4XI0A

Mama 41-end from desulfovibrio magneticus rs-1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
177
structure length
177
Chain Sequence
AMGDKAKLYRNISQRCLRRGSPEEALRYLKEWARHEKNDPEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTAAEHFTKVMELERSQDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MamA as a Model Protein for Structure-Based Insight into the Evolutionary Origins of Magnetotactic Bacteria.
pubmed doi rcsb
source organism Desulfovibrio magneticus rs-1
molecule tags Protein binding
molecule keywords Magnetosome protein MamA
total genus 71
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi0A00
4H7XA 4CDRA 3RIBA 4U0SA 4NRHB 3JYSA 3LKUA 3UPVA 3NF1A 3PE4A 4J0UA 2R5SA 4N5CA 4UI9C 5EX0A 5JJ6A 3QKYA 3QWVA 4WNDA 3N71A 2C0LA 3CKCA 2PQNA 4U0ZA 4JL0A 2C2LA 1WAO1 4HOTA 5KJNA 2VYIA 4GYYA 1YA0A 1ZBPA 4AY5A 4JA7A 2KCVA 2KCLA 3ZHEB 3MV2B 2YHCA 5DBKA 3URZA 4XIFA 1P5QA 2FBNA 4N2SA 5EX3A 2FO7A 4HOSA 3CKBA 4U07A 1QQEA 4G24A 3KAEA 4I1AA 2HR2A 4G26A 3E4BA 2XCCA 3FWVA 2XPIA 1QZ2A 2IF4A 3S7DA 4GZ3A 4I2ZA 3OXFA 5BNWA 5G05J 2KATA 4HOUA 1A17A 2PL2A 3K9IA 4GZ5A 1ELWA 4I17A 2LSVA 5FT9A 5CCLA 5LCWJ 2PQRA 4XI0A 1IHGA 3PDNA 5CHEE 5KJLA 2V5FA 3ASGA 5EKQD 5LCWC 4YVOA 3U4TA 2LNIA 4J8FA 3FFLA 4H7YA 3RU0A 2XGSA 4BWRA 4GZ6A 3WXXA 4AY6A 5G05C 3QDNA 3IEGA 1PC2A 3CK9A 2VGXB 3FP3A 2OOEA 3U3WA 1KLXA 4ME2A 3ASFA 1IYGA 4IN3B 5M72A 4UI9K 1HXIA 4BTAA 3R9AB 4O6FA 5D0OD 1Y8MA 4F3VA 3MV3B 3Q47B 4GCNA 4WUYA 3ZGQA 3MEKA 3CVPA 4Y6WA 2XGMA 3ZHEA 4APOA 4KXKB 3QOUA 1ELRA 3BEEA 2MHKA 4KYOB 2VSNA 3SF4A 4A1SA 4I9CA 3S7JA 2BUGA 3OXLA 2VGXA 3LY7A 3MKRA 4W9RA 2Y4TA 3QWPA 4JA9A 2AVPA 1KT0A 5JJ7A 5JJTA 5G04J 4J8EA 3LY9A 5D0QD 2FI7A 3CK7A 1OUVA 3TG5A 1HH8A 1KT1A 4JHRA 4KBQA 3RJVA 5G04C 4HOQA 3PE3A 4NQ0A 4YNDA 4CGVA 5KJKA 4G25A 5HQ8A 3Q49B 4UQZA 4RG9A 3Q5MA 4N3BA 4UQYA 3ASHA 2HYZA 2VGYA 3ESKA 3LYAA 3ZPJA 2XEVA 2UWJG 5ARFA 3EDTB 4BT8A 1ZU2A 3CVLA 3LY8A 3GZ2A 2Y4UA 5DIZA 5FTPA 3KS2A 5FZQA 2PZIA 2FF4A 3CEQA 5BW8C 4BT9A 2XGOA 1WM5A 2DBAA 2LSUA 3GW4A 4GYOA 2VSYA 4N39A 2NC9A 2YQ8A 3HYMB 4UQXA 3ASDA 4N3CA 4YVQC 2QFCA 3GYZA 5HI7A 3CV0A 3TG4A 5BT1A 2KCKA 3ZN3A 4AIFA 1W3BA 1XNFA 5KJMA 2XCBA 3LCAA 3CVNA 4WNFA 4WNGA 3SZ7A 3S7FA 4ABNA 4I2WA 5FJYA 5AYWD 3RO3A 2HO1A 1NA3A 4Y6CA 1E96B 3UUXA 4GPKA 2I6HA 1B89A 3GZ1A 2JLBA 3ZFWA 4U0UA 2VQ2A 5CCMA 2KC7A 4G1TA 4UI9J 3KD7A 3QWWA 2WQHA 3Q4AB 4N3AA 1HZ4A 2J9QA 1FCHA 2GW1A 3MA5A 4GA1A 3S7BA 3AS8A 3Q15A 4RG6A 5C1DA 4J8DA 4AM9A 4G2VA 2UY1A 4U04A 4XI9A 2FEZA 3RO2A 4CGWA 4I9EA 5A7DB 3RKVA 1NZNA 2E2EA 4GCOA 4EQFA 4GA0A 4WNEA 2P58C 3VTXA 4G23A 3VTYA 4GA2A 3UQ3A 3AS5A 2L6JA 4HORA 3LPZA 3TGOA 3OXGA 1TJCA 2WPVA 3AS4A 3O48A 2Q7FA 1NA0A 3TAXA 4N2QA 4B94A 4GYWA 3ULQA 4BTBA 2IFUA 4LEUA 5ARGA 5FZRA 3CK8A 2UY1B 3CVQA 2ONDA 2C0MA 5FZSA 5A6CA
chains in the Genus database with same CATH superfamily
3RIBA 3TWXA 4JVSA 4JD2G 5AQ9A 4U0ZA 1WAO1 1TYQG 3JXIA 1OWNA 3PZ4A 1N4QA 3I4GA 4UWLA 1QZ2A 4DI3A 2KATA 4L1BA 5FINA 3ZU7B 3UM2A 3U4TA 3UM3A 3ZEFA 3QB2A 5EYLA 2MRIA 1OWOA 4DJAA 4J8YA 2DIWA 2DYRE 2H6GA 4CDMA 1SQMA 3UT7A 4GTMA 4W9RA 2XQ0A 1K1BA 2DWZA 3D9IA 3PS6A 2F0YA 3ABME 3FH5A 2X6FA 4FU3A 3U3WA 1HG2A 4N3CA 3CV0A 4AXHA 2XCBA 4WNFA 1SZ9A 4A63B 1E96B 5EN5D 1S0PA 2PNNA 3UT8A 4G1TA 3QJZA 2IY0C 3MA5A 4L2YA 3ULEG 4CEMA 4ANWA 4AOFA 3FTWA 4LEUA 1HS6A 2XPZA 3NB2A 4NRHB 2Y69E 5JJ6A 4J0UA 1N4PA 4FJZA 1FVHA 5DBKA 3R9MA 3CKBA 1IQRA 4JHKA 5KNHD 3L82A 2XPIA 1N9AA 3ZNGA 4GZ3A 4G8KA 4ACKA 5G05J 3Q7FA 2V5QC 5CCLA 3PH0C 4GAAA 3CR3A 4F53A 4J8FA 2LUHA 3IEGA 4GZCA 3CQCB 4IN3B 2IOSA 3PZDA 3IV0A 3ONLA 1ELRA 3BEEA 1HX8A 4CZ2D 3OXLA 3MKRA 3CVVA 4KZ0A 3D9HA 1HH8A 5KJKA 4U7EB 1OCRE 3J5QB 1UN9A 3FTXA 1XGWA 5BT1A 4IYPA 2L0TB 1NA3A 5AENA 3QC1A 3LVQE 5KWDA 4YDEA 5A7DB 4HB5A 3UIOC 5LFAA 3CVUA 3B95A 2VJ8A 3B7UX 4ILHB 5BV0A 1O5MA 2J09A 4RQIA 3CK8A 4XZ4A 5FZSA 5BUZA 4AIFA 1A5EA 3L9TA 2VYIA 4KMOA 4GPMA 2LXLA 3CQGB 3VLEA 1QQEA 4GTSA 4I1AA 4ACLA 4MKTA 5CRVA 2YINA 4I2ZA 4JC8A 2X6IA 2V5FA 5AN8A 3FP3A 2X6KA 4XEIG 5KBAA 1N11A 3ZGQA 1TN8A 4KXKB 3PNTB 4U8VD 4PS8A 2VSNA 3O4ZA 1RZ4A 3FH8A 3ISMC 3DSWA 3C3RA 3C3QA 4PDXA 3V2XA 2IU1A 4RVBA 3ABKE 2FF4A 4K5CA 2VSYA 3TG4A 3CSTA 3KEAA 3ZFWA 3FUIA 4F6RD 3S7BA 4U04A 4UWGA 2OVFA 2WXRA 1U3CA 5ENQD 3LPZA 4EHMA 3TAXA 2VSXE 3CHPA 3CVQA 3DSTA 4YDOA 3D9OA 5CEAA 3UPVA 3C5RA 2C0LA 2C2LA 1ZBPA 4BERA 4AY5A 1H2VC 4N2SA 1S64A 3FDHA 1OCCE 1LF8A 5LCWJ 5CHEE 3PREA 1QNFA 1JWGA 4HS2A 1PC2A 3ENEA 3T5XA 3EHRA 3R9AB 3DXMG 3TWTA 3Q47B 4GCNA 2EQXA 3E32A 1EDUA 3FUFA 2VGXA 3MZLB 3ESLA 1LD8A 4Q94A 4AJWA 3ZVVA 5FQ8A 4HOQA 4YNDA 4DRXE 4EZJA 1JWFA 4N3BA 4RG9A 1UW4B 1H6OA 2LAHA 1PY1A 3EDTB 3GZ2A 5FTPA 2XGOA 1WM5A 2OVBA 2OEWA 3GYZA 3EU9A 2KCKA 3SO8A 3FU6A 2Y1LE 4YDYA 3ZN3A 3SZ7A 3AG3E 4MRUA 4UWFA 3EIQC 2PM6A 3ASNE 4CYMD 2DCPA 4L9PA 5C1DA 5AIJA 3DSSA 3DPYA 1UJKA 4EQFA 1L5JA 4G23A 2RKKA 4GA2A 3DBSA 3UQ3A 2P9LG 2R59A 2UY1B 1Z3YA 3TWQA 4XX5A 2CFZA 4DLOA 3B7BA 2WXPA 4AV7A 5ENNA 1P5QA 4OAUC 2FO7A 3MX3A 2IF4A 2ZISA 3ABLE 4HOUA 4GZ5A 1V54E 5KJLA 4AY6A 4ME2A 1HXIA 4O6FA 2P9NG 4GTVA 3BU8A 4JZYA 5FQ6A 1OCOE 4LG6A 3V2OA 5JJ7A 1KT1A 1KZPA 3UXGA 5G04C 4G25A 4BFRA 2V0PA 4BT8A 3Q75A 4U8YD 5M72A 2WQ7A 2DBAA 4FLBA 2YQ8A 5CECB 3NAWA 4R7LA 1W3BA 3NZUA 3FH7A 1FVFA 3OTNA 4GPKA 3E37A 2VQ2A 2WQHA 1O1RA 2J9QA 2QZAA 1K1AA 1MX4A 3TL5A 1HG5A 3RO2A 1MX2A 3UT4A 4ILIA 5G55A 5T4YA 3SFYA 4LCTA 4MS6A 3HXFA 2BF0X 4LRZA 4K5BA 