8Y A;  4OAV B;  4CGV A;  3ZHE A;  1K8K G;  5AAO A;  3P2B A;  2AVP A;  4G2V A;  4IUL A;  5AEN A;  3L17 A;  5FQ8 A;  1TJC A;  4DLQ A;  4FP7 A;  2V4H C;  3L08 A;  3D9P A;  3FTS A;  2H6G A;  5CCL A;  3UIO C;  5LCW J;  1IYG A;  3FTW A;  1S63 A;  1OWN A;  4HI8 A;  1G3N B;  2FUL A;  4AEZ C;  4TV3 A;  3RRM B;  1NA3 A;  5AQ7 A;  4WWN A;  3VTX A;  1HS6 A;  4FHJ A;  3KSQ A;  5CED B;  3GW4 A;  3UTM A;  1MQS A;  3SD5 A;  3CV0 A;  1HH8 A;  3FUF A;  3Q4A B;  5EIL A;  2CHW A;  2GRO B;  3LS8 A;  4K0R A;  4FA6 A;  2P9L G;  3ASD A;  1EDU A;  1N4Q A;  4YDE A;  3DPD A;  2AXZ A;  1KT0 A;  2KZT A;  3Q47 B;  5KNH D;  2ZGG A;  2LAI A;  5H7P A;  2IJG X;  3JUI A;  3V2O A;  1KZP A;  1MX4 A;  2IY0 C;  3ASO E;  4FC8 A;  1XGW A;  5EYP F;  3AJI A;  4NIK A;  4CCA A;  3HG0 D;  5LP0 A;  3UKU G;  3CVN A;  5CMW A;  5KJK A;  2V8S E;  2PNN A;  4O60 A;  3V30 A;  4APO A;  1X81 A;  4HVB A;  1WAO 1;  4ANV A;  3QAQ A;  1OWO A;  4DX2 A;  4AOF A;  1WM5 A;  1K1A A;  3FY4 A;  5HI7 A;  5BNW A;  2ZXW E;  3NF1 A;  4FU3 A;  2DYS E;  4YVO A;  3OAW A;  3D9M A;  2KZT B;  4J7W A;  2H6F A;  3CLJ A;  4FJY A;  1E8Z A;  2R5S A;  1TNU A;  5E76 A;  4GYO A;  4N2Q A;  5D66 A;  2GW1 A;  3V79 K;  4BTA A;  3EUV A;  3WXX A;  5B3S E;  3VLE A;  4GPK A;  1ZB1 A;  3SGH A;  3FH7 A;  5JA4 D;  4MKT A;  4U04 A;  3TL5 A;  4EHM A;  4HOR A;  3B7T A;  2A5E A;  1WG0 A;  3I5P A;  4OVU A;  3LDZ A;  2X6F A;  4FUL A;  2LAH A;  5ARF A;  2VYI A;  5KNG A;  2GRM A;  3D9L A;  1EF1 C;  2WM9 A;  1UW4 B;  4GZ5 A;  2GGF A;  4YND A;  3UPV A;  1PC2 A;  2P9P G;  3BG1 B;  2HR2 A;  3CGH A;  4XI0 A;  4F1P A;  4BSZ B;  2OND A;  3FFL A;  3UX4 A;  1TN6 A;  2EIK E;  4UUC A;  3UT7 A;  5BW8 C;  1LF8 A;  4XKB A;  4AP2 A;  2XZT G;  4WAF A;  3HYM B;  4OAU C;  3N71 A;  3CVX A;  1FT1 A;  5G04 C;  4EBA A;  5FJY A;  2YNQ A;  3DPY A;  2X6J A;  3RRN B;  1HX8 A;  3Q7A A;  3LY7 A;  1IXV A;  4B8A A;  4ANU A;  3CST A;  3S7J A;  1XNF A;  1N9A A;  3CR3 A;  5CMY A;  1Q2Z A;  4N3B A;  4GCN A;  3T5V A;  4UWK A;  4GTO A;  4BX9 A;  3UKR G;  3EU5 A;  2X6K A;  4I2W A;  4J8S A;  2I1K A;  4GU5 A;  4J6I A;  4ANX A;  3ZN3 A;  5JMN D; 
#chains in the Genus database with same CATH homology
