1INZA

Solution structure of the epsin n-terminal homology (enth) domain of human epsin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
GSSRMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords EPS15-INTERACTING PORTEIN(EPSIN)
publication title Solution structure of the epsin N-terminal homology (ENTH) domain of human epsin
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2000-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1inzA00
1EDUA 1JPLA 3G2TA 3CLJA 1SZ9A 3ONKA 1DVPA 3ZYLA 3D9KA 3D9NA 4AVXA 3G2VA 1JUQA 4NACA 2L0IA 2QY7A 4HFGA 4Q96A 3G2WA 3ZYMA 2DIWA 1H0AA 2BF0X 1HG2A 3G2SA 1SZAA 4GZCA 5CMYA 3ZYQA 1HFAA 4Q94A 5CMWA 4FU3A 1INZA 1JWGA 3D9OA 1PY1A 2DCPA 1ELKA 5LP0A 2L0TB 2LO6A 4FLBA 3G2UA 3ONLA 1HF8A 1LF8A 1HX8A 3RRUA 5J08A 2V8SE 1MHQA 1UJKA 1VDYA 4GZDA 1HG5A 3LDZA 1JWFA 3D9LA 2MOWA 3ZYKA 5LOZA 1XGWA 3D9PA 1X5BA 2KM4A 3D9JA 3D9IA 1EYHA 3D9MA 4JXTA 1UJJA
chains in the Genus database with same CATH superfamily
1EDUA 2LSVA 3TWXA 3ASDA 3I4RB 2LXLA 4URKA 4RG6A 3R9AB 2QY7A 4WWOA 3N71A 3EU5A 4XKBA 3DSVA 2FI7A 2Y0BG 1BU9A 3MZLB 2LXMA 4C0MA 4HXIA 2X6FA 1K1BA 3OTNA 3ZYLA 4AVXA 3T8MA 1OWMA 3UKRG 1EPUA 1N94A 3AG3E 5LCWJ 2WMNA 1BD8A 1H0AA 1TNUA 2BF0X 3SQVA 3RKVA 4OVUA 2VSYA 4GTQA 4LG6A 2XZDG 3B7RL 2V8SE 3Q7FA 4RLYA 4YDEA 4J6IA 3CGHA 4FA6A 1IKND 5T4YA 4GZ6A 3Q73A 1FPPA 4FHKA 3HG0D 1OWNA 4GZCA 3HXFA 2FO7A 4I9CA 3CIAA 1IYGA 4WUYA 3RRUA 2IF4A 4U8HA 2Y4UA 4GCOA 5AJLA 2ETAA 5B1BE 2JABA 1N11A 1MZCA 4HQDA 3ZU7B 3CHRA 2QYJA 3V31A 3RSEG 2XCBA 1PY1A 4GYYA 4U95D 3QJZA 3QARA 1QZ2A 1JCQA 3U9WA 1N0RA 4PDXA 4J8DA 3RO2A 3ZHEA 4ILIA 1V54E 4KZ0A 3F6QA 4ILHB 3KSLA 1ZBPA 3CSTA 3EHRA 4MKTA 3GZ1A 4DPRA 3TWVA 1E7UA 5CCMA 1BI8B 3FTXA 4GAAA 3MV2B 4O1PA 2IU1A 4MLPA 5EYPF 3FTVA 3ZYMA 1S0PA 4J0UA 2LSUA 2YHEA 4I1OB 3QWVA 2BTDA 2VSNA 1WY6A 3FUDA 2WXIA 5FT9A 5ENOD 3UM3A 3CVVA 3ML8A 3FWVA 4HS2A 