4XI0A

Mama 41-end from desulfovibrio magneticus rs-1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
177
structure length
177
Chain Sequence
AMGDKAKLYRNISQRCLRRGSPEEALRYLKEWARHEKNDPEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTAAEHFTKVMELERSQDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Magnetosome protein MamA
publication title MamA as a Model Protein for Structure-Based Insight into the Evolutionary Origins of Magnetotactic Bacteria.
pubmed doi rcsb
source organism Desulfovibrio magneticus rs-1
total genus 71
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi0A00
5CHEE 3ESKA 5KJLA 4RG9A 1ZBPA 4N5CA 2R5SA 4AY5A 4YNDA 3TG4A 4ME2A 3GW4A 4HORA 5LCWC 4WNGA 2VGXA 5KJNA 4GZ5A 3ZFWA 5FZRA 4HOTA 4G24A 4YVQC 2JLBA 1FCHA 1XNFA 3CVNA 5JJ7A 3ZHEA 4WNDA 4J8DA 4APOA 4W9RA 3KD7A 3LCAA 3CK9A 2C2LA 1WM5A 3Q4AB 3SF4A 1ELRA 4UI9J 2P58C 4UQYA 3LY7A 3K9IA 4IN3B 2VGYA 3S7JA 4UI9C 4G23A 4GA0A 3QWWA 2HO1A 4YVOA 2XCBA 2HR2A 3RKVA 4GA1A 4XI0A 4Y6CA 3S7BA 2XEVA 2LNIA 4CDRA 5A6CA 2XGMA 3PE4A 4CGVA 5EX0A 5BT1A 5KJMA 1KT0A 4GZ6A 4G25A 3RU0A 3OXGA 3ZHEB 5G05C 2KCLA 1HXIA 3LPZA 4UI9K 1NZNA 2LSVA 2L6JA 5DIZA 1YA0A 2J9QA 3N71A 2C0MA 1B89A 3KAEA 5JJ6A 3UUXA 4U04A 5BW8C 5AYWD 3CVPA 4J8EA 2OOEA 5D0OD 3LY9A 3CV0A 3AS4A 2I6HA 3OXLA 4AY6A 3QWVA 1QQEA 2YHCA 3CKBA 3BEEA 3PE3A 2PZIA 3E4BA 3SZ7A 2IF4A 3NF1A 3CEQA 4I2ZA 2FF4A 2AVPA 4G2VA 4G26A 5FZSA 3ASDA 3Q49B 1ELWA 4A1SA 5CCLA 2ONDA 4JL0A 4N3AA 3EDTB 3CVQA 2PL2A 1PC2A 3LKUA 2FI7A 3JYSA 4HOUA 4G1TA 5D0QD 2IFUA 4WNFA 4U0ZA 4GYYA 4I17A 5ARFA 1E96B 4BWRA 4BTAA 2XPIA 3WXXA 1KT1A 3TG5A 2NC9A 2XGOA 2FEZA 3GZ1A 4RG6A 4XIFA 3QWPA 4HOQA 4KBQA 1TJCA 3Q5MA 4UQZA 2XGSA 2DBAA 2KCKA 2LSUA 4U07A 3R9AB 1KLXA 4J8FA 3RJVA 3UQ3A 3S7DA 4J0UA 4AM9A 2VSYA 3KS2A 3AS5A 4H7YA 5HI7A 4B94A 1IHGA 3MEKA 1QZ2A 4BT8A 4GCOA 2Y4UA 3S7FA 3RIBA 2FBNA 2MHKA 1W3BA 4WNEA 2VYIA 3FFLA 5FZQA 3QKYA 2GW1A 2KCVA 3MV3B 4GYOA 1HH8A 1P5QA 4KXKB 1Y8MA 4JA7A 1IYGA 5FTPA 4CGWA 3MA5A 4JA9A 2VQ2A 3MV2B 2V5FA 4JHRA 2QFCA 3AS8A 2HYZA 2UY1B 5LCWJ 4Y6WA 3O48A 3CK8A 3ASHA 2VSNA 3LY8A 5HQ8A 4GYWA 4BTBA 3RO2A 3ZN3A 1NA3A 1NA0A 4U0SA 1HZ4A 3IEGA 3VTYA 3OXFA 4GZ3A 3TAXA 3VTXA 2XCCA 4GCNA 3Q15A 4KYOB 5FJYA 2E2EA 5BNWA 2WQHA 3U4TA 2KATA 5CCMA 3UPVA 4N2QA 4F3VA 2PQRA 4HOSA 4GA2A 5A7DB 3CVLA 2WPVA 5KJKA 2Q7FA 3U3WA 4O6FA 4AIFA 2YQ8A 3ASGA 4UQXA 4N3CA 4BT9A 3URZA 4N3BA 4U0UA 5ARGA 3ASFA 2PQNA 3ZGQA 4ABNA 3CKCA 5JJTA 3TGOA 5C1DA 3QOUA 2UY1A 3FP3A 3CK7A 3PDNA 5DBKA 3GZ2A 3HYMB 2VGXB 3RO3A 2KC7A 3LYAA 1ZU2A 4H7XA 4LEUA 4GPKA 5G05J 4I2WA 4NQ0A 4N2SA 3MKRA 1OUVA 4XI9A 3FWVA 5EX3A 1WAO1 2Y4TA 4N39A 4I9CA 2UWJG 4I9EA 5G04J 5FT9A 4EQFA 3GYZA 3QDNA 5EKQD 2C0LA 2FO7A 3Q47B 5M72A 5G04C 1A17A 3ULQA 3ZPJA 4WUYA 2BUGA 4I1AA 4NRHB
chains in the Genus database with same CATH superfamily
5KJLA 2I9CA 3FUEA 2M63A 4XZ4A 3PZ1A 1OCCE 5LP0A 3ONKA 2BEDA 2L0IA 2E0IA 4YDWA 2X6KA 4WNGA 4M3OA 4HQDA 5KJNA 3D9PA 1Z5SC 1HE8A 3ONLA 2JLBA 4XKBA 2LAHA 3V31A 1OCZE 2IOLA 1K1AA 5D2MC 4F1SA 2WXKA 3SO8A 3LCAA 3CK9A 5KCMA 4HVBA 1ELRA 4UWLA 2DYSE 3ASNE 2EIJE 3K9IA 3ISMC 4G23A 4GA0A 3QWWA 4NIKA 4B93B 2WXLA 2ZISA 3U64A 3L9TA 5JHBA 4WWPA 2Y69E 4GTSA 3PE4A 4LG6A 5BT1A 5KJMA 2AW6A 4A3TA 4GZCA 4GZ6A 3JQ0A 2Y3AA 3PZ2A 5BPPA 2ETAA 4GMLA 2IJGX 3VLFA 4AEZC 4F6RD 1FPPA 3WG7E 1MX4A 3ML9A 1UJKA 4BERA 1YA0A 1IQRA 3DEOA 4ILIA 1H19A 3FTWA 4L7TA 1H2UA 2DIWA 4BX8A 2J9QA 1WY6A 2GGFA 3JUIA 2GRLA 4E6HA 3G2TA 3QJZA 2VJ8A 5ENOD 5AYWD 3HXFA 3C3QA 3CVPA 4ANVA 2A5UA 5EYLA 2CHZA 2NYJA 3P2BA 2R2LA 5KNGA 3T8KA 4I1OB 2IONA 2V8SE 4YDOA 3PE3A 5H7PA 3RRMB 1OWNA 1K1BA 4ANUA 3DPDA 4I6GA 1DC2A 2PZIA 3SFXA 3B7SA 1Y6IA 3SZ7A 2IF4A 3MYVA 2FF4A 4G2VA 2YNQA 2L0TB 4TUMA 5HRYA 4FLBA 2CG2A 3L22A 2CFZA 4UWKA 4LNUD 2ONDA 5KNHD 2WXOA 4RSYA 1HF8A 2V0PA 3AG2E 3D9NA 3NZSA 3NOGD 2FI7A 3Q79A 4ZFHA 5AN8A 3ULEG 3PEVB 1KPSB 3KEZA 4L2LA 3TXMA 2QZAA 5AENA 5D66A 4U0ZA 1SZ9A 1E8ZA 3JUEA 4EZLA 3ZYMA 1V55E 2XZDG 4L23A 3UKRG 1E96B 4PH4B 4BWRA 4BSXA 4O1PA 3CHRA 3EHQA 2P9NG 4U8VD 5BXOA 2FEZA 2WM9A 4U8HA 2J07A 3FUIA 1FT2A 3QWPA 4CT4A 3TXNA 4DX6D 4HOQA 3UM3A 4UQZA 3CHSA 4CEMA 4OYSA 2DBAA 3B13A 1G3NB 5B1BE 3R9AB 1N4QA 3SBSA 4HI9A 4J8FA 3ABKE 3S7DA 4OAUC 4JD2G 1L5JA 1Z6TA 3B7TA 4FJZA 1N0QA 3IXEA 4KVMA 2V4HC 1IQUA 2Y4UA 2MHKA 3HDXA 3RSEG 5ENSD 5E76A 3IHYA 3ZXSA 3C3RA 1RZ4A 3B7UX 1LF8A 1BI8B 4GYOA 4KT6B 1O5MA 3MA5A 2VQ2A 2GRPB 4C0MA 1MHQA 1HG2A 5T3RA 3E30A 4IRUA 3ZRHA 3CVWA 3AS8A 3P1UA 4Y6WA 3D9MA 3CK8A 5EDSA 5IY5E 3AJIA 1PY1A 1SW6A 4GYWA 5EYPF 1TN7A 3Q78A 1NA3A 3FTSA 3KEAA 1HZ4A 3HIZA 2XCCA 3UINC 4MKTA 1NFIE 5ENNA 3CHQA 3TL5A 1Q2ZA 3DEPA 2BKGA 5EIBE 5FINA 5B3SE 3HXBA 3PH0C 3U3WA 4O6FA 4K5CA 4O1OA 3U9WA 4XKCA 3SNXA 1FT1A 4B0ZA 3L17A 4N3BA 3KSLA 1OY3D 3ZNGA 4C9BB 4ABNA 5C1DA 1AWCB 3DSSA 4G8LA 3FU3A 3FP3A 3CK7A 3UMVA 4TXQA 3Q9UC 2VGXB 3RO3A 3FTXA 3AG3E 1TNZA 4B89A 1ZU2A 1LD7A 4FHKA 5G2NA 2ZXWE 1LTXA 4FC8A 5HKPA 3R7RA 2VGEA 3CHPA 3X2QE 4GAAA 1OUVA 2LO6A 5EX3A 2IEJA 4N39A 1HG5A 4KZ0A 4EZJA 3V30A 3EIQC 3MX3A 4GTOA 3GYZA 5JHAA 2XEHA 2J4BA 3I3NA 3ESLA 2BUGA 3DSVA 4U96D 1YCSB 5CHEE 5FQ6A 3JQ1A 4RG9A 4NACA 3VLEA 5KWDA 2R5SA 3LXUX 3TG4A 4JHJA 4FJYA 2XENA 4DPRA 4PS7A 4HOTA 1MX2A 1BU9A 4GU5A 2J08A 3DXKG 3NOCD 2R03A 5JA4D 2MYOA 3HRAA 5JJ7A 3QK0A 5EILA 3AAAC 4JC8A 4APOA 3B7BA 1H6OA 1N4SA 2V4LA 2CHXA 2Y0BG 3TWXA 1Z3YA 4ZHBA 3Q4AB 3TWUA 1JCQA 2P58C 3L82A 1A5EA 3LY7A 