1INZA

Solution structure of the epsin n-terminal homology (enth) domain of human epsin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
GSSRMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPS15-INTERACTING PORTEIN(EPSIN)
publication title Solution structure of the epsin N-terminal homology (ENTH) domain of human epsin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2000-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1inzA00
4GZDA 4GZCA 4Q94A 4FLBA 3ZYLA 3RRUA 2V8SE 3D9KA 1VDYA 4NACA 1ELKA 3D9IA 4HFGA 1X5BA 5LOZA 1EYHA 3D9LA 3G2VA 4JXTA 1HX8A 2BF0X 1UJJA 3CLJA 3ZYMA 1PY1A 2DCPA 3D9PA 1H0AA 1HF8A 2QY7A 3ONLA 1MHQA 2LO6A 3D9NA 5CMYA 1JWGA 3ZYKA 3D9OA 2MOWA 4Q96A 3D9MA 3ONKA 1JPLA 5LP0A 1UJKA 3G2SA 1HG2A 2L0TB 1JWFA 1DVPA 3G2TA 4AVXA 5CMWA 1EDUA 2DIWA 5J08A 1INZA 3D9JA 3G2WA 1JUQA 3G2UA 4FU3A 1HFAA 1HG5A 1LF8A 3LDZA 1SZ9A 3ZYQA 1XGWA 2L0IA 1SZAA 2KM4A
chains in the Genus database with same CATH superfamily
4Q94A 2GROB 2I6HA 2WXLA 2IONA 2XEEA 1QZ2A 3PE4A 4A1SA 3TWVA 3OTNA 3DXMG 1Z3YA 3ZRHA 3L54A 3Q73A 2ZISA 2LXMA 1OT8A 1FVHA 5G55A 3TL5A 2EILE 5KJMA 2KM4A 4CEMA 2X6IA 2XRZA 2QYJA 4U96D 3KD7A 2YQ8A 3ZYQA 2WPVA 3ZGQA 3AU5A 4E6HA 3PVLA 4ZFHA 1OWNA 3ISMC 3ABKE 1JCQA 4IRUA 3ZN3A 3RO3A 4GTQA 4ACLA 2C0LA 2FEZA 4GCOA 4ANVA 4ATZD 5FINA 3D9LA 3AS8A 2E2EA 4I43A 2R2LA 3Q5MA 1ELWA 2WMOA 4DJAA 2IFUA 2MHKA 3LCAA 4GA1A 3NBNB 3V31A 1PC2A 2L6JA 2OV8A 4I9CA 3DWLG 2OVBA 2WXMA 5BNWA 4JHRA 1UJKA 3CEQA 1V55E 3GYZA 3SO8A 1E90A 5FQ8A 1HO8A 5FZSA 3JUEA 4JEHA 2YHCA 4NACA 3FEYA 4BFRA 5E75A 2EIJE 3RJVA 3UKUG 1EF1C 4BTAA 4X8QA 3NB2A 1MX6A 3HXBA 1ZU2A 4MS6A 5J90A 3QOUA 2IEJA 4GPKA 3SFYA 3PE3A 5AIJA 2F37A 2GRQB 3UM0A 2XS1A 4G2VA 4J8DA 3G2VA 1HX8A 4G26A 3ENEA 4HRNA 4A3TA 3CVNA 3ONKA 2P9NG 1H6OA 2JABA 4NRHB 3UX4A 4A1GA 4U95D 4U04A 2VJ8A 2XS8A 3LJ3A 4ACKA 3OAWA 2P9SG 2P2CP 4N2SA 1TNOA 2WM9A 1NL4A 2R5SA 3WXXA 2WQHA 3PEVB 2J07A 4GMRA 3KS2A 2R17C 1HF8A 3I4GA 5ENRD 5B1AE 5AQ9A 2WXFA 4I17A 3D9MA 4EPZA 5AAOA 3PRZA 3Q15A 1AP7A 4A63B 1E8ZA 2V5FA 4HRMB 5CERB 1B89A 4JA9A 2Y4TA 5FTPA 1FT2A 3DSTA 2XGSA 4GYOA 2P9LG 2R59A 3JQ1A 1SVXA 1MHQA 4KYOB 4RG6A 4K03A 4B89A 3DBSA 4JHKA 4JZYA 2VTBA 4MBGA 4DI3A 1H19A 1N4SA 4BERA 3U64A 1UW4B 4XX5A 1H6PA 3L6AA 1EDUA 5CEDB 1YCSB 3QJZA 3CIAA 1RW2A 5ENOD 3ZNGA 3LKUA 3DEPA 1FVFA 4GMJA 3FY4A 4J8YA 4CGVA 2OEWA 3D9OA 4KT6B 3RAUA 4TXPA 2AXUA 4W9RA 2P9UG 4CZ2D 4L2YA 1E7UA 3EU5A 4PS8A 5LFAA 4ATGA 2V4LA 3AG2E 3MV2B 2VSNA 3MGBA 4I1MA 2FF4A 4UQYA 4N5CA 2CHWA 4XE0A 2H6GA 2KC7A 1HU3A 2AXZA 2LO6A 2J4DA 3TWXA 2Y1LE 1P5QA 4XIFA 5LX8A 2PQNA 4HBDA 4F1SA 3CQGB 5EYLA 1MX4A 3UIPC 4DX1A 1SA5A 1U3CA 3DSVA 2LSUA 4BX8A 3NOGD 3GW4A 2DYSE 4F1PA 1LD7A 4FHJA 2WQ7A 4OAUC 1YYHA 5ENSD 2H6FA 2LSVA 2YNQA 3MZLB 4FHKA 1WDYA 2DBAA 2BUGA 1IYGA 3UQ3A 4LRZA 4AOFA 2I2OA 2WXIA 4N3BA 2J49A 3SBTB 3CGHA 2DIWA 5G05J 1DCQA 4O1OA 3EIJA 3LYAA 1NA3A 4JL0A 4BTBA 3IKOB 4FLHA 2X6FA 2VSXE 1TN6A 2UY1B 3C3OA 2R02A 1DVPA 5ARFA 1Z6TA 3FTYA 2P9KG 4OVUA 1JUQA 3LXUX 2E0IA 2KCKA 2GRLA 2QFCA 3UMVA 1VDYA 4M3OA 4XZ4A 3TAXA 4G1TA 3QWVA 3MKQB 4I2WA 4I6GA 1TNUA 4BX9A 3OXGA 5EN5D 2V8SE 4Q69A 5ENNA 4TV3A 3PNLB 5CCLA 5FZQA 4BT9A 3NAWA 5G2NA 3UKRG 3EIQC 2IO3C 5FZRA 3N71A 3D9KA 2J09A 5HI7A 3P2BA 3HXEA 1OWMA 4GZ5A 3WG7E 3F6QA 5G04C 5ENPD 3EDTB 3CVYA 4RLYA 5LP0A 5EX3A 4JEUA 3EHRA 4WUYA 3UT4A 3B7RL 2CG2A 4BETA 2RG8A 3ZXPA 4F7AA 3LY7A 4UI9C 3W9FA 5BV1A 3T5VA 3RO2A 1JPLA 1ZBPA 2UWJG 3C3RA 1QNFA 3E32A 1KT0A 2RFMA 4WWPA 2AWIA 4XI0A 3DSWA 3C72A 2ZXWE 4KVMA 2H6IA 1MYOA 2QYUA 4CYMD 1SW6A 2Q7FA 4HXIA 1A17A 3QAQA 2MYOA 1N4QA 3B7BA 3UPVA 3EHMA 2WXJA 5LCWC 1TJCA 3S7JA 4L7TA 2DCPA 1S70B 3FTVA 4JVSA 4ME2A 4GTRA 2CHXA 3FULA 3QARA 3FH7A 4GPMA 3G2WA 4J7WA 1E96B 1S0PA 3V2OA 3V79K 1E8YA 1KLXA 4FLBA 5C1DA 3UXGA 3ULQA 5LOZA 1OUVA 4PUCA 3B7UX 1Q2ZA 3MJWA 4L9PA 4IN3B 3FHEA 5FT9A 3MKQA 3IEGA 1Y8MA 3PH0C 3ASOE 5ENQD 3SFZA 3FH5A 4EBAG 4AV7A 2FO1E 4HNAD 3ULEG 4I2ZA 4CDNA 4JA7A 5ANLA 3BEEA 1XNFA 3GZ2A 4B93B 4F53A 4WNDA 3FU3A 3Q9NC 1X81A 3JQ0A 3CSTA 3FUEA 4CT0A 1AWCB 4GAAA 3I4RB 3Q49B 3BU8A 1JWGA 3LY8A 3SI5A 2VTBB 2FO7A 3KAEA 3FWVA 5CCMA 5AARA 3TXMA 4HRLA 3FU0A 3SHFA 2F8XK 1HG5A 2IU1A 4XKCA 3AS5A 3MA5A 5BW8C 3SNXA 4AP2A 1YA0A 2NC9A 4YDYA 1UOHA 4OAVB 2KXPC 5KJNA 2DVWA 1OCOE 1ZB1A 4UI9K 3NZUA 1TEZA 3V30A 3X2QE 4CT4A 1KT1A 4O6FA 3AS4A 4GYWA 3D3MA 4IYPA 1O1RA 5FJYA 3PZ2A 2XHEA 1HZ4A 2P9IG 3DSUA 3D9NA 3VTXA 4WNEA 4BSZB 5KNGA 2R03A 3ABME 4R7LA 4HOTA 2EQXA 2WMNA 5AN8A 5JHBA 4N3AA 3VLFA 4PS3A 4HFGA 3CSFA 3NQPA 3T5XA 3ML9A 4I6JA 5AYWD 4TXRA 2XENA 4UWHA 3SFXA 1UN9A 4F6RD 4J8FA 2LAHA 3ABLE 4H7YA 4FP7A 3UM1A 1ELRA 3FUMA 2FI7A 4YDWA 4I1AA 2LUHA 2X38A 2PM6A 3IHYA 4CDRA 4C0EA 2VSOE 3HHMA 4J8SA 1HS6A 4HI9A 4C9BB 2BTDA 3HVEB 3C5RA 2DWZA 4DX6D 4MRUA 3UM2A 5ENTD 3Q4AB 4DUIA 4F3VA 3V2XA 2WQ6A 4BWRA 1KZOA 4LG6A 4TXQA 4HLLA 1TJFA 