1E8YA 1Y6IA 2ONDA 1V55E 3PNLB 5EYPF 4AP2A 4NIKA 4G8LA 1OY3D 3FU3A 4QQIA 5EIDA 4JA7A 3EJNA 1MX6A 1NFIE 1TNYA 3UMVA 3ZW3A 5J08A 3LEWA 2BKKB 1S70B 1Z5SC 3FTUA 4U8HA 3S7DA 3D3MA 1H19A 4XI0A 3UKRG 5LCWC 3WXXA 4OYSA 4TUMA 4O1OA 3PEUB 1AP7A 4F3VA 2AW6A 5AAOA 5BV1A 5JHBA 1YYHA 1OWMA 4LERA 4LNGA 3D9LA 3ZXPA 4DI4A 3Q7AA 4RLYA 4UQZA 3ZPJA 4JHJA 2XS8A 5B1BE 1SW6A 5FZQA 2VTBB 3SHFA 4N39A 2QFCA 2IONA 3LCAA 2V4LA 1H2UA 3RO3A 4ZFHA 3QK0A 3CHRA 1D8DA 2B6CA 4RG6A 4XI9A 1NZNA 4GA0A 4WNEA 3MYVA 3D9JA 4TRQA 2EIME 2EIKE 2X6HA 4PH4B 4J7WA 4B94A 5JA4D 1Q2ZA 4FLHA 2OCCE 4FHKA 3SFXA 3L08A 3S2AA 3HVEA 5H7PA 3QWVA 4WNDA 3ZRHA 4L7TA 3HXCA 3SFZA 2PQNA 3F6QA 4GTPA 1E8XA 4MLPA 2YHCA 4I1MA 2WMOA 4FADA 4G24A 3LDZA 3OXFA 1FT2A 4HFGA 4I17A 1ELWA 2YHEA 2X6JA 3FUKA 4I43A 3CGHA 3U9WA 3BG1B 1DCQA 2P9IG 5CBOA 3MKQB 2X38A 1TN7A 1E7VA 1K3ZD 4C9BB 3DRAA 2XZDG 2P9PG 2Y4TA 3QWPA 5JJTA 4HRNA 4HLEA 4JHRA 4KBQA 3CHOA 3AJIA 3L54A 2CHXA 2XEVA 4LNBA 3TWSA 5ITZF 4L2LA 2PZIA 4UQXA 2L6BA 5HI7A 4KVMA 2DZOA 4D10C 3UM0A 4EZLA 2Y3AA 5FJYA 3GZ1A 4G11A 2FO1E 2GW1A 2KM4A 3I4RB 4I6JA 4EBAA 2WXMA 4JEUA 3I3NA 3SGHA 3B7RL 1TN6A 2AWIA 4GYWA 2V4HC 5D66A 1H6KA 2L9BA 3MCXA 5ARGA 5FZRA 2L0IA 3IXEA 3MV2B 4H7XA 4U0SA 1OWLA 3T9KA 3D9KA 5B1AE 3N71A 5AARA 3R7RA 1UN8A 4GYYA 1YA0A 5J90A 2KCVA 1AWCB 3UKUG 2VGEA 4GTQA 4B89A 4G26A 3D9MA 3RRUA 3NOGD 1IXVA 2HM8A 4P29A 1HE8A 2IO2C 3KSLA 4GZ6A 5G05C 4JEHA 1Y8MA 2AJAA 4ILGA 4PS7A 3SF4A 2A5EA 1E90A 2QYUA 4GTTA 3ONKA 3GZSA 4NQ0A 4PUCA 3UI2A 3ASHA 2VGYA 4RSYA 3HDXA 1DVPA 3VLFA 2GRLA 4LNUD 4WWPA 5C2YA 4TXPA 4A3VA 4ABNA 2GRMA 1INZA 3W9FA 4UI9J 2BKGA 3Q4AB 2QYJA 3NQPA 4E85A 4BESA 3APCA 1WDYA 4Q69A 3FEXA 2H6IA 1H2TC 4ATGA 4OVVA 3TGOA 2WXIA 4HQDA 2ETCA 4NURA 2GRRB 2WXLA 3C3OA 1SA4A 2R5SA 3DSUA 3PZ1A 4ATZD 1BU9A 3V30A 1N0QA 1EPUA 3DSXA 3PRZA 5EX3A 2B0OE 3TJPA 4MBGA 2CHWA 4FC8A 1WG0A 2ILRA 3TWVA 5AQBA 3BQOA 4TUUA 2LNIA 2X3MA 4BWRA 3FUNA 4FA6A 3TXNA 3X2QE 3IBEA 1O1SA 4APOA 1LD7A 1X81A 2A4ZA 2ZXWE 1UG3A 4J8EA 4BX9A 5T8IA 3TG5A 5ENOD 3RJVA 3APFA 3MJWA 3LY8A 5DIZA 5ENSD 5KJMA 4WNGA 4BSXA 1OXJA 2WMNA 2QY7A 3PZ3A 2LO6A 3L6AA 1E7UA 3UX4A 3Q15A 2GROB 3EHNA 3VTXA 3VTYA 3U66A 1TNOA 2Q7FA 1NA0A 3ULQA 2R02A 2DYSE 3FUJA 1NP7A 1IQUA 1JCRA 3AU4A 4GTRA 1QBQA 2WB2A 3URZA 2WXFA 4GZDA 2EILE 4HI9A 2HR2A 3P2BA 5D2MC 3FWVA 4JPSA 2XEEA 3DSVA 1VDYA 4GMRA 2LSVA 3IKOB 3C98A 3PVLA 2H6HA 4EPZA 1S63A 1EF1C 3QDNA 3SQVA 2P9UG 3CHMA 2WXGA 4BTAA 1N94A 5EIBE 3ZHEA 1TNBA 2GRPB 4AEZC 2J08A 3MKQA 3Q9UC 2AVPA 2XEHA 3ML8A 5ANLA 3PE3A 3NZSA 3Q5MA 2HE0A 3BUAA 2V8SE 4GTOA 2RFAA 2R2LA 4DK5A 1HFAA 3KEZA 3GW4A 4V3IA 1SZAA 1XNFA 2WXKA 1N52A 1HF8A 4HLLA 4I2WA 4Y6CA 4HRMB 2GRQB 3HXEA 4NACA 1BPOA 4N3AA 1BI8B 2M63A 2UY1A 4G2VA 5CMYA 2H6FA 1KPSB 4PS3A 4L23A 3ULYA 2WXHA 3B13A 3DWLG 3P1UA 5JMND 5BXUA 1HU3A 1RW2A 3L22A 3Q78A 2R03A 5A23A 1D8EA 3QKYA 1G3NB 5ANRA 3E33A 4JL0A 3U64A 4BY6A 3HRAA 4XIFA 4HOSA 2XZTG 3VLDA 4N5QA 5BNWA 3G2WA 1BI7B 2RD0A 1MYOA 5FT9A 2QC9A 4ZHBA 5BPPA 2ZIRA 3LXUX 4UUCA 2JEKA 1IYGA 2AXZA 2NXPA 3LVRE 3CVPA 2XGMA 3AG4E 2E0IA 1JCSA 4DX5D 4I9CA 3S7JA 2BUGA 4JB8P 2FI7A 1ELKA 3Q79A 1DCEA 4CGVA 3FTVA 3Q49B 4TXRA 4UQYA 3CVXA 3HXBA 4A1GA 1H0AA 2LSUA 5G2NA 4CRWA 4QFVA 4AVXA 3EIJA 2DVWA 5AYWD 3V79K 2HO1A 2I6HA 1N4RA 2J8SD 4DPRA 3PEVB 4GA1A 1FCHA 3CVYA 4U95D 4DLQA 4CGWA 4C0EA 3ZYKA 4WWOA 1UJJA 3FUEA 2FULA 4HORA 3OXGA 3O48A 3V31A 4O60A 3IHYA 3LKUA 2F8XK 1YCSB 1TEZA 4DUIA 2BTDA 3Q9NC 3DPDA 3JQ0A 3E4BA 3DEOA 4BX8A 4CDNA 5FQ7A 1NL4A 1MJ0A 1IHGA 5KNGA 5EKQD 5ENRD 2PM7A 3SBSA 3CK9A 2CHZA 3RSEG 1N0RA 4UI9K 3MV3B 5ENTD 2P9KG 3BG0B 3B7TA 4WUYA 4Y6WA 4M3OA 4KYOB 4CT0A 4EECA 3EHQA 4EZKA 4F7AA 1OCZE 2VTBA 1KT0A 5G04J 4HNAD 5D0QD 4B93B 2LXMA 2XENA 4HRLA 4BSZB 3JCKC 3ASOE 3PUKA 3KS2A 3CEQA 3EUVA 5LP0A 5EDSA 2WXJA 3RK6A 3CIAA 3SBTB 1HO8A 4O1PA 5HS0A 2F8YA 3G2VA 3PZ2A 1DC2A 4B0ZA 4F1PA 3DXKG 2ZGGA 4CDRA 3JYSA 4GMJA 2J4BA 4F1SA 5EX0A 4OVUA 3NOCD 5FIOA 1IHBA 2KCLA 2I1KA 4HXIA 3FTYA 1N54A 3FUMA 3KAEA 3CLJA 4CT4A 3T8MA 3FU5A 3K9IA 4EBAG 2KZTB 2J07A 3PDNA 2CFUA 3ASGA 4YVOA 3RU0A 4BETA 2R17C 4DX7D 3UTMA 3FTSA 3IHVA 4Z68A 2CG2A 5D0OD 5HKPA 2OEVA 4K5AB 3QOUA 4I6EA 4A1SA 4JW1A 1KZOA 3TWUA 3LY7A 4XKCA 4ANUA 3CK7A 1OUVA 5LOZA 1YMPA 3LJ3A 3SI5A 4XE0A 3ESKA 2HYZA 1MZCA 3LYAA 4GB9A 3TXMA 3J5PA 1ZU2A 2Y4UA 2J49A 3LS8A 3FU0A 4KZCA 5CEDB 3S7FA 1MQSA 4U0UA 5CCMA 2KC7A 1HZ4A 1BLXB 4DX6D 4DX1A 2FEZA 1O1TA 2KXPC 4GCOA 3ZXSA 4XKBA 2OV8A 3AS5A 4U96D 2L6JA 4URKA 4OAVB 1TJCA 2WPVA 3CHSA 5E76A 1D9SA 2I9CA 3RRMB 3L16A 3RRNB 3CHQA 3PE4A 4N5CA 5ENPD 4BEPA 3D9PA 2RG8A 4FP7A 2EINE 2J4DA 4E6HA 5CRUA 2ETAA 2A5UA 3ZHEB 3FUHA 3HG0D 4U07A 3EU5A 3QNKA 2AXUA 3KSQA 1GW6A 2EIJE 2WQ6A 3PUJA 1SVXA 3ZYMA 3L17A 1OWPA 1QYMA 2VGXB 1TR4A 4DX2A 3ASFA 2KBXA 3QAQA 3HIZA 3RAUA 2WXQA 1UOHA 4K03A 5B3SE 3JQ1A 3AU5A 2MHKA 1X5BA 3MGBA 3T5VA 1H6PA 2P9SG 5IY5E 1N95A 1Z6TA 3D9NA 2GGFA 1E8ZA 4C0MA 5ARFA 4FHJA 1FT1A 4YVQC 3G2TA 1JPLA 3ZYQA 2IJGX 3UUXA 1LTXA 2IEJA 5FWQA 5T3RA 4B8CB 4I9EA 2E2EA 3AG2E 3ZIMA 4J8SA 4A3TA 4KT6B 1JCQA 2LAIA 2IFUA 3G2UA 5AJDA 4K0RA 3LJNA 3CKCA 4HOTA 2FBNA 4KVOA 5CERB 3CVWA 2F37A 2BEDA 2ETBA 2GRNB 2Y0BG 5FQ4A 2ZGDA 3E34A 2PL2A 4FULA 5AJLA 1WY6A 3G2SA 2OOEA 4CCAA 3CSFA 3UINC 3UIPC 4HBDA 4ANVA 3HXDA 4JXTA 5EILA 2XS1A 1NI1A 1TNZA 2ZU6B 2IQCA 4HI8A 2NSZA 5BXOA 3FHEA 1SA5A 1PAQA 5CBNA 4WWNA 2XRZA 5HQ8A 2I2OA 3APDA 1EYHA 4LUNU 3Q73A 1U3DA 2CG3A 2XPYA 4GMLA 3HYMB 