2WQHA

Crystal structure of ctpr3y3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
104
structure length
104
Chain Sequence
PGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTPR3Y3
publication title Self-association of TPR domains: Lessons learned from a designed, consensus-based TPR oligomer.
pubmed doi rcsb
molecule tags De novo protein
total genus 46
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wqhA00
3SZ7A 2FO7A 2BUGA 5G04J 3QDNA 3Q47B 4U0SA 5EKQD 3CV0A 4N5CA 5A6CA 4I9EA 5BW8C 1XNFA 1ELRA 4U04A 1KLXA 2UWJG 1ZU2A 3KAEA 4UI9K 3RJVA 3KS2A 3TGOA 3FWVA 2C0MA 5EX0A 4I17A 4G26A 4UQXA 2KC7A 4N3AA 4I2WA 2VYIA 2VQ2A 4G2VA 4AY5A 4APOA 4HOQA 4HORA 4GZ3A 4EQFA 2UY1A 3FP3A 2XPIA 3LY7A 2XGMA 2HYZA 4H7XA 3KD7A 3LKUA 3EDTB 5BT1A 4UI9J 5FZSA 3TAXA 5DIZA 3CEQA 3S7FA 4AY6A 3CK8A 3UQ3A 4U0UA 4XI9A 4YVOA 4UQZA 1KT0A 4GYYA 4NRHB 3O48A 2HR2A 4O6FA 4ABNA 5LCWJ 5G05J 3QOUA 1B89A 4GA2A 2Y4UA 5G04C 1IHGA 1NZNA 1FCHA 1PC2A 3ESKA 3LCAA 3VTXA 1QZ2A 4F3VA 2MHKA 5KJNA 5CHEE 3OXLA 1IYGA 3R9AB 2YQ8A 2FF4A 5FZQA 5KJKA 4NQ0A 3MKRA 1HH8A 4RG6A 2UY1B 4N3BA 3GZ1A 3FFLA 1P5QA 3GYZA 2C0LA 3LY8A 1YA0A 5A7DB 2PL2A 2IFUA 4HOUA 2JLBA 2PZIA 5D0OD 2WPVA 2FI7A 4RG9A 3AS5A 5DBKA 2ONDA 2AVPA 1Y8MA 3CKBA 4UI9C 3RO3A 4YNDA 3UUXA 5KJLA 4GZ6A 3K9IA 4J8EA 3ZFWA 2XEVA 3GZ2A 3Q15A 3JYSA 4AIFA 2IF4A 3QWWA 5LCWC 5G05C 4XIFA 4N2SA 4HOTA 3MA5A 3U4TA 4JA9A 3RU0A 2OOEA 3MV2B 3LYAA 1HZ4A 3HYMB 1NA0A 4J8FA 4GYOA 3ZN3A 2PQRA 4JHRA 3CK7A 3PDNA 4U07A 3OXFA 5FJYA 1E96B 2QFCA 3ZPJA 1WAO1 5EX3A 3CK9A 2V5FA 2XCBA 3E4BA 3ASHA 4Y6CA 4N3CA 4A1SA 2HO1A 4GCOA 5CCLA 3QKYA 3UPVA 3QWVA 3AS8A 3ZGQA 4CGVA 4BWRA 3Q49B 2NC9A 4CGWA 4CDRA 3CKCA 1W3BA 2KCVA 3Q4AB 4U0ZA 2Y4TA 4I1AA 2I6HA 2XCCA 4JL0A 4GA0A 2J9QA 4I2ZA 4J8DA 3CVQA 5AYWD 3RO2A 3OXGA 5FZRA 5C1DA 4G23A 4I9CA 4WUYA 1ZBPA 3S7BA 4KXKB 3CVLA 5D0QD 4N2QA 5FTPA 3IEGA 4BT8A 3PE4A 2KCLA 2FBNA 4AM9A 2VGXA 4N39A 4W9RA 4GPKA 4ME2A 5BNWA 3MV3B 4BT9A 3LY9A 2R5SA 2VGYA 2VSYA 2LSUA 4J0UA 2GW1A 1OUVA 4Y6WA 5JJ6A 2XGSA 3ASGA 3PE3A 4WNEA 4GA1A 3NF1A 3AS4A 3RKVA 4UQYA 3TG5A 4G25A 3LPZA 3QWPA 4WNGA 3ULQA 3TG4A 4GCNA 3WXXA 4HOSA 5KJMA 5HQ8A 4BTAA 2Q7FA 2KCKA 4GYWA 3ZHEB 1KT1A 3N71A 1A17A 3Q5MA 2YHCA 2KATA 3BEEA 3RIBA 2E2EA 3S7DA 1ELWA 4IN3B 2WQHA 3S7JA 2P58C 3U3WA 2VGXB 1TJCA 2DBAA 5HI7A 4LEUA 4JA7A 3MEKA 2LNIA 4GZ5A 1HXIA 2L6JA 3ASFA 5JJ7A 4G1TA 5ARGA 3ASDA 2PQNA 2FEZA 3GW4A 4WNDA 5FT9A 3URZA 4H7YA 4B94A 3CVPA 3ZHEA 4YVQC 5JJTA 3SF4A 4KBQA 3CVNA 3VTYA 4G24A 4WNFA 4BTBA 1NA3A 1QQEA 5ARFA 4XI0A 2VSNA 5CCMA 2XGOA 2C2LA 4KYOB 2LSVA 5M72A 1WM5A
chains in the Genus database with same CATH superfamily
3BG0B 2FO7A 3ABKE 4A3VA 5EKQD 3JCKC 2DZOA 3FHEA 5CERB 2WM9A 2DYSE 4GTQA 4U63A 5A6CA 2WXQA 4B93B 4U04A 1KLXA 1NP7A 2A4ZA 2CG2A 3RJVA 3D9JA 2BF0X 5FQ6A 1TJFA 2GRPB 3UM2A 2P9KG 3FU3A 2C0MA 3UX4A 2J4BA 3DPDA 3ABME 1O1RA 4N3AA 2VYIA 4G2VA 3SD5A 3KEZA 2KZTA 3FDHA 2P9NG 3ZVVA 1AP7A 4PS7A 2XPIA 3PNLB 2XGMA 4HBDA 4HRMB 3T5VA 5ENRD 3Q73A 5FZSA 3PZ4A 3TAXA 4A3TA 5D2MC 1FVHA 1YYHA 1KZPA 2YINA 3MX3A 1OWPA 3ZYLA 4U0UA 1JWFA 2GRRB 2PNNA 3G2SA 2E0IA 3B95A 1OT8A 1HS6A 4O6FA 3ONLA 4I6EA 4HVBA 2L0IA 4ILIA 3EHNA 2XEHA 1NZNA 3Q9UC 2J8SD 3MCXA 4EBAA 3FH8A 2XPZA 2MHKA 1H6KA 5KJNA 3UT4A 3BQOA 4WAFA 3TXNA 1NI1A 3CLJA 1HFAA 4JHKA 4UUCA 3CVYA 3MKRA 1SA5A 2WXOA 4A55A 3FEXA 4AJWA 4Q69A 4OYSA 3LY8A 1YCSB 4CEMA 5A7DB 2IFUA 3DEPA 2WQ6A 4PUCA 4FJZA 1BD8A 4JZYA 2F0YA 2WPVA 3Q78A 4LERA 3D9PA 5CBNA 5AQ9A 2NYJA 5DBKA 4F1SA 2ONDA 2AVPA 1Y8MA 5T8IA 3LXUX 1O5MA 2VTBB 4WWOA 4GZ6A 3MJWA 3TXMA 4OVVA 4L1BA 3J5QB 3WG7E 3R7RA 2XEVA 3NBNB 3C3QA 4URKA 2IF4A 4MLPA 3VLFA 5LCWC 5G05C 4MRUA 3SNXA 2DVWA 4HOTA 4JA9A 1BPOA 3RU0A 2GROB 3LYAA 1HZ4A 3ZYMA 3QARA 2WXHA 1E8XA 1TR4A 2VSOE 2IOSA 4G11A 3KSQA 3NOCD 1WAO1 4EZJA 2RFMA 3DPYA 1JWGA 2FULA 1LD8A 2XCBA 3QK0A 1H2VC 2XS8A 1D8DA 5H7PA 3FUJA 4N3CA 2XZTG 3O4ZA 2HO1A 2H6IA 5KCMA 3QWVA 3D3MA 3D9IA 4KZ0A 2DYRE 2XRZA 4TUMA 4CGWA 1TN7A 2WMOA 3DSUA 4CDRA 3C72A 4O1OA 1DVPA 4U0ZA 5G2NA 2XCCA 4JL0A 4GA0A 2GRQB 2J9QA 3OXGA 4I9CA 4HB5A 2ETBA 1IHBA 3ULYA 5J08A 4GAAA 4F1PA 4K5BA 3PE4A 2MYOA 4JVSA 5AJDA 2AJAA 3I5PA 3TWSA 3SI5A 1N4RA 2CG3A 4TXQA 3EIQC 1D9SA 3LY9A 3V30A 2LSUA 2GW1A 4D10C 3F6QA 1K8KG 4ANXA 3EU9A 4GMLA 2P9IG 3Q7FA 3PE3A 3HXCA 4BERA 3FTUA 3FU0A 3FH7A 1UOHA 1Z3YA 4B8CB 3SQVA 3FY4A 5B3SE 3LPZA 3QWPA 3SGHA 4CDMA 4GPMA 2J49A 5AJLA 2KCKA 4GYWA 2DCPA 1KT1A 3Q5MA 3SY2A 3L6AA 2KATA 3BEEA 3CSFA 3ISMC 2E2EA 3S7DA 3S7JA 2X6FA 1SQMA 4HI8A 4LUNU 3U3WA 5E75A 3B13A 4E85A 4XX5A 4EECA 4AOFA 3CVXA 1U3CA 3MEKA 2WXLA 3UM1A 4DX2A 5EILA 1TNYA 3HXBA 1RW2A 3ESLA 3CVVA 4HRLA 2R2LA 3CHPA 3AAAC 2PQNA 3DSSA 5EYPF 2EIJE 2XZDG 3APFA 4GTRA 1SVXA 4B94A 4FULA 2Y1LE 3SF4A 4KBQA 3DSTA 5ENOD 4FADA 3CVUA 3OAWA 4BTBA 1N52A 3I4GA 4CT4A 1E8ZA 2IJGX 4JHJA 3FUHA 1WDYA 3TJPA 4L23A 2XGOA 3EU5A 3TWUA 2LSVA 2XPYA 4ANWA 4C0MA 1WM5A 2ZISA 5G04J 3Q47B 3CHRA 4AXHA 4CCAA 2CFUA 2X6HA 3LJNA 3NB2A 4PS3A 3L9TA 2UWJG 2H6FA 3FUKA 4KZCA 3KS2A 3TGOA 3UIPC 4ANUA 1Z3XA 2AWIA 5J90A 4G8LA 5C2YA 1N54A 5EX0A 4I17A 2KC7A 3HXEA 5AARA 4I2WA 4ATGA 4GZ3A 4LRZA 2I1KA 5BV1A 2LAIA 3R9MA 4C0EA 4I6GA 3EDTB 4R7LA 5BT1A 4UI9J 4HNAD 4J6IA 3S7FA 1N94A 3CR3A 3CK8A 4IULA 5FIOA 4GZCA 1IQUA 4XI9A 4YVOA 3UIOC 1QBQA 3G2VA 2HE0A 4UQZA 1MHQA 5LFAA 2HR2A 3CGHA 2BKGA 3JQ1A 4GMJA 1EPUA 3QOUA 1B89A 2EIKE 3V2XA 1IHGA 3I4RB 2IO3C 