2WQHA

Crystal structure of ctpr3y3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
104
structure length
104
Chain Sequence
PGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords CTPR3Y3
publication title Self-association of TPR domains: Lessons learned from a designed, consensus-based TPR oligomer.
pubmed doi rcsb
total genus 46
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wqhA00
4I1AA 3TG5A 3Q49B 3QDNA 4GA0A 3S7BA 4UQZA 3ZPJA 4HOQA 1HZ4A 2NC9A 2WQHA 4GYYA 3ZHEA 5KJMA 3OXFA 3NF1A 3EDTB 4J8DA 5FZQA 4N2QA 1QZ2A 2Y4UA 3AS8A 2PQNA 3UPVA 4HOSA 4JA7A 4NQ0A 3FWVA 4AY6A 4WUYA 4CGVA 3TG4A 3IEGA 5ARGA 3RO2A 1OUVA 1KT1A 4HORA 5DBKA 4H7XA 2XGOA 4O6FA 2V5FA 2P58C 3CVNA 2UY1A 2FF4A 4U0SA 3CEQA 4AM9A 4J0UA 5G05J 1P5QA 1XNFA 4J8EA 5JJTA 3LPZA 3QWVA 2E2EA 4ABNA 3OXGA 2C0MA 4YVQC 5M72A 3PDNA 4WNFA 2QFCA 4F3VA 5FZSA 4Y6CA 3RJVA 4I2ZA 3ASHA 2XCCA 2YQ8A 2I6HA 4APOA 1NZNA 3GYZA 3SF4A 3URZA 4GPKA 1PC2A 4UI9C 3LY7A 4I17A 2Q7FA 5FT9A 4WNGA 4U07A 4G23A 3E4BA 2VGXB 3GZ2A 2VQ2A 4WNDA 5LCWJ 2VGYA 4JA9A 2AVPA 5DIZA 3PE3A 5FZRA 4XI9A 4BWRA 5D0OD 5FTPA 3ULQA 2JLBA 5KJKA 3GZ1A 3CK7A 3ASGA 3Q4AB 1NA0A 2WPVA 1KLXA 2XPIA 3KD7A 5HI7A 2PZIA 3VTYA 4N39A 2XCBA 1W3BA 3U4TA 3CVQA 4JL0A 3RKVA 3CVPA 3QWWA 5CCLA 3S7JA 2XEVA 2MHKA 1B89A 3RIBA 3LY9A 4YVOA 3O48A 4N5CA 4A1SA 4U0ZA 4G1TA 5BT1A 4I2WA 3BEEA 2KCVA 4BTBA 5KJLA 4I9CA 5CHEE 4IN3B 2KCKA 3S7DA 5A7DB 3Q47B 1ELWA 2FI7A 3QKYA 2R5SA 1HXIA 4RG9A 3KS2A 2IF4A 3KAEA 2GW1A 4CDRA 3MV2B 4W9RA 3U3WA 2HR2A 4GA1A 1ZU2A 2ONDA 3RU0A 2C2LA 3ZN3A 2FBNA 4GYWA 3ZGQA 3WXXA 4N2SA 3VTXA 1E96B 5AYWD 2Y4TA 3HYMB 1FCHA 4WNEA 3GW4A 3RO3A 4N3CA 2KC7A 4YNDA 5EX0A 4KXKB 4KYOB 2YHCA 4U0UA 4GZ5A 4J8FA 4NRHB 5BW8C 4GZ6A 3ESKA 2IFUA 5C1DA 4H7YA 5FJYA 5ARFA 2PL2A 3MEKA 5G05C 3LYAA 2LSVA 3LCAA 4G2VA 4AIFA 3ZFWA 1A17A 4CGWA 4LEUA 5BNWA 4GCOA 2KCLA 4AY5A 3LY8A 3K9IA 2J9QA 3UUXA 2VGXA 1TJCA 4BT8A 3JYSA 2XGMA 2PQRA 2C0LA 1IHGA 4UQXA 3FFLA 5G04J 4KBQA 4UI9K 3N71A 4I9EA 1QQEA 1HH8A 1NA3A 4N3BA 3SZ7A 2UY1B 4EQFA 2VYIA 3TAXA 5CCMA 4UI9J 3FP3A 4XIFA 4RG6A 5JJ7A 4BT9A 2VSYA 3MKRA 3CV0A 3ASFA 2XGSA 3S7FA 1ZBPA 5HQ8A 4G25A 5LCWC 5D0QD 2FEZA 1KT0A 3MA5A 4GZ3A 2FO7A 2HO1A 4N3AA 4GCNA 3PE4A 1IYGA 3MV3B 2L6JA 1WAO1 2HYZA 5A6CA 3AS4A 4UQYA 3Q5MA 2OOEA 2UWJG 5EX3A 1WM5A 3UQ3A 3CKCA 1YA0A 4BTAA 3QWPA 3LKUA 3CVLA 2DBAA 1ELRA 4GYOA 3QOUA 4XI0A 1Y8MA 4JHRA 4HOUA 5G04C 4G26A 4GA2A 4B94A 3ASDA 5JJ6A 3CK9A 3OXLA 5EKQD 4HOTA 3ZHEB 2LNIA 3CKBA 4U04A 4G24A 5KJNA 3CK8A 2VSNA 3R9AB 2LSUA 3Q15A 2KATA 3TGOA 4Y6WA 4ME2A 2BUGA 3AS5A
chains in the Genus database with same CATH superfamily
2B6CA 4BEPA 4A1GA 1Q2ZA 1XGWA 2V0PA 3D9JA 3W9FA 3ZYQA 5KJMA 3OXFA 4GTVA 4GTPA 4AEZC 5FINA 3BG1B 2Y4UA 3AS8A 1HG5A 3UPVA 1NL4A 3FWVA 5AQ9A 5ENNA 3DRAA 4AY6A 2J8SD 1SZAA 4MLPA 2IONA 4HS2A 3HDXA 5ARGA 2P9PG 2DVWA 1H6PA 2IOSA 1N95A 2RFMA 5DBKA 3CVWA 4BX9A 4CCAA 2J49A 2XGOA 2V5FA 2P58C 3ZU7B 1Y6IA 2MYOA 4U0SA 4ILHB 3FEXA 4J0UA 1ELKA 4L2YA 3MGBA 2F0YA 3JXJA 3QWVA 4ABNA 3HVEB 1EDUA 3UM2A 3RRNB 1HG2A 2WXLA 3SHFA 4AP2A 5M72A 3PDNA 3CVYA 4WNFA 2RFAA 1H2VC 1OCRE 2L9BA 3PEVB 4I2ZA 2IEJA 3D9HA 4ILIA 2KM4A 3SF4A 3URZA 3DSXA 4YDYA 2KBXA 3C3OA 3W9GA 3LY7A 2WVIA 2EILE 5C2YA 4HI9A 3ZXPA 3Q9UC 3P1UA 2BTDA 1N4PA 4G23A 4O1OA 1N94A 3CQGB 1TN6A 2VQ2A 4P29A 4WNDA 5LCWJ 4HBDA 2IJGX 1JPLA 2AVPA 3TXNA 3DPDA 3CHPA 4UUCA 3QAQA 4XI9A 1UJJA 5FTPA 3ULQA 2JLBA 3GZ1A 2J09A 2Y69E 3ASGA 4FJZA 1NA0A 2CHWA 3T8MA 4U8HA 3B95A 3T9KA 2XPIA 4LNGA 4I43A 1W3BA 3S2AA 4LSZE 3CVQA 3G2UA 4GU5A 5CRUA 3J5PA 1SA5A 4DPRA 2WXGA 3FTWA 3I3NA 2BKKB 4CDNA 4MS6A 4I1MA 1S0PA 4J7WA 4DX1A 4U0ZA 4GTMA 5EILA 5AQAA 4GMJA 3FTZA 4BTBA 5CHEE 2KCKA 4RSYA 3Q47B 5ENTD 3QKYA 2R5SA 2H6GA 2WXFA 3MYVA 4B0ZA 3JCKC 2GRRB 3PNTB 4W9RA 3U3WA 1ZU2A 5EIBE 5ENSD 3PZ2A 4HFGA 2FBNA 3PH0C 2A5UA 3PUKA 5AJLA 4I6GA 4N2SA 4A3TA 4TUUA 3AU5A 5BV0A 1SQMA 3EIQC 3GW4A 1QNFA 4CZ2D 2R59A 4KXKB 1ZB1A 2CFZA 3TWQA 2QZAA 1MJ0A 4J8FA 4EZLA 5BW8C 4GZ6A 3ESKA 5FQ6A 1K3ZD 5HS0A 2CFUA 3PZ1A 4H7YA 5ARFA 4DI4A 3MEKA 3V2XA 3VLDA 3LCAA 1E8XA 5KCMA 1LF8A 4AIFA 3CHRA 2BKGA 4B93B 1YMPA 4NURA 5CECB 3G2SA 4LEUA 3FUNA 2KCLA 5FWQA 2R2LA 3LY8A 5KBAA 4UWKA 2J9QA 2VGXA 2F8YA 1TJCA 4BT8A 3UM0A 4A55A 1NFIE 3TWWA 3F6QA 4UQXA 1JCQA 3CHOA 3FFLA 4CDMA 3FUEA 5D2MC 2FO1E 4I9EA 1HH8A 4ANUA 3UMVA 2UY1B 2ZXWE 2NXPA 3TAXA 1H0AA 3DXMG 4UI9J 2R05A 4RG6A 4GMLA 3KEAA 3FTVA 2VSYA 2XPZA 3FULA 2XGSA 1HO8A 1MHQA 3MKQA 4MKTA 4QFVA 2FEZA 1KT0A 3I4RB 3MA5A 2XS1A 3CGHA 2XQ0A 4LNBA 4CEMA 1TNUA 5FQ4A 5AENA 3UIOC 5CMWA 3DXKG 2XS8A 5EIDA 3PS6A 2KXPC 1N4QA 4X8QA 3LKUA 2DBAA 5G2NA 3FU5A 3UM3A 2GRPB 3I4GA 2WXIA 3EU5A 3AG1E 3PVLA 5EYLA 1TNOA 3Q75A 2J08A 4B94A 3ASDA 3CK9A 3PEUB 3OXLA 1JWGA 1BI8B 2KZTA 5ENQD 3CK8A 3R9AB 4DRXE 2H6IA 3QC1A 3V31A 2KATA 4N5QA 4ME2A 2R17C 3AS5A 4K0RA 5T8IA 3Q73A 4I1AA 3QDNA 4L9PA 4GA0A 4Q96A 3S7BA 3ZPJA 1JUQA 2NC9A 2GRLA 2EIME 2XEEA 4DLOA 2ZGDA 2DWZA 4BSXA 2QY7A 4J8DA 3PZ4A 4N2QA 5AJDA 3D9NA 1EPUA 2P9SG 1QZ2A 4O60A 2CG3A 2PM7A 4NQ0A 2GRQB 4KT6B 3CIAA 4L2LA 1BLXB 1OWOA 1U3DA 3C3QA 1N11A 1Z6TA 3U64A 2IU1A 3L6AA 3RO2A 3MCXA 3FUKA 1KT1A 3L17A 1E8WA 4GTTA 4LNUD 2NSZA 4FLBA 3UKUG 2RG8A 4JVSA 4U95D 2H6HA 1O1SA 5ENOD 3UINC 3NBNB 1JCRA 2FF4A 5EYPF 3G2TA 3CEQA 1HX8A 3LDZA 3LJ3A 2L6BA 4U7EB 3LPZA 4CRWA 1S64A 1RW2A 3T8KA 3L08A 4FADA 3TWXA 3UM1A 1IKND 5ENPD 2AW6A 4YDOA 3QNKA 3D3MA 