1U2VG 3ASDA 3FY4A 5KCMA 4N2QA 3CVNA 4X8QA 3EHMA 3SY2A 3ZYLA 3TWWA 3E30A 2JLBA 2XRYA 3KD7A 3QWWA 3B7SA 4M7CA 3AS8A 4J8DA 2JABA 2NYJA 4ANXA 2P58C 1MHQA 2WXOA 4UWKA 3AS4A 4IRUA 4A55A 1TNUA 4BTBA 5AQ7A 5A6CA 1ZB1A 4YDWA 3NF1A 4UI9C 2RFMA 4I6GA 3T8KA 1TJFA 3NBNB 4TV3A 5LX8A 3FEYA 4J6IA 4IULA 4Q96A 5KJNA 5AQAA 3SD5A 2MOWA 2WM9A 2XCCA 3OAWA 1A17A 1N4SA 3ZKJA 5E75A 2PQRA 3FUDA 3FFLA 4H7YA 2XGSA 2AXVA 5HRYA 1KLXA 1FPPA 4U63A 4LSZE 3TWRA 3W9GA 4APFA 3MEKA 1E8WA 4HVBA 3FULA 4TXQA 2IO3C 5JHAA 3AAAC 2R05A 3JUEA 4JA9A 2YNQA 2DZNA 3LY9A 2WVIA 1JUQA 2P2CP 3WG7E 3SNXA 4B8AA 2UWJG 3CVLA 1OT8A 4BT9A 5BW8C 4GYOA 2NC9A 3JUIA 3I5PA 2VSOE 5CMWA 4WAFA 3DEPA 4UWHA 4C48B 1B89A 4GU5A 3JXJA 3L13A 4FJYA 1DNPA 1IKND 4I1OB 1BD8A 2IOLA 4AM9A 1K8KG 3FTZA 3AG1E 3UM1A 3RKVA 2MYOA 3ZUVB 3HVEB 3R7QA 2I1JA 2WXNA 3QARA 3ML9A 2XHEA 3HHMA 1Z3XA 3C72A 2KZTA 2C0MA
chains in the Genus database with same CATH topology
4CDRA 3RIBA 3JYSA 4GMJA 2J4BA 4XX5A 4F1SA 2WXLA 4JVSA 2R5SA 4OVUA 5EX0A 2CFZA 4DLOA 4U0ZA 1WAO1 2WXPA 4AV7A 5ENNA 1EPUA 2KCLA 3PRZA 1P5QA 2I1KA 1OWNA 5EX3A 2FO7A 4HXIA 3FTYA 1N54A 3FUMA 3KAEA 3I4GA 4UWLA 1QZ2A 2IF4A 3CLJA 3MX3A 4CT4A 4DI3A 3T8MA 3TJPA 2KATA 3FU5A 4HOUA 4L1BA 2CHWA 4FC8A 3K9IA 4GZ5A 2ILRA 4EBAG 2KZTB 2J07A 5KJLA 3PDNA 2CFUA 3ASGA 4TUUA 4YVOA 3U4TA 2LNIA 3RU0A 3QB2A 3ZEFA 4AY6A 2X3MA 2MRIA 1OWOA 3FUNA 4BWRA 4FA6A 2R17C 4DJAA 3FTSA 3TXNA 4ME2A 2DIWA 3IBEA 1HXIA 3IHVA 4O6FA 2CG2A 5D0OD 4CDMA 4JZYA 1SQMA 4APOA 3UT7A 3QOUA 4I6EA 4A1SA 4JW1A 2A4ZA 5FQ6A 3LY7A 4W9RA 4XKCA 4ANUA 2XQ0A 1UG3A 5JJ7A 4J8EA 4BX9A 3CK7A 5T8IA 1OUVA 3TG5A 1KT1A 5LOZA 3LJ3A 3RJVA 5G04C 4G25A 3D9IA 3PS6A 3SI5A 4XE0A 3ESKA 2HYZA 3LYAA 4BFRA 3APFA 3FH5A 2V0PA 4GB9A 3MJWA 4BT8A 2X6FA 3TXMA 1ZU2A 3LY8A 2Y4UA 5DIZA 2J49A 5M72A 3LS8A 2WQ7A 2DBAA 4FU3A 4FLBA 3U3WA 2YQ8A 3FU0A 1HG2A 4KZCA 4N3CA 3CV0A 5KJMA 4R7LA 1W3BA 3NZUA 2XCBA 4WNFA 4WNGA 4AXHA 3FH7A 4BSXA 1SZ9A 3S7FA 1MQSA 1FVFA 2WMNA 1E96B 3OTNA 4GPKA 2QY7A 1S0PA 4U0UA 2VQ2A 3UT8A 5CCMA 2KC7A 2LO6A 4G1TA 2WQHA 3L6AA 3QJZA 1E7UA 1HZ4A 2J9QA 3MA5A 4L2YA 3UX4A 3Q15A 3TL5A 1HG5A 3RO2A 2FEZA 4CEMA 3UT4A 4GCOA 3ZXSA 3EHNA 4ILIA 5G55A 5T4YA 3VTXA 4XKBA 4ANWA 2OV8A 3VTYA 4LCTA 3U66A 4MS6A 3AS5A 2L6JA 4URKA 1TJCA 2WPVA 2BF0X 2Q7FA 1NA0A 4LRZA 4AOFA 3ULQA 3FTWA 4LEUA 3CHSA 1E8YA 1Y6IA 5E76A 2ONDA 2I9CA 1HS6A 2XPZA 3FUJA 3RRMB 3PNLB 4NRHB 3L16A 3RRNB 4AP2A 3CHQA 3PE4A 4J0UA 4N5CA 5JJ6A 1NP7A 3D9PA 2RG8A 1IQUA 3AU4A 3FU3A 4FP7A 4FJZA 2J4DA 4E6HA 2WB2A 1FVHA 4JA7A 3EJNA 2A5UA 3ZHEB 3FUHA 5DBKA 3URZA 2WXFA 4GZDA 3CKBA 4U07A 1IQRA 4JHKA 2HR2A 3P2BA 3UMVA 3ZW3A 3QNKA 5J08A 3LEWA 3FWVA 2XPIA 4JPSA 2AXUA 3FTUA 4U8HA 3S7DA 4GZ3A 1VDYA 4ACKA 5G05J 1GW6A 2WQ6A 3PUJA 2LSVA 3D3MA 3C98A 1H19A 3IKOB 3PH0C 3PVLA 3CR3A 4GAAA 4XI0A 4EPZA 4F53A 5CCLA 5LCWC 1EF1C 3ZYMA 4J8FA 3WXXA 3L17A 3QDNA 4GZCA 3IEGA 1OWPA 2VGXB 4OYSA 3CQCB 3PEUB 3CHMA 3ASFA 3QAQA 2WXGA 4IN3B 3HIZA 4BTAA 2IOSA 2WXQA 4F3VA 3PZDA 2AW6A 4K03A 3JQ1A 3AU5A 3ZHEA 3IV0A 3ONLA 4AEZC 1ELRA 3BEEA 2J08A 2MHKA 5BV1A 1HX8A 1X5BA 1OWMA 3MGBA 3MKQA 4LERA 3OXLA 5JHBA 3MKRA 3T5VA 3D9LA 2AVPA 3CVVA 4KZ0A 4DI4A 1HH8A 3ML8A 5ANLA 3PE3A 5KJKA 3NZSA 4UQZA 1Z6TA 3D9NA 3Q5MA 3ZPJA 1E8ZA 2GGFA 4JHJA 4C0MA 1UN9A 2V8SE 5ARFA 3FTXA 4FHJA 4DK5A 5FZQA 2VTBB 1XGWA 3SHFA 1HFAA 3KEZA 3GW4A 4N39A 4V3IA 4YVQC 1SZAA 5BT1A 2QFCA 4IYPA 2IONA 1XNFA 3G2TA 2WXKA 1N52A 1JPLA 2L0TB 1HF8A 3LCAA 2V4LA 4I2WA 1H2UA 3RO3A 1NA3A 4Y6CA 3QK0A 3ZYQA 2IJGX 3UUXA 5AENA 3CHRA 4NACA 3QC1A 1BPOA 4N3AA 5FWQA 3LVQE 4RG6A 5T3RA 4B8CB 2M63A 2UY1A 4G2VA 4XI9A 4I9EA 5A7DB 1NZNA 5CMYA 2E2EA 4GA0A 4WNEA 5LFAA 3CVUA 3MYVA 3D9JA 3ZIMA 4J8SA 4PS3A 4L23A 4TRQA 4A3TA 2VJ8A 2WXHA 4KT6B 3B7UX 4ILHB 5BV0A 2X6HA 3B13A 4PH4B 2J09A 3P1UA 4B94A 2LAIA 2IFUA 3G2UA 4FLHA 5AJDA 3CK8A 4XZ4A 4FHKA 5FZSA 1HU3A 3L08A 3S2AA 3L22A 5BUZA 4AIFA 3HVEA 4K0RA 5A23A 3QKYA 3QWVA 4WNDA 3ZRHA 5ANRA 4L7TA 3SFZA 3CKCA 2PQNA 4JL0A 4HOTA 2VYIA 3U64A 4KMOA 4BY6A 1E8XA 4MLPA 2YHCA 4I1MA 4XIFA 2FBNA 3CQGB 4KVOA 2WMOA 3VLEA 4HOSA 4FADA 1QQEA 4G24A 3CVWA 4I1AA 3VLDA 4ACLA 4MKTA 5FQ4A 3LDZA 5BNWA 2YINA 3OXFA 4I2ZA 3G2WA 2RD0A 2PL2A 4HFGA 4I17A 4FULA 1ELWA 4JC8A 2YHEA 5AJLA 2X6IA 2X6JA 5FT9A 2V5FA 5BPPA 3LXUX 3FUKA 4I43A 3CGHA 1WY6A 3U9WA 2JEKA 3FP3A 2OOEA 2X6KA 3G2SA 4CCAA 3CSFA 3BG1B 1IYGA 3MKQB 4ANVA 2AXZA 4JXTA 2NXPA 3LVRE 3ZGQA 3CVPA 2XGMA 2E0IA 2X38A 1E7VA 4KXKB 3PNTB 2ZU6B 2VSNA 4PS8A 3O4ZA 2IQCA 4I9CA 4C9BB 3S7JA 2BUGA 2NSZA 3FH8A 3FHEA 2Y4TA 3QWPA 1PAQA 5JJTA 4WWNA 2FI7A 4HLEA 1ELKA 4JHRA 4KBQA 2XRZA 4CGVA 3CHOA 3FTVA 3Q49B 5HQ8A 2I2OA 4UQYA 3L54A 4PDXA 2CHXA 3APDA 1Z3YA 2XEVA 1EYHA 3CVXA 2IU1A 4RVBA 4LUNU 4A1GA 1U3DA 4L2LA 2CG3A 2FF4A 2PZIA 1H0AA 2XPYA 2LSUA 4GMLA 5G2NA 2VSYA 4UQXA 3HYMB 4QFVA 3TG4A 4AVXA 3ASDA 5HI7A 4CRWA 3FY4A 4KVMA 3EIJA 4D10C 5KCMA 4N2QA 3CVNA 4EZLA 2Y3AA 3EHMA 5FJYA 5AYWD 2HO1A 3ZYLA 2I6HA 3GZ1A 3CSTA 2JLBA 4G11A 2XRYA 3ZFWA 4DPRA 3PEVB 3KD7A 3QWWA 3B7SA 3FUIA 4GA1A 1FCHA 2GW1A 2KM4A 3CVYA 3S7BA 3AS8A 4DLQA 4J8DA 4CGWA 4U04A 4UWGA 4C0EA 3ZYKA 2OVFA 2WXRA 3I4RB 4ANXA 4I6JA 2P58C 4EBAA 4WWOA 1MHQA 1U3CA 1UJJA 2WXOA 3FUEA 2WXMA 2FULA 4JEUA 4UWKA 3I3NA 4HORA 3LPZA 3OXGA 3AS4A 3SGHA 3O48A 4IRUA 3B7RL 3TAXA 4A55A 2VSXE 2AWIA 4GYWA 4BTBA 1H6KA 2L9BA 3MCXA 5ARGA 3CHPA 3CVQA 2L0IA 3MV2B 5FZRA 3D9OA 3IHYA 5A6CA 4H7XA 4U0SA 1OWLA 3LKUA 3UPVA 3NF1A 3D9KA 4UI9C 4I6GA 