3ZU7B 2WQ7A 3TWRA 1PC2A 3ESKA 2VSXE 2ETAA 4EZLA 3VTXA 1QZ2A 3JQ0A 4F3VA 3EHMA 3UMVA 5CHEE 3RK6A 5CECB 2LXMA 5AENA 1H2TC 2FF4A 2X6IA 3ZXSA 4GZDA 4NQ0A 3UKRG 5CMYA 3HIZA 2R02A 5FQ7A 3GZ1A 3FFLA 1P5QA 4J7WA 2C0LA 1YA0A 2P9SG 2PL2A 1TYQG 2I1JA 3UXGA 4JC8A 1LD7A 2PZIA 2Y69E 4FJYA 2VGEA 1XGWA 2NXPA 2FI7A 4RG9A 2OV8A 2A5EA 4PS8A 3W9GA 4LNBA 2XENA 3RO3A 2X6KA 2ZGDA 5CEAA 3L82A 3ENEA 3CSTA 5KJLA 1IQRA 3UTMA 3K9IA 4HS2A 1PAQA 3PS6A 4CZ2D 4AIFA 2WXRA 5ENTD 3QWWA 5EIBE 4BETA 3LVQE 3QNKA 2ILRA 3LDZA 3PREA 5ENSD 3J5PA 3QAQA 2OOEA 3MV2B 4I6JA 2J07A 4J8FA 4GYOA 4AVXA 1FT2A 2QYJA 3IXEA 4JHRA 3CK7A 3CHMA 3PDNA 4U07A 2X38A 3ZPJA 1QNFA 5AAOA 3TWTA 2P9UG 1TNBA 4UWFA 4RSYA 2V5FA 4ACKA 4TUUA 3E4BA 4E6HA 1JUQA 1UW4B 3FTVA 5CCLA 3QKYA 4FP7A 3PVLA 5LX8A 2LUHA 3FTYA 4HLEA 1V54E 4CGVA 3ABLE 2MOWA 2J09A 3IKOB 3Q7AA 4F7AA 2IU1A 3E37A 3Q4AB 1MX4A 3MKQB 4KMOA 2Y4TA 3DSVA 2I6HA 4I1AA 2P9PG 1EDUA 3TWXA 4J8DA 4A63B 3CHSA 4CRWA 4P29A 4G23A 3B7SA 3E30A 5E76A 1ZBPA 3ZW3A 2JABA 3CVLA 5AN8A 4N2QA 4BT8A 4DX6D 2VGXA 5B1AE 4UWLA 2AXVA 2J4DA 1N11A 5CRVA 1IXVA 4K03A 4EHMA 4GTTA 3BU8A 5HKPA 2YHEA 1S63A 3C98A 1WG0A 4Y6WA 2NSZA 3G2TA 3P2BA 3ASGA 3ONKA 4GTMA 4WNEA 3D9KA 3E34A 4GA1A 4LNGA 3U64A 5HRYA 3MKQA 1A5EA 3ZNGA 2IOLA 3IV0A 4G25A 3PRZA 3ULQA 3TG4A 3UT8A 4U96D 4GCNA 2B6CA 3AG1E 2P9LG 4BTAA 3JUIA 1U3DA 3VLDA 3Q9NC 3ZHEB 3TWWA 1A17A 2L0TB 2AXZA 1UN8A 3EJNA 2QZAA 4DK5A 2YHCA 3RIBA 2R03A 1INZA 2HM8A 4FLHA 5JHBA 2KBXA 1TJCA 5HI7A 4LEUA 1Z5SC 2CHWA 1Y6IA 2IY0C 3UM0A 3NZUA 4M7CA 4OAUC 5EN5D 4JB8P 1DCEA 2OVBA 3G2UA 3QC1A 5EDSA 2EILE 1OCOE 4DLOA 2FEZA 3D9MA 3UI2A 3CVPA 5ANRA 3ZHEA 5JJTA 3E32A 1MJ0A 2LO6A 2L9BA 4L9PA 2BKKB 3VTYA 5D66A 1NA3A 5ARFA 1VDYA 2RG8A 3JXIA 4Q96A 3G2WA 2EQXA 1S64A 3ZKJA 4TXRA 2R05A 4KYOB 5BXUA 5M72A 2H6GA 4KT6B 3SZ7A 3EIJA 2BUGA 1IKND 4U0SA 3T8MA 3CV0A 1K1BA 4N5CA 3PZ2A 1PY1A 3FULA 5BW8C 2CHZA 1XNFA 4U95D 4IRUA 1ZU2A 2XS1A 3V2OA 3FWVA 1E8YA 3PH0C 2F8YA 3AU4A 2DIWA 2PM7A 3OTNA 1NFIE 3B7BA 2LAHA 4AY5A 4APOA 4L2LA 3ZYQA 4EQFA 2UY1A 4AP2A 3FP3A 3LY7A 3ML8A 1X81A 4C48B 2HYZA 5CRUA 4H7XA 1DC2A 3LKUA 4I1MA 3MGBA 5FQ8A 5T3RA 1HE8A 4A1GA 3CEQA 5ITZF 2V8SE 4AY6A 3IHYA 4J8SA 1DCQA 4FA6A 3ZRHA 3DSWA 3UQ3A 4RLYA 4DX1A 3MZLB 1KT0A 4GYYA 3O48A 3VLEA 2IONA 4ABNA 2RFAA 4EZKA 5KBAA 4DPRA 4EBAG 4V3IA 4GA2A 1BI8B 2Y4UA 3DWLG 5G04C 4JEHA 5LOZA 4PH4B 3L54A 3CHOA 4XZ4A 1O1SA 2ZIRA 3TL5A 2V5QC 3OXLA 3R9AB 2YQ8A 2IQCA 5FZQA 4M3OA 3LEWA 4KVMA 2WB2A 2DZNA 3APDA 4RG6A 3B7TA 4N3BA 5IY5E 5FWQA 5ANLA 3HXFA 4JW1A 3PUJA 1JPLA 1FPPA 1ELKA 4HOUA 2OCCE 1N9AA 2AW6A 4DLQA 1S70B 1KZOA 4KVOA 3U9WA 4BSZB 3FUDA 3CKBA 4UI9C 2WXJA 3RSEG 4LNUD 3HXDA 4J8YA 2BTDA 4I43A 1TNOA 1TN8A 4APFA 3ZFWA 3HHMA 3IHVA 3UINC 2WXKA 3UKUG 1OCRE 3Q15A 1V55E 3FUEA 2V0PA 1FT1A 4XIFA 4N2SA 2OEWA 2ZGGA 5BPPA 2QYUA 3ZN3A 3KEAA 3U66A 1EF1C 3BG1B 4QFVA 5ENQD 3OXFA 4U8VD 2XQ0A 2QFCA 3TWQA 4DJAA 2X6JA 5EIDA 3HDXA 4Y6CA 4UWKA 1N4PA 1N95A 4A1SA 3T9KA 4K5CA 2CHXA 4C9BB 4GCOA 4K5AB 5BV0A 4ACLA 3UPVA 4O1PA 1MYOA 3HVEA 2CFZA 4DI4A 4BESA 4BWRA 1MX2A 2NC9A 3ASNE 2ETCA 3L16A 4PDXA 3C3OA 1ZB1A 4WWPA 3SFZA 4JEUA 1HO8A 5AYWD 1N0RA 4AV7A 4ILHB 4TV3A 5FZRA 5BXOA 5C1DA 1TNUA 3NZSA 1OXJA 3NAWA 1HF8A 1E7UA 3IEGA 3FTWA 2BEDA 2KCLA 3LJ3A 3JXJA 4AM9A 4N39A 4W9RA 2IO2C 4GPKA 3V31A 1JCQA 5BNWA 1OWOA 3MV3B 3DEOA 2VGYA 1HG5A 4J0UA 3CQGB 3ZUVB 2V4HC 3EHQA 2F8XK 1H6PA 2LXLA 3D9OA 5AQAA 5HS0A 4XKBA 2EIME 3AS4A 3RKVA 4OAVB 4UQYA 3TG5A 4LSZE 4B8AA 4MKTA 3V79K 4JPSA 1HG2A 1LF8A 1SW6A 2KM4A 3P1UA 1TNZA 2X3MA 4B89A 2R59A 3N71A 2RKKA 1X5BA 3PZ1A 2B0OE 1MZCA 4U8HA 2R17C 2WQHA 3LS8A 4IYPA 4L2YA 2VGXB 2DBAA 4XEIG 2H6HA 3IBEA 4EPZA 2WXGA 4GZ5A 3JUEA 2L6JA 3ASFA 5JJ7A 4HFGA 3ASDA 4U8YD 1RZ4A 5KNGA 5AIJA 4FC8A 4YVQC 1OCCE 4N5QA 2WXMA 4BSXA 1S0PA 4XE0A 4BY6A 3CVNA 3FUFA 4G24A 4WNFA 3AJIA 1QQEA 4HLLA 2ZU6B 1BLXB 3RRMB 3AU5A 4XI0A 2I2OA 1H2UA 2DWZA 4MS6A 4YDEA 2JEKA 3PZDA 2XHEA 3FEYA 5KNHD 1N4QA 3CQCB 4DX5D 3QDNA 4ANVA 5JA4D 1KPSB 4G8KA 3BUAA 4I9EA 1ELRA 3KAEA 4U7EB 3RAUA 4Q94A 4UI9K 2GRNB 1E7VA 3FH5A 2WXPA 4LG6A 4GTOA 4BX8A 4G26A 4UQXA 2VQ2A 4HOQA 4HORA 4B0ZA 4F6RD 4GMRA 4UWHA 2OVFA 1D8EA 1SA4A 3QB2A 3KD7A 1H0AA 4XKCA 3PNTB 2WMNA 3L17A 5DIZA 4RQIA 2QC9A 2WXNA 1QYMA 3DRAA 3FUIA 3W9FA 1OWLA 3I3NA 1K1AA 2J08A 2EINE 2VTBA 4MBGA 4ILGA 3T8KA 4NRHB 3R7QA 1NL4A 2GGFA 3SO8A 4CYMD 5LCWJ 5G05J 1OWMA 3S2AA 4HQDA 2WVIA 4RVBA 1FCHA 3LCAA 2I9CA 4X8QA 4GTVA 2AXUA 4Z68A 3X2QE 4FHKA 1N4SA 1IYGA 2MRIA 5KJKA 3FU6A 3GZSA 1HH8A 2UY1B 1AWCB 3GYZA 1DNPA 3DXMG 2RD0A 2JLBA 3KSLA 5D0OD 1WY6A 2M63A 3AS5A 3C5RA 1YMPA 4I1OB 4YDOA 3CVWA 4HI9A 2FO1E 4YNDA 3FUMA 3FUNA 3UUXA 4J8EA 5CMWA 3GZ2A 3C3RA 3EHRA 3JYSA 3PZ3A 1Z6TA 3AG3E 1H6OA 3D9LA 5FINA 4UWGA 3MA5A 3U4TA 3PUKA 3HRAA 3HYMB 1NA0A 2F37A 4TXPA 5FQ4A 3SFYA 2PQRA 3MYVA 3Q75A 5ENPD 1G3NB 5FJYA 1E96B 5KWDA 1TEZA 4GB9A 2WXFA 5EX3A 3CK9A 5JMND 5A23A 3HG0D 5JHAA 2OEVA 3DXKG 3SHFA 3ASHA 3FTXA 4YDWA 4CDNA 3SBTB 4DX7D 4BFRA 1FVFA 3LVRE 3AS8A 3ZGQA 4F53A 3D9HA 5AQ7A 4GTSA 3E33A 1JCSA 4ZFHA 3Q49B 4HXIA 4CT0A 4K0RA 2GRLA 3CKCA 1W3BA 3CIAA 2KCVA 4O60A 4YDYA 4NACA 2A5UA 1E90A 3EUVA 2IEJA 4I2ZA 4DI3A 4L7TA 3CVQA 3RO2A 5CBOA 3B7RL 4WUYA 3S7BA 4KXKB 5D0QD 3FU5A 5CEDB 2XEEA 3L22A 5FTPA 4FHJA 1GW6A 5LP0A 1MQSA 3PEUB 2FBNA 1U2VG 3CHQA 1Q2ZA 4ME2A 3APCA 3DSXA 1SZAA 4BT9A 3NOGD 3QJZA 1H19A 2R5SA 2VSYA 1OUVA 5JJ6A 2XGSA 1TN6A 2QY7A 2XRYA 3ASOE 3NF1A 1HX8A 1OY3D 3HVEB 1UG3A 1BI7B 4TRQA 5ENNA 2YNQA 1L5JA 3DBSA 4DRXE 4BX9A 4ZHBA 1EYHA 4WNGA 4FLBA 3ZIMA 3WXXA 4HOSA 5KJMA 5HQ8A 2Q7FA 3SFXA 2KXPC 1UJKA 2WXIA 5G55A 3UM3A 3AG4E 2VJ8A 3ZYKA 4DUIA 1OCZE 1ELWA 4IN3B 4NIKA 4OVUA 1UJJA 1N0QA 1SZ9A 3SBSA 3AG2E 1MX6A 3RRUA 2P58C 5B1BE 3ULEG 1K3ZD 4QQIA 4NURA 3D9NA 4JA7A 5EYLA 2Y3AA 2LNIA 3ML9A 2L6BA 1HXIA 5T4YA 3TWVA 1E8WA 4G1TA 5ARGA 3FTSA 4WWNA 2V4LA 2PM6A 3GW4A 4WNDA 1JCRA 4HRNA 5FT9A 4JD2G 4BEPA 3URZA 3ZXPA 4H7YA 2P2CP 2GRMA 1HU3A 4LCTA 1O1TA 4ATZD 5AQBA 1UN9A 2Y0BG 3NQPA 2ZXWE 4FU3A 3L13A 3FTZA 3RRNB 1BU9A 1OWNA 2KZTB 2VSNA 4JXTA 3L08A 3T5XA 3UT7A 5CCMA 4AEZC 3ZEFA 2C2LA 4GU5A 5BUZA 3PEVB 3B7UX 4GTPA 1LTXA 3Q79A