4GTPA 5G04C 5AJDA 4Z68A 4F6RD 2DYSE 4I1MA 3PNLB 4HRMB 2VSOE 3ZVVA 4AY5A 4I2WA 2QFCA 1N4PA 2DBAA 2Y69E 1BI7B 4LNBA 3DBSA 3ABLE 2QC9A 4A1GA 4JEHA 3T8KA 5G2NA 3GYZA 3UT4A 5CRUA 5G55A 2IOLA 4BFRA 5E75A 2C2LA 3HXBA 3LYAA 2J07A 3D9IA 3RK6A 5EKQD 3SY2A 4DX6D 3FDHA 1P5QA 2C0LA 2MRIA 1IQRA 4N5QA 2BUGA 4XZ4A 4TUMA 5DIZA 5J08A 2PQNA 1ELRA 4TXQA 1KLXA 2IOSA 3K9IA 4EQFA 3DSUA 3ASOE 4U8YD 3PH0C 2AWIA 3E33A 4BTAA 2IEJA 1NL4A 2NSZA 3DPYA 2XGMA 4TRQA 3SFZA 1N52A 3D9JA 4JZYA 4QQIA 3AU4A 1UG3A 1NFIE 2ZGDA 4Q96A 3L82A 2PL2A 1OXJA 3X2QE 4UQZA 1AWCB 5FZSA 4E6HA 1EF1C 3B13A 4GB9A 1V55E 2R17C 1OCRE 3QAQA 3RRNB 4V3IA 4WWPA 3L22A 2OOEA 4DRXE 3UQ3A 5FQ4A 4RVBA 4J7WA 3KEZA 1SA4A 1IHBA 2PZIA 4LNUD 2VGXA 2LO6A 5HQ8A 3EHNA 2KXPC 5G04J 4IYPA 4G23A 2PNNA 2Y3AA 5FWQA 1U3DA 3RO3A 1Y6IA 4BEPA 2RD0A 4F1SA 1DC2A 4HVBA 4UQXA 1XGWA 2HE0A 2X3MA 3AU5A 2EQXA 1DVPA 2GW1A 3ISMC 3EU9A 3L16A 1SVXA 2DZNA 1OCZE 4OYSA 4X8QA 2DCPA 3ZPJA 3DPDA 5HRYA 3UT7A 3HRAA 3S7DA 3ONKA 3UI2A 3IKOB 4GTTA 3V79K 1OWOA 3PE3A 4FU3A 4JHRA 3PS6A 3HVEA 2VGXB 2RFAA 2WVIA 5FQ6A 5KWDA 3MKQA 5D0QD 2WXNA 3AG1E 3FUNA 5FZRA 3Q49B 2UWJG 5BV0A 2ZIRA 2H6FA 4KT6B 5ANRA 3OAWA 3O48A 4L2YA 2XHEA 3PE4A 4G8LA 5JJTA 2XEVA 3W9FA 3FH8A 2GRRB 5C2YA 2AVPA 2ZGGA 3BU8A 5BUZA 1E8XA 2WQ7A 3ABKE 2V4LA 4HI9A 5FINA 3ZGQA 4K5CA 4KMOA 3V2OA 4AM9A 3CK7A 1RZ4A 1NP7A 2A5EA 3I4GA 2XEHA 4LUNU 2P9KG 3ZEFA 3D9NA 4KYOB 1TJCA 4Y6WA 4CT0A 3WG7E 3JYSA 4DUIA 5LX8A 5BXUA 4GA1A 3BUAA 3Q4AB 2NC9A 4U04A 2YHCA 1OY3D 4WNDA 2WB2A 3ZKJA 3HVEB 4I1AA 4I9EA 4ATZD 4KBQA 2AXZA 5ENRD 4GMJA 3FUEA 3QK0A 3ZRHA 3TWUA 4LERA 1KT1A 5KJLA 5BW8C 1Y8MA 2P9NG 1HXIA 1OCCE 3PEUB 4YDWA 4M7CA 4UWLA 4CGWA 3CK8A 5KJNA 5FJYA 2WXFA 2J4BA 3PDNA 2IFUA 2L9BA 5AIJA 3PNTB 2R02A 1FVHA 3IXEA 4K0RA 4BY6A 3HXCA 4Y6CA 5FZQA 3GZSA 4EBAA 4I2ZA 4B89A 5BXOA 4A63B 2I9CA 5EN5D 4ANVA 1PAQA 3S2AA 4NQ0A 1NA3A 4ME2A 4N3AA 2ZU6B 