2GW1A 1IHBA 1LTXA 5KJLA 2XCBA 4A55A 1N54A 5EDSA 4RSYA 3SQVA 3CKCA 3LS8A 2ZGGA 4AEZC 1OCRE 2NYJA 4GYYA 1IHGA 2WXNA 4G11A 2WXGA 4PDXA 1HXIA 1OY3D 3RRNB 3Q79A 5CRUA 4GTMA 3UINC 4O1PA 1BI7B 3E4BA 4XI9A 5EX0A 4GCNA 2WXHA 4C48B 2CHZA 5AENA 4DLQA 3R9AB 1KZPA 3E37A 3TG5A 4Q96A 1WM5A 3PUJA 4HB5A 4AVXA 2J9QA 3PUKA 4JHJA 2F8YA 2C0MA 1FPPA 3MCXA 2GRMA 2ZU6B 1FCHA 3ZFWA 3D9PA 2LNIA 5CBNA 2WXKA 4HOUA 4FA6A 3Q78A 3O4ZA 5CEAA 2KCVA 4N2QA 2X6HA 3SZ7A 2V5QC 5HRYA 3AJIA 3FTSA 3ZPJA 4D10C 4JW1A 3ZIMA 3HYMB 3ZKJA 2NXPA 2ETCA 2Y4UA 4H7XA 3RKVA 3L08A 2CFZA 1RZ4A 3AG4E 1Y6IA 5T3RA 2KATA 3Q47B 1N52A 3HVEA 3DRAA 4LCTA 4CRWA 1O5MA 3KEZA 3JUIA 1PAQA 3DXKG 4K0RA 3CVWA 4G8LA 1IXVA 2IF4A 1G3NB 1OWOA 1INZA 4CGWA 3JXIA 3Q7FA 1JCSA 4GMLA 3PZ1A 2J08A 4HOSA 3FTZA 5JHAA 4GZ6A 2QC9A 3OXFA 3CHPA 2ETBA 5BT1A 3BUAA 2H6HA 3FUHA 5D0QD 4B8CB 3ZW3A 4KVOA 2M63A 3LVRE 4EZJA 3HXFA 3QWWA 5A23A 4B0ZA 2OVFA 2HYZA 1NZNA 1N9AA 3BG1B 5KWDA 2VGEA 4AJWA 1JWFA 3FDHA 4UWKA 1N11A 3BQOA 4FU3A 3FEXA 1WY6A 5EIBE 4O60A 3B7TA 4U0ZA 3PNTB 3Q7AA 4UI9J 3FTXA 3TG4A 2YINA 5B3SE 1OXJA 3CHQA 3CKBA 3G2TA 4EECA 5G05C 5CMWA 3L82A 5CRVA 2A5UA 2ILRA 2XGOA 3QWPA 4RVBA 4NURA 4GTTA 2Y69E 1U2VG 1EPUA 1GW6A 2EIME 3FU6A 3KSLA 4JXTA 4J6IA 1NA0A 3GZSA 2GGFA 1NI1A 4V3IA 4APOA 2I1JA 2XQ0A 3UT8A 1H2UA 5D0OD 1IQRA 1BU9A 4GTSA 5FQ7A 2VGYA 4BSXA 1TN8A 3CVVA 1MX2A 4K5CA 1QQEA 4C0MA 1IKND 4J8EA 3DEOA 3PZDA 3GZ1A 5E76A 5ITZF 3EUVA 3NF1A 4AM9A 4FADA 4HI8A 4FULA 3K9IA 2OEVA 3MX3A 2GRNB 5BUZA 2OCCE 5A7DB 1Z3XA 1TNZA 1MZCA 3DSXA 4TUMA 3L16A 3IBEA 3CHMA 2ONDA 3R7RA 3ASNE 4LEUA 5D2MC 4DX2A 4UWGA 2KZTB 1K1AA 3ZVVA 1A5EA 3T9KA 3OXLA 2QY7A 4YVOA 3R7QA 4UQZA 3UUXA 5C2YA 4EQFA 4MLPA 3D9JA 2VSYA 3FP3A 3LY9A 4WNFA 5H7PA 3RSEG 4Z68A 2V4HC 3BG0B 2ZGDA 3EHNA 2OOEA 3HRAA 1X5BA 5AJDA 2VYIA 4YVQC 2KCLA 5T4YA 2VQ2A 5FIOA 3ONLA 3PDNA 2X6JA 2PL2A 4L2LA 5FQ6A 4JPSA 4E85A 1TYQG 5EYPF 3LJNA 4TUUA 2J8SD 4QFVA 3J5QB 4YDEA 2WXOA 2I1KA 4GTVA 4LNBA 1IQUA 1L5JA 4DRXE 3FUDA 4BT8A 4N5QA 3R9MA 4ANWA 4KXKB 3L9TA 3PREA 3RRMB 4DX7D 4ILGA 1NFIE 3QK0A 4ABNA 4ILIA 2ZIRA 3SF4A 4Y6CA 4EZLA 2AXVA 1UJJA 4U63A 3EU9A 3JCKC 5AQAA 1O1SA 5D66A 4LERA 3ML8A 5BXOA 3G2UA 3PEUB 5ANRA 5AQ7A 4WWOA 2PNNA 1SZAA 4U0UA 2L9BA 3ZXSA 2I9CA 3IV0A 4BY6A 3FUJA 5HKPA 4ZHBA 3W9GA 4UWLA 3QNKA 4NQ0A 1JCRA 2IOSA 4FJZA 3DPYA 4AY5A 1HH8A 3D9HA 3FUIA 1OWLA 3PZ4A 1E7VA 3AG1E 2RFAA 3ESKA 3MEKA 3RK6A 2WB2A 3AAAC 2HO1A 4GZDA 2QZAA 3UTMA 1WG0A 2XEVA 4K5BA 3UIOC 3VLEA 2XPZA 4M7CA 1N0QA 5FWQA 4XEIG 1SQMA 2KZTA 4FC8A 2EINE 3L17A 2GRRB 3D9IA 2WXPA 2F0YA 2XZDG 1FT1A 3KSQA 3EJNA 3CLJA 3CHRA 1PY1A 2DYRE 5M72A 1MJ0A 4AY6A 3FFLA 3FH8A 4GA0A 4GZ3A 5DIZA 3TWSA 2HM8A 5B1BE 5HS0A 4P29A 4U8YD 2FBNA 4EZKA 3SD5A 4TRQA 3ZYMA 1K3ZD 4U7EB 2MRIA 4HQDA 2IY0C 1NP7A 3SY2A 1HE8A 3FUKA 2GRPB 3FUFA 4U07A 4FJYA 3B13A 3SGHA 4G23A 3ZUVB 3TXNA 3U4TA 4L23A 1E8XA 4LUNU 4U8HA 2XGMA 1SA4A 3S2AA 3URZA 4I9EA 5EKQD 5BPPA 5JA4D 3E30A 4K5AB 4ANXA 3S7DA 1DNPA 4G8KA 1LF8A 3FU5A 3RU0A 2CG3A 4DK5A 3ASGA 4ILHB 2BF0X 4UUCA 1H0AA 3NOCD 3TWUA 3C3QA 5AJLA 4UQXA 1HFAA 3DSSA 3LEWA 3TWQA 3U9WA 4DPRA 3ZYLA 4WWNA 2XEHA 4IULA 5KCMA 2DZOA 2RD0A 2DZNA 3LPZA 4G25A 1TNBA 3C98A 4RG9A 3T8MA 1TN7A 1N0RA 3ZEFA 3L22A 4GTOA 2HR2A 3CR3A 5JJ7A 4CDMA 3U3WA 4J0UA 4APFA 3AG3E 3KEAA 3UM3A 1EYHA 1DC2A 5DBKA 2JLBA 4AXHA 2PQRA 4OYSA 4I1OB 3FTUA 3Q9UC 4Y6WA 3IHVA 3PZ3A 2R05A 3Q75A 2RKKA 3U66A 5JMND 5CHEE 1TNYA 4U0SA 5JJTA 2IQCA 1XGWA 2L0IA 2CFUA 3TWWA 1H2TC 4UWFA 2NSZA 2BKKB 3VLDA 4JC8A 4KMOA 4YDOA 3I3NA 3JXJA 3HXCA 4YNDA 2FULA 4BESA 5KJKA 3QDNA 4GB9A 2IO2C 4B94A 5EILA 1ELKA 4U8VD 1K8KG 4MKTA 4DX5D 4QQIA 1OCZE 3O48A 2B0OE 2PZIA 4AIFA 4EBAA 4DI4A 2VGXB 3CHSA 5BXUA 2BKGA 2AW6A 3FTWA 3HDXA 3APDA 5KBAA 3RRUA 2XPYA 3TWRA 3CQCB 1H2VC 4G24A 3TGOA 2P9PG 4KBQA 4N39A 1N4PA 1BD8A 1E8WA 4OVVA 4HORA 1N95A 1D9SA 4HS2A 4L1BA 3UI2A 2Y0BG 3ZHEB 3VTYA 5KNHD 3E34A 3J5PA 3S7BA 2PM7A 1DCEA 3QKYA 2XRYA 2XZTG 4HVBA 5A6CA 2MOWA 2WXQA 4DLOA 3L13A 4EHMA 3PS6A 4JD2G 2WXRA 3ZU7B 4BEPA 4GZCA 2AVPA 4PS7A 3ASHA 3QC1A 2IOLA 5G04J 3DPDA 1OWPA 4XKBA 4B8AA 5CECB 3NZSA 1Z5SC 4HOQA 4KZCA 2C2LA 3AU4A 4URKA 3ULYA 3CVQA 3IXEA 2L0TB 4GTPA 3CK8A 3MYVA 2A4ZA 4CCAA 3CVXA 1BI8B 1N4RA 2BEDA 3CK9A 3CVLA 3SBSA 3ASFA 3T8KA 1YMPA 2B6CA 3CVPA 3CVUA 1LD8A 2A5EA 4PH4B 2IJGX 1D8DA 1UN8A 3CV0A 3FUNA 4RQIA 3B95A 1N94A 2LXLA 4NIKA 5IY5E 1S64A 1D8EA 4WAFA 2J4BA 3ZYKA 1K1BA 4N3CA 1V54E 4I6EA 3TWTA 3G2SA 2XPIA 3CK7A 3APFA 3UT7A 1U3DA 5EIDA 5CBOA 5T8IA 3ESLA 3I5PA 3RIBA 5LCWJ 3ASDA 3MV3B 1KPSB 1S63A 2VGXA 1BLXB 1MQSA 2X6KA 4LSZE 1QYMA 5ARGA 5BV0A 3APCA 5FQ4A 3EHQA 3HG0D 1SZ9A 4A3VA 3S7FA 2V0PA 2Y3AA 2WVIA 3QB2A 1WAO1 2KBXA 4GA2A 1H6KA 1OCCE 2L6BA 1BPOA 3ZHEA 3CHOA 4ANUA 2JEKA 2AJAA 3MKRA 3E33A 4WNGA 2ETAA 3B7SA 3P1UA 1TR4A 3JYSA 5AQBA 3LVQE 1HG2A 4JB8P 5J08A 2LAIA 4GU5A 4LNGA 5HQ8A 4HLEA 1UG3A 2UY1A 3HXDA 2XCCA 3HIZA 2P58C 5CMYA 2YHEA 5JJ6A 2EIKE 4KZ0A 3TJPA 2X3MA 3LDZA 1O1TA 4LNUD 1QBQA 1W3BA 2HE0A