chains in the Genus database with same CATH topology
4KT6B 3BG0B 3SZ7A 2FO7A 2BUGA 3EIJA 5G04J 3QDNA 3Q47B 4U0SA 4A3VA 5EKQD 3T8MA 3CV0A 3JCKC 3FHEA 2WM9A 4N5CA 4ANVA 3CHRA 4U63A 4AXHA 4CCAA 2CFUA 2X6HA 5A6CA 2WXQA 1PY1A 3FULA 4I9EA 4PS3A 5BW8C 2CHZA 1XNFA 1ELRA 4U04A 1KLXA 1NP7A 1ZU2A 2A4ZA 2UWJG 3KAEA 4IRUA 4Q94A 4UI9K 2CG2A 3FUKA 4KZCA 3RJVA 3KS2A 1E7VA 2BF0X 3D9JA 3TGOA 5FQ6A 1TJFA 4ANUA 3FWVA 3FU3A 3FH5A 2WXPA 1E8YA 3PH0C 1Z3XA 2AWIA 2C0MA 5J90A 3AU4A 5C2YA 2DIWA 3UX4A 1N54A 2PM7A 2J4BA 3DPDA 5EX0A 4BX8A 4I17A 4G26A 3OTNA 4UQXA 2KC7A 4N3AA 4I2WA 2LAHA 4ATGA 2VYIA 2VQ2A 4G2VA 3SD5A 4AY5A 4APOA 3KEZA 4L2LA 2KZTA 4HOQA 3ZYQA 4HORA 4GZ3A 4B0ZA 4LRZA 4EQFA 3FDHA 2I1KA 2UY1A 3ZVVA 4AP2A 2LAIA 4PS7A 3FP3A 5BV1A 2XPIA 3LY7A 3ML8A 4UWHA 3PNLB 2XGMA 2HYZA 2OVFA 4C0EA 3QB2A 4H7XA 3KD7A 3T5VA 4I6GA 3LKUA 4I1MA 3MGBA 5FQ8A 3EDTB 1H0AA 4R7LA 5T3RA 1HE8A 4XKCA 3PNTB 2WMNA 5BT1A 3L17A 4UI9J 5FZSA 3TAXA 4A3TA 5DIZA 4J6IA 4A1GA 3CEQA 3S7FA 3CR3A 1FVHA 2V8SE 4AY6A 2YINA 2WXNA 3IHYA 4J8SA 3CK8A 3MX3A 4IULA 4FA6A 3ZRHA 4GZCA 3UQ3A 3FUIA 1IQUA 1OWPA 3ZYLA 1OWLA 1JWFA 3I3NA 2J08A 4U0UA 4XI9A 4YVOA 3G2VA 2VTBA 4UQZA 3MZLB 4ILGA 1KT0A 4GYYA 4NRHB 3G2SA 2E0IA 1MHQA 3O48A 5LFAA 1HS6A 3VLEA 2IONA 2HR2A 4O6FA 3R7QA 3CGHA 4ABNA 4EZKA 4DPRA 2GGFA 4EBAG 3JQ1A 4GMJA 3ONLA 5LCWJ 4I6EA 1EPUA 4V3IA 5G05J 3QOUA 1OWMA 1B89A 4GA2A 3S2AA 4HVBA 2L0IA 2Y4UA 4ILIA 5G04C 4JEHA 1IHGA 2WVIA 3EHNA 3I4RB 4RVBA 4PH4B 1NZNA 5LOZA 1FCHA 2WQ7A 1PC2A 3ESKA 3L54A 2VSXE 3CHOA 3LCAA 4EZLA 4XZ4A 3VTXA 1QZ2A 3JQ0A 2I9CA 3MCXA 4F3VA 4EBAA 2AXUA 3FH8A 2XPZA 3EHMA 2MHKA 1H6KA 3UMVA 5KJNA 5CHEE 3RK6A 3TL5A 3UT4A 3OXLA 4FHKA 1IYGA 4WAFA 5AENA 3R9AB 1H2TC 3TXNA 2YQ8A 2FF4A 3CLJA 2MRIA 2IQCA 1HFAA 2X6IA 3LEWA 4GZDA 4JHKA 4KVMA 4M3OA 4NQ0A 5FZQA 3ZXSA 5KJKA 2WB2A 3CVYA 5CMYA 3FU6A 3MKRA 3GZSA 1HH8A 2WXOA 3APDA 4RG6A 2UY1B 4A55A 3B7TA 3HIZA 3FEXA 4N3BA 5FWQA 5ANLA 4AJWA 4Q69A 4OYSA 3GZ1A 3FFLA 1P5QA 5FQ7A 3GYZA 4JW1A 2C0LA 3LY8A 1DNPA 1YA0A 4CEMA 5A7DB 2PL2A 3PUJA 2IFUA 1JPLA 1ELKA 2I1JA 2WQ6A 2RD0A 2JLBA 4HOUA 4JC8A 4PUCA 2PZIA 2AW6A 4FJZA 4DLQA 5D0OD 4FJYA 1XGWA 1WY6A 4JZYA 2WPVA 2M63A 4LERA 4KVOA 2NXPA 2FI7A 3U9WA 3D9PA 4RG9A 2OV8A 3AS5A 5DBKA 4F1SA 2ONDA 3FUDA 2AVPA 1Y8MA 3CKBA 4PS8A 4UI9C 2WXJA 5T8IA 3LXUX 4I1OB 3CVWA 3RO3A 2X6KA 2VTBB 2BTDA 4YNDA 3FUMA 4I43A 3ENEA 3FUNA 4WWOA 3UUXA 3CSTA 5KJLA 4GZ6A 1IQRA 3MJWA 4APFA 3TXMA 3K9IA 4J8EA 3HHMA 3ZFWA 4OVVA 4L1BA 3IHVA 4HS2A 1PAQA 2XEVA 3PS6A 3R7RA 2WXKA 3GZ2A 5CMWA 3Q15A 3JYSA 4AIFA 4URKA 1Z6TA 2IF4A 4MLPA 2WXRA 3QWWA 3FUEA 3VLFA 3LVQE 3QNKA 2V0PA 2ILRA 3LDZA 5LCWC 3D9LA 5G05C 4MRUA 4XIFA 4N2SA 3PREA 4UWGA 5BPPA 3SNXA 4HOTA 3MA5A 3U4TA 4JA9A 3PUKA 1BPOA 3RU0A 3QAQA 2OOEA 3MV2B 4I6JA 3LYAA 1HZ4A 2J07A 1NA0A 3HYMB 4J8FA 3ZYMA 4GYOA 3QARA 3ZN3A 2WXHA 4AVXA 3U66A 1E8XA 5FQ4A 2PQRA 3MYVA 4JHRA 1EF1C 3BG1B 3CK7A 2VSOE 4QFVA 3CHMA 3PDNA 2IOSA 4U07A 4G11A 3OXFA 2X38A 5FJYA 1E96B 2XQ0A 2QFCA 3ZPJA 1TEZA 1QNFA 1WAO1 4GB9A 4DJAA 2WXFA 4EZJA 5EX3A 4UWFA 3CK9A 2X6JA 1JWGA 4RSYA 5A23A 2FULA 2V5FA 2XCBA 4ACKA 5JHAA 3QK0A 3HDXA 1H2VC 4TUUA 3E4BA 3FUJA 3SHFA 3ASHA 4Y6CA 4E6HA 1JUQA 4UWKA 4N3CA 1UW4B 4A1SA 3FTXA 3FTVA 3O4ZA 2HO1A 2CHXA 4C9BB 4CDNA 3SBTB 4GCOA 5CCLA 3QKYA 4BFRA 4ACLA 5BV0A 1FVFA 3UPVA 4FP7A 5KCMA 3LVRE 3QWVA 3PVLA 3AS8A 3ZGQA 5LX8A 3HVEA 4F53A 3D3MA 3FTYA 4HLEA 2CFZA 3D9IA 4DI4A 4KZ0A 4CGVA 4BWRA 2XRZA 3Q49B 2MOWA 2J09A 2NC9A 4HXIA 4CGWA 4CT0A 4K0RA 3IKOB 2GRLA 2WMOA 4F7AA 4CDRA 3CKCA 1W3BA 3CIAA 2IU1A 2KCVA 3L16A 4PDXA 4NACA 1DVPA 3Q4AB 4U0ZA 3MKQB 2A5UA 1E90A 4KMOA 2Y4TA 4I1AA 2I6HA 5G2NA 2XCCA 4JL0A 4GA0A 2J9QA 4I2ZA 1EDUA 4DI3A 4J8DA 4L7TA 4WWPA 3SFZA 4JEUA 3CVQA 1HO8A 5AYWD 4AV7A 3RO2A 4ILHB 4BT8A 3CHSA 4TV3A 3OXGA 3B7RL 5FZRA 4CRWA 5C1DA 4P29A 3NZSA 4G23A 4I9CA 3B7SA 4WUYA 5E76A 1ZBPA 3S7BA 4KXKB 3CVLA 5D0QD 3ZW3A 4N2QA 3FU5A 1HF8A 4GAAA 5J08A 3L22A 1E7UA 3IEGA 3FTWA 4FHJA 1GW6A 2KCLA 3PE4A 4JVSA 3LJ3A 5AJDA 5LP0A 1MQSA 3PEUB 2FBNA 4AM9A 2VGXA 3CHQA 3I5PA 4N39A 4W9RA 4UWLA 2AXVA 4GPKA 2J4DA 4ME2A 3SI5A 1OWOA 5BNWA 3APCA 3MV3B 2CG3A 4K03A 1SZAA 4BT9A 3EIQC 3QJZA 3LY9A 1H19A 2YHEA 2R5SA 1HG5A 2VGYA 5FTPA 2VSYA 2LSUA 4J0UA 3CQGB 2GW1A 1OUVA 4D10C 3C98A 4Y6WA 5JJ6A 4ANXA 2NSZA 2XGSA 4GMLA 3G2TA 2QY7A 3P2BA 2XRYA 3ASGA 3ONKA 3D9OA 3PE3A 4WNEA 3FTUA 4XKBA 3D9KA 3FU0A 4GA1A 3FH7A 3NF1A 1Z3YA 1HX8A 3U64A 4B8CB 3AS4A 3HVEB 3MKQA 3RKVA 1UG3A 4UQYA 4TRQA 3TG5A 2IOLA 3IV0A 2YNQA 5ENNA 3FY4A 4G25A 3PRZA 4B8AA 4MKTA 1L5JA 3DBSA 4BX9A 3LPZA 3QWPA 4JPSA 1EYHA 4WNGA 4FLBA 1HG2A 1LF8A 3ULQA 3TG4A 3ZIMA 3UT8A 3SGHA 4GCNA 3WXXA 2KM4A 4CDMA 4HOSA 5KJMA 