3LCAA 3KAEA 2P9PG 3KEAA 3NQPA 2AW6A 1UOHA 3G2SA 4YNDA 4MBGA 4O1OA 2B6CA 1MHQA 1UJKA 3FHEA 1JCSA 3MYVA 3EJNA 3D9PA 3QC1A 1YCSB 2WXGA 2CFZA 4XEIG 2IJGX 4GMLA 3RRMB 3PVLA 4ANUA 2VTBB 3CVXA 2LAIA 2VGYA 1HH8A 1D8EA 3TAXA 3LPZA 1DCEA 4CGVA 2V5QC 3TWRA 5ENTD 5CECB 5FQ8A 4A3TA 4XIFA 3TWQA 3L08A 3LJ3A 2UY1B 3MA5A 3LY8A 2XS1A 3G2VA 3ULQA 4A3VA 1TNYA 2F8XK 2YINA 1N54A 5A23A 1FVFA 1DNPA 1TN6A 3CVNA 4A1SA 2RG8A 2LAHA 5CEAA 3PZ3A 4HNAD 3CSFA 5AQAA 4NRHB 3T9KA 3CK9A 3JCKC 4GYWA 2KBXA 3VTYA 2CG2A 1O1TA 2CFUA 4H7XA 4EBAG 3BG0B 4K03A 3MJWA 4G8KA 3NZSA 1TR4A 2KC7A 2VYIA 3C3OA 3FU5A 2IONA 3CVPA 2OCCE 5AQ7A 4UQYA 5T8IA 2OEVA 1O5MA 3ZNGA 2Y1LE 3AJIA 2AXUA 5AENA 3FUMA 2VGEA 4Q94A 3UM0A 2OV8A 5FIOA 3I3NA 2DZOA 4GA0A 4IRUA 4I6EA 4YDOA 4ANWA 3SZ7A 1L5JA 1WM5A 2CHXA 3T5VA 5KNHD 3QB2A 4J8EA 1JWFA 4YVOA 5LOZA 3CKCA 2L6BA 4TUUA 2I1JA 5KJMA 2X6KA 5E76A 1TN7A 3EUVA 5HI7A 4CDNA 4ANXA 1S70B 4KVMA 4GYOA 3RJVA 4BT9A 3FUFA 2ETBA 2XZTG 4N39A 1LTXA 4J8YA 4P29A 3SBSA 3P1UA 2LNIA 3Q15A 3Q47B 3DSXA 4C0EA 2XENA 4F3VA 4K5BA 1O1RA 2HYZA 4JEUA 3Q9UC 2PQRA 1YYHA 3U64A 2Y4TA 4GZDA 4GTSA 4TXPA 4WNGA 1MYOA 1WDYA 2A5UA 5AYWD 3CVUA 4U7EB 5JA4D 1MX2A 4U96D 2HM8A 1TJFA 2WQHA 2EIJE 2VJ8A 3UMVA 3TXMA 1MJ0A 3R9MA 3AS5A 3E30A 5IY5E 2V5FA 2XCCA 2P2CP 4U63A 3WXXA 3JUEA 5B3SE 3PUJA 1VDYA 2OEWA 4BT8A 5JHAA 3CHMA 3ZIMA 3ZUVB 3CHOA 5B1AE 3ABME 3VLEA 1TN8A 3S7JA 3OXFA 3HDXA 4ABNA 4AIFA 4JHJA 4DX2A 4UWKA 1TNOA 4M3OA 3O4ZA 4GMRA 2IY0C 5EIBE 3D9KA 3ESLA 1QYMA 5FQ7A 4KXKB 1OWLA 4H7YA 2J49A 3QWWA 3FTSA 3MKRA 4MRUA 4EZLA 5D2MC 3ASGA 1SA5A 2ZXWE 3EHQA 1BLXB 3PZ4A 1Z6TA 4GU5A 1NZNA 4JD2G 4HOQA 3QWPA 3MCXA 5ENSD 2H6GA 4GPKA 4FJYA 4G24A 3JQ1A 3PEVB 3DSTA 1H19A 3DSWA 3FUIA 1TEZA 3DEOA 3LVQE 4NURA 1IHGA 3EIQC 2XPIA 4BSXA 1ELWA 3AG2E 3IEGA 3SO8A 4DLQA 5CEDB 5D66A 5CRVA 2GROB 2L0TB 4BERA 3Q9NC 3HYMB 5AQBA 1HG5A 3TJPA 1MX4A 3NAWA 4UWFA 5ANLA 4KVOA 