1HU3A 2IOLA 4UWHA 2QFCA 2IQCA 3V2OA 1MZCA 3RSEG 3MJWA 4HI8A 4PS3A 2V5QC 4OVUA 2XCCA 2YQ8A 1H6OA 2I6HA 3HXCA 3PZ3A 2M63A 4GPKA 2ZU6B 2LAHA 2P9NG 4WNGA 2WQ7A 3MZLB 4C48B 5BUZA 5BV1A 5ANRA 1O5MA 2R03A 3TWRA 2VGYA 3B7RL 2AWIA 4G8LA 3BUAA 2EINE 5D0OD 4FHJA 5KJKA 3CK7A 5CBNA 2DYSE 1S63A 3UXGA 3E37A 4UWFA 1KLXA 3SO8A 1X81A 1K1AA 4F1SA 3KD7A 5HI7A 1O1TA 4ANWA 3B7SA 3RKVA 5CCLA 3S7JA 2MHKA 3RIBA 3LY9A 3HIZA 4Z68A 4L7TA 3LS8A 3O48A 3ABME 3DWLG 4A1SA 2OEWA 3VLFA 4B8CB 1OCOE 5ANLA 1IXVA 4TXRA 4FC8A 4I9CA 3ZRHA 4AXHA 1AWCB 1HXIA 2P9LG 3SFXA 3ONKA 1DCQA 4JPSA 2GW1A 4GTQA 3FDHA 3SGHA 2DZNA 4NACA 3MX3A 4GA1A 3TWUA 3RU0A 1K8KG 3DPYA 3CLJA 3D9KA 4GYWA 2LAIA 3R9MA 1E8ZA 3AG4E 4HRLA 4I6JA 1E96B 5AQ7A 2Y4TA 3C72A 3HVEA 2GRNB 3RO3A 3G2WA 2KC7A 4YNDA 4LRZA 1H2UA 3RAUA 1HFAA 3B13A 4F6RD 5EN5D 3FH7A 3CHMA 4XE0A 5C1DA 5FJYA 3PRZA 3D9OA 1OWPA 2LSVA 4G2VA 4TRQA 4PS7A 2XENA 1O1RA 4CGWA 5BNWA 4GCOA 4AY5A 3NZSA 1SA4A 1OWLA 4DUIA 1HF8A 4DX6D 1FPPA 4JB8P 3IHYA 2P9UG 3JYSA 1LD8A 2PQRA 5JA4D 3Q79A 2WXQA 2WMNA 5G04J 3TWVA 4MBGA 1E7UA 3O4ZA 4BFRA 1OCCE 2WXOA 4I6EA 2CG2A 1FVHA 5CCMA 5D66A 5JMND 2DCPA 3JQ1A 4EZJA 4BT9A 2YNQA 3CQCB 3FTYA 3ASFA 4JEHA 2ZISA 2BEDA 4ATGA 3APFA 5ENRD 2CHZA 2F8XK 5HQ8A 4G25A 2X6FA 5LCWC 5D0QD 1TR4A 3CSFA 3UX4A 3PE4A 1IYGA 4XKCA 4GTRA 1KPSB 3LJNA 3E33A 3AS4A 2EIJE 4GZDA 5KNHD 2VTBB 2UWJG 5G55A 3BG0B 3UQ3A 3D9MA 1YA0A 2HE0A 4E85A 1X5BA 3QWPA 3FU0A 1SW6A 3CVLA 1BD8A 4GYOA 2A5EA 1N0QA 4V3IA 1N52A 3OAWA 1JWFA 4CT0A 5AAOA 2PNNA 4HVBA 1Y8MA 5G04C 1KZOA 4HOUA 5BXUA 5KNGA 4TXQA 3ZW3A 3DSUA 3CSTA 5EKQD 3SBSA 3FH5A 1DVPA 2VGEA 2LNIA 4EHMA 5ITZF 4U04A 2WXJA 4CT4A 2WMOA 2J4DA 2LSUA 3APCA 3TGOA 3AJIA 5FQ8A 2RD0A 4PDXA 2BUGA 3E32A 3DSVA 3CVXA 4U96D 3TG5A 1UW4B 4HLEA 5B1BE 1IHBA 3TJPA 1IQUA 4LERA 4UQZA 2B0OE 2Y3AA 4IRUA 2ZGGA 2XHEA 3C5RA 3NF1A 2BF0X 4K5AB 4KZCA 1TNBA 4OVVA 1FVFA 4FJYA 3X2QE 1BI7B 4HOSA 3TWTA 2XZDG 1H19A 3JUEA 4WUYA 4CGVA 1UG3A 3TL5A 3L9TA 1OWNA 3SFZA 4FP7A 3FUIA 1OUVA 1EYHA 4HORA 3U9WA 2I2OA 3CVVA 4O6FA 4AJWA 3BQOA 3RRUA 2UY1A 3BU8A 4F1PA 3FTSA 2ETBA 1P5QA 5G05J 1Z5SC 4J8EA 5JJTA 4DI3A 5A23A 3ZIMA 2ETCA 3OXGA 3ABKE 5CEDB 3SY2A 2JABA 3KSLA 3T5XA 5CERB 5FZSA 1WY6A 2OVFA 3SBTB 1K1BA 3CHQA 4G8KA 3FY4A 4GTOA 1NZNA 3GYZA 5LP0A 4TUMA 4UI9C 2Q7FA 2V8SE 4JEUA 4XZ4A 4JXTA 4OYSA 1PY1A 2DYRE 4UWGA 2XEHA 3HG0D 4XKBA 2AJAA 4K03A 3FHEA 4OAUC 2YHEA 3EU9A 1E7VA 5KWDA 1Z3XA 5T3RA 4J6IA 4Q94A 5AQBA 5DIZA 3PE3A 3UKRG 4U63A 4GAAA 4EBAA 4BWRA 2E0IA 4U8VD 1TJFA 3DEPA 3SFYA 3E30A 2WPVA 2A4ZA 3SQVA 2CHXA 4GB9A 4A3VA 5B3SE 2PZIA 3CVUA 2WXPA 4D10C 2XCBA 3U4TA 2X6JA 4JL0A 4RQIA 4R7LA 3CVPA 4JZYA 4DX7D 2WXRA 4WAFA 1D8DA 1B89A 1D8EA 2V4LA 4N5CA 3ZYMA 4LG6A 3DSWA 4YDWA 3NOCD 4G1TA 4Q69A 4I2WA 3BEEA 2KCVA 4GPMA 1MYOA 4ACKA 5KJLA 4IN3B 3S7DA 3L16A 4ILGA 3D9LA 5A7DB 2FI7A 3FUHA 4RG9A 2IF4A 3KAEA 4E6HA 2XRYA 2VJ8A 4JW1A 4CDRA 2P9KG 2WXKA 1GW6A 3ML8A 3QB2A 2C2LA 2WXHA 1OWMA 3TWSA 4A63B 1OT8A 3ZUVB 3WXXA 2PM6A 3UI2A 5LFAA 2IO2C 3I5PA 3VTXA 3OTNA 1EF1C 3KSQA 2Y0BG 5AYWD 1N4SA 3HYMB 4DJAA 2OV8A 5CMYA 1N9AA 3JQ0A 3SD5A 1OXJA 2QYJA 4WWNA 4KYOB 1MX2A 4U0UA 3UIPC 5AN8A 4GZ5A 4EZKA 2GROB 3FTXA 4EBAG 5IY5E 3UTMA 4NRHB 3Q9NC 2IFUA 1UJKA 1V55E 3LVQE 2V4HC 2OVBA 3LYAA 3P2BA 1UN9A 3DBSA 3ZFWA 3DSTA 2LXLA 4APFA 2XPYA 1NI1A 1Z3YA 1A17A 4AOFA 2WQ6A 3ULEG 3K9IA 3UUXA 2IO3C 3QJZA 1H6KA 3RRMB 1TN7A 3HXFA 2FULA 1AP7A 4K5CA 2XGMA 2WB2A 1V54E 3G2VA 2C0LA 1IHGA 1FT1A 3ESLA 4BX8A 3V79K 5AARA 1SVXA 4UI9K 3NB2A 1QQEA 1NA3A 4FU3A 3QARA 3T5VA 1IQRA 4EECA 3EHMA 1WDYA 1N0RA 4YDEA 2VYIA 4DLQA 3LXUX 3FP3A 4XIFA 3JXIA 3MKRA 5H7PA 2VSXE 2X38A 3CV0A 2GGFA 4URKA 3S7FA 1G3NB 1ZBPA 3L22A 3HRAA 3ASNE 4FHKA 4GZ3A 2FO7A 4BSZB 4N3AA 4JD2G 2JEKA 4IULA 2HM8A 3EHQA 3ONLA 3SNXA 1WAO1 3AU4A 3IV0A 3EHNA 4PUCA 5EX3A 5AIJA 1E90A 4G11A 2H6FA 3ZYLA 2Y1LE 3CKCA 2J4BA 1PAQA 3PZDA 3QOUA 2AXUA 5B1AE 3HXBA 2VSOE 4JHRA 3FTUA 4HRMB 4G26A 4GA2A 3ULYA 3ZKJA 4HLLA 1DCEA 3R7QA 4HOTA 3ZHEB 4LCTA 1S70B 1VDYA 1RZ4A 4G24A 3C3RA 5KJNA 4KZ0A 5EDSA 5J90A 2IY0C 3Q15A 4KVMA 1U3CA 4Y6WA 5JHBA 3HXEA 4DX5D 4HQDA 3J5QB 3Q49B 4B8AA 5FIOA 3Q78A 1D9SA 1BU9A 4HOQA 1HZ4A 2WQHA 4GYYA 4AV7A 3ZHEA 4FA6A 3IKOB 5CBOA 2DIWA 3EDTB 3PNLB 3UT7A 4KMOA 5FQ7A 5FZQA 4EPZA 4XEIG 1A5EA 2PQNA 4JA7A 3FU6A 4BESA 3FU3A 3L54A 3WG7E 1TN8A 2MRIA 3TG4A 2L0IA 3IEGA 1NP7A 3ZVVA 1MX4A 1WG0A 3C98A 1QYMA 4H7XA 2DZOA 4KVOA 2R02A 2EIKE 3PREA 2XRZA 4XX5A 5BPPA 5CEAA 3AG3E 3CVNA 3ABLE 4AM9A 4J8YA 3B7UX 4FLHA 1XNFA 1QBQA 3APDA 2EQXA 2E2EA 1U2VG 1YYHA 4QQIA 2C0MA 4HNAD 4YVQC 3UT8A 2ETAA 3NZUA 1TYQG 4F3VA 4DK5A 1TNYA 4ANVA 4Y6CA 3RJVA 3ASHA 4APOA 2VTBA 3HXDA 3SI5A 1PC2A 4AVXA 2LO6A 4I17A 3ZEFA 5FT9A 4U07A 4I1OB 2WXNA 2X6KA 3LEWA 3E4BA 2LUHA 2VGXB 3GZ2A 2J07A 5HKPA 3ENEA 4C9BB 4JA9A 5JHAA 2RKKA 4U8YD 2P2CP 5FZRA 3AG2E 3QK0A 2X6HA 4OAVB 2I1KA 3AAAC 3Q4AB 4HXIA 5J08A 1N4RA 3KEZA 3IXEA 3LVRE 4WWPA 3ZNGA 5LOZA 3VLEA 4NIKA 3VTYA 4N39A 4ATZD 4MRUA 2LXMA 3MKQB 3QWWA 3FUMA 2XEVA 3RK6A 4ACLA 4YVOA 2QYUA 3GZSA 2OCCE 1HE8A 3R7RA 1INZA 3FH8A 3IHVA 5BT1A 2I9CA 4L23A 3ZXSA 3DSSA 4CYMD 3B7BA 1ELWA 2QC9A 2L0TB 3KS2A 3DEOA 4UWLA 3ASOE 3MV2B 4BY6A 2HR2A 3V30A 2ONDA 3EHRA 3ZN3A 3EJNA 2KZTB 3ZGQA 3D9PA 5E76A 3CHSA 4PH4B 3FUJA 4RLYA 2AXZA 4FULA 1FT2A 4JHKA 2P9IG 1DNPA 2GRMA 4HB5A 1HS6A 1FCHA 2OEVA 4WNEA 4N3CA 3PUJA 3U66A 4ZHBA 3CR3A 5EX0A 1TEZA 2AXVA 2YHCA 3ZYKA 2ZIRA 4HRNA 3L82A 1MQSA 2PL2A 5G05C 4F7AA 1L5JA 1UOHA 3L13A 2MOWA 5HRYA 4K5BA 3UT4A 5T4YA 3E34A 1LTXA 1BPOA 3JUIA 1H2TC 4F53A 4L1BA 4DX2A 4TV3A 2NYJA 4GZCA 4B89A 3FUDA 5BXOA 4LUNU 2ILRA 4KBQA 4O1PA 1N54A 3N71A 5CRVA 4JHJA 4N3BA 3SZ7A 4RVBA 3FEYA 4BETA 4EQFA 2X6IA 4ANXA 4WWOA 4PS8A 1YCSB 5JJ7A 4TXPA 1TNZA 3ML9A 3Q7FA 2WXMA 2WM9A 2X3MA 2HO1A 3IBEA 3FUFA 1KZPA 4GCNA 4GMRA 3MV3B 1JCSA 3HHMA 2L6JA 2YINA 1OCZE 4C0EA 2HYZA 5A6CA 2I1JA 4UQYA 3Q5MA 2OOEA 1E8YA 4C0MA 4IYPA 1WM5A 3Q7AA 1LD7A 3B7TA 4BTAA 1OY3D 4ZFHA 1DC2A 1ELRA 3NQPA 4JC8A 4M7CA 4BERA 3NOGD 4XI0A 3NAWA 1MX6A 5E75A 3EIJA 5JJ6A 1SZ9A 3D9IA 4M3OA 1UN8A 3CKBA 3ISMC 3TXMA 3EUVA 2VSNA 2XZTG 4J8SA 5LX8A 2F37A 4GTSA