3N71A 2C0LA 1TJFA 1TEZA 4TV3A 2C2LA 3R7RA 1UN8A 2BTDA 5LX8A 3FEYA 4J6IA 4IULA 4GYYA 1YA0A 1ZBPA 4Q96A 5KJNA 4AY5A 1H2VC 5J90A 2KCVA 3DPDA 4N2SA 3SD5A 2MOWA 3JQ0A 4B89A 2WM9A 4G26A 3E4BA 3FDHA 2XCCA 3D9MA 4BX8A 3OAWA 3RRUA 1A17A 4CDNA 1LF8A 2HM8A 4P29A 5FQ7A 5E75A 5LCWJ 1HE8A 2PQRA 1IHGA 5CHEE 5EKQD 3FUDA 2PM7A 3SBSA 3PREA 1QNFA 3FFLA 1JWGA 4H7YA 2XGSA 4GZ6A 5G05C 4HS2A 1PC2A 2AXVA 3CK9A 2CHZA 1KLXA 4JEHA 3ENEA 3T5XA 4U63A 4UI9K 3R9AB 1Y8MA 3MV3B 3BG0B 3Q47B 3B7TA 4GCNA 4WUYA 4APFA 4ILGA 3MEKA 1E8WA 4HVBA 4Y6WA 3FULA 4PS7A 4M3OA 2EQXA 4KYOB 4CT0A 4EECA 1EDUA 3FUFA 3SF4A 4EZKA 4F7AA 5JHAA 1E90A 2VGXA 3MZLB 3ESLA 2VTBA 4JA9A 2YNQA 1KT0A 4Q94A 5G04J 3LY9A 3ONKA 5D0QD 3GZSA 4AJWA 3ZVVA 5FQ8A 2WVIA 1JUQA 4HOQA 4NQ0A 4YNDA 4PUCA 4EZJA 1JWFA 4N3BA 4RG9A 3ASHA 2VGYA 4RSYA 1UW4B 3HDXA 1DVPA 2LAHA 3SNXA 4B8AA 2UWJG 1PY1A 3JCKC 3EDTB 3VLFA 2GRLA 3CVLA 3PUKA 3GZ2A 5FTPA 3KS2A 4BT9A 3CEQA 5BW8C 2XGOA 1WM5A 4GYOA 4WWPA 5C2YA 2OVBA 5LP0A 2NC9A 5EDSA 3JUIA 3GYZA 2KCKA 3ZN3A 3FU6A 4A3VA 3I5PA 3SZ7A 2VSOE 2WXJA 4WAFA 4ABNA 5CMWA 3RK6A 4MRUA 4UWHA 2GRMA 4UWFA 1INZA 1B89A 3EIQC 2PM6A 3CIAA 3SBTB 4GU5A 4UI9J 3L13A 4FJYA 1DNPA 3Q4AB 4I1OB 1HO8A 2DCPA 3NQPA 2IOLA 5C1DA 3FTZA 4AM9A 4E85A 5AIJA 3APCA 1UJKA 3RKVA 4EQFA 4Q69A 1L5JA 3FEXA 3HVEB 4G23A 3R7QA 2I1JA 4GA2A 3DBSA 1H2TC 3UQ3A 4ATGA 4OVVA 2WXNA 3TGOA 2WXIA 3G2VA 3QARA 3ML9A 2XHEA 4B0ZA 3HHMA 1Z3XA 2KZTA 2R59A 4NURA 2UY1B 2C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H7X A;  4CDR A;  3RIB A;  4U0S A;  4NRH B;  3JYS A;  3LKU A;  3UPV A;  3NF1 A;  3PE4 A;  4J0U A;  2R5S A;  4N5C A;  4UI9 C;  5EX0 A;  5JJ6 A;  3QKY A;  3QWV A;  4WND A;  3N71 A;  2C0L A;  3CKC A;  2PQN A;  4U0Z A;  4JL0 A;  2C2L A;  1WAO 1;  4HOT A;  5KJN A;  2VYI A;  4GYY A;  1YA0 A;  1ZBP A;  4AY5 A;  4JA7 A;  2KCV A;  2KCL A;  3ZHE B;  3MV2 B;  2YHC A;  5DBK A;  3URZ A;  4XIF A;  1P5Q A;  2FBN A;  4N2S A;  5EX3 A;  2FO7 A;  4HOS A;  3CKB A;  4U07 A;  1QQE A;  4G24 A;  3KAE A;  4I1A A;  2HR2 A;  4G26 A;  3E4B A;  2XCC A;  3FWV A;  2XPI A;  1QZ2 A;  2IF4 A;  3S7D A;  4GZ3 A;  4I2Z A;  3OXF A;  5BNW A;  5G05 J;  2KAT A;  4HOU A;  1A17 A;  2PL2 A;  3K9I A;  4GZ5 A;  1ELW A;  4I17 A;  2LSV A;  5FT9 A;  5CCL A;  5LCW J;  2PQR A;  4XI0 A;  1IHG A;  3PDN A;  5CHE E;  5KJL A;  2V5F A;  3ASG A;  5EKQ D;  5LCW C;  4YVO A;  3U4T A;  2LNI A;  4J8F A;  3FFL A;  4H7Y A;  3RU0 A;  2XGS A;  4BWR A;  4GZ6 A;  3WXX A;  4AY6 A;  5G05 C;  3QDN A;  3IEG A;  1PC2 A;  3CK9 A;  2VGX B;  3FP3 A;  2OOE A;  3U3W A;  1KLX A;  4ME2 A;  3ASF A;  1IYG A;  4IN3 B;  5M72 A;  4UI9 K;  1HXI A;  4BTA A;  3R9A B;  4O6F A;  5D0O D;  1Y8M A;  4F3V A;  3MV3 B;  3Q47 B;  4GCN A;  4WUY A;  3ZGQ A;  3MEK A;  3CVP A;  4Y6W A;  2XGM A;  3ZHE A;  4APO A;  4KXK B;  3QOU A;  1ELR A;  3BEE A;  2MHK A;  4KYO B;  2VSN A;  3SF4 A;  4A1S A;  4I9C A;  3S7J A;  2BUG A;  3OXL A;  2VGX A;  3LY7 A;  3MKR A;  4W9R A;  2Y4T A;  3QWP A;  4JA9 A;  2AVP A;  1KT0 A;  5JJ7 A;  5JJT A;  5G04 J;  4J8E A;  3LY9 A;  5D0Q D;  2FI7 A;  3CK7 A;  1OUV A;  3TG5 A;  1HH8 A;  1KT1 A;  4JHR A;  4KBQ A;  3RJV A;  5G04 C;  4HOQ A;  3PE3 A;  4NQ0 A;  4YND A;  4CGV A;  5KJK A;  4G25 A;  5HQ8 A;  3Q49 B;  4UQZ A;  4RG9 A;  3Q5M A;  4N3B A;  4UQY A;  3ASH A;  2HYZ A;  2VGY A;  3ESK A;  3LYA A;  3ZPJ A;  2XEV A;  2UWJ G;  5ARF A;  3EDT B;  4BT8 A;  1ZU2 A;  3CVL A;  3LY8 A;  3GZ2 A;  2Y4U A;  5DIZ A;  5FTP A;  3KS2 A;  5FZQ A;  2PZI A;  2FF4 A;  3CEQ A;  5BW8 C;  4BT9 A;  2XGO A;  1WM5 A;  2DBA A;  2LSU A;  3GW4 A;  4GYO A;  2VSY A;  4N39 A;  2NC9 A;  2YQ8 A;  3HYM B;  4UQX A;  3ASD A;  4N3C A;  4YVQ C;  2QFC A;  3GYZ A;  5HI7 A;  3CV0 A;  3TG4 A;  5BT1 A;  2KCK A;  3ZN3 A;  4AIF A;  1W3B A;  1XNF A;  5KJM A;  2XCB A;  3LCA A;  3CVN A;  4WNF A;  4WNG A;  3SZ7 A;  3S7F A;  4ABN A;  4I2W A;  5FJY A;  5AYW D;  3RO3 A;  2HO1 A;  1NA3 A;  4Y6C A;  1E96 B;  3UUX A;  4GPK A;  2I6H A;  1B89 A;  3GZ1 A;  2JLB A;  3ZFW A;  4U0U A;  2VQ2 A;  5CCM A;  2KC7 A;  4G1T A;  4UI9 J;  3KD7 A;  3QWW A;  2WQH A;  3Q4A B;  4N3A A;  1HZ4 A;  2J9Q A;  1FCH A;  2GW1 A;  3MA5 A;  4GA1 A;  3S7B A;  3AS8 A;  3Q15 A;  4RG6 A;  5C1D A;  4J8D A;  4AM9 A;  4G2V A;  2UY1 A;  4U04 A;  4XI9 A;  2FEZ A;  3RO2 A;  4CGW A;  4I9E A;  5A7D B;  3RKV A;  1NZN A;  2E2E A;  4GCO A;  4EQF A;  4GA0 A;  4WNE A;  2P58 C;  3VTX A;  4G23 A;  3VTY A;  4GA2 A;  3UQ3 A;  3AS5 A;  2L6J A;  4HOR A;  3LPZ A;  3TGO A;  3OXG A;  1TJC A;  2WPV A;  3AS4 A;  3O48 A;  2Q7F A;  1NA0 A;  3TAX A;  4N2Q A;  4B94 A;  4GYW A;  3ULQ A;  4BTB A;  2IFU A;  4LEU A;  5ARG A;  5FZR A;  3CK8 A;  2UY1 B;  3CVQ A;  2OND A;  2C0M A;  5FZS A;  5A6C A; 
#chains in the Genus database with same CATH topology