4WWNA 3ULYA 4PS3A 5FTPA 3NBNB 3FTWA 4HFGA 3ZYQA 1H6PA 4CDMA 1N95A 4FADA 2PM7A 1MX6A 4G25A 2WXKA 2R05A 3LVRE 1N9AA 2GGFA 1E96B 4EHMA 4JXTA 4JA7A 2E0IA 2BKKB 3KS2A 1RW2A 3AG4E 4AV7A 3L17A 4B93B 3PRZA 2IQCA 4DX1A 5HS0A 3CVYA 3V2XA 4HRLA 1D8DA 4BX9A 3CKBA 4JVSA 5T3RA 3CVWA 3UTMA 3Q78A 4TXRA 4G11A 4E85A 3DSSA 3G2WA 3B95A 1OT8A 3R7RA 3FU6A 4PUCA 5BV1A 3EDTB 4GTVA 1E8YA 2XEEA 4FLBA 1UN8A 5KNGA 5J90A 4APOA 2GRMA 3QDNA 3AS4A 3APFA 3UIOC 4JW1A 3C98A 3IBEA 3CLJA 4O60A 4XI9A 3DEPA 2I6HA 1QQEA 2J4DA 2GRLA 5H7PA 3CHPA 4AP2A 4OAUC 5EYLA 4EPZA 2MHKA 3UPVA 5CCLA 3V30A 1AP7A 4B94A 4F7AA 1E8WA 5A6CA 3LXUX 1HS6A 3ZW3A 4NIKA 4B0ZA 4DI4A 4CZ2D 3SF4A 1SQMA 4UWGA 2KCVA 3OXGA 5EIDA 5G05C 3SD5A 3CR3A 4BX8A 3NZUA 1N0QA 3T5XA 2ETCA 4HLEA 2DVWA 2F37A 2GRNB 3CEQA 4A55A 3TG5A 2NYJA 1OUVA 2FEZA 4U0ZA 4U07A 2ONDA 4F1PA 1X81A 2VTBA 3QKYA 4JPSA 3FUJA 5D0OD 3Q5MA 4N5CA 1WG0A 4K5AB 2UY1A 1B89A 2RFMA 2L6JA 3CHSA 2F0YA 3ZN3A 4I43A 1JPLA 4N3CA 4JL0A 1Q2ZA 2EIKE 4KZCA 1K8KG 4LEUA 3ASFA 3CVLA 3AS8A 4DX7D 3LDZA 3FH5A 3FTYA 4FULA 3E4BA 1KZPA 1UN9A 3EHMA 3P2BA 3SHFA 2I1KA 5DBKA 1LD8A 3C3QA 1HG2A 1SZAA 2J9QA 3ML9A 1WAO1 4HORA 2PM6A 2P9SG 3C3RA 4I6JA 1K1AA 2HR2A 2KM4A 2X6IA 3TWTA 3Q75A 4B8CB 4CDRA 3C72A 3LEWA 1N4SA 4RG9A 4JHKA 2OVBA 2XRZA 3MEKA 5ENNA 2KCKA 3FEXA 4XX5A 1NI1A 3UT8A 3B7BA 2LUHA 4OAVB 3L54A 2X38A 1JUQA 3DRAA 4G2VA 2YNQA 1G3NB 3VLFA 3TL5A 2BEDA 5BNWA 1D9SA 1LD7A 4O6FA 1HE8A 2QYUA 3UM1A 1K3ZD 3JXJA 5G05J 1N4RA 2I2OA 3PREA 3KSQA 1H6OA 2X6JA 3HXEA 3SFYA 3TWSA 4C9BB 1A17A 2P58C 4DK5A 1JWGA 3B7TA 3J5QB 4JC8A 5ARGA 4CT4A 3U3WA 2H6IA 3ONLA 4WNFA 2XRYA 4DI3A 5JJ6A 1BPOA 1X5BA 1UJJA 4HBDA 2J09A 3APCA 1TNZA 4CEMA 2WPVA 4DJAA 3SI5A 2WXRA 3QOUA 4DX5D 1IQUA 3LS8A 1KPSB 4FJZA 4GZ3A 3PZ2A 4GZ5A 1EYHA 5EX3A 2DYRE 3FH7A 4HOTA 3TWWA 1HFAA 2V0PA 4L9PA 2WM9A 3QNKA 4LCTA 3NOGD 3SGHA 2Q7FA 3FY4A 1HX8A 4ATGA 2MYOA 4XE0A 1GW6A 1ZU2A 3ASNE 2VSXE 3URZA 4UUCA 3IV0A 1XNFA 3I5PA 4ACLA 1YMPA 3ZXSA 4J8FA 5JJ7A 4FP7A 2OVFA 4G26A 1O1SA 4APFA 3B7SA 3UUXA 1ELKA 3UINC 1S64A 1IXVA 4BSZB 4CYMD 5CBNA 1HU3A 1NA0A 2QZAA 1FCHA 5BT1A 1TNBA 2XGSA 3S7FA 3BQOA 5CERB 2JEKA 2DWZA 4ZFHA 5ARFA 3D9OA 2X6HA 1FT2A 4AJWA 1H2TC 2GRPB 2WXJA 1ZB1A 5CHEE 4JB8P 4BETA 4YVQC 4GA2A 4B8AA 2C0MA 3PUKA 3D3MA 3IHYA 3NF1A 4GPMA 2NXPA 3ZHEB 2CG3A 3KD7A 4YDYA 4I6GA 3D9LA 4AY6A 2EIME 3DWLG 4F53A 1E8ZA 4HOSA 1SZ9A 3U66A 2WXMA 4WAFA 2AJAA 3L9TA 3MGBA 4XKCA 4I17A 3CV0A 3NOCD 2J8SD 4PS8A 2WXLA 3L13A 5LP0A 5CBOA 3JUIA 2KCLA 2J08A 2H6HA 4UI9C 5ENQD 3TGOA 3HIZA 5HKPA 3U4TA 3GW4A 3MV3B 3FU0A 4N2QA 2L0IA 2VQ2A 1MQSA 3HHMA 3VLDA 1OWPA 4AEZC 5ENPD 3RAUA 1E90A 3B7UX 3DXMG 4JA9A 3UKUG 4PH4B 3D9HA 3G2TA 3MX3A 4HB5A 2P9LG 2XS8A 4HI8A 2WQ6A 2F8YA 2WMOA 4BTBA 4HLLA 2ILRA 3IHVA 5AARA 2R5SA 3SFXA 3ZYKA 2CHZA 3LKUA 3TXNA 3ULEG 1KT0A 4GTOA 4XI0A 2M63A 4TV3A 5CMWA 1A5EA 4N2SA 2IO2C 1HF8A 3UXGA 3R7QA 3ZXPA 2CHWA 2WXOA 3D9MA 1INZA 4IN3B 3FFLA 5JHBA 3FU3A 4MS6A 1HZ4A 1JCRA 5AN8A 1SW6A 4UWHA 5M72A 4EECA 3CHQA 4W9RA 3FULA 2IO3C 2FO1E 3E34A 1LF8A 3UX4A 2GRQB 5JMND 1S63A 3CQCB 2FF4A 4LRZA 4CRWA 4DLOA 5ITZF 1OCOE 3LY7A 1YA0A 2DIWA 4GTMA 1U3CA 4D10C 4RQIA 3AAAC 2E2EA 1TYQG 4U8VD 4IULA 3CQGB 3UIPC 1Z3YA 4ZHBA 4U0SA 3PZDA 3E32A 2XQ0A 4WNEA 3BG1B 5A7DB 4FLHA 2A4ZA 2P9IG 4UI9J 3ESKA 3C5RA 2WXHA 2FULA 4L7TA 5LFAA 1H2VC 3GZ2A 4CCAA 3SNXA 4EZKA 3FUHA 3VTXA 2KZTA 3CVQA 1DCQA 1HO8A 3SBTB 4ILGA 3FUKA 3E37A 1KZOA 2V4HC 4PS7A 5EX0A 2XPZA 4AOFA 5KCMA 3ZFWA 4FC8A 4L1BA 4L23A 2BKGA 1PC2A 4ACKA 2AXVA 4G1TA 1QBQA 1FT1A 2KATA 4NACA 4RSYA 3EIJA 3FEYA 3FTUA 1U2VG 5AAOA 4J8SA 3PZ1A 2R59A 5BPPA 5LCWC 1H6KA 4EZJA 5KJKA 3ENEA 4LSZE 3RIBA 4GCNA 4C48B 5C1DA 3RU0A 3FP3A 4UI9K 2ZISA 4HOUA 2YQ8A 3BEEA 3Q7AA 2EINE 4GTRA 1H2UA 2FBNA 3W9GA 2P9UG 5AQ9A 4U0UA 4Q69A 3NB2A 2WXQA 2HO1A 3FTZA 1Z5SC 2KZTB 