5HQ8A 2J49A 5AJLA 4BTAA 2Q7FA 3P1UA 2KCKA 4GYWA 3JUIA 1U3DA 3VLDA 2DCPA 1UJKA 2X3MA 4B89A 2R59A 3ZHEB 1KT1A 3N71A 1A17A 2L0TB 2AXZA 2WXIA 1UN8A 3EJNA 1X5BA 5G55A 3Q5MA 4DK5A 2YHCA 3L6AA 2KATA 3BEEA 2VJ8A 3CSFA 3RIBA 4U8HA 2E2EA 3ZYKA 3S7DA 1ELWA 4IN3B 4OVUA 1INZA 1UJJA 2R17C 3SBSA 1SZ9A 2WQHA 3LS8A 2HM8A 3S7JA 2X6FA 1SQMA 4FLHA 3RRUA 5JHBA 2P58C 4LUNU 4IYPA 3U3WA 4L2YA 2VGXB 5E75A 3B13A 1TJCA 2DBAA 5HI7A 4E85A 4XX5A 4LEUA 4EECA 4AOFA 4NURA 3D9NA 4JA7A 2Y3AA 2CHWA 3CVXA 1Y6IA 3IBEA 1U3CA 3MEKA 2WXLA 2LNIA 3ML9A 4EPZA 3NZUA 2WXGA 4GZ5A 1HXIA 2L6JA 5T4YA 3ESLA 3CVVA 1E8WA 3ASFA 5JJ7A 4G1TA 2OVBA 3G2UA 4HFGA 5ARGA 3FTSA 4WWNA 3CHPA 3ASDA 2V4LA 3QC1A 2PM6A 2PQNA 5EDSA 4DLOA 2FEZA 3GW4A 4WNDA 5FT9A 5AIJA 3URZA 3D9MA 3APFA 4H7YA 4B94A 2GRMA 4FC8A 1HU3A 3CVPA 4FULA 5ANRA 4LCTA 4YVQC 3ZHEA 5JJTA 1UN9A 2WXMA 3SF4A 4BSXA 1S0PA 2LO6A 4XE0A 2L9BA 3NQPA 4KBQA 4BY6A 3CVNA 3VTYA 3FUFA 4G24A 4WNFA 4FADA 3CVUA 3OAWA 4FU3A 4BTBA 3L13A 1NA3A 1QQEA 5ARFA 3FTZA 1N52A 3I4GA 4CT4A 1E8ZA 2ZU6B 1VDYA 2IJGX 3RRNB 3RRMB 3AU5A 4JHJA 1OWNA 2RG8A 4XI0A 3FUHA 4Q96A 2KZTB 2VSNA 2I2OA 1H2UA 3G2WA 4JXTA 2EQXA 3L08A 3TJPA 3T5XA 4MS6A 2JEKA 3UT7A 5CCMA 3PZDA 4L23A 3ZEFA 4AEZC 2XGOA 2C2LA 2XHEA 4KYOB 3FEYA 2LSVA 2XPYA 4GU5A 5BUZA 4ANWA 3PEVB 3B7UX 4C0MA 3CQCB 5M72A 1WM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZ7 A;  2FO7 A;  2BUG A;  5G04 J;  3QDN A;  3Q47 B;  4U0S A;  5EKQ D;  3CV0 A;  4N5C A;  5A6C A;  4I9E A;  5BW8 C;  1XNF A;  1ELR A;  4U04 A;  1KLX A;  2UWJ G;  1ZU2 A;  3KAE A;  4UI9 K;  3RJV A;  3KS2 A;  3TGO A;  3FWV A;  2C0M A;  5EX0 A;  4I17 A;  4G26 A;  4UQX A;  2KC7 A;  4N3A A;  4I2W A;  2VYI A;  2VQ2 A;  4G2V A;  4AY5 A;  4APO A;  4HOQ A;  4HOR A;  4GZ3 A;  4EQF A;  2UY1 A;  3FP3 A;  2XPI A;  3LY7 A;  2XGM A;  2HYZ A;  4H7X A;  3KD7 A;  3LKU A;  3EDT B;  5BT1 A;  4UI9 J;  5FZS A;  3TAX A;  5DIZ A;  3CEQ A;  3S7F A;  4AY6 A;  3CK8 A;  3UQ3 A;  4U0U A;  4XI9 A;  4YVO A;  4UQZ A;  1KT0 A;  4GYY A;  4NRH B;  3O48 A;  2HR2 A;  4O6F A;  4ABN A;  5LCW J;  5G05 J;  3QOU A;  1B89 A;  4GA2 A;  2Y4U A;  5G04 C;  1IHG A;  1NZN A;  1FCH A;  1PC2 A;  3ESK A;  3LCA A;  3VTX A;  1QZ2 A;  4F3V A;  2MHK A;  5KJN A;  5CHE E;  3OXL A;  1IYG A;  3R9A B;  2YQ8 A;  2FF4 A;  5FZQ A;  5KJK A;  4NQ0 A;  3MKR A;  1HH8 A;  4RG6 A;  2UY1 B;  4N3B A;  3GZ1 A;  3FFL A;  1P5Q A;  3GYZ A;  2C0L A;  3LY8 A;  1YA0 A;  5A7D B;  2PL2 A;  2IFU A;  4HOU A;  2JLB A;  2PZI A;  5D0O D;  2WPV A;  2FI7 A;  4RG9 A;  3AS5 A;  5DBK A;  2OND A;  2AVP A;  1Y8M A;  3CKB A;  4UI9 C;  3RO3 A;  4YND A;  3UUX A;  5KJL A;  4GZ6 A;  3K9I A;  4J8E A;  3ZFW A;  2XEV A;  3GZ2 A;  3Q15 A;  3JYS A;  4AIF A;  2IF4 A;  3QWW A;  5LCW C;  5G05 C;  4XIF A;  4N2S A;  4HOT A;  3MA5 A;  3U4T A;  4JA9 A;  3RU0 A;  2OOE A;  3MV2 B;  3LYA A;  1HZ4 A;  3HYM B;  1NA0 A;  4J8F A;  4GYO A;  3ZN3 A;  2PQR A;  4JHR A;  3CK7 A;  3PDN A;  4U07 A;  3OXF A;  5FJY A;  1E96 B;  2QFC A;  3ZPJ A;  1WAO 1;  5EX3 A;  3CK9 A;  2V5F A;  2XCB A;  3E4B A;  3ASH A;  4Y6C A;  4N3C A;  4A1S A;  2HO1 A;  4GCO A;  5CCL A;  3QKY A;  3UPV A;  3QWV A;  3AS8 A;  3ZGQ A;  4CGV A;  4BWR A;  3Q49 B;  2NC9 A;  4CGW A;  4CDR A;  3CKC A;  1W3B A;  2KCV A;  3Q4A B;  4U0Z A;  2Y4T A;  4I1A A;  2I6H A;  2XCC A;  4JL0 A;  4GA0 A;  2J9Q A;  4I2Z A;  4J8D A;  3CVQ A;  5AYW D;  3RO2 A;  3OXG A;  5FZR A;  5C1D A;  4G23 A;  4I9C A;  4WUY A;  1ZBP A;  3S7B A;  4KXK B;  3CVL A;  5D0Q D;  4N2Q A;  5FTP A;  3IEG A;  4BT8 A;  3PE4 A;  2KCL A;  2FBN A;  4AM9 A;  2VGX A;  4N39 A;  4W9R A;  4GPK A;  4ME2 A;  5BNW A;  3MV3 B;  4BT9 A;  3LY9 A;  2R5S A;  2VGY A;  2VSY A;  2LSU A;  4J0U A;  2GW1 A;  1OUV A;  4Y6W A;  5JJ6 A;  2XGS A;  3ASG A;  3PE3 A;  4WNE A;  4GA1 A;  3NF1 A;  3AS4 A;  3RKV A;  4UQY A;  3TG5 A;  4G25 A;  3LPZ A;  3QWP A;  4WNG A;  3ULQ A;  3TG4 A;  4GCN A;  3WXX A;  4HOS A;  5KJM A;  5HQ8 A;  4BTA A;  2Q7F A;  2KCK A;  4GYW A;  3ZHE B;  1KT1 A;  3N71 A;  1A17 A;  3Q5M A;  2YHC A;  2KAT A;  3BEE A;  3RIB A;  2E2E A;  3S7D A;  1ELW A;  4IN3 B;  2WQH A;  3S7J A;  2P58 C;  3U3W A;  2VGX B;  1TJC A;  2DBA A;  5HI7 A;  4LEU A;  4JA7 A;  3MEK A;  2LNI A;  4GZ5 A;  1HXI A;  2L6J A;  3ASF A;  5JJ7 A;  4G1T A;  5ARG A;  3ASD A;  2PQN A;  2FEZ A;  3GW4 A;  4WND A;  5FT9 A;  3URZ A;  4H7Y A;  4B94 A;  3CVP A;  3ZHE A;  4YVQ C;  5JJT A;  3SF4 A;  4KBQ A;  3CVN A;  3VTY A;  4G24 A;  4WNF A;  4BTB A;  1NA3 A;  1QQE A;  5ARF A;  4XI0 A;  2VSN A;  5CCM A;  2XGO A;  2C2L A;  4KYO B;  2LSV A;  5M72 A;  1WM5 A; 
#chains in the Genus database with same CATH topology