chains in the Genus database with same CATH topology
4Q94A 4BX9A 2I6HA 2WXLA 3OXGA 2IONA 2V8SE 1QZ2A 3PE4A 4A1SA 4JHJA 3SD5A 4TRQA 2C0MA 3MCXA 2GRMA 2ZU6B 3OTNA 1FCHA 3ZFWA 3ZYMA 4Q69A 1Z3YA 2LNIA 3D9PA 2MRIA 2WXKA 5ENNA 4TV3A 3PNLB 4HOUA 4FA6A 3O4ZA 5CCLA 5FZQA 1NP7A 4BT9A 1HE8A 2KCVA 3FUKA 5G2NA 2X6HA 3SZ7A 3ZRHA 3L54A 3FUFA 4N2QA 4U07A 3FTSA 3ZPJA 4D10C 3EIQC 4FJYA 4JW1A 3ZIMA 3B13A 1FVHA 5FZRA 5G55A 3SGHA 3HYMB 3TL5A 3N71A 2KM4A 4G23A 4CEMA 5KJMA 3TXNA 3D9KA 2J09A 3U4TA 5HI7A 2X6IA 2XRZA 3P2BA 4L23A 1E8XA 2NXPA 1OWMA 4GZ5A 4LUNU 4U8HA 2XGMA 2Y4UA 5G04C 3KD7A 4H7XA 2YQ8A 3RKVA 3L08A 2CFZA 3ZYQA 3S2AA 2WPVA 3EDTB 3CVYA 3ZGQA 3AU5A 4E6HA 3PVLA 1Y6IA 1OWNA 3URZA 4I9EA 5T3RA 5LP0A 2KATA 3Q47B 4IRUA 5EX3A 1N52A 5EKQD 5BPPA 3HVEA 3ZN3A 4JEUA 3RO3A 4LCTA 4ANXA 4CRWA 3S7DA 1DNPA 1LF8A 4WUYA 3FU5A 3UT4A 3KEZA 3RU0A 3JUIA 3B7RL 4ACLA 2CG3A 2C0LA 2FEZA 4GCOA 3ASGA 4ANVA 4DK5A 1PAQA 2CG2A 2RG8A 4ILHB 3D9LA 3AS8A 2E2EA 4F7AA 4K0RA 3CVWA 2BF0X 3LY7A 4UI9C 4I43A 1H0AA 5BV1A 3Q5MA 1ELWA 2IF4A 3T5VA 2WMOA 3RO2A 1JPLA 4DJAA 1ZBPA 1OWOA 2IFUA 2UWJG 1INZA 1QNFA 5AJLA 4UQXA 2MHKA 4CGWA 1HFAA 1KT0A 4WWPA 3LCAA 4GA1A 2AWIA 3LEWA 4XI0A 3U9WA 4DPRA 3ZYLA 4GMLA 4WWNA 4IULA 4KVMA 5KCMA 2J08A 1PC2A 2L6JA 2OV8A 4HOSA 3FTZA 4I9CA 2RD0A 3LPZA 4G25A 2OVBA 5JHAA 4GZ6A 3OXFA 3C98A 3CHPA 5BT1A 2WXMA 4RG9A 5BNWA 4JHRA 1UJKA 3CEQA 3T8MA 3FUHA 2Q7FA 4HXIA 5D0QD 3GYZA 3ZEFA 1E90A 3L22A 5FQ8A 2HR2A 1A17A 1HO8A 3QAQA 4B8CB 3CR3A 3ZW3A 5JJ7A 4KVOA 3UPVA 5FZSA 2M63A 3LVRE 4JEHA 2YHCA 4NACA 3EHMA 4CDMA 4EZJA 3U3WA 4J0UA 4APFA 2WXJA 3FEYA 4BFRA 1EYHA 5E75A 5LCWC 5DBKA 1TJCA 3RJVA 3QWWA 2JLBA 3S7JA 2PQRA 4B0ZA 2OVFA 1EF1C 4L7TA 4AXHA 4BTAA 2DCPA 2HYZA 1NZNA 4OYSA 3BG1B 3FTUA 3FTVA 4I1OB 4Y6WA 4JVSA 4ME2A 2CHXA 3FULA 3IHVA 4AJWA 3QARA 1JWFA 3FH7A 3U66A 1ZU2A 4MS6A 5J90A 3QOUA 3G2WA 3FDHA 4UWKA 5CHEE 4GPKA 4FU3A 4U0SA 3FEXA 3PE3A 1E96B 1S0PA 5AIJA 2IQCA 5JJTA 1XGWA 2L0IA 1E8YA 1KLXA 2CFUA 4FLBA 1WY6A 1H2TC 4UWFA 5C1DA 2NSZA 3ULQA 4G2VA 3B7TA 5LOZA 3VLDA 4U0ZA 1OUVA 4J8DA 3G2VA 4JC8A 4PUCA 3B7UX 1HX8A 3MJWA 3PNTB 4UI9J 4KMOA 3FTXA 4G26A 3ENEA 4IN3B 3I3NA 3FHEA 5FT9A 3TG4A 2YINA 3CHQA 3MKQA 3CKBA 3CVNA 3IEGA 3ONKA 4YNDA 4A3TA 2FULA 3G2TA 4EECA 1Y8MA 3PH0C 5G05C 5CMWA 5KJKA 4NRHB 3QDNA 3UX4A 4A1GA 4GB9A 4U04A 2A5UA 2ILRA 2VJ8A 2XGOA 3LJ3A 3QWPA 4RVBA 4ACKA 3OAWA 4NURA 4B94A 1EPUA 1GW6A 3FU6A 4N2SA 2WM9A 1ELKA 2R5SA 3SFZA 3WXXA 4MKTA 2WQHA 3PEVB 3FH5A 4EBAG 4AV7A 4JXTA 2J07A 4J6IA 3KS2A 2R17C 3O48A 4I2ZA 4CDNA 1HF8A 3I4GA 2PZIA 4JA7A 5ANLA 2WXFA 3BEEA 3D9MA 4I17A 1NA0A 4AIFA 4EBAA 3GZSA 1XNFA 3GZ2A 4EPZA 2GGFA 3PRZA 4DI4A 3Q15A 4V3IA 4APOA 4F53A 2VGXB 3CHSA 4WNDA 2I1JA 2XQ0A 3UT8A 1H2UA 2AW6A 3FTWA 3FU3A 5D0OD 3HDXA 3APDA 3JQ0A 1IQRA 3CSTA 5FQ7A 2VGYA 3FUEA 4BSXA 1E8ZA 3RRUA 2V5FA 4CT0A 2XPYA 3CVVA 1B89A 4JA9A 2Y4TA 3CQCB 1H2VC 5FTPA 4GAAA 4G24A 1QQEA 3TGOA 2XGSA 3I4RB 4KBQA 4GYOA 4C0MA 2R59A 3JQ1A 3Q49B 1MHQA 4KYOB 4RG6A 4J8EA 1JWGA 3LY8A 3SI5A 2VTBB 4K03A 2FO7A 3PZDA 3KAEA 4N39A 3GZ1A 4B89A 5E76A 3DBSA 3FWVA 4JHKA 1E8WA 3NF1A 4OVVA 4AM9A 5CCMA 4FADA 4HORA 4HS2A 4L1BA 3TXMA 3FU0A 4FULA 3SHFA 1HG5A 2IU1A 3ZHEB 3K9IA 3VTYA 3MX3A 4XKCA 3AS5A 5BUZA 3S7BA 4JZYA 2VTBA 2PM7A 4DI3A 1H19A 3MA5A 5BW8C 5A7DB 3SNXA 3QKYA 4AP2A 1YA0A 2XRYA 4HVBA 1Z3XA 2NC9A 5A6CA 3U64A 1UW4B 2MOWA 3L16A 3IBEA 3CHMA 2ONDA 4XX5A 3R7RA 5KJNA 2WXQA 4DLOA 3L13A 5A23A 3L6AA 1EDUA 3PS6A 4LEUA 4UI9K 3NZUA 3QJZA 2WXRA 1TEZA 3CIAA 4CT4A 4GZCA 1KT1A 4O6FA 2AVPA 3LKUA 3AS4A 2KZTB 3ASHA 3QC1A 4GYWA 2IOLA 3D3MA 4IYPA 1FVFA 4PS7A 4UWGA 5FJYA 4GMJA 5G04J 3ZVVA 2XHEA 3DPDA 3FY4A 1OWPA 1HZ4A 4XKBA 3OXLA 2QY7A 3D9NA 4B8AA 4CGVA 4YVOA 3D9OA 3R7QA 3NZSA 3VTXA 4UQZA 4KT6B 3UUXA 4WNEA 5C2YA 4EQFA 4MLPA 4HOQA 4KZCA 2C2LA 3AU4A 4URKA 3D9JA 2VSYA 2AXUA 4R7LA 3FP3A 3LY9A 4W9RA 4HOTA 2EQXA 4WNFA 2WMNA 3CVQA 5JHBA 4N3AA 2L0TB 3VLFA 3CK8A 3BG0B 3EHNA 3MYVA 4L2YA 2OOEA 4PS3A 4HFGA 1X5BA 2A4ZA 3CSFA 5AJDA 3NQPA 2VYIA 3T5XA 4YVQC 3ML9A 4I6JA 4CCAA 2KCLA 3CVXA 5AYWD 2VQ2A 5T4YA 1E7UA 3ONLA 4PS8A 5LFAA 4ATGA 3CK9A 2V4LA 4UWHA 3MV2B 3CVLA 1UN9A 3SBSA 3ASFA 3PDNA 2X6JA 3CVPA 3CVUA 2PL2A 4L2LA 4J8FA 4PH4B 2IJGX 5FQ6A 2VSNA 3MGBA 4JPSA 4E85A 1UN8A 3CV0A 4I1MA 3FUNA 2LAHA 4H7YA 4FP7A 4TUUA 2FF4A 4QFVA 4UQYA 1ELRA 4N5CA 2CHWA 4XE0A 3FUMA 4WAFA 2J4BA 2FI7A 2KC7A 1HU3A 2AXZA 2I1KA 2WXOA 3ZYKA 2LO6A 2J4DA 4I1AA 1IQUA 4N3CA 4I6EA 1L5JA 2X38A 2PM6A 3IHYA 3FUDA 3G2SA 1P5QA 2XPIA 3CK7A 4BT8A 4C0EA 4CDRA 4ANWA 2VSOE 3HHMA 4KXKB 3APFA 4J8SA 4XIFA 3PREA 1HS6A 3RRMB 5LX8A 4C9BB 2PQNA 4ILGA 3UT7A 1U3DA 4F1SA 2BTDA 3CQGB 3HVEB 3QK0A 4ABNA 4ILIA 5T8IA 3ESLA 3I5PA 4MRUA 3RIBA 3SF4A 4Y6CA 5LCWJ 3ASDA 3MV3B 4EZLA 2AXVA 1U3CA 1UJJA 3Q4AB 2LSUA 