4YVQC

Crystal structure of flu-tpr in complex with the c-terminal region of glutr
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
119
structure length
119
Chain Sequence
PKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamyl-tRNA reductase 1, chloroplastic
publication title The Non-canonical Tetratricopeptide Repeat (TPR) Domain of Fluorescent (FLU) Mediates Complex Formation with Glutamyl-tRNA Reductase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase/fluorescent protein
total genus 50
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yvqC00
3S7BA 3FP3A 4AY5A 4J0UA 3HYMB 4JA9A 2FF4A 4GPKA 2QFCA 3AS8A 3LY9A 1Y8MA 2HR2A 2UY1A 2VGYA 3QKYA 3ZFWA 4XI0A 4HORA 3SF4A 3K9IA 2YHCA 4G25A 3GZ1A 3UQ3A 4RG6A 2J9QA 5KJKA 1ELRA 4I1AA 4RG9A 2XGMA 3GZ2A 3PE3A 2KCKA 3S7DA 3LYAA 1HH8A 2WPVA 2IFUA 4GZ6A 3RIBA 3VTXA 2FBNA 4UQXA 4KBQA 1XNFA 3ESKA 3CVNA 2DBAA 3O48A 1NZNA 2Q7FA 1IHGA 4GYOA 2XEVA 2R5SA 5EKQD 2YQ8A 2WQHA 2XGOA 4XI9A 1W3BA 1PC2A 4GA1A 3AS5A 4J8FA 3PDNA 5ARGA 2KATA 4ME2A 1FCHA 4N3BA 4G24A 3FWVA 4Y6WA 3Q49B 3LPZA 4GCNA 4JL0A 3MV2B 4HOUA 2VYIA 3Q5MA 4HOSA 3S7FA 4AIFA 3ASHA 2V5FA 3CKBA 3MA5A 3URZA 4G26A 3RO3A 1WAO1 4I9CA 2FI7A 3CK9A 4CGWA 5CCMA 1ZBPA 1NA0A 4U0UA 3SZ7A 5FZSA 3ZPJA 4N3CA 1OUVA 4UQZA 4BT8A 1ELWA 3PE4A 5G04J 4BWRA 5JJTA 2PZIA 4YNDA 4AM9A 5LCWC 2IF4A 4ABNA 4CDRA 5FJYA 4WUYA 3E4BA 3MKRA 3MV3B 3Q4AB 2C2LA 1NA3A 2VGXA 3U3WA 2FEZA 4GYYA 3RKVA 1KT1A 2KCLA 4JA7A 3QOUA 4UI9J 2JLBA 4O6FA 5ARFA 5DIZA 2FO7A 2VSNA 3NF1A 3ULQA 3OXLA 5EX0A 1HZ4A 4U04A 1IYGA 3LY7A 3RO2A 3Q47B 4YVOA 2GW1A 4N2QA 2UY1B 3VTYA 3TGOA 5BNWA 3GYZA 3LKUA 3LY8A 2LSUA 4I2ZA 3RU0A 3TAXA 2XPIA 4EQFA 3ASDA 2VGXB 4BTBA 3AS4A 2BUGA 2OOEA 2NC9A 3FFLA 3WXXA 4GZ5A 4UI9C 2Y4TA 4YVQC 4IN3B 2LNIA 4J8DA 5C1DA 4BT9A 3ZGQA 2C0MA 4W9RA 4GYWA 4KXKB 4H7YA 1A17A 3ASGA 4I9EA 2I6HA 4GZ3A 5KJNA 4APOA 3QWWA 5D0OD 3Q15A 4GA2A 2KCVA 4N5CA 4B94A 3CVLA 2PQNA 1KT0A 3CVPA 4I17A 3ZHEA 1QQEA 5BW8C 5BT1A 3CV0A 3CK7A 1TJCA 4NQ0A 4WNGA 5FT9A 1B89A 3QWPA 3U4TA 1KLXA 2ONDA 4G23A 5DBKA 4Y6CA 4AY6A 5A6CA 2XCCA 3IEGA 3CEQA 3ZN3A 2XGSA 3KD7A 5G05J 2AVPA 3UPVA 3LCAA 3TG5A 4N3AA 3ZHEB 3CKCA 5HI7A 3KAEA 4GCOA 3MEKA 4UI9K 2VQ2A 4G2VA 3TG4A 5G04C 5D0QD 5FZQA 5KJMA 2P58C 3KS2A 4HOQA 2KC7A 4U07A 4GA0A 4XIFA 5KJLA 2HO1A 3BEEA 2C0LA 2UWJG 3GW4A 4U0SA 3JYSA 5G05C 4LEUA 4KYOB 5EX3A 3S7JA 4N39A 1WM5A 3QWVA 5A7DB 2VSYA 5CHEE 5FZRA 4N2SA 4WNDA 4G1TA 1QZ2A 3OXGA 2LSVA 5FTPA 2L6JA 2PQRA 2Y4UA 2PL2A 2XCBA 4JHRA 4WNEA 5M72A 3UUXA 4CGVA 3N71A 2HYZA 4BTAA 5AYWD 3QDNA 4U0ZA 4H7XA 5JJ6A 1HXIA 5CCLA 4I2WA 1ZU2A 1P5QA 2MHKA 5LCWJ 3OXFA 4J8EA 4WNFA 3RJVA 3CK8A 3ASFA 4A1SA 2E2EA 3EDTB 4NRHB 5JJ7A 1E96B 4F3VA 4UQYA 3CVQA 5HQ8A 1YA0A 3R9AB 4HOTA
chains in the Genus database with same CATH superfamily
3S7BA 2WMNA 4RSYA 4AY5A 3P1UA 4DJAA 3HYMB 3FTYA 2FF4A 5AQ7A 4UWKA 4MLPA 3FEYA 3L17A 2HR2A 3SQVA 4Q96A 4HORA 3NOGD 2ILRA 2OEVA 3AG1E 3RRUA 2YHCA 4G25A 3ULEG 3VLDA 2OVBA 4RVBA 2LAHA 3G2VA 3CVVA 4I1AA 1UOHA 4RG9A 2XGMA 4C48B 2LUHA 4EZJA 2CHXA 1U3DA 3U66A 3FU6A 2A4ZA 4GTRA 3S7DA 4DI3A 3FUIA 3RK6A 1X5BA 2M63A 3HVEA 4Q94A 3RIBA 1OXJA 4CEMA 3PEUB 4HXIA 4DK5A 3ESKA 2V4HC 1EDUA 2DBAA 1WG0A 3O48A 1NZNA 2Q7FA 2ZIRA 1N0QA 1QNFA 2IOLA 2R5SA 3FU3A 5EKQD 2XGOA 4XI9A 4DX5D 1W3BA 1PC2A 4X8QA 5ARGA 4HRLA 1JCQA 4G11A 4ME2A 4N3BA 4M3OA 4GCNA 1TNOA 1NI1A 3W9GA 4HOUA 3CQGB 2A5EA 3PH0C 3Q5MA 3CVWA 4MBGA 2P9PG 3ASHA 2V5FA 1H6OA 3SGHA 1K8KG 4I9CA 3L13A 5AENA 5CCMA 4HI9A 5ENQD 2PM7A 2CG3A 4XKBA 2BKGA 1NFIE 1ELWA 5G55A 5G04J 4BWRA 4HI8A 5JJTA 4EHMA 2PZIA 4AM9A 3UKRG 3UM1A 4ABNA 3ZYKA 5FJYA 4DRXE 3AU5A 4PS8A 4L9PA 3MV3B 1H2TC 2BEDA 4APFA 2J09A 1O1RA 4FU3A 5BV0A 1H6KA 3CVXA 3E33A 5C2YA 3FTVA 4UI9J 4JA7A 5CEDB 4DLOA 2JLBA 5HS0A 5DIZA 3UKUG 2XQ0A 1LD7A 3CQCB 3I4GA 4B0ZA 4AV7A 1HZ4A 2WXKA 1S70B 3FH5A 1YCSB 3UT4A 3RO2A 3Q47B 1TN8A 4F7AA 4N2QA 3TGOA 3LKUA 3RU0A 3QNKA 3SBTB 5CERB 4BTBA 3L08A 3AS4A 5HKPA 2BUGA 4DX1A 4UWLA 2OOEA 5ITZF 3QARA 3E32A 2LAIA 3ENEA 4GZ5A 3R7QA 5KCMA 4UI9C 1OCOE 4TUUA 3BG0B 4I6EA 3G2WA 4MKTA 2DWZA 1MX6A 3Q78A 4A3VA 2QZAA 2ZU6B 5C1DA 1E90A 5FQ6A 3PZ2A 3ZGQA 2C0MA 4W9RA 3PS6A 5KNHD 1A17A 1N4QA 3EIJA 3DSUA 3QJZA 3Q75A 4APOA 3G2SA 1SA4A 3QWWA 3Q15A 2KCVA 3APDA 2IO3C 2WXFA 2EQXA 3HXFA 4IULA 3ZHEA 4JEUA 4C0MA 1TN7A 3B7UX 5BT1A 4J8YA 3CK7A 1TJCA 4WNGA 3IBEA 4WWPA 3ABLE 2WXNA 3Q73A 2HE0A 4HLLA 1S0PA 3CEQA 1N11A 3LCAA 5JHAA 3TG5A 1D8EA 4N3AA 3DEPA 3Q7AA 3ONLA 2VTBB 1N9AA 2VQ2A 4XE0A 5CBOA 4BEPA 2IONA 2DCPA 1D8DA 5CBNA 2P58C 5CECB 1JCSA 3NZSA 4U07A 2ETAA 5KJLA 3ZW3A 5ENRD 3B7BA 3JUEA 3IXEA 2ZGDA 3Q9NC 4R7LA 4ACLA 4LEUA 3UT7A 3DSWA 3JUIA 3U64A 3DSTA 3F6QA 3FTSA 3NB2A 5CHEE 3IV0A 5G2NA 2LSVA 3ABME 3I3NA 4GTTA 1S63A 3ZXSA 4ILHB 4JHRA 4OAUC 5FWQA 4U8VD 2LO6A 4FA6A 2QYUA 4U0ZA 4F1PA 2R03A 3UM3A 2MRIA 4BERA 1LTXA 3EHQA 2LXLA 2NSZA 1UW4B 4BSZB 2WXLA 3L6AA 3Q79A 2VJ8A 3ASFA 2R02A 2DVWA 5JMND 5E76A 3ZKJA 4LNBA 4A1SA 3T5VA 4LRZA 4BFRA 3D9NA 1MX4A 2EIJE 2BTDA 2IQCA 3D9JA 1JWGA 4JPSA 2GRRB 3OTNA 2VGEA 2L6BA 1BLXB 1DNPA 1H2VC 1N4SA 3EHRA 2QFCA 2GROB 3AS8A 3W9FA 3L9TA 4XI0A 1K1AA 3QK0A 3TL5A 3K9IA 2VSOE 1UJJA 3UQ3A 5ENSD 4TUMA 3NAWA 2J9QA 3S2AA 4C0EA 3DBSA 3GZ2A 2LXMA 2WXOA 2MOWA 3HDXA 1DCQA 4G8LA 4O1OA 1RW2A 1HH8A 2WPVA 2IFUA 1Z3XA 3FULA 4KVMA 4ZHBA 4UQXA 4CYMD 3LDZA 3CVNA 1OWOA 3LVRE 1IHGA 2R17C 4GYOA 1E8YA 2AXVA 3ULYA 1H19A 2QC9A 