1INZA

Solution structure of the epsin n-terminal homology (enth) domain of human epsin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
b'GSSRMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPS15-INTERACTING PORTEIN(EPSIN)
publication title Solution structure of the epsin N-terminal homology (ENTH) domain of human epsin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2000-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1inzA00
3G2WA 1JWFA 4GZCA 1HG5A 1SZ9A 1SZAA 3D9JA 3ONKA 3G2UA 3ONLA 2BF0X 4FU3A 1XGWA 4NACA 1HX8A 2LO6A 3D9KA 3G2SA 1JWGA 1UJJA 4JXTA 3RRUA 1LF8A 3ZYLA 2L0IA 5J08A 4Q94A 2V8SE 3LDZA 3ZYQA 4FLBA 2KM4A 3D9OA 3D9PA 1UJKA 2QY7A 3G2VA 1HF8A 4Q96A 3ZYMA 1HG2A 1JPLA 2DIWA 4HFGA 3ZYKA 1VDYA 1H0AA 1EYHA 5CMYA 5LP0A 1MHQA 3D9NA 4GZDA 3G2TA 2DCPA 1INZA 2L0TB 1X5BA 3CLJA 3D9IA 2MOWA 1DVPA 5CMWA 5LOZA 1JUQA 1ELKA 3D9LA 3D9MA 4AVXA 1EDUA 1PY1A 1HFAA
chains in the Genus database with same CATH superfamily
4LNUD 2AXZA 3LY8A 2Y0BG 3E33A 5KWDA 4JW1A 1N95A 5FQ6A 3NF1A 4L2LA 2X6JA 3Q9UC 5E75A 4HFGA 1H6PA 1IXVA 5HS0A 5BXUA 4TXPA 3G2TA 4KT6B 5LOZA 3E37A 3UI2A 2R5SA 3FEXA 4CT0A 4YDOA 4CEMA 1K3ZD 3DWLG 2IFUA 2WQHA 3ASDA 4XI9A 3UT7A 1WM5A 2L0TB 3R7RA 5D0OD 4F3VA 3KS2A 3TG5A 4X8QA 3EU5A 2P9IG 2GROB 1E7UA 2C0MA 1TEZA 2VSNA 4LUNU 5JMND 2FO7A 3SZ7A 5KJNA 1S63A 5FQ8A 4BEPA 2XRZA 1NA3A 4UQZA 3PEUB 2PZIA 4RVBA 3S7JA 4UI9C 1YA0A 2ETCA 2VSOE 1N4QA 4UWLA 1K1AA 3SBSA 4GTPA 2VJ8A 5IY5E 5LCWJ 3T8KA 4W9RA 4NIKA 4N3AA 4M3OA 2ZISA 3LJ3A 2VTBA 5KJLA 3OAWA 3SY2A 4LEUA 2GGFA 4EBAA 4FLBA 1TN7A 3F6QA 4HVBA 2QFCA 3UM2A 3JXJA 4L9PA 4RG9A 1H19A 1JUQA 1OWPA 3QAQA 3ZXSA 4LRZA 3AG3E 4JXTA 3B7SA 3RRUA 1K8KG 1UOHA 3L16A 4U8VD 2Q7FA 3UM0A 1OWNA 3I3NA 4XKBA 2L6JA 4A55A 4OVVA 2WXOA 4BT8A 3SD5A 3ML9A 1OXJA 3HVEB 4U04A 2VGXB 4UUCA 4A3VA 5AENA 3T8MA 1Z3YA 4XZ4A 4CDMA 4LNGA 2GRNB 2ZGDA 4F7AA 2EIJE 1HXIA 1FT1A 4G1TA 1RW2A 3FHEA 4N5QA 1DVPA 4ILIA 3LKUA 4ILGA 3ASFA 1IYGA 5AYWD 4AXHA 1BPOA 4HOUA 4U0UA 3ZYQA 5HKPA 2KZTA 2UY1A 3EIJA 5J90A 2YHEA 3D9NA 2AXVA 4JEHA 2YHCA 4MKTA 4BFRA 4BETA 5AQ7A 2VSYA 1DCEA 3NZUA 5CERB 4YNDA 3HXCA 3TAXA 3CSFA 3Q4AB 3TWVA 3FU5A 3VTYA 3CHSA 2P2CP 2LNIA 3NOGD 3QK0A 3UIPC 4CGWA 4DX2A 2YINA 4TXRA 4UWFA 4CT4A 2H6GA 3PH0C 3CHQA 4MS6A 3E4BA 5B1AE 3ZYMA 2J8SD 3SQVA 4A1GA 2WB2A 3ASNE 4BTBA 3LY7A 4O6FA 4A1SA 5T3RA 4GTTA 3ULEG 3PS6A 3VLDA 3NOCD 5CHEE 3GZ1A 2V5FA 3B7BA 1E8XA 1IHGA 1A5EA 3MV3B 3UKRG 1INZA 4RSYA 4J8DA 5BUZA 1N52A 2LAIA 4ILHB 2ZXWE 3R9AB 4AOFA 4WAFA 2YNQA 5BV0A 4HLEA 3QWWA 2IOLA 1WDYA 4GZDA 1IQRA 2RG8A 3CVYA 1N94A 3TWWA 2OCCE 1KLXA 5DBKA 3V31A 3RU0A 1MQSA 3T5VA 1NFIE 1OCOE 1OCRE 3DXKG 2IEJA 2WXLA 2B6CA 4BESA 4G23A 3S7DA 4U0SA 3Q7AA 5AIJA 3PNTB 3CK7A 4GZ3A 3FUNA 3L54A 3LDZA 4JEUA 3BEEA 3L82A 4JHKA 3FULA 2KATA 1HG2A 2NYJA 2WMNA 4APOA 1U2VG 4ZHBA 4NURA 1ZU2A 3JQ0A 3TGOA 2RKKA 1BLXB 3QWPA 4E85A 1P5QA 4XKCA 3C72A 4JHJA 3LCAA 3TWSA 3ZIMA 4M7CA 1WY6A 2VYIA 2V4HC 5CMWA 2AJAA 4I9CA 4GTQA 4G26A 5ARGA 3L6AA 4P29A 1XGWA 4NACA 3E30A 4ZFHA 5LFAA 2IONA 3CHMA 3UT4A 3AS4A 2OEWA 4Y6CA 4TXQA 5AQBA 3WXXA 3K9IA 3R9MA 3QWVA 4RLYA 4YVQC 4BTAA 4JHRA 3FH7A 4N5CA 1FVFA 1FT2A 3CGHA 3X2QE 4F6RD 4GA1A 2X6HA 3NB2A 2X38A 2XEHA 3CK9A 5KCMA 2UY1B 3HXFA 1W3BA 2R02A 2XCBA 3C3RA 3FTUA 3FUKA 2F0YA 3QNKA 4KMOA 5M72A 3U66A 3QB2A 1BI8B 3SF4A 5G04J 1N0RA 4B89A 3OTNA 1NA0A 3WG7E 1Z5SC 3AAAC 3R7QA 2I1JA 4F1SA 4K03A 4PS7A 2L6BA 3NZSA 2WXKA 4BSZB 4MBGA 1O1RA 2P9NG 3TG4A 3CV0A 4K5AB 1D8EA 2Y4UA 2ZGGA 1N4RA 3T9KA 4KZCA 2H6IA 4HS2A 4GYWA 2KC7A 3EHQA 1L5JA 3CKBA 3ZHEA 2ZU6B 3UQ3A 4I6EA 1O1TA 4YDEA 2XGMA 4B93B 4ATZD 5C1DA 1ELKA 4DX7D 1KZPA 2XPIA 1NZNA 5JHBA 3FUIA 4UQYA 4WNFA 3P2BA 1OT8A 1UW4B 3DSTA 4FHJA 5EYPF 4EZKA 2CHXA 4B8CB 4OVUA 4U63A 4IULA 4JA9A 3NAWA 2WVIA 2P9KG 1MZCA 4OAUC 4FU3A 2LO6A 4N2QA 3SO8A 3EIQC 4HOTA 1OY3D 4O1OA 2HO1A 3V2XA 1E96B 3UXGA 4E6HA 2P9SG 5A6CA 3VLFA 5ARFA 1SVXA 5ENRD 4CDNA 3D9LA 3B7UX 4GTVA 4HOQA 4UWKA 2DYRE 2YQ8A 3B95A 3PZ2A 2LXLA 2F37A 4TUMA 2L9BA 2X6FA 4DI4A 1H6KA 3L13A 4EHMA 2GRQB 2WXGA 5HQ8A 2WXJA 2F8YA 2KCKA 4XI0A 3AG4E 4GMJA 4DPRA 2MOWA 2FULA 2H6HA 4V3IA 2HM8A 3HDXA 1B89A 1DC2A 5CEDB 5D2MC 2A4ZA 3I5PA 3DRAA 4BY6A 3L17A 3CQGB 4YDWA 3B13A 2E2EA 4WWPA 4CDRA 3SFXA 2GRRB 4I6JA 3ABME 1H2TC 5FWQA 4QFVA 3B7RL 3LXUX 3D9MA 4BX9A 1WAO1 1HG5A 2WMOA 2WXIA 4BSXA 4ME2A 3PNLB 2KM4A 3ESLA 2WXPA 3ASOE 1OCCE 3LJNA 1MHQA 4N39A 4I1OB 3FP3A 5G05J 4HBDA 4AVXA 4URKA 3ONLA 1FCHA 2DZOA 3ML8A 3U3WA 4U96D 1HS6A 1MX4A 3IHVA 3JUIA 3UPVA 3Q7FA 5FQ7A 4EPZA 1SA4A 3L22A 3ULYA 3V30A 3ABLE 4WNEA 1SZAA 4C0MA 4CRWA 3CR3A 3UX4A 4G8LA 5BV1A 4G24A 4HRNA 3QJZA 2J9QA 1JCQA 5AQAA 5ENNA 1MYOA 3V79K 2I2OA 1IHBA 1TR4A 2KXPC 3IEGA 2WQ7A 2R2LA 5ITZF 4L7TA 4I43A 4FHKA 5FIOA 1UJKA 3U4TA 2FI7A 2AVPA 4Q96A 4QQIA 3GW4A 1E8ZA 2PQNA 4C0EA 3S2AA 3FTXA 3KSLA 4B0ZA 1HFAA 5FTPA 4GZCA 