 3MCX A;  3QWP A;  3ULQ A;  1OUV A;  3ZYK A;  3PUK A;  4I1A A;  4Q69 A;  4HS2 A;  3CKB A;  4BSX A;  5AIJ A;  4ILG A;  3QWW A;  1SZA A;  4YVQ C;  5J08 A;  1UJK A;  4NAC A;  5G2N A;  4FLB A;  3FHE A;  2Y4U A;  2X6H A;  4A55 A;  4UQZ A;  3AS8 A;  1UN8 A;  1WY6 A;  5FQ7 A;  4HOT A;  2J08 A;  1N52 A;  2XQ0 A;  4LRZ A;  2CHZ A;  2JLB A;  3QOU A;  2XCB A;  1PAQ A;  4FJZ A;  3IBE A;  3VTY A;  2CG3 A;  4XX5 A;  3D9K A;  3RRU A;  1JPL A;  3L54 A;  5A7D B;  3TG4 A;  2OVB A;  3PH0 C;  2WXM A;  3KS2 A;  4W9R A;  5JJ6 A;  2IOL A;  2C2L A;  1KT1 A;  3OTN A;  4NQ0 A;  5AYW D;  3O48 A;  4G23 A;  4XIF A;  3EIQ C;  2AXU A;  4IYP A;  2XPY A;  1X5B A;  3FUI A;  3APD A;  4U07 A;  1E8Y A;  1OWL A;  3FH8 A;  1W3B A;  2V0P A;  5BV0 A;  3ZXS A;  1N54 A;  3LEW A;  2KC7 A;  5JHB A;  4I9E A;  2HO1 A;  4G1T A;  3JQ0 A;  3PZD A;  3Q5M A;  3FDH A;  2PZI A;  1S0P A;  2BTD A;  4I1O B;  2J4B A;  4KVM A;  3GYZ A;  1KLX A;  5E75 A;  2IF4 A;  3I4R B;  2L0I A;  3QC1 A;  1E8X A;  1HXI A;  4ACL A;  4EBA G;  1OWP A;  1QNF A;  3MKQ B;  4HOU A;  2UY1 B;  4GCO A;  3MYV A;  3CSF A;  4AXH A;  3FUH A;  2J49 A;  3PRZ A;  1HFA A;  4I6J A;  4U0S A;  3LPZ A;  4JVS A;  3FTU A;  3ZPJ A;  1TEZ A;  4GML A;  3L16 A;  1HZ4 A;  1HU3 A;  5LX8 A;  2WQH A;  3E4B A;  4KVO A;  4UI9 C;  4UWG A;  5CHE E;  4AJW A;  3FWV A;  4EEC A;  4A3V A;  3SBS A;  4U0Z A;  4FAD A;  5LCW C;  4EQF A;  4AM9 A;  3ASG A;  3NQP A;  4JEH A;  3PEU B;  1ELR A;  5ANR A;  1OWM A;  3FUL A;  2VTB B;  5BV1 A;  1UN9 A;  4GA0 A;  3CVW A;  4JHJ A;  3CHS A;  5G04 J;  3AS5 A;  1H2V C;  3P1U A;  3RK6 A;  5G55 A;  4C9B B;  1UG3 A;  3CHO A;  3R9A B;  1B89 A;  3ONL A;  2MRI A;  3ML8 A;  2FF4 A;  4UWF A;  3UT4 A;  2WB2 A;  3I3N A;  1E96 B;  2VSX E;  3NZS A;  3UUX A;  2BF0 X;  2RD0 A;  1E7V A;  5BUZ A;  3B13 A;  2Q7F A;  3HVE A;  4ATG A;  1H2T C;  1JUQ A;  3T5X A;  3MEK A;  4I17 A;  4BT8 A;  3ONK A;  4ANW A;  3SI5 A;  2QFC A;  4HOQ A;  3APF A;  5HQ8 A;  2PM7 A;  5C2Y A;  3Q49 B;  3FUN A;  4JXT A;  3B7S A;  2R17 C;  3FTZ A;  3MJW A;  4J8F A;  1SQM A;  4XZ4 A;  3SHF A;  3LXU X;  2HM8 A;  2IQC A;  4G11 A;  5FT9 A;  2XGM A;  4JL0 A;  5KJM A;  2WXI A;  2A5U A;  4F3V A;  1H6K A;  4ILH B;  4L1B A;  4G24 