4U63A 4BX8A 4F3VA 2VGXA 3JCKC 2WQ6A 1MQSA 2X6KA 3GW4A 4BWRA 5ARGA 1TJFA 5BV0A 4FHJA 3APCA 4LERA 2WQ7A 5FQ4A 3ML8A 2GW1A 3G2UA 3PEUB 5ANRA 5KJLA 4WWOA 1SZ9A 2LSVA 3MZLB 2YNQA 4FHKA 1SZAA 2XCBA 2DBAA 4U0UA 2BUGA 4A3VA 2L9BA 3S7FA 3ZXSA 4A55A 1IYGA 2V0PA 2I9CA 1N54A 3IV0A 4BY6A 3UQ3A 5EDSA 2Y3AA 4RSYA 2WVIA 3FUJA 4LRZA 3CKCA 4UWLA 3LS8A 4AOFA 2I2OA 3QNKA 4NQ0A 2WXIA 1WAO1 3QB2A 4GA2A 2IOSA 1H6KA 4N3BA 2J49A 4FJZA 3SBTB 4AY5A 3CGHA 1HH8A 1BPOA 4AEZC 3FUIA 3ZHEA 1OWLA 3CHOA 2DIWA 4ANUA 5G05J 1E7VA 2JEKA 1IHGA 4GYYA 2WXNA 4G11A 3MKRA 3EIJA 3ESKA 3MEKA 3RK6A 2WB2A 2WXGA 4PDXA 1HXIA 2HO1A 4WNGA 4GZDA 3B7SA 3P1UA 3RRNB 3LYAA 1NA3A 4JL0A 2XEVA 4BTBA 3IKOB 4FLHA 2X6FA 3JYSA 3VLEA 2VSXE 3E4BA 2XPZA 4XI9A 2UY1B 5EX0A 3LVQE 1HG2A 1DVPA 5ARFA 1Z6TA 5FWQA 3FTYA 5J08A 2LAIA 1SQMA 4GU5A 4GCNA 4OVUA 2WXHA 1JUQA 5HQ8A 4HLEA 3LXUX 2KZTA 4FC8A 2E0IA 2KCKA 2GRLA 3L17A 2QFCA 2CHZA 5AENA 3UMVA 1VDYA 1UG3A 3D9IA 2UY1A 2WXPA 4M3OA 4DLQA 4XZ4A 2XCCA 3EJNA 3HIZA 3R9AB 2P58C 3CLJA 3CHRA 3TAXA 1PY1A 3TG5A 5CMYA 4G1TA 5M72A 3QWVA 4AY6A 2YHEA 4Q96A 3FFLA 3FH8A 4GA0A 4GZ3A 5DIZA 1WM5A 3PUJA 2HM8A 5JJ6A 4AVXA 4KZ0A 3TJPA 3MKQB 2J9QA 4P29A 4I2WA 2X3MA 4I6GA 2FBNA 3LDZA 3PUKA 4EZKA 1W3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZD A;  4GZC A;  4Q94 A;  4FLB A;  3ZYL A;  3RRU A;  2V8S E;  3D9K A;  1VDY A;  4NAC A;  1ELK A;  3D9I A;  4HFG A;  1X5B A;  5LOZ A;  1EYH A;  3D9L A;  3G2V A;  4JXT A;  1HX8 A;  2BF0 X;  1UJJ A;  3CLJ A;  3ZYM A;  1PY1 A;  2DCP A;  3D9P A;  1H0A A;  1HF8 A;  2QY7 A;  3ONL A;  1MHQ A;  2LO6 A;  3D9N A;  5CMY A;  1JWG A;  3ZYK A;  3D9O A;  2MOW A;  4Q96 A;  3D9M A;  3ONK A;  1JPL A;  5LP0 A;  1UJK A;  3G2S A;  1HG2 A;  2L0T B;  1JWF A;  1DVP A;  3G2T A;  4AVX A;  5CMW A;  1EDU A;  2DIW A;  5J08 A;  1INZ A;  3D9J A;  3G2W A;  1JUQ A;  3G2U A;  4FU3 A;  1HFA A;  1HG5 A;  1LF8 A;  3LDZ A;  1SZ9 A;  3ZYQ A;  1XGW A;  2L0I A;  1SZA A;  2KM4 A; 
#chains in the Genus database with same CATH topology
 4Q94 A;  2GRO B;  2I6H A;  2WXL A;  2ION A;  2XEE A;  1QZ2 A;  3PE4 A;  4A1S A;  3TWV A;  3OTN A;  3DXM G;  1Z3Y A;  3ZRH A;  3L54 A;  3Q73 A;  2ZIS A;  2LXM A;  1OT8 A;  1FVH A;  5G55 A;  3TL5 A;  2EIL E;  5KJM A;  2KM4 A;  4CEM A;  2X6I A;  2XRZ A;  2QYJ A;  4U96 D;  3KD7 A;  2YQ8 A;  3ZYQ A;  2WPV A;  3ZGQ A;  3AU5 A;  4E6H A;  3PVL A;  4ZFH A;  1OWN A;  3ISM C;  3ABK E;  1JCQ A;  4IRU A;  3ZN3 A;  3RO3 A;  4GTQ A;  4ACL A;  2C0L A;  2FEZ A;  4GCO A;  4ANV A;  4ATZ D;  5FIN A;  3D9L A;  3AS8 A;  2E2E A;  4I43 A;  2R2L A;  3Q5M A;  1ELW A;  2WMO A;  4DJA A;  2IFU A;  2MHK A;  3LCA A;  4GA1 A;  3NBN B;  3V31 A;  1PC2 A;  2L6J A;  2OV8 A;  4I9C A;  3DWL G;  2OVB A;  2WXM A;  5BNW A;  4JHR A;  1UJK A;  3CEQ A;  1V55 E;  3GYZ A;  3SO8 A;  1E90 A;  5FQ8 A;  1HO8 A;  5FZS A;  3JUE A;  4JEH A;  2YHC A;  4NAC A;  3FEY A;  4BFR A;  5E75 A;  2EIJ E;  3RJV A;  3UKU G;  1EF1 C;  4BTA A;  4X8Q A;  3NB2 A;  1MX6 A;  3HXB A;  1ZU2 A;  4MS6 A;  5J90 A;  3QOU A;  2IEJ A;  4GPK A;  3SFY A;  3PE3 A;  5AIJ A;  2F37 A;  2GRQ B;  3UM0 A;  2XS1 A;  4G2V A;  4J8D A;  3G2V A;  1HX8 A;  4G26 A;  3ENE A;  4HRN A;  4A3T A;  3CVN A;  3ONK A;  2P9N G;  1H6O A;  2JAB A;  4NRH B;  3UX4 A;  4A1G A;  4U95 D;  4U04 A;  2VJ8 A;  2XS8 A;  3LJ3 A;  4ACK A;  3OAW A;  2P9S G;  2P2C P;  4N2S A;  1TNO A;  2WM9 A;  1NL4 A;  2R5S A;  3WXX A;  2WQH A;  3PEV B;  2J07 A;  4GMR A;  3KS2 A;  2R17 C;  1HF8 A;  3I4G A;  5ENR D;  5B1A E;  5AQ9 A;  2WXF A;  4I17 A;  3D9M A;  4EPZ A;  5AAO A;  3PRZ A;  3Q15 A;  1AP7 A;  4A63 B;  1E8Z A;  2V5F A;  4HRM B;  5CER B;  1B89 A;  4JA9 A;  2Y4T A;  5FTP A;  1FT2 A;  3DST A;  2XGS A;  4GYO A;  2P9L G;  2R59 A;  3JQ1 A;  1SVX A;  1MHQ A;  4KYO B;  4RG6 A;  4K03 A;  4B89 A;  3DBS A;  4JHK A;  4JZY A;  2VTB A;  4MBG A;  4DI3 A;  1H19 A;  1N4S A;  4BER A;  3U64 A;  1UW4 B;  4XX5 A;  1H6P A;  3L6A A;  1EDU A;  5CED B;  1YCS B;  3QJZ A;  3CIA A;  1RW2 A;  5ENO D;  3ZNG A;  3LKU A;  3DEP A;  1FVF A;  4GMJ A;  3FY4 A;  4J8Y A;  4CGV A;  2OEW A;  3D9O A;  4KT6 B;  3RAU A;  4TXP A;  2AXU A;  4W9R A;  2P9U G;  4CZ2 D;  4L2Y A;  1E7U A;  3EU5 A;  4PS8 A;  5LFA A;  4ATG A;  2V4L A;  3AG2 E;  3MV2 B;  2VSN A;  3MGB A;  4I1M A;  2FF4 A;  4UQY A;  4N5C A;  2CHW A;  4XE0 A;  2H6G A;  2KC7 A;  1HU3 A;  2AXZ A;  2LO6 A;  2J4D A;  3TWX A;  2Y1L E;  1P5Q A;  4XIF A;  5LX8 A;  2PQN A;  4HBD A;  4F1S A;  3CQG B;  5EYL A;  1MX4 A;  3UIP C;  4DX1 A;  1SA5 A;  1U3C A;  3DSV A;  2LSU A;  4BX8 A;  3NOG D;  3GW4 A;  2DYS E;  4F1P A;  1LD7 A;  4FHJ A;  2WQ7 A;  4OAU C;  1YYH A;  5ENS D;  2H6F A;  2LSV A;  2YNQ A;  3MZL B;  4FHK A;  1WDY A;  2DBA A;  2BUG A;  1IYG A;  3UQ3 A;  4LRZ A;  4AOF A;  2I2O A;  2WXI A;  4N3B A;  2J49 A;  3SBT B;  3CGH A;  2DIW A;  5G05 