3DSUA 3ZHEB 2ETAA 2ZIRA 4U0ZA 4GPMA 1JWGA 3ASGA 1TJCA 4G25A 4GTSA 2IO2C 1S64A 4GCNA 2BTDA 3PRZA 5CCMA 4HQDA 1ELWA 3HXEA 4J8FA 2DYSE 2RFMA 3SFZA 3GYZA 3TWTA 4I1AA 4H7XA 3UINC 1IKND 1V55E 1AP7A 3CHRA 3AG2E 5ENPD 1O5MA 2QYUA 3MCXA 2LSVA 1U3CA 5E76A 2J09A 1Z3XA 1N4PA 3CVPA 4PS8A 2OV8A 5FINA 3G2SA 3ISMC 2J4BA 4GMRA 3RO2A 1NL4A 4GB9A 2ILRA 1Y6IA 5AJDA 4I17A 4K5BA 4AY5A 2FEZA 3VTXA 4I6GA 1RZ4A 1HH8A 2WXHA 5AJLA 5G55A 4J0UA 1TJFA 1Y8MA 2LUHA 4JD2G 3GZSA 4HNAD 2JEKA 2GRPB 4G11A 3MEKA 1UN8A 5C2YA 2LXMA 2ONDA 3CVUA 3APFA 3D9JA 3HRAA 3O48A 2XEEA 5EIBE 4FJZA 1D8DA 2J4DA 1SQMA 5CMYA 1NI1A 3D3MA 1X5BA 3CLJA 4ANUA 4ANXA 3J5PA 1H2VC 5CRVA 5AAOA 1TN8A 3APDA 2A5UA 4WNDA 3J5QB 2GW1A 3Q15A 3UKUG 2WPVA 5ENQD 4UQXA 2RD0A 5ENOD 3SFYA 4WNGA 5D0QD 4GYOA 3PE3A 3NBNB 1EF1C 3S7BA 3FFLA 5LCWC 1Z6TA 3PUJA 3PUKA 4C48B 1SW6A 3BG1B 3T5XA 2PM7A 4BERA 2Y1LE 2ETBA 3FH8A 1BD8A 4TUUA 3PZ3A 3VLEA 4JL0A 3ZGQA 1TNUA 5EKQD 3OXLA 3CVWA 3QDNA 2AW6A 3TWQA 5JJ6A 4YVOA 2KCVA 3CIAA 4HLLA 2XPYA 4FJYA 3Q49B 1YCSB 3L08A 2VSXE 2XZDG 2EINE 5JA4D 4ACLA 3UT8A 3FDHA 3DEOA 3FY4A 2B0OE 2CG2A 1KZOA 4U7EB 4XE0A 3BU8A 4UI9J 3KD7A 2P58C 5CBNA 4RQIA 4I2WA 4FC8A 1Q2ZA 4GTRA 3OXGA 2XHEA 3I4GA 3FUEA 4KVMA 3CK8A 3ZUVB 2FF4A 4FADA 3URZA 3V2OA 3ZEFA 3EHNA 4DLQA 4Q94A 3O4ZA 5EN5D 1HZ4A 2PM6A 3JQ1A 2IO3C 5AN8A 5KJMA 4HRLA 2AXUA 5FZRA 3HHMA 1LD8A 5LX8A 2OVFA 4N2SA 1JWFA 2XS8A 5ANRA 4CCAA 2X6KA 3MKQA 2M63A 3Q9NC 2DBAA 3QOUA 5J08A 2V8SE 3DSXA 3D9OA 3D9PA 2QY7A 2OVBA 4UWGA 1HO8A 3EUVA 1S70B 4K0RA 1X81A 2OEVA 2P9UG 3D9IA 3AS8A 2V0PA 1UN9A 3ZN3A 4GCOA 5A7DB 3C3OA 2VQ2A 4BT9A 3IXEA 2QC9A 3PVLA 4H7YA 4O1PA 4EQFA 5JJTA 4G2VA 2C0LA 4WWOA 3RIBA 1K1BA 3FUHA 3DPDA 5EDSA 3G2WA 4HORA 1YMPA 3CVLA 3QKYA 2P9PG 5FZQA 2EIKE 4EZJA 3CVXA 2HE0A 1XNFA 3PZ1A 3TXNA 4WUYA 5KBAA 4APFA 4IRUA 2LAHA 2WXMA 2F8XK 5H7PA 3BQOA 5T8IA 4B8AA 3ONKA 4B94A 4XX5A 3KSQA 2C2LA 3SNXA 1KT1A 3MV2B 2NSZA 3W9FA 3Q47B 1OWOA 1D9SA 2NC9A 1ELRA 3TXMA 2MHKA 3PDNA 4GMLA 3RRMB 3G2UA 3UM1A 3RSEG 2Y4TA 2HR2A 2BKKB 3FH5A 2CG3A 4GZ5A 3FWVA 5HI7A 2X3MA 2DWZA 4J8YA 3ZVVA 4UI9K 1V54E 2CFUA 3GZ2A 5ANLA 3FTYA 3JXIA 2EQXA 4C9BB 5EIDA 3CVNA 4GAAA 4DX1A 3ABKE 3HIZA 1MJ0A 3AU4A 3LVQE 2J49A 2XENA 2VGYA 3EHMA 3FUFA 4J7WA 1OWMA 4KZ0A 5CCLA 4I1MA 3MX3A 3DPYA 5CBOA 4AP2A 3HXDA 4KVOA 1SZ9A 3PEVB 3P1UA 4GA0A 2CHWA 3D9KA 1G3NB 5CECB 3LYAA 4D10C 2XEVA 3N71A 1H0AA 3Q79A 4LNBA 4ACKA 1ZB1A 3RKVA 3ZU7B 3CSTA 5JHAA 3JUEA 2IY0C 1BI7B 3CVVA 1YYHA 2IU1A 4DX5D 3D9HA 4HRMB 2PL2A 3ZYLA 4RG6A 4G8KA 3KEZA 2XPZA 4DI3A 1OCZE 2BUGA 1LTXA 2BEDA 3LPZA 3SHFA 2DCPA 3ZXPA 1JCSA 4U95D 3MKQB 2Y3AA 4KYOB 1DCQA 4UWHA 3CEQA 5EX0A 4WWNA 3AS5A 3LVRE 5G04C 4GPKA 2IJGX 4AIFA 4CGVA 2DIWA 3RK6A 2R59A 3S7FA 3TWXA 3NQPA 2Y69E 3OXFA 4NRHB 2V4LA 3ZPJA 1E8WA 1FPPA 3PZDA 5BNWA 1PAQA 1LD7A 4PUCA 3E34A 1N11A 4HOSA 3PREA 2NXPA 4ATGA 4N3CA 1HU3A 1OWLA 4NQ0A 5KNHD 4L2YA 3C3QA 4GU5A 2EIME 3LS8A 4N3BA 5KJKA 2XS1A 2A5EA 2JLBA 4XIFA 4ABNA 2XGOA 2V5QC 3HXBA 4JA7A 3EU9A 3BUAA 5FJYA 3FTZA 2XZTG 3Q78A 2P9LG 3SGHA 3JYSA 2HYZA 4AJWA 3APCA 4TRQA 3ZYKA 3ZKJA 4Z68A 5HRYA 3TL5A 5FZSA 1EDUA 3E32A 3C5RA 3FTSA 4GA2A 2CFZA 4GYYA 5CRUA 2IOSA 4KBQA 4PDXA 2WQ6A 1TYQG 3QC1A 4HI8A 1HE8A 3RO3A 1PC2A 3DBSA 5EYLA 3ZRHA 4HB5A 1TN6A 1QYMA 1SA5A 1ZBPA 4MLPA 4OYSA 1WG0A 2PNNA 5D66A 1TNOA 3KAEA 3MA5A 3RJVA 3JCKC 4L23A 5ENSD 2H6FA 3FTVA 2EILE 3ZNGA 4AEZC 3FU0A 5AQ9A 3TWRA 4EECA 2MRIA 1FVHA 2JABA 1H2UA 4JPSA 3Q75A 2MYOA 1N54A 4GTMA 3DSSA 4CYMD 3ZFWA 2KBXA 3G2VA 1PY1A 2LSUA 4DRXE 2VGEA 1U3DA 3MZLB 4IN3B 4DX6D 5FQ4A 2UWJG 2WXNA 3ESKA 1EPUA 4CZ2D 4A63B 3UUXA 1N0QA 4IYPA 3PE4A 1MX6A 3MJWA 4HXIA 1QNFA 5EX3A 2WXFA 1S0PA 3KEAA 5FT9A 4FLHA 3AG1E 2RFAA 3ENEA 2I1KA 3UMVA 1JPLA 3CKCA 1EYHA 4ANWA 1JCRA 3TJPA 1AWCB 2J08A 2BKGA 3CHOA 3W9GA 1O1SA 3CHPA 5G05C 4I9EA 4PH4B 2FBNA 1OUVA 4LCTA 2R03A 2VTBB 4LSZE 4U8HA 3EHRA 3DSVA 2DVWA 2R17C 2WXRA 5B1BE 5G2NA 4L1BA 3EDTB 3C98A 4FP7A 5BXOA 5BPPA 2R05A 4JZYA 5AARA 3UIOC 2WM9A 4FA6A 5ENTD 3RAUA 4JVSA 4U07A 4KXKB 3EJNA 2E0IA 2BF0X 5KNGA 3HYMB 1UJJA 3IHYA 5BT1A 5EILA 1E8YA 2GRMA 2L0IA 2X6IA 4LG6A 1N4SA 4A3TA 4EZLA 2KCLA 1E7VA 1KT0A 2GRLA 4XEIG 1QBQA 2XCCA 1TNBA 4K5CA 3TWUA 4F1PA 4FULA 5B3SE 3SI5A 4BX8A 4AY6A 4F53A 1TNZA 2XGSA 2QZAA 4BWRA 3FEYA 5JJ7A 4O60A 2KZTB 5A23A 4Q69A 4DLOA 2OOEA 3HG0D 3U64A 3BG0B 2PQRA 3FUDA 4DUIA 2IF4A 2XQ0A 2XRYA 2CHZA 2IQCA 3LY9A 5CEAA 1QQEA 3Q73A 4OAVB 4MRUA 3ULQA 3I4RB 4J8SA 3DSWA 2I9CA 3FTWA 5T4YA 3Q5MA 4AM9A 1GW6A 1KPSB 4AV7A 1H6OA 3FU3A 3IBEA 3MKRA 4YDYA 1E90A 4I2ZA 3FUMA 2WXQA 3DXMG 4GTOA 1A17A 4HI9A 3B7TA 3HVEA 2FO1E 2VGXA 4DJAA 3ASHA 4Y6WA 3IKOB 1UG3A 3CQCB 4J8EA 4JC8A 3QARA 3FUJA 2J07A 1BU9A 3AJIA 3DEPA 3ZW3A 1TNYA 4EBAG 3MGBA 3L9TA 4PS3A 4DK5A 1DNPA 2I6HA 1LF8A 1N9AA 3PZ4A 2DZNA 3LEWA 4TV3A 4R7LA 4ANVA 1HF8A 3CVQA 4GZ6A 4J6IA 2QYJA 3IV0A 3UM3A 1IQUA 1QZ2A 1HX8A 4LERA 1NP7A 2AWIA 3SBTB 3FU6A 3MYVA 3RRNB 4JB8P 1VDYA 5LP0A 5BW8C 1MX2A 3U9WA 4U8YD 3UTMA 3AU5A 5DIZA