 3RIB A;  3TWX A;  4JVS A;  4JD2 G;  5AQ9 A;  4U0Z A;  1WAO 1;  1TYQ G;  3JXI A;  1OWN A;  3PZ4 A;  1N4Q A;  3I4G A;  4UWL A;  1QZ2 A;  4DI3 A;  2KAT A;  4L1B A;  5FIN A;  3ZU7 B;  3UM2 A;  3U4T A;  3UM3 A;  3ZEF A;  3QB2 A;  5EYL A;  2MRI A;  1OWO A;  4DJA A;  4J8Y A;  2DIW A;  2DYR E;  2H6G A;  4CDM A;  1SQM A;  3UT7 A;  4GTM A;  4W9R A;  2XQ0 A;  1K1B A;  2DWZ A;  3D9I A;  3PS6 A;  2F0Y A;  3ABM E;  3FH5 A;  2X6F A;  4FU3 A;  3U3W A;  1HG2 A;  4N3C A;  3CV0 A;  4AXH A;  2XCB A;  4WNF A;  1SZ9 A;  4A63 B;  1E96 B;  5EN5 D;  1S0P A;  2PNN A;  3UT8 A;  4G1T A;  3QJZ A;  2IY0 C;  3MA5 A;  4L2Y A;  3ULE G;  4CEM A;  4ANW A;  4AOF A;  3FTW A;  4LEU A;  1HS6 A;  2XPZ A;  3NB2 A;  4NRH B;  2Y69 E;  5JJ6 A;  4J0U A;  1N4P A;  4FJZ A;  1FVH A;  5DBK A;  3R9M A;  3CKB A;  1IQR A;  4JHK A;  5KNH D;  3L82 A;  2XPI A;  1N9A A;  3ZNG A;  4GZ3 A;  4G8K A;  4ACK A;  5G05 J;  3Q7F A;  2V5Q C;  5CCL A;  3PH0 C;  4GAA A;  3CR3 A;  4F53 A;  4J8F A;  2LUH A;  3IEG A;  4GZC A;  3CQC B;  4IN3 B;  2IOS A;  3PZD A;  3IV0 A;  3ONL A;  1ELR A;  3BEE A;  1HX8 A;  4CZ2 D;  3OXL A;  3MKR A;  3CVV A;  4KZ0 A;  3D9H A;  1HH8 A;  5KJK A;  4U7E B;  1OCR E;  3J5Q B;  1UN9 A;  3FTX A;  1XGW A;  5BT1 A;  4IYP A;  2L0T B;  1NA3 A;  5AEN A;  3QC1 A;  3LVQ E;  5KWD A;  4YDE A;  5A7D B;  4HB5 A;  3UIO C;  5LFA A;  3CVU A;  3B95 A;  2VJ8 A;  3B7U X;  4ILH B;  5BV0 A;  1O5M A;  2J09 A;  4RQI A;  3CK8 A;  4XZ4 A;  5FZS A;  5BUZ A;  4AIF A;  1A5E A;  3L9T A;  2VYI A;  4KMO A;  4GPM A;  2LXL A;  3CQG B;  3VLE A;  1QQE A;  4GTS A;  4I1A A;  4ACL A;  4MKT A;  5CRV A;  2YIN A;  4I2Z A;  4JC8 A;  2X6I A;  2V5F A;  5AN8 A;  3FP3 A;  2X6K A;  4XEI G;  5KBA A;  1N11 A;  3ZGQ A;  1TN8 A;  4KXK B;  3PNT B;  4U8V D;  4PS8 A;  2VSN A;  3O4Z A;  1RZ4 A;  3FH8 A;  3ISM C;  3DSW A;  3C3R A;  3C3Q A;  4PDX A;  3V2X A;  2IU1 A;  4RVB A;  3ABK E;  2FF4 A;  4K5C A;  2VSY A;  3TG4 A;  3CST A;  3KEA A;  3ZFW A;  3FUI A;  4F6R D;  3S7B A;  4U04 A;  4UWG A;  2OVF A;  2WXR A;  1U3C A;  5ENQ D;  3LPZ A;  4EHM A;  3TAX A;  2VSX E;  3CHP A;  3CVQ A;  3DST A;  4YDO A;  3D9O A;  5CEA A;  3UPV A;  3C5R A;  2C0L A;  2C2L A;  1ZBP A;  4BER A;  4AY5 A;  1H2V C;  4N2S A;  1S64 A;  3FDH A;  1OCC E;  1LF8 A;  5LCW J;  5CHE E;  3PRE A;  1QNF A;  1JWG A;  4HS2 A;  1PC2 A;  3ENE A;  3T5X A;  3EHR A;  3R9A B;  3DXM G;  3TWT A;  3Q47 B;  4GCN A;  2EQX A;  3E32 A;  1EDU A;  3FUF A;  2VGX A;  3MZL B;  3ESL A;  1LD8 A;  4Q94 A;  4AJW A;  3ZVV A;  5FQ8 A;  4HOQ A;  4YND A;  4DRX E;  4EZJ A;  1JWF A;  4N3B A;  4RG9 A;  1UW4 B;  1H6O A;  2LAH A;  1PY1 A;  3EDT B;  3GZ2 A;  5FTP A;  2XGO A;  1WM5 A;  2OVB A;  2OEW A;  3GYZ A;  3EU9 A;  2KCK A;  3SO8 A;  3FU6 A;  2Y1L E;  4YDY A;  3ZN3 A;  3SZ7 A;  3AG3 E;  4MRU A;  4UWF A;  3EIQ C;  2PM6 A;  3ASN E;  4CYM D;  2DCP A;  4L9P A;  5C1D A;  5AIJ A;  3DSS A;  3DPY A;  1UJK A;  4EQF A;  1L5J A;  4G23 A;  2RKK A;  4GA2 A;  3DBS A;  3UQ3 A;  2P9L G;  2R59 A;  2UY1 B;  1Z3Y A;  3TWQ A;  4XX5 A;  2CFZ A;  4DLO A;  3B7B A;  2WXP A;  4AV7 A;  5ENN A;  1P5Q A;  4OAU C;  2FO7 A;  3MX3 A;  2IF4 A;  2ZIS A;  3ABL E;  4HOU A;  4GZ5 A;  1V54 E;  5KJL A;  4AY6 A;  4ME2 A;  1HXI A;  4O6F A;  2P9N G;  4GTV A;  3BU8 A;  4JZY A;  5FQ6 A;  1OCO E;  4LG6 A;  3V2O A;  5JJ7 A;  1KT1 A;  1KZP A;  3UXG A;  5G04 C;  4G25 A;  4BFR A;  2V0P A;  4BT8 A;  3Q75 A;  4U8Y D;  5M72 A;  2WQ7 A;  2DBA A;  4FLB A;  2YQ8 A;  5CEC B;  3NAW A;  4R7L A;  1W3B A;  3NZU A;  3FH7 A;  1FVF A;  3OTN A;  4GPK A;  3E37 A;  2VQ2 A;  2WQH A;  1O1R A;  2J9Q A;  2QZA A;  1K1A A;  1MX4 A;  3TL5 A;  1HG5 A;  3RO2 A;  1MX2 A;  3UT4 A;  4ILI A;  5G55 A;  5T4Y A;  3SFY A;  4LCT A;  4MS6 A;  3HXF A;  2BF0 X;  4LRZ A;  4K5B A;  1E8Y A;  1Y6I A;  2OND A;  1V55 E;  3PNL B;  5EYP F;  4AP2 A;  4NIK A;  4G8L A;  1OY3 D;  3FU3 A;  4QQI A;  5EID A;  4JA7 A;  3EJN A;  1MX6 A;  1NFI E;  1TNY A;  3UMV A;  3ZW3 A;  5J08 A;  3LEW A;  2BKK B;  1S70 B;  1Z5S C;  3FTU A;  4U8H A;  3S7D A;  3D3M A;  1H19 A;  4XI0 A;  3UKR G;  5LCW C;  3WXX A;  4OYS A;  4TUM A;  4O1O A;  3PEU B;  1AP7 A;  4F3V A;  2AW6 A;  5AAO A;  5BV1 A;  5JHB A;  1YYH A;  1OWM A;  4LER A;  4LNG A;  3D9L A;  3ZXP A;  4DI4 A;  3Q7A A;  4RLY A;  4UQZ A;  3ZPJ A;  4JHJ A;  2XS8 A;  5B1B E;  1SW6 A;  5FZQ A;  2VTB B;  3SHF A;  4N39 A;  2QFC A;  2ION A;  3LCA A;  2V4L A;  1H2U A;  3RO3 A;  4ZFH A;  3QK0 A;  3CHR A;  1D8D A;  2B6C A;  4RG6 A;  4XI9 A;  1NZN A;  4GA0 A;  4WNE A;  3MYV A;  3D9J A;  4TRQ A;  2EIM E;  2EIK E;  2X6H A;  4PH4 B;  4J7W A;  4B94 A;  5JA4 D;  1Q2Z A;  4FLH A;  2OCC E;  4FHK A;  3SFX A;  3L08 A;  3S2A A;  3HVE A;  5H7P A;  3QWV A;  4WND A;  3ZRH A;  4L7T A;  3HXC A;  3SFZ A;  2PQN A;  3F6Q A;  4GTP A;  1E8X A;  4MLP A;  2YHC A;  4I1M A;  2WMO A;  4FAD A;  4G24 A;  3LDZ A;  3OXF A;  1FT2 A;  4HFG A;  4I17 A;  1ELW A;  2YHE A;  2X6J A;  3FUK A;  4I43 A;  3CGH A;  3U9W A;  3BG1 B;  1DCQ A;  2P9I G;  5CBO A;  3MKQ B;  2X38 A;  1TN7 A;  1E7V A;  1K3Z D;  4C9B B;  3DRA A;  2XZD G;  2P9P G;  2Y4T A;  3QWP A;  5JJT A;  4HRN A;  4HLE A;  4JHR A;  4KBQ A;  3CHO A;  3AJI A;  3L54 A;  2CHX A;  2XEV A;  4LNB A;  3TWS A;  5ITZ F;  4L2L A;  2PZI A;  4UQX A;  2L6B A;  5HI7 A;  4KVM A;  2DZO A;  4D10 C;  3UM0 A;  4EZL A;  2Y3A A;  5FJY A;  3GZ1 A;  4G11 A;  2FO1 E;  2GW1 A;  2KM4 A;  3I4R B;  4I6J A;  4EBA A;  2WXM A;  4JEU A;  3I3N A;  3SGH A;  3B7R L;  1TN6 A;  2AWI A;  4GYW A;  2V4H C;  5D66 A;  1H6K A;  2L9B A;  3MCX A;  5ARG A;  5FZR A;  2L0I A;  3IXE A;  3MV2 B;  4H7X A;  4U0S A;  1OWL A;  3T9K A;  3D9K A;  5B1A E;  3N71 A;  5AAR A;  3R7R A;  1UN8 A;  4GYY A;  1YA0 A;  5J90 A;  2KCV A;  1AWC B;  3UKU G;  2VGE A;  4GTQ A;  4B89 A;  4G26 A;  3D9M A;  3RRU A;  3NOG D;  1IXV A;  2HM8 A;  4P29 A;  1HE8 A;  2IO2 C;  3KSL A;  4GZ6 A;  5G05 C;  4JEH A;  1Y8M A;  2AJA A;  4ILG A;  4PS7 A;  3SF4 A;  2A5E A;  1E90 A;  2QYU A;  4GTT A;  