4KVOA 2WQ7A 3SGHA 2VGYA 2BKKB 1H6KA 3T9KA 4TXRA 1D8DA 3G2UA 2HO1A 1U2VG 4YVOA 4AV7A 2HR2A 3EU9A 3RKVA 4GA1A 4A1GA 4YDYA 1N94A 4CDRA 3FTUA 4V3IA 1OT8A 4ILHB 2XGMA 4CGVA 5EX0A 4GTQA 3NZUA 4CZ2D 1MYOA 4HFGA 1KT0A 2R17C 4ANXA 2J09A 2IOSA 4CDMA 4YDEA 5JMND 4C48B 3NBNB 2KCLA 3ABLE 1N4RA 1OWPA 4DX2A 4FA6A 2FULA 2ILRA 3TWWA 2R05A 4U7EB 4JW1A 2C0MA 3KAEA 3OAWA 1NP7A 1D8EA 1UN9A 1N52A 2OOEA 5D0OD 4OVVA 3QNKA 5CRVA 2FO1E 5B1AE 3MZLB 2R59A 2P2CP 2P9LG 1XGWA 3SQVA 3BU8A 2BTDA 3FTVA 3E4BA 2GRRB 2ETCA 1TR4A 1TN6A 2AVPA 5LOZA 4RQIA 3CVQA 5ENRD 3CLJA 1PC2A 1DNPA 4HOUA 3J5PA 1OWMA 3HXDA 5AJDA 3Q75A 1EPUA 4ACLA 3IHVA 5ARFA 3BG0B 2WXIA 3PZ4A 3ZIMA 2XGOA 4XIFA 2ZIRA 3PZDA 3FUNA 3BG1B 1OWLA 4GMJA 2EILE 4ATGA 1O1SA 3UKUG 2KCKA 2LSUA 1WG0A 4K03A 2H6IA 3RK6A 3UQ3A 5FQ8A 1JPLA 2I1JA 3MKQA 4B94A 1IHGA 3MEKA 4GCOA 3D9OA 1HU3A 3RIBA 4AJWA 3PEUB 2VYIA 4UUCA 3D9IA 2F8YA 1HH8A 1U3CA 3ZYLA 3FH5A 1LD8A 4JA7A 2AJAA 2NXPA 4DJAA 3FU5A 4JA9A 5G55A 3MV2B 4R7LA 3NAWA 4HRNA 3ASOE 3LJNA 3RRNB 1UOHA 5LCWJ 4MS6A 4BEPA 3VLDA 2DZOA 2I1KA 4HXIA 2X3MA 4HRLA 3RO2A 2IO2C 4BETA 3VTYA 4U0SA 1UG3A 3TAXA 4PS3A 3Q7AA 4GCNA 4KYOB 3MKQB 5BUZA 4J8SA 2WQHA 3U4TA 2KATA 4U8YD 4EZKA 2PQRA 2DVWA 4HOSA 1E8WA 1E7VA 3HXEA 5CRUA 3CVLA 5KJKA 5CMWA 3ASGA 3SFYA 4BT9A 2LXLA 1TN8A 2RG8A 1V54E 3R9MA 3ZGQA 3E37A 3CKCA 2RFMA 5JJTA 3TGOA 3UM0A 4L1BA 3PDNA 5DBKA 3EIJA 3GZ2A 2EIME 3LYAA 4EBAG 3APCA 5AQBA 2IQCA 3SFZA 4GPKA 5G05J 2AXVA 4NQ0A 4NURA 2EQXA 3L6AA 1TYQG 3MKRA 3FWVA 5ANLA 1WAO1 1N95A 2Y4TA 4I9CA 2WXNA 4JXTA 4HS2A 2ZGGA 3QDNA 1IKND 2FO7A 3Q47B 3L16A 3Q7FA 3ULQA 5M72A 4GTTA 3TWSA 1E8YA 4J6IA 3FTZA 3ZPJA 4I1AA 1UJJA 5FIOA 3SD5A 3E33A 4A3VA 3ESKA 3ENEA 2F37A 2A4ZA 1ZBPA 4N5CA 3DPYA 3TJPA 4YNDA 1RW2A 2XPZA 1HX8A 4ME2A 2CFUA 2F0YA 5LCWC 4KZCA 2VGXA 5J90A 3UI2A 1IHBA 3L08A 4IULA 3ZFWA 5FZRA 4LSZE 3L54A 3O4ZA 3QC1A 3L13A 3QB2A 2XS8A 3CSTA 3ZU7B 3CIAA 4TRQA 3FULA 4BFRA 3ULYA 2DCPA 1JCSA 3FUMA 5CMYA 1XNFA 2KZTB 3CVNA 3AG4E 3PS6A 4JEHA 4WNDA 4J8DA 3UT8A 2OEVA 5AJLA 4W9RA 3G2SA 4BSZB 5CEDB 4UWHA 3UIPC 1WM5A 1MJ0A 1OXJA 1INZA 1K8KG 4UQYA 4DLOA 3EHNA 3E34A 4IN3B 3S7JA 4WAFA 2DZNA 4UI9C 4Q96A 2ETBA 4HI8A 3C5RA 2HE0A 4ANWA 3U66A 4XI0A 1K3ZD 4TUUA 3S7BA 4FP7A 2LNIA 5A6CA 4Z68A 1O1RA 3DWLG 3JXJA 4F53A 5ENPD 3B7RL 2WXHA 3T8MA 1VDYA 2AXUA 1O1TA 4WWNA 3LVQE 4TXPA 3OXGA 3FUKA 5T8IA 5G05C 4N5QA 3UXGA 5HS0A 4RVBA 4A63B 3LPZA 4HBDA 5DIZA 2AWIA 4BY6A 2LAIA 3C72A 3ZXPA 5CEAA 4TV3A 4B8CB 4CCAA 1N4PA 1B89A 5JJ6A 3RAUA 4LRZA 3AU4A 3OTNA 4J8EA 3TWRA 3LDZA 3Q73A 1YMPA 4ATZD 2WXGA 4I1MA 2I6HA 3OXLA 1S63A 3QWVA 3R7QA 1SA5A 1UW4B 4IYPA 3RRUA 5CBOA 1N9AA 1BD8A 3UIOC 2XEEA 1FVFA 2XRYA 4PUCA 5A23A 1SVXA 4DLQA 4HLLA 4G26A 5FZSA 3ASDA 4BESA 2XQ0A 3AU5A 4PDXA 3Q49B 1ELWA 4A1SA 5CCLA 4JL0A 2JABA 3EDTB 3PZ3A 5EIDA 3CVUA 2PL2A 3AG1E 3LKUA 3D3MA 1MZCA 3JYSA 3PRZA 2P9PG 1GW6A 3D9KA 4WNFA 3SI5A 2I2OA 2H6HA 4GYYA 4BX9A 1TNUA 1MQSA 3CHMA 4X8QA 2XPIA 5T4YA 3WXXA 3UTMA 3FUHA 4RG6A 3IKOB 4DK5A 4KBQA 1TJCA 3CQGB 3Q5MA 2H6FA 2OCCE 2OV8A 4AP2A 2XGSA 3TWTA 3C3OA 5KBAA 4U07A 4GTPA 4JB8P 1QNFA 2WMNA 1KLXA 1E90A 3PREA 3RJVA 1S0PA 4CYMD 5BXUA 4AM9A 2ZU6B 2VSYA 1NI1A 3NQPA 3W9GA 4JHKA 4H7YA 5HI7A 4EBAA 1DCEA 4APFA 3IBEA 4BT8A 3T5VA 1JWFA 2FBNA 4FADA 3V79K 3ZVVA 1S70B 2GW1A 2KCVA 1Y8MA 1IYGA 1H2TC 5FTPA 4CGWA 2X38A 3DSTA 4F7AA 2MRIA 3HVEB 4GTRA 3DSWA 3FUJA 2V5FA 4XX5A 3HG0D 3D9JA 3FDHA 2QFCA 4ILGA 4CRWA 2UY1B 4Q94A 3HHMA 2AXZA 3O48A 3TWQA 3ASHA 2VSNA 4JZYA 1JUQA 1YYHA 1X5BA 1S64A 4BTBA 4HRMB 3OXFA 2CHWA 4J8YA 3VTXA 4AVXA 5ENQD 4DI4A 3Q15A 5FJYA 2XZTG 2E2EA 3EHMA 3QARA 4EHMA 4AXHA 5CCMA 3UPVA 4N2QA 3MCXA 4U95D 3UT4A 3SY2A 1H2VC 1AP7A 2PM7A 4GA2A 5BV0A 2WXMA 5AQ7A 1NL4A 5CECB 2Q7FA 1BPOA 4AIFA 4UQXA 4N3CA 3URZA 1EYHA 4F1PA 1JWGA 2B0OE 2QC9A 2WMOA 2WXPA 5ARGA 2RD0A 3JCKC 2GRQB 4CT0A 2PQNA 2BF0X 4AOFA 2X6HA 1EF1C 3QOUA 1UN8A 2QY7A 3HYMB 4DRXE 2YINA 4GB9A 2VSXE 4H7XA 4LNBA 2EIKE 2J49A 3I4GA 2KM4A 4EECA 1HFAA 1QBQA 3CVVA 2DYRE 4N2SA 2XRZA 4XI9A 3UX4A 3KSQA 3DRAA 2EINE 3CVYA 2P9SG 4DX7D 2PM6A 5FT9A 3I4RB 4HB5A 4KMOA 5EKQD 2C0LA 1BI7B 5G04C 2QYUA 5AARA 3FUDA 4A55A 4GMRA 4GZDA 4WUYA 2OVFA 4LUNU 1N0RA 4FU3A 4URKA 4NRHB 3FY4A 5LX8A 3S2AA 1QYMA 1HO8A 4AY5A 3GW4A 3EUVA 4HORA 3PUJA 4L9PA 4UWFA 2X6IA 1KZPA 1MX6A 3W9FA 4GZ5A 4O60A 4G24A 4YVQC 2GRNB 1FCHA 3EU5A 2WXFA 3ZHEA 3SBTB 4G11A 3ML8A 4DI3A 3D9LA 3Q9NC 4QFVA 3KD7A 4DX1A 4LNGA 1EDUA 1H0AA 2C2LA 1SQMA 3SF4A 2V5QC 4UI9J 5E75A 5CERB 5AQAA 2XCBA 1TNYA 4HLEA 1OWOA 3CSFA 4MRUA 4Y6CA 3ZYQA 3ZYKA 4ACKA 2XEVA 3SHFA 5FQ4A 4DUIA 5AIJA 1OCOE 4JVSA 4I6EA 3V2OA 3FH7A 3APDA 3LJ3A 2GRMA 4WWOA 2WQ6A 2RFAA 3ZW3A 3QAQA 4G25A 4XE0A 3RU0A 3HXCA 2KZTA 3ZHEB 3PUKA 4OAVB 4K0RA 2VTBA 1TNBA 1HXIA 4UI9K 1NZNA 2LSVA 2L6JA 1KZOA 5FQ7A 4MBGA 3FEYA 3V2XA 4FULA 2NSZA 1IXVA 2L6BA 3UT7A 2KXPC 3UM2A 1SA4A 4FHJA 3PNTB 3N71A 3UUXA 4U04A 1TEZA 5BW8C 4GPMA 3J5QB 3F6QA 2PNNA 5ANRA 4HNAD 4MLPA 4I43A 3LY9A 3CV0A 3AS4A 2ZGDA 3PVLA 2WXQA 4AY6A 1QQEA 2YHCA 3CKBA 2X6FA 3BEEA 5LFAA 1X81A 3FU0A 2VSOE 2J4DA 3NF1A 5CBNA 2IO3C 1WDYA 5AAOA 2CG3A 3CEQA 4I2ZA 3CGHA 3CQCB 2XS1A 3FUFA 2VTBB 1N11A 3TWVA 2OVBA 4N3AA 2WXRA 4G8KA 1DCQA 3G2VA 4G1TA 2QYJA 3LEWA 4PS8A 2L9BA 5D0QD 2IFUA 2RKKA 4DX5D 1H6PA 3APFA 2H6GA 1DVPA 1U3DA 4I17A 4U63A 1TNOA 1FVHA 4BTAA 5ITZF 4D10C 3EHRA 4M7CA 1KT1A 1OCRE 1ELKA 3TG5A 2NC9A 3GZ1A 3LVRE 1N54A 4K5AB 3FTYA 2DWZA 4E85A 4Q69A 1SZAA 1D9SA 