chains in the Genus database with same CATH topology
3CVUA 3FH7A 4N5CA 3OXFA 3APFA 3D9JA 4NRHB 1FVFA 3CGHA 3O48A 2V4LA 4GA1A 2X6HA 2AXZA 3ZPJA 3LY8A 2X38A 1E8WA 3CK9A 4FJZA 3PZDA 5KCMA 4JW1A 2UY1B 5FQ6A 5BNWA 3NF1A 4L2LA 2J4DA 2X6JA 1PAQA 5E75A 1SQMA 1W3BA 2XCBA 3FTUA 4HFGA 3FUKA 4PUCA 5CMYA 4HOSA 3G2TA 3PREA 2NXPA 1X5BA 3D3MA 3QNKA 3CLJA 4KMOA 5M72A 3U66A 4ANUA 4KT6B 4ANXA 5LOZA 4ATGA 3QB2A 3SF4A 4N3CA 1H2VC 2R5SA 5G04J 1HU3A 1OWLA 4NQ0A 3APDA 2A5UA 4L2YA 4WNDA 4B89A 2GW1A 3FEXA 3Q15A 3OTNA 3LS8A 4GU5A 4N3BA 5KJKA 4CT0A 1NA0A 2WPVA 4CEMA 2JLBA 4XIFA 4UQXA 4ABNA 3R7QA 2IFUA 2XGOA 2RD0A 2I1JA 2WQHA 3ASDA 4XI9A 4F1SA 4K03A 4WNGA 3UT7A 1WM5A 2L0TB 4JA7A 5D0QD 4PS7A 4GYOA 3PE3A 3R7RA 5FJYA 1EF1C 5D0OD 4F3VA 3NZSA 2WXKA 3KS2A 3S7BA 3FTZA 3FFLA 3TG5A 5LCWC 3TG4A 3CV0A 1Z6TA 3PUJA 2Y4UA 3PUKA 3SGHA 1E7UA 3JYSA 4KZCA 4HS2A 2C0MA 2HYZA 1TEZA 2VSNA 4LUNU 4AJWA 2FO7A 3APCA 3BG1B 3T5XA 4TRQA 3SZ7A 3ZYKA 5KJNA 2PM7A 5FQ8A 4GYWA 2XRZA 1NA3A 2KC7A 3PEUB 4UQZA 3TL5A 5FZSA 2PZIA 3FH8A 4RVBA 3S7JA 1EDUA 4TUUA 4UI9C 3FTSA 4GA2A 2CFZA 1L5JA 4GYYA 1YA0A 3VLEA 4JL0A 2IOSA 3CKBA 3ZGQA 2VSOE 4KBQA 4PDXA 2WQ6A 3ZHEA 2ZU6B 4UWLA 3QC1A 5EKQD 3OXLA 1HE8A 3RO3A 1PC2A 3DBSA 3UQ3A 3SBSA 4I6EA 3ZRHA 3QDNA 3CVWA 2AW6A 2VJ8A 5JJ6A 4YVOA 1ZBPA 2KCVA 3CIAA 4MLPA 2XGMA 2XPYA 5LCWJ 4FJYA 4OYSA 3Q49B 4W9RA 4N3AA 3L08A 4M3OA 1ELKA 2VSXE 5C1DA 3LJ3A 2VTBA 3KAEA 3MA5A 2XPIA 3RJVA 3JCKC 4L23A 5KJLA 3FTVA 4AEZC 3OAWA 1NZNA 5JHBA 4ACLA 3FUIA 4UQYA 3UT8A 3FU0A 3FDHA 4WNFA 3P2BA 3FY4A 2GGFA 2CG2A 2MRIA 4LEUA 1FVHA 4EECA 4FLBA 4EBAA 1UW4B 4FHJA 4XE0A 4HVBA 2QFCA 4EZKA 4UI9J 1H2UA 4JPSA 2CHXA 4B8CB 3KD7A 4OVUA 4U63A 2P58C 1N54A 4RG9A 1H19A 4IULA 4JA9A 4FC8A 4I2WA 1JUQA 3ZFWA 1OWPA 2WVIA 1PY1A 3G2VA 2LSUA 3OXGA 3QAQA 2XHEA 3I4GA 3ZXSA 3FUEA 4KVMA 1U3DA 3CK8A 4LRZA 4FU3A 2FF4A 4FADA 3URZA 2LO6A 3MZLB 4IN3B 4JXTA 3B7SA 3RRUA 3ZEFA 4N2QA 3EHNA 5FQ4A 4DLQA 4Q94A 2UWJG 3EIQC 3L16A 2WXNA 2Q7FA 4HOTA 3O4ZA 2HO1A 3ESKA 1E96B 4E6HA 1EPUA 1HZ4A 2PM6A 3JQ1A 1OWNA 3UUXA 3I3NA 4XKBA 2L6JA 4A55A 5A6CA 3VLFA 4IYPA 5KJMA 5ARFA 4OVVA 3PE4A 2AXUA 4CDNA 2WXOA 5FZRA 3D9LA 3HHMA 1QNFA 3B7UX 3MJWA 4HOQA 4HXIA 3SD5A 3ML9A 4BT8A 2OVFA 3HVEB 4UWKA 5LX8A 4N2SA 1JWFA 4U04A 5EX3A 2VGXB 2WXFA 2YQ8A 1S0PA 5FT9A 4A3VA 5ANRA 4CCAA 3T8MA 5AENA 1Z3YA 2X6KA 4XZ4A 3MKQA 4CDMA 2L9BA 2M63A 2DBAA 2X6FA 4DI4A 1H6KA 3QOUA 4FLHA 3L13A 2V8SE 5J08A 2WXGA 3D9OA 3D9PA 2QY7A 2OVBA 1HXIA 4UWGA 4F7AA 5HQ8A 1HO8A 2WXJA 3ENEA 2I1KA 3UMVA 1JPLA 3CKCA 1EYHA 2KCKA 4K0RA 4XI0A 4G1TA 4ANWA 4GMJA 3FHEA 4DPRA 3D9IA 2MOWA 1DVPA 2FULA 3AS8A 4ILIA 4V3IA 2V0PA 2HM8A 1UN9A 3TJPA 3ZN3A 3HDXA 4GCOA 1B89A 3LKUA 2J08A 4ILGA 5A7DB 3CHOA 3ASFA 1IYGA 2A4ZA 3CHPA 3I5PA 2VQ2A 5AYWD 4AXHA 4BT9A 4BY6A 1BPOA 5G05C 3L17A 4HOUA 4I9EA 3CQGB 3PVLA 4PH4B 4U0UA 3ZYQA 2FBNA 4H7YA 4EQFA 2KZTA 2UY1A 3EIJA 5JJTA 1OUVA 5J90A 3B13A 2E2EA 2YHEA 4LCTA 4WWPA 4G2VA 4CDRA 3D9NA 4I6JA 2AXVA 2VTBB 2C0LA 4JEHA 4WWOA 2YHCA 4MKTA 3RIBA 4BFRA 4U8HA 1H2TC 2VSYA 3DPDA 3FUHA 3NZUA 4QFVA 3B7RL 5FWQA 3LXUX 3D9MA 4BX9A 5EDSA 1WAO1 2R17C 3G2WA 2WXRA 4HORA 1HG5A 3CVLA 5G2NA 4YNDA 4L1BA 2WMOA 3QKYA 2WXIA 3EDTB 3C98A 4FP7A 4BSXA 4ME2A 3TAXA 3CSFA 3PNLB 3Q4AB 5FZQA 5BPPA 4JZYA 2KM4A 3ESLA 2WXPA 4EZJA 3CVXA 1XNFA 3FU5A 3TXNA 3VTYA 3CHSA 2WM9A 4WUYA 1MHQA 4APFA 4IRUA 2LAHA 2WXMA 4N39A 4FA6A 4I1OB 2LNIA 3FP3A 3QK0A 5G05J 4CGWA 4JVSA 4U07A 4AVXA 4URKA 2YINA 4KXKB 5T8IA 3EJNA 4B8AA 4UWFA 3ONKA 4CT4A 2E0IA 3ONLA 3PH0C 4XX5A 2BF0X 3CHQA 4B94A 1FCHA 3HYMB 3ML8A 1UJJA 2C2LA 3IHYA 3SNXA 5BT1A 3U3WA 1E8YA 2GRMA 1KT1A 2L0IA 3MV2B 4MS6A 1HS6A 3UPVA 3IHVA 3JUIA 2X6IA 5FQ7A 4EPZA 3E4BA 4A3TA 3L22A 2NSZA 3ZYMA 4EZLA 4A1GA 3Q47B 1OWOA 2WB2A 2KCLA 4BTBA 3LY7A 1E7VA 1KT0A 2NC9A 4O6FA 4WNEA 1ELRA 3TXMA 2MHKA 4A1SA 5T3RA 2GRLA 3PDNA 4GMLA 1SZAA 4C0MA 2XCCA 3PS6A 3RRMB 3G2UA 3VLDA 4CRWA 3CR3A 3UX4A 5CHEE 3GZ1A 2V5FA 2Y4TA 5BV1A 1E8XA 4G24A 1IHGA 2HR2A 3QJZA 4FULA 3FH5A 3MV3B 2J9QA 3SI5A 2CG3A 4GZ5A 4BX8A 1INZA 3FWVA 5ENNA 4AY6A 4F53A 4RSYA 5HI7A 2X3MA 4J8DA 2I2OA 5BUZA 1N52A 2XGSA 3ZVVA 4UI9K 2CFUA 3IEGA 2LAIA 3GZ2A 3FEYA 4ILHB 5ANLA 4BWRA 2WQ7A 5JJ7A 4L7TA 4I43A 2KZTB 3FTYA 2EQXA 4FHKA 5A23A 3R9AB 4Q69A 4C9BB 4DLOA 4AOFA 4WAFA 1UJKA 3U4TA 2FI7A 2OOEA 2YNQA 2AVPA 5BV0A 4Q96A 3CVNA 3GW4A 3U64A 1E8ZA 2PQNA 3QWWA 4GAAA 4HLEA 2IOLA 2PQRA 3BG0B 3FUDA 4GZDA 4C0EA 3HIZA 2IF4A 2XQ0A 3S2AA 2XRYA 1IQRA 2CHZA 3FTXA 3AU4A 3LVQE 2RG8A 2J49A 4B0ZA 1HFAA 3CVYA 5FTPA 4GZCA 2IQCA 3ZHEB 3LY9A 4U0ZA 1KLXA 5DBKA 1QQEA 2VGYA 1JWGA 3RU0A 3EHMA 3FUFA 3ASGA 1TJCA 1OWMA 1MQSA 4MRUA 4KZ0A 3I4RB 4G25A 4J8SA 3ULQA 2I9CA 5CCLA 3T5VA 4I1MA 3FTWA 5T4YA 3Q5MA 4AM9A 1GW6A 3FU3A 2WXLA 3IBEA 3MX3A 4AV7A 3MKRA 4GCNA 2BTDA 