3ONK A;  3GZS A;  4NQ0 A;  4PUC A;  3UI2 A;  3ASH A;  2VGY A;  4RSY A;  3HDX A;  1DVP A;  3VLF A;  2GRL A;  4LNU D;  4WWP A;  5C2Y A;  4TXP A;  4A3V A;  4ABN A;  2GRM A;  1INZ A;  3W9F A;  4UI9 J;  2BKG A;  3Q4A B;  2QYJ A;  3NQP A;  4E85 A;  4BES A;  3APC A;  1WDY A;  4Q69 A;  3FEX A;  2H6I A;  1H2T C;  4ATG A;  4OVV A;  3TGO A;  2WXI A;  4HQD A;  2ETC A;  4NUR A;  2GRR B;  2WXL A;  3C3O A;  1SA4 A;  2R5S A;  3DSU A;  3PZ1 A;  4ATZ D;  1BU9 A;  3V30 A;  1N0Q A;  1EPU A;  3DSX A;  3PRZ A;  5EX3 A;  2B0O E;  3TJP A;  4MBG A;  2CHW A;  4FC8 A;  1WG0 A;  2ILR A;  3TWV A;  5AQB A;  3BQO A;  4TUU A;  2LNI A;  2X3M A;  4BWR A;  3FUN A;  4FA6 A;  3TXN A;  3X2Q E;  3IBE A;  1O1S A;  4APO A;  1LD7 A;  1X81 A;  2A4Z A;  2ZXW E;  1UG3 A;  4J8E A;  4BX9 A;  5T8I A;  3TG5 A;  5ENO D;  3RJV A;  3APF A;  3MJW A;  3LY8 A;  5DIZ A;  5ENS D;  5KJM A;  4WNG A;  4BSX A;  1OXJ A;  2WMN A;  2QY7 A;  3PZ3 A;  2LO6 A;  3L6A A;  1E7U A;  3UX4 A;  3Q15 A;  2GRO B;  3EHN A;  3VTX A;  3VTY A;  3U66 A;  1TNO A;  2Q7F A;  1NA0 A;  3ULQ A;  2R02 A;  2DYS E;  3FUJ A;  1NP7 A;  1IQU A;  1JCR A;  3AU4 A;  4GTR A;  1QBQ A;  2WB2 A;  3URZ A;  2WXF A;  4GZD A;  2EIL E;  4HI9 A;  2HR2 A;  3P2B A;  5D2M C;  3FWV A;  4JPS A;  2XEE A;  3DSV A;  1VDY A;  4GMR A;  2LSV A;  3IKO B;  3C98 A;  3PVL A;  2H6H A;  4EPZ A;  1S63 A;  1EF1 C;  3QDN A;  3SQV A;  2P9U G;  3CHM A;  2WXG A;  4BTA A;  1N94 A;  5EIB E;  3ZHE A;  1TNB A;  2GRP B;  4AEZ C;  2J08 A;  3MKQ A;  3Q9U C;  2AVP A;  2XEH A;  3ML8 A;  5ANL A;  3PE3 A;  3NZS A;  3Q5M A;  2HE0 A;  3BUA A;  2V8S E;  4GTO A;  2RFA A;  2R2L A;  4DK5 A;  1HFA A;  3KEZ A;  3GW4 A;  4V3I A;  1SZA A;  1XNF A;  2WXK A;  1N52 A;  1HF8 A;  4HLL A;  4I2W A;  4Y6C A;  4HRM B;  2GRQ B;  3HXE A;  4NAC A;  1BPO A;  4N3A A;  1BI8 B;  2M63 A;  2UY1 A;  4G2V A;  5CMY A;  2H6F A;  1KPS B;  4PS3 A;  4L23 A;  3ULY A;  2WXH A;  3B13 A;  3DWL G;  3P1U A;  5JMN D;  5BXU A;  1HU3 A;  1RW2 A;  3L22 A;  3Q78 A;  2R03 A;  5A23 A;  1D8E A;  3QKY A;  1G3N B;  5ANR A;  3E33 A;  4JL0 A;  3U64 A;  4BY6 A;  3HRA A;  4XIF A;  4HOS A;  2XZT G;  3VLD A;  4N5Q A;  5BNW A;  3G2W A;  1BI7 B;  2RD0 A;  1MYO A;  5FT9 A;  2QC9 A;  4ZHB A;  5BPP A;  2ZIR A;  3LXU X;  4UUC A;  2JEK A;  1IYG A;  2AXZ A;  2NXP A;  3LVR E;  3CVP A;  2XGM A;  3AG4 E;  2E0I A;  1JCS A;  4DX5 D;  4I9C A;  3S7J A;  2BUG A;  4JB8 P;  2FI7 A;  1ELK A;  3Q79 A;  1DCE A;  4CGV A;  3FTV A;  3Q49 B;  4TXR A;  4UQY A;  3CVX A;  3HXB A;  4A1G A;  1H0A A;  2LSU A;  5G2N A;  4CRW A;  4QFV A;  4AVX A;  3EIJ A;  2DVW A;  5AYW D;  3V79 K;  2HO1 A;  2I6H A;  1N4R A;  2J8S D;  4DPR A;  3PEV B;  4GA1 A;  1FCH A;  3CVY A;  4U95 D;  4DLQ A;  4CGW A;  4C0E A;  3ZYK A;  4WWO A;  1UJJ A;  3FUE A;  2FUL A;  4HOR A;  3OXG A;  3O48 A;  3V31 A;  4O60 A;  3IHY A;  3LKU A;  2F8X K;  1YCS B;  1TEZ A;  4DUI A;  2BTD A;  3Q9N C;  3DPD A;  3JQ0 A;  3E4B A;  3DEO A;  4BX8 A;  4CDN A;  5FQ7 A;  1NL4 A;  1MJ0 A;  1IHG A;  5KNG A;  5EKQ D;  5ENR D;  2PM7 A;  3SBS A;  3CK9 A;  2CHZ A;  3RSE G;  1N0R A;  4UI9 K;  3MV3 B;  5ENT D;  2P9K G;  3BG0 B;  3B7T A;  4WUY A;  4Y6W A;  4M3O A;  4KYO B;  4CT0 A;  4EEC A;  3EHQ A;  4EZK A;  4F7A A;  1OCZ E;  2VTB A;  1KT0 A;  5G04 J;  4HNA D;  5D0Q D;  4B93 B;  2LXM A;  2XEN A;  4HRL A;  4BSZ B;  3JCK C;  3ASO E;  3PUK A;  3KS2 A;  3CEQ A;  3EUV A;  5LP0 A;  5EDS A;  2WXJ A;  3RK6 A;  3CIA A;  3SBT B;  1HO8 A;  4O1P A;  5HS0 A;  2F8Y A;  3G2V A;  3PZ2 A;  1DC2 A;  4B0Z A;  4F1P A;  3DXK G;  2ZGG A;  4CDR A;  3JYS A;  4GMJ A;  2J4B A;  4F1S A;  5EX0 A;  4OVU A;  3NOC D;  5FIO A;  1IHB A;  2KCL A;  2I1K A;  4HXI A;  3FTY A;  1N54 A;  3FUM A;  3KAE A;  3CLJ A;  4CT4 A;  3T8M A;  3FU5 A;  3K9I A;  4EBA G;  2KZT B;  2J07 A;  3PDN A;  2CFU A;  3ASG A;  4YVO A;  3RU0 A;  4BET A;  2R17 C;  4DX7 D;  3UTM A;  3FTS A;  3IHV A;  4Z68 A;  2CG2 A;  5D0O D;  5HKP A;  2OEV A;  4K5A B;  3QOU A;  4I6E A;  4A1S A;  4JW1 A;  1KZO A;  3TWU A;  3LY7 A;  4XKC A;  4ANU A;  3CK7 A;  1OUV A;  5LOZ A;  1YMP A;  3LJ3 A;  3SI5 A;  4XE0 A;  3ESK A;  2HYZ A;  1MZC A;  3LYA A;  4GB9 A;  3TXM A;  3J5P A;  1ZU2 A;  2Y4U A;  2J49 A;  3LS8 A;  3FU0 A;  4KZC A;  5CED B;  3S7F A;  1MQS A;  4U0U A;  5CCM A;  2KC7 A;  1HZ4 A;  1BLX B;  4DX6 D;  4DX1 A;  2FEZ A;  1O1T A;  2KXP C;  4GCO A;  3ZXS A;  4XKB A;  2OV8 A;  3AS5 A;  4U96 D;  2L6J A;  4URK A;  4OAV B;  1TJC A;  2WPV A;  3CHS A;  5E76 A;  1D9S A;  2I9C A;  3RRM B;  3L16 A;  3RRN B;  3CHQ A;  3PE4 A;  4N5C A;  5ENP D;  4BEP A;  3D9P A;  2RG8 A;  4FP7 A;  2EIN E;  2J4D A;  4E6H A;  5CRU A;  2ETA A;  2A5U A;  3ZHE B;  3FUH A;  3HG0 D;  4U07 A;  3EU5 A;  3QNK A;  2AXU A;  3KSQ A;  1GW6 A;  2EIJ E;  2WQ6 A;  3PUJ A;  1SVX A;  3ZYM A;  3L17 A;  1OWP A;  1QYM A;  2VGX B;  1TR4 A;  4DX2 A;  3ASF A;  2KBX A;  3QAQ A;  3HIZ A;  3RAU A;  2WXQ A;  1UOH A;  4K03 A;  5B3S E;  3JQ1 A;  3AU5 A;  2MHK A;  1X5B A;  3MGB A;  3T5V A;  1H6P A;  2P9S G;  5IY5 E;  1N95 A;  1Z6T A;  3D9N A;  2GGF A;  1E8Z A;  4C0M A;  5ARF A;  4FHJ A;  1FT1 A;  4YVQ C;  3G2T A;  1JPL A;  3ZYQ A;  2IJG X;  3UUX A;  1LTX A;  2IEJ A;  5FWQ A;  5T3R A;  4B8C B;  4I9E A;  2E2E A;  3AG2 E;  3ZIM A;  4J8S A;  4A3T A;  4KT6 B;  1JCQ A;  2LAI A;  2IFU A;  3G2U A;  5AJD A;  4K0R A;  3LJN A;  3CKC A;  4HOT A;  2FBN A;  4KVO