4LCTA 1N4RA 5BUZA 2KATA 3SFZA 3JQ1A 1FCHA 1N52A 2NYJA 4Y6WA 2DYSE 3LPZA 3UXGA 4JL0A 5FQ7A 4U95D 4E6HA 4UWHA 3OAWA 5CEAA 2CFZA 2VYIA 2CFUA 4AIFA 4F1SA 4Q69A 3C72A 3MA5A 4LERA 2V0PA 2AWIA 4G26A 3RO3A 4NURA 5B1BE 2MYOA 2FI7A 2L9BA 3MCXA 3UMVA 4RQIA 5H7PA 3SZ7A 3JXJA 3R9MA 3U9WA 3D3MA 3ZPJA 3T5XA 4XKCA 3PUKA 1TNBA 2VTBA 2EIKE 3HXEA 4UQZA 3UINC 3PE4A 4JW1A 4MS6A 3FEXA 1NP7A 5LCWC 3D9MA 3SY2A 3FU5A 2Y1LE 2X6HA 3BQOA 2L0IA 3V2XA 1TNZA 4WUYA 5ENPD 3IKOB 1V54E 3E4BA 1JPLA 1DC2A 1MZCA 3Q4AB 2C2LA 3QC1A 2V8SE 3RKVA 2J4DA 2J07A 3HRAA 3TWRA 3CVYA 3QOUA 2X6FA 2B6CA 2FO7A 3TXMA 4I43A 4BX9A 1O1SA 3JQ0A 1HF8A 4KT6B 5FIOA 1QYMA 4WWNA 4U04A 4F53A 1LD8A 1IYGA 2OEWA 4TXQA 1SA5A 3LY7A 3TWVA 2GW1A 2UY1B 5BNWA 3GYZA 4EBAG 5AQ9A 2YHEA 2F8YA 2LSUA 4I2ZA 3ASDA 3E34A 2VGXB 1E7VA 2XS8A 3EHMA 2H6HA 4J8SA 2NC9A 3UTMA 3LS8A 4FJYA 2QYJA 4YVQC 3ASNE 3PVLA 3B7SA 1E8WA 3BUAA 5HRYA 3B7RL 3FUMA 3DSSA 4BT9A 3PZDA 2OV8A 3HG0D 4P29A 4D10C 4GYWA 4FP7A 1K3ZD 3HXCA 3AG4E 3E30A 4H7YA 1JCRA 3PEVB 3ASGA 2RD0A 2XZDG 5KJNA 4B94A 2PQNA 3D9PA 2XS1A 4HBDA 4B8AA 4A1GA 2PNNA 1AP7A 3SFYA 5BW8C 3FHEA 2X38A 4B8CB 3CV0A 4NQ0A 1HU3A 5FT9A 3QWPA 2NXPA 2AJAA 3U4TA 3PNLB 1SQMA 4G23A 1QBQA 2KZTB 1JWFA 4BSXA 3ESLA 5A6CA 2F37A 4HB5A 3KSLA 4U96D 2KBXA 4U63A 2XGSA 1OWLA 3KD7A 2AVPA 3BU8A 3MKQA 1MJ0A 4HNAD 5KWDA 4GCOA 2XRYA 4JB8P 4UI9K 1MHQA 5AQBA 4L2YA 2H6GA 1FT2A 1Y6IA 2ZXWE 3TG4A 5G04C 1FPPA 2X3MA 4HOQA 3ZYMA 1Z6TA 4OAVB 2Y3AA 3APCA 4GZDA 1IKND 3ISMC 4U0SA 3JYSA 5ENOD 3C3RA 4AXHA 3DXKG 3CSFA 1WM5A 2V4LA 2XZTG 5B3SE 3AAAC 3MZLB 5KBAA 1HO8A 3CHQA 4OVUA 4G1TA 2VSXE 1EPUA 1K1BA 1QZ2A 4K5BA 4K03A 2I1KA 4KZCA 2L6JA 2PQRA 2BKKB 2PL2A 2XCBA 3SBSA 5AAOA 1TYQG 2XPZA 3UUXA 4CGVA 3SHFA 3MYVA 2HYZA 5AYWD 5EIDA 3PZ3A 3V30A 4I2WA 5D66A 3EUVA 1DCEA 2L0TB 4J8EA 4WNFA 2X6IA 4FC8A 2KM4A 3LEWA 5JA4D 3ONKA 4HVBA 4ATGA 5CMYA 2CHZA 5JJ7A 2P9NG 2QY7A 4GTSA 4UQYA 3ZU7B 5ANLA 3R9AB 4HOTA 4KVOA 2R2LA 1N95A 2H6FA 3FP3A 1VDYA 3FTZA 4EBAA 4J0UA 4JA9A 1SZAA 4L1BA 4URKA 3I4RB 4I6JA 1HG5A 1Y8MA 2UY1A 3ZNGA 2DZNA 4YDYA 3TWWA 5EDSA 2WXHA 1ELRA 2YNQA 3HIZA 3HXDA 3TJPA 3G2UA 1TNUA 1IHBA 4G8KA 4JEHA 4JZYA 2GRNB 1OY3D 3ZXPA 3UM2A 4DX7D 2EILE 3FUDA 4IYPA 4KBQA 4GU5A 3SO8A 3FH7A 4BESA 1YYHA 2XEVA 5J08A 2YQ8A 2WQHA 3ZUVB 4BY6A 3V2OA 2X6JA 4J8FA 2WXQA 3PDNA 4XEIG 4DX6D 3EU9A 4U8YD 3O4ZA 4L2LA 4G24A 3FWVA 2J4BA 2WB2A 1V55E 3HVEB 4TXRA 5CRUA 5FINA 1IQUA 4HOSA 3CHRA 4ILGA 4GTOA 3URZA 4LSZE 1H0AA 3Q7FA 1HFAA 4CT4A 4N5QA 3CK9A 2A5UA 1MQSA 4L7TA 4YDOA 2R05A 1ZBPA 4GTMA 3UM0A 4U0UA 4CZ2D 3FUJA 5EIBE 3QAQA 3RSEG 2GRPB 2IO2C 1OUVA 4JVSA 3KSQA 4BETA 3VLFA 4U8HA 4J6IA 4JHKA 1KZPA 5CRVA 4YNDA 3FTUA 2AW6A 2RFMA 2EINE 4FLHA 1Z3YA 4FJZA 1NA3A 2XHEA 4GYYA 3UIOC 1KT1A 1N54A 4A63B 4JHJA 5AIJA 3D9LA 1D9SA 5ARFA 2VSNA 3NF1A 4AOFA 3OXLA 2WXPA 3DPYA 1U2VG 4F6RD 3AU4A 4YVOA 5KNGA 3VTYA 2J8SD 1O1TA 2WMOA 3MX3A 3TAXA 2XPIA 3LJNA 5T4YA 2GRMA 2H6IA 5AN8A 3B13A 3B95A 3PUJA 4U7EB 2ETCA 3L54A 5EYLA 3FY4A 1PAQA 4XZ4A 4MRUA 1FVHA 5AARA 2X6KA 3E37A 3D9IA 4FHJA 4KXKB 3L16A 5EYPF 1BI8B 1E7UA 3L22A 4AVXA 4I9EA 3T8MA 5EN5D 3DSXA 4ANVA 3I5PA 1BD8A 5JHBA 3T9KA 5FQ4A 1YMPA 1QQEA 1Q2ZA 2WXGA 1BU9A 1B89A 2ZISA 4NACA 2R59A 1KLXA 2ONDA 3FTXA 3B7TA 3CHSA 3D9OA 3BG1B 4GTQA 4Y6CA 4AY6A 4FULA 1UG3A 2F0YA 4HQDA 5G05J 3X2QE 3UPVA 1SW6A 3SI5A 3D9KA 2P9UG 2WQ7A 3ZHEB 2F8XK 1MX2A 3CKCA 5HI7A 1U3CA 4G2VA 3NQPA 1EYHA 1Z5SC 3ZYQA 3T8KA 3CLJA 5KJMA 2FO1E 2KC7A 5ENTD 4GA0A 4XIFA 4EECA 3ML9A 4C9BB 3BEEA 2UWJG 3Q9UC 3GW4A 5G05C 4K5CA 4KYOB 4PS3A 5EX3A 3S7JA 4DUIA 4N39A 3QB2A 3QWVA 2P2CP 2YINA 3CIAA 5A7DB 4A3TA 4AP2A 5FZRA 4HS2A 4AEZC 4N2SA 2I1JA 3RRMB 3MGBA 2Y69E 4TRQA 2OVFA 3DEOA 4B93B 1BI7B 4LNGA 2IOSA 5ANRA 1OCRE 4WNEA 5M72A 5IY5E 3P2BA 3N71A 4CDMA 1HE8A 4BTAA 1N0RA 4H7XA 5JJ6A 3SD5A 3UIPC 5CCLA 4A55A 2PM6A 3HHMA 4DX2A 1P5QA 4QQIA 3ZEFA 5LOZA 4PDXA 5BXOA 4XX5A 3L82A 3RJVA 4FADA 5BV1A 1O5MA 3MJWA 2GGFA 4LUNU 2WXIA 1BPOA 4NIKA 1TNYA 3UT8A 2E2EA 3EDTB 4NRHB 4UUCA 4EPZA 1E96B 4K5AB 4F3VA 2BF0X 4O1PA 3KEZA 3TWQA 4JC8A 3TWTA 1HG2A 4B89A 1WY6A 4GPKA 3LY9A 3C3QA 2VGYA 4FLBA 3QKYA 3ZFWA 3SF4A 3UI2A 2IU1A 3WG7E 3GZ1A 1IXVA 3ZYLA 4RG6A 4JD2G 2XRZA 1AWCB 1ELKA 5KJKA 4FHKA 3EHNA 4EZLA 1TN6A 3TWXA 3PE3A 3FUKA 2KCKA 3C3OA 5B1AE 1H2UA 3LYAA 4GZ6A 4ATZD 3VTXA 1HX8A 2FBNA 4YDWA 5LFAA 1XNFA 2WVIA 1UN8A 3SFXA 2RFAA 3EIQC 4QFVA 2XPYA 3AJIA 3CR3A 4LG6A 3NZUA 3ML8A 2IEJA 4GA1A 3AS5A 3J5QB 3EU5A 3FH8A 3TWSA 1LF8A 4TV3A 1KZOA 3Q49B 2CG2A 1A5EA 4DPRA 4GMJA 5ENNA 3FDHA 4HFGA 1N94A 4CRWA 4GMRA 3MV2B 3UX4A 4L23A 3RRNB 3S7FA 3CHOA 1E8XA 3CKBA 3D9HA 4RLYA 3FUEA 2I9CA 1UN9A 1WAO1 3DRAA 1WDYA 3DPDA 4TXPA 4CGWA 1EF1C 3ZVVA 1GW6A 1NA0A 2AXZA 4ACKA 3ZIMA 4GTVA 4DLQA 2RKKA 5FZSA 1OCZE 4N3CA 2IJGX 4BT8A 1OCCE 4J7WA 2JABA 3DSVA 2FULA 2DZOA 3J5PA 4UWFA 3EJNA 1ZB1A 3PZ1A 2IF4A 4PS7A 4CDRA 1MYOA 1H6PA 3MKRA 4GZCA 3LVQE 3NOCD 2VGXA 4HLEA 3U3WA 2FEZA 4WAFA 1TJFA 5EILA 4E85A 2I2OA 2KCLA 4UWGA 4O6FA 4GPMA 4GMLA 4IRUA 4OYSA 3ULQA 2RG8A 3PREA 3IHYA 5AJLA 5EX0A 2DIWA 4GB9A 2V5QC 4ZFHA 4KZ0A 5J90A 4ANXA 1N4PA 1SVXA 4HRNA 3LY8A 3G2TA 4EQFA 3RAUA 2ETBA 3GZSA 4LNUD 3C5RA 4DI4A 4I1MA 5BPPA 3FFLA 3NBNB 3WXXA 5LP0A 2Y4TA 2JEKA 1JUQA 3ABKE 1XGWA 3HXBA 4WWOA 4IN3B 2LNIA 4J8DA 4K0RA 1L5JA 1OWMA 3CHMA 5T8IA 2WXRA 2KXPC 2P9SG 2KZTA 3FUFA 4V3IA 2P9IG 3PZ4A 4PH4B 4HRMB 2P9LG 2I6HA 4GZ3A 3SNXA 2WXJA 1KPSB 5D0OD 3AG2E 4GA2A 4N5CA 3CVLA 