 3BG0 B;  2FO7 A;  3ABK E;  4A3V A;  5EKQ D;  3JCK C;  2DZO A;  3FHE A;  5CER B;  2WM9 A;  2DYS E;  4GTQ A;  4U63 A;  5A6C A;  2WXQ A;  4B93 B;  4U04 A;  1KLX A;  1NP7 A;  2A4Z A;  2CG2 A;  3RJV A;  3D9J A;  2BF0 X;  5FQ6 A;  1TJF A;  2GRP B;  3UM2 A;  2P9K G;  3FU3 A;  2C0M A;  3UX4 A;  2J4B A;  3DPD A;  3ABM E;  1O1R A;  4N3A A;  2VYI A;  4G2V A;  3SD5 A;  3KEZ A;  2KZT A;  3FDH A;  2P9N G;  3ZVV A;  1AP7 A;  4PS7 A;  2XPI A;  3PNL B;  2XGM A;  4HBD A;  4HRM B;  3T5V A;  5ENR D;  3Q73 A;  5FZS A;  3PZ4 A;  3TAX A;  4A3T A;  5D2M C;  1FVH A;  1YYH A;  1KZP A;  2YIN A;  3MX3 A;  1OWP A;  3ZYL A;  4U0U A;  1JWF A;  2GRR B;  2PNN A;  3G2S A;  2E0I A;  3B95 A;  1OT8 A;  1HS6 A;  4O6F A;  3ONL A;  4I6E A;  4HVB A;  2L0I A;  4ILI A;  3EHN A;  2XEH A;  1NZN A;  3Q9U C;  2J8S D;  3MCX A;  4EBA A;  3FH8 A;  2XPZ A;  2MHK A;  1H6K A;  5KJN A;  3UT4 A;  3BQO A;  4WAF A;  3TXN A;  1NI1 A;  3CLJ A;  1HFA A;  4JHK A;  4UUC A;  3CVY A;  3MKR A;  1SA5 A;  2WXO A;  4A55 A;  3FEX A;  4AJW A;  4Q69 A;  4OYS A;  3LY8 A;  1YCS B;  4CEM A;  5A7D B;  2IFU A;  3DEP A;  2WQ6 A;  4PUC A;  4FJZ A;  1BD8 A;  4JZY A;  2F0Y A;  2WPV A;  3Q78 A;  4LER A;  3D9P A;  5CBN A;  5AQ9 A;  2NYJ A;  5DBK A;  4F1S A;  2OND A;  2AVP A;  1Y8M A;  5T8I A;  3LXU X;  1O5M A;  2VTB B;  4WWO A;  4GZ6 A;  3MJW A;  3TXM A;  4OVV A;  4L1B A;  3J5Q B;  3WG7 E;  3R7R A;  2XEV A;  3NBN B;  3C3Q A;  4URK A;  2IF4 A;  4MLP A;  3VLF A;  5LCW C;  5G05 C;  4MRU A;  3SNX A;  2DVW A;  4HOT A;  4JA9 A;  1BPO A;  3RU0 A;  2GRO B;  3LYA A;  1HZ4 A;  3ZYM A;  3QAR A;  2WXH A;  1E8X A;  1TR4 A;  2VSO E;  2IOS A;  4G11 A;  3KSQ A;  3NOC D;  1WAO 1;  4EZJ A;  2RFM A;  3DPY A;  1JWG A;  2FUL A;  1LD8 A;  2XCB A;  3QK0 A;  1H2V C;  2XS8 A;  1D8D A;  5H7P A;  3FUJ A;  4N3C A;  2XZT G;  3O4Z A;  2HO1 A;  2H6I A;  5KCM A;  3QWV A;  3D3M A;  3D9I A;  4KZ0 A;  2DYR E;  2XRZ A;  4TUM A;  4CGW A;  1TN7 A;  2WMO A;  3DSU A;  4CDR A;  3C72 A;  4O1O A;  1DVP A;  4U0Z A;  5G2N A;  2XCC A;  4JL0 A;  4GA0 A;  2GRQ B;  2J9Q A;  3OXG A;  4I9C A;  4HB5 A;  2ETB A;  1IHB A;  3ULY A;  5J08 A;  4GAA A;  4F1P A;  4K5B A;  3PE4 A;  2MYO A;  4JVS A;  5AJD A;  2AJA A;  3I5P A;  3TWS A;  3SI5 A;  1N4R A;  2CG3 A;  4TXQ A;  3EIQ C;  1D9S A;  3LY9 A;  3V30 A;  2LSU A;  2GW1 A;  4D10 C;  3F6Q A;  1K8K G;  4ANX A;  3EU9 A;  4GML A;  2P9I G;  3Q7F A;  3PE3 A;  3HXC A;  4BER A;  3FTU A;  3FU0 A;  3FH7 A;  1UOH A;  1Z3Y A;  4B8C B;  3SQV A;  3FY4 A;  5B3S E;  3LPZ A;  3QWP A;  3SGH A;  4CDM A;  4GPM A;  2J49 A;  5AJL A;  2KCK A;  4GYW A;  2DCP A;  1KT1 A;  3Q5M A;  3SY2 A;  3L6A A;  2KAT A;  3BEE A;  3CSF A;  3ISM C;  2E2E A;  3S7D A;  3S7J A;  2X6F A;  1SQM A;  4HI8 A;  4LUN U;  3U3W A;  5E75 A;  3B13 A;  4E85 A;  4XX5 A;  4EEC A;  4AOF A;  3CVX A;  1U3C A;  3MEK A;  2WXL A;  3UM1 A;  4DX2 A;  5EIL A;  1TNY A;  3HXB A;  1RW2 A;  3ESL A;  3CVV A;  4HRL A;  2R2L A;  3CHP A;  3AAA C;  2PQN A;  3DSS A;  5EYP F;  2EIJ E;  2XZD G;  3APF A;  4GTR A;  1SVX A;  4B94 A;  4FUL A;  2Y1L E;  3SF4 A;  4KBQ A;  3DST A;  5ENO D;  4FAD A;  3CVU A;  3OAW A;  4BTB A;  1N52 A;  3I4G A;  4CT4 A;  1E8Z A;  2IJG X;  4JHJ A;  3FUH A;  1WDY A;  3TJP A;  4L23 A;  2XGO A;  3EU5 A;  3TWU A;  2LSV A;  2XPY A;  4ANW A;  4C0M A;  1WM5 A;  2ZIS A;  5G04 J;  3Q47 B;  3CHR A;  4AXH A;  4CCA A;  2CFU A;  2X6H A;  3LJN A;  3NB2 A;  4PS3 A;  3L9T A;  2UWJ G;  2H6F A;  3FUK A;  4KZC A;  3KS2 A;  3TGO A;  3UIP C;  4ANU A;  1Z3X A;  2AWI A;  5J90 A;  4G8L A;  5C2Y A;  1N54 A;  5EX0 A;  4I17 A;  2KC7 A;  3HXE A;  5AAR A;  4I2W A;  4ATG A;  4GZ3 A;  4LRZ A;  2I1K A;  5BV1 A;  2LAI A;  3R9M A;  4C0E A;  4I6G A;  3EDT B;  4R7L A;  5BT1 A;  4UI9 J;  4HNA D;  4J6I A;  3S7F A;  1N94 A;  3CR3 A;  3CK8 A;  4IUL A;  5FIO A;  4GZC A;  1IQU A;  4XI9 A;  4YVO A;  3UIO C;  1QBQ A;  3G2V A;  2HE0 A;  4UQZ A;  1MHQ A;  5LFA A;  2HR2 A;  3CGH A;  2BKG A;  3JQ1 A;  4GMJ A;  1EPU A;  3QOU A;  1B89 A;  2EIK E;  3V2X A;  1IHG A;  3I4R B;  2IO3 C;  3ZU7 B;  2WQ7 A;  3TWR A;  1PC2 A;  3ESK A;  2VSX E;  2ETA A;  4EZL A;  3VTX A;  1QZ2 A;  3JQ0 A;  4F3V A;  3EHM A;  3UMV A;  5CHE E;  3RK6 A;  5CEC B;  2LXM A;  5AEN A;  1H2T C;  2FF4 A;  2X6I A;  3ZXS A;  4GZD A;  4NQ0 A;  3UKR G;  5CMY A;  3HIZ A;  2R02 A;  5FQ7 A;  3GZ1 A;  3FFL A;  1P5Q A;  4J7W A;  2C0L A;  1YA0 A;  2P9S G;  2PL2 A;  1TYQ G;  2I1J A;  3UXG A;  4JC8 A;  1LD7 A;  2PZI A;  2Y69 E;  4FJY A;  2VGE A;  1XGW A;  2NXP A;  2FI7 A;  4RG9 A;  2OV8 A;  2A5E A;  4PS8 A;  3W9G A;  4LNB A;  2XEN A;  3RO3 A;  2X6K A;  2ZGD A;  5CEA A;  3L82 A;  3ENE A;  3CST A;  5KJL A;  1IQR A;  3UTM A;  3K9I A;  4HS2 A;  1PAQ A;  3PS6 A;  4CZ2 D;  4AIF A;  2WXR A;  5ENT D;  3QWW A;  5EIB E;  4BET A;  3LVQ E;  3QNK A;  2ILR A;  3LDZ A;  3PRE A;  5ENS D;  3J5P A;  3QAQ A;  2OOE A;  3MV2 B;  4I6J A;  2J07 A;  4J8F A;  4GYO A;  4AVX A;  1FT2 A;  2QYJ A;  3IXE A;  4JHR A;  3CK7 A;  3CHM A;  3PDN A;  4U07 A;  2X38 A;  3ZPJ A;  1QNF A;  5AAO A;  3TWT A;  2P9U G;  1TNB A;  4UWF A;  4RSY A;  2V5F A;  4ACK A;  4TUU A;  3E4B A;  4E6H A;  1JUQ A;  1UW4 B;  3FTV A;  5CCL A;  3QKY A;  4FP7 A;  3PVL A;  5LX8 A;  2LUH A;  3FTY A;  4HLE A;  1V54 E;  4CGV A;  3ABL E;  2MOW A;  2J09 A;  3IKO B;  3Q7A A;  4F7A A;  2IU1 A;  3E37 A;  3Q4A B;  1MX4 A;  3MKQ B;  4KMO A;  2Y4T A;  3DSV A;  2I6H A;  4I1A A;  2P9P G;  1EDU A;  3TWX A;  4J8D A;  4A63 B;  3CHS A;  4CRW A;  4P29 A;  4G23 A;  3B7S A;  3E30 A;  5E76 A;  1ZBP A;  3ZW3 A;  2JAB A;  3CVL A;  5AN8 A;  4N2Q A;  4BT8 A;  4DX6 D;  2VGX A;  5B1A E;  4UWL A;  2AXV A;  2J4D A;  1N11 A;  5CRV A;  1IXV A;  4K03 A;  4EHM A;  4GTT A;  3BU8 A;  5HKP A;  2YHE A;  1S63 A;  3C98 A;  1WG0 A;  4Y6W A;  2NSZ A;  3G2T A;  3P2B A;  3ASG A;  3ONK A;  4GTM A;  4WNE A;  3D9K A;  3E34 A;  4GA1 A;  4LNG A;  3U64 A;  5HRY A;  3MKQ A;  1A5E A;  3ZNG A;  2IOL A;  3IV0 A;  4G25 A;  3PRZ A;  3ULQ A;  3TG4 A;  3UT8 A;  4U96 D;  4GCN A;  2B6C A;  3AG1 E;  2P9L G;  4BTA A;  3JUI