A;  5CER B;  3CVW A;  2F37 A;  2BED A;  2ETB A;  2GRN B;  2Y0B G;  5FQ4 A;  2ZGD A;  3E34 A;  2PL2 A;  4FUL A;  5AJL A;  1WY6 A;  3G2S A;  2OOE A;  4CCA A;  3CSF A;  3UIN C;  3UIP C;  4HBD A;  4ANV A;  3HXD A;  4JXT A;  5EIL A;  2XS1 A;  1NI1 A;  1TNZ A;  2ZU6 B;  2IQC A;  4HI8 A;  2NSZ A;  5BXO A;  3FHE A;  1SA5 A;  1PAQ A;  5CBN A;  4WWN A;  2XRZ A;  5HQ8 A;  2I2O A;  3APD A;  1EYH A;  4LUN U;  3Q73 A;  1U3D A;  2CG3 A;  2XPY A;  4GML A;  3HYM B;  1U2V G;  3ASD A;  3FY4 A;  5KCM A;  4N2Q A;  3CVN A;  4X8Q A;  3EHM A;  3SY2 A;  3ZYL A;  3TWW A;  3E30 A;  2JLB A;  2XRY A;  3KD7 A;  3QWW A;  3B7S A;  4M7C A;  3AS8 A;  4J8D A;  2JAB A;  2NYJ A;  4ANX A;  2P58 C;  1MHQ A;  2WXO A;  4UWK A;  3AS4 A;  4IRU A;  4A55 A;  1TNU A;  4BTB A;  5AQ7 A;  5A6C A;  1ZB1 A;  4YDW A;  3NF1 A;  4UI9 C;  2RFM A;  4I6G A;  3T8K A;  1TJF A;  3NBN B;  4TV3 A;  5LX8 A;  3FEY A;  4J6I A;  4IUL A;  4Q96 A;  5KJN A;  5AQA A;  3SD5 A;  2MOW A;  2WM9 A;  2XCC A;  3OAW A;  1A17 A;  1N4S A;  3ZKJ A;  5E75 A;  2PQR A;  3FUD A;  3FFL A;  4H7Y A;  2XGS A;  2AXV A;  5HRY A;  1KLX A;  1FPP A;  4U63 A;  4LSZ E;  3TWR A;  3W9G A;  4APF A;  3MEK A;  1E8W A;  4HVB A;  3FUL A;  4TXQ A;  2IO3 C;  5JHA A;  3AAA C;  2R05 A;  3JUE A;  4JA9 A;  2YNQ A;  2DZN A;  3LY9 A;  2WVI A;  1JUQ A;  2P2C P;  3WG7 E;  3SNX A;  4B8A A;  2UWJ G;  3CVL A;  1OT8 A;  4BT9 A;  5BW8 C;  4GYO A;  2NC9 A;  3JUI A;  3I5P A;  2VSO E;  5CMW A;  4WAF A;  3DEP A;  4UWH A;  4C48 B;  1B89 A;  4GU5 A;  3JXJ A;  3L13 A;  4FJY A;  1DNP A;  1IKN D;  4I1O B;  1BD8 A;  2IOL A;  4AM9 A;  1K8K G;  3FTZ A;  3AG1 E;  3UM1 A;  3RKV A;  2MYO A;  3ZUV B;  3HVE B;  3R7Q A;  2I1J A;  2WXN A;  3QAR A;  3ML9 A;  2XHE A;  3HHM A;  1Z3X A;  3C72 A;  2KZT A;  2C0M A; 
#chains in the Genus database with same CATH homology
 4CDR A;  3RIB A;  3JYS A;  4GMJ A;  2J4B A;  4XX5 A;  4F1S A;  2WXL A;  4JVS A;  2R5S A;  4OVU A;  5EX0 A;  2CFZ A;  4DLO A;  4U0Z A;  1WAO 1;  2WXP A;  4AV7 A;  5ENN A;  1EPU A;  2KCL A;  3PRZ A;  1P5Q A;  2I1K A;  1OWN A;  5EX3 A;  2FO7 A;  4HXI A;  3FTY A;  1N54 A;  3FUM A;  3KAE A;  3I4G A;  4UWL A;  1QZ2 A;  2IF4 A;  3CLJ A;  3MX3 A;  4CT4 A;  4DI3 A;  3T8M A;  3TJP A;  2KAT A;  3FU5 A;  4HOU A;  4L1B A;  2CHW A;  4FC8 A;  3K9I A;  4GZ5 A;  2ILR A;  4EBA G;  2KZT B;  2J07 A;  5KJL A;  3PDN A;  2CFU A;  3ASG A;  4TUU A;  4YVO A;  3U4T A;  2LNI A;  3RU0 A;  3QB2 A;  3ZEF A;  4AY6 A;  2X3M A;  2MRI A;  1OWO A;  3FUN A;  4BWR A;  4FA6 A;  2R17 C;  4DJA A;  3FTS A;  3TXN A;  4ME2 A;  2DIW A;  3IBE A;  1HXI A;  3IHV A;  4O6F A;  2CG2 A;  5D0O D;  4CDM A;  4JZY A;  1SQM A;  4APO A;  3UT7 A;  3QOU A;  4I6E A;  4A1S A;  4JW1 A;  2A4Z A;  5FQ6 A;  3LY7 A;  4W9R A;  4XKC A;  4ANU A;  2XQ0 A;  1UG3 A;  5JJ7 A;  4J8E A;  4BX9 A;  3CK7 A;  5T8I A;  1OUV A;  3TG5 A;  1KT1 A;  5LOZ A;  3LJ3 A;  3RJV A;  5G04 C;  4G25 A;  3D9I A;  3PS6 A;  3SI5 A;  4XE0 A;  3ESK A;  2HYZ A;  3LYA A;  4BFR A;  3APF A;  3FH5 A;  2V0P A;  4GB9 A;  3MJW A;  4BT8 A;  2X6F A;  3TXM A;  1ZU2 A;  3LY8 A;  2Y4U A;  5DIZ A;  2J49 A;  5M72 A;  3LS8 A;  2WQ7 A;  2DBA A;  4FU3 A;  4FLB A;  3U3W A;  2YQ8 A;  3FU0 A;  1HG2 A;  4KZC A;  4N3C A;  3CV0 A;  5KJM A;  4R7L A;  1W3B A;  3NZU A;  2XCB A;  4WNF A;  4WNG A;  4AXH A;  3FH7 A;  4BSX A;  1SZ9 A;  3S7F A;  1MQS A;  1FVF A;  2WMN A;  1E96 B;  3OTN A;  4GPK A;  2QY7 A;  1S0P A;  4U0U A;  2VQ2 A;  3UT8 A;  5CCM A;  2KC7 A;  2LO6 A;  4G1T A;  2WQH A;  3L6A A;  3QJZ A;  1E7U A;  1HZ4 A;  2J9Q A;  3MA5 A;  4L2Y A;  3UX4 A;  3Q15 A;  3TL5 A;  1HG5 A;  3RO2 A;  2FEZ A;  4CEM A;  3UT4 A;  4GCO A;  3ZXS A;  3EHN A;  4ILI A;  5G55 A;  5T4Y A;  3VTX A;  4XKB A;  4ANW A;  2OV8 A;  3VTY A;  4LCT A;  3U66 A;  4MS6 A;  3AS5 A;  2L6J A;  4URK A;  1TJC A;  2WPV A;  2BF0 X;  2Q7F A;  1NA0 A;  4LRZ A;  4AOF A;  3ULQ A;  3FTW A;  4LEU A;  3CHS A;  1E8Y A;  1Y6I A;  5E76 A;  2OND A;  2I9C A;  1HS6 A;  2XPZ A;  3FUJ A;  3RRM B;  3PNL B;  4NRH B;  3L16 A;  3RRN B;  4AP2 A;  3CHQ A;  3PE4 A;  4J0U A;  4N5C A;  5JJ6 A;  1NP7 A;  3D9P A;  2RG8 A;  1IQU A;  3AU4 A;  3FU3 A;  4FP7 A;  4FJZ A;  2J4D A;  4E6H A;  2WB2 A;  1FVH A;  4JA7 A;  3EJN A;  2A5U A;  3ZHE B;  3FUH A;  5DBK A;  3URZ A;  2WXF A;  4GZD A;  3CKB A;  4U07 A;  1IQR A;  4JHK A;  2HR2 A;  3P2B A;  3UMV A;  3ZW3 A;  3QNK A;  5J08 A;  3LEW A;  3FWV A;  2XPI A;  4JPS A;  2AXU A;  3FTU A;  4U8H A;  3S7D A;  4GZ3 A;  1VDY A;  4ACK A;  5G05 J;  1GW6 A;  2WQ6 A;  3PUJ A;  2LSV A;  3D3M A;  3C98 A;  1H19 A;  3IKO B;  3PH0 C;  3PVL A;  3CR3 A;  4GAA A;  4XI0 A;  4EPZ A;  4F53 A;  5CCL A;  5LCW C;  1EF1 C;  3ZYM A;  4J8F A;  3WXX A;  3L17 A;  3QDN A;  4GZC A;  3IEG A;  1OWP A;  2VGX B;  4OYS A;  3CQC B;  3PEU B;  3CHM A;  3ASF A;  3QAQ A;  2WXG A;  4IN3 B;  3HIZ A;  4BTA A;  2IOS A;  2WXQ A;  4F3V A;  3PZD A;  2AW6 A;  4K03 A;  3JQ1 A;  3AU5 A;  3ZHE A;  3IV0 A;  3ONL A;  4AEZ C;  1ELR A;  3BEE A;  2J08 A;  2MHK A;  5BV1 A;  1HX8 A;  1X5B A;  1OWM A;  3MGB A;  3MKQ A;  4LER A;  3OXL A;  5JHB A;  3MKR A;  3T5V A;  3D9L A;  2AVP A;  3CVV A;  4KZ0 A;  4DI4 A;  1HH8 A;  3ML8 A;  5ANL A;  3PE3 A;  5KJK A;  3NZS A;  4UQZ A;  1Z6T A;  3D9N A;  3Q5M A;  3ZPJ A;  1E8Z A;  2GGF A;  4JHJ A;  4C0M A;  1UN9 A;  2V8S E;  5ARF A;  3FTX A;  4FHJ A;  4DK5 A;  5FZQ A;  2VTB