3PRZA 5CCMA 1E90A 4I2ZA 1ELWA 3FUMA 4AP2A 2WXQA 4J8FA 4G23A 3S7DA 3SFZA 3GYZA 4U0SA 4KVOA 4I1AA 4H7XA 1A17A 1SZ9A 3PEVB 3P1UA 3B7TA 4GA0A 3PNTB 3CK7A 3CHRA 5AIJA 4GZ3A 3HVEA 2CHWA 3D9KA 2VGXA 3FUNA 4DJAA 3ASHA 3L54A 4Y6WA 3IKOB 3LDZA 3LYAA 4JEUA 1UG3A 3BEEA 3CQCB 4JHKA 4J8EA 4JC8A 3FULA 3QARA 2KATA 4D10C 1HG2A 3FUJA 2J07A 2XEVA 3N71A 1H0AA 2WMNA 4ACKA 3MCXA 4APOA 3ZW3A 2LSVA 4NURA 3RKVA 1U3CA 4EBAG 3MGBA 1ZU2A 4PS3A 5E76A 2J09A 1Z3XA 5DIZA 4DK5A 3CVPA 3CSTA 3JQ0A 3TGOA 5JHAA 4PS8A 3CVVA 3QWPA 1DNPA 2IU1A 2OV8A 3G2SA 4E85A 2J4BA 1P5QA 2I6HA 1LF8A 2PL2A 3ZYLA 3RO2A 4RG6A 4GB9A 2ILRA 1Y6IA 3LEWA 4TV3A 5AJDA 4XKCA 3KEZA 4I17A 4R7LA 4ANVA 2XPZA 1HF8A 3CVQA 4GZ6A 4DI3A 4JHJA 4J6IA 3LCAA 3ZIMA 4AY5A 2BUGA 2FEZA 3LPZA 3SHFA 2DCPA 1WY6A 2VYIA 3VTXA 5CMWA 4I6GA 1HH8A 3IV0A 4I9CA 1IQUA 1QZ2A 3MKQB 2Y3AA 4KYOB 4G26A 5ARGA 4UWHA 3L6AA 3CEQA 2WXHA 4P29A 1XGWA 4NACA 1HX8A 4J0UA 5AJLA 5G55A 1TJFA 5EX0A 4LERA 4WWNA 1NP7A 5LFAA 2AWIA 3AS5A 3LVRE 2IONA 3CHMA 3SBTB 3AS4A 3FU6A 3MYVA 5G04C 3UT4A 4Y6CA 4GPKA 3RRNB 1Y8MA 2IJGX 4AIFA 4CGVA 3WXXA 2DIWA 3K9IA 2R59A 1VDYA 3RK6A 5LP0A 3QWVA 3GZSA 4YVQC 2JEKA 3S7FA 4BTAA 5BW8C 3U9WA 3NQPA 4G11A 3MEKA 1UN8A 4JHRA 3AU5A 5C2YA 2ONDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2W A;  1JWF A;  4GZC A;  1HG5 A;  1SZ9 A;  1SZA A;  3D9J A;  3ONK A;  3G2U A;  3ONL A;  2BF0 X;  4FU3 A;  1XGW A;  4NAC A;  1HX8 A;  2LO6 A;  3D9K A;  3G2S A;  1JWG A;  1UJJ A;  4JXT A;  3RRU A;  1LF8 A;  3ZYL A;  2L0I A;  5J08 A;  4Q94 A;  2V8S E;  3LDZ A;  3ZYQ A;  4FLB A;  2KM4 A;  3D9O A;  3D9P A;  1UJK A;  2QY7 A;  3G2V A;  1HF8 A;  4Q96 A;  3ZYM A;  1HG2 A;  1JPL A;  2DIW A;  4HFG A;  3ZYK A;  1VDY A;  1H0A A;  1EYH A;  5CMY A;  5LP0 A;  1MHQ A;  3D9N A;  4GZD A;  3G2T A;  2DCP A;  1INZ A;  2L0T B;  1X5B A;  3CLJ A;  3D9I A;  2MOW A;  1DVP A;  5CMW A;  5LOZ A;  1JUQ A;  1ELK A;  3D9L A;  3D9M A;  4AVX A;  1EDU A;  1PY1 A;  1HFA A; 
#chains in the Genus database with same CATH topology
 4LNU D;  2AXZ A;  3LY8 A;  2Y0B G;  3E33 A;  5KWD A;  4JW1 A;  1N95 A;  5FQ6 A;  3NF1 A;  4L2L A;  2X6J A;  3Q9U C;  5E75 A;  4HFG A;  1H6P A;  1IXV A;  5HS0 A;  5BXU A;  4TXP A;  3G2T A;  4KT6 B;  5LOZ A;  3E37 A;  3UI2 A;  2R5S A;  3FEX A;  4CT0 A;  4YDO A;  4CEM A;  1K3Z D;  3DWL G;  2IFU A;  2WQH A;  3ASD A;  4XI9 A;  3UT7 A;  1WM5 A;  2L0T B;  3R7R A;  5D0O D;  4F3V A;  3KS2 A;  3TG5 A;  4X8Q A;  3EU5 A;  2P9I G;  2GRO B;  1E7U A;  2C0M A;  1TEZ A;  2VSN A;  4LUN U;  5JMN D;  2FO7 A;  3SZ7 A;  5KJN A;  1S63 A;  5FQ8 A;  4BEP A;  2XRZ A;  1NA3 A;  4UQZ A;  3PEU B;  2PZI A;  4RVB A;  3S7J A;  4UI9 C;  1YA0 A;  2ETC A;  2VSO E;  1N4Q A;  4UWL A;  1K1A A;  3SBS A;  4GTP A;  2VJ8 A;  5IY5 E;  5LCW J;  3T8K A;  4W9R A;  4NIK A;  4N3A A;  4M3O A;  2ZIS A;  3LJ3 A;  2VTB A;  5KJL A;  3OAW A;  3SY2 A;  4LEU A;  2GGF A;  4EBA A;  4FLB A;  1TN7 A;  3F6Q A;  4HVB A;  2QFC A;  3UM2 A;  3JXJ A;  4L9P A;  4RG9 A;  1H19 A;  1JUQ A;  1OWP A;  3QAQ A;  3ZXS A;  4LRZ A;  3AG3 E;  4JXT A;  3B7S A;  3RRU A;  1K8K G;  1UOH A;  3L16 A;  4U8V D;  2Q7F A;  3UM0 A;  1OWN A;  3I3N A;  4XKB A;  2L6J A;  4A55 A;  4OVV A;  2WXO A;  4BT8 A;  3SD5 A;  3ML9 A;  1OXJ A;  3HVE B;  4U04 A;  2VGX B;  4UUC A;  4A3V A;  5AEN A;  3T8M A;  1Z3Y A;  4XZ4 A;  4CDM A;  4LNG A;  2GRN B;  2ZGD A;  4F7A A;  2EIJ E;  1HXI A;  1FT1 A;  4G1T A;  1RW2 A;  3FHE A;  4N5Q A;  1DVP A;  4ILI A;  3LKU A;  4ILG A;  3ASF A;  1IYG A;  5AYW D;  4AXH A;  1BPO A;  4HOU A;  4U0U A;  3ZYQ A;  5HKP A;  2KZT A;  2UY1 A;  3EIJ A;  5J90 A;  2YHE A;  3D9N A;  2AXV A;  4JEH A;  2YHC A;  4MKT A;  4BFR A;  4BET A;  5AQ7 A;  2VSY A;  1DCE A;  3NZU A;  5CER B;  4YND A;  3HXC A;  3TAX A;  3CSF A;  3Q4A B;  3TWV A;  3FU5 A;  3VTY A;  3CHS A;  2P2C P;  2LNI A;  3NOG D;  3QK0 A;  3UIP C;  4CGW A;  4DX2 A;  2YIN A;  4TXR A;  4UWF A;  4CT4 A;  2H6G A;  3PH0 C;  3CHQ A;  4MS6 A;  3E4B A;  5B1A E;  3ZYM A;  2J8S D;  3SQV A;  4A1G A;  2WB2 A;  3ASN E;  4BTB A;  3LY7 A;  4O6F A;  4A1S A;  5T3R A;  4GTT A;  3ULE G;  3PS6 A;  3VLD A;  3NOC D;  5CHE E;  3GZ1 A;  2V5F A;  3B7B A;  1E8X A;  1IHG A;  1A5E A;  3MV3 B;  3UKR G;  1INZ A;  4RSY A;  4J8D A;  5BUZ A;  1N52 A;  2LAI A;  4ILH B;  2ZXW E;  3R9A B;  4AOF A;  4WAF A;  2YNQ A;  5BV0 A;  4HLE A;  3QWW A;  2IOL A;  1WDY A;  4GZD A;  1IQR A;  2RG8 A;  3CVY A;  1N94 A;  3TWW A;  2OCC E;  1KLX A;  5DBK A;  3V31 A;  3RU0 A;  1MQS A;  3T5V A;  1NFI E;  1OCO E;  1OCR E;  3DXK G;  2IEJ A;  2WXL A;  2B6C A;  4BES A;  4G23 A;  3S7D A;  4U0S A;  3Q7A A;  5AIJ A;  3PNT B;  3CK7 A;  4GZ3 A;  3FUN A;  3L54 A;  3LDZ A;  4JEU A;  3BEE A;  3L82 A;  4JHK A;  3FUL A;  2KAT A;  1HG2 A;  2NYJ A;  2WMN A;  4APO A;  1U2V G;  4ZHB A;  4NUR A;  1ZU2 A;  3JQ0 A;  3TGO A;  2RKK