J;  1DCQ A;  4O1O A;  3EIJ A;  3LYA A;  1NA3 A;  4JL0 A;  4BTB A;  3IKO B;  4FLH A;  2X6F A;  2VSX E;  1TN6 A;  2UY1 B;  3C3O A;  2R02 A;  1DVP A;  5ARF A;  1Z6T A;  3FTY A;  2P9K G;  4OVU A;  1JUQ A;  3LXU X;  2E0I A;  2KCK A;  2GRL A;  2QFC A;  3UMV A;  1VDY A;  4M3O A;  4XZ4 A;  3TAX A;  4G1T A;  3QWV A;  3MKQ B;  4I2W A;  4I6G A;  1TNU A;  4BX9 A;  3OXG A;  5EN5 D;  2V8S E;  4Q69 A;  5ENN A;  4TV3 A;  3PNL B;  5CCL A;  5FZQ A;  4BT9 A;  3NAW A;  5G2N A;  3UKR G;  3EIQ C;  2IO3 C;  5FZR A;  3N71 A;  3D9K A;  2J09 A;  5HI7 A;  3P2B A;  3HXE A;  1OWM A;  4GZ5 A;  3WG7 E;  3F6Q A;  5G04 C;  5ENP D;  3EDT B;  3CVY A;  4RLY A;  5LP0 A;  5EX3 A;  4JEU A;  3EHR A;  4WUY A;  3UT4 A;  3B7R L;  2CG2 A;  4BET A;  2RG8 A;  3ZXP A;  4F7A A;  3LY7 A;  4UI9 C;  3W9F A;  5BV1 A;  3T5V A;  3RO2 A;  1JPL A;  1ZBP A;  2UWJ G;  3C3R A;  1QNF A;  3E32 A;  1KT0 A;  2RFM A;  4WWP A;  2AWI A;  4XI0 A;  3DSW A;  3C72 A;  2ZXW E;  4KVM A;  2H6I A;  1MYO A;  2QYU A;  4CYM D;  1SW6 A;  2Q7F A;  4HXI A;  1A17 A;  3QAQ A;  2MYO A;  1N4Q A;  3B7B A;  3UPV A;  3EHM A;  2WXJ A;  5LCW C;  1TJC A;  3S7J A;  4L7T A;  2DCP A;  1S70 B;  3FTV A;  4JVS A;  4ME2 A;  4GTR A;  2CHX A;  3FUL A;  3QAR A;  3FH7 A;  4GPM A;  3G2W A;  4J7W A;  1E96 B;  1S0P A;  3V2O A;  3V79 K;  1E8Y A;  1KLX A;  4FLB A;  5C1D A;  3UXG A;  3ULQ A;  5LOZ A;  1OUV A;  4PUC A;  3B7U X;  1Q2Z A;  3MJW A;  4L9P A;  4IN3 B;  3FHE A;  5FT9 A;  3MKQ A;  3IEG A;  1Y8M A;  3PH0 C;  3ASO E;  5ENQ D;  3SFZ A;  3FH5 A;  4EBA G;  4AV7 A;  2FO1 E;  4HNA D;  3ULE G;  4I2Z A;  4CDN A;  4JA7 A;  5ANL A;  3BEE A;  1XNF A;  3GZ2 A;  4B93 B;  4F53 A;  4WND A;  3FU3 A;  3Q9N C;  1X81 A;  3JQ0 A;  3CST A;  3FUE A;  4CT0 A;  1AWC B;  4GAA A;  3I4R B;  3Q49 B;  3BU8 A;  1JWG A;  3LY8 A;  3SI5 A;  2VTB B;  2FO7 A;  3KAE A;  3FWV A;  5CCM A;  5AAR A;  3TXM A;  4HRL A;  3FU0 A;  3SHF A;  2F8X K;  1HG5 A;  2IU1 A;  4XKC A;  3AS5 A;  3MA5 A;  5BW8 C;  3SNX A;  4AP2 A;  1YA0 A;  2NC9 A;  4YDY A;  1UOH A;  4OAV B;  2KXP C;  5KJN A;  2DVW A;  1OCO E;  1ZB1 A;  4UI9 K;  3NZU A;  1TEZ A;  3V30 A;  3X2Q E;  4CT4 A;  1KT1 A;  4O6F A;  3AS4 A;  4GYW A;  3D3M A;  4IYP A;  1O1R A;  5FJY A;  3PZ2 A;  2XHE A;  1HZ4 A;  2P9I G;  3DSU A;  3D9N A;  3VTX A;  4WNE A;  4BSZ B;  5KNG A;  2R03 A;  3ABM E;  4R7L A;  4HOT A;  2EQX A;  2WMN A;  5AN8 A;  5JHB A;  4N3A A;  3VLF A;  4PS3 A;  4HFG A;  3CSF A;  3NQP A;  3T5X A;  3ML9 A;  4I6J A;  5AYW D;  4TXR A;  2XEN A;  4UWH A;  3SFX A;  1UN9 A;  4F6R D;  4J8F A;  2LAH A;  3ABL E;  4H7Y A;  4FP7 A;  3UM1 A;  1ELR A;  3FUM A;  2FI7 A;  4YDW A;  4I1A A;  2LUH A;  2X38 A;  2PM6 A;  3IHY A;  4CDR A;  4C0E A;  2VSO E;  3HHM A;  4J8S A;  1HS6 A;  4HI9 A;  4C9B B;  2BTD A;  3HVE B;  3C5R A;  2DWZ A;  4DX6 D;  4MRU A;  3UM2 A;  5ENT D;  3Q4A B;  4DUI A;  4F3V A;  3V2X A;  2WQ6 A;  4BWR A;  1KZO A;  4LG6 A;  4TXQ A;  4HLL A;  1TJF A;  2GW1 A;  1IHB A;  1LTX A;  5KJL A;  2XCB A;  4A55 A;  1N54 A;  5EDS A;  4RSY A;  3SQV A;  3CKC A;  3LS8 A;  2ZGG A;  4AEZ C;  1OCR E;  2NYJ A;  4GYY A;  1IHG A;  2WXN A;  4G11 A;  2WXG A;  4PDX A;  1HXI A;  1OY3 D;  3RRN B;  3Q79 A;  5CRU A;  4GTM A;  3UIN C;  4O1P A;  1BI7 B;  3E4B A;  4XI9 A;  5EX0 A;  4GCN A;  2WXH A;  4C48 B;  2CHZ A;  5AEN A;  4DLQ A;  3R9A B;  1KZP A;  3E37 A;  3TG5 A;  4Q96 A;  1WM5 A;  3PUJ A;  4HB5 A;  4AVX A;  2J9Q A;  3PUK A;  4JHJ A;  2F8Y A;  2C0M A;  1FPP A;  3MCX A;  2GRM A;  2ZU6 B;  1FCH A;  3ZFW A;  3D9P A;  2LNI A;  5CBN A;  2WXK A;  4HOU A;  4FA6 A;  3Q78 A;  3O4Z A;  5CEA A;  2KCV A;  4N2Q A;  2X6H A;  3SZ7 A;  2V5Q C;  5HRY A;  3AJI A;  3FTS A;  3ZPJ A;  4D10 C;  4JW1 A;  3ZIM A;  3HYM B;  3ZKJ A;  2NXP A;  2ETC A;  2Y4U A;  4H7X A;  3RKV A;  3L08 A;  2CFZ A;  1RZ4 A;  3AG4 E;  1Y6I A;  5T3R A;  2KAT A;  3Q47 B;  1N52 A;  3HVE A;  3DRA A;  4LCT A;  4CRW A;  1O5M A;  3KEZ A;  3JUI A;  1PAQ A;  3DXK G;  4K0R A;  3CVW A;  4G8L A;  1IXV A;  2IF4 A;  1G3N B;  1OWO A;  1INZ A;  4CGW A;  3JXI A;  3Q7F A;  1JCS A;  4GML A;  3PZ1 A;  2J08 A;  4HOS A;  3FTZ A;  5JHA A;  4GZ6 A;  2QC9 A;  3OXF A;  3CHP A;  2ETB A;  5BT1 A;  3BUA A;  2H6H A;  3FUH A;  5D0Q D;  4B8C B;  3ZW3 A;  4KVO A;  2M63 A;  3LVR E;  4EZJ A;  3HXF A;  3QWW A;  5A23 A;  4B0Z A;  2OVF A;  2HYZ A;  1NZN A;  1N9A A;  3BG1 B;  5KWD A;  2VGE A;  4AJW A;  1JWF A;  3FDH A;  4UWK A;  1N11 A;  3BQO A;  4FU3 A;  3FEX A;  1WY6 A;  5EIB E;  4O60 A;  3B7T A;  4U0Z A;  3PNT B;  3Q7A A;  4UI9 J;  3FTX A;  3TG4 A;  2YIN A;  5B3S E;  1OXJ A;  3CHQ A;  3CKB A;  3G2T A;  4EEC A;  5G05 C;  5CMW A;  3L82 A;  5CRV A;  2A5U A;  2ILR A;  2XGO A;  3QWP A;  4RVB A;  4NUR A;  4GTT A;  2Y69 E;  1U2V G;  1EPU A;  1GW6 A;  2EIM E;  3FU6 A;  3KSL A;  4JXT A;  4J6I A;  1NA0 A;  3GZS