A;  4BT9 A;  2XRZ A;  1E90 A;  2WXF A;  2R59 A;  3S7F A;  3L6A A;  3MA5 A;  4OYS A;  5FQ6 A;  4APF A;  2XRY A;  4CT4 A;  4TUU A;  4N3C A;  4L23 A;  4GMJ A;  2PL2 A;  5ANL A;  1Z3Y A;  3QK0 A;  3ZW3 A;  4I9C A;  2JEK A;  4UI9 K;  3K9I A;  4TRQ A;  3D9J A;  4Q94 A;  4A1G A;  2X38 A;  3G2U A;  5EDS A;  2DCP A;  5BPP A;  2M63 A;  2YIN A;  2OV8 A;  2PQR A;  4BFR A;  3SZ7 A;  3CVQ A;  3QAR A;  3B7R L;  3LY9 A;  4PS3 A;  2J4D A;  3TG5 A;  4C0E A;  1FVF A;  1H19 A;  1UJJ A;  4N2S A;  3ZYL A;  5KCM A;  4GAA A;  2HYZ A;  4U8H A;  1Z3X A;  2J07 A;  4ACK A;  3MV2 B;  4IN3 B;  2XCC A;  1EPU A;  3FU3 A;  3JYS A;  3FU0 A;  4J8E A;  2VSN A;  4CGW A;  3BG0 B;  2XPI A;  2XPZ A;  5JJ7 A;  5FTP A;  2VGX B;  1NA0 A;  3FTY A;  4O6F A;  3LKU A;  2MOW A;  2C0L A;  3U4T A;  4AVX A;  4LER A;  4FHK A;  2FI7 A;  3PDN A;  2IU1 A;  3ZIM A;  2KCL A;  5M72 A;  2E2E A;  4FLH A;  1Z6T A;  3PS6 A;  3IHY A;  4GZD A;  4CGV A;  4JZY A;  1IQU A;  3ZHE A;  4B94 A;  2P58 C;  4AIF A;  4UWH A;  3P2B A;  1HG2 A;  2AVP A;  4G2V A;  5JHA A;  3CHP A;  1Y6I A;  3PUJ A;  4IUL A;  4LEU A;  2X3M A;  5AEN A;  3L17 A;  1IHG A;  5FQ8 A;  1TJC A;  3HVE B;  4DLQ A;  3CK9 A;  4JA7 A;  4FP7 A;  2VGY A;  3C98 A;  3EDT B;  3L08 A;  3D9P A;  4J0U A;  4UI9 J;  4GZ6 A;  2NC9 A;  2WXQ A;  2WXP A;  2AWI A;  3FTS A;  2GRL A;  5CCL A;  1JWF A;  4BWR A;  5LCW J;  4I1M A;  1IYG A;  1U3C A;  3FTW A;  1JWG A;  1OWN A;  2FBN A;  4GYY A;  2CFU A;  2FUL A;  3FH5 A;  3OXF A;  4AEZ C;  4TV3 A;  3G2W A;  3ZFW A;  3FEY A;  5CCM A;  3RRM B;  1NA3 A;  4U63 A;  3T8M A;  2CHX A;  1EYH A;  4WWN A;  3VTX A;  3PE3 A;  2UWJ G;  1HS6 A;  5KJN A;  5FZR A;  4FHJ A;  2WVI A;  3CHM A;  3R7Q A;  4DLO A;  3ZRH A;  2I6H A;  3GW4 A;  1MQS A;  3SD5 A;  3CVY A;  3UQ3 A;  4F1S A;  5D0Q D;  3CV0 A;  1HH8 A;  3FUF A;  1FCH A;  4HFG A;  3Q4A B;  4BX8 A;  2CHW A;  1DNP A;  2LNI A;  3LS8 A;  2YQ8 A;  4K0R A;  2PQN A;  3QJZ A;  4JHK A;  4F53 A;  4FA6 A;  1H0A A;  4GA1 A;  3GZ1 A;  3U66 A;  3ASD A;  1EDU A;  2WPV A;  3FU5 A;  4PH4 B;  3MGB A;  3DPD A;  2WXJ A;  3O4Z A;  5AJD A;  2AXZ A;  4CDM A;  3U3W A;  1KT0 A;  2KZT A;  2KCV A;  3Q47 B;  3VLF A;  4PDX A;  1FVH A;  5FZS A;  