B;  1XGW A;  3SHF A;  1HFA A;  3KEZ A;  3GW4 A;  4N39 A;  4V3I A;  4YVQ C;  1SZA A;  5BT1 A;  2QFC A;  4IYP A;  2ION A;  1XNF A;  3G2T A;  2WXK A;  1N52 A;  1JPL A;  2L0T B;  1HF8 A;  3LCA A;  2V4L A;  4I2W A;  1H2U A;  3RO3 A;  1NA3 A;  4Y6C A;  3QK0 A;  3ZYQ A;  2IJG X;  3UUX A;  5AEN A;  3CHR A;  4NAC A;  3QC1 A;  1BPO A;  4N3A A;  5FWQ A;  3LVQ E;  4RG6 A;  5T3R A;  4B8C B;  2M63 A;  2UY1 A;  4G2V A;  4XI9 A;  4I9E A;  5A7D B;  1NZN A;  5CMY A;  2E2E A;  4GA0 A;  4WNE A;  5LFA A;  3CVU A;  3MYV A;  3D9J A;  3ZIM A;  4J8S A;  4PS3 A;  4L23 A;  4TRQ A;  4A3T A;  2VJ8 A;  2WXH A;  4KT6 B;  3B7U X;  4ILH B;  5BV0 A;  2X6H A;  3B13 A;  4PH4 B;  2J09 A;  3P1U A;  4B94 A;  2LAI A;  2IFU A;  3G2U A;  4FLH A;  5AJD A;  3CK8 A;  4XZ4 A;  4FHK A;  5FZS A;  1HU3 A;  3L08 A;  3S2A A;  3L22 A;  5BUZ A;  4AIF A;  3HVE A;  4K0R A;  5A23 A;  3QKY A;  3QWV A;  4WND A;  3ZRH A;  5ANR A;  4L7T A;  3SFZ A;  3CKC A;  2PQN A;  4JL0 A;  4HOT A;  2VYI A;  3U64 A;  4KMO A;  4BY6 A;  1E8X A;  4MLP A;  2YHC A;  4I1M A;  4XIF A;  2FBN A;  3CQG B;  4KVO A;  2WMO A;  3VLE A;  4HOS A;  4FAD A;  1QQE A;  4G24 A;  3CVW A;  4I1A A;  3VLD A;  4ACL A;  4MKT A;  5FQ4 A;  3LDZ A;  5BNW A;  2YIN A;  3OXF A;  4I2Z A;  3G2W A;  2RD0 A;  2PL2 A;  4HFG A;  4I17 A;  4FUL A;  1ELW A;  4JC8 A;  2YHE A;  5AJL A;  2X6I A;  2X6J A;  5FT9 A;  2V5F A;  5BPP A;  3LXU X;  3FUK A;  4I43 A;  3CGH A;  1WY6 A;  3U9W A;  2JEK A;  3FP3 A;  2OOE A;  2X6K A;  3G2S A;  4CCA A;  3CSF A;  3BG1 B;  1IYG A;  3MKQ B;  4ANV A;  2AXZ A;  4JXT A;  2NXP A;  3LVR E;  3ZGQ A;  3CVP A;  2XGM A;  2E0I A;  2X38 A;  1E7V A;  4KXK B;  3PNT B;  2ZU6 B;  2VSN A;  4PS8 A;  3O4Z A;  2IQC A;  4I9C A;  4C9B B;  3S7J A;  2BUG A;  2NSZ A;  3FH8 A;  3FHE A;  2Y4T A;  3QWP A;  1PAQ A;  5JJT A;  4WWN A;  2FI7 A;  4HLE A;  1ELK A;  4JHR A;  4KBQ A;  2XRZ A;  4CGV A;  3CHO A;  3FTV A;  3Q49 B;  5HQ8 A;  2I2O A;  4UQY A;  3L54 A;  4PDX A;  2CHX A;  3APD A;  1Z3Y A;  2XEV A;  1EYH A;  3CVX A;  2IU1 A;  4RVB A;  4LUN U;  4A1G A;  1U3D A;  4L2L A;  2CG3 A;  2FF4 A;  2PZI A;  1H0A A;  2XPY A;  2LSU A;  4GML A;  5G2N A;  2VSY A;  4UQX A;  3HYM B;  4QFV A;  3TG4 A;  4AVX A;  3ASD A;  5HI7 A;  4CRW A;  3FY4 A;  4KVM A;  3EIJ A;  4D10 C;  5KCM A;  4N2Q A;  3CVN A;  4EZL A;  2Y3A A;  3EHM A;  5FJY A;  5AYW D;  2HO1 A;  3ZYL A;  2I6H A;  3GZ1 A;  3CST A;  2JLB A;  4G11 A;  2XRY A;  3ZFW A;  4DPR A;  3PEV B;  3KD7 A;  3QWW A;  3B7S A;  3FUI A;  4GA1 A;  1FCH A;  2GW1 A;  2KM4 A;  3CVY A;  3S7B A;  3AS8 A;  4DLQ A;  4J8D A;  4CGW A;  4U04 A;  4UWG A;  4C0E A;  3ZYK A;  2OVF A;  2WXR A;  3I4R B;  4ANX A;  4I6J A;  2P58 C;  4EBA A;  4WWO A;  1MHQ A;  1U3C A;  1UJJ A;  2WXO A;  3FUE A;  2WXM A;  2FUL A;  4JEU A;  4UWK A;  3I3N A;  4HOR A;  3LPZ A;  3OXG A;  3AS4 A;  3SGH A;  3O48 A;  4IRU A;  3B7R L;  3TAX A;  4A55 A;  2VSX E;  2AWI A;  4GYW A;  4BTB A;  1H6K A;  2L9B A;  3MCX A;  5ARG A;  3CHP A;  3CVQ A;  2L0I A;  3MV2 B;  5FZR A;  3D9O A;  3IHY A;  5A6C A;  4H7X A;  4U0S A;  1OWL A;  3LKU A;  3UPV A;  3NF1 A;  3D9K A;  4UI9 C;  4I6G A;  3N71 A;  2C0L A;  1TJF A;  1TEZ A;  4TV3 A;  2C2L A;  3R7R A;  1UN8 A;  2BTD A;  5LX8 A;  3FEY A;  4J6I A;  4IUL A;  4GYY A;  1YA0 A;  1ZBP A;  4Q96 A;  5KJN A;  4AY5 A;  1H2V C;  5J90 A;  2KCV A;  3DPD A;  4N2S A;  3SD5 A;  2MOW A;  3JQ0 A;  4B89 A;  2WM9 A;  4G26 A;  3E4B A;  3FDH A;  2XCC A;  3D9M A;  4BX8 A;  3OAW A;  3RRU A;  1A17 A;  4CDN A;  1LF8 A;  2HM8 A;  4P29 A;  5FQ7 A;  5E75 A;  5LCW J;  1HE8 A;  2PQR A;  1IHG A;  5CHE E;  5EKQ D;  3FUD A;  2PM7 A;  3SBS A;  3PRE A;  1QNF A;  3FFL A;  1JWG A;  4H7Y A;  2XGS A;  4GZ6 A;  5G05 C;  4HS2 A;  1PC2 A;  2AXV A;  3CK9 A;  2CHZ A;  1KLX A;  4JEH A;  3ENE A;  3T5X A;  4U63 A;  4UI9 K;  3R9A B;  1Y8M A;  3MV3 B;  3BG0 B;  3Q47 B;  3B7T A;  4GCN A;  4WUY A;  4APF A;  4ILG A;  3MEK A;  1E8W A;  4HVB A;  4Y6W A;  3FUL A;  4PS7 A;  4M3O A;  2EQX A;  4KYO B;  4CT0 A;  4EEC A;  1EDU A;  3FUF A;  3SF4 A;  4EZK A;  4F7A A;  5JHA A;  1E90 A;  2VGX A;  3MZL B;  3ESL A;  2VTB A;  4JA9 A;  2YNQ A;  1KT0 A;  4Q94 A;  5G04 J;  3LY9 A;  3ONK A;  5D0Q D;  3GZS A;  4AJW A;  3ZVV A;  5FQ8 A;  2WVI A;  1JUQ A;  4HOQ A;  4NQ0 A;  4YND A;  4PUC A;  4EZJ A;  1JWF A;  4N3B A;  4RG9 A;  3ASH A;  2VGY A;  4RSY A;  1UW4 B;  3HDX A;  1DVP A;  2LAH A;  3SNX A;  4B8A A;  2UWJ G;  1PY1 A;  3JCK C;  3EDT B;  3VLF A;  2GRL A;  3CVL A;  3PUK A;  3GZ2 A;  5FTP A;  3KS2 A;  4BT9 A;  3CEQ A;  5BW8 C;  2XGO A;  1WM5 A;  4GYO A;  4WWP A;  5C2Y A;  2OVB A;  5LP0 A;  2NC9 A;  5EDS A;  3JUI A;  3GYZ A;  2KCK A;  3ZN3 A;  3FU6 A;  4A3V A;  3I5P A;  3SZ7 A;  2VSO E;  2WXJ A;  4WAF A;  4ABN A;  5CMW A;  3RK6 A;  4MRU A;  4UWH A;  2GRM A;  4UWF A;  1INZ A;  1B89 A;  3EIQ C;  2PM6 A;  3CIA A;  3SBT B;  4GU5 A;  4UI9 J;  3L13 A;  4FJY A;  1DNP A;  3Q4A B;  4I1O B;  1HO8 A;  2DCP A;  3NQP A;  2IOL A;  5C1D A;  3FTZ A;  4AM9 A;  4E85 A;  5AIJ A;  3APC A;  1UJK A;  3RKV A;  4EQF A;  4Q69 A;  1L5J A;  3FEX A;  3HVE B;  4G23 A;  3R7Q A;  2I1J A;  4GA2 A;  3DBS A;  1H2T C;  3UQ3 A;  4ATG A;  4OVV A;  2WXN A;  3TGO A;  2WXI A;  3G2V A;  3QAR A;  3ML9 A;  2XHE A;  4B0Z A;  3HHM A;  1Z3X A;  2KZT A;  2R59 A;  4NUR A;  2UY1 B;  2C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...