A;  2GGF A;  1NI1 A;  4V3I A;  4APO A;  2I1J A;  2XQ0 A;  3UT8 A;  1H2U A;  5D0O D;  1IQR A;  1BU9 A;  4GTS A;  5FQ7 A;  2VGY A;  4BSX A;  1TN8 A;  3CVV A;  1MX2 A;  4K5C A;  1QQE A;  4C0M A;  1IKN D;  4J8E A;  3DEO A;  3PZD A;  3GZ1 A;  5E76 A;  5ITZ F;  3EUV A;  3NF1 A;  4AM9 A;  4FAD A;  4HI8 A;  4FUL A;  3K9I A;  2OEV A;  3MX3 A;  2GRN B;  5BUZ A;  2OCC E;  5A7D B;  1Z3X A;  1TNZ A;  1MZC A;  3DSX A;  4TUM A;  3L16 A;  3IBE A;  3CHM A;  2OND A;  3R7R A;  3ASN E;  4LEU A;  5D2M C;  4DX2 A;  4UWG A;  2KZT B;  1K1A A;  3ZVV A;  1A5E A;  3T9K A;  3OXL A;  2QY7 A;  4YVO A;  3R7Q A;  4UQZ A;  3UUX A;  5C2Y A;  4EQF A;  4MLP A;  3D9J A;  2VSY A;  3FP3 A;  3LY9 A;  4WNF A;  5H7P A;  3RSE G;  4Z68 A;  2V4H C;  3BG0 B;  2ZGD A;  3EHN A;  2OOE A;  3HRA A;  1X5B A;  5AJD A;  2VYI A;  4YVQ C;  2KCL A;  5T4Y A;  2VQ2 A;  5FIO A;  3ONL A;  3PDN A;  2X6J A;  2PL2 A;  4L2L A;  5FQ6 A;  4JPS A;  4E85 A;  1TYQ G;  5EYP F;  3LJN A;  4TUU A;  2J8S D;  4QFV A;  3J5Q B;  4YDE A;  2WXO A;  2I1K A;  4GTV A;  4LNB A;  1IQU A;  1L5J A;  4DRX E;  3FUD A;  4BT8 A;  4N5Q A;  3R9M A;  4ANW A;  4KXK B;  3L9T A;  3PRE A;  3RRM B;  4DX7 D;  4ILG A;  1NFI E;  3QK0 A;  4ABN A;  4ILI A;  2ZIR A;  3SF4 A;  4Y6C A;  4EZL A;  2AXV A;  1UJJ A;  4U63 A;  3EU9 A;  3JCK C;  5AQA A;  1O1S A;  5D66 A;  4LER A;  3ML8 A;  5BXO A;  3G2U A;  3PEU B;  5ANR A;  5AQ7 A;  4WWO A;  2PNN A;  1SZA A;  4U0U A;  2L9B A;  3ZXS A;  2I9C A;  3IV0 A;  4BY6 A;  3FUJ A;  5HKP A;  4ZHB A;  3W9G A;  4UWL A;  3QNK A;  4NQ0 A;  1JCR A;  2IOS A;  4FJZ A;  3DPY A;  4AY5 A;  1HH8 A;  3D9H A;  3FUI A;  1OWL A;  3PZ4 A;  1E7V A;  3AG1 E;  2RFA A;  3ESK A;  3MEK A;  3RK6 A;  2WB2 A;  3AAA C;  2HO1 A;  4GZD A;  2QZA A;  3UTM A;  1WG0 A;  2XEV A;  4K5B A;  3UIO C;  3VLE A;  2XPZ A;  4M7C A;  1N0Q A;  5FWQ A;  4XEI G;  1SQM A;  2KZT A;  4FC8 A;  2EIN E;  3L17 A;  2GRR B;  3D9I A;  2WXP A;  2F0Y A;  2XZD G;  1FT1 A;  3KSQ A;  3EJN A;  3CLJ A;  3CHR A;  1PY1 A;  2DYR E;  5M72 A;  1MJ0 A;  4AY6 A;  3FFL A;  3FH8 A;  4GA0 A;  4GZ3 A;  5DIZ A;  3TWS A;  2HM8 A;  5B1B E;  5HS0 A;  4P29 A;  4U8Y D;  2FBN A;  4EZK A;  3SD5 A;  4TRQ A;  3ZYM A;  1K3Z D;  4U7E B;  2MRI A;  4HQD A;  2IY0 C;  1NP7 A;  3SY2 A;  1HE8 A;  3FUK A;  2GRP B;  3FUF A;  4U07 A;  4FJY A;  3B13 A;  3SGH A;  4G23 A;  3ZUV B;  3TXN A;  3U4T A;  4L23 A;  1E8X A;  4LUN U;  4U8H A;  2XGM A;  1SA4 A;  3S2A A;  3URZ A;  4I9E A;  5EKQ D;  5BPP A;  5JA4 D;  3E30 A;  4K5A B;  4ANX A;  3S7D A;  1DNP A;  4G8K A;  1LF8 A;  3FU5 A;  3RU0 A;  2CG3 A;  4DK5 A;  3ASG A;  4ILH B;  2BF0 X;  4UUC A;  1H0A A;  3NOC D;  3TWU A;  3C3Q A;  5AJL A;  4UQX A;  1HFA A;  3DSS A;  3LEW A;  3TWQ A;  3U9W A;  4DPR A;  3ZYL A;  4WWN A;  2XEH A;  4IUL A;  5KCM A;  2DZO A;  2RD0 A;  2DZN A;  3LPZ A;  4G25 A;  1TNB A;  3C98 A;  4RG9 A;  3T8M A;  1TN7 A;  1N0R A;  3ZEF A;  3L22 A;  4GTO A;  2HR2 A;  3CR3 A;  5JJ7 A;  4CDM A;  3U3W A;  4J0U A;  4APF A;  3AG3 E;  3KEA A;  3UM3 A;  1EYH A;  1DC2 A;  5DBK A;  2JLB A;  4AXH A;  2PQR A;  4OYS A;  4I1O B;  3FTU A;  3Q9U C;  4Y6W A;  3IHV A;  3PZ3 A;  2R05 A;  3Q75 A;  2RKK A;  3U66 A;  5JMN D;  5CHE E;  1TNY A;  4U0S A;  5JJT A;  2IQC A;  1XGW A;  2L0I A;  2CFU A;  3TWW A;  1H2T C;  4UWF A;  2NSZ A;  2BKK B;  3VLD A;  4JC8 A;  4KMO A;  4YDO A;  3I3N A;  3JXJ A;  3HXC A;  4YND A;  2FUL A;  4BES A;  5KJK A;  3QDN A;  4GB9 A;  2IO2 C;  4B94 A;  5EIL A;  1ELK A;  4U8V D;  1K8K G;  4MKT A;  4DX5 D;  4QQI A;  1OCZ E;  3O48 A;  2B0O E;  2PZI A;  4AIF A;  4EBA A;  4DI4 A;  2VGX B;  3CHS A;  5BXU A;  2BKG A;  2AW6 A;  3FTW A;  3HDX A;  3APD A;  5KBA A;  3RRU A;  2XPY A;  3TWR A;  3CQC B;  1H2V C;  4G24 A;  3TGO A;  2P9P G;  4KBQ A;  4N39 A;  1N4P A;  1BD8 A;  1E8W A;  4OVV A;  4HOR A;  1N95 A;  1D9S A;  4HS2 A;  4L1B A;  3UI2 A;  2Y0B G;  3ZHE B;  3VTY A;  5KNH D;  3E34 A;  3J5P A;  3S7B A;  2PM7 A;  1DCE A;  3QKY A;  2XRY A;  2XZT G;  4HVB A;  5A6C A;  2MOW A;  2WXQ A;  4DLO A;  3L13 A;  4EHM A;  3PS6 A;  4JD2 G;  2WXR A;  3ZU7 B;  4BEP A;  4GZC A;  2AVP A;  4PS7 A;  3ASH A;  3QC1 A;  2IOL A;  5G04 J;  3DPD A;  1OWP A;  4XKB A;  4B8A A;  5CEC B;  3NZS A;  1Z5S C;  4HOQ A;  4KZC A;  2C2L A;  3AU4 A;  4URK A;  3ULY A;  3CVQ A;  3IXE A;  2L0T B;  4GTP A;  3CK8 A;  3MYV A;  2A4Z A;  4CCA A;  3CVX A;  1BI8 B;  1N4R A;  2BED A;  3CK9 A;  3CVL A;  3SBS A;  3ASF A;  3T8K A;  1YMP A;  2B6C A;  3CVP A;  3CVU A;  1LD8 A;  2A5E A;  4PH4 B;  2IJG X;  1D8D A;  1UN8 A;  3CV0 A;  3FUN A;  4RQI A;  3B95 A;  1N94 A;  2LXL A;  4NIK A;  5IY5 E;  1S64 A;  1D8E A;  4WAF A;  2J4B A;  3ZYK A;  1K1B A;  4N3C A;  1V54 E;  4I6E A;  3TWT A;  3G2S A;  2XPI A;  3CK7 A;  3APF A;  3UT7 A;  1U3D A;  5EID A;  5CBO A;  5T8I A;  3ESL A;  3I5P A;  3RIB A;  5LCW J;  3ASD A;  3MV3 B;  1KPS B;  1S63 A;  2VGX A;  1BLX B;  1MQS A;  2X6K A;  4LSZ E;  1QYM A;  5ARG A;  5BV0 A;  3APC A;  5FQ4 A;  3EHQ A;  3HG0 D;  1SZ9 A;  4A3V A;  3S7F A;  2V0P A;  2Y3A A;  2WVI A;  3QB2 A;  1WAO 1;  2KBX A;  4GA2 A;  1H6K A;  1OCC E;  2L6B A;  1BPO A;  3ZHE A;  3CHO A;  4ANU A;  2JEK A;  2AJA A;  3MKR A;  3E33 A;  4WNG A;  2ETA A;  3B7S A;  3P1U A;  1TR4 A;  3JYS A;  5AQB A;  3LVQ E;  1HG2 A;  4JB8 P;  5J08 A;  2LAI A;  4GU5 A;  4LNG A;  5HQ8 A;  4HLE A;  1UG3 A;  2UY1 A;  3HXD A;  2XCC A;  3HIZ A;  2P58 C;  5CMY A;  2YHE A;  5JJ6 A;  2EIK E;  4KZ0 A;  3TJP A;  2X3M A;  3LDZ A;  1O1T A;  4LNU D;  1QBQ A;  1W3B A;  2HE0 A; 