1KT0A 3CVPA 4I17A 1OT8A 3R7RA 1SZ9A 5BXUA 1NL4A 4AJWA 2AXUA 3PRZA 4CT0A 3DXMG 1INZA 4CDNA 3ASOE 3FTWA 4YDEA 5DBKA 5LX8A 2OCCE 2P9KG 4CCAA 3JCKC 2XCCA 3IEGA 3ZN3A 2XENA 1DVPA 5T3RA 1UJKA 3JXIA 3TXNA 3V31A 4OVVA 3CHPA 4ILIA 3TWUA 3KAEA 3MEKA 3ZRHA 1X81A 2DYRE 4BX8A 4GAAA 5D0QD 5FZQA 3VLEA 1E8ZA 3KEAA 3KS2A 2J49A 4ANWA 2CHWA 3V79K 5AQAA 1OWPA 3CSTA 2HO1A 3CVUA 2C0LA 5A23A 3FU0A 2E0IA 3PNTB 4JXTA 1HS6A 2GRLA 4EZKA 3MKQB 1IQRA 4I1OB 2WQ6A 3FUHA 2HM8A 5AJDA 3C98A 2VSYA 3LXUX 2EIME 3IHVA 4WNDA 5CMWA 3OXGA 1TR4A 5FTPA 2XEHA 2Y4UA 5D2MC 3QDNA 5FQ8A 1HXIA 2Y0BG 3DWLG 3FUNA 1ZU2A 2MHKA 4GTPA 5LCWJ 4O60A 2B0OE 1FT1A 3OXFA 4ANUA 4I6GA 4M7CA 3CK8A 1S64A 3AG3E 3LJ3A 2GRQB 1G3NB 1PY1A 1OWNA 1TEZA 3APFA 4KMOA 1RZ4A 2IY0C 3CVQA 4PUCA 2WM9A 4Z68A 5HQ8A 3CGHA 1YA0A 5E75A 2XEEA 2ZGGA 2WXMA 2J08A 1FVFA
chains in the Genus database with same CATH topology
1HG2A 4KVOA 3S7BA 3FP3A 1VDYA 2WMNA 3FTZA 4RSYA 4AY5A 3P1UA 4EBAA 4J0UA 1DNPA 4DJAA 3HYMB 4JA9A 1SZAA 1H2VC 2FF4A 3FTYA 4B89A 4L1BA 1WY6A 4URKA 4GPKA 2QFCA 4UWKA 3I4RB 3AS8A 4MLPA 3FEYA 4I6JA 3LY9A 1HG5A 3L17A 1Y8MA 2HR2A 2UY1A 2VGYA 3QKYA 4FLBA 4Q96A 4XI0A 3ZFWA 4HORA 2ILRA 3SF4A 2IU1A 3QK0A 3RRUA 3TL5A 3K9IA 2YHCA 2VSOE 1UJJA 4G25A 3GZ1A 3UQ3A 3VLDA 2OVBA 4RVBA 5EDSA 2WXHA 2LAHA 4RG6A 3ZYLA 2XRZA 1ELKA 3G2VA 2J9QA 5KJKA 3CVVA 3S2AA 4FHKA 1ELRA 3EHNA 4I1AA 4RG9A 2XGMA 4EZLA 4EZJA 4C0EA 2CHXA 1U3DA 3DBSA 3GZ2A 2YNQA 3PE3A 3HIZA 3TJPA 2WXOA 3FUKA 2KCKA 2MOWA 3U66A 3FU6A 3HDXA 2A4ZA 3S7DA 3G2UA 4DI3A 4JEHA 4JZYA 3FUIA 3RK6A 1H2UA 3LYAA 1HH8A 2WPVA 1X5BA 2IFUA 2M63A 3HVEA 4GZ6A 4Q94A 1Z3XA 3RIBA 4CEMA 3FULA 3VTXA 1HX8A 2FBNA 3FUDA 4KVMA 3PEUB 4IYPA 4KBQA 4UQXA 5LFAA 4GU5A 1XNFA 4HXIA 2WVIA 4DK5A 3LDZA 3ESKA 3CVNA 1UN8A 1OWOA 1EDUA 2DBAA 3O48A 1NZNA 2Q7FA 3LVRE 3EIQC 1IHGA 3FH7A 2R17C 4GYOA 1E8YA 1QNFA 2AXVA 2IOLA 4QFVA 2XPYA 2XEVA 3CR3A 2R5SA 3FU3A 5EKQD 5J08A 1H19A 2YQ8A 3NZUA 2WQHA 2XGOA 4XI9A 3ML8A 1W3BA 4BY6A 1PC2A 4LCTA 2X6JA 4GA1A 3AS5A 2WXQA 3PDNA 4J8FA 3FH8A 5ARGA 5BUZA 2KATA 1LF8A 3SFZA 4G11A 3O4ZA 4ME2A 3JQ1A 4TV3A 1FCHA 4L2LA 1N52A 4N3BA 4G24A 3FWVA 4M3OA 4Y6WA 3Q49B 2CG2A 3LPZA 2J4BA 4DPRA 4GCNA 4GMJA 2WB2A 3HVEB 5ENNA 4JL0A 3FDHA 5FQ7A 4HFGA 4CRWA 4E6HA 3MV2B 4HOUA 4UWHA 3UX4A 3OAWA 2CFZA 2VYIA 3CQGB 4L23A 2CFUA 3PH0C 3Q5MA 3CVWA 1IQUA 3RRNB 4HOSA 3S7FA 3CHOA 3CHRA 4AIFA 4ILGA 4F1SA 4Q69A 1E8XA 3ASHA 2V5FA 3CKBA 3MA5A 3URZA 4LERA 2V0PA 2AWIA 3FUEA 2I9CA 1UN9A 1WAO1 4G26A 3RO3A 1H0AA 4NURA 3SGHA 1HFAA 3DPDA 4I9CA 3L13A 2FI7A 2L9BA 3MCXA 3UMVA 3CK9A 4CT4A 5AENA 4CGWA 2A5UA 5CCMA 1MQSA 4L7TA 1EF1C 2PM7A 3ZVVA 1ZBPA 2CG3A 1GW6A 3OTNA 1NA0A 2AXZA 4U0UA 4XKBA 4ACKA 3FUJA 3ZIMA 4DLQA 3QAQA 3SZ7A 5FZSA 3U9WA 3D3MA 3ZPJA 3T5XA 4XKCA 3PUKA 4N3CA 1OUVA 2VTBA 2IJGX 4JVSA 4UQZA 4BT8A 1ELWA 5G55A 3PE4A 3VLFA 4U8HA 4J6IA 5G04J 4JHKA 4JW1A 4BWRA 2FULA 5JJTA 2PZIA 4YNDA 4MS6A 3FTUA 2AW6A 3FEXA 4AM9A 1NP7A 4UWFA 3EJNA 5LCWC 3D9MA 2IF4A 3FU5A 4PS7A 4ABNA 4CDRA 2X6HA 4FLHA 3ZYKA 2L0IA 1Z3YA 5FJYA 4WUYA 3IKOB 3E4BA 3AU5A 4PS8A 3MKRA 4GZCA 1JPLA 4FJZA 3LVQE 3MV3B 3Q4AB 1H2TC 2C2LA 1NA3A 4APFA 2J09A 3QC1A 4FU3A 2XHEA 2VGXA 2V8SE 5BV0A 4HLEA 3U3WA 2FEZA 4GYYA 1H6KA 3CVXA 4WAFA 1TJFA 3RKVA 1KT1A 2J4DA 2J07A 5C2YA 3FTVA 3CVYA 4E85A 1N54A 2I2OA 2KCLA 3QOUA 4JA7A 4UI9J 2X6FA 4UWGA 4DLOA 2JLBA 4JHJA 4O6FA 5AIJA 3D9LA 5ARFA 4GMLA 5DIZA 4IRUA 2FO7A 4OYSA 2XQ0A 4I43A 3TXMA 2VSNA 3NF1A 4BX9A 1TEZA 3JQ0A 3ULQA 1HF8A 3CQCB 4KT6B 2RG8A 3PREA 4AOFA 3IHYA 3OXLA 5AJLA 3I4GA 5EX0A 2DIWA 2WXPA 4GB9A 4B0ZA 1HZ4A 4AV7A 4WWNA 2WXKA 4U04A 3FH5A 4F53A 1IYGA 4KZ0A 5J90A 3AU4A 3LY7A 3RO2A 3Q47B 4YVOA 2GW1A 3UT4A 4ANXA 4F7AA 4N2QA 2UY1B 3VTYA 3TGOA 5BNWA 3GYZA 4EBAG 2YHEA 2WMOA 3LKUA 3LY8A 2LSUA 3MX3A 3QNKA 4I2ZA 3RU0A 3G2TA 3TAXA 2XPIA 4EQFA 3ASDA 3SBTB 2VGXB 5T4YA 3GZSA 1E7VA 4BTBA 2GRMA 3L08A 3AS4A 3EHMA 4DI4A 2BUGA 4UWLA 3B13A 2OOEA 4I1MA 2NC9A 4J8SA 3QARA 5BPPA 2LAIA 3ENEA 3LS8A 3PUJA 3FFLA 4FJYA 3WXXA 4GZ5A 3R7QA 5KCMA 4UI9C 5LP0A 2Y4TA 2JEKA 1JUQA 4YVQC 4TUUA 3L54A 1XGWA 4WWOA 4IN3B 2LNIA 3BG0B 3FY4A 4I6EA 4J8DA 3G2WA 4K0RA 1L5JA 3PVLA 1OWMA 3B7SA 1E8WA 1PAQA 4MKTA 4A3VA 3B7RL 2ZU6B 3FUMA 4MRUA 4XZ4A 5C1DA 4BT9A 1E90A 1FVHA 2OV8A 3CHMA 3PZDA 4P29A 5FQ6A 3ZGQA 4D10C 5T8IA 2C0MA 2X6KA 4W9RA 2WXRA 4GYWA 3D9IA 4FHJA 4FP7A 4KXKB 3L16A 3PS6A 2KZTA 1E7UA 3L22A 3FUFA 4V3IA 4H7YA 1A17A 4AVXA 4PH4B 3PEVB 3ASGA 3EIJA 4I9EA 3T8MA 2RD0A 2I6HA 3QJZA 4GZ3A 5KJNA 4APOA 3G2SA 3QWWA 3SNXA 2WXJA 5D0OD 3Q15A 4GA2A 2KCVA 3APDA 4N5CA 4B94A 3CVLA 4ANVA 2PQNA 1KT0A 2WXFA 2EQXA 3CVPA 3D9PA 4I17A 3I5PA 4IULA 3ZHEA 4B8AA 4A1GA 5JHBA 5FQ4A 4JEUA 3R7RA 4C0MA 1QQEA 1SZ9A 5BW8C 3B7UX 3FHEA 5BT1A 2X38A 4B8CB 3CV0A 3CK7A 1TJCA 4NQ0A 4AJWA 4WNGA 3IBEA 1HU3A 2WXGA 4WWPA 2AXUA 5FT9A 1B89A 3PRZA 4CT0A 1INZA 3QWPA 2NXPA 2WXNA 4NACA 4CDNA 3U4TA 3PNLB 2R59A 1KLXA 2ONDA 3FTXA 1SQMA 4G23A 3B7TA 2KZTB 3CHSA 3D9OA 3FTWA 3BG1B 1JWFA 5DBKA 4BSXA 3ESLA 4Y6CA 1S0PA 5LX8A 4AY6A 4CCAA 4FULA 3JCKC 5A6CA 1UG3A 2XCCA 3IEGA 3CEQA 3ZN3A 4U63A 1DVPA 5T3RA 2XGSA 1OWLA 3KD7A 5G05J 1UJKA 2AVPA 3UPVA 3SI5A 3LCAA 5JHAA 3TXNA 3D9KA 3TG5A 3MKQA 2WQ7A 4N3AA 4OVVA 3ZHEB 3CHPA 3ONLA 3CKCA 4ILIA 5HI7A 3KAEA 4GCOA 2XRYA 2VTBB 3MEKA 4UI9K 1MHQA 1U3CA 3ZRHA 4L2YA 2VQ2A 4G2VA 4XE0A 3NQPA 2IONA 1EYHA 1Y6IA 3ZYQA 4BX8A 3TG4A 2DCPA 5G04C 4GAAA 5D0QD 5FZQA 3CLJA 3VLEA 5KJMA 2X3MA 1E8ZA 2P58C 