chains in the Genus database with same CATH topology
5T8IA 3CVXA 4I1AA 3TG5A 1UW4B 4HLEA 3Q49B 3QDNA 4B8AA 4GA0A 4A1GA 4Q96A 1XGWA 1IQUA 2V0PA 4LERA 3S7BA 3TJPA 4UQZA 3ZPJA 2Y3AA 1JUQA 4IRUA 4HOQA 1HZ4A 2GRLA 2NC9A 2WQHA 4GYYA 4DLOA 3D9JA 2XHEA 4AV7A 3ZYQA 3ZHEA 4FA6A 3IKOB 5KJMA 3OXFA 3NF1A 4BSXA 4AEZC 2BF0X 2QY7A 2DIWA 3EDTB 3PNLB 3UT7A 4KMOA 4J8DA 4KZCA 5FQ7A 5FZQA 4N2QA 4OVVA 1FVFA 4EPZA 5AJDA 3D9NA 1EPUA 3BG1B 1QZ2A 2Y4UA 4FJYA 3AS8A 2CG3A 2PQNA 1HG5A 3UPVA 4HOSA 2PM7A 4JA7A 4NQ0A 3FU6A 3FWVA 4KT6B 5ENNA 1H19A 3FU3A 4AY6A 3CIAA 3L54A 4L2LA 1SZAA 1OWOA 1U3DA 4MLPA 2IONA 4WUYA 1Z6TA 4HS2A 4CGVA 1UG3A 3TL5A 3U64A 2MRIA 3TG4A 3HDXA 2IU1A 2L0IA 3L6AA 3IEGA 5ARGA 3RO2A 3MCXA 1OWNA 1NP7A 3SFZA 3ZVVA 3FUKA 3FUIA 1OUVA 1KT1A 4FP7A 1EYHA 4HORA 3L17A 2IOSA 3C98A 1E8WA 3U9WA 5DBKA 4H7XA 3CVWA 2NSZA 4FLBA 2RG8A 4JVSA 4KVOA 2I2OA 4BX9A 3PREA 2XRZA 4CCAA 4XX5A 2J49A 2XGOA 5BPPA 3CVVA 4O6FA 4AJWA 2V5FA 2P58C 3CVNA 2UY1A 3RRUA 2FF4A 3G2TA 1Y6IA 4U0SA 4ILHB 3CEQA 4AM9A 3FEXA 3FTSA 4J0UA 5G05J 1P5QA 1HX8A 3LDZA 1ELKA 3B7UX 3LJ3A 4FLHA 4L2YA 1XNFA 3MGBA 4J8EA 5JJTA 3APDA 2EQXA 3LPZA 4CRWA 3QWVA 2E2EA 3L08A 4DI3A 5A23A 4ABNA 4FADA 3ZIMA 3HVEB 1EDUA 3RRNB 3OXGA 2C0MA 1HG2A 2WXLA 3SHFA 4YVQC 2AW6A 3UT8A 4AP2A 5M72A 3QNKA 3PDNA 3D3MA 3CVYA 3NZUA 4WNFA 1HU3A 2IOLA 4UWHA 1H2VC 2QFCA 4F3VA 2IQCA 3T5XA 4DK5A 2L9BA 5FZSA 1WY6A 2OVFA 3PEVB 3SBTB 3MJWA 4PS3A 4ANVA 3CHQA 4Y6CA 3RJVA 4I2ZA 3ASHA 4OVUA 2XCCA 2YQ8A 2I6HA 3FY4A 4APOA 4ILIA 2VTBA 1NZNA 2KM4A 2M63A 3SI5A 3GYZA 3SF4A 3URZA 4GPKA 1PC2A 4AVXA 2LO6A 5LP0A 4UI9C 2ZU6B 3LY7A 2WVIA 4I17A 2LAHA 2Q7FA 3ZEFA 5FT9A 2V8SE 4JEUA 4XZ4A 4WNGA 4JXTA 2WQ7A 5C2YA 4OYSA 4U07A 1PY1A 4I1OB 2WXNA 3MZLB 3P1UA 2X6KA 3LEWA 2BTDA 4UWGA 5BUZA 4G23A 3E4BA 4XKBA 2VGXB 3GZ2A 2J07A 3FHEA 4K03A 2YHEA 5BV1A 3CQGB 1E7VA 2VQ2A 4P29A 4WNDA 3ENEA 5ANRA 5LCWJ 1Z3XA 5T3RA 2VGYA 4C9BB 2IJGX 3B7RL 4JA9A 1JPLA 2AVPA 4J6IA 4Q94A 3TXNA 3DPDA 5JHAA 5DIZA 3PE3A 2AWIA 3CHPA 5FZRA 3QK0A 3QAQA 4U63A 4GAAA 2X6HA 4XI9A 4EBAA 4BWRA 5D0OD 1UJJA 2E0IA 5FTPA 2I1KA 3ULQA 2JLBA 1TJFA 4FHJA 5KJKA 3GZ1A 2J09A 3CK7A 3ASGA 3Q4AB 4FJZA 4HXIA 1NA0A 2CHWA 3T8MA 2WPVA 4U8HA 5J08A 2A4ZA 3KEZA 4UWFA 1KLXA 2CHXA 4F1SA 3LVRE 4WWPA 5LOZA 4GB9A 2XPIA 4A3VA 3KD7A 5HI7A 3VLEA 2PZIA 3VTYA 4N39A 3CVUA 2WXPA 4I43A 4D10C 2XCBA 1W3BA 3S2AA 3U4TA 2X6JA 4ANWA 4MRUA 3B7SA 3CVQA 3G2UA 4JL0A 4R7LA 3MKQB 3CVPA 4GU5A 3RKVA 3QWWA 3FUMA 5CCLA 4JZYA 2WXRA 3S7JA 2XEVA 4WAFA 2MHKA 3RK6A 4DPRA 1B89A 3RIBA 3LY9A 3HIZA 4ACLA 4YVOA 2V4LA 2WXGA 3FTWA 3I3NA 4L7TA 3LS8A 3O48A 4CDNA 3GZSA 4N5CA 3ZYMA 1HE8A 4MS6A 4I1MA 1S0PA 3R7RA 4A1SA 1INZA 3FH8A 3VLFA 4B8CB 4U0ZA 3IHVA 4G1TA 5ANLA 4Q69A 2I9CA 5BT1A 4I2WA 3BEEA 2KCVA 4GMJA 3FTZA 4BTBA 4FC8A 4ACKA 5KJLA 4I9CA 4L23A 5CHEE 4IN3B 2KCKA 3S7DA 3ZRHA 3L16A 4RSYA 4ILGA 3ZXSA 4AXHA 3D9LA 5A7DB 3Q47B 1ELWA 2FI7A 3FUHA 3QKYA 2R5SA 1HXIA 2L0TB 4RG9A 3ONKA 3KS2A 2WXFA 2IF4A 4JPSA 3KAEA 3MYVA 2GW1A 4E6HA 4UWLA 3FDHA 2XRYA 2VJ8A 4JW1A 3SGHA 4CDRA 2WXKA 1GW6A 4B0ZA 3JCKC 3MV2B 4NACA 3ML8A 4BY6A 2BUGA 3PNTB 3MX3A 4W9RA 3U3WA 2HR2A 4GA1A 1ZU2A 2ONDA 3RU0A 2C2LA 3QB2A 3ZN3A 2WXHA 3EJNA 3CLJA 1OWMA 3D9KA 4HFGA 2KZTB 2FBNA 4GYWA 3PH0C 2LAIA 3ZGQA 1E8ZA 2A5UA 3D9PA 3CHSA 3PUKA 2PM6A 4PH4B 5E76A 3WXXA 3FUJA 5AJLA 4I6GA 4I6JA 5LFAA 4N2SA 2AXZA 3I5PA 4FULA 3VTXA 4A3TA 3OTNA 4JHKA 1E96B 1EF1C 4TUUA 1DNPA 2GRMA 2Y4TA 3AU5A 3HYMB 5AYWD 4DJAA 1HS6A 2OV8A 5BV0A 1FCHA 1SQMA 3HVEA 4WNEA 5CMYA 3EIQC 3GW4A 3JQ0A 3RO3A 4N3CA 3SD5A 3G2WA 1QNFA 3PUJA 3U66A 2KC7A 4YNDA 3CR3A 5EX0A 4WWNA 2R59A 4KXKB 1TEZA 2AXVA 4LRZA 2CFZA 4KYOB 2YHCA 4U0UA 1H2UA 4EZKA 4GZ5A 4J8FA 1HFAA 3FTXA 4EBAG 3B13A 3ZYKA 4NRHB 4EZLA 5BW8C 4GZ6A 3FH7A 3ESKA 2IFUA 5FQ6A 3CHMA 4XE0A 1UJKA 2CFUA 5C1DA 4H7YA 1MQSA 5FJYA 5ARFA 3LVQE 4DI4A 3PRZA 2PL2A 3MEKA 5G05C 2OVBA 3VLDA 4F7AA 3D9OA 1OWPA 3LYAA 1L5JA 2LSVA 3L13A 3LCAA 1E8XA 3P2BA 4G2VA 5KCMA 1UN9A 1LF8A 2MOWA 3DBSA 4AIFA 3CHRA 4TRQA 3ZFWA 4APFA 4PS7A 2XPYA 3UT4A 1Z3YA 5T4YA 1A17A 4CGWA 4NURA 3G2SA 4LEUA 5BNWA 3FUNA 2KCLA 4GCOA 5FWQA 4AOFA 4AY5A 3NZSA 3LY8A 2WQ6A 1OWLA 4UWKA 1BPOA 3K9IA 2J9QA 3UUXA 1HF8A 2VGXA 3QJZA 3JUIA 1H6KA 3RRMB 1H2TC 4F53A 1TJCA 4L1BA 3IHYA 4BT8A 2FULA 4TV3A 3JYSA 2XGMA 2WB2A 4A55A 3G2VA 2PQRA 4GZCA 2C0LA 1IHGA 4B89A 4UQXA 2WXQA 2WMNA 3FUDA 3CHOA 3ESLA 3FFLA 5G04J 4LUNU 2ILRA 4BX8A 3FUEA 4CDMA 4KBQA 4UI9K 1N54A 3N71A 4I9EA 1QQEA 1HH8A 1NA3A 4JHJA 4FU3A 3QARA 4ANUA 1E7UA 4N3BA 3SZ7A 3UMVA 2UY1B 3O4ZA 4RVBA 4BFRA 3FEYA 3T5VA 1IQRA 2WXOA 4EECA 3EHMA 4EQFA 4I6EA 2X6IA 2NXPA 2VYIA 2CG2A 3TAXA 1FVHA 1H0AA 4ANXA 4DLQA 3LXUX 4WWOA 5CCMA 4UI9J 3FP3A 4XIFA 