#chains in the Genus database with same CATH homology
 4Q94 A;  4BX9 A;  2I6H A;  2WXL A;  3OXG A;  2ION A;  2V8S E;  1QZ2 A;  3PE4 A;  4A1S A;  4JHJ A;  3SD5 A;  4TRQ A;  2C0M A;  3MCX A;  2GRM A;  2ZU6 B;  3OTN A;  1FCH A;  3ZFW A;  3ZYM A;  4Q69 A;  1Z3Y A;  2LNI A;  3D9P A;  2MRI A;  2WXK A;  5ENN A;  4TV3 A;  3PNL B;  4HOU A;  4FA6 A;  3O4Z A;  5CCL A;  5FZQ A;  1NP7 A;  4BT9 A;  1HE8 A;  2KCV A;  3FUK A;  5G2N A;  2X6H A;  3SZ7 A;  3ZRH A;  3L54 A;  3FUF A;  4N2Q A;  4U07 A;  3FTS A;  3ZPJ A;  4D10 C;  3EIQ C;  4FJY A;  4JW1 A;  3ZIM A;  3B13 A;  1FVH A;  5FZR A;  5G55 A;  3SGH A;  3HYM B;  3TL5 A;  3N71 A;  2KM4 A;  4G23 A;  4CEM A;  5KJM A;  3TXN A;  3D9K A;  2J09 A;  3U4T A;  5HI7 A;  2X6I A;  2XRZ A;  3P2B A;  4L23 A;  1E8X A;  2NXP A;  1OWM A;  4GZ5 A;  4LUN U;  4U8H A;  2XGM A;  2Y4U A;  5G04 C;  3KD7 A;  4H7X A;  2YQ8 A;  3RKV A;  3L08 A;  2CFZ A;  3ZYQ A;  3S2A A;  2WPV A;  3EDT B;  3CVY A;  3ZGQ A;  3AU5 A;  4E6H A;  3PVL A;  1Y6I A;  1OWN A;  3URZ A;  4I9E A;  5T3R A;  5LP0 A;  2KAT A;  3Q47 B;  4IRU A;  5EX3 A;  1N52 A;  5EKQ D;  5BPP A;  3HVE A;  3ZN3 A;  4JEU A;  3RO3 A;  4LCT A;  4ANX A;  4CRW A;  3S7D A;  1DNP A;  1LF8 A;  4WUY A;  3FU5 A;  3UT4 A;  3KEZ A;  3RU0 A;  3JUI A;  3B7R L;  4ACL A;  2CG3 A;  2C0L A;  2FEZ A;  4GCO A;  3ASG A;  4ANV A;  4DK5 A;  1PAQ A;  2CG2 A;  2RG8 A;  4ILH B;  3D9L A;  3AS8 A;  2E2E A;  4F7A A;  4K0R A;  3CVW A;  2BF0 X;  3LY7 A;  4UI9 C;  4I43 A;  1H0A A;  5BV1 A;  3Q5M A;  1ELW A;  2IF4 A;  3T5V A;  2WMO A;  3RO2 A;  1JPL A;  4DJA A;  1ZBP A;  1OWO A;  2IFU A;  2UWJ G;  1INZ A;  1QNF A;  5AJL A;  4UQX A;  2MHK A;  4CGW A;  1HFA A;  1KT0 A;  4WWP A;  3LCA A;  4GA1 A;  2AWI A;  3LEW A;  4XI0 A;  3U9W A;  4DPR A;  3ZYL A;  4GML A;  4WWN A;  4IUL A;  4KVM A;  5KCM A;  2J08 A;  1PC2 A;  2L6J A;  2OV8 A;  4HOS A;  3FTZ A;  4I9C A;  2RD0 A;  3LPZ A;  4G25 A;  2OVB A;  5JHA A;  4GZ6 A;  3OXF A;  3C98 A;  3CHP A;  5BT1 A;  2WXM A;  4RG9 A;  5BNW A;  4JHR A;  1UJK A;  3CEQ A;  3T8M A;  3FUH A;  2Q7F A;  4HXI A;  5D0Q D;  3GYZ A;  3ZEF A;  1E90 A;  3L22 A;  5FQ8 A;  2HR2 A;  1A17 A;  1HO8 A;  3QAQ A;  4B8C B;  3CR3 A;  3ZW3 A;  5JJ7 A;  4KVO A;  3UPV A;  5FZS A;  2M63 A;  3LVR E;  4JEH A;  2YHC A;  4NAC A;  3EHM A;  4CDM A;  4EZJ A;  3U3W A;  4J0U A;  4APF A;  2WXJ A;  3FEY A;  4BFR A;  1EYH A;  5E75 A;  5LCW C;  5DBK A;  1TJC A;  3RJV A;  3QWW A;  2JLB A;  3S7J A;  2PQR A;  4B0Z A;  2OVF A;  1EF1 C;  4L7T A;  4AXH A;  4BTA A;  2DCP A;  2HYZ A;  1NZN A;  4OYS A;  3BG1 B;  3FTU A;  3FTV A;  4I1O B;  4Y6W A;  4JVS A;  4ME2 A;  2CHX A;  3FUL A;  3IHV A;  4AJW A;  3QAR A;  1JWF A;  3FH7 A;  3U66 A;  1ZU2 A;  4MS6 A;  5J90 A;  3QOU A;  3G2W A;  3FDH A;  4UWK A;  5CHE E;  4GPK A;  4FU3 A;  4U0S A;  3FEX A;  3PE3 A;  1E96 B;  1S0P A;  5AIJ A;  2IQC A;  5JJT A;  1XGW A;  2L0I A;  1E8Y A;  1KLX A;  2CFU A;  4FLB A;  1WY6 A;  1H2T C;  4UWF A;  5C1D A;  2NSZ A;  3ULQ A;  4G2V A;  3B7T A;  5LOZ A;  3VLD A;  4U0Z A;  1OUV A;  4J8D A;  3G2V A;  4JC8 A;  4PUC A;  3B7U X;  1HX8 A;  3MJW A;  3PNT B;  4UI9 J;  4KMO A;  3FTX A;  4G26 A;  3ENE A;  4IN3 B;  3I3N A;  3FHE A;  5FT9 A;  3TG4 A;  2YIN A;  3CHQ A;  3MKQ A;  3CKB A;  3CVN A;  3IEG A;  3ONK A;  4YND A;  4A3T A;  2FUL A;  3G2T A;  4EEC A;  1Y8M A;  3PH0 C;  5G05 C;  5CMW A;  5KJK A;  4NRH B;  3QDN A;  3UX4 A;  4A1G A;  4GB9 A;  4U04 A;  2A5U A;  2ILR A;  2VJ8 A;  2XGO A;  3LJ3 A;  3QWP A;  4RVB A;  4ACK A;  3OAW A;  4NUR A;  4B94 A;  1EPU A;  1GW6 A;  3FU6 A;  4N2S A;  2WM9 A;  1ELK A;  2R5S A;  3SFZ A;  3WXX A;  4MKT A;  2WQH A;  3PEV B;  3FH5 A;  4EBA G;  4AV7 A;  4JXT A;  2J07 A;  4J6I A;  3KS2 A;  2R17 C;  3O48 A;  4I2Z A;  4CDN A;  1HF8 A;  3I4G A;  2PZI A;  4JA7 A;  5ANL A;  2WXF A;  3BEE A;  3D9M A;  4I17 A;  1NA0 A;  4AIF A;  4EBA A;  3GZS A;  1XNF A;  3GZ2 A;  4EPZ A;  2GGF A;  3PRZ A;  4DI4 A;  3Q15 A;  4V3I A;  4APO A;  4F53 A;  2VGX B;  3CHS A;  4WND A;  2I1J A;  2XQ0 A;  3UT8 A;  1H2U A;  2AW6 A;  3FTW A;  3FU3 A;  5D0O D;  3HDX A;  3APD A;  3JQ0 A;  1IQR A;  3CST