A;  1U3D A;  3VLD A;  3Q9N C;  3ZHE B;  3TWW A;  1A17 A;  2L0T B;  2AXZ A;  1UN8 A;  3EJN A;  2QZA A;  4DK5 A;  2YHC A;  3RIB A;  2R03 A;  1INZ A;  2HM8 A;  4FLH A;  5JHB A;  2KBX A;  1TJC A;  5HI7 A;  4LEU A;  1Z5S C;  2CHW A;  1Y6I A;  2IY0 C;  3UM0 A;  3NZU A;  4M7C A;  4OAU C;  5EN5 D;  4JB8 P;  1DCE A;  2OVB A;  3G2U A;  3QC1 A;  5EDS A;  2EIL E;  1OCO E;  4DLO A;  2FEZ A;  3D9M A;  3UI2 A;  3CVP A;  5ANR A;  3ZHE A;  5JJT A;  3E32 A;  1MJ0 A;  2LO6 A;  2L9B A;  4L9P A;  2BKK B;  3VTY A;  5D66 A;  1NA3 A;  5ARF A;  1VDY A;  2RG8 A;  3JXI A;  4Q96 A;  3G2W A;  2EQX A;  1S64 A;  3ZKJ A;  4TXR A;  2R05 A;  4KYO B;  5BXU A;  5M72 A;  2H6G A;  4KT6 B;  3SZ7 A;  3EIJ A;  2BUG A;  1IKN D;  4U0S A;  3T8M A;  3CV0 A;  1K1B A;  4N5C A;  3PZ2 A;  1PY1 A;  3FUL A;  5BW8 C;  2CHZ A;  1XNF A;  4U95 D;  4IRU A;  1ZU2 A;  2XS1 A;  3V2O A;  3FWV A;  1E8Y A;  3PH0 C;  2F8Y A;  3AU4 A;  2DIW A;  2PM7 A;  3OTN A;  1NFI E;  3B7B A;  2LAH A;  4AY5 A;  4APO A;  4L2L A;  3ZYQ A;  4EQF A;  2UY1 A;  4AP2 A;  3FP3 A;  3LY7 A;  3ML8 A;  1X81 A;  4C48 B;  2HYZ A;  5CRU A;  4H7X A;  1DC2 A;  3LKU A;  4I1M A;  3MGB A;  5FQ8 A;  5T3R A;  1HE8 A;  4A1G A;  3CEQ A;  5ITZ F;  2V8S E;  4AY6 A;  3IHY A;  4J8S A;  1DCQ A;  4FA6 A;  3ZRH A;  3DSW A;  3UQ3 A;  4RLY A;  4DX1 A;  3MZL B;  1KT0 A;  4GYY A;  3O48 A;  3VLE A;  2ION A;  4ABN A;  2RFA A;  4EZK A;  5KBA A;  4DPR A;  4EBA G;  4V3I A;  4GA2 A;  1BI8 B;  2Y4U A;  3DWL G;  5G04 C;  4JEH A;  5LOZ A;  4PH4 B;  3L54 A;  3CHO A;  4XZ4 A;  1O1S A;  2ZIR A;  3TL5 A;  2V5Q C;  3OXL A;  3R9A B;  2YQ8 A;  2IQC A;  5FZQ A;  4M3O A;  3LEW A;  4KVM A;  2WB2 A;  2DZN A;  3APD A;  4RG6 A;  3B7T A;  4N3B A;  5IY5 E;  5FWQ A;  5ANL A;  3HXF A;  4JW1 A;  3PUJ A;  1JPL A;  1FPP A;  1ELK A;  4HOU A;  2OCC E;  1N9A A;  2AW6 A;  4DLQ A;  1S70 B;  1KZO A;  4KVO A;  3U9W A;  4BSZ B;  3FUD A;  3CKB A;  4UI9 C;  2WXJ A;  3RSE G;  4LNU D;  3HXD A;  4J8Y A;  2BTD A;  4I43 A;  1TNO A;  1TN8 A;  4APF A;  3ZFW A;  3HHM A;  3IHV A;  3UIN C;  2WXK A;  3UKU G;  1OCR E;  3Q15 A;  1V55 E;  3FUE A;  2V0P A;  1FT1 A;  4XIF A;  4N2S A;  2OEW A;  2ZGG A;  5BPP A;  2QYU A;  3ZN3 A;  3KEA A;  3U66 A;  1EF1 C;  3BG1 B;  4QFV A;  5ENQ D;  3OXF A;  4U8V D;  2XQ0 A;  2QFC A;  3TWQ A;  4DJA A;  2X6J A;  5EID A;  3HDX A;  4Y6C A;  4UWK A;  1N4P A;  1N95 A;  4A1S A;  3T9K A;  4K5C A;  2CHX A;  4C9B B;  4GCO A;  4K5A B;  5BV0 A;  4ACL A;  3UPV A;  4O1P A;  1MYO A;  3HVE A;  2CFZ A;  4DI4 A;  4BES A;  4BWR A;  1MX2 A;  2NC9 A;  3ASN E;  2ETC A;  3L16 A;  4PDX A;  3C3O A;  1ZB1 A;  4WWP A;  3SFZ A;  4JEU A;  1HO8 A;  5AYW D;  1N0R A;  4AV7 A;  4ILH B;  4TV3 A;  5FZR A;  5BXO A;  5C1D A;  1TNU A;  3NZS A;  1OXJ A;  3NAW A;  1HF8 A;  1E7U A;  3IEG A;  3FTW A;  2BED A;  2KCL A;  3LJ3 A;  3JXJ A;  4AM9 A;  4N39 A;  4W9R A;  2IO2 C;  4GPK A;  3V31 A;  1JCQ A;  5BNW A;  1OWO A;  3MV3 B;  3DEO A;  2VGY A;  1HG5 A;  4J0U A;  3CQG B;  3ZUV B;  2V4H C;  3EHQ A;  2F8X K;  1H6P A;  2LXL A;  3D9O A;  5AQA A;  5HS0 A;  4XKB A;  2EIM E;  3AS4 A;  3RKV A;  4OAV B;  4UQY A;  3TG5 A;  4LSZ E;  4B8A A;  4MKT A;  3V79 K;  4JPS A;  1HG2 A;  1LF8 A;  1SW6 A;  2KM4 A;  3P1U A;  1TNZ A;  2X3M A;  4B89 A;  2R59 A;  3N71 A;  2RKK A;  1X5B A;  3PZ1 A;  2B0O E;  1MZC A;  4U8H A;  2R17 C;  2WQH A;  3LS8 A;  4IYP A;  4L2Y A;  2VGX B;  2DBA A;  4XEI G;  2H6H A;  3IBE A;  4EPZ A;  2WXG A;  4GZ5 A;  3JUE A;  2L6J A;  3ASF A;  5JJ7 A;  4HFG A;  3ASD A;  4U8Y D;  1RZ4 A;  5KNG A;  5AIJ A;  4FC8 A;  4YVQ C;  1OCC E;  4N5Q A;  2WXM A;  4BSX A;  1S0P A;  4XE0 A;  4BY6 A;  3CVN A;  3FUF A;  4G24 A;  4WNF A;  3AJI A;  1QQE A;  4HLL A;  2ZU6 B;  1BLX B;  3RRM B;  3AU5 A;  4XI0 A;  2I2O A;  1H2U A;  2DWZ A;  4MS6 A;  4YDE A;  2JEK A;  3PZD A;  2XHE A;  3FEY A;  5KNH D;  1N4Q A;  3CQC B;  4DX5 D;  3QDN A;  4ANV A;  5JA4 D;  1KPS B;  4G8K A;  3BUA A;  4I9E A;  1ELR A;  3KAE A;  4U7E B;  3RAU A;  4Q94 A;  4UI9 K;  2GRN B;  1E7V A;  3FH5 A;  2WXP A;  4LG6 A;  4GTO A;  4BX8 A;  4G26 A;  4UQX A;  2VQ2 A;  4HOQ A;  4HOR A;  4B0Z A;  4F6R D;  4GMR A;  4UWH A;  2OVF A;  1D8E A;  1SA4 A;  3QB2 A;  3KD7 A;  1H0A A;  4XKC A;  3PNT B;  2WMN A;  3L17 A;  5DIZ A;  4RQI A;  2QC9 A;  2WXN A;  1QYM A;  3DRA A;  3FUI A;  3W9F A;  1OWL A;  3I3N A;  1K1A A;  2J08 A;  2EIN E;  2VTB A;  4MBG A;  4ILG A;  3T8K A;  4NRH B;  3R7Q A;  1NL4 A;  2GGF A;  3SO8 A;  4CYM D;  5LCW J;  5G05 J;  1OWM A;  3S2A A;  4HQD A;  2WVI A;  4RVB A;  1FCH A;  3LCA A;  2I9C A;  4X8Q A;  4GTV A;  2AXU A;  4Z68 A;  3X2Q E;  4FHK A;  1N4S A;  1IYG A;  2MRI A;  5KJK A;  3FU6 A;  3GZS A;  1HH8 A;  2UY1 B;  1AWC B;  3GYZ A;  1DNP A;  3DXM G;  2RD0 A;  2JLB A;  3KSL A;  5D0O D;  1WY6 A;  2M63 A;  3AS5 A;  3C5R A;  1YMP A;  4I1O B;  4YDO A;  3CVW A;  4HI9 A;  2FO1 E;  4YND A;  3FUM A;  3FUN A;  3UUX A;  4J8E A;  5CMW A;  3GZ2 A;  3C3R A;  3EHR A;  3JYS A;  3PZ3 A;  1Z6T A;  3AG3 E;  1H6O A;  3D9L A;  5FIN A;  4UWG A;  3MA5 A;  3U4T A;  3PUK A;  3HRA A;  3HYM B;  1NA0 A;  2F37 A;  4TXP A;  5FQ4 A;  3SFY A;  2PQR A;  3MYV A;  3Q75 A;  5ENP D;  1G3N B;  5FJY A;  1E96 B;  5KWD A;  1TEZ A;  4GB9 A;  2WXF A;  5EX3 A;  3CK9 A;  5JMN D;  5A23 A;  3HG0 D;  5JHA A;  2OEV A;  3DXK G;  3SHF A;  3ASH A;  3FTX A;  4YDW A;  4CDN A;  