3KS2A 4HOQA 2KC7A 3NZSA 2J49A 4ANWA 4U07A 1Z6TA 4GA0A 3ZYMA 2Y3AA 4XIFA 2CHWA 5KJLA 3ZW3A 3APCA 4GZDA 1OWPA 4EECA 3ML9A 3CSTA 2HO1A 4C9BB 3BEEA 2C0LA 3CVUA 2UWJG 5A23A 3FU0A 2E0IA 3GW4A 3PNTB 4R7LA 4JXTA 1HS6A 3JYSA 4U0SA 2GRLA 4EZKA 5G05C 4ACLA 3MKQB 4LEUA 3UT7A 1IQRA 4KYOB 4PS3A 5EX3A 4AXHA 4I1OB 3S7JA 2WQ6A 3FUHA 2HM8A 4N39A 3CSFA 5AJDA 1WM5A 2V4LA 3JUIA 3QB2A 3U64A 3QWVA 2YINA 3FTSA 3C98A 3CIAA 5A7DB 4A3TA 4AP2A 2VSYA 3MZLB 5CHEE 5FZRA 3LXUX 1HO8A 4HS2A 3IHVA 4AEZC 4WNDA 3CHQA 4OVUA 4N2SA 4G1TA 2VSXE 3IV0A 1EPUA 2I1JA 5CMWA 1QZ2A 3OXGA 4K03A 5G2NA 2LSVA 2I1KA 3RRMB 5FTPA 4KZCA 3MGBA 4TRQA 2L6JA 3I3NA 2PQRA 2OVFA 2Y4UA 3ZXSA 2IOSA 2PL2A 4ILHB 5ANRA 2XCBA 4JHRA 3SBSA 4WNEA 5FWQA 5M72A 2LO6A 2XPZA 3UUXA 3P2BA 3N71A 3SHFA 4CGVA 4CDMA 1HE8A 2HYZA 3MYVA 4FA6A 4BTAA 5AYWD 3QDNA 4U0ZA 5FQ8A 4H7XA 5JJ6A 1HXIA 3SD5A 5CCLA 4A55A 2MRIA 2PM6A 3FUNA 4I2WA 3HHMA 1ZU2A 1P5QA 2MHKA 2NSZA 3ZEFA 5LCWJ 5LOZA 4PDXA 1UW4B 2WXLA 3OXFA 4XX5A 3L6AA 4ANUA 2L0TB 4J8EA 4I6GA 4WNFA 3RJVA 4FADA 2VJ8A 3CK8A 2X6IA 5BV1A 3ASFA 3MJWA 4FC8A 2KM4A 3LJ3A 2GGFA 4LUNU 3LEWA 2WXIA 3ONKA 4HVBA 1BPOA 1OWNA 1PY1A 5E76A 4ATGA 5CMYA 3UT8A 2CHZA 4A1SA 3T5VA 2E2EA 3EDTB 3APFA 4LRZA 4KMOA 4NRHB 4BFRA 5JJ7A 4EPZA 1E96B 3D9NA 2QY7A 4F3VA 2BF0X 2BTDA 2IQCA 4UQYA 3CVQA 4PUCA 2WM9A 3D9JA 5ANLA 5HQ8A 3CGHA 1YA0A 3KEZA 5E75A 3R9AB 1JWGA 4HOTA 4JPSA 2WXMA 2J08A 4JC8A 1FVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7B A;  3FP3 A;  4AY5 A;  4J0U A;  3HYM B;  4JA9 A;  2FF4 A;  4GPK A;  2QFC A;  3AS8 A;  3LY9 A;  1Y8M A;  2HR2 A;  2UY1 A;  2VGY A;  3QKY A;  3ZFW A;  4XI0 A;  4HOR A;  3SF4 A;  3K9I A;  2YHC A;  4G25 A;  3GZ1 A;  3UQ3 A;  4RG6 A;  2J9Q A;  5KJK A;  1ELR A;  4I1A A;  4RG9 A;  2XGM A;  3GZ2 A;  3PE3 A;  2KCK A;  3S7D A;  3LYA A;  1HH8 A;  2WPV A;  2IFU A;  4GZ6 A;  3RIB A;  3VTX A;  2FBN A;  4UQX A;  4KBQ A;  1XNF A;  3ESK A;  3CVN A;  2DBA A;  3O48 A;  1NZN A;  2Q7F A;  1IHG A;  4GYO A;  2XEV A;  2R5S A;  5EKQ D;  2YQ8 A;  2WQH A;  2XGO A;  4XI9 A;  1W3B A;  1PC2 A;  4GA1 A;  3AS5 A;  4J8F A;  3PDN A;  5ARG A;  2KAT A;  4ME2 A;  1FCH A;  4N3B A;  4G24 A;  3FWV A;  4Y6W A;  3Q49 B;  3LPZ A;  4GCN A;  4JL0 A;  3MV2 B;  4HOU A;  2VYI A;  3Q5M A;  4HOS A;  3S7F A;  4AIF A;  3ASH A;  2V5F A;  3CKB A;  3MA5 A;  3URZ A;  4G26 A;  3RO3 A;  1WAO 1;  4I9C A;  2FI7 A;  3CK9 A;  4CGW A;  5CCM A;  1ZBP A;  1NA0 A;  4U0U A;  3SZ7 A;  5FZS A;  3ZPJ A;  4N3C A;  1OUV A;  4UQZ A;  4BT8 A;  1ELW A;  3PE4 A;  5G04 J;  4BWR A;  5JJT A;  2PZI A;  4YND A;  4AM9 A;  5LCW C;  2IF4 A;  4ABN A;  4CDR A;  5FJY A;  4WUY A;  3E4B A;  3MKR A;  3MV3 B;  3Q4A B;  2C2L A;  1NA3 A;  2VGX A;  3U3W A;  2FEZ A;  4GYY A;  3RKV A;  1KT1 A;  2KCL A;  4JA7 A;  3QOU A;  4UI9 J;  2JLB A;  4O6F A;  5ARF A;  5DIZ A;  2FO7 A;  2VSN A;  3NF1 A;  3ULQ A;  3OXL A;  5EX0 A;  1HZ4 A;  4U04 A;  1IYG A;  3LY7 A;  3RO2 A;  3Q47 B;  4YVO A;  2GW1 A;  4N2Q A;  2UY1 B;  3VTY A;  3TGO A;  5BNW A;  3GYZ A;  3LKU A;  3LY8 A;  2LSU A;  4I2Z A;  3RU0 A;  3TAX A;  2XPI A;  4EQF A;  3ASD A;  2VGX B;  4BTB A;  3AS4 A;  2BUG A;  2OOE A;  2NC9 A;  3FFL A;  3WXX A;  4GZ5 A;  4UI9 C;  2Y4T A;  4YVQ C;  4IN3 B;  2LNI A;  4J8D A;  5C1D A;  4BT9 A;  3ZGQ A;  2C0M A;  4W9R A;  4GYW A;  4KXK B;  4H7Y A;  1A17 A;  3ASG A;  4I9E A;  2I6H A;  4GZ3 A;  5KJN A;  4APO A;  3QWW A;  5D0O D;  3Q15 A;  4GA2 A;  2KCV A;  4N5C A;  4B94 A;  3CVL A;  2PQN A;  1KT0 A;  3CVP A;  4I17 A;  3ZHE A;  1QQE A;  5BW8 C;  5BT1 A;  3CV0 A;  3CK7 A;  1TJC A;  4NQ0 A;  4WNG A;  5FT9 A;  1B89 A;  3QWP A;  3U4T A;  1KLX A;  2OND A;  4G23 A;  5DBK A;  4Y6C A;  4AY6 A;  5A6C A;  2XCC A;  3IEG A;  3CEQ A;  3ZN3 A;  2XGS A;  3KD7 A;  5G05 J;  2AVP A;  3UPV A;  3LCA A;  3TG5 A;  4N3A A;  3ZHE B;  3CKC A;  5HI7 A;  3KAE A;  4GCO A;  3MEK A;  4UI9 K;  2VQ2 A;  4G2V A;  3TG4 A;  5G04 C;  5D0Q D;  5FZQ A;  5KJM A;  2P58 C;  3KS2 A;  4HOQ A;  2KC7 A;  4U07 A;  4GA0 A;  4XIF A;  5KJL A;  2HO1 A;  3BEE A;  2C0L A;  2UWJ G;  3GW4 A;  4U0S A;  3JYS A;  5G05 C;  4LEU A;  4KYO B;  5EX3 A;  3S7J A;  4N39 A;  1WM5 A;  3QWV A;  5A7D B;  2VSY A;  5CHE E;  5FZR A;  4N2S A;  4WND A;  4G1T A;  1QZ2 A;  3OXG A;  2LSV A;  5FTP A;  2L6J A;  2PQR A;  2Y4U A;  2PL2 A;  2XCB A;  4JHR A;  4WNE A;  5M72 A;  3UUX A;  4CGV A;  3N71 A;  2HYZ A;  4BTA A;  5AYW D;  3QDN A;  4U0Z A;  4H7X A;  5JJ6 A;  1HXI A;  5CCL A;  4I2W A;  1ZU2 A;  1P5Q A;  2MHK A;  5LCW J;  3OXF A;  4J8E A;  4WNF A;  3RJV A;  3CK8 A;  3ASF A;  4A1S A;  2E2E A;  3EDT B;  4NRH B;  5JJ7 A;  1E96 B;  4F3V A;  4UQY A;  3CVQ A;  5HQ8 A;  1YA0 A;  3R9A B;  4HOT A; 
#chains in the Genus database with same CATH topology