1HS6A 2F8XK 3CR3A 3CVXA 2GROB 4JPSA 4J0UA 3KS2A 4K5BA 3AS5A 2Y1LE 4GTMA 4LCTA 3I5PA 4FLHA 1TJFA 1QZ2A 1BLXB 2A5EA 3S7FA 3BQOA 1E7UA 1W3BA 4WNEA 2R02A 3DSXA 3FFLA 3LS8A 5FZQA 3QKYA 3MV3B 1P5QA 2YHEA 4KXKB 5BV1A 1JCRA 3FU6A 3EJNA 2J8SD 3T5XA 4EPZA 3DXMG 2WVIA 4JHRA 2HYZA 2LUHA 5ENTD 3MGBA 3D9HA 3LY8A 5HQ8A 3ABME 3GZSA 3FHEA 5AQ9A 3ZN3A 4C0EA 3E32A 3ZUVB 2XPYA 1NA0A 4RLYA 3IEGA 4GZ3A 2X6JA 2WXJA 3FH8A 2B6CA 3G2WA 3ZKJA 4JEUA 5BNWA 4F3VA 4J7WA 4B8AA 3BUAA 4QQIA 2P9KG 2OEWA 5A7DB 2WPVA 3CHOA 4LERA 2P9IG 2KBXA 2YQ8A 4UWGA 3HVEA 4L2YA 4U0UA 2P9UG 3JXIA 3ASFA 3DSUA 2UY1A 3FEXA 2JEKA 2KC7A 4CDNA 3C98A 3DBSA 4LEUA 2HM8A 1E8XA 4I2WA 3PNLB 3UM1A 1PAQA 4GTVA 3NB2A 2IU1A 4P29A 3ZEFA 5FWQA 4I6JA 2UWJG 3MJWA 4I9EA 5G04J 4EQFA 3B95A 4OVUA 1A17A 2MOWA 3IV0A 2XHEA 5J08A 4XEIG 2WB2A 5EN5D 2IY0C 2LXMA 1Z3XA 5C2YA 1ZB1A
chains in the Genus database with same CATH topology
5CHEE 3ESKA 3FY4A 4A3VA 5FQ6A 5KJLA 3ENEA 2I9CA 2A4ZA 3FUEA 3JQ1A 4RG9A 5LX8A 2M63A 1ZBPA 4NACA 4N5CA 3S2AA 3VLEA 2R5SA 1HO8A 4XZ4A 4AY5A 3TJPA 4YNDA 3LXUX 5LP0A 3TG4A 3ONKA 2XPZA 2L0IA 2E0IA 1HX8A 4ME2A 3GW4A 4HORA 3PUJA 2X6KA 2CFUA 4FJYA 4JHJA 4WNGA 5LCWC 4KZCA 2VGXA 4DPRA 4M3OA 4UWFA 5J90A 2X6IA 5KJNA 3D9PA 3L08A 4GZ5A 4IULA 3ZFWA 5FZRA 4PS7A 4HOTA 3L54A 3O4ZA 3QC1A 1HE8A 4G24A 3L13A 3ONLA 3QB2A 4YVQC 2JLBA 3CSTA 2J08A 3CIAA 4GU5A 3FULA 4TRQA 4BFRA 4XKBA 1FCHA 2LAHA 2DCPA 3FUMA 5CMYA 1XNFA 2IOLA 2KZTB 3CVNA 2WXFA 3PS6A 4JEHA 5JJ7A 3QK0A 3ZHEA 4WNDA 4J8DA 3SBTB 4JC8A 3UT8A 4F1SA 2WXKA 4APOA 4G11A 5AJLA 4W9RA 3G2SA 3ML8A 2V4LA 4DI3A 3D9LA 4QFVA 3KD7A 2CHXA 3LCAA 1EDUA 1Z3YA 1H0AA 3CK9A 2C2LA 4UWHA 1SQMA 1WM5A 3Q4AB 5KCMA 3SF4A 4HVBA 1ELRA 4UI9J 5E75A 1INZA 2P58C 4UQYA 4UWLA 4DLOA 3EHNA 3LY7A 4KVOA 2WQ7A 3K9IA 3SGHA 4IN3B 2VGYA 3S7JA 4WAFA 1H6KA 4UI9C 4Q96A 4G23A 4GA0A 3QWWA 3G2UA 2HO1A 4YVOA 2XCBA 4AV7A 4ANWA 2WXLA 2HR2A 4HLEA 1OWOA 3RKVA 3CSFA 3U66A 4MRUA 4GA1A 4XI0A 3U64A 4Y6CA 4TUUA 3ZYQA 3ZYKA 3S7BA 2XEVA 4FP7A 4WWPA 3SHFA 4A1GA 4ACKA 2LNIA 4CDRA 5A6CA 3FTUA 4V3IA 5FQ4A 4ILHB 2XGMA 5AIJA 3PE4A 4F53A 3B7RL 4CGVA 5EX0A 5BT1A 2WXHA 5KJMA 4JVSA 4I6EA 3T8MA 2AW6A 3NZUA 3FH7A 3APDA 4HFGA 3LJ3A 2GRMA 1VDYA 1KT0A 2AXUA 2R17C 4WWOA 4A3TA 4ANXA 4GZCA 2WQ6A 4WWNA 3LVQE 4GZ6A 3ZW3A 3QAQA 2J09A 4G25A 2IOSA 4CDMA 3JQ0A 2Y3AA 3OXGA 4XE0A 3RU0A 3FUKA 5BPPA 5T8IA 2KZTA 5G05C 3ZHEB 3PUKA 4GMLA 2IJGX 2KCLA 3VLFA 4K0RA 4AEZC 4RVBA 2VTBA 1HXIA 3LPZA 4UI9K 1OWPA 4FA6A 1NZNA 2LSVA 2L6JA 3ML9A 1UJKA 2AWIA 5DIZA 4BY6A 1YA0A 1IQRA 5FQ7A 3FEYA 2LAIA 2FULA 4FULA 4ILIA 2NSZA 2ILRA 1H19A 3UT7A 3FTWA 4L7TA 1H2UA 4TV3A 4B8CB 2DIWA 4BX8A 4CCAA 2J9QA 1WY6A 2GGFA 3JUIA 4FHJA 3PNTB 4JW1A 3N71A 2C0MA 1B89A 2GRLA 3KAEA 5JJ6A 3SD5A 4LRZA 3AU4A 4U04A 3UUXA 4E6HA 3G2TA 3OAWA 3QJZA 5BW8C 1TEZA 1NP7A 2VJ8A 1UN9A 3OTNA 5AYWD 3CVPA 4ANVA 4J8EA 1N52A 2OOEA 2A5UA 3LDZA 2CHZA 5D0OD 3P2BA 2WXGA 4OVVA 5ANRA 4MLPA 3QNKA 4I43A 3LY9A 3CV0A 3AS4A 4I1MA 2I6HA 3OXLA 3PVLA 2WXQA 3QWVA 1QQEA 2YHCA 4AY6A 3CKBA 3MZLB 3R7QA 2R59A 4I1OB 2X6FA 2IONA 2V8SE 3BEEA 3PE3A 1UW4B 5LFAA 1XGWA 4IYPA 3RRMB 1OWNA 3RRUA 4ANUA 3DPDA 2BTDA 3FTVA 2PZIA 3E4BA 3FU0A 4I6GA 3B7SA 1Y6IA 2J4DA 1FVFA 2VSOE 3SZ7A 2IF4A 2XRYA 3NF1A 4PUCA 2CG3A 3CEQA 3MYVA 4I2ZA 5A23A 2FF4A 2AVPA 3CGHA 4G2VA 3CQCB 2YNQA 2L0TB 4DLQA 3FUFA 4G26A 5FZSA 3ASDA 2XQ0A 4FLBA 3AU5A 4PDXA 5LOZA 2CG2A 2VTBB 3Q49B 3L22A 1ELWA 4A1SA 2CFZA 4UWKA 5CCLA 2ONDA 2OVBA 4JL0A 4N3AA 3EDTB 2WXRA 2WXOA 3CVQA 1HF8A 4RSYA 3CVUA 2PL2A 2V0PA 3CLJA 1PC2A 3D9NA 3LKUA 3D3MA 3NZSA 2FI7A 3JYSA 3G2VA 3PRZA 1DNPA 4HOUA 4G1TA 3LEWA 3PEVB 4PS8A 3KEZA 2L9BA 4L2LA 1GW6A 2IFUA 5D0QD 3D9KA 4WNFA 1OWMA 3SI5A 5AENA 4U0ZA 1SZ9A 5AJDA 1EPUA 2I2OA 4GYYA 3APFA 1DVPA 1E8ZA 1U3DA 4I17A 4ACLA 4BX9A 4EZLA 3ZYMA 3IHVA 4L23A 3BG0B 4U63A 5ARFA 1MQSA 2WXIA 1E96B 4PH4B 4BWRA 1FVHA 4BSXA 4BTAA 3CHMA 3ZIMA 4D10C 2XPIA 5T4YA 3CHRA 3WXXA 1KT1A 1ELKA 3TG5A 3FUHA 2NC9A 2XGOA 2FEZA 3GZ1A 3LVRE 4RG6A 3IKOB 1N54A 2WM9A 4U8HA 3FTYA 4XIFA 3PZDA 2J07A 3FUNA 3BG1B 3FUIA 4DK5A 1OWLA 3QWPA 4CT4A 4E85A 4GMJA 3TXNA 4Q69A 1SZAA 4HOQA 4KBQA 1TJCA 3CQGB 3Q5MA 4UQZA 2OV8A 3CHSA 2XGSA 4AP2A 4OYSA 2DBAA 3B13A 4ATGA 4CEMA 2KCKA 2LSUA 4U07A 1HS6A 1QNFA 3R9AB 3CR3A 2WMNA 3CVXA 1KLXA 4K03A 3SBSA 1E90A 3PREA 4J8FA 3RJVA 1S0PA 4JPSA 3RK6A 3UQ3A 3S7DA 4J0UA 4AM9A 2ZU6B 2VSYA 3KS2A 3AS5A 5FQ8A 3NQPA 1JPLA 4JHKA 4H7YA 5HI7A 1L5JA 1Z6TA 4EBAA 4LCTA 3B7TA 3I5PA 2I1JA 3MKQA 4FJZA 1TJFA 4FLHA 1IHGA 3MEKA 4KVMA 4B94A 1QZ2A 4APFA 3IBEA 4BT8A 4GCOA 3T5VA 1JWFA 3D9OA 1HU3A 1IQUA 2Y4UA 3S7FA 3RIBA 2FBNA 1E7UA 1W3BA 2MHKA 3PEUB 4WNEA 3HDXA 4AJWA 4FADA 5E76A 2VYIA 3FFLA 3IHYA 3LS8A 3ZXSA 5FZQA 3QKYA 3ZVVA 2GW1A 2KCVA 3D9IA 3B7UX 1LF8A 3MV3B 4GYOA 1HH8A 1P5QA 2YHEA 4KXKB 1U3CA 3ZYLA 1Y8MA 5BV1A 3FH5A 4KT6B 3FU6A 4JA7A 1IYGA 1H2TC 5FTPA 2NXPA 4DJAA 2X38A 3FU5A 3MA5A 4JA9A 2VQ2A 4CGWA 4C0MA 4F7AA 3EJNA 5G55A 3MV2B 2MRIA 3HVEB 4R7LA 1MHQA 3T5XA 1HG2A 4EPZA 3FUJA 2WVIA 5T3RA 2V5FA 4JHRA 4XX5A 4IRUA 3ZRHA 3CVWA 3D9JA 3FDHA 2QFCA 3AS8A 4ILGA 3RRNB 2HYZA 4CRWA 3P1UA 2UY1B 4Q94A 5LCWJ 4MS6A 3HHMA 2AXZA 4Y6WA 3O48A 3D9MA 3CK8A 3MGBA 3VLDA 5EDSA 3ASHA 2VSNA 3LY8A 4JZYA 5HQ8A 1JUQA 2I1KA 1X5BA 4HXIA 2X3MA 1PY1A 3GZSA 4GYWA 5JHBA 3FHEA 4BTBA 3RO2A 3ZN3A 1NA3A 4C0EA 3FTSA 2XPYA 1NA0A 4U0SA 1HZ4A 1UG3A 3IEGA 3OXFA 2CHWA 4GZ3A 3TAXA 3VTYA 4PS3A 3HIZA 3VTXA 2XCCA 4AVXA 2X6JA 4DI4A 