4PS8A 4RG6A 4GMLA 2DCPA 3JQ1A 4EZJA 5JJ7A 3FTVA 4BT9A 2VSYA 3MKRA 2XPZA 3FULA 2YNQA 3CQCB 3FTYA 2VSXE 2X38A 3CV0A 2GGFA 3ASFA 4URKA 2XGSA 1HO8A 3ML9A 4JEHA 3S7FA 4ATGA 3APFA 1MHQA 1ZBPA 3L22A 2CHZA 5HQ8A 3MKQA 4MKTA 4G25A 2X6FA 4QFVA 5D0QD 2FEZA 1KT0A 2WXMA 3CSFA 3I4RB 2WM9A 5LCWC 2X3MA 3MA5A 3UX4A 4FHKA 4GZ3A 2FO7A 2HO1A 3CGHA 2XQ0A 3IBEA 3FUFA 4N3AA 4CEMA 2JEKA 4IULA 4GCNA 2HM8A 3ONLA 3PE4A 4XKCA 1IYGA 3MV3B 3HHMA 2L6JA 2YINA 3SNXA 1WAO1 3AU4A 5FQ4A 4C0EA 5AENA 2HYZA 3IV0A 5CMWA 5A6CA 3EHNA 2I1JA 3AS4A 4GZDA 4UQYA 3Q5MA 2OOEA 2VTBB 2UWJG 4PUCA 5EX3A 5AIJA 3PS6A 1E90A 1E8YA 5G55A 4C0MA 4G11A 4IYPA 1WM5A 3BG0B 3UQ3A 3ZYLA 3B7TA 3CKCA 3D9MA 1YA0A 4BTAA 2J4BA 1PAQA 1X5BA 3PZDA 3FU0A 3QWPA 4E85A 3LKUA 3CVLA 2DBAA 1ELRA 3NQPA 4GYOA 5G2NA 3FU5A 4JC8A 4V3IA 1N52A 3OAWA 3I4GA 3QOUA 1JWFA 4CT0A 4XI0A 2AXUA 2WXIA 2VSOE 4HVBA 1Y8MA 3PVLA 4HOUA 4JHRA 5G04C 3FTUA 5E75A 2J08A 4G26A 4GA2A 4B94A 3EIJA 3ZW3A 3CSTA 3ASDA 5JJ6A 3CK9A 3PEUB 3OXLA 1SZ9A 3D9IA 1JWGA 5EKQD 3R7QA 3SBSA 3FH5A 2KZTA 1DVPA 4HOTA 4M3OA 3ZHEB 4LCTA 2LNIA 1UN8A 3CKBA 3TXMA 1VDYA 4U04A 4G24A 5KJNA 4KZ0A 3CK8A 2WXJA 2VSNA 4J8SA 4CT4A 3R9AB 5EDSA 2WMOA 5J90A 2J4DA 2LSUA 3Q15A 3QC1A 3APCA 4KVMA 1U3CA 5LX8A 2KATA 3TGOA 5FQ8A 2RD0A 4Y6WA 5JHBA 4ME2A 4PDXA 2R17C 3AS5A 4K0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1A A;  3TG5 A;  3Q49 B;  3QDN A;  4GA0 A;  3S7B A;  4UQZ A;  3ZPJ A;  4HOQ A;  1HZ4 A;  2NC9 A;  2WQH A;  4GYY A;  3ZHE A;  5KJM A;  3OXF A;  3NF1 A;  3EDT B;  4J8D A;  5FZQ A;  4N2Q A;  1QZ2 A;  2Y4U A;  3AS8 A;  2PQN A;  3UPV A;  4HOS A;  4JA7 A;  4NQ0 A;  3FWV A;  4AY6 A;  4WUY A;  4CGV A;  3TG4 A;  3IEG A;  5ARG A;  3RO2 A;  1OUV A;  1KT1 A;  4HOR A;  5DBK A;  4H7X A;  2XGO A;  4O6F A;  2V5F A;  2P58 C;  3CVN A;  2UY1 A;  2FF4 A;  4U0S A;  3CEQ A;  4AM9 A;  4J0U A;  5G05 J;  1P5Q A;  1XNF A;  4J8E A;  5JJT A;  3LPZ A;  3QWV A;  2E2E A;  4ABN A;  3OXG A;  2C0M A;  4YVQ C;  5M72 A;  3PDN A;  4WNF A;  2QFC A;  4F3V A;  5FZS A;  4Y6C A;  3RJV A;  4I2Z A;  3ASH A;  2XCC A;  2YQ8 A;  2I6H A;  4APO A;  1NZN A;  3GYZ A;  3SF4 A;  3URZ A;  4GPK A;  1PC2 A;  4UI9 C;  3LY7 A;  4I17 A;  2Q7F A;  5FT9 A;  4WNG A;  4U07 A;  4G23 A;  3E4B A;  2VGX B;  3GZ2 A;  2VQ2 A;  4WND A;  5LCW J;  2VGY A;  4JA9 A;  2AVP A;  5DIZ A;  3PE3 A;  5FZR A;  4XI9 A;  4BWR A;  5D0O D;  5FTP A;  3ULQ A;  2JLB A;  5KJK A;  3GZ1 A;  3CK7 A;  3ASG A;  3Q4A B;  1NA0 A;  2WPV A;  1KLX A;  2XPI A;  3KD7 A;  5HI7 A;  2PZI A;  3VTY A;  4N39 A;  2XCB A;  1W3B A;  3U4T A;  3CVQ A;  4JL0 A;  3RKV A;  3CVP A;  3QWW A;  5CCL A;  3S7J A;  2XEV A;  2MHK A;  1B89 A;  3RIB A;  3LY9 A;  4YVO A;  3O48 A;  4N5C A;  4A1S A;  4U0Z A;  4G1T A;  5BT1 A;  4I2W A;  3BEE A;  2KCV A;  4BTB A;  5KJL A;  4I9C A;  5CHE E;  4IN3 B;  2KCK A;  3S7D A;  5A7D B;  3Q47 B;  1ELW A;  2FI7 A;  3QKY A;  2R5S A;  1HXI A;  4RG9 A;  3KS2 A;  2IF4 A;  3KAE A;  2GW1 A;  4CDR A;  3MV2 B;  4W9R A;  3U3W A;  2HR2 A;  4GA1 A;  1ZU2 A;  2OND A;  3RU0 A;  2C2L A;  3ZN3 A;  2FBN A;  4GYW A;  3ZGQ A;  3WXX A;  4N2S A;  3VTX A;  1E96 B;  5AYW D;  2Y4T A;  3HYM B;  1FCH A;  4WNE A;  3GW4 A;  3RO3 A;  4N3C A;  2KC7 A;  4YND A;  5EX0 A;  4KXK B;  4KYO B;  2YHC A;  4U0U A;  4GZ5 A;  4J8F A;  4NRH B;  5BW8 C;  4GZ6 A;  3ESK A;  2IFU A;  5C1D A;  4H7Y A;  5FJY A;  5ARF A;  2PL2 A;  3MEK A;  5G05 C;  3LYA A;  2LSV A;  3LCA A;  4G2V A;  4AIF A;  3ZFW A;  1A17 A;  4CGW A;  4LEU A;  5BNW A;  4GCO A;  2KCL A;  4AY5 A;  3LY8 A;  3K9I A;  2J9Q A;  3UUX A;  2VGX A;  1TJC A;  4BT8 A;  3JYS A;  2XGM A;  2PQR A;  2C0L A;  1IHG A;  4UQX A;  3FFL A;  5G04 J;  4KBQ A;  4UI9 K;  3N71 A;  4I9E A;  1QQE A;  1HH8 A;  1NA3 A;  4N3B A;  3SZ7 A;  2UY1 B;  4EQF A;  2VYI A;  3TAX A;  5CCM A;  4UI9 J;  3FP3 A;  4XIF A;  4RG6 A;  5JJ7 A;  4BT9 A;  2VSY A;  3MKR A;  3CV0 A;  3ASF A;  2XGS A;  3S7F A;  1ZBP A;  5HQ8 A;  4G25 A;  5LCW C;  5D0Q D;  2FEZ A;  1KT0 A;  3MA5 A;  4GZ3 A;  2FO7 A;  2HO1 A;  4N3A A;  4GCN A;  3PE4 A;  1IYG A;  3MV3 B;  2L6J A;  1WAO 1;  2HYZ A;  5A6C A;  3AS4 A;  4UQY A;  3Q5M A;  2OOE A;  2UWJ G;  5EX3 A;  1WM5 A;  3UQ3 A;  3CKC A;  1YA0 A;  4BTA A;  3QWP A;  3LKU A;  3CVL A;  2DBA A;  1ELR A;  4GYO A;  3QOU A;  4XI0 A;  1Y8M A;  4JHR A;  4HOU A;  5G04 C;  4G26 A;  4GA2 A;  4B94 A;  3ASD A;  5JJ6 A;  3CK9 A;  3OXL A;  5EKQ D;  4HOT A;  3ZHE B;  2LNI A;  3CKB A;  4U04 A;  4G24 A;  5KJN A;  3CK8 A;  2VSN A;  3R9A B;  2LSU A;  3Q15 A;  2KAT A;  3TGO A;  4Y6W A;  4ME2 A;  2BUG A;  3AS5 A; 
#chains in the Genus database with same CATH topology