A;  5FQ7 A;  2VGY A;  3FUE A;  4BSX A;  1E8Z A;  3RRU A;  2V5F A;  4CT0 A;  2XPY A;  3CVV A;  1B89 A;  4JA9 A;  2Y4T A;  3CQC B;  1H2V C;  5FTP A;  4GAA A;  4G24 A;  1QQE A;  3TGO A;  2XGS A;  3I4R B;  4KBQ A;  4GYO A;  4C0M A;  2R59 A;  3JQ1 A;  3Q49 B;  1MHQ A;  4KYO B;  4RG6 A;  4J8E A;  1JWG A;  3LY8 A;  3SI5 A;  2VTB B;  4K03 A;  2FO7 A;  3PZD A;  3KAE A;  4N39 A;  3GZ1 A;  4B89 A;  5E76 A;  3DBS A;  3FWV A;  4JHK A;  1E8W A;  3NF1 A;  4OVV A;  4AM9 A;  5CCM A;  4FAD A;  4HOR A;  4HS2 A;  4L1B A;  3TXM A;  3FU0 A;  4FUL A;  3SHF A;  1HG5 A;  2IU1 A;  3ZHE B;  3K9I A;  3VTY A;  3MX3 A;  4XKC A;  3AS5 A;  5BUZ A;  3S7B A;  4JZY A;  2VTB A;  2PM7 A;  4DI3 A;  1H19 A;  3MA5 A;  5BW8 C;  5A7D B;  3SNX A;  3QKY A;  4AP2 A;  1YA0 A;  2XRY A;  4HVB A;  1Z3X A;  2NC9 A;  5A6C A;  3U64 A;  1UW4 B;  2MOW A;  3L16 A;  3IBE A;  3CHM A;  2OND A;  4XX5 A;  3R7R A;  5KJN A;  2WXQ A;  4DLO A;  3L13 A;  5A23 A;  3L6A A;  1EDU A;  3PS6 A;  4LEU A;  4UI9 K;  3NZU A;  3QJZ A;  2WXR A;  1TEZ A;  3CIA A;  4CT4 A;  4GZC A;  1KT1 A;  4O6F A;  2AVP A;  3LKU A;  3AS4 A;  2KZT B;  3ASH A;  3QC1 A;  4GYW A;  2IOL A;  3D3M A;  4IYP A;  1FVF A;  4PS7 A;  4UWG A;  5FJY A;  4GMJ A;  5G04 J;  3ZVV A;  2XHE A;  3DPD A;  3FY4 A;  1OWP A;  1HZ4 A;  4XKB A;  3OXL A;  2QY7 A;  3D9N A;  4B8A A;  4CGV A;  4YVO A;  3D9O A;  3R7Q A;  3NZS A;  3VTX A;  4UQZ A;  4KT6 B;  3UUX A;  4WNE A;  5C2Y A;  4EQF A;  4MLP A;  4HOQ A;  4KZC A;  2C2L A;  3AU4 A;  4URK A;  3D9J A;  2VSY A;  2AXU A;  4R7L A;  3FP3 A;  3LY9 A;  4W9R A;  4HOT A;  2EQX A;  4WNF A;  2WMN A;  3CVQ A;  5JHB A;  4N3A A;  2L0T B;  3VLF A;  3CK8 A;  3BG0 B;  3EHN A;  3MYV A;  4L2Y A;  2OOE A;  4PS3 A;  4HFG A;  1X5B A;  2A4Z A;  3CSF A;  5AJD A;  3NQP A;  2VYI A;  3T5X A;  4YVQ C;  3ML9 A;  4I6J A;  4CCA A;  2KCL A;  3CVX A;  5AYW D;  2VQ2 A;  5T4Y A;  1E7U A;  3ONL A;  4PS8 A;  5LFA A;  4ATG A;  3CK9 A;  2V4L A;  4UWH A;  3MV2 B;  3CVL A;  1UN9 A;  3SBS A;  3ASF A;  3PDN A;  2X6J A;  3CVP A;  3CVU A;  2PL2 A;  4L2L A;  4J8F A;  4PH4 B;  2IJG X;  5FQ6 A;  2VSN A;  3MGB A;  4JPS A;  4E85 A;  1UN8 A;  3CV0 A;  4I1M A;  3FUN A;  2LAH A;  4H7Y A;  4FP7 A;  4TUU A;  2FF4 A;  4QFV A;  4UQY A;  1ELR A;  4N5C A;  2CHW A;  4XE0 A;  3FUM A;  4WAF A;  2J4B A;  2FI7 A;  2KC7 A;  1HU3 A;  2AXZ A;  2I1K A;  2WXO A;  3ZYK A;  2LO6 A;  2J4D A;  4I1A A;  1IQU A;  4N3C A;  4I6E A;  1L5J A;  2X38 A;  2PM6 A;  3IHY A;  3FUD A;  3G2S A;  1P5Q A;  2XPI A;  3CK7 A;  4BT8 A;  4C0E A;  4CDR A;  4ANW A;  2VSO E;  3HHM A;  4KXK B;  3APF A;  4J8S A;  4XIF A;  3PRE A;  1HS6 A;  3RRM B;  5LX8 A;  4C9B B;  2PQN A;  4ILG A;  3UT7 A;  1U3D A;  4F1S A;  2BTD A;  3CQG B;  3HVE B;  3QK0 A;  4ABN A;  4ILI A;  5T8I A;  3ESL A;  3I5P A;  4MRU A;  3RIB A;  3SF4 A;  4Y6C A;  5LCW J;  3ASD A;  3MV3 B;  4EZL A;  2AXV A;  1U3C A;  1UJJ A;  3Q4A B;  2LSU A;  4U63 A;  4BX8 A;  4F3V A;  2VGX A;  3JCK C;  2WQ6 A;  1MQS A;  2X6K A;  3GW4 A;  4BWR A;  5ARG A;  1TJF A;  5BV0 A;  4FHJ A;  3APC A;  4LER A;  2WQ7 A;  5FQ4 A;  3ML8 A;  2GW1 A;  3G2U A;  3PEU B;  5ANR A;  5KJL A;  4WWO A;  1SZ9 A;  2LSV A;  3MZL B;  2YNQ A;  4FHK A;  1SZA A;  2XCB A;  2DBA A;  4U0U A;  2BUG A;  4A3V A;  2L9B A;  3S7F A;  3ZXS A;  4A55 A;  1IYG A;  2V0P A;  2I9C A;  1N54 A;  3IV0 A;  4BY6 A;  3UQ3 A;  5EDS A;  2Y3A A;  4RSY A;  2WVI A;  3FUJ A;  4LRZ A;  3CKC A;  4UWL A;  3LS8 A;  4AOF A;  2I2O A;  3QNK A;  4NQ0 A;  2WXI A;  1WAO 1;  3QB2 A;  4GA2 A;  2IOS A;  1H6K A;  4N3B A;  2J49 A;  4FJZ A;  3SBT B;  4AY5 A;  3CGH A;  1HH8 A;  1BPO A;  4AEZ C;  3FUI A;  3ZHE A;  1OWL A;  3CHO A;  2DIW A;  4ANU A;  5G05 J;  1E7V A;  2JEK A;  1IHG A;  4GYY A;  2WXN A;  4G11 A;  3MKR A;  3EIJ A;  3ESK A;  3MEK A;  3RK6 A;  2WB2 A;  2WXG A;  4PDX A;  1HXI A;  2HO1 A;  4WNG A;  4GZD A;  3B7S A;  3P1U A;  3RRN B;  3LYA A;  1NA3 A;  4JL0 A;  2XEV A;  4BTB A;  3IKO B;  4FLH A;  2X6F A;  3JYS A;  3VLE A;  2VSX E;  3E4B A;  2XPZ A;  4XI9 A;  2UY1 B;  5EX0 A;  3LVQ E;  1HG2 A;  1DVP A;  5ARF A;  1Z6T A;  5FWQ A;  3FTY A;  5J08 A;  2LAI A;  1SQM A;  4GU5 A;  4GCN A;  4OVU A;  2WXH A;  1JUQ A;  5HQ8 A;  4HLE A;  3LXU X;  2KZT A;  4FC8 A;  2E0I A;  2KCK A;  2GRL A;  3L17 A;  2QFC A;  2CHZ A;  5AEN A;  3UMV A;  1VDY A;  1UG3 A;  3D9I A;  2UY1 A;  2WXP A;  4M3O A;  4DLQ A;  4XZ4 A;  2XCC A;  3EJN A;  3HIZ A;  3R9A B;  2P58 C;  3CLJ A;  3CHR A;  3TAX A;  1PY1 A;  3TG5 A;  5CMY A;  4G1T A;  5M72 A;  3QWV A;  4AY6 A;  2YHE A;  4Q96 A;  3FFL A;  3FH8 A;  4GA0 A;  4GZ3 A;  5DIZ A;  1WM5 A;  3PUJ A;  2HM8 A;  5JJ6 A;  4AVX A;  4KZ0 A;  3TJP A;  3MKQ B;  2J9Q A;  4P29 A;  4I2W A;  2X3M A;  4I6G A;  2FBN A;  3LDZ A;  3PUK A;  4EZK A;  1W3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...