2WXJA 4GCNA 3Q15A 4KYOB 5FJYA 3FH8A 3MKQB 2E2EA 4MKTA 3EHMA 3QARA 3G2WA 5BUZA 5ENNA 3CHQA 3TL5A 4JEUA 4AXHA 5BNWA 4J8SA 2WQHA 3U4TA 2KATA 5CCMA 3UPVA 4N2QA 4F3VA 4EZKA 2PQRA 3MCXA 4B8AA 4HOSA 1E8WA 1E7VA 3UT4A 1H2VC 2PM7A 4GA2A 3PH0C 5A7DB 5BV0A 2WXMA 3CVLA 2WPVA 5KJKA 3CHOA 4LERA 2Q7FA 3U3WA 4O6FA 1BPOA 4AIFA 2YQ8A 3ASGA 5CMWA 3U9WA 4UQXA 3TXMA 4N3CA 4BT9A 3URZA 4XKCA 1EYHA 3SNXA 1JWGA 4UWGA 4B0ZA 2WMOA 3L17A 4N3BA 2RG8A 3HVEA 4L2YA 2WXPA 4U0UA 2RD0A 5ARGA 3ASFA 3JCKC 4CT0A 2PQNA 4C9BB 2BF0X 3ZGQA 4ABNA 3CKCA 4AOFA 2X6HA 5JJTA 1EF1C 3TGOA 5C1DA 3QOUA 2UY1A 1UN8A 3FEXA 3FU3A 4L1BA 3FP3A 3CK7A 3PDNA 5DBKA 3UMVA 3EIJA 2QY7A 3GZ2A 2VGXB 3HYMB 3RO3A 2JEKA 3FTXA 2KC7A 4CDNA 3LYAA 4EBAG 3APCA 4B89A 2YINA 4GB9A 2VSXE 1ZU2A 3C98A 4H7XA 3DBSA 4LEUA 4FHKA 2IQCA 5G2NA 3SFZA 4GPKA 2J49A 2HM8A 1E8XA 3I4GA 2KM4A 4FC8A 5G05J 2AXVA 4I2WA 4EECA 4NQ0A 3PNLB 3R7RA 4NURA 2EQXA 1HFAA 1PAQA 3CVVA 4N2SA 2XRZA 3L6AA 3CHPA 3MKRA 4GAAA 1OUVA 2IU1A 4P29A 4XI9A 2LO6A 3FWVA 3UX4A 3ZEFA 5EX3A 5FWQA 5ANLA 1WAO1 2Y4TA 4I6JA 4N39A 4I9CA 2UWJG 1HG5A 3CVYA 2WXNA 4JXTA 4HS2A 4KZ0A 4EZJA 3MJWA 4I9EA 5G04J 2PM6A 5FT9A 4EQFA 3EIQC 3MX3A 3GYZA 3I4RB 3QDNA 5JHAA 4KMOA 4OVUA 5EKQD 2C0LA 2FO7A 3Q47B 3L16A 5M72A 5G04C 1A17A 2MOWA 3FUDA 2J4BA 2XHEA 3IV0A 3ULQA 4A55A 5J08A 1E8YA 2WB2A 4J6IA 3FTZA 3ZPJA 3I3NA 4GZDA 3ESLA 4WUYA 1Z3XA 2OVFA 4LUNU 5C2YA 2BUGA 4I1AA 4FU3A 4URKA 1UJJA 4NRHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHE E;  3ESK A;  5KJL A;  4RG9 A;  1ZBP A;  4N5C A;  2R5S A;  4AY5 A;  4YND A;  3TG4 A;  4ME2 A;  3GW4 A;  4HOR A;  5LCW C;  4WNG A;  2VGX A;  5KJN A;  4GZ5 A;  3ZFW A;  5FZR A;  4HOT A;  4G24 A;  4YVQ C;  2JLB A;  1FCH A;  1XNF A;  3CVN A;  5JJ7 A;  3ZHE A;  4WND A;  4J8D A;  4APO A;  4W9R A;  3KD7 A;  3LCA A;  3CK9 A;  2C2L A;  1WM5 A;  3Q4A B;  3SF4 A;  1ELR A;  4UI9 J;  2P58 C;  4UQY A;  3LY7 A;  3K9I A;  4IN3 B;  2VGY A;  3S7J A;  4UI9 C;  4G23 A;  4GA0 A;  3QWW A;  2HO1 A;  4YVO A;  2XCB A;  2HR2 A;  3RKV A;  4GA1 A;  4XI0 A;  4Y6C A;  3S7B A;  2XEV A;  2LNI A;  4CDR A;  5A6C A;  2XGM A;  3PE4 A;  4CGV A;  5EX0 A;  5BT1 A;  5KJM A;  1KT0 A;  4GZ6 A;  4G25 A;  3RU0 A;  3OXG A;  3ZHE B;  5G05 C;  2KCL A;  1HXI A;  3LPZ A;  4UI9 K;  1NZN A;  2LSV A;  2L6J A;  5DIZ A;  1YA0 A;  2J9Q A;  3N71 A;  2C0M A;  1B89 A;  3KAE A;  5JJ6 A;  3UUX A;  4U04 A;  5BW8 C;  5AYW D;  3CVP A;  4J8E A;  2OOE A;  5D0O D;  3LY9 A;  3CV0 A;  3AS4 A;  2I6H A;  3OXL A;  4AY6 A;  3QWV A;  1QQE A;  2YHC A;  3CKB A;  3BEE A;  3PE3 A;  2PZI A;  3E4B A;  3SZ7 A;  2IF4 A;  3NF1 A;  3CEQ A;  4I2Z A;  2FF4 A;  2AVP A;  4G2V A;  4G26 A;  5FZS A;  3ASD A;  3Q49 B;  1ELW A;  4A1S A;  5CCL A;  2OND A;  4JL0 A;  4N3A A;  3EDT B;  3CVQ A;  2PL2 A;  1PC2 A;  3LKU A;  2FI7 A;  3JYS A;  4HOU A;  4G1T A;  5D0Q D;  2IFU A;  4WNF A;  4U0Z A;  4GYY A;  4I17 A;  5ARF A;  1E96 B;  4BWR A;  4BTA A;  2XPI A;  3WXX A;  1KT1 A;  3TG5 A;  2NC9 A;  2XGO A;  2FEZ A;  3GZ1 A;  4RG6 A;  4XIF A;  3QWP A;  4HOQ A;  4KBQ A;  1TJC A;  3Q5M A;  4UQZ A;  2XGS A;  2DBA A;  2KCK A;  2LSU A;  4U07 A;  3R9A B;  1KLX A;  4J8F A;  3RJV A;  3UQ3 A;  3S7D A;  4J0U A;  4AM9 A;  2VSY A;  3KS2 A;  3AS5 A;  4H7Y A;  5HI7 A;  4B94 A;  1IHG A;  3MEK A;  1QZ2 A;  4BT8 A;  4GCO A;  2Y4U A;  3S7F A;  3RIB A;  2FBN A;  2MHK A;  1W3B A;  4WNE A;  2VYI A;  3FFL A;  5FZQ A;  3QKY A;  2GW1 A;  2KCV A;  3MV3 B;  4GYO A;  1HH8 A;  1P5Q A;  4KXK B;  1Y8M A;  4JA7 A;  1IYG A;  5FTP A;  4CGW A;  3MA5 A;  4JA9 A;  2VQ2 A;  3MV2 B;  2V5F A;  4JHR A;  2QFC A;  3AS8 A;  2HYZ A;  2UY1 B;  5LCW J;  4Y6W A;  3O48 A;  3CK8 A;  3ASH A;  2VSN A;  3LY8 A;  5HQ8 A;  4GYW A;  4BTB A;  3RO2 A;  3ZN3 A;  1NA3 A;  1NA0 A;  4U0S A;  1HZ4 A;  3IEG A;  3VTY A;  3OXF A;  4GZ3 A;  3TAX A;  3VTX A;  2XCC A;  4GCN A;  3Q15 A;  4KYO B;  5FJY A;  2E2E A;  5BNW A;  2WQH A;  3U4T A;  2KAT A;  5CCM A;  3UPV A;  4N2Q A;  4F3V A;  2PQR A;  4HOS A;  4GA2 A;  5A7D B;  3CVL A;  2WPV A;  5KJK A;  2Q7F A;  3U3W A;  4O6F A;  4AIF A;  2YQ8 A;  3ASG A;  4UQX A;  4N3C A;  4BT9 A;  3URZ A;  4N3B A;  4U0U A;  5ARG A;  3ASF A;  2PQN A;  3ZGQ A;  4ABN A;  3CKC A;  5JJT A;  3TGO A;  5C1D A;  3QOU A;  2UY1 A;  3FP3 A;  3CK7 A;  3PDN A;  5DBK A;  3GZ2 A;  3HYM B;  2VGX B;  3RO3 A;  2KC7 A;  3LYA A;  1ZU2 A;  4H7X A;  4LEU A;  4GPK A;  5G05 J;  4I2W A;  4NQ0 A;  4N2S A;  3MKR A;  1OUV A;  4XI9 A;  3FWV A;  5EX3 A;  1WAO 1;  2Y4T A;  4N39 A;  4I9C A;  2UWJ G;  4I9E A;  5G04 J;  5FT9 A;  4EQF A;  3GYZ A;  3QDN A;  5EKQ D;  2C0L A;  2FO7 A;  3Q47 B;  5M72 A;  5G04 C;  1A17 A;  3ULQ A;  3ZPJ A;  4WUY A;  2BUG A;  4I1A A;  4NRH B; 
#chains in the Genus database with same CATH topology