1L5J A;  1INZ A;  4P29 A;  4MS6 A;  4MLP A;  4F7A A;  4R7L A;  1DVP A;  1H2U A;  2WXH A;  3RJV A;  4A1S A;  3RU0 A;  1NP7 A;  2V5F A;  2LAI A;  3IEG A;  4UQX A;  3ZYM A;  1HF8 A;  2IJG X;  3JUI A;  3JQ1 A;  3I4G A;  4FC8 A;  4CDN A;  3QKY A;  4B8C B;  4CT0 A;  2CG2 A;  2WXO A;  3L22 A;  2VSY A;  1XGW A;  2IOS A;  2WXK A;  3PE4 A;  3OXL A;  5EX3 A;  4KXK B;  3RKV A;  3U9W A;  2XGS A;  1TJF A;  4CCA A;  4Y6W A;  4GZC A;  5T3R A;  3CHR A;  5T4Y A;  4M3O A;  2WXL A;  5LP0 A;  3LVR E;  2NSZ A;  2VSO E;  3LY8 A;  3CVN A;  3RO2 A;  3CQG B;  4ABN A;  5CMW A;  5KJK A;  2V8S E;  3RO3 A;  3QWV A;  4KT6 B;  2CFZ A;  3UMV A;  3MKQ A;  4AV7 A;  4GZ3 A;  3HDX A;  4XI9 A;  3ZGQ A;  4N3A A;  3BEE A;  3G2V A;  3FU6 A;  3R7R A;  1ELW A;  3B7U X;  3G2T A;  3S7D A;  4APO A;  2OOE A;  3FP3 A;  4HXI A;  3S7B A;  5DIZ A;  3EHN A;  3MZL B;  3APC A;  1VDY A;  3ML9 A;  2MHK A;  4LCT A;  4HVB A;  4AY6 A;  3QDN A;  1WAO 1;  4C0M A;  2OVF A;  3VLD A;  4ANV A;  3MKR A;  3CK8 A;  3GZ2 A;  1OWO A;  3QAQ A;  5G05 C;  2ION A;  4AOF A;  4EPZ A;  3QB2 A;  5JJT A;  1WM5 A;  3FY4 A;  4WNG A;  2XEV A;  5KJL A;  2VTB A;  5HI7 A;  2XHE A;  5BNW A;  2VQ2 A;  2BUG A;  3SNX A;  4EZK A;  5BT1 A;  3EIJ A;  4URK A;  3ZVV A;  5EKQ D;  1GW6 A;  5D0O D;  3NF1 A;  2C0M A;  1A17 A;  4FU3 A;  4H7Y A;  4I2Z A;  4L2L A;  4BTB A;  2L9B A;  3L13 A;  4YVO A;  4I43 A;  5ARG A;  3RIB A;  4GB9 A;  4ILI A;  3OAW A;  1E8W A;  2ILR A;  3D9M A;  4AY5 A;  4E85 A;  4WND A;  4DK5 A;  2KZT B;  4I6E A;  2Y4T A;  3MV3 B;  3CKC A;  4HLE A;  2WQ7 A;  3ASH A;  3CLJ A;  4FJY A;  5J90 A;  3CVV A;  2WXG A;  1E8Z A;  4RSY A;  4GYW A;  2R5S A;  2L6J A;  3D9I A;  3FUD A;  1QZ2 A;  1YA0 A;  5E76 A;  2A4Z A;  4DI3 A;  4EZJ A;  4GYO A;  4GA2 A;  4KYO B;  4LUN U;  4N2Q A;  1SZ9 A;  3ENE A;  2GW1 A;  3G2S A;  4Y6C A;  4BTA A;  4J8D A;  4DI4 A;  3CHQ A;  4KBQ A;  4V3I A;  3WXX A;  4WNE A;  5ENN A;  3CVU A;  3VLE A;  3FTV A;  3TJP A;  1QQE A;  4GPK A;  3HIZ A;  3SGH A;  3FH7 A;  2KM4 A;  4MKT A;  4U04 A;  3TL5 A;  5FQ4 A;  1MHQ A;  4HOR A;  2RG8 A;  3B7T A;  4JPS A;  4WWO A;  4JW1 A;  4RG6 A;  3I5P A;  4OVU A;  2YHC A;  3LYA A;  1E7U A;  3EHM A;  5C1D A;  3LDZ A;  