3SBT B;  4DX7 D;  4BFR A;  1FVF A;  3LVR E;  3AS8 A;  3ZGQ A;  4F53 A;  3D9H A;  5AQ7 A;  4GTS A;  3E33 A;  1JCS A;  4ZFH A;  3Q49 B;  4HXI A;  4CT0 A;  4K0R A;  2GRL A;  3CKC A;  1W3B A;  3CIA A;  2KCV A;  4O60 A;  4YDY A;  4NAC A;  2A5U A;  1E90 A;  3EUV A;  2IEJ A;  4I2Z A;  4DI3 A;  4L7T A;  3CVQ A;  3RO2 A;  5CBO A;  3B7R L;  4WUY A;  3S7B A;  4KXK B;  5D0Q D;  3FU5 A;  5CED B;  2XEE A;  3L22 A;  5FTP A;  4FHJ A;  1GW6 A;  5LP0 A;  1MQS A;  3PEU B;  2FBN A;  1U2V G;  3CHQ A;  1Q2Z A;  4ME2 A;  3APC A;  3DSX A;  1SZA A;  4BT9 A;  3NOG D;  3QJZ A;  1H19 A;  2R5S A;  2VSY A;  1OUV A;  5JJ6 A;  2XGS A;  1TN6 A;  2QY7 A;  2XRY A;  3ASO E;  3NF1 A;  1HX8 A;  1OY3 D;  3HVE B;  1UG3 A;  1BI7 B;  4TRQ A;  5ENN A;  2YNQ A;  1L5J A;  3DBS A;  4DRX E;  4BX9 A;  4ZHB A;  1EYH A;  4WNG A;  4FLB A;  3ZIM A;  3WXX A;  4HOS A;  5KJM A;  5HQ8 A;  2Q7F A;  3SFX A;  2KXP C;  1UJK A;  2WXI A;  5G55 A;  3UM3 A;  3AG4 E;  2VJ8 A;  3ZYK A;  4DUI A;  1OCZ E;  1ELW A;  4IN3 B;  4NIK A;  4OVU A;  1UJJ A;  1N0Q A;  1SZ9 A;  3SBS A;  3AG2 E;  1MX6 A;  3RRU A;  2P58 C;  5B1B E;  3ULE G;  1K3Z D;  4QQI A;  4NUR A;  3D9N A;  4JA7 A;  5EYL A;  2Y3A A;  2LNI A;  3ML9 A;  2L6B A;  1HXI A;  5T4Y A;  3TWV A;  1E8W A;  4G1T A;  5ARG A;  3FTS A;  4WWN A;  2V4L A;  2PM6 A;  3GW4 A;  4WND A;  1JCR A;  4HRN A;  5FT9 A;  4JD2 G;  4BEP A;  3URZ A;  3ZXP A;  4H7Y A;  2P2C P;  2GRM A;  1HU3 A;  4LCT A;  1O1T A;  4ATZ D;  5AQB A;  1UN9 A;  2Y0B G;  3NQP A;  2ZXW E;  4FU3 A;  3L13 A;  3FTZ A;  3RRN B;  1BU9 A;  1OWN A;  2KZT B;  2VSN A;  4JXT A;  3L08 A;  3T5X A;  3UT7 A;  5CCM A;  4AEZ C;  3ZEF A;  2C2L A;  4GU5 A;  5BUZ A;  3PEV B;  3B7U X;  4GTP A;  1LTX A;  3Q79 A; 
#chains in the Genus database with same CATH homology
 4KT6 B;  3BG0 B;  3SZ7 A;  2FO7 A;  2BUG A;  3EIJ A;  5G04 J;  3QDN A;  3Q47 B;  4U0S A;  4A3V A;  5EKQ D;  3T8M A;  3CV0 A;  3JCK C;  3FHE A;  2WM9 A;  4N5C A;  4ANV A;  3CHR A;  4U63 A;  4AXH A;  4CCA A;  2CFU A;  2X6H A;  5A6C A;  2WXQ A;  1PY1 A;  3FUL A;  4I9E A;  4PS3 A;  5BW8 C;  2CHZ A;  1XNF A;  1ELR A;  4U04 A;  1KLX A;  1NP7 A;  1ZU2 A;  2A4Z A;  2UWJ G;  3KAE A;  4IRU A;  4Q94 A;  4UI9 K;  2CG2 A;  3FUK A;  4KZC A;  3RJV A;  3KS2 A;  1E7V A;  2BF0 X;  3D9J A;  3TGO A;  5FQ6 A;  1TJF A;  4ANU A;  3FWV A;  3FU3 A;  3FH5 A;  2WXP A;  1E8Y A;  3PH0 C;  1Z3X A;  2AWI A;  2C0M A;  5J90 A;  3AU4 A;  5C2Y A;  2DIW A;  3UX4 A;  1N54 A;  2PM7 A;  2J4B A;  3DPD A;  5EX0 A;  4BX8 A;  4I17 A;  4G26 A;  3OTN A;  4UQX A;  2KC7 A;  4N3A A;  4I2W A;  2LAH A;  4ATG A;  2VYI A;  2VQ2 A;  4G2V A;  3SD5 A;  4AY5 A;  4APO A;  3KEZ A;  4L2L A;  2KZT A;  4HOQ A;  3ZYQ A;  4HOR A;  4GZ3 A;  4B0Z A;  4LRZ A;  4EQF A;  3FDH A;  2I1K A;  2UY1 A;  3ZVV A;  4AP2 A;  2LAI A;  4PS7 A;  3FP3 A;  5BV1 A;  2XPI A;  3LY7 A;  3ML8 A;  4UWH A;  3PNL B;  2XGM A;  2HYZ A;  2OVF A;  4C0E A;  3QB2 A;  4H7X A;  3KD7 A;  3T5V A;  4I6G A;  3LKU A;  4I1M A;  3MGB A;  5FQ8 A;  3EDT B;  1H0A A;  4R7L A;  5T3R A;  1HE8 A;  4XKC A;  3PNT B;  2WMN A;  5BT1 A;  3L17 A;  4UI9 J;  5FZS A;  3TAX A;  4A3T A;  5DIZ A;  4J6I A;  4A1G A;  3CEQ A;  3S7F A;  3CR3 A;  1FVH A;  2V8S E;  4AY6 A;  2YIN A;  2WXN A;  3IHY A;  4J8S A;  3CK8 A;  3MX3 A;  4IUL A;  4FA6 A;  3ZRH A;  4GZC A;  3UQ3 A;  3FUI A;  1IQU A;  1OWP A;  3ZYL A;  1OWL A;  1JWF A;  3I3N A;  2J08 A;  4U0U A;  4XI9 A;  4YVO A;  3G2V A;  2VTB A;  4UQZ A;  3MZL B;  4ILG A;  1KT0 A;  4GYY A;  4NRH B;  3G2S A;  2E0I A;  1MHQ A;  3O48 A;  5LFA A;  1HS6 A;  3VLE A;  2ION A;  2HR2 A;  4O6F A;  3R7Q A;  3CGH A;  4ABN A;  4EZK A;  4DPR A;  2GGF A;  4EBA G;  3JQ1 A;  4GMJ A;  3ONL A;  5LCW J;  4I6E A;  1EPU A;  4V3I A;  5G05 J;  3QOU A;  1OWM A;  1B89 A;  4GA2 A;  3S2A A;  4HVB A;  2L0I A;  2Y4U A;  4ILI A;  5G04 C;  4JEH A;  1IHG A;  2WVI A;  3EHN A;  3I4R B;  4RVB A;  4PH4 B;  1NZN A;  5LOZ A;  1FCH A;  2WQ7 A;  1PC2 A;  3ESK A;  3L54 A;  2VSX E;  3CHO A;  3LCA A;  4EZL A;  4XZ4 A;  3VTX A;  1QZ2 A;  3JQ0 A;  2I9C A;  3MCX A;  4F3V A;  4EBA A;  2AXU A;  3FH8 A;  2XPZ A;  3EHM A;  2MHK A;  1H6K A;  3UMV A;  5KJN A;  5CHE E;  3RK6 A;  3TL5 A;  3UT4 A;  3OXL A;  4FHK A;  1IYG A;  4WAF A;  5AEN A;  3R9A B;  1H2T C;  3TXN A;  2YQ8 A;  2FF4 A;  3CLJ A;  2MRI A;  2IQC A;  1HFA A;  2X6I A;  3LEW A;  4GZD A;  4JHK A;  4KVM A;  4M3O A;  4NQ0 A;  5FZQ A;  3ZXS A;  5KJK A;  2WB2 A;  3CVY A;  5CMY A;  3FU6 A;  3MKR A;  3GZS A;  1HH8 A;  2WXO A;  3APD A;  4RG6 A;  2UY1 B;  4A55 A;  3B7T A;  3HIZ A;  3FEX A;  4N3B A;  5FWQ A;  5ANL A;  4AJW A;  4Q69 A;  4OYS A;  3GZ1 A;  3FFL A;  1P5Q A;  5FQ7 A;  3GYZ A;  4JW1 A;  2C0L A;  3LY8 A;  1DNP A;  1YA0 A;  4CEM A;  5A7D B;  2PL2 A;  3PUJ A;  2IFU A;  1JPL A;  1ELK A;  2I1J A;  2WQ6 A;  2RD0 A;  2JLB A;  4HOU A;  4JC8 A;  4PUC A;  2PZI A;  2AW6 A;  4FJZ A;  4DLQ A;  5D0O D;  4FJY A;  1XGW A;  1WY6 A;  4JZY A;  2WPV A;  2M63 A;  4LER A;  4KVO A;  2NXP A;  2FI7 A;  3U9W A;  3D9P A;  4RG9 A;  2OV8 A;  3AS5 A;  5DBK A;  4F1S A;  2OND A;  3FUD A;  2AVP A;  1Y8M A;  3CKB A;  4PS8 A;  4UI9 C;  2WXJ A;  5T8I A;  3LXU X;  4I1O B;  3CVW A;  3RO3 A;  2X6K A;  2VTB B;  2BTD A;  4YND A;  3FUM A;  4I43 A;  3ENE A;  3FUN A;  4WWO A;  3UUX A;  3CST A;  5KJL A;  4GZ6 A;  1IQR A;  3MJW A;  4APF A;  