 5KJL A;  2I9C A;  3FUE A;  2M63 A;  4XZ4 A;  3PZ1 A;  1OCC E;  5LP0 A;  3ONK A;  2BED A;  2L0I A;  2E0I A;  4YDW A;  2X6K A;  4WNG A;  4M3O A;  4HQD A;  5KJN A;  3D9P A;  1Z5S C;  1HE8 A;  3ONL A;  2JLB A;  4XKB A;  2LAH A;  3V31 A;  1OCZ E;  2IOL A;  1K1A A;  5D2M C;  4F1S A;  2WXK A;  3SO8 A;  3LCA A;  3CK9 A;  5KCM A;  4HVB A;  1ELR A;  4UWL A;  2DYS E;  3ASN E;  2EIJ E;  3K9I A;  3ISM C;  4G23 A;  4GA0 A;  3QWW A;  4NIK A;  4B93 B;  2WXL A;  2ZIS A;  3U64 A;  3L9T A;  5JHB A;  4WWP A;  2Y69 E;  4GTS A;  3PE4 A;  4LG6 A;  5BT1 A;  5KJM A;  2AW6 A;  4A3T A;  4GZC A;  4GZ6 A;  3JQ0 A;  2Y3A A;  3PZ2 A;  5BPP A;  2ETA A;  4GML A;  2IJG X;  3VLF A;  4AEZ C;  4F6R D;  1FPP A;  3WG7 E;  1MX4 A;  3ML9 A;  1UJK A;  4BER A;  1YA0 A;  1IQR A;  3DEO A;  4ILI A;  1H19 A;  3FTW A;  4L7T A;  1H2U A;  2DIW A;  4BX8 A;  2J9Q A;  1WY6 A;  2GGF A;  3JUI A;  2GRL A;  4E6H A;  3G2T A;  3QJZ A;  2VJ8 A;  5ENO D;  5AYW D;  3HXF A;  3C3Q A;  3CVP A;  4ANV A;  2A5U A;  5EYL A;  2CHZ A;  2NYJ A;  3P2B A;  2R2L A;  5KNG A;  3T8K A;  4I1O B;  2ION A;  2V8S E;  4YDO A;  3PE3 A;  5H7P A;  3RRM B;  1OWN A;  1K1B A;  4ANU A;  3DPD A;  4I6G A;  1DC2 A;  2PZI A;  3SFX A;  3B7S A;  1Y6I A;  3SZ7 A;  2IF4 A;  3MYV A;  2FF4 A;  4G2V A;  2YNQ A;  2L0T B;  4TUM A;  5HRY A;  4FLB A;  2CG2 A;  3L22 A;  2CFZ A;  4UWK A;  4LNU D;  2OND A;  5KNH D;  2WXO A;  4RSY A;  1HF8 A;  2V0P A;  3AG2 E;  3D9N A;  3NZS A;  3NOG D;  2FI7 A;  3Q79 A;  4ZFH A;  5AN8 A;  3ULE G;  3PEV B;  1KPS B;  3KEZ A;  4L2L A;  3TXM A;  2QZA A;  5AEN A;  5D66 A;  4U0Z A;  1SZ9 A;  1E8Z A;  3JUE A;  4EZL A;  3ZYM A;  1V55 E;  2XZD G;  4L23 A;  3UKR G;  1E96 B;  4PH4 B;  4BWR A;  4BSX A;  4O1P A;  3CHR A;  3EHQ A;  2P9N G;  4U8V D;  5BXO A;  2FEZ A;  2WM9 A;  4U8H A;  2J07 A;  3FUI A;  1FT2 A;  3QWP A;  4CT4 A;  3TXN A;  4DX6 D;  4HOQ A;  3UM3 A;  4UQZ A;  3CHS A;  4CEM A;  4OYS A;  2DBA A;  3B13 A;  1G3N B;  5B1B E;  3R9A B;  1N4Q A;  3SBS A;  4HI9 A;  4J8F A;  3ABK E;  3S7D A;  4OAU C;  4JD2 G;  1L5J A;  1Z6T A;  3B7T A;  4FJZ A;  1N0Q A;  3IXE A;  4KVM A;  2V4H C;  1IQU A;  2Y4U A;  2MHK A;  3HDX A;  3RSE G;  5ENS D;  5E76 A;  3IHY A;  3ZXS A;  3C3R A;  1RZ4 A;  3B7U X;  1LF8 A;  1BI8 B;  4GYO A;  4KT6 B;  1O5M A;  3MA5 A;  2VQ2 A;  2GRP B;  4C0M A;  1MHQ A;  1HG2 A;  5T3R A;  3E30 A;  4IRU A;  3ZRH A;  3CVW A;  3AS8 A;  3P1U A;  4Y6W A;  3D9M A;  3CK8 A;  5EDS A;  5IY5 E;  3AJI A;  1PY1 A;  1SW6 A;  4GYW A;  5EYP F;  1TN7 A;  3Q78 A;  1NA3 A;  3FTS A;  3KEA A;  1HZ4 A;  3HIZ A;  2XCC A;  3UIN C;  4MKT A;  1NFI E;  5ENN A;  3CHQ A;  3TL5 A;  1Q2Z A;  3DEP A;  2BKG A;  5EIB E;  5FIN A;  5B3S E;  3HXB A;  3PH0 C;  3U3W A;  4O6F A;  4K5C A;  4O1O A;  3U9W A;  4XKC A;  3SNX A;  1FT1 A;  4B0Z A;  3L17 A;  4N3B A;  3KSL A;  1OY3 D;  3ZNG A;  4C9B B;  4ABN A;  5C1D A;  1AWC B;  3DSS A;  4G8L A;  3FU3 A;  3FP3 A;  3CK7 A;  3UMV A;  4TXQ A;  3Q9U C;  2VGX B;  3RO3 A;  3FTX A;  3AG3 E;  1TNZ A;  4B89 A;  1ZU2 A;  1LD7 A;  4FHK A;  5G2N A;  2ZXW E;  1LTX A;  4FC8 A;  5HKP A;  3R7R A;  2VGE A;  3CHP A;  3X2Q E;  4GAA A;  1OUV A;  2LO6 A;  5EX3 A;  2IEJ A;  4N39 A;  1HG5 A;  4KZ0 A;  4EZJ A;  3V30 A;  3EIQ C;  3MX3 A;  4GTO A;  3GYZ A;  5JHA A;  2XEH A;  2J4B A;  3I3N A;  3ESL A;  2BUG A;  3DSV A;  4U96 D;  1YCS B;  5CHE E;  5FQ6 A;  3JQ1 A;  4RG9 A;  4NAC A;  3VLE A;  5KWD A;  2R5S A;  3LXU X;  3TG4 A;  4JHJ A;  4FJY A;  2XEN A;  4DPR A;  4PS7 A;  4HOT A;  1MX2 A;  1BU9 A;  4GU5 A;  2J08 A;  3DXK G;  3NOC D;  2R03 A;  5JA4 D;  2MYO A;  3HRA A;  5JJ7 A;  3QK0 A;  5EIL A;  3AAA C;  4JC8 A;  4APO A;  3B7B A;  1H6O A;  1N4S A;  2V4L A;  2CHX A;  2Y0B G;  3TWX A;  1Z3Y A;  4ZHB A;  3Q4A B;  3TWU A;  1JCQ A;  2P58 C;  3L82 A;  1A5E A;  3LY7 A;  4KVO A;  2WQ7 A;  3SGH A;  2VGY A;  2BKK B;  1H6K A;  3T9K A;  4TXR A;  1D8D A;  3G2U A;  2HO1 A;  1U2V G;  4YVO A;  4AV7 A;  2HR2 A;  3EU9 A;  3RKV A;  4GA1 A;  4A1G A;  4YDY A;  1N94 A;  4CDR A;  3FTU A;  4V3I A;  1OT8 A;  4ILH B;  2XGM A;  4CGV A;  5EX0 A;  4GTQ A;  3NZU A;  4CZ2 D;  1MYO A;  4HFG A;  1KT0 A;  2R17 C;  4ANX A;  2J09 A;  2IOS A;  4CDM A;  4YDE A;  5JMN D;  4C48 B;  3NBN B;  2KCL A;  3ABL E;  1N4R A;  1OWP A;  4DX2 A;  4FA6 A;  2FUL A;  2ILR A;  3TWW A;  2R05 A;  4U7E B;  4JW1 A;  2C0M A;  3KAE A;  3OAW A;  1NP7 A;  1D8E A;  1UN9 A;  1N52 A;  2OOE A;  5D0O D;  4OVV A;  3QNK A;  5CRV A;  2FO1 E;  5B1A E;  3MZL B;  2R59 A;  2P2C P;  2P9L G;  1XGW A;  3SQV A;  3BU8 A;  2BTD A;  3FTV A;  3E4B A;  2GRR B;  2ETC A;  1TR4 A;  1TN6 A;  2AVP A;  5LOZ A;  4RQI A;  3CVQ A;  5ENR D;  3CLJ A;  1PC2 A;  1DNP A;  4HOU A;  3J5P A;  1OWM A;  3HXD A;  5AJD A;  3Q75 A;  1EPU A;  4ACL A;  3IHV A;  5ARF A;  3BG0 B;  2WXI A;  3PZ4 A;  3ZIM A;  2XGO A;  4XIF A;  2ZIR A;  3PZD A;  3FUN A;  3BG1 B;  1OWL A;  4GMJ A;  2EIL E;  4ATG A;  1O1S A;  3UKU G;  2KCK A;  2LSU A;  1WG0 A;  4K03 A;  2H6I A;  3RK6 A;  3UQ3 A;  5FQ8 A;  1JPL A;  2I1J A;  3MKQ A;  4B94 A;  1IHG A;  3MEK A;  4GCO A;  3D9O A;  1HU3 A;  3RIB A;  4AJW A;  3PEU B;  2VYI A;  4UUC A;  3D9I A;  2F8Y A;  1HH8 A;  1U3C A;  3ZYL A;  3FH5 A;  1LD8 A;  4JA7 A;  2AJA A;  2NXP A;  4DJA A;  3FU5 A;  4JA9 A;  5G55 A;  3MV2 B;  4R7L A;  3NAW A;  4HRN A;  3ASO E;  3LJN A;  3RRN B;  1UOH A;  5LCW J;  4MS6 A;  4BEP A;  3VLD A;  2DZO A;  2I1K A;  4HXI A;  2X3M A;  4HRL A;  3RO2 A;  2IO2 C;  4BET A;  3VTY A;  4U0S A;  1UG3 A;  3TAX A;  4PS3 A;  3Q7A A;  4GCN A;  4KYO B;  3MKQ B;  5BUZ A;  4J8S A;  2WQH A;  3U4T A;  2KAT A;  4U8Y D;  4EZK A;  2PQR A;  2DVW A;  4HOS A;  1E8W A;  1E7V A;  3HXE A;  5CRU A;  3CVL A;  5KJK A;  5CMW A;  3ASG A;  3SFY A;  4BT9 A;  2LXL A;  1TN8 A;  2RG8 A;  1V54 E;  3R9M A;  3ZGQ A;  3E37 A;  3CKC A;  2RFM A;  5JJT A;  3TGO A;  3UM0 A;  4L1B A;  3PDN A;  5DBK A;  3EIJ A;  3GZ2 A;  2EIM E;  3LYA A;  4EBA G;  3APC A;  5AQB A;  2IQC A;  3SFZ A;  4GPK A;  5G05 J;  2AXV A;  4NQ0 