4QFVA 1N4QA 2R03A 2EILE 1W3BA 3UM2A 4BWRA 3L6AA 1E7VA 3MKQB 3J5PA 3ASHA 3JXIA 5EDSA 4FHJA 3LY9A 4HRNA 4AXHA 4N3BA 4L2LA 3LJNA 2R2LA 3HXDA 2JLBA 1Z3XA 3OXLA 3TG4A 4OVVA 4R7LA 3S7BA 3DXKG 3JQ0A 5EILA 2WXPA 2XPYA 1UW4B 1QNFA 3Q79A 5CMYA 2XGOA 4LNGA 5KBAA 2B0OE 4BESA 3G2UA 3APDA 2MOWA 2RKKA
chains in the Genus database with same CATH topology
1EDUA 3OAWA 5ANRA 2VSXE 3URZA 3O48A 4L2YA 2XHEA 3IV0A 1XNFA 2LSVA 3D9KA 3ESLA 3I5PA 4ACLA 3PE4A 3ASDA 3ZXSA 3I4RB 4J8FA 4URKA 4RG6A 5JJ7A 4FP7A 3R9AB 5JJTA 2QY7A 2XEVA 4WWOA 2OVFA 4G26A 3N71A 3FH8A 5C2YA 4APFA 2AVPA 3B7SA 5FQ7A 4KXKB 1OWLA 3UUXA 4H7YA 2J49A 3QWWA 4XKBA 1ELKA 1E8XA 5BUZA 2WQ7A 3FTSA 3MKRA 4MRUA 4EZLA 2V4LA 2FI7A 3ZGQA 4KMOA 3ASGA 3MZLB 4AM9A 3CK7A 1HU3A 4C0MA 1Z6TA 4HXIA 1NP7A 1NA0A 1NZNA 4GU5A 1FCHA 3I4GA 4HOQA 3QWPA 2X6FA 4LUNU 3OTNA 3ZEFA 3ZYLA 5BT1A 4AVXA 3D9NA 2XGSA 3T8MA 3MCXA 1OWMA 3S7FA 1EPUA 5LCWJ 4KYOB 2WMNA 1TJCA 4Y6WA 4CT0A 2JEKA 1H0AA 2BF0X 4GPKA 3JYSA 4FJYA 5ARFA 3RKVA 4G24A 4OVUA 2VSYA 5LX8A 3D9OA 3JQ1A 4GA1A 3Q4AB 3PEVB 1H19A 2X6HA 4AJWA 2NC9A 3B7RL 4U04A 2V8SE 1H2TC 2YHCA 2WXJA 3FUIA 4J6IA 4WNDA 1TEZA 2WB2A 3LVQE 5CHEE 3CGHA 4NURA 4FA6A 1IHGA 3EIQC 5T4YA 4YVQC 4GZ6A 2XPIA 4GA2A 4B8AA 3HVEB 4I1AA 2C0MA 4FHKA 4I9EA 4BSXA 4KBQA 2AXZA 1ELWA 3PUKA 3D3MA 3IHYA 3NF1A 4GMJA 3IEGA 2NXPA 3FUEA 1OWNA 3QK0A 3ZRHA 4DLQA 4GZCA 3ZHEB 2FO7A 4I9CA 3CIAA 4LERA 2CG3A 2L0TB 1IYGA 4WUYA 3RRUA 1KT1A 3KD7A 3HYMB 2IF4A 1HG5A 2Y4UA 4I6GA 4U8HA 4GCOA 3D9LA 5KJLA 5BW8C 1Y8MA 5AJLA 3TJPA 1HXIA 4AY6A 3QWVA 4UWFA 5ANLA 3PEUB 4KVOA 4F53A 1E8ZA 4WWNA 4HOSA 1SZ9A 4UWLA 3U66A 4CGWA 4PS3A 5FTPA 3CK8A 2WXMA 4WAFA 5KJNA 5FJYA 2WXFA 2J4BA 3FTWA 3PDNA 3CHRA 4HFGA 3MGBA 4XKCA 4I17A 3CV0A 3ZYQA 4CDMA 2IFUA 2L9BA 4PS8A 4FADA 2WXLA 5AIJA 2XCBA 2PM7A 1PY1A 4GYYA 3L13A 3PNTB 5LP0A 3JUIA 4G25A 2KCLA 3QJZA 3QARA 1FVHA 2WXKA 4K0RA 2J08A 3LVRE 1QZ