A;  1BLX B;  3QWP A;  4E85 A;  1P5Q A;  4XKC A;  3C72 A;  4JHJ A;  3LCA A;  3TWS A;  3ZIM A;  4M7C A;  1WY6 A;  2VYI A;  2V4H C;  5CMW A;  2AJA A;  4I9C A;  4GTQ A;  4G26 A;  5ARG A;  3L6A A;  4P29 A;  1XGW A;  4NAC A;  3E30 A;  4ZFH A;  5LFA A;  2ION A;  3CHM A;  3UT4 A;  3AS4 A;  2OEW A;  4Y6C A;  4TXQ A;  5AQB A;  3WXX A;  3K9I A;  3R9M A;  3QWV A;  4RLY A;  4YVQ C;  4BTA A;  4JHR A;  3FH7 A;  4N5C A;  1FVF A;  1FT2 A;  3CGH A;  3X2Q E;  4F6R D;  4GA1 A;  2X6H A;  3NB2 A;  2X38 A;  2XEH A;  3CK9 A;  5KCM A;  2UY1 B;  3HXF A;  1W3B A;  2R02 A;  2XCB A;  3C3R A;  3FTU A;  3FUK A;  2F0Y A;  3QNK A;  4KMO A;  5M72 A;  3U66 A;  3QB2 A;  1BI8 B;  3SF4 A;  5G04 J;  1N0R A;  4B89 A;  3OTN A;  1NA0 A;  3WG7 E;  1Z5S C;  3AAA C;  3R7Q A;  2I1J A;  4F1S A;  4K03 A;  4PS7 A;  2L6B A;  3NZS A;  2WXK A;  4BSZ B;  4MBG A;  1O1R A;  2P9N G;  3TG4 A;  3CV0 A;  4K5A B;  1D8E A;  2Y4U A;  2ZGG A;  1N4R A;  3T9K A;  4KZC A;  2H6I A;  4HS2 A;  4GYW A;  2KC7 A;  3EHQ A;  1L5J A;  3CKB A;  3ZHE A;  2ZU6 B;  3UQ3 A;  4I6E A;  1O1T A;  4YDE A;  2XGM A;  4B93 B;  4ATZ D;  5C1D A;  1ELK A;  4DX7 D;  1KZP A;  2XPI A;  1NZN A;  5JHB A;  3FUI A;  4UQY A;  4WNF A;  3P2B A;  1OT8 A;  1UW4 B;  3DST A;  4FHJ A;  5EYP F;  4EZK A;  2CHX A;  4B8C B;  4OVU A;  4U63 A;  4IUL A;  4JA9 A;  3NAW A;  2WVI A;  2P9K G;  1MZC A;  4OAU C;  4FU3 A;  2LO6 A;  4N2Q A;  3SO8 A;  3EIQ C;  4HOT A;  1OY3 D;  4O1O A;  2HO1 A;  3V2X A;  1E96 B;  3UXG A;  4E6H A;  2P9S G;  5A6C A;  3VLF A;  5ARF A;  1SVX A;  5ENR D;  4CDN A;  3D9L A;  3B7U X;  4GTV A;  4HOQ A;  4UWK A;  2DYR E;  2YQ8 A;  3B95 A;  3PZ2 A;  2LXL A;  2F37 A;  4TUM A;  2L9B A;  2X6F A;  4DI4 A;  1H6K A;  3L13 A;  4EHM A;  2GRQ B;  2WXG A;  5HQ8 A;  2WXJ A;  2F8Y A;  2KCK A;  4XI0 A;  3AG4 E;  4GMJ A;  4DPR A;  2MOW A;  2FUL A;  2H6H A;  4V3I A;  2HM8 A;  3HDX A;  1B89 A;  1DC2 A;  5CED B;  5D2M C;  2A4Z A;  3I5P A;  3DRA A;  4BY6 A;  3L17 A;  3CQG B;  4YDW A;  3B13 A;  2E2E A;  4WWP A;  4CDR A;  3SFX A;  2GRR B;  4I6J A;  3ABM E;  1H2T C;  5FWQ A;  4QFV A;  3B7R L;  3LXU X;  3D9M A;  4BX9 A;  1WAO 1;  1HG5 A;  2WMO A;  2WXI A;  4BSX A;  4ME2 A;  3PNL B;  2KM4 A;  3ESL A;  2WXP A;  3ASO E;  1OCC E;  3LJN A;  1MHQ A;  4N39 A;  4I1O B;  3FP3 A;  5G05 J;  4HBD A;  4AVX A;  4URK A;  3ONL A;  1FCH A;  2DZO A;  3ML8 A;  3U3W A;  4U96 D;  1HS6 A;  1MX4 A;  3IHV A;  3JUI A;  3UPV A;  3Q7F A;  5FQ7 A;  4EPZ A;  1SA4 A;  3L22 A;  3ULY A;  3V30 A;  3ABL E;  4WNE A;  1SZA A;  4C0M A;  4CRW A;  3CR3 A;  3UX4 A;  4G8L A;  5BV1 A;  4G24 A;  4HRN A;  3QJZ A;  2J9Q A;  1JCQ A;  5AQA A;  5ENN A;  1MYO A;  3V79 K;  2I2O A;  1IHB A;  1TR4 A;  2KXP C;  3IEG A;  2WQ7 A;  2R2L A;  5ITZ F;  4L7T A;  4I43 A;  4FHK A;  5FIO A;  1UJK A;  3U4T A;  2FI7 A;  2AVP A;  4Q96 A;  4QQI A;  3GW4 A;  1E8Z A;  2PQN A;  4C0E A;  3S2A A;  3FTX A;  3KSL A;  4B0Z A;  1HFA A;  5FTP A;  4GZC A;  3DSU A;  3ZHE B;  2ETA A;  2ZIR A;  4U0Z A;  4GPM A;  1JWG A;  3ASG A;  1TJC A;  4G25 A;  4GTS A;  2IO2 C;  1S64 A;  4GCN A;  2BTD A;  3PRZ A;  5CCM A;  4HQD A;  1ELW A;  3HXE A;  4J8F A;  2DYS E;  2RFM A;  3SFZ A;  3GYZ A;  3TWT A;  4I1A A;  4H7X A;  3UIN C;  1IKN D;  1V55 E;  1AP7 A;  3CHR A;  3AG2 E;  5ENP D;  1O5M A;  2QYU A;  3MCX A;  2LSV A;  1U3C A;  5E76 A;  2J09 A;  1Z3X A;  1N4P A;  3CVP A;  4PS8 A;  2OV8 A;  5FIN A;  3G2S A;  3ISM C;  2J4B A;  4GMR A;  3RO2 A;  1NL4 A;  4GB9 A;  2ILR A;  1Y6I A;  5AJD A;  4I17 A;  4K5B A;  4AY5 A;  2FEZ A;  3VTX A;  4I6G A;  1RZ4 A;  1HH8 A;  2WXH A;  5AJL A;  5G55 A;  4J0U A;  1TJF A;  1Y8M A;  2LUH A;  4JD2 G;  3GZS A;  4HNA D;  2JEK A;  2GRP B;  4G11 A;  3MEK A;  1UN8 A;  5C2Y A;  2LXM A;  2OND A;  3CVU A;  3APF A;  3D9J A;  3HRA A;  3O48 A;  2XEE A;  5EIB E;  4FJZ A;  1D8D A;  2J4D A;  1SQM A;  5CMY A;  1NI1 A;  3D3M A;  1X5B A;  3CLJ A;  4ANU A;  4ANX A;  3J5P A;  1H2V C;  5CRV A;  5AAO A;  1TN8 A;  3APD A;  2A5U A;  4WND A;  3J5Q B;  2GW1 A;  3Q15 A;  3UKU G;  2WPV A;  5ENQ D;  4UQX A;  2RD0 A;  5ENO D;  3SFY A;  4WNG A;  5D0Q D;  4GYO A;  3PE3 A;  3NBN B;  1EF1 C;  3S7B A;  3FFL A;  5LCW C;  1Z6T A;  3PUJ A;  3PUK A;  4C48 B;  1SW6 A;  3BG1 B;  3T5X A;  2PM7 A;  4BER A;  2Y1L E;  2ETB A;  3FH8 A;  1BD8 A;  4TUU A;  3PZ3 A;  3VLE A;  4JL0 A;  3ZGQ A;  1TNU A;  5EKQ D;  3OXL A;  3CVW A;  3QDN A;  2AW6 A;  3TWQ A;  5JJ6 A;  4YVO A;  2KCV A;  3CIA A;  4HLL A;  2XPY A;  4FJY A;  3Q49 B;  1YCS B;  3L08 A;  2VSX E;  2XZD G;  2EIN E;  5JA4 D;  4ACL A;  3UT8 A;  3FDH A;  3DEO A;  3FY4 A;  2B0O E;  2CG2 A;  1KZO A;  4U7E B;  4XE0 A;  3BU8 A;  4UI9 J;  3KD7 A;  2P58 C;  5CBN A;  4RQI A;  4I2W A;  4FC8 A;  1Q2Z A;  4GTR A;  3OXG A;  2XHE A;  3I4G A;  3FUE A;  4KVM A;  3CK8 A;  3ZUV B;  2FF4 A;  4FAD A;  3URZ A;  3V2O A;  3ZEF A;  3EHN A;  4DLQ A;  4Q94 A;  3O4Z A;  5EN5 D;  1HZ4 A;  2PM6 A;  3JQ1 A;  2IO3 C;  5AN8 A;  5KJM A;  4HRL A;  2AXU A;  5FZR A;  3HHM A;  1LD8 A;  5LX8 A;  2OVF A;  4N2S A;  1JWF A;  2XS8 A;  5ANR A;  4CCA A;  2X6K A;  3MKQ A;  2M63 A;  3Q9N C;  2DBA A;  3QOU A;  5J08 A;  2V8S E;  3DSX A;  3D9O A;  3D9P A;  2QY7 A;  2OVB A;  4UWG A;  1HO8 A;  3EUV A;  1S70 B;  4K0R A;  1X81 A;  2OEV A;  2P9U G;  3D9I A;  3AS8 A;  2V0P A;  1UN9 A;  3ZN3 A;  4GCO A;  5A7D B;  3C3O A;  2VQ2 A;  4BT9 A;  3IXE A;  2QC9 A;  3PVL A;  4H7Y A;  4O1P A;  4EQF A;  5JJT A;  4G2V A;  2C0L A;  4WWO A;  3RIB A;  1K1B A;  3FUH A;  3DPD A;  5EDS A;  3G2W A;  4HOR A;  1YMP A;  3CVL A;  3QKY A;  2P9P G;  5FZQ A;  2EIK E;  4EZJ A;  3CVX A;  2HE0 A;  1XNF A;  3PZ1 A;  3TXN A;  4WUY A;  5KBA A;  4APF A;  4IRU A;  2LAH A;  2WXM A;  2F8X K;  5H7P A;  3BQO A;  5T8I A;  4B8A A;  3ONK A;  4B94 A;  4XX5 A;  3KSQ A;  2C2L A;  3SNX A;  1KT1 A;  3MV2 B;  2NSZ A;  3W9F A;  3Q47 B;  1OWO A;  1D9S A;  2NC9 A;  1ELR A;  3TXM A;  2MHK A;  3PDN A;  4GML A;  3RRM B;  3G2U A;  3UM1 A;  3RSE G;  2Y4T A;  2HR2 A;  2BKK B;  3FH5 A;  2CG3 A;  4GZ5 A;  3FWV A;  5HI7 A;  2X3M A;  2DWZ A;  4J8Y A;  3ZVV A;  4UI9 K;  1V54 E;  2CFU A;  3GZ2 A;  5ANL A;  3FTY A;  3JXI A;  2EQX A;  4C9B B;  5EID A;  3CVN A;  4GAA A;  4DX1 A;  3ABK E;  3HIZ A;  1MJ0 A;  3AU4 A;  3LVQ E;  2J49 A;  2XEN A;  2VGY A;  3EHM A;  3FUF A;  4J7W A;  1OWM A;  4KZ0 A;  5CCL A;  4I1M A;  3MX3 A;  3DPY A;  5CBO A;  4AP2 A;  3HXD A;  4KVO A;  1SZ9 A;  3PEV B;  3P1U A;  4GA0 A;  2CHW A;  3D9K A;  1G3N B;  5CEC B;  3LYA A;  4D10 C;  2XEV A;  3N71 A;  1H0A A;  3Q79 A;  4LNB A;  4ACK A;  1ZB1 A;  3RKV A;  3ZU7 B;  3CST A;  5JHA A;  3JUE A;  2IY0 C;  1BI7 B;  3CVV A;  1YYH A;  2IU1 A;  4DX5 D;  3D9H A;  4HRM B;  2PL2 A;  3ZYL A;  4RG6 A;  4G8K A;  3KEZ A;  2XPZ A;  4DI3 A;  1OCZ E;  2BUG A;  1LTX A;  2BED A;  3LPZ A;  3SHF A;  2DCP A;  3ZXP A;  1JCS A;  4U95 D;  3MKQ B;  2Y3A A;  4KYO B;  1DCQ A;  4UWH A;  3CEQ A;  5EX0 A;  4WWN A;  3AS5 A;  3LVR E;  5G04 C;  4GPK A;  2IJG X;  4AIF A;  4CGV A;  2DIW A;  3RK6 A;  2R59 A;  3S7F A;  3TWX A;  3NQP A;  2Y69 E;  3OXF A;  4NRH B;  2V4L A;  3ZPJ A;  1E8W A;  1FPP A;  3PZD A;  5BNW A;  1PAQ A;  1LD7 A;  4PUC A;  3E34 A;  1N11 A;  4HOS A;  3PRE A;  2NXP A;  4ATG A;  4N3C A;  1HU3 A;  1OWL A;  4NQ0 A;  5KNH D;  4L2Y A;  3C3Q A;  4GU5 A;  2EIM E;  3LS8 A;  4N3B A;  5KJK A;  2XS1 A;  2A5E A;  2JLB A;  4XIF A;  4ABN A;  2XGO A;  2V5Q C;  3HXB A;  4JA7 A;  3EU9 A;  3BUA A;  5FJY A;  3FTZ A;  2XZT G;  3Q78 A;  2P9L G;  3SGH A;  3JYS A;  2HYZ A;  4AJW A;  3APC A;  4TRQ A;  3ZYK A;  3ZKJ A;  4Z68 A;  5HRY A;  3TL5 A;  5FZS A;  1EDU A;  3E32 A;  3C5R A;  3FTS A;  4GA2 A;  2CFZ A;  4GYY A;  5CRU A;  2IOS A;  4KBQ A;  4PDX A;  2WQ6 A;  1TYQ G;  3QC1 A;  4HI8 A;  1HE8 A;  3RO3 A;  1PC2 A;  3DBS A;  5EYL A;  3ZRH A;  4HB5 A;  1TN6 A;  1QYM A;  1SA5 A;  1ZBP A;  4MLP A;  4OYS A;  1WG0 A;  2PNN A;  5D66 A;  1TNO A;  3KAE A;  3MA5 A;  3RJV A;  3JCK C;  4L23 A;  5ENS D;  2H6F A;  3FTV A;  2EIL E;  3ZNG A;  4AEZ C;  3FU0 A;  5AQ9 A;  3TWR A;  4EEC A;  2MRI A;  1FVH A;  2JAB A;  1H2U A;  4JPS A;  3Q75 A;  2MYO A;  1N54 A;  4GTM A;  3DSS A;  4CYM D;  3ZFW A;  2KBX A;  3G2V A;  1PY1 A;  2LSU A;  4DRX E;  2VGE A;  1U3D A;  3MZL B;  4IN3 B;  4DX6 D;  5FQ4 A;  2UWJ G;  2WXN A;  3ESK A;  1EPU A;  4CZ2 D;  4A63 B;  3UUX A;  1N0Q A;  4IYP A;  3PE4 A;  1MX6 A;  3MJW A;  4HXI A;  1QNF A;  5EX3 A;  2WXF A;  1S0P A;  3KEA A;  5FT9 A;  4FLH A;  3AG1 E;  2RFA A;  3ENE A;  2I1K A;  3UMV A;  1JPL A;  3CKC A;  1EYH A;  4ANW A;  1JCR A;  3TJP A;  1AWC B;  2J08 A;  2BKG A;  3CHO A;  3W9G A;  1O1S A;  3CHP A;  5G05 C;  4I9E A;  4PH4 B;  2FBN A;  1OUV A;  4LCT A;  2R03 A;  2VTB B;  4LSZ E;  4U8H A;  3EHR A;  3DSV A;  2DVW A;  2R17 C;  2WXR A;  5B1B E;  5G2N A;  4L1B A;  3EDT B;  3C98 A;  4FP7 A;  5BXO A;  5BPP A;  2R05 A;  4JZY A;  5AAR A;  3UIO C;  2WM9 A;  4FA6 A;  5ENT D;  3RAU A;  4JVS A;  4U07 A;  4KXK B;  3EJN A;  2E0I A;  2BF0 X;  5KNG A;  3HYM B;  1UJJ A;  3IHY A;  5BT1 A;  5EIL A;  1E8Y A;  2GRM A;  2L0I A;  2X6I A;  4LG6 A;  1N4S A;  4A3T A;  4EZL A;  2KCL A;  1E7V A;  1KT0 A;  2GRL A;  4XEI G;  1QBQ A;  2XCC A;  1TNB A;  4K5C A;  3TWU A;  4F1P A;  4FUL A;  5B3S E;  3SI5 A;  4BX8 A;  4AY6 A;  4F53 A;  1TNZ A;  2XGS A;  2QZA A;  4BWR A;  3FEY A;  5JJ7 A;  4O60 A;  2KZT B;  5A23 A;  4Q69 A;  4DLO A;  2OOE A;  3HG0 D;  3U64 A;  3BG0 B;  2PQR A;  3FUD A;  4DUI A;  2IF4 A;  2XQ0 A;  2XRY A;  2CHZ A;  2IQC A;  3LY9 A;  5CEA A;  1QQE A;  3Q73 A;  4OAV B;  4MRU A;  3ULQ A;  3I4R B;  4J8S A;  3DSW A;  2I9C A;  3FTW A;  5T4Y A;  3Q5M A;  4AM9 A;  1GW6 A;  1KPS B;  4AV7 A;  1H6O A;  3FU3 A;  3IBE A;  3MKR A;  4YDY A;  1E90 A;  4I2Z A;  3FUM A;  2WXQ A;  3DXM G;  4GTO A;  1A17 A;  4HI9 A;  3B7T A;  3HVE A;  2FO1 E;  2VGX A;  4DJA A;  3ASH A;  4Y6W A;  3IKO B;  1UG3 A;  3CQC B;  4J8E A;  4JC8 A;  3QAR A;  3FUJ A;  2J07 A;  1BU9 A;  3AJI A;  3DEP A;  3ZW3 A;  1TNY A;  4EBA G;  3MGB A;  3L9T A;  4PS3 A;  4DK5 A;  1DNP A;  2I6H A;  1LF8 A;  1N9A A;  3PZ4 A;  2DZN A;  3LEW A;  4TV3 A;  4R7L A;  4ANV A;  1HF8 A;  3CVQ A;  4GZ6 A;  4J6I A;  2QYJ A;  3IV0 A;  3UM3 A;  1IQU A;  1QZ2 A;  1HX8 A;  4LER A;  1NP7 A;  2AWI A;  3SBT B;  3FU6 A;  3MYV A;  3RRN B;  4JB8 P;  1VDY A;  5LP0 A;  5BW8 C;  1MX2 A;  3U9W A;  4U8Y D;  3UTM A;  3AU5 A;  5DIZ A; 