A;  4NUR A;  2EQX A;  3L6A A;  1TYQ G;  3MKR A;  3FWV A;  5ANL A;  1WAO 1;  1N95 A;  2Y4T A;  4I9C A;  2WXN A;  4JXT A;  4HS2 A;  2ZGG A;  3QDN A;  1IKN D;  2FO7 A;  3Q47 B;  3L16 A;  3Q7F A;  3ULQ A;  5M72 A;  4GTT A;  3TWS A;  1E8Y A;  4J6I A;  3FTZ A;  3ZPJ A;  4I1A A;  1UJJ A;  5FIO A;  3SD5 A;  3E33 A;  4A3V A;  3ESK A;  3ENE A;  2F37 A;  2A4Z A;  1ZBP A;  4N5C A;  3DPY A;  3TJP A;  4YND A;  1RW2 A;  2XPZ A;  1HX8 A;  4ME2 A;  2CFU A;  2F0Y A;  5LCW C;  4KZC A;  2VGX A;  5J90 A;  3UI2 A;  1IHB A;  3L08 A;  4IUL A;  3ZFW A;  5FZR A;  4LSZ E;  3L54 A;  3O4Z A;  3QC1 A;  3L13 A;  3QB2 A;  2XS8 A;  3CST A;  3ZU7 B;  3CIA A;  4TRQ A;  3FUL A;  4BFR A;  3ULY A;  2DCP A;  1JCS A;  3FUM A;  5CMY A;  1XNF A;  2KZT B;  3CVN A;  3AG4 E;  3PS6 A;  4JEH A;  4WND A;  4J8D A;  3UT8 A;  2OEV A;  5AJL A;  4W9R A;  3G2S A;  4BSZ B;  5CED B;  4UWH A;  3UIP C;  1WM5 A;  1MJ0 A;  1OXJ A;  1INZ A;  1K8K G;  4UQY A;  4DLO A;  3EHN A;  3E34 A;  4IN3 B;  3S7J A;  4WAF A;  2DZN A;  4UI9 C;  4Q96 A;  2ETB A;  4HI8 A;  3C5R A;  2HE0 A;  4ANW A;  3U66 A;  4XI0 A;  1K3Z D;  4TUU A;  3S7B A;  4FP7 A;  2LNI A;  5A6C A;  4Z68 A;  1O1R A;  3DWL G;  3JXJ A;  4F53 A;  5ENP D;  3B7R L;  2WXH A;  3T8M A;  1VDY A;  2AXU A;  1O1T A;  4WWN A;  3LVQ E;  4TXP A;  3OXG A;  3FUK A;  5T8I A;  5G05 C;  4N5Q A;  3UXG A;  5HS0 A;  4RVB A;  4A63 B;  3LPZ A;  4HBD A;  5DIZ A;  2AWI A;  4BY6 A;  2LAI A;  3C72 A;  3ZXP A;  5CEA A;  4TV3 A;  4B8C B;  4CCA A;  1N4P A;  1B89 A;  5JJ6 A;  3RAU A;  4LRZ A;  3AU4 A;  3OTN A;  4J8E A;  3TWR A;  3LDZ A;  3Q73 A;  1YMP A;  4ATZ D;  2WXG A;  4I1M A;  2I6H A;  3OXL A;  1S63 A;  3QWV A;  3R7Q A;  1SA5 A;  1UW4 B;  4IYP A;  3RRU A;  5CBO A;  1N9A A;  1BD8 A;  3UIO C;  2XEE A;  1FVF A;  2XRY A;  4PUC A;  5A23 A;  1SVX A;  4DLQ A;  4HLL A;  4G26 A;  5FZS A;  3ASD A;  4BES A;  2XQ0 A;  3AU5 A;  4PDX A;  3Q49 B;  1ELW A;  4A1S A;  5CCL A;  4JL0 A;  2JAB A;  3EDT B;  3PZ3 A;  5EID A;  3CVU A;  2PL2 A;  3AG1 E;  3LKU A;  3D3M A;  1MZC A;  3JYS A;  3PRZ A;  2P9P G;  1GW6 A;  3D9K A;  4WNF A;  3SI5 A;  2I2O A;  2H6H A;  4GYY A;  4BX9 A;  1TNU A;  1MQS A;  3CHM A;  4X8Q A;  2XPI A;  5T4Y A;  3WXX A;  3UTM A;  3FUH A;  4RG6 A;  3IKO B;  4DK5 A;  4KBQ A;  1TJC A;  3CQG B;  3Q5M A;  2H6F A;  2OCC E;  2OV8 A;  4AP2 A;  2XGS A;  3TWT A;  3C3O A;  5KBA A;  4U07 A;  4GTP A;  4JB8 P;  1QNF A;  2WMN A;  1KLX A;  1E90 A;  3PRE A;  3RJV A;  1S0P A;  4CYM D;  5BXU A;  4AM9 A;  2ZU6 B;  2VSY A;  1NI1 A;  3NQP A;  3W9G A;  4JHK A;  4H7Y A;  5HI7 A;  4EBA A;  1DCE A;  4APF A;  3IBE A;  4BT8 A;  3T5V A;  1JWF A;  2FBN A;  4FAD A;  3V79 K;  3ZVV A;  1S70 B;  2GW1 A;  2KCV A;  1Y8M A;  1IYG A;  1H2T C;  5FTP A;  4CGW A;  2X38 A;  3DST A;  4F7A A;  2MRI A;  3HVE B;  4GTR A;  3DSW A;  3FUJ A;  2V5F A;  4XX5 A;  3HG0 D;  3D9J A;  3FDH A;  2QFC A;  4ILG A;  4CRW A;  2UY1 B;  4Q94 A;  3HHM A;  2AXZ A;  3O48 A;  3TWQ A;  3ASH A;  2VSN A;  4JZY A;  1JUQ A;  1YYH A;  1X5B A;  1S64 A;  4BTB A;  4HRM B;  3OXF A;  2CHW A;  4J8Y A;  3VTX A;  4AVX A;  5ENQ D;  4DI4 A;  3Q15 A;  5FJY A;  2XZT G;  2E2E A;  3EHM A;  3QAR A;  4EHM A;  4AXH A;  5CCM A;  3UPV A;  4N2Q A;  3MCX A;  4U95 D;  3UT4 A;  3SY2 A;  1H2V C;  1AP7 A;  2PM7 A;  4GA2 A;  5BV0 A;  2WXM A;  5AQ7 A;  1NL4 A;  5CEC B;  2Q7F A;  1BPO A;  4AIF A;  4UQX A;  4N3C A;  3URZ A;  1EYH A;  4F1P A;  1JWG A;  2B0O E;  2QC9 A;  2WMO A;  2WXP A;  5ARG A;  2RD0 A;  3JCK C;  2GRQ B;  4CT0 A;  2PQN A;  2BF0 X;  4AOF A;  2X6H A;  1EF1 C;  3QOU A;  1UN8 A;  2QY7 A;  3HYM B;  4DRX E;  2YIN A;  4GB9 A;  2VSX E;  4H7X A;  4LNB A;  2EIK E;  2J49 A;  3I4G A;  2KM4 A;  4EEC A;  1HFA A;  1QBQ A;  3CVV A;  2DYR E;  4N2S A;  2XRZ A;  4XI9 A;  3UX4 A;  3KSQ A;  3DRA A;  2EIN E;  3CVY A;  2P9S G;  4DX7 D;  2PM6 A;  5FT9 A;  3I4R B;  4HB5 A;  4KMO A;  5EKQ D;  2C0L A;  1BI7 B;  5G04 C;  2QYU A;  5AAR A;  3FUD A;  4A55 A;  4GMR A;  4GZD A;  4WUY A;  2OVF A;  4LUN U;  1N0R A;  4FU3 A;  4URK A;  4NRH B;  3FY4 A;  5LX8 A;  3S2A A;  1QYM A;  1HO8 A;  4AY5 A;  3GW4 A;  3EUV A;  4HOR A;  3PUJ A;  4L9P A;  4UWF A;  2X6I A;  1KZP A;  1MX6 A;  3W9F A;  4GZ5 A;  4O60 A;  4G24 A;  4YVQ C;  2GRN B;  1FCH A;  3EU5 A;  2WXF A;  3ZHE A;  3SBT B;  4G11 A;  3ML8 A;  4DI3 A;  3D9L A;  3Q9N C;  4QFV A;  3KD7 A;  4DX1 A;  4LNG A;  1EDU A;  1H0A A;  2C2L A;  1SQM A;  3SF4 A;  2V5Q C;  4UI9 J;  5E75 A;  5CER B;  5AQA A;  2XCB A;  1TNY A;  4HLE A;  1OWO A;  3CSF A;  4MRU A;  4Y6C A;  3ZYQ A;  3ZYK A;  4ACK A;  2XEV A;  3SHF A;  5FQ4 A;  4DUI A;  5AIJ A;  1OCO E;  4JVS A;  4I6E A;  3V2O A;  3FH7 A;  3APD A;  3LJ3 A;  2GRM A;  4WWO A;  2WQ6 A;  2RFA A;  3ZW3 A;  3QAQ A;  4G25 A;  4XE0 A;  3RU0 A;  3HXC A;  2KZT A;  3ZHE B;  3PUK A;  4OAV B;  4K0R A;  2VTB A;  1TNB A;  1HXI A;  4UI9 K;  1NZN A;  2LSV A;  2L6J A;  1KZO A;  5FQ7 A;  4MBG A;  3FEY A;  3V2X A;  4FUL A;  2NSZ A;  1IXV A;  2L6B A;  3UT7 A;  2KXP C;  3UM2 A;  1SA4 A;  4FHJ A;  3PNT B;  3N71 A;  3UUX A;  4U04 A;  1TEZ A;  5BW8 C;  4GPM A;  3J5Q B;  3F6Q A;  2PNN A;  5ANR A;  4HNA D;  4MLP A;  4I43 A;  3LY9 A;  3CV0 A;  3AS4 A;  2ZGD A;  3PVL A;  2WXQ A;  4AY6 A;  1QQE A;  2YHC A;  3CKB A;  2X6F A;  3BEE A;  5LFA A;  1X81 A;  3FU0 A;  2VSO E;  2J4D A;  3NF1 A;  5CBN A;  2IO3 C;  1WDY A;  5AAO A;  