 3S7B A;  2WMN A;  4RSY A;  4AY5 A;  3P1U A;  4DJA A;  3HYM B;  3FTY A;  2FF4 A;  5AQ7 A;  4UWK A;  4MLP A;  3FEY A;  3L17 A;  2HR2 A;  3SQV A;  4Q96 A;  4HOR A;  3NOG D;  2ILR A;  2OEV A;  3AG1 E;  3RRU A;  2YHC A;  4G25 A;  3ULE G;  3VLD A;  2OVB A;  4RVB A;  2LAH A;  3G2V A;  3CVV A;  4I1A A;  1UOH A;  4RG9 A;  2XGM A;  4C48 B;  2LUH A;  4EZJ A;  2CHX A;  1U3D A;  3U66 A;  3FU6 A;  2A4Z A;  4GTR A;  3S7D A;  4DI3 A;  3FUI A;  3RK6 A;  1X5B A;  2M63 A;  3HVE A;  4Q94 A;  3RIB A;  1OXJ A;  4CEM A;  3PEU B;  4HXI A;  4DK5 A;  3ESK A;  2V4H C;  1EDU A;  2DBA A;  1WG0 A;  3O48 A;  1NZN A;  2Q7F A;  2ZIR A;  1N0Q A;  1QNF A;  2IOL A;  2R5S A;  3FU3 A;  5EKQ D;  2XGO A;  4XI9 A;  4DX5 D;  1W3B A;  1PC2 A;  4X8Q A;  5ARG A;  4HRL A;  1JCQ A;  4G11 A;  4ME2 A;  4N3B A;  4M3O A;  4GCN A;  1TNO A;  1NI1 A;  3W9G A;  4HOU A;  3CQG B;  2A5E A;  3PH0 C;  3Q5M A;  3CVW A;  4MBG A;  2P9P G;  3ASH A;  2V5F A;  1H6O A;  3SGH A;  1K8K G;  4I9C A;  3L13 A;  5AEN A;  5CCM A;  4HI9 A;  5ENQ D;  2PM7 A;  2CG3 A;  4XKB A;  2BKG A;  1NFI E;  1ELW A;  5G55 A;  5G04 J;  4BWR A;  4HI8 A;  5JJT A;  4EHM A;  2PZI A;  4AM9 A;  3UKR G;  3UM1 A;  4ABN A;  3ZYK A;  5FJY A;  4DRX E;  3AU5 A;  4PS8 A;  4L9P A;  3MV3 B;  1H2T C;  2BED A;  4APF A;  2J09 A;  1O1R A;  4FU3 A;  5BV0 A;  1H6K A;  3CVX A;  3E33 A;  5C2Y A;  3FTV A;  4UI9 J;  4JA7 A;  5CED B;  4DLO A;  2JLB A;  5HS0 A;  5DIZ A;  3UKU G;  2XQ0 A;  1LD7 A;  3CQC B;  3I4G A;  4B0Z A;  4AV7 A;  1HZ4 A;  2WXK A;  1S70 B;  3FH5 A;  1YCS B;  3UT4 A;  3RO2 A;  3Q47 B;  1TN8 A;  4F7A A;  4N2Q A;  3TGO A;  3LKU A;  3RU0 A;  3QNK A;  3SBT B;  5CER B;  4BTB A;  3L08 A;  3AS4 A;  5HKP A;  2BUG A;  4DX1 A;  4UWL A;  2OOE A;  5ITZ F;  3QAR A;  3E32 A;  2LAI A;  3ENE A;  4GZ5 A;  3R7Q A;  5KCM A;  4UI9 C;  1OCO E;  4TUU A;  3BG0 B;  4I6E A;  3G2W A;  4MKT A;  2DWZ A;  1MX6 A;  3Q78 A;  4A3V A;  2QZA A;  2ZU6 B;  5C1D A;  1E90 A;  5FQ6 A;  3PZ2 A;  3ZGQ A;  2C0M A;  4W9R A;  3PS6 A;  5KNH D;  1A17 A;  1N4Q A;  3EIJ A;  3DSU A;  3QJZ A;  3Q75 A;  4APO A;  3G2S A;  1SA4 A;  3QWW A;  3Q15 A;  2KCV A;  3APD A;  2IO3 C;  2WXF A;  2EQX A;  3HXF A;  4IUL A;  3ZHE A;  4JEU A;  4C0M A;  1TN7 A;  3B7U X;  5BT1 A;  4J8Y A;  3CK7 A;  1TJC A;  4WNG A;  3IBE A;  4WWP A;  3ABL E;  2WXN A;  3Q73 A;  2HE0 A;  4HLL A;  1S0P A;  3CEQ A;  1N11 A;  3LCA A;  5JHA A;  3TG5 A;  1D8E A;  4N3A A;  3DEP A;  3Q7A A;  3ONL A;  2VTB B;  1N9A A;  2VQ2 A;  4XE0 A;  5CBO A;  4BEP A;  2ION A;  2DCP A;  1D8D A;  5CBN A;  2P58 C;  5CEC B;  1JCS A;  3NZS A;  4U07 A;  2ETA A;  5KJL A;  3ZW3 A;  5ENR D;  3B7B A;  3JUE A;  3IXE A;  2ZGD A;  3Q9N C;  4R7L A;  4ACL A;  4LEU A;  3UT7 A;  3DSW A;  3JUI A;  3U64 A;  3DST A;  3F6Q A;  3FTS A;  3NB2 A;  5CHE E;  3IV0 A;  5G2N A;  2LSV A;  3ABM E;  3I3N A;  4GTT A;  1S63 A;  3ZXS A;  4ILH B;  4JHR A;  4OAU C;  5FWQ A;  4U8V D;  2LO6 A;  4FA6 A;  2QYU A;  4U0Z A;  4F1P A;  2R03 A;  3UM3 A;  2MRI A;  4BER A;  1LTX A;  3EHQ A;  2LXL A;  2NSZ A;  1UW4 B;  4BSZ B;  2WXL A;  3L6A A;  3Q79 A;  2VJ8 A;  3ASF A;  2R02 A;  2DVW A;  5JMN D;  5E76 A;  3ZKJ A;  4LNB A;  4A1S A;  3T5V A;  4LRZ A;  4BFR A;  3D9N A;  1MX4 A;  2EIJ E;  2BTD A;  2IQC A;  3D9J A;  1JWG A;  4JPS A;  2GRR B;  3OTN A;  2VGE A;  2L6B A;  1BLX B;  1DNP A;  1H2V C;  1N4S A;  3EHR A;  2QFC A;  2GRO B;  3AS8 A;  3W9F A;  3L9T A;  4XI0 A;  1K1A A;  3QK0 A;  3TL5 A;  3K9I A;  2VSO E;  1UJJ A;  3UQ3 A;  5ENS D;  4TUM A;  3NAW A;  2J9Q A;  3S2A A;  4C0E A;  3DBS A;  3GZ2 A;  2LXM A;  2WXO A;  2MOW A;  3HDX A;  1DCQ A;  4G8L A;  4O1O A;  1RW2 A;  1HH8 A;  2WPV A;  2IFU A;  1Z3X A;  3FUL A;  4KVM A;  4ZHB A;  4UQX A;  4CYM D;  3LDZ A;  3CVN A;  1OWO A;  3LVR E;  1IHG A;  2R17 C;  4GYO A;  1E8Y A;  2AXV A;  3ULY A;  1H19 A;  2QC9 A;  4LCT A;  1N4R A;  5BUZ A;  2KAT A;  3SFZ A;  3JQ1 A;  1FCH A;  1N52 A;  2NYJ A;  4Y6W A;  2DYS E;  3LPZ A;  3UXG A;  4JL0 A;  5FQ7 A;  4U95 D;  4E6H A;  4UWH A;  3OAW A;  5CEA A;  2CFZ A;  2VYI A;  2CFU A;  4AIF A;  4F1S A;  4Q69 A;  3C72 A;  3MA5 A;  4LER A;  2V0P A;  2AWI A;  4G26 A;  3RO3 A;  4NUR A;  5B1B E;  2MYO A;  2FI7 A;  2L9B A;  3MCX A;  3UMV A;  4RQI A;  5H7P A;  3SZ7 A;  3JXJ A;  3R9M A;  3U9W A;  3D3M A;  3ZPJ A;  3T5X A;  4XKC A;  3PUK A;  1TNB A;  2VTB A;  2EIK E;  3HXE A;  4UQZ A;  3UIN C;  3PE4 A;  4JW1 A;  4MS6 A;  3FEX A;  1NP7 A;  5LCW C;  3D9M A;  3SY2 A;  3FU5 A;  2Y1L E;  2X6H A;  3BQO A;  2L0I A;  3V2X A;  1TNZ A;  4WUY A;  5ENP D;  3IKO B;  1V54 E;  3E4B A;  1JPL A;  1DC2 A;  1MZC A;  3Q4A B;  2C2L A;  3QC1 A;  2V8S E;  3RKV A;  2J4D A;  2J07 A;  3HRA A;  3TWR A;  3CVY A;  3QOU A;  2X6F A;  2B6C A;  2FO7 A;  3TXM A;  4I43 A;  4BX9 A;  1O1S A;  3JQ0 A;  1HF8 A;  4KT6 B;  5FIO A;  1QYM A;  4WWN A;  4U04 A;  4F53 A;  1LD8 A;  1IYG A;  2OEW A;  4TXQ A;  1SA5 A;  3LY7 A;  3TWV A;  2GW1 A;  2UY1 B;  5BNW A;  3GYZ A;  4EBA G;  5AQ9 A;  2YHE A;  2F8Y A;  2LSU A;  4I2Z A;  3ASD A;  3E34 A;  2VGX B;  1E7V A;  2XS8 A;  3EHM A;  2H6H A;  4J8S A;  2NC9 A;  3UTM A;  3LS8 A;  4FJY A;  2QYJ A;  4YVQ C;  3ASN E;  3PVL A;  3B7S A;  1E8W A;  3BUA A;  5HRY A;  3B7R L;  3FUM A;  3DSS A;  4BT9 A;  3PZD A;  2OV8 A;  3HG0 D;  4P29 A;  4D10 C;  4GYW A;  4FP7 A;  1K3Z D;  3HXC A;  3AG4 E;  3E30 A;  4H7Y A;  1JCR A;  3PEV B;  3ASG A;  2RD0 A;  2XZD G;  5KJN A;  4B94 A;  2PQN A;  3D9P A;  2XS1 A;  4HBD A;  4B8A A;  4A1G A;  2PNN A;  1AP7 A;  3SFY A;  5BW8 C;  3FHE A;  2X38 A;  4B8C B;  3CV0 A;  4NQ0 A;  1HU3 A;  5FT9 A;  3QWP A;  2NXP A;  2AJA A;  3U4T A;  3PNL B;  1SQM A;  4G23 A;  1QBQ A;  2KZT B;  1JWF A;  4BSX A;  3ESL A;  5A6C A;  2F37 A;  4HB5 A;  3KSL A;  4U96 D;  2KBX A;  4U63 A;  2XGS A;  1OWL A;  3KD7 A;  2AVP A;  3BU8 A;  3MKQ A;  1MJ0 A;  4HNA D;  5KWD A;  4GCO A;  2XRY A;  4JB8 P;  4UI9 K;  1MHQ A;  5AQB A;  4L2Y A;  2H6G A;  1FT2 A;  1Y6I A;  2ZXW E;  3TG4 A;  5G04 C;  1FPP A;  2X3M A;  4HOQ A;  3ZYM