 2B6C A;  4BEP A;  4A1G A;  1Q2Z A;  1XGW A;  2V0P A;  3D9J A;  3W9F A;  3ZYQ A;  5KJM A;  3OXF A;  4GTV A;  4GTP A;  4AEZ C;  5FIN A;  3BG1 B;  2Y4U A;  3AS8 A;  1HG5 A;  3UPV A;  1NL4 A;  3FWV A;  5AQ9 A;  5ENN A;  3DRA A;  4AY6 A;  2J8S D;  1SZA A;  4MLP A;  2ION A;  4HS2 A;  3HDX A;  5ARG A;  2P9P G;  2DVW A;  1H6P A;  2IOS A;  1N95 A;  2RFM A;  5DBK A;  3CVW A;  4BX9 A;  4CCA A;  2J49 A;  2XGO A;  2V5F A;  2P58 C;  3ZU7 B;  1Y6I A;  2MYO A;  4U0S A;  4ILH B;  3FEX A;  4J0U A;  1ELK A;  4L2Y A;  3MGB A;  2F0Y A;  3JXJ A;  3QWV A;  4ABN A;  3HVE B;  1EDU A;  3UM2 A;  3RRN B;  1HG2 A;  2WXL A;  3SHF A;  4AP2 A;  5M72 A;  3PDN A;  3CVY A;  4WNF A;  2RFA A;  1H2V C;  1OCR E;  2L9B A;  3PEV B;  4I2Z A;  2IEJ A;  3D9H A;  4ILI A;  2KM4 A;  3SF4 A;  3URZ A;  3DSX A;  4YDY A;  2KBX A;  3C3O A;  3W9G A;  3LY7 A;  2WVI A;  2EIL E;  5C2Y A;  4HI9 A;  3ZXP A;  3Q9U C;  3P1U A;  2BTD A;  1N4P A;  4G23 A;  4O1O A;  1N94 A;  3CQG B;  1TN6 A;  2VQ2 A;  4P29 A;  4WND A;  5LCW J;  4HBD A;  2IJG X;  1JPL A;  2AVP A;  3TXN A;  3DPD A;  3CHP A;  4UUC A;  3QAQ A;  4XI9 A;  1UJJ A;  5FTP A;  3ULQ A;  2JLB A;  3GZ1 A;  2J09 A;  2Y69 E;  3ASG A;  4FJZ A;  1NA0 A;  2CHW A;  3T8M A;  4U8H A;  3B95 A;  3T9K A;  2XPI A;  4LNG A;  4I43 A;  1W3B A;  3S2A A;  4LSZ E;  3CVQ A;  3G2U A;  4GU5 A;  5CRU A;  3J5P A;  1SA5 A;  4DPR A;  2WXG A;  3FTW A;  3I3N A;  2BKK B;  4CDN A;  4MS6 A;  4I1M A;  1S0P A;  4J7W A;  4DX1 A;  4U0Z A;  4GTM A;  5EIL A;  5AQA A;  4GMJ A;  3FTZ A;  4BTB A;  5CHE E;  2KCK A;  4RSY A;  3Q47 B;  5ENT D;  3QKY A;  2R5S A;  2H6G A;  2WXF A;  3MYV A;  4B0Z A;  3JCK C;  2GRR B;  3PNT B;  4W9R A;  3U3W A;  1ZU2 A;  5EIB E;  5ENS D;  3PZ2 A;  4HFG A;  2FBN A;  3PH0 C;  2A5U A;  3PUK A;  5AJL A;  4I6G A;  4N2S A;  4A3T A;  4TUU A;  3AU5 A;  5BV0 A;  1SQM A;  3EIQ C;  3GW4 A;  1QNF A;  4CZ2 D;  2R59 A;  4KXK B;  1ZB1 A;  2CFZ A;  3TWQ A;  2QZA A;  1MJ0 A;  4J8F A;  4EZL A;  5BW8 C;  4GZ6 A;  3ESK A;  5FQ6 A;  1K3Z D;  5HS0 A;  2CFU A;  3PZ1 A;  4H7Y A;  5ARF A;  4DI4 A;  3MEK A;  3V2X A;  3VLD A;  3LCA A;  1E8X A;  5KCM A;  1LF8 A;  4AIF A;  3CHR A;  2BKG A;  4B93 B;  1YMP A;  4NUR A;  5CEC B;  3G2S A;  4LEU A;  3FUN A;  2KCL A;  5FWQ A;  2R2L A;  3LY8 A;  5KBA A;  4UWK A;  2J9Q A;  2VGX A;  2F8Y A;  1TJC A;  4BT8 A;  3UM0 A;  4A55 A;  1NFI E;  3TWW A;  3F6Q A;  4UQX A;  1JCQ A;  3CHO A;  3FFL A;  4CDM A;  3FUE A;  5D2M C;  2FO1 E;  4I9E A;  1HH8 A;  4ANU A;  3UMV A;  2UY1 B;  2ZXW E;  2NXP A;  3TAX A;  1H0A A;  3DXM G;  4UI9 J;  2R05 A;  4RG6 A;  4GML A;  3KEA A;  3FTV A;  2VSY A;  2XPZ A;  3FUL A;  2XGS A;  1HO8 A;  1MHQ A;  3MKQ A;  4MKT A;  4QFV A;  2FEZ A;  1KT0 A;  3I4R B;  3MA5 A;  2XS1 A;  3CGH A;  2XQ0 A;  4LNB A;  4CEM A;  1TNU A;  5FQ4 A;  5AEN A;  3UIO C;  5CMW A;  3DXK G;  2XS8 A;  5EID A;  3PS6 A;  2KXP C;  1N4Q A;  4X8Q A;  3LKU A;  2DBA A;  5G2N A;  3FU5 A;  3UM3 A;  2GRP B;  3I4G A;  2WXI A;  3EU5 A;  3AG1 E;  3PVL A;  5EYL A;  1TNO A;  3Q75 A;  2J08 A;  4B94 A;  3ASD A;  3CK9 A;  3PEU B;  3OXL A;  1JWG A;  1BI8 B;  2KZT A;  5ENQ D;  3CK8 A;  3R9A B;  4DRX E;  2H6I A;  3QC1 A;  3V31 A;  2KAT A;  4N5Q A;  4ME2 A;  2R17 C;  3AS5 A;  4K0R A;  5T8I A;  3Q73 A;  4I1A A;  3QDN A;  4L9P A;  4GA0 A;  4Q96 A;  3S7B A;  3ZPJ A;  1JUQ A;  2NC9 A;  2GRL A;  2EIM E;  2XEE A;  4DLO A;  2ZGD A;  2DWZ A;  4BSX A;  2QY7 A;  4J8D A;  3PZ4 A;  4N2Q A;  5AJD A;  3D9N A;  1EPU A;  2P9S G;  1QZ2 A;  4O60 A;  2CG3 A;  2PM7 A;  4NQ0 A;  2GRQ B;  4KT6 B;  3CIA A;  4L2L A;  1BLX B;  1OWO A;  1U3D A;  3C3Q A;  1N11 A;  1Z6T A;  3U64 A;  2IU1 A;  3L6A A;  3RO2 A;  3MCX A;  3FUK A;  1KT1 A;  3L17 A;  1E8W A;  4GTT A;  4LNU D;  2NSZ A;  4FLB A;  3UKU G;  2RG8 A;  4JVS A;  4U95 D;  2H6H A;  1O1S A;  5ENO D;  3UIN C;  3NBN B;  1JCR A;  2FF4 A;  5EYP F;  3G2T A;  3CEQ A;  1HX8 A;  3LDZ A;  3LJ3 A;  2L6B A;  4U7E B;  3LPZ A;  4CRW A;  1S64 A;  1RW2 A;  3T8K A;  3L08 A;  4FAD A;  3TWX A;  3UM1 A;  1IKN D;  5ENP D;  2AW6 A;  4YDO A;  3QNK A;  3D3M A;  1HU3 A;  2IOL A;  4UWH A;  2QFC A;  2IQC A;  3V2O A;  1MZC A;  3RSE G;  3MJW A;  4HI8 A;  4PS3 A;  2V5Q C;  4OVU A;  2XCC A;  2YQ8 A;  1H6O A;  2I6H A;  3HXC A;  3PZ3 A;  2M63 A;  4GPK A;  2ZU6 B;  2LAH A;  2P9N G;  4WNG A;  2WQ7 A;  3MZL B;  4C48 B;  5BUZ A;  5BV1 A;  5ANR A;  1O5M A;  2R03 A;  3TWR A;  2VGY A;  3B7R L;  2AWI A;  4G8L A;  3BUA A;  2EIN E;  5D0O D;  4FHJ A;  5KJK A;  3CK7 A;  5CBN A;  2DYS E;  1S63 A;  3UXG A;  3E37 A;  4UWF A;  1KLX A;  3SO8 A;  1X81 A;  1K1A A;  4F1S A;  3KD7 A;  5HI7 A;  1O1T A;  4ANW A;  3B7S A;  3RKV A;  5CCL A;  3S7J A;  2MHK A;  3RIB A;  3LY9 A;  3HIZ A;  4Z68 A;  4L7T A;  3LS8 A;  3O48 A;  3ABM E;  3DWL G;  4A1S A;  2OEW A;  3VLF A;  4B8C B;  1OCO E;  5ANL A;  1IXV A;  4TXR A;  4FC8 A;  4I9C A;  3ZRH A;  4AXH A;  1AWC B;  1HXI A;  2P9L G;  3SFX A;  3ONK A;  1DCQ A;  4JPS A;  2GW1 A;  4GTQ A;  3FDH A;  3SGH A;  2DZN A;  4NAC A;  3MX3 A;  4GA1 A;  3TWU A;  3RU0 A;  1K8K G;  3DPY A;  3CLJ A;  3D9K A;  4GYW A;  2LAI A;  3R9M A;  1E8Z A;  3AG4 E;  4HRL A;  4I6J A;  1E96 B;  5AQ7 A;  2Y4T A;  3C72 A;  3HVE A;  2GRN B;  3RO3 A;  3G2W A;  2KC7 A;  4YND A;  4LRZ A;  1H2U A;  3RAU A;  1HFA A;  3B13 A;  4F6R D;  5EN5 D;  3FH7 A;  3CHM A;  4XE0 A;  5C1D A;  5FJY A;  3PRZ A;  3D9O A;  1OWP A;  2LSV A;  4G2V A;  4TRQ A;  4PS7 A;  2XEN A;  1O1R A;  4CGW A;  5BNW A;  4GCO A;  4AY5 A;  3NZS A;  1SA4 A;  1OWL A;  4DUI A;  1HF8 A;  4DX6 D;  1FPP A;  4JB8 P;  3IHY A;  2P9U G;  3JYS A;  1LD8 A;  2PQR A;  5JA4 D;  3Q79 A;  2WXQ A;  2WMN A;  5G04 J;  3TWV A;  4MBG A;  1E7U A;  3O4Z A;  4BFR A;  1OCC E;  2WXO A;  4I6E A;  2CG2 A;  1FVH A;  5CCM A;  5D66 A;  5JMN D;  2DCP A;  3JQ1 A;  4EZJ A;  4BT9 A;  2YNQ A;  3CQC B;  3FTY A;  3ASF A;  4JEH A;  2ZIS A;  2BED A;  4ATG A;  3APF A;  5ENR D;  2CHZ A;  2F8X K;  5HQ8 A;  4G25 A;  2X6F A;  5LCW C;  5D0Q D;  1TR4 A;  3CSF A;  3UX4 A;  3PE4 A;  1IYG A;  4XKC A;  4GTR A;  1KPS B;  3LJN A;  3E33 