2CG3 A;  3CEQ A;  4I2Z A;  3CGH A;  3CQC B;  2XS1 A;  3FUF A;  2VTB B;  1N11 A;  3TWV A;  2OVB A;  4N3A A;  2WXR A;  4G8K A;  1DCQ A;  3G2V A;  4G1T A;  2QYJ A;  3LEW A;  4PS8 A;  2L9B A;  5D0Q D;  2IFU A;  2RKK A;  4DX5 D;  1H6P A;  3APF A;  2H6G A;  1DVP A;  1U3D A;  4I17 A;  4U63 A;  1TNO A;  1FVH A;  4BTA A;  5ITZ F;  4D10 C;  3EHR A;  4M7C A;  1KT1 A;  1OCR E;  1ELK A;  3TG5 A;  2NC9 A;  3GZ1 A;  3LVR E;  1N54 A;  4K5A B;  3FTY A;  2DWZ A;  4E85 A;  4Q69 A;  1SZA A;  1D9S A;  1HS6 A;  2F8X K;  3CR3 A;  3CVX A;  2GRO B;  4JPS A;  4J0U A;  3KS2 A;  4K5B A;  3AS5 A;  2Y1L E;  4GTM A;  4LCT A;  3I5P A;  4FLH A;  1TJF A;  1QZ2 A;  1BLX B;  2A5E A;  3S7F A;  3BQO A;  1E7U A;  1W3B A;  4WNE A;  2R02 A;  3DSX A;  3FFL A;  3LS8 A;  5FZQ A;  3QKY A;  3MV3 B;  1P5Q A;  2YHE A;  4KXK B;  5BV1 A;  1JCR A;  3FU6 A;  3EJN A;  2J8S D;  3T5X A;  4EPZ A;  3DXM G;  2WVI A;  4JHR A;  2HYZ A;  2LUH A;  5ENT D;  3MGB A;  3D9H A;  3LY8 A;  5HQ8 A;  3ABM E;  3GZS A;  3FHE A;  5AQ9 A;  3ZN3 A;  4C0E A;  3E32 A;  3ZUV B;  2XPY A;  1NA0 A;  4RLY A;  3IEG A;  4GZ3 A;  2X6J A;  2WXJ A;  3FH8 A;  2B6C A;  3G2W A;  3ZKJ A;  4JEU A;  5BNW A;  4F3V A;  4J7W A;  4B8A A;  3BUA A;  4QQI A;  2P9K G;  2OEW A;  5A7D B;  2WPV A;  3CHO A;  4LER A;  2P9I G;  2KBX A;  2YQ8 A;  4UWG A;  3HVE A;  4L2Y A;  4U0U A;  2P9U G;  3JXI A;  3ASF A;  3DSU A;  2UY1 A;  3FEX A;  2JEK A;  2KC7 A;  4CDN A;  3C98 A;  3DBS A;  4LEU A;  2HM8 A;  1E8X A;  4I2W A;  3PNL B;  3UM1 A;  1PAQ A;  4GTV A;  3NB2 A;  2IU1 A;  4P29 A;  3ZEF A;  5FWQ A;  4I6J A;  2UWJ G;  3MJW A;  4I9E A;  5G04 J;  4EQF A;  3B95 A;  4OVU A;  1A17 A;  2MOW A;  3IV0 A;  2XHE A;  5J08 A;  4XEI G;  2WB2 A;  5EN5 D;  2IY0 C;  2LXM A;  1Z3X A;  5C2Y A;  1ZB1 A; 
#chains in the Genus database with same CATH homology
 5CHE E;  3ESK A;  3FY4 A;  4A3V A;  5FQ6 A;  5KJL A;  3ENE A;  2I9C A;  2A4Z A;  3FUE A;  3JQ1 A;  4RG9 A;  5LX8 A;  2M63 A;  1ZBP A;  4NAC A;  4N5C A;  3S2A A;  3VLE A;  2R5S A;  1HO8 A;  4XZ4 A;  4AY5 A;  3TJP A;  4YND A;  3LXU X;  5LP0 A;  3TG4 A;  3ONK A;  2XPZ A;  2L0I A;  2E0I A;  1HX8 A;  4ME2 A;  3GW4 A;  4HOR A;  3PUJ A;  2X6K A;  2CFU A;  4FJY A;  4JHJ A;  4WNG A;  5LCW C;  4KZC A;  2VGX A;  4DPR A;  4M3O A;  4UWF A;  5J90 A;  2X6I A;  5KJN A;  3D9P A;  3L08 A;  4GZ5 A;  4IUL A;  3ZFW A;  5FZR A;  4PS7 A;  4HOT A;  3L54 A;  3O4Z A;  3QC1 A;  1HE8 A;  4G24 A;  3L13 A;  3ONL A;  3QB2 A;  4YVQ C;  2JLB A;  3CST A;  2J08 A;  3CIA A;  4GU5 A;  3FUL A;  4TRQ A;  4BFR A;  4XKB A;  1FCH A;  2LAH A;  2DCP A;  3FUM A;  5CMY A;  1XNF A;  2IOL A;  2KZT B;  3CVN A;  2WXF A;  3PS6 A;  4JEH A;  5JJ7 A;  3QK0 A;  3ZHE A;  4WND A;  4J8D A;  3SBT B;  4JC8 A;  3UT8 A;  4F1S A;  2WXK A;  4APO A;  4G11 A;  5AJL A;  4W9R A;  3G2S A;  3ML8 A;  2V4L A;  4DI3 A;  3D9L A;  4QFV A;  3KD7 A;  2CHX A;  3LCA A;  1EDU A;  1Z3Y A;  1H0A A;  3CK9 A;  2C2L A;  4UWH A;  1SQM A;  1WM5 A;  3Q4A B;  5KCM A;  3SF4 A;  4HVB A;  1ELR A;  4UI9 J;  5E75 A;  1INZ A;  2P58 C;  4UQY A;  4UWL A;  4DLO A;  3EHN A;  3LY7 A;  4KVO A;  2WQ7 A;  3K9I A;  3SGH A;  4IN3 B;  2VGY A;  3S7J A;  4WAF A;  1H6K A;  4UI9 C;  4Q96 A;  4G23 A;  4GA0 A;  3QWW A;  3G2U A;  2HO1 A;  4YVO A;  2XCB A;  4AV7 A;  4ANW A;  2WXL A;  2HR2 A;  4HLE A;  1OWO A;  3RKV A;  3CSF A;  3U66 A;  4MRU A;  4GA1 A;  4XI0 A;  3U64 A;  4Y6C A;  4TUU A;  3ZYQ A;  3ZYK A;  3S7B A;  2XEV A;  4FP7 A;  4WWP A;  3SHF A;  4A1G A;  4ACK A;  2LNI A;  4CDR A;  5A6C A;  3FTU A;  4V3I A;  5FQ4 A;  4ILH B;  2XGM A;  5AIJ A;  3PE4 A;  4F53 A;  3B7R L;  4CGV A;  5EX0 A;  5BT1 A;  2WXH A;  5KJM A;  4JVS A;  4I6E A;  3T8M A;  2AW6 A;  3NZU A;  3FH7 A;  3APD A;  4HFG A;  3LJ3 A;  2GRM A;  1VDY A;  1KT0 A;  2AXU A;  2R17 C;  4WWO A;  4A3T A;  4ANX A;  4GZC A;  2WQ6 A;  4WWN A;  3LVQ E;  4GZ6 A;  3ZW3 A;  3QAQ A;  2J09 A;  4G25 A;  2IOS A;  4CDM A;  3JQ0 A;  2Y3A A;  3OXG A;  4XE0 A;  3RU0 A;  3FUK A;  5BPP A;  5T8I A;  2KZT A;  5G05 C;  3ZHE B;  3PUK A;  4GML A;  2IJG X;  2KCL A;  3VLF A;  4K0R A;  4AEZ C;  4RVB A;  2VTB A;  1HXI A;  3LPZ A;  4UI9 K;  1OWP A;  4FA6 A;  1NZN A;  2LSV A;  2L6J A;  3ML9 A;  1UJK A;  2AWI A;  5DIZ A;  4BY6 A;  1YA0 A;  1IQR A;  5FQ7 A;  3FEY A;  2LAI A;  2FUL A;  4FUL A;  4ILI A;  2NSZ A;  2ILR A;  1H19 A;  3UT7 A;  3FTW A;  4L7T A;  1H2U A;  4TV3 A;  4B8C B;  2DIW A;  4BX8 A;  4CCA A;  2J9Q A;  1WY6 A;  2GGF A;  3JUI A;  4FHJ A;  3PNT B;  4JW1 A;  3N71 A;  2C0M A;  1B89 A;  2GRL A;  3KAE A;  5JJ6 A;  3SD5 A;  4LRZ A;  3AU4 A;  4U04 A;  3UUX A;  4E6H A;  3G2T A;  3OAW A;  3QJZ A;  5BW8 C;  1TEZ A;  1NP7 A;  2VJ8 A;  1UN9 A;  3OTN A;  5AYW D;  3CVP A;  4ANV A;  4J8E A;  1N52 A;  2OOE A;  2A5U A;  3LDZ A;  2CHZ A;  5D0O D;  3P2B A;  2WXG A;  4OVV A;  5ANR A;  4MLP A;  3QNK A;  4I43 A;  3LY9 A;  3CV0 A;  3AS4 A;  4I1M A;  2I6H A;  3OXL A;  3PVL A;  2WXQ A;  3QWV A;  1QQE A;  2YHC A;  4AY6 A;  3CKB A;  3MZL B;  3R7Q A;  2R59 A;  4I1O B;  2X6F A;  2ION A;  2V8S E;  3BEE A;  3PE3 A;  1UW4 B;  5LFA A;  1XGW A;  4IYP A;  3RRM B;  1OWN A;  3RRU A;  4ANU A;  3DPD A;  2BTD A;  3FTV A;  2PZI A;  3E4B A;  3FU0 A;  4I6G A;  3B7S A;  1Y6I A;  2J4D A;  1FVF A;  2VSO E;  3SZ7 A;  2IF4 A;  2XRY A;  3NF1 A;  4PUC A;  2CG3 A;  3CEQ A;  3MYV A;  4I2Z A;  5A23 A;  2FF4 A;  2AVP A;  