3TXM A;  3K9I A;  4J8E A;  3HHM A;  3ZFW A;  4OVV A;  4L1B A;  3IHV A;  4HS2 A;  1PAQ A;  2XEV A;  3PS6 A;  3R7R A;  2WXK A;  3GZ2 A;  5CMW A;  3Q15 A;  3JYS A;  4AIF A;  4URK A;  1Z6T A;  2IF4 A;  4MLP A;  2WXR A;  3QWW A;  3FUE A;  3VLF A;  3LVQ E;  3QNK A;  2V0P A;  2ILR A;  3LDZ A;  5LCW C;  3D9L A;  5G05 C;  4MRU A;  4XIF A;  4N2S A;  3PRE A;  4UWG A;  5BPP A;  3SNX A;  4HOT A;  3MA5 A;  3U4T A;  4JA9 A;  3PUK A;  1BPO A;  3RU0 A;  3QAQ A;  2OOE A;  3MV2 B;  4I6J A;  3LYA A;  1HZ4 A;  2J07 A;  1NA0 A;  3HYM B;  4J8F A;  3ZYM A;  4GYO A;  3QAR A;  3ZN3 A;  2WXH A;  4AVX A;  3U66 A;  1E8X A;  5FQ4 A;  2PQR A;  3MYV A;  4JHR A;  1EF1 C;  3BG1 B;  3CK7 A;  2VSO E;  4QFV A;  3CHM A;  3PDN A;  2IOS A;  4U07 A;  4G11 A;  3OXF A;  2X38 A;  5FJY A;  1E96 B;  2XQ0 A;  2QFC A;  3ZPJ A;  1TEZ A;  1QNF A;  1WAO 1;  4GB9 A;  4DJA A;  2WXF A;  4EZJ A;  5EX3 A;  4UWF A;  3CK9 A;  2X6J A;  1JWG A;  4RSY A;  5A23 A;  2FUL A;  2V5F A;  2XCB A;  4ACK A;  5JHA A;  3QK0 A;  3HDX A;  1H2V C;  4TUU A;  3E4B A;  3FUJ A;  3SHF A;  3ASH A;  4Y6C A;  4E6H A;  1JUQ A;  4UWK A;  4N3C A;  1UW4 B;  4A1S A;  3FTX A;  3FTV A;  3O4Z A;  2HO1 A;  2CHX A;  4C9B B;  4CDN A;  3SBT B;  4GCO A;  5CCL A;  3QKY A;  4BFR A;  4ACL A;  5BV0 A;  1FVF A;  3UPV A;  4FP7 A;  5KCM A;  3LVR E;  3QWV A;  3PVL A;  3AS8 A;  3ZGQ A;  5LX8 A;  3HVE A;  4F53 A;  3D3M A;  3FTY A;  4HLE A;  2CFZ A;  3D9I A;  4DI4 A;  4KZ0 A;  4CGV A;  4BWR A;  2XRZ A;  3Q49 B;  2MOW A;  2J09 A;  2NC9 A;  4HXI A;  4CGW A;  4CT0 A;  4K0R A;  3IKO B;  2GRL A;  2WMO A;  4F7A A;  4CDR A;  3CKC A;  1W3B A;  3CIA A;  2IU1 A;  2KCV A;  3L16 A;  4PDX A;  4NAC A;  1DVP A;  3Q4A B;  4U0Z A;  3MKQ B;  2A5U A;  1E90 A;  4KMO A;  2Y4T A;  4I1A A;  2I6H A;  5G2N A;  2XCC A;  4JL0 A;  4GA0 A;  2J9Q A;  4I2Z A;  1EDU A;  4DI3 A;  4J8D A;  4L7T A;  4WWP A;  3SFZ A;  4JEU A;  3CVQ A;  1HO8 A;  5AYW D;  4AV7 A;  3RO2 A;  4ILH B;  4BT8 A;  3CHS A;  4TV3 A;  3OXG A;  3B7R L;  5FZR A;  4CRW A;  5C1D A;  4P29 A;  3NZS A;  4G23 A;  4I9C A;  3B7S A;  4WUY A;  5E76 A;  1ZBP A;  3S7B A;  4KXK B;  3CVL A;  5D0Q D;  3ZW3 A;  4N2Q A;  3FU5 A;  1HF8 A;  4GAA A;  5J08 A;  3L22 A;  1E7U A;  3IEG A;  3FTW A;  4FHJ A;  1GW6 A;  2KCL A;  3PE4 A;  4JVS A;  3LJ3 A;  5AJD A;  5LP0 A;  1MQS A;  3PEU B;  2FBN A;  4AM9 A;  2VGX A;  3CHQ A;  3I5P A;  4N39 A;  4W9R A;  4UWL A;  2AXV A;  4GPK A;  2J4D A;  4ME2 A;  3SI5 A;  1OWO A;  5BNW A;  3APC A;  3MV3 B;  2CG3 A;  4K03 A;  1SZA A;  4BT9 A;  3EIQ C;  3QJZ A;  3LY9 A;  1H19 A;  2YHE A;  2R5S A;  1HG5 A;  2VGY A;  5FTP A;  2VSY A;  2LSU A;  4J0U A;  3CQG B;  2GW1 A;  1OUV A;  4D10 C;  3C98 A;  4Y6W A;  5JJ6 A;  4ANX A;  2NSZ A;  2XGS A;  4GML A;  3G2T A;  2QY7 A;  3P2B A;  2XRY A;  3ASG A;  3ONK A;  3D9O A;  3PE3 A;  4WNE A;  3FTU A;  4XKB A;  3D9K A;  3FU0 A;  4GA1 A;  3FH7 A;  3NF1 A;  1Z3Y A;  1HX8 A;  3U64 A;  4B8C B;  3AS4 A;  3HVE B;  3MKQ A;  3RKV A;  1UG3 A;  4UQY A;  4TRQ A;  3TG5 A;  2IOL A;  3IV0 A;  2YNQ A;  5ENN A;  3FY4 A;  4G25 A;  3PRZ A;  4B8A A;  4MKT A;  1L5J A;  3DBS A;  4BX9 A;  3LPZ A;  3QWP A;  4JPS A;  1EYH A;  4WNG A;  4FLB A;  1HG2 A;  1LF8 A;  3ULQ A;  3TG4 A;  3ZIM A;  3UT8 A;  3SGH A;  4GCN A;  3WXX A;  2KM4 A;  4CDM A;  4HOS A;  5KJM A;  5HQ8 A;  2J49 A;  5AJL A;  4BTA A;  2Q7F A;  3P1U A;  2KCK A;  4GYW A;  3JUI A;  1U3D A;  3VLD A;  2DCP A;  1UJK A;  2X3M A;  4B89 A;  2R59 A;  3ZHE B;  1KT1 A;  3N71 A;  1A17 A;  2L0T B;  2AXZ A;  2WXI A;  1UN8 A;  3EJN A;  1X5B A;  5G55 A;  3Q5M A;  4DK5 A;  2YHC A;  3L6A A;  2KAT A;  3BEE A;  2VJ8 A;  3CSF A;  3RIB A;  4U8H A;  2E2E A;  3ZYK A;  3S7D A;  1ELW A;  4IN3 B;  4OVU A;  1INZ A;  1UJJ A;  2R17 C;  3SBS A;  1SZ9 A;  2WQH A;  3LS8 A;  2HM8 A;  3S7J A;  2X6F A;  1SQM A;  4FLH A;  3RRU A;  5JHB A;  2P58 C;  4LUN U;  4IYP A;  3U3W A;  4L2Y A;  2VGX B;  5E75 A;  3B13 A;  1TJC A;  2DBA A;  5HI7 A;  4E85 A;  4XX5 A;  4LEU A;  4EEC A;  4AOF A;  4NUR A;  3D9N A;  4JA7 A;  2Y3A A;  2CHW A;  3CVX A;  1Y6I A;  3IBE A;  1U3C A;  3MEK A;  2WXL A;  2LNI A;  3ML9 A;  4EPZ A;  3NZU A;  2WXG A;  4GZ5 A;  1HXI A;  2L6J A;  5T4Y A;  3ESL A;  3CVV A;  1E8W A;  3ASF A;  5JJ7 A;  4G1T A;  2OVB A;  3G2U A;  4HFG A;  5ARG A;  3FTS A;  4WWN A;  3CHP A;  3ASD A;  2V4L A;  3QC1 A;  2PM6 A;  2PQN A;  5EDS A;  4DLO A;  2FEZ A;  3GW4 A;  4WND A;  5FT9 A;  5AIJ A;  3URZ A;  3D9M A;  3APF A;  4H7Y A;  4B94 A;  2GRM A;  4FC8 A;  1HU3 A;  3CVP A;  4FUL A;  5ANR A;  4LCT A;  4YVQ C;  3ZHE A;  5JJT A;  1UN9 A;  2WXM A;  3SF4 A;  4BSX A;  1S0P A;  2LO6 A;  4XE0 A;  2L9B A;  3NQP A;  4KBQ A;  4BY6 A;  3CVN A;  3VTY A;  3FUF A;  4G24 A;  4WNF A;  4FAD A;  3CVU A;  3OAW A;  4FU3 A;  4BTB A;  3L13 A;  1NA3 A;  1QQE A;  5ARF A;  3FTZ A;  1N52 A;  3I4G A;  4CT4 A;  1E8Z A;  2ZU6 B;  1VDY A;  2IJG X;  3RRN B;  3RRM B;  3AU5 A;  4JHJ A;  1OWN A;  2RG8 A;  4XI0 A;  3FUH A;  4Q96 A;  2KZT B;  2VSN A;  2I2O A;  1H2U A;  3G2W A;  4JXT A;  2EQX A;  3L08 A;  3TJP A;  3T5X A;  4MS6 A;  2JEK A;  3UT7 A;  5CCM A;  3PZD A;  4L23 A;  3ZEF A;  4AEZ C;  2XGO A;  2C2L A;  2XHE A;  4KYO B;  3FEY A;  2LSV A;  2XPY A;  4GU5 A;  5BUZ A;  4ANW A;  3PEV B;  3B7U X;  4C0M A;  3CQC B;  5M72 A;  1WM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...