A;  3AS4 A;  2EIJ E;  4GZD A;  5KNH D;  2VTB B;  2UWJ G;  5G55 A;  3BG0 B;  3UQ3 A;  3D9M A;  1YA0 A;  2HE0 A;  4E85 A;  1X5B A;  3QWP A;  3FU0 A;  1SW6 A;  3CVL A;  1BD8 A;  4GYO A;  2A5E A;  1N0Q A;  4V3I A;  1N52 A;  3OAW A;  1JWF A;  4CT0 A;  5AAO A;  2PNN A;  4HVB A;  1Y8M A;  5G04 C;  1KZO A;  4HOU A;  5BXU A;  5KNG A;  4TXQ A;  3ZW3 A;  3DSU A;  3CST A;  5EKQ D;  3SBS A;  3FH5 A;  1DVP A;  2VGE A;  2LNI A;  4EHM A;  5ITZ F;  4U04 A;  2WXJ A;  4CT4 A;  2WMO A;  2J4D A;  2LSU A;  3APC A;  3TGO A;  3AJI A;  5FQ8 A;  2RD0 A;  4PDX A;  2BUG A;  3E32 A;  3DSV A;  3CVX A;  4U96 D;  3TG5 A;  1UW4 B;  4HLE A;  5B1B E;  1IHB A;  3TJP A;  1IQU A;  4LER A;  4UQZ A;  2B0O E;  2Y3A A;  4IRU A;  2ZGG A;  2XHE A;  3C5R A;  3NF1 A;  2BF0 X;  4K5A B;  4KZC A;  1TNB A;  4OVV A;  1FVF A;  4FJY A;  3X2Q E;  1BI7 B;  4HOS A;  3TWT A;  2XZD G;  1H19 A;  3JUE A;  4WUY A;  4CGV A;  1UG3 A;  3TL5 A;  3L9T A;  1OWN A;  3SFZ A;  4FP7 A;  3FUI A;  1OUV A;  1EYH A;  4HOR A;  3U9W A;  2I2O A;  3CVV A;  4O6F A;  4AJW A;  3BQO A;  3RRU A;  2UY1 A;  3BU8 A;  4F1P A;  3FTS A;  2ETB A;  1P5Q A;  5G05 J;  1Z5S C;  4J8E A;  5JJT A;  4DI3 A;  5A23 A;  3ZIM A;  2ETC A;  3OXG A;  3ABK E;  5CED B;  3SY2 A;  2JAB A;  3KSL A;  3T5X A;  5CER B;  5FZS A;  1WY6 A;  2OVF A;  3SBT B;  1K1B A;  3CHQ A;  4G8K A;  3FY4 A;  4GTO A;  1NZN A;  3GYZ A;  5LP0 A;  4TUM A;  4UI9 C;  2Q7F A;  2V8S E;  4JEU A;  4XZ4 A;  4JXT A;  4OYS A;  1PY1 A;  2DYR E;  4UWG A;  2XEH A;  3HG0 D;  4XKB A;  2AJA A;  4K03 A;  3FHE A;  4OAU C;  2YHE A;  3EU9 A;  1E7V A;  5KWD A;  1Z3X A;  5T3R A;  4J6I A;  4Q94 A;  5AQB A;  5DIZ A;  3PE3 A;  3UKR G;  4U63 A;  4GAA A;  4EBA A;  4BWR A;  2E0I A;  4U8V D;  1TJF A;  3DEP A;  3SFY A;  3E30 A;  2WPV A;  2A4Z A;  3SQV A;  2CHX A;  4GB9 A;  4A3V A;  5B3S E;  2PZI A;  3CVU A;  2WXP A;  4D10 C;  2XCB A;  3U4T A;  2X6J A;  4JL0 A;  4RQI A;  4R7L A;  3CVP A;  4JZY A;  4DX7 D;  2WXR A;  4WAF A;  1D8D A;  1B89 A;  1D8E A;  2V4L A;  4N5C A;  3ZYM A;  4LG6 A;  3DSW A;  4YDW A;  3NOC D;  4G1T A;  4Q69 A;  4I2W A;  3BEE A;  2KCV A;  4GPM A;  1MYO A;  4ACK A;  5KJL A;  4IN3 B;  3S7D A;  3L16 A;  4ILG A;  3D9L A;  5A7D B;  2FI7 A;  3FUH A;  4RG9 A;  2IF4 A;  3KAE A;  4E6H A;  2XRY A;  2VJ8 A;  4JW1 A;  4CDR A;  2P9K G;  2WXK A;  1GW6 A;  3ML8 A;  3QB2 A;  2C2L A;  2WXH A;  1OWM A;  3TWS A;  4A63 B;  1OT8 A;  3ZUV B;  3WXX A;  2PM6 A;  3UI2 A;  5LFA A;  2IO2 C;  3I5P A;  3VTX A;  3OTN A;  1EF1 C;  3KSQ A;  2Y0B G;  5AYW D;  1N4S A;  3HYM B;  4DJA A;  2OV8 A;  5CMY A;  1N9A A;  3JQ0 A;  3SD5 A;  1OXJ A;  2QYJ A;  4WWN A;  4KYO B;  1MX2 A;  4U0U A;  3UIP C;  5AN8 A;  4GZ5 A;  4EZK A;  2GRO B;  3FTX A;  4EBA G;  5IY5 E;  3UTM A;  4NRH B;  3Q9N C;  2IFU A;  1UJK A;  1V55 E;  3LVQ E;  2V4H C;  2OVB A;  3LYA A;  3P2B A;  1UN9 A;  3DBS A;  3ZFW A;  3DST A;  2LXL A;  4APF A;  2XPY A;  1NI1 A;  1Z3Y A;  1A17 A;  4AOF A;  2WQ6 A;  3ULE G;  3K9I A;  3UUX A;  2IO3 C;  3QJZ A;  1H6K A;  3RRM B;  1TN7 A;  3HXF A;  2FUL A;  1AP7 A;  4K5C A;  2XGM A;  2WB2 A;  1V54 E;  3G2V A;  2C0L A;  1IHG A;  1FT1 A;  3ESL A;  4BX8 A;  3V79 K;  5AAR A;  1SVX A;  4UI9 K;  3NB2 A;  1QQE A;  1NA3 A;  4FU3 A;  3QAR A;  3T5V A;  1IQR A;  4EEC A;  3EHM A;  1WDY A;  1N0R A;  4YDE A;  2VYI A;  4DLQ A;  3LXU X;  3FP3 A;  4XIF A;  3JXI A;  3MKR A;  5H7P A;  2VSX E;  2X38 A;  3CV0 A;  2GGF A;  4URK A;  3S7F A;  1G3N B;  1ZBP A;  3L22 A;  3HRA A;  3ASN E;  4FHK A;  4GZ3 A;  2FO7 A;  4BSZ B;  4N3A A;  4JD2 G;  2JEK A;  4IUL A;  2HM8 A;  3EHQ A;  3ONL A;  3SNX A;  1WAO 1;  3AU4 A;  3IV0 A;  3EHN A;  4PUC A;  5EX3 A;  5AIJ A;  1E90 A;  4G11 A;  2H6F A;  3ZYL A;  2Y1L E;  3CKC A;  2J4B A;  1PAQ A;  3PZD A;  3QOU A;  2AXU A;  5B1A E;  3HXB A;  2VSO E;  4JHR A;  3FTU A;  4HRM B;  4G26 A;  4GA2 A;  3ULY A;  3ZKJ A;  4HLL A;  1DCE A;  3R7Q A;  4HOT A;  3ZHE B;  4LCT A;  1S70 B;  1VDY A;  1RZ4 A;  4G24 A;  3C3R A;  5KJN A;  4KZ0 A;  5EDS A;  5J90 A;  2IY0 C;  3Q15 A;  4KVM A;  1U3C A;  4Y6W A;  5JHB A;  3HXE A;  4DX5 D;  4HQD A;  3J5Q B;  3Q49 B;  4B8A A;  5FIO A;  3Q78 A;  1D9S A;  1BU9 A;  4HOQ A;  1HZ4 A;  2WQH A;  4GYY A;  4AV7 A;  3ZHE A;  4FA6 A;  3IKO B;  5CBO A;  2DIW A;  3EDT B;  3PNL B;  3UT7 A;  4KMO A;  5FQ7 A;  5FZQ A;  4EPZ A;  4XEI G;  1A5E A;  2PQN A;  4JA7 A;  3FU6 A;  4BES A;  3FU3 A;  3L54 A;  3WG7 E;  1TN8 A;  2MRI A;  3TG4 A;  2L0I A;  3IEG A;  1NP7 A;  3ZVV A;  1MX4 A;  1WG0 A;  3C98 A;  1QYM A;  4H7X A;  2DZO A;  4KVO A;  2R02 A;  2EIK E;  3PRE A;  2XRZ A;  4XX5 A;  5BPP A;  5CEA A;  3AG3 E;  3CVN A;  3ABL E;  4AM9 A;  4J8Y A;  3B7U X;  4FLH A;  1XNF A;  1QBQ A;  3APD A;  2EQX A;  2E2E A;  1U2V G;  1YYH A;  4QQI A;  2C0M A;  4HNA D;  4YVQ C;  3UT8 A;  2ETA A;  3NZU A;  1TYQ G;  4F3V A;  4DK5 A;  1TNY A;  4ANV A;  4Y6C A;  3RJV A;  3ASH A;  4APO A;  2VTB A;  3HXD A;  3SI5 A;  1PC2 A;  4AVX A;  2LO6 A;  4I17 A;  3ZEF A;  5FT9 A;  4U07 A;  4I1O B;  2WXN A;  2X6K A;  3LEW A;  3E4B A;  2LUH A;  2VGX B;  3GZ2 A;  2J07 A;  5HKP A;  3ENE A;  4C9B B;  4JA9 A;  5JHA A;  2RKK A;  4U8Y D;  2P2C P;  5FZR A;  3AG2 E;  3QK0 A;  2X6H A;  4OAV B;  2I1K A;  3AAA C;  3Q4A B;  4HXI A;  5J08 A;  1N4R A;  3KEZ A;  3IXE A;  3LVR E;  4WWP A;  3ZNG A;  5LOZ A;  3VLE A;  4NIK A;  3VTY