3CGH A;  4G2V A;  3CQC B;  2YNQ A;  2L0T B;  4DLQ A;  3FUF A;  4G26 A;  5FZS A;  3ASD A;  2XQ0 A;  4FLB A;  3AU5 A;  4PDX A;  5LOZ A;  2CG2 A;  2VTB B;  3Q49 B;  3L22 A;  1ELW A;  4A1S A;  2CFZ A;  4UWK A;  5CCL A;  2OND A;  2OVB A;  4JL0 A;  4N3A A;  3EDT B;  2WXR A;  2WXO A;  3CVQ A;  1HF8 A;  4RSY A;  3CVU A;  2PL2 A;  2V0P A;  3CLJ A;  1PC2 A;  3D9N A;  3LKU A;  3D3M A;  3NZS A;  2FI7 A;  3JYS A;  3G2V A;  3PRZ A;  1DNP A;  4HOU A;  4G1T A;  3LEW A;  3PEV B;  4PS8 A;  3KEZ A;  2L9B A;  4L2L A;  1GW6 A;  2IFU A;  5D0Q D;  3D9K A;  4WNF A;  1OWM A;  3SI5 A;  5AEN A;  4U0Z A;  1SZ9 A;  5AJD A;  1EPU A;  2I2O A;  4GYY A;  3APF A;  1DVP A;  1E8Z A;  1U3D A;  4I17 A;  4ACL A;  4BX9 A;  4EZL A;  3ZYM A;  3IHV A;  4L23 A;  3BG0 B;  4U63 A;  5ARF A;  1MQS A;  2WXI A;  1E96 B;  4PH4 B;  4BWR A;  1FVH A;  4BSX A;  4BTA A;  3CHM A;  3ZIM A;  4D10 C;  2XPI A;  5T4Y A;  3CHR A;  3WXX A;  1KT1 A;  1ELK A;  3TG5 A;  3FUH A;  2NC9 A;  2XGO A;  2FEZ A;  3GZ1 A;  3LVR E;  4RG6 A;  3IKO B;  1N54 A;  2WM9 A;  4U8H A;  3FTY A;  4XIF A;  3PZD A;  2J07 A;  3FUN A;  3BG1 B;  3FUI A;  4DK5 A;  1OWL A;  3QWP A;  4CT4 A;  4E85 A;  4GMJ A;  3TXN A;  4Q69 A;  1SZA A;  4HOQ A;  4KBQ A;  1TJC A;  3CQG B;  3Q5M A;  4UQZ A;  2OV8 A;  3CHS A;  2XGS A;  4AP2 A;  4OYS A;  2DBA A;  3B13 A;  4ATG A;  4CEM A;  2KCK A;  2LSU A;  4U07 A;  1HS6 A;  1QNF A;  3R9A B;  3CR3 A;  2WMN A;  3CVX A;  1KLX A;  4K03 A;  3SBS A;  1E90 A;  3PRE A;  4J8F A;  3RJV A;  1S0P A;  4JPS A;  3RK6 A;  3UQ3 A;  3S7D A;  4J0U A;  4AM9 A;  2ZU6 B;  2VSY A;  3KS2 A;  3AS5 A;  5FQ8 A;  3NQP A;  1JPL A;  4JHK A;  4H7Y A;  5HI7 A;  1L5J A;  1Z6T A;  4EBA A;  4LCT A;  3B7T A;  3I5P A;  2I1J A;  3MKQ A;  4FJZ A;  1TJF A;  4FLH A;  1IHG A;  3MEK A;  4KVM A;  4B94 A;  1QZ2 A;  4APF A;  3IBE A;  4BT8 A;  4GCO A;  3T5V A;  1JWF A;  3D9O A;  1HU3 A;  1IQU A;  2Y4U A;  3S7F A;  3RIB A;  2FBN A;  1E7U A;  1W3B A;  2MHK A;  3PEU B;  4WNE A;  3HDX A;  4AJW A;  4FAD A;  5E76 A;  2VYI A;  3FFL A;  3IHY A;  3LS8 A;  3ZXS A;  5FZQ A;  3QKY A;  3ZVV A;  2GW1 A;  2KCV A;  3D9I A;  3B7U X;  1LF8 A;  3MV3 B;  4GYO A;  1HH8 A;  1P5Q A;  2YHE A;  4KXK B;  1U3C A;  3ZYL A;  1Y8M A;  5BV1 A;  3FH5 A;  4KT6 B;  3FU6 A;  4JA7 A;  1IYG A;  1H2T C;  5FTP A;  2NXP A;  4DJA A;  2X38 A;  3FU5 A;  3MA5 A;  4JA9 A;  2VQ2 A;  4CGW A;  4C0M A;  4F7A A;  3EJN A;  5G55 A;  3MV2 B;  2MRI A;  3HVE B;  4R7L A;  1MHQ A;  3T5X A;  1HG2 A;  4EPZ A;  3FUJ A;  2WVI A;  5T3R A;  2V5F A;  4JHR A;  4XX5 A;  4IRU A;  3ZRH A;  3CVW A;  3D9J A;  3FDH A;  2QFC A;  3AS8 A;  4ILG A;  3RRN B;  2HYZ A;  4CRW A;  3P1U A;  2UY1 B;  4Q94 A;  5LCW J;  4MS6 A;  3HHM A;  2AXZ A;  4Y6W A;  3O48 A;  3D9M A;  3CK8 A;  3MGB A;  3VLD A;  5EDS A;  3ASH A;  2VSN A;  3LY8 A;  4JZY A;  5HQ8 A;  1JUQ A;  2I1K A;  1X5B A;  4HXI A;  2X3M A;  1PY1 A;  3GZS A;  4GYW A;  5JHB A;  3FHE A;  4BTB A;  3RO2 A;  3ZN3 A;  1NA3 A;  4C0E A;  3FTS A;  2XPY A;  1NA0 A;  4U0S A;  1HZ4 A;  1UG3 A;  3IEG A;  3OXF A;  2CHW A;  4GZ3 A;  3TAX A;  3VTY A;  4PS3 A;  3HIZ A;  3VTX A;  2XCC A;  4AVX A;  2X6J A;  4DI4 A;  2WXJ A;  4GCN A;  3Q15 A;  4KYO B;  5FJY A;  3FH8 A;  3MKQ B;  2E2E A;  4MKT A;  3EHM A;  3QAR A;  3G2W A;  5BUZ A;  5ENN A;  3CHQ A;  3TL5 A;  4JEU A;  4AXH A;  5BNW A;  4J8S A;  2WQH A;  3U4T A;  2KAT A;  5CCM A;  3UPV A;  4N2Q A;  4F3V A;  4EZK A;  2PQR A;  3MCX A;  4B8A A;  4HOS A;  1E8W A;  1E7V A;  3UT4 A;  1H2V C;  2PM7 A;  4GA2 A;  3PH0 C;  5A7D B;  5BV0 A;  2WXM A;  3CVL A;  2WPV A;  5KJK A;  3CHO A;  4LER A;  2Q7F A;  3U3W A;  4O6F A;  1BPO A;  4AIF A;  2YQ8 A;  3ASG A;  5CMW A;  3U9W A;  4UQX A;  3TXM A;  4N3C A;  4BT9 A;  3URZ A;  4XKC A;  1EYH A;  3SNX A;  1JWG A;  4UWG A;  4B0Z A;  2WMO A;  3L17 A;  4N3B A;  2RG8 A;  3HVE A;  4L2Y A;  2WXP A;  4U0U A;  2RD0 A;  5ARG A;  3ASF A;  3JCK C;  4CT0 A;  2PQN A;  4C9B B;  2BF0 X;  3ZGQ A;  4ABN A;  3CKC A;  4AOF A;  2X6H A;  5JJT A;  1EF1 C;  3TGO A;  5C1D A;  3QOU A;  2UY1 A;  1UN8 A;  3FEX A;  3FU3 A;  4L1B A;  3FP3 A;  3CK7 A;  3PDN A;  5DBK A;  3UMV A;  3EIJ A;  2QY7 A;  3GZ2 A;  2VGX B;  3HYM B;  3RO3 A;  2JEK A;  3FTX A;  2KC7 A;  4CDN A;  3LYA A;  4EBA G;  3APC A;  4B89 A;  2YIN A;  4GB9 A;  2VSX E;  1ZU2 A;  3C98 A;  4H7X A;  3DBS A;  4LEU A;  4FHK A;  2IQC A;  5G2N A;  3SFZ A;  4GPK A;  2J49 A;  2HM8 A;  1E8X A;  3I4G A;  2KM4 A;  4FC8 A;  5G05 J;  2AXV A;  4I2W A;  4EEC A;  4NQ0 A;  3PNL B;  3R7R A;  4NUR A;  2EQX A;  1HFA A;  1PAQ A;  3CVV A;  4N2S A;  2XRZ A;  3L6A A;  3CHP A;  3MKR A;  4GAA A;  1OUV A;  2IU1 A;  4P29 A;  4XI9 A;  2LO6 A;  3FWV A;  3UX4 A;  3ZEF A;  5EX3 A;  5FWQ A;  5ANL A;  1WAO 1;  2Y4T A;  4I6J A;  4N39 A;  4I9C A;  2UWJ G;  1HG5 A;  3CVY A;  2WXN A;  4JXT A;  4HS2 A;  4KZ0 A;  4EZJ A;  3MJW A;  4I9E A;  5G04 J;  2PM6 A;  5FT9 A;  4EQF A;  3EIQ C;  3MX3 A;  3GYZ A;  3I4R B;  3QDN A;  5JHA A;  4KMO A;  4OVU A;  5EKQ D;  2C0L A;  2FO7 A;  3Q47 B;  3L16 A;  5M72 A;  5G04 C;  1A17 A;  2MOW A;  3FUD A;  2J4B A;  2XHE A;  3IV0 A;  3ULQ A;  4A55 A;  5J08 A;  1E8Y A;  2WB2 A;  4J6I A;  3FTZ A;  3ZPJ A;  3I3N A;  4GZD A;  3ESL A;  4WUY A;  1Z3X A;  2OVF A;  4LUN U;  5C2Y A;  2BUG A;  4I1A A;  4FU3 A;  4URK A;  1UJJ A;  4NRH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...