1ELK A;  2X6F A;  4FUL A;  2DIW A;  3IV0 A;  4WNF A;  2DBA A;  3IKO B;  2LAH A;  4E6H A;  5ARF A;  2PM6 A;  2VYI A;  2V4L A;  2GRM A;  3KEZ A;  2AW6 A;  3AS4 A;  3D9L A;  1EF1 C;  5LFA A;  2VJ8 A;  3D9N A;  4N5C A;  4HOS A;  2WM9 A;  2X6I A;  4CDR A;  1UW4 B;  3D3M A;  2E0I A;  3FUM A;  4GZ5 A;  1HE8 A;  2GGF A;  2WMO A;  4YND A;  3UPV A;  2I9C A;  2KCK A;  2WMN A;  3FUK A;  3LVQ E;  3ZYQ A;  1PC2 A;  2NXP A;  3FEX A;  5FWQ A;  4JEU A;  3Q15 A;  3BG1 B;  3JCK C;  2HR2 A;  4KMO A;  4L7T A;  2IFU A;  2ZU6 B;  3CEQ A;  3CGH A;  4XI0 A;  4MRU A;  4DPR A;  5T8I A;  4QFV A;  2VGX A;  2OND A;  4WUY A;  3FFL A;  3UX4 A;  4B89 A;  3CVL A;  3LJ3 A;  3UT7 A;  4RG9 A;  4EZL A;  4PS8 A;  4BY6 A;  4DJA A;  2L0T B;  4G26 A;  5A23 A;  2I1J A;  2EQX A;  3KAE A;  5BW8 C;  1LF8 A;  4XKB A;  4AP2 A;  3AU5 A;  4WAF A;  3CVP A;  3HYM B;  2LSV A;  4JC8 A;  4KZC A;  3CQC B;  3KD7 A;  2WQ6 A;  4CEM A;  2I2O A;  2KAT A;  1U3D A;  3PRE A;  3N71 A;  1HO8 A;  3UT8 A;  3ZHE B;  4N39 A;  3TXN A;  1IQR A;  3FUE A;  4UWL A;  1BPO A;  1Y8M A;  3CVX A;  3GZS A;  1ZBP A;  1NZN A;  5G04 C;  3FUJ A;  4EBA A;  5FJY A;  2YNQ A;  4UQY A;  2J9Q A;  2X6J A;  3RRN B;  3PNL B;  4L2Y A;  4U0U A;  2FO7 A;  1HX8 A;  4JHR A;  5FZQ A;  2YHE A;  3SF4 A;  4OVV A;  3LY7 A;  4B8A A;  5G05 J;  3ZEF A;  3AU4 A;  2UY1 A;  2WXN A;  3PNT B;  3HHM A;  4I6G A;  4ANU A;  3CST A;  2FEZ A;  4NUR A;  4PUC A;  3CIA A;  1PY1 A;  3EJN A;  3ESL A;  3S7J A;  1XNF A;  4A3T A;  5LOZ A;  3QNK A;  3IHV A;  3ESK A;  2Y3A A;  3FTX A;  3PVL A;  3ASF A;  3CK7 A;  3TGO A;  4KZ0 A;  4IRU A;  4RVB A;  4G25 A;  4D10 C;  2LSU A;  3TXM A;  3CR3 A;  4Q96 A;  4CRW A;  1ZU2 A;  2AXV A;  2J09 A;  4XKC A;  3D9O A;  5CMY A;  4H7X A;  4ME2 A;  3TAX A;  3SFZ A;  2LO6 A;  3DBS A;  5DBK A;  1HG5 A;  3SBT B;  4K03 A;  4B0Z A;  2XGO A;  5AJL A;  5EX0 A;  4N3B A;  3U64 A;  4GCN A;  5A6C A;  3OXG A;  3T5V A;  3MX3 A;  3URZ A;  4UWK A;  3S2A A;  4BX9 A;  4XE0 A;  2X6K A;  3PEV B;  4PS7 A;  4JA9 A;  3LCA A;  4I2W A;  4J8S A;  4WWP A;  2QY7 A;  2I1K A;  4GU5 A;  4J6I A;  4NRH B;  4ANX A;  3ZN3 A;  1P5Q A;  2WXR A;  3NZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...