A;  4N39 A;  4ATZ D;  4MRU A;  2LXM A;  3MKQ B;  3QWW A;  3FUM A;  2XEV A;  3RK6 A;  4ACL A;  4YVO A;  2QYU A;  3GZS A;  2OCC E;  1HE8 A;  3R7R A;  1INZ A;  3FH8 A;  3IHV A;  5BT1 A;  2I9C A;  4L23 A;  3ZXS A;  3DSS A;  4CYM D;  3B7B A;  1ELW A;  2QC9 A;  2L0T B;  3KS2 A;  3DEO A;  4UWL A;  3ASO E;  3MV2 B;  4BY6 A;  2HR2 A;  3V30 A;  2OND A;  3EHR A;  3ZN3 A;  3EJN A;  2KZT B;  3ZGQ A;  3D9P A;  5E76 A;  3CHS A;  4PH4 B;  3FUJ A;  4RLY A;  2AXZ A;  4FUL A;  1FT2 A;  4JHK A;  2P9I G;  1DNP A;  2GRM A;  4HB5 A;  1HS6 A;  1FCH A;  2OEV A;  4WNE A;  4N3C A;  3PUJ A;  3U66 A;  4ZHB A;  3CR3 A;  5EX0 A;  1TEZ A;  2AXV A;  2YHC A;  3ZYK A;  2ZIR A;  4HRN A;  3L82 A;  1MQS A;  2PL2 A;  5G05 C;  4F7A A;  1L5J A;  1UOH A;  3L13 A;  2MOW A;  5HRY A;  4K5B A;  3UT4 A;  5T4Y A;  3E34 A;  1LTX A;  1BPO A;  3JUI A;  1H2T C;  4F53 A;  4L1B A;  4DX2 A;  4TV3 A;  2NYJ A;  4GZC A;  4B89 A;  3FUD A;  5BXO A;  4LUN U;  2ILR A;  4KBQ A;  4O1P A;  1N54 A;  3N71 A;  5CRV A;  4JHJ A;  4N3B A;  3SZ7 A;  4RVB A;  3FEY A;  4BET A;  4EQF A;  2X6I A;  4ANX A;  4WWO A;  4PS8 A;  1YCS B;  5JJ7 A;  4TXP A;  1TNZ A;  3ML9 A;  3Q7F A;  2WXM A;  2WM9 A;  2X3M A;  2HO1 A;  3IBE A;  3FUF A;  1KZP A;  4GCN A;  4GMR A;  3MV3 B;  1JCS A;  3HHM A;  2L6J A;  2YIN A;  1OCZ E;  4C0E A;  2HYZ A;  5A6C A;  2I1J A;  4UQY A;  3Q5M A;  2OOE A;  1E8Y A;  4C0M A;  4IYP A;  1WM5 A;  3Q7A A;  1LD7 A;  3B7T A;  4BTA A;  1OY3 D;  4ZFH A;  1DC2 A;  1ELR A;  3NQP A;  4JC8 A;  4M7C A;  4BER A;  3NOG D;  4XI0 A;  3NAW A;  1MX6 A;  5E75 A;  3EIJ A;  5JJ6 A;  1SZ9 A;  3D9I A;  4M3O A;  1UN8 A;  3CKB A;  3ISM C;  3TXM A;  3EUV A;  2VSN A;  2XZT G;  4J8S A;  5LX8 A;  2F37 A;  4GTS A; 
#chains in the Genus database with same CATH homology
 5T8I A;  3CVX A;  4I1A A;  3TG5 A;  1UW4 B;  4HLE A;  3Q49 B;  3QDN A;  4B8A A;  4GA0 A;  4A1G A;  4Q96 A;  1XGW A;  1IQU A;  2V0P A;  4LER A;  3S7B A;  3TJP A;  4UQZ A;  3ZPJ A;  2Y3A A;  1JUQ A;  4IRU A;  4HOQ A;  1HZ4 A;  2GRL A;  2NC9 A;  2WQH A;  4GYY A;  4DLO A;  3D9J A;  2XHE A;  4AV7 A;  3ZYQ A;  3ZHE A;  4FA6 A;  3IKO B;  5KJM A;  3OXF A;  3NF1 A;  4BSX A;  4AEZ C;  2BF0 X;  2QY7 A;  2DIW A;  3EDT B;  3PNL B;  3UT7 A;  4KMO A;  4J8D A;  4KZC A;  5FQ7 A;  5FZQ A;  4N2Q A;  4OVV A;  1FVF A;  4EPZ A;  5AJD A;  3D9N A;  1EPU A;  3BG1 B;  1QZ2 A;  2Y4U A;  4FJY A;  3AS8 A;  2CG3 A;  2PQN A;  1HG5 A;  3UPV A;  4HOS A;  2PM7 A;  4JA7 A;  4NQ0 A;  3FU6 A;  3FWV A;  4KT6 B;  5ENN A;  1H19 A;  3FU3 A;  4AY6 A;  3CIA A;  3L54 A;  4L2L A;  1SZA A;  1OWO A;  1U3D A;  4MLP A;  2ION A;  4WUY A;  1Z6T A;  4HS2 A;  4CGV A;  1UG3 A;  3TL5 A;  3U64 A;  2MRI A;  3TG4 A;  3HDX A;  2IU1 A;  2L0I A;  3L6A A;  3IEG A;  5ARG A;  3RO2 A;  3MCX A;  1OWN A;  1NP7 A;  3SFZ A;  3ZVV A;  3FUK A;  3FUI A;  1OUV A;  1KT1 A;  4FP7 A;  1EYH A;  4HOR A;  3L17 A;  2IOS A;  3C98 A;  1E8W A;  3U9W A;  5DBK A;  4H7X A;  3CVW A;  2NSZ A;  4FLB A;  2RG8 A;  4JVS A;  4KVO A;  2I2O A;  4BX9 A;  3PRE A;  2XRZ A;  4CCA A;  4XX5 A;  2J49 A;  2XGO A;  5BPP A;  3CVV A;  4O6F A;  4AJW A;  2V5F A;  2P58 C;  3CVN A;  2UY1 A;  3RRU A;  2FF4 A;  3G2T A;  1Y6I A;  4U0S A;  4ILH B;  3CEQ A;  4AM9 A;  3FEX A;  3FTS A;  4J0U A;  5G05 J;  1P5Q A;  1HX8 A;  3LDZ A;  1ELK A;  3B7U X;  3LJ3 A;  4FLH A;  4L2Y A;  1XNF A;  3MGB A;  4J8E A;  5JJT A;  3APD A;  2EQX A;  3LPZ A;  4CRW A;  3QWV A;  2E2E A;  3L08 A;  4DI3 A;  5A23 A;  4ABN A;  4FAD A;  3ZIM A;  3HVE B;  1EDU A;  3RRN B;  3OXG A;  2C0M A;  1HG2 A;  2WXL A;  3SHF A;  4YVQ C;  2AW6 A;  3UT8 A;  4AP2 A;  5M72 A;  3QNK A;  3PDN A;  3D3M A;  3CVY A;  3NZU A;  4WNF A;  1HU3 A;  2IOL A;  4UWH A;  1H2V C;  2QFC A;  4F3V A;  2IQC A;  3T5X A;  4DK5 A;  2L9B A;  5FZS A;  1WY6 A;  2OVF A;  3PEV B;  3SBT B;  3MJW A;  4PS3 A;  4ANV A;  3CHQ A;  4Y6C A;  3RJV A;  4I2Z A;  3ASH A;  4OVU A;  2XCC A;  2YQ8 A;  2I6H A;  3FY4 A;  4APO A;  4ILI A;  2VTB A;  1NZN A;  2KM4 A;  2M63 A;  3SI5 A;  3GYZ A;  3SF4 A;  3URZ A;  4GPK A;  1PC2 A;  4AVX A;  2LO6 A;  5LP0 A;  4UI9 C;  2ZU6 B;  3LY7 A;  2WVI A;  4I17 A;  2LAH A;  2Q7F A;  3ZEF A;  5FT9 A;  2V8S E;  4JEU A;  4XZ4 A;  4WNG A;  4JXT A;  2WQ7 A;  5C2Y A;  4OYS A;  4U07 A;  1PY1 A;  4I1O B;  2WXN A;  3MZL B;  3P1U A;  2X6K A;  3LEW A;  2BTD A;  4UWG A;  5BUZ A;  4G23 A;  3E4B A;  4XKB A;  2VGX B;  3GZ2 A;  2J07 A;  3FHE A;  4K03 A;  2YHE A;  5BV1 A;  3CQG B;  1E7V A;  2VQ2 A;  4P29 A;  4WND A;  3ENE A;  5ANR A;  5LCW J;  1Z3X A;  5T3R A;  2VGY A;  4C9B B;  2IJG X;  3B7R L;  4JA9 A;  1JPL A;  2AVP A;  4J6I A;  4Q94 A;  3TXN A;  3DPD A;  5JHA A;  5DIZ A;  3PE3 A;  2AWI A;  3CHP A;  5FZR A;  3QK0 A;  3QAQ A;  4U63 A;  4GAA A;  2X6H A;  4XI9 A;  4EBA A;  4BWR A;  5D0O D;  1UJJ A;  2E0I A;  5FTP A;  2I1K A;  3ULQ A;  2JLB A;  1TJF A;  4FHJ A;  5KJK A;  3GZ1 A;  2J09 A;  3CK7 A;  3ASG A;  3Q4A B;  4FJZ A;  4HXI A;  1NA0 A;  2CHW A;  3T8M A;  2WPV A;  4U8H A;  5J08 A;  2A4Z A;  3KEZ A;  4UWF A;  1KLX A;  2CHX A;  4F1S A;  3LVR E;  4WWP A;  5LOZ A;  4GB9 A;  2XPI A;  4A3V A;  3KD7 A;  5HI7 A;  3VLE A;  2PZI A;  3VTY A;  4N39 A;  3CVU A;  2WXP A;  4I43 A;  4D10 C;  2XCB A;  1W3B A;  3S2A A;  3U4T A;  2X6J A;  4ANW A;  4MRU A;  3B7S A;  3CVQ A;  3G2U A;  4JL0 A;  4R7L A;  3MKQ B;  3CVP A;  4GU5 