A;  1Z6T A;  4OAV B;  2Y3A A;  3APC A;  4GZD A;  1IKN D;  3ISM C;  4U0S A;  3JYS A;  5ENO D;  3C3R A;  4AXH A;  3DXK G;  3CSF A;  1WM5 A;  2V4L A;  2XZT G;  5B3S E;  3AAA C;  3MZL B;  5KBA A;  1HO8 A;  3CHQ A;  4OVU A;  4G1T A;  2VSX E;  1EPU A;  1K1B A;  1QZ2 A;  4K5B A;  4K03 A;  2I1K A;  4KZC A;  2L6J A;  2PQR A;  2BKK B;  2PL2 A;  2XCB A;  3SBS A;  5AAO A;  1TYQ G;  2XPZ A;  3UUX A;  4CGV A;  3SHF A;  3MYV A;  2HYZ A;  5AYW D;  5EID A;  3PZ3 A;  3V30 A;  4I2W A;  5D66 A;  3EUV A;  1DCE A;  2L0T B;  4J8E A;  4WNF A;  2X6I A;  4FC8 A;  2KM4 A;  3LEW A;  5JA4 D;  3ONK A;  4HVB A;  4ATG A;  5CMY A;  2CHZ A;  5JJ7 A;  2P9N G;  2QY7 A;  4GTS A;  4UQY A;  3ZU7 B;  5ANL A;  3R9A B;  4HOT A;  4KVO A;  2R2L A;  1N95 A;  2H6F A;  3FP3 A;  1VDY A;  3FTZ A;  4EBA A;  4J0U A;  4JA9 A;  1SZA A;  4L1B A;  4URK A;  3I4R B;  4I6J A;  1HG5 A;  1Y8M A;  2UY1 A;  3ZNG A;  2DZN A;  4YDY A;  3TWW A;  5EDS A;  2WXH A;  1ELR A;  2YNQ A;  3HIZ A;  3HXD A;  3TJP A;  3G2U A;  1TNU A;  1IHB A;  4G8K A;  4JEH A;  4JZY A;  2GRN B;  1OY3 D;  3ZXP A;  3UM2 A;  4DX7 D;  2EIL E;  3FUD A;  4IYP A;  4KBQ A;  4GU5 A;  3SO8 A;  3FH7 A;  4BES A;  1YYH A;  2XEV A;  5J08 A;  2YQ8 A;  2WQH A;  3ZUV B;  4BY6 A;  3V2O A;  2X6J A;  4J8F A;  2WXQ A;  3PDN A;  4XEI G;  4DX6 D;  3EU9 A;  4U8Y D;  3O4Z A;  4L2L A;  4G24 A;  3FWV A;  2J4B A;  2WB2 A;  1V55 E;  3HVE B;  4TXR A;  5CRU A;  5FIN A;  1IQU A;  4HOS A;  3CHR A;  4ILG A;  4GTO A;  3URZ A;  4LSZ E;  1H0A A;  3Q7F A;  1HFA A;  4CT4 A;  4N5Q A;  3CK9 A;  2A5U A;  1MQS A;  4L7T A;  4YDO A;  2R05 A;  1ZBP A;  4GTM A;  3UM0 A;  4U0U A;  4CZ2 D;  3FUJ A;  5EIB E;  3QAQ A;  3RSE G;  2GRP B;  2IO2 C;  1OUV A;  4JVS A;  3KSQ A;  4BET A;  3VLF A;  4U8H A;  4J6I A;  4JHK A;  1KZP A;  5CRV A;  4YND A;  3FTU A;  2AW6 A;  2RFM A;  2EIN E;  4FLH A;  1Z3Y A;  4FJZ A;  1NA3 A;  2XHE A;  4GYY A;  3UIO C;  1KT1 A;  1N54 A;  4A63 B;  4JHJ A;  5AIJ A;  3D9L A;  1D9S A;  5ARF A;  2VSN A;  3NF1 A;  4AOF A;  3OXL A;  2WXP A;  3DPY A;  1U2V G;  4F6R D;  3AU4 A;  4YVO A;  5KNG A;  3VTY A;  2J8S D;  1O1T A;  2WMO A;  3MX3 A;  3TAX A;  2XPI A;  3LJN A;  5T4Y A;  2GRM A;  2H6I A;  5AN8 A;  3B13 A;  3B95 A;  3PUJ A;  4U7E B;  2ETC A;  3L54 A;  5EYL A;  3FY4 A;  1PAQ A;  4XZ4 A;  4MRU A;  1FVH A;  5AAR A;  2X6K A;  3E37 A;  3D9I A;  4FHJ A;  4KXK B;  3L16 A;  5EYP F;  1BI8 B;  1E7U A;  3L22 A;  4AVX A;  4I9E A;  3T8M A;  5EN5 D;  3DSX A;  4ANV A;  3I5P A;  1BD8 A;  5JHB A;  3T9K A;  5FQ4 A;  1YMP A;  1QQE A;  1Q2Z A;  2WXG A;  1BU9 A;  1B89 A;  2ZIS A;  4NAC A;  2R59 A;  1KLX A;  2OND A;  3FTX A;  3B7T A;  3CHS A;  3D9O A;  3BG1 B;  4GTQ A;  4Y6C A;  4AY6 A;  4FUL A;  1UG3 A;  2F0Y A;  4HQD A;  5G05 J;  3X2Q E;  3UPV A;  1SW6 A;  3SI5 A;  3D9K A;  2P9U G;  2WQ7 A;  3ZHE B;  2F8X K;  1MX2 A;  3CKC A;  5HI7 A;  1U3C A;  4G2V A;  3NQP A;  1EYH A;  1Z5S C;  3ZYQ A;  3T8K A;  3CLJ A;  5KJM A;  2FO1 E;  2KC7 A;  5ENT D;  4GA0 A;  4XIF A;  4EEC A;  3ML9 A;  4C9B B;  3BEE A;  2UWJ G;  3Q9U C;  3GW4 A;  5G05 C;  4K5C A;  4KYO B;  4PS3 A;  5EX3 A;  3S7J A;  4DUI A;  4N39 A;  3QB2 A;  3QWV A;  2P2C P;  2YIN A;  3CIA A;  5A7D B;  4A3T A;  4AP2 A;  5FZR A;  4HS2 A;  4AEZ C;  4N2S A;  2I1J A;  3RRM B;  3MGB A;  2Y69 E;  4TRQ A;  2OVF A;  3DEO A;  4B93 B;  1BI7 B;  4LNG A;  2IOS A;  5ANR A;  1OCR E;  4WNE A;  5M72 A;  5IY5 E;  3P2B A;  3N71 A;  4CDM A;  1HE8 A;  4BTA A;  1N0R A;  4H7X A;  5JJ6 A;  3SD5 A;  3UIP C;  5CCL A;  4A55 A;  2PM6 A;  3HHM A;  4DX2 A;  1P5Q A;  4QQI A;  3ZEF A;  5LOZ A;  4PDX A;  5BXO A;  4XX5 A;  3L82 A;  3RJV A;  4FAD A;  5BV1 A;  1O5M A;  3MJW A;  2GGF A;  4LUN U;  2WXI A;  1BPO A;  4NIK A;  1TNY A;  3UT8 A;  2E2E A;  3EDT B;  4NRH B;  4UUC A;  4EPZ A;  1E96 B;  4K5A B;  4F3V A;  2BF0 X;  4O1P A;  3KEZ A;  3TWQ A;  4JC8 A;  3TWT A;  1HG2 A;  4B89 A;  1WY6 A;  4GPK A;  3LY9 A;  3C3Q A;  2VGY A;  4FLB A;  3QKY A;  3ZFW A;  3SF4 A;  3UI2 A;  2IU1 A;  3WG7 E;  3GZ1 A;  1IXV A;  3ZYL A;  4RG6 A;  4JD2 G;  2XRZ A;  1AWC B;  1ELK A;  5KJK A;  4FHK A;  3EHN A;  4EZL A;  1TN6 A;  3TWX A;  3PE3 A;  3FUK A;  2KCK A;  3C3O A;  5B1A E;  1H2U A;  3LYA A;  4GZ6 A;  4ATZ D;  3VTX A;  1HX8 A;  2FBN A;  4YDW A;  5LFA A;  1XNF A;  2WVI A;  1UN8 A;  3SFX A;  2RFA A;  3EIQ C;  4QFV A;  2XPY A;  3AJI A;  3CR3 A;  4LG6 A;  3NZU A;  3ML8 A;  2IEJ A;  4GA1 A;  3AS5 A;  3J5Q B;  3EU5 A;  3FH8 A;  3TWS A;  1LF8 A;  4TV3 A;  1KZO A;  3Q49 B;  2CG2 A;  1A5E A;  4DPR A;  4GMJ A;  5ENN A;  3FDH A;  4HFG A;  1N94 A;  4CRW A;  4GMR A;  3MV2 B;  3UX4 A;  4L23 A;  3RRN B;  3S7F A;  3CHO A;  1E8X A;  3CKB A;  3D9H A;  4RLY A;  3FUE A;  2I9C A;  1UN9 A;  1WAO 1;  3DRA A;  1WDY A;  3DPD A;  4TXP A;  4CGW A;  1EF1 C;  3ZVV A;  1GW6 A;  1NA0 A;  2AXZ A;  4ACK A;  3ZIM A;  4GTV A;  4DLQ A;  2RKK A;  5FZS A;  1OCZ E;  4N3C A;  2IJG X;  4BT8 A;  1OCC E;  4J7W A;  2JAB A;  3DSV A;  2FUL A;  2DZO A;  3J5P A;  4UWF A;  3EJN A;  1ZB1 A;  3PZ1 A;  2IF4 A;  4PS7 A;  4CDR A;  1MYO A;  1H6P A;  3MKR A;  4GZC A;  3LVQ E;  3NOC D;  2VGX A;  4HLE A;  3U3W A;  2FEZ A;  4WAF A;  1TJF A;  5EIL A;  4E85 A;  2I2O A;  2KCL A;  4UWG A;  4O6F A;  4GPM A;  4GML A;  4IRU A;  4OYS A;  3ULQ A;  2RG8 A;  3PRE A;  3IHY A;  5AJL A;  5EX0 A;  2DIW A;  4GB9 A;  2V5Q C;  4ZFH A;  4KZ0 A;  