#chains in the Genus database with same CATH homology
 3CVU A;  3FH7 A;  4N5C A;  3OXF A;  3APF A;  3D9J A;  4NRH B;  1FVF A;  3CGH A;  3O48 A;  2V4L A;  4GA1 A;  2X6H A;  2AXZ A;  3ZPJ A;  3LY8 A;  2X38 A;  1E8W A;  3CK9 A;  4FJZ A;  3PZD A;  5KCM A;  4JW1 A;  2UY1 B;  5FQ6 A;  5BNW A;  3NF1 A;  4L2L A;  2J4D A;  2X6J A;  1PAQ A;  5E75 A;  1SQM A;  1W3B A;  2XCB A;  3FTU A;  4HFG A;  3FUK A;  4PUC A;  5CMY A;  4HOS A;  3G2T A;  3PRE A;  2NXP A;  1X5B A;  3D3M A;  3QNK A;  3CLJ A;  4KMO A;  5M72 A;  3U66 A;  4ANU A;  4KT6 B;  4ANX A;  5LOZ A;  4ATG A;  3QB2 A;  3SF4 A;  4N3C A;  1H2V C;  2R5S A;  5G04 J;  1HU3 A;  1OWL A;  4NQ0 A;  3APD A;  2A5U A;  4L2Y A;  4WND A;  4B89 A;  2GW1 A;  3FEX A;  3Q15 A;  3OTN A;  3LS8 A;  4GU5 A;  4N3B A;  5KJK A;  4CT0 A;  1NA0 A;  2WPV A;  4CEM A;  2JLB A;  4XIF A;  4UQX A;  4ABN A;  3R7Q A;  2IFU A;  2XGO A;  2RD0 A;  2I1J A;  2WQH A;  3ASD A;  4XI9 A;  4F1S A;  4K03 A;  4WNG A;  3UT7 A;  1WM5 A;  2L0T B;  4JA7 A;  5D0Q D;  4PS7 A;  4GYO A;  3PE3 A;  3R7R A;  5FJY A;  1EF1 C;  5D0O D;  4F3V A;  3NZS A;  2WXK A;  3KS2 A;  3S7B A;  3FTZ A;  3FFL A;  3TG5 A;  5LCW C;  3TG4 A;  3CV0 A;  1Z6T A;  3PUJ A;  2Y4U A;  3PUK A;  3SGH A;  1E7U A;  3JYS A;  4KZC A;  4HS2 A;  2C0M A;  2HYZ A;  1TEZ A;  2VSN A;  4LUN U;  4AJW A;  2FO7 A;  3APC A;  3BG1 B;  3T5X A;  4TRQ A;  3SZ7 A;  3ZYK A;  5KJN A;  2PM7 A;  5FQ8 A;  4GYW A;  2XRZ A;  1NA3 A;  2KC7 A;  3PEU B;  4UQZ A;  3TL5 A;  5FZS A;  2PZI A;  3FH8 A;  4RVB A;  3S7J A;  1EDU A;  4TUU A;  4UI9 C;  3FTS A;  4GA2 A;  2CFZ A;  1L5J A;  4GYY A;  1YA0 A;  3VLE A;  4JL0 A;  2IOS A;  3CKB A;  3ZGQ A;  2VSO E;  4KBQ A;  4PDX A;  2WQ6 A;  3ZHE A;  2ZU6 B;  4UWL A;  3QC1 A;  5EKQ D;  3OXL A;  1HE8 A;  3RO3 A;  1PC2 A;  3DBS A;  3UQ3 A;  3SBS A;  4I6E A;  3ZRH A;  3QDN A;  3CVW A;  2AW6 A;  2VJ8 A;  5JJ6 A;  4YVO A;  1ZBP A;  2KCV A;  3CIA A;  4MLP A;  2XGM A;  2XPY A;  5LCW J;  4FJY A;  4OYS A;  3Q49 B;  4W9R A;  4N3A A;  3L08 A;  4M3O A;  1ELK A;  2VSX E;  5C1D A;  3LJ3 A;  2VTB A;  3KAE A;  3MA5 A;  2XPI A;  3RJV A;  3JCK C;  4L23 A;  5KJL A;  3FTV A;  4AEZ C;  3OAW A;  1NZN A;  5JHB A;  4ACL A;  3FUI A;  4UQY A;  3UT8 A;  3FU0 A;  3FDH A;  4WNF A;  3P2B A;  3FY4 A;  2GGF A;  2CG2 A;  2MRI A;  4LEU A;  1FVH A;  4EEC A;  4FLB A;  4EBA A;  1UW4 B;  4FHJ A;  4XE0 A;  4HVB A;  2QFC A;  4EZK A;  4UI9 J;  1H2U A;  4JPS A;  2CHX A;  4B8C B;  3KD7 A;  4OVU A;  4U63 A;  2P58 C;  1N54 A;  4RG9 A;  1H19 A;  4IUL A;  4JA9 A;  4FC8 A;  4I2W A;  1JUQ A;  3ZFW A;  1OWP A;  2WVI A;  1PY1 A;  3G2V A;  2LSU A;  3OXG A;  3QAQ A;  2XHE A;  3I4G A;  3ZXS A;  3FUE A;  4KVM A;  1U3D A;  3CK8 A;  4LRZ A;  4FU3 A;  2FF4 A;  4FAD A;  3URZ A;  2LO6 A;  3MZL B;  4IN3 B;  4JXT A;  3B7S A;  3RRU A;  3ZEF A;  4N2Q A;  3EHN A;  5FQ4 A;  4DLQ A;  4Q94 A;  2UWJ G;  3EIQ C;  3L16 A;  2WXN A;  2Q7F A;  4HOT A;  3O4Z A;  2HO1 A;  3ESK A;  1E96 B;  4E6H A;  1EPU A;  1HZ4 A;  2PM6 A;  3JQ1 A;  1OWN A;  3UUX A;  3I3N A;  4XKB A;  2L6J A;  4A55 A;  5A6C A;  3VLF A;  4IYP A;  5KJM A;  5ARF A;  4OVV A;  3PE4 A;  2AXU A;  4CDN A;  2WXO A;  5FZR A;  3D9L A;  3HHM A;  1QNF A;  3B7U X;  3MJW A;  4HOQ A;  4HXI A;  3SD5 A;  3ML9 A;  4BT8 A;  2OVF A;  3HVE B;  4UWK A;  5LX8 A;  4N2S A;  1JWF A;  4U04 A;  5EX3 A;  2VGX B;  2WXF A;  2YQ8 A;  1S0P A;  5FT9 A;  4A3V A;  5ANR A;  4CCA A;  3T8M A;  5AEN A;  1Z3Y A;  2X6K A;  4XZ4 A;  3MKQ A;  4CDM A;  2L9B A;  2M63 A;  2DBA A;  2X6F A;  4DI4 A;  1H6K A;  3QOU A;  4FLH A;  3L13 A;  2V8S E;  5J08 A;  2WXG A;  3D9O A;  3D9P A;  2QY7 A;  2OVB A;  1HXI A;  4UWG A;  4F7A A;  5HQ8 A;  1HO8 A;  2WXJ A;  3ENE A;  2I1K A;  3UMV A;  1JPL A;  3CKC A;  1EYH A;  2KCK A;  4K0R A;  4XI0 A;  4G1T A;  4ANW A;  4GMJ A;  3FHE A;  4DPR A;  3D9I A;  2MOW A;  1DVP A;  2FUL A;  3AS8 A;  4ILI A;  4V3I A;  2V0P A;  2HM8 A;  1UN9 A;  3TJP A;  3ZN3 A;  3HDX A;  4GCO A;  1B89 A;  3LKU A;  2J08 A;  4ILG A;  5A7D B;  3CHO A;  3ASF A;  1IYG A;  2A4Z A;  3CHP A;  3I5P A;  2VQ2 A;  5AYW D;  4AXH A;  4BT9 A;  4BY6 A;  1BPO A;  5G05 