A;  3RKV A;  3QWW A;  3FUM A;  5CCL A;  4JZY A;  2WXR A;  3S7J A;  2XEV A;  4WAF A;  2MHK A;  3RK6 A;  4DPR A;  1B89 A;  3RIB A;  3LY9 A;  3HIZ A;  4ACL A;  4YVO A;  2V4L A;  2WXG A;  3FTW A;  3I3N A;  4L7T A;  3LS8 A;  3O48 A;  4CDN A;  3GZS A;  4N5C A;  3ZYM A;  1HE8 A;  4MS6 A;  4I1M A;  1S0P A;  3R7R A;  4A1S A;  1INZ A;  3FH8 A;  3VLF A;  4B8C B;  4U0Z A;  3IHV A;  4G1T A;  5ANL A;  4Q69 A;  2I9C A;  5BT1 A;  4I2W A;  3BEE A;  2KCV A;  4GMJ A;  3FTZ A;  4BTB A;  4FC8 A;  4ACK A;  5KJL A;  4I9C A;  4L23 A;  5CHE E;  4IN3 B;  2KCK A;  3S7D A;  3ZRH A;  3L16 A;  4RSY A;  4ILG A;  3ZXS A;  4AXH A;  3D9L A;  5A7D B;  3Q47 B;  1ELW A;  2FI7 A;  3FUH A;  3QKY A;  2R5S A;  1HXI A;  2L0T B;  4RG9 A;  3ONK A;  3KS2 A;  2WXF A;  2IF4 A;  4JPS A;  3KAE A;  3MYV A;  2GW1 A;  4E6H A;  4UWL A;  3FDH A;  2XRY A;  2VJ8 A;  4JW1 A;  3SGH A;  4CDR A;  2WXK A;  1GW6 A;  4B0Z A;  3JCK C;  3MV2 B;  4NAC A;  3ML8 A;  4BY6 A;  2BUG A;  3PNT B;  3MX3 A;  4W9R A;  3U3W A;  2HR2 A;  4GA1 A;  1ZU2 A;  2OND A;  3RU0 A;  2C2L A;  3QB2 A;  3ZN3 A;  2WXH A;  3EJN A;  3CLJ A;  1OWM A;  3D9K A;  4HFG A;  2KZT B;  2FBN A;  4GYW A;  3PH0 C;  2LAI A;  3ZGQ A;  1E8Z A;  2A5U A;  3D9P A;  3CHS A;  3PUK A;  2PM6 A;  4PH4 B;  5E76 A;  3WXX A;  3FUJ A;  5AJL A;  4I6G A;  4I6J A;  5LFA A;  4N2S A;  2AXZ A;  3I5P A;  4FUL A;  3VTX A;  4A3T A;  3OTN A;  4JHK A;  1E96 B;  1EF1 C;  4TUU A;  1DNP A;  2GRM A;  2Y4T A;  3AU5 A;  3HYM B;  5AYW D;  4DJA A;  1HS6 A;  2OV8 A;  5BV0 A;  1FCH A;  1SQM A;  3HVE A;  4WNE A;  5CMY A;  3EIQ C;  3GW4 A;  3JQ0 A;  3RO3 A;  4N3C A;  3SD5 A;  3G2W A;  1QNF A;  3PUJ A;  3U66 A;  2KC7 A;  4YND A;  3CR3 A;  5EX0 A;  4WWN A;  2R59 A;  4KXK B;  1TEZ A;  2AXV A;  4LRZ A;  2CFZ A;  4KYO B;  2YHC A;  4U0U A;  1H2U A;  4EZK A;  4GZ5 A;  4J8F A;  1HFA A;  3FTX A;  4EBA G;  3B13 A;  3ZYK A;  4NRH B;  4EZL A;  5BW8 C;  4GZ6 A;  3FH7 A;  3ESK A;  2IFU A;  5FQ6 A;  3CHM A;  4XE0 A;  1UJK A;  2CFU A;  5C1D A;  4H7Y A;  1MQS A;  5FJY A;  5ARF A;  3LVQ E;  4DI4 A;  3PRZ A;  2PL2 A;  3MEK A;  5G05 C;  2OVB A;  3VLD A;  4F7A A;  3D9O A;  1OWP A;  3LYA A;  1L5J A;  2LSV A;  3L13 A;  3LCA A;  1E8X A;  3P2B A;  4G2V A;  5KCM A;  1UN9 A;  1LF8 A;  2MOW A;  3DBS A;  4AIF A;  3CHR A;  4TRQ A;  3ZFW A;  4APF A;  4PS7 A;  2XPY A;  3UT4 A;  1Z3Y A;  5T4Y A;  1A17 A;  4CGW A;  4NUR A;  3G2S A;  4LEU A;  5BNW A;  3FUN A;  2KCL A;  4GCO A;  5FWQ A;  4AOF A;  4AY5 A;  3NZS A;  3LY8 A;  2WQ6 A;  1OWL A;  4UWK A;  1BPO A;  3K9I A;  2J9Q A;  3UUX A;  1HF8 A;  2VGX A;  3QJZ A;  3JUI A;  1H6K A;  3RRM B;  1H2T C;  4F53 A;  1TJC A;  4L1B A;  3IHY A;  4BT8 A;  2FUL A;  4TV3 A;  3JYS A;  2XGM A;  2WB2 A;  4A55 A;  3G2V A;  2PQR A;  4GZC A;  2C0L A;  1IHG A;  4B89 A;  4UQX A;  2WXQ A;  2WMN A;  3FUD A;  3CHO A;  3ESL A;  3FFL A;  5G04 J;  4LUN U;  2ILR A;  4BX8 A;  3FUE A;  4CDM A;  4KBQ A;  4UI9 K;  1N54 A;  3N71 A;  4I9E A;  1QQE A;  1HH8 A;  1NA3 A;  4JHJ A;  4FU3 A;  3QAR A;  4ANU A;  1E7U A;  4N3B A;  3SZ7 A;  3UMV A;  2UY1 B;  3O4Z A;  4RVB A;  4BFR A;  3FEY A;  3T5V A;  1IQR A;  2WXO A;  4EEC A;  3EHM A;  4EQF A;  4I6E A;  2X6I A;  2NXP A;  2VYI A;  2CG2 A;  3TAX A;  1FVH A;  1H0A A;  4ANX A;  4DLQ A;  3LXU X;  4WWO A;  5CCM A;  4UI9 J;  3FP3 A;  4XIF A;  4PS8 A;  4RG6 A;  4GML A;  2DCP A;  3JQ1 A;  4EZJ A;  5JJ7 A;  3FTV A;  4BT9 A;  2VSY A;  3MKR A;  2XPZ A;  3FUL A;  2YNQ A;  3CQC B;  3FTY A;  2VSX E;  2X38 A;  3CV0 A;  2GGF A;  3ASF A;  4URK A;  2XGS A;  1HO8 A;  3ML9 A;  4JEH A;  3S7F A;  4ATG A;  3APF A;  1MHQ A;  1ZBP A;  3L22 A;  2CHZ A;  5HQ8 A;  3MKQ A;  4MKT A;  4G25 A;  2X6F A;  4QFV A;  5D0Q D;  2FEZ A;  1KT0 A;  2WXM A;  3CSF A;  3I4R B;  2WM9 A;  5LCW C;  2X3M A;  3MA5 A;  3UX4 A;  4FHK A;  4GZ3 A;  2FO7 A;  2HO1 A;  3CGH A;  2XQ0 A;  3IBE A;  3FUF A;  4N3A A;  4CEM A;  2JEK A;  4IUL A;  4GCN A;  2HM8 A;  3ONL A;  3PE4 A;  4XKC A;  1IYG A;  3MV3 B;  3HHM A;  2L6J A;  2YIN A;  3SNX A;  1WAO 1;  3AU4 A;  5FQ4 A;  4C0E A;  5AEN A;  2HYZ A;  3IV0 A;  5CMW A;  5A6C A;  3EHN A;  2I1J A;  3AS4 A;  4GZD A;  4UQY A;  3Q5M A;  2OOE A;  2VTB B;  2UWJ G;  4PUC A;  5EX3 A;  5AIJ A;  3PS6 A;  1E90 A;  1E8Y A;  5G55 A;  4C0M A;  4G11 A;  4IYP A;  1WM5 A;  3BG0 B;  3UQ3 A;  3ZYL A;  3B7T A;  3CKC A;  3D9M A;  1YA0 A;  4BTA A;  2J4B A;  1PAQ A;  1X5B A;  3PZD A;  3FU0 A;  3QWP A;  4E85 A;  3LKU A;  3CVL A;  2DBA A;  1ELR A;  3NQP A;  4GYO A;  5G2N A;  3FU5 A;  4JC8 A;  4V3I A;  1N52 A;  3OAW A;  3I4G A;  3QOU A;  1JWF A;  4CT0 A;  4XI0 A;  2AXU A;  2WXI A;  2VSO E;  4HVB A;  1Y8M A;  3PVL A;  4HOU A;  4JHR A;  5G04 C;  3FTU A;  5E75 A;  2J08 A;  4G26 A;  4GA2 A;  4B94 A;  3EIJ A;  3ZW3 A;  3CST A;  3ASD A;  5JJ6 A;  3CK9 A;  3PEU B;  3OXL A;  1SZ9 A;  3D9I A;  1JWG A;  5EKQ D;  3R7Q A;  3SBS A;  3FH5 A;  2KZT A;  1DVP A;  4HOT A;  4M3O A;  3ZHE B;  4LCT A;  2LNI A;  1UN8 A;  3CKB A;  3TXM A;  1VDY A;  4U04 A;  4G24 A;  5KJN A;  4KZ0 A;  3CK8 A;  2WXJ A;  2VSN A;  4J8S A;  4CT4 A;  3R9A B;  5EDS A;  2WMO A;  5J90 A;  2J4D A;  2LSU A;  3Q15 A;  3QC1 A;  3APC A;  4KVM A;  1U3C A;  5LX8 A;  2KAT A;  3TGO A;  5FQ8 A;  2RD0 A;  4Y6W A;  5JHB A;  4ME2 A;  4PDX A;  2R17 C;  3AS5 A;  4K0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...