5J90 A;  4ANX A;  1N4P A;  1SVX A;  4HRN A;  3LY8 A;  3G2T A;  4EQF A;  3RAU A;  2ETB A;  3GZS A;  4LNU D;  3C5R A;  4DI4 A;  4I1M A;  5BPP A;  3FFL A;  3NBN B;  3WXX A;  5LP0 A;  2Y4T A;  2JEK A;  1JUQ A;  3ABK E;  1XGW A;  3HXB A;  4WWO A;  4IN3 B;  2LNI A;  4J8D A;  4K0R A;  1L5J A;  1OWM A;  3CHM A;  5T8I A;  2WXR A;  2KXP C;  2P9S G;  2KZT A;  3FUF A;  4V3I A;  2P9I G;  3PZ4 A;  4PH4 B;  4HRM B;  2P9L G;  2I6H A;  4GZ3 A;  3SNX A;  2WXJ A;  1KPS B;  5D0O D;  3AG2 E;  4GA2 A;  4N5C A;  3CVL A;  1KT0 A;  3CVP A;  4I17 A;  1OT8 A;  3R7R A;  1SZ9 A;  5BXU A;  1NL4 A;  4AJW A;  2AXU A;  3PRZ A;  4CT0 A;  3DXM G;  1INZ A;  4CDN A;  3ASO E;  3FTW A;  4YDE A;  5DBK A;  5LX8 A;  2OCC E;  2P9K G;  4CCA A;  3JCK C;  2XCC A;  3IEG A;  3ZN3 A;  2XEN A;  1DVP A;  5T3R A;  1UJK A;  3JXI A;  3TXN A;  3V31 A;  4OVV A;  3CHP A;  4ILI A;  3TWU A;  3KAE A;  3MEK A;  3ZRH A;  1X81 A;  2DYR E;  4BX8 A;  4GAA A;  5D0Q D;  5FZQ A;  3VLE A;  1E8Z A;  3KEA A;  3KS2 A;  2J49 A;  4ANW A;  2CHW A;  3V79 K;  5AQA A;  1OWP A;  3CST A;  2HO1 A;  3CVU A;  2C0L A;  5A23 A;  3FU0 A;  2E0I A;  3PNT B;  4JXT A;  1HS6 A;  2GRL A;  4EZK A;  3MKQ B;  1IQR A;  4I1O B;  2WQ6 A;  3FUH A;  2HM8 A;  5AJD A;  3C98 A;  2VSY A;  3LXU X;  2EIM E;  3IHV A;  4WND A;  5CMW A;  3OXG A;  1TR4 A;  5FTP A;  2XEH A;  2Y4U A;  5D2M C;  3QDN A;  5FQ8 A;  1HXI A;  2Y0B G;  3DWL G;  3FUN A;  1ZU2 A;  2MHK A;  4GTP A;  5LCW J;  4O60 A;  2B0O E;  1FT1 A;  3OXF A;  4ANU A;  4I6G A;  4M7C A;  3CK8 A;  1S64 A;  3AG3 E;  3LJ3 A;  2GRQ B;  1G3N B;  1PY1 A;  1OWN A;  1TEZ A;  3APF A;  4KMO A;  1RZ4 A;  2IY0 C;  3CVQ A;  4PUC A;  2WM9 A;  4Z68 A;  5HQ8 A;  3CGH A;  1YA0 A;  5E75 A;  2XEE A;  2ZGG A;  2WXM A;  2J08 A;  1FVF A; 
#chains in the Genus database with same CATH homology
 1HG2 A;  4KVO A;  3S7B A;  3FP3 A;  1VDY A;  2WMN A;  3FTZ A;  4RSY A;  4AY5 A;  3P1U A;  4EBA A;  4J0U A;  1DNP A;  4DJA A;  3HYM B;  4JA9 A;  1SZA A;  1H2V C;  2FF4 A;  3FTY A;  4B89 A;  4L1B A;  1WY6 A;  4URK A;  4GPK A;  2QFC A;  4UWK A;  3I4R B;  3AS8 A;  4MLP A;  3FEY A;  4I6J A;  3LY9 A;  1HG5 A;  3L17 A;  1Y8M A;  2HR2 A;  2UY1 A;  2VGY A;  3QKY A;  4FLB A;  4Q96 A;  4XI0 A;  3ZFW A;  4HOR A;  2ILR A;  3SF4 A;  2IU1 A;  3QK0 A;  3RRU A;  3TL5 A;  3K9I A;  2YHC A;  2VSO E;  1UJJ A;  4G25 A;  3GZ1 A;  3UQ3 A;  3VLD A;  2OVB A;  4RVB A;  5EDS A;  2WXH A;  2LAH A;  4RG6 A;  3ZYL A;  2XRZ A;  1ELK A;  3G2V A;  2J9Q A;  5KJK A;  3CVV A;  3S2A A;  4FHK A;  1ELR A;  3EHN A;  4I1A A;  4RG9 A;  2XGM A;  4EZL A;  4EZJ A;  4C0E A;  2CHX A;  1U3D A;  3DBS A;  3GZ2 A;  2YNQ A;  3PE3 A;  3HIZ A;  3TJP A;  2WXO A;  3FUK A;  2KCK A;  2MOW A;  3U66 A;  3FU6 A;  3HDX A;  2A4Z A;  3S7D A;  3G2U A;  4DI3 A;  4JEH A;  4JZY A;  3FUI A;  3RK6 A;  1H2U A;  3LYA A;  1HH8 A;  2WPV A;  1X5B A;  2IFU A;  2M63 A;  3HVE A;  4GZ6 A;  4Q94 A;  1Z3X A;  3RIB A;  4CEM A;  3FUL A;  3VTX A;  1HX8 A;  2FBN A;  3FUD A;  4KVM A;  3PEU B;  4IYP A;  4KBQ A;  4UQX A;  5LFA A;  4GU5 A;  1XNF A;  4HXI A;  2WVI A;  4DK5 A;  3LDZ A;  3ESK A;  3CVN A;  1UN8 A;  1OWO A;  1EDU A;  2DBA A;  3O48 A;  1NZN A;  2Q7F A;  3LVR E;  3EIQ C;  1IHG A;  3FH7 A;  2R17 C;  4GYO A;  1E8Y A;  1QNF A;  2AXV A;  2IOL A;  4QFV A;  2XPY A;  2XEV A;  3CR3 A;  2R5S A;  3FU3 A;  5EKQ D;  5J08 A;  1H19 A;  2YQ8 A;  3NZU A;  2WQH A;  2XGO A;  4XI9 A;  3ML8 A;  1W3B A;  4BY6 A;  1PC2 A;  4LCT A;  2X6J A;  4GA1 A;  3AS5 A;  2WXQ A;  3PDN A;  4J8F A;  3FH8 A;  5ARG A;  5BUZ A;  2KAT A;  1LF8 A;  3SFZ A;  4G11 A;  3O4Z A;  4ME2 A;  3JQ1 A;  4TV3 A;  1FCH A;  4L2L A;  1N52 A;  4N3B A;  4G24 A;  3FWV A;  4M3O A;  4Y6W A;  3Q49 B;  2CG2 A;  3LPZ A;  2J4B A;  4DPR A;  4GCN A;  4GMJ A;  2WB2 A;  3HVE B;  5ENN A;  4JL0 A;  3FDH A;  5FQ7 A;  4HFG A;  4CRW A;  4E6H A;  3MV2 B;  4HOU A;  4UWH A;  3UX4 A;  3OAW A;  2CFZ A;  2VYI A;  3CQG B;  4L23 A;  2CFU A;  3PH0 C;  3Q5M A;  3CVW A;  1IQU A;  3RRN B;  4HOS A;  3S7F A;  3CHO A;  3CHR A;  4AIF A;  4ILG A;  4F1S A;  4Q69 A;  1E8X A;  3ASH A;  2V5F A;  3CKB A;  3MA5 A;  3URZ A;  4LER A;  2V0P A;  2AWI A;  3FUE A;  2I9C A;  1UN9 A;  1WAO 1;  4G26 A;  3RO3 A;  1H0A A;  4NUR A;  3SGH A;  1HFA A;  3DPD A;  4I9C A;  3L13 A;  2FI7 A;  2L9B A;  3MCX A;  3UMV A;  3CK9 A;  4CT4 A;  5AEN A;  4CGW A;  2A5U A;  5CCM A;  1MQS A;  4L7T A;  1EF1 C;  2PM7 A;  3ZVV A;  1ZBP A;  2CG3 A;  1GW6 A;  3OTN A;  1NA0 A;  2AXZ A;  4U0U A;  4XKB A;  4ACK A;  3FUJ A;  3ZIM A;  4DLQ A;  3QAQ A;  3SZ7 A;  5FZS A;  3U9W A;  3D3M A;  3ZPJ A;  3T5X A;  4XKC A;  3PUK A;  4N3C A;  1OUV A;  2VTB A;  2IJG X;  4JVS A;  4UQZ A;  4BT8 A;  1ELW A;  5G55 A;  3PE4 A;  3VLF A;  4U8H A;  4J6I A;  5G04 J;  4JHK A;  4JW1 A;  4BWR A;  2FUL A;  5JJT A;  2PZI A;  4YND A;  4MS6 A;  3FTU A;  2AW6 A;  3FEX A;  4AM9 A;  1NP7 A;  4UWF A;  3EJN A;  5LCW C;  3D9M A;  2IF4 A;  3FU5 A;  4PS7 A;  4ABN A;  4CDR A;  2X6H A;  4FLH A;  3ZYK A;  2L0I A;  1Z3Y A;  5FJY A;  4WUY A;  3IKO B;  3E4B A;  3AU5 A;  4PS8 A;  3MKR A;  4GZC A;  1JPL A;  4FJZ A;  3LVQ E;  3MV3 B;  3Q4A B;  1H2T C;  2C2L A;  1NA3 A;  4APF A;  2J09 A;  3QC1 A;  4FU3 A;  2XHE A;  2VGX A;  2V8S E;  5BV0 A;  4HLE A;  3U3W A;  2FEZ A;  4GYY A;  1H6K A;  3CVX A;  4WAF A;  1TJF A;  3RKV A;  1KT1 A;  2J4D A;  2J07 A;  5C2Y A;  3FTV A;  3CVY A;  4E85 A;  1N54 A;  2I2O A;  2KCL A;  3QOU A;  4JA7 A;  4UI9 J;  2X6F A;  4UWG A;  4DLO A;  2JLB A;  4JHJ A;  4O6F A;  5AIJ A;  3D9L A;  5ARF A;  4GML A;  5DIZ A;  4IRU A;  2FO7 A;  4OYS A;  2XQ0 A;  4I43 A;  3TXM A;  2VSN A;  3NF1 A;  4BX9 A;  1TEZ A;  3JQ0 A;  3ULQ A;  1HF8 A;  3CQC B;  4KT6 B;  2RG8 A;  3PRE A;  4AOF A;  3IHY A;  3OXL A;  5AJL A;  3I4G A;  5EX0 A;  2DIW A;  2WXP A;  4GB9 A;  4B0Z A;  1HZ4 A;  4AV7 A;  4WWN A;  2WXK A;  4U04 A;  3FH5 A;  4F53 A;  1IYG A;  4KZ0 A;  5J90 A;  3AU4 A;  3LY7 A;  3RO2 A;  3Q47 B;  4YVO A;  2GW1 A;  3UT4 A;  4ANX A;  4F7A A;  4N2Q A;  2UY1 B;  3VTY A;  3TGO A;  5BNW A;  3GYZ A;  4EBA G;  2YHE A;  2WMO A;  3LKU A;  3LY8 A;  2LSU A;  3MX3 A;  3QNK A;  4I2Z A;  3RU0 A;  3G2T A;  3TAX A;  2XPI A;  4EQF A;  3ASD A;  3SBT B;  2VGX B;  5T4Y A;  3GZS A;  1E7V A;  4BTB A;  2GRM A;  3L08 A;  3AS4 A;  3EHM A;  4DI4 A;  2BUG A;  4UWL A;  3B13 A;  2OOE A;  4I1M A;  2NC9 A;  4J8S A;  3QAR A;  5BPP A;  2LAI A;  3ENE A;  3LS8 A;  3PUJ A;  3FFL A;  4FJY A;  3WXX A;  4GZ5 A;  3R7Q A;  5KCM A;  4UI9 C;  5LP0 A;  2Y4T A;  2JEK A;  1JUQ A;  4YVQ C;  4TUU A;  3L54 A;  1XGW A;  4WWO A;  4IN3 B;  2LNI A;  3BG0 B;  3FY4 A;  4I6E A;  4J8D A;  3G2W A;  4K0R A;  1L5J A;  3PVL A;  1OWM A;  3B7S A;  1E8W A;  1PAQ A;  4MKT A;  4A3V A;  3B7R L;  2ZU6 B;  3FUM A;  4MRU A;  4XZ4 A;  5C1D A;  4BT9 A;  1E90 A;  1FVH A;  2OV8 A;  3CHM A;  3PZD A;  4P29 A;  5FQ6 A;  3ZGQ A;  4D10 C;  5T8I A;  2C0M A;  2X6K A;  4W9R A;  2WXR A;  4GYW A;  3D9I A;  4FHJ A;  4FP7 A;  4KXK B;  3L16 A;  3PS6 A;  2KZT A;  1E7U A;  3L22 A;  3FUF A;  4V3I A;  4H7Y A;  1A17 A;  4AVX A;  4PH4 B;  3PEV B;  3ASG A;  3EIJ A;  4I9E A;  3T8M A;  2RD0 A;  2I6H A;  3QJZ A;  4GZ3 A;  5KJN A;  4APO A;  3G2S A;  3QWW A;  3SNX A;  2WXJ A;  5D0O D;  3Q15 A;  4GA2 A;  2KCV A;  3APD A;  4N5C A;  4B94 A;  3CVL A;  4ANV A;  2PQN A;  1KT0 A;  2WXF A;  2EQX A;  3CVP A;  3D9P A;  4I17 A;  3I5P A;  4IUL A;  3ZHE A;  4B8A A;  4A1G A;  5JHB A;  5FQ4 A;  4JEU A;  3R7R A;  4C0M A;  1QQE A;  1SZ9 A;  5BW8 C;  3B7U X;  3FHE A;  5BT1 A;  2X38 A;  4B8C B;  3CV0 A;  3CK7 A;  1TJC A;  4NQ0 A;  4AJW A;  4WNG A;  3IBE A;  1HU3 A;  2WXG A;  4WWP A;  2AXU A;  5FT9 A;  1B89 A;  3PRZ A;  4CT0 A;  1INZ A;  3QWP A;  2NXP A;  2WXN A;  4NAC A;  4CDN A;  3U4T A;  3PNL B;  2R59 A;  1KLX A;  2OND A;  3FTX A;  1SQM A;  4G23 A;  3B7T A;  2KZT B;  3CHS A;  3D9O A;  3FTW A;  3BG1 B;  1JWF A;  5DBK A;  4BSX A;  3ESL A;  4Y6C A;  1S0P A;  5LX8 A;  4AY6 A;  4CCA A;  4FUL A;  3JCK C;  5A6C A;  1UG3 A;  2XCC A;  3IEG A;  3CEQ A;  3ZN3 A;  4U63 A;  1DVP A;  5T3R A;  2XGS A;  1OWL A;  3KD7 A;  5G05 J;  1UJK A;  2AVP A;  3UPV A;  3SI5 A;  3LCA A;  5JHA A;  3TXN A;  3D9K A;  3TG5 A;  3MKQ A;  2WQ7 A;  4N3A A;  4OVV A;  3ZHE B;  3CHP A;  3ONL A;  3CKC A;  4ILI A;  5HI7 A;  3KAE A;  4GCO A;  2XRY A;  2VTB B;  3MEK A;  4UI9 K;  1MHQ A;  1U3C A;  3ZRH A;  4L2Y A;  2VQ2 A;  4G2V A;  4XE0 A;  3NQP A;  2ION A;  1EYH A;  1Y6I A;  3ZYQ A;  4BX8 A;  3TG4 A;  2DCP A;  5G04 C;  4GAA A;  5D0Q D;  5FZQ A;  3CLJ A;  3VLE A;  5KJM A;  2X3M A;  1E8Z A;  2P58 C;  3KS2 A;  4HOQ A;  2KC7 A;  3NZS A;  2J49 A;  4ANW A;  4U07 A;  1Z6T A;  4GA0 A;  3ZYM A;  2Y3A A;  4XIF A;  2CHW A;  5KJL A;  3ZW3 A;  3APC A;  4GZD A;  1OWP A;  4EEC A;  3ML9 A;  3CST A;  2HO1 A;  4C9B B;  3BEE A;  2C0L A;  3CVU A;  2UWJ G;  5A23 A;  3FU0 A;  2E0I A;  3GW4 A;  3PNT B;  4R7L A;  4JXT A;  1HS6 A;  3JYS A;  4U0S A;  2GRL A;  4EZK A;  5G05 C;  4ACL A;  3MKQ B;  4LEU A;  3UT7 A;  1IQR A;  4KYO B;  4PS3 A;  5EX3 A;  4AXH A;  4I1O B;  3S7J A;  2WQ6 A;  3FUH A;  2HM8 A;  4N39 A;  3CSF A;  5AJD A;  1WM5 A;  2V4L A;  3JUI A;  3QB2 A;  3U64 A;  3QWV A;  2YIN A;  3FTS A;  3C98 A;  3CIA A;  5A7D B;  4A3T A;  4AP2 A;  2VSY A;  3MZL B;  5CHE E;  5FZR A;  3LXU X;  1HO8 A;  4HS2 A;  3IHV A;  4AEZ C;  4WND A;  3CHQ A;  4OVU A;  4N2S A;  4G1T A;  2VSX E;  3IV0 A;  1EPU A;  2I1J A;  5CMW A;  1QZ2 A;  3OXG A;  4K03 A;  5G2N A;  2LSV A;  2I1K A;  3RRM B;  5FTP A;  4KZC A;  3MGB A;  4TRQ A;  2L6J A;  3I3N A;  2PQR A;  2OVF A;  2Y4U A;  3ZXS A;  2IOS A;  2PL2 A;  4ILH B;  5ANR A;  2XCB A;  4JHR A;  3SBS A;  4WNE A;  5FWQ A;  5M72 A;  2LO6 A;  2XPZ A;  3UUX A;  3P2B A;  3N71 A;  3SHF A;  4CGV A;  4CDM A;  1HE8 A;  2HYZ A;  3MYV A;  4FA6 A;  4BTA A;  5AYW D;  3QDN A;  4U0Z A;  5FQ8 A;  4H7X A;  5JJ6 A;  1HXI A;  3SD5 A;  5CCL A;  4A55 A;  2MRI A;  2PM6 A;  3FUN A;  4I2W A;  3HHM A;  1ZU2 A;  1P5Q A;  2MHK A;  2NSZ A;  3ZEF A;  5LCW J;  5LOZ A;  4PDX A;  1UW4 B;  2WXL A;  3OXF A;  4XX5 A;  3L6A A;  4ANU A;  2L0T B;  4J8E A;  4I6G A;  4WNF A;  3RJV A;  4FAD A;  2VJ8 A;  3CK8 A;  2X6I A;  5BV1 A;  3ASF A;  3MJW A;  4FC8 A;  2KM4 A;  3LJ3 A;  2GGF A;  4LUN U;  3LEW A;  2WXI A;  3ONK A;  4HVB A;  1BPO A;  1OWN A;  1PY1 A;  5E76 A;  4ATG A;  5CMY A;  3UT8 A;  2CHZ A;  4A1S A;  3T5V A;  2E2E A;  3EDT B;  3APF A;  4LRZ A;  4KMO A;  4NRH B;  4BFR A;  5JJ7 A;  4EPZ A;  1E96 B;  3D9N A;  2QY7 A;  4F3V A;  2BF0 X;  2BTD A;  2IQC A;  4UQY A;  3CVQ A;  4PUC A;  2WM9 A;  3D9J A;  5ANL A;  5HQ8 A;  3CGH A;  1YA0 A;  3KEZ A;  5E75 A;  3R9A B;  1JWG A;  4HOT A;  4JPS A;  2WXM A;  2J08 A;  4JC8 A;  1FVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...