C;  3L17 A;  4HOU A;  4I9E A;  3CQG B;  3PVL A;  4PH4 B;  4U0U A;  3ZYQ A;  2FBN A;  4H7Y A;  4EQF A;  2KZT A;  2UY1 A;  3EIJ A;  5JJT A;  1OUV A;  5J90 A;  3B13 A;  2E2E A;  2YHE A;  4LCT A;  4WWP A;  4G2V A;  4CDR A;  3D9N A;  4I6J A;  2AXV A;  2VTB B;  2C0L A;  4JEH A;  4WWO A;  2YHC A;  4MKT A;  3RIB A;  4BFR A;  4U8H A;  1H2T C;  2VSY A;  3DPD A;  3FUH A;  3NZU A;  4QFV A;  3B7R L;  5FWQ A;  3LXU X;  3D9M A;  4BX9 A;  5EDS A;  1WAO 1;  2R17 C;  3G2W A;  2WXR A;  4HOR A;  1HG5 A;  3CVL A;  5G2N A;  4YND A;  4L1B A;  2WMO A;  3QKY A;  2WXI A;  3EDT B;  3C98 A;  4FP7 A;  4BSX A;  4ME2 A;  3TAX A;  3CSF A;  3PNL B;  3Q4A B;  5FZQ A;  5BPP A;  4JZY A;  2KM4 A;  3ESL A;  2WXP A;  4EZJ A;  3CVX A;  1XNF A;  3FU5 A;  3TXN A;  3VTY A;  3CHS A;  2WM9 A;  4WUY A;  1MHQ A;  4APF A;  4IRU A;  2LAH A;  2WXM A;  4N39 A;  4FA6 A;  4I1O B;  2LNI A;  3FP3 A;  3QK0 A;  5G05 J;  4CGW A;  4JVS A;  4U07 A;  4AVX A;  4URK A;  2YIN A;  4KXK B;  5T8I A;  3EJN A;  4B8A A;  4UWF A;  3ONK A;  4CT4 A;  2E0I A;  3ONL A;  3PH0 C;  4XX5 A;  2BF0 X;  3CHQ A;  4B94 A;  1FCH A;  3HYM B;  3ML8 A;  1UJJ A;  2C2L A;  3IHY A;  3SNX A;  5BT1 A;  3U3W A;  1E8Y A;  2GRM A;  1KT1 A;  2L0I A;  3MV2 B;  4MS6 A;  1HS6 A;  3UPV A;  3IHV A;  3JUI A;  2X6I A;  5FQ7 A;  4EPZ A;  3E4B A;  4A3T A;  3L22 A;  2NSZ A;  3ZYM A;  4EZL A;  4A1G A;  3Q47 B;  1OWO A;  2WB2 A;  2KCL A;  4BTB A;  3LY7 A;  1E7V A;  1KT0 A;  2NC9 A;  4O6F A;  4WNE A;  1ELR A;  3TXM A;  2MHK A;  4A1S A;  5T3R A;  2GRL A;  3PDN A;  4GML A;  1SZA A;  4C0M A;  2XCC A;  3PS6 A;  3RRM B;  3G2U A;  3VLD A;  4CRW A;  3CR3 A;  3UX4 A;  5CHE E;  3GZ1 A;  2V5F A;  2Y4T A;  5BV1 A;  1E8X A;  4G24 A;  1IHG A;  2HR2 A;  3QJZ A;  4FUL A;  3FH5 A;  3MV3 B;  2J9Q A;  3SI5 A;  2CG3 A;  4GZ5 A;  4BX8 A;  1INZ A;  3FWV A;  5ENN A;  4AY6 A;  4F53 A;  4RSY A;  5HI7 A;  2X3M A;  4J8D A;  2I2O A;  5BUZ A;  1N52 A;  2XGS A;  3ZVV A;  4UI9 K;  2CFU A;  3IEG A;  2LAI A;  3GZ2 A;  3FEY A;  4ILH B;  5ANL A;  4BWR A;  2WQ7 A;  5JJ7 A;  4L7T A;  4I43 A;  2KZT B;  3FTY A;  2EQX A;  4FHK A;  5A23 A;  3R9A B;  4Q69 A;  4C9B B;  4DLO A;  4AOF A;  4WAF A;  1UJK A;  3U4T A;  2FI7 A;  2OOE A;  2YNQ A;  2AVP A;  5BV0 A;  4Q96 A;  3CVN A;  3GW4 A;  3U64 A;  1E8Z A;  2PQN A;  3QWW A;  4GAA A;  4HLE A;  2IOL A;  2PQR A;  3BG0 B;  3FUD A;  4GZD A;  4C0E A;  3HIZ A;  2IF4 A;  2XQ0 A;  3S2A A;  2XRY A;  1IQR A;  2CHZ A;  3FTX A;  3AU4 A;  3LVQ E;  2RG8 A;  2J49 A;  4B0Z A;  1HFA A;  3CVY A;  5FTP A;  4GZC A;  2IQC A;  3ZHE B;  3LY9 A;  4U0Z A;  1KLX A;  5DBK A;  1QQE A;  2VGY A;  1JWG A;  3RU0 A;  3EHM A;  3FUF A;  3ASG A;  1TJC A;  1OWM A;  1MQS A;  4MRU A;  4KZ0 A;  3I4R B;  4G25 A;  4J8S A;  3ULQ A;  2I9C A;  5CCL A;  3T5V A;  4I1M A;  3FTW A;  5T4Y A;  3Q5M A;  4AM9 A;  1GW6 A;  3FU3 A;  2WXL A;  3IBE A;  3MX3 A;  4AV7 A;  3MKR A;  4GCN A;  2BTD A;  3PRZ A;  5CCM A;  1E90 A;  4I2Z A;  1ELW A;  3FUM A;  4AP2 A;  2WXQ A;  4J8F A;  4G23 A;  3S7D A;  3SFZ A;  3GYZ A;  4U0S A;  4KVO A;  4I1A A;  4H7X A;  1A17 A;  1SZ9 A;  3PEV B;  3P1U A;  3B7T A;  4GA0 A;  3PNT B;  3CK7 A;  3CHR A;  5AIJ A;  4GZ3 A;  3HVE A;  2CHW A;  3D9K A;  2VGX A;  3FUN A;  4DJA A;  3ASH A;  3L54 A;  4Y6W A;  3IKO B;  3LDZ A;  3LYA A;  4JEU A;  1UG3 A;  3BEE A;  3CQC B;  4JHK A;  4J8E A;  4JC8 A;  3FUL A;  3QAR A;  2KAT A;  4D10 C;  1HG2 A;  3FUJ A;  2J07 A;  2XEV A;  3N71 A;  1H0A A;  2WMN A;  4ACK A;  3MCX A;  4APO A;  3ZW3 A;  2LSV A;  4NUR A;  3RKV A;  1U3C A;  4EBA G;  3MGB A;  1ZU2 A;  4PS3 A;  5E76 A;  2J09 A;  1Z3X A;  5DIZ A;  4DK5 A;  3CVP A;  3CST A;  3JQ0 A;  3TGO A;  5JHA A;  4PS8 A;  3CVV A;  3QWP A;  1DNP A;  2IU1 A;  2OV8 A;  3G2S A;  4E85 A;  2J4B A;  1P5Q A;  2I6H A;  1LF8 A;  2PL2 A;  3ZYL A;  3RO2 A;  4RG6 A;  4GB9 A;  2ILR A;  1Y6I A;  3LEW A;  4TV3 A;  5AJD A;  4XKC A;  3KEZ A;  4I17 A;  4R7L A;  4ANV A;  2XPZ A;  1HF8 A;  3CVQ A;  4GZ6 A;  4DI3 A;  4JHJ A;  4J6I A;  3LCA A;  3ZIM A;  4AY5 A;  2BUG A;  2FEZ A;  3LPZ A;  3SHF A;  2DCP A;  1WY6 A;  2VYI A;  3VTX A;  5CMW A;  4I6G A;  1HH8 A;  3IV0 A;  4I9C A;  1IQU A;  1QZ2 A;  3MKQ B;  2Y3A A;  4KYO B;  4G26 A;  5ARG A;  4UWH A;  3L6A A;  3CEQ A;  2WXH A;  4P29 A;  1XGW A;  4NAC A;  1HX8 A;  4J0U A;  5AJL A;  5G55 A;  1TJF A;  5EX0 A;  4LER A;  4WWN A;  1NP7 A;  5LFA A;  2AWI A;  3AS5 A;  3LVR E;  2ION A;  3CHM A;  3SBT B;  3AS4 A;  3FU6 A;  3MYV A;  5G04 C;  3UT4 A;  4Y6C A;  4GPK A;  3RRN B;  1Y8M A;  2IJG X;  4AIF A;  4CGV A;  3WXX A;  2DIW A;  3K9I A;  2R59 A;  1VDY A;  3RK6 A;  5LP0 A;  3QWV A;  3GZS A;  4YVQ C;  2JEK A;  3S7F A;  4BTA A;  5BW8 C;  3U9W A;  3NQP A;  4G11 A;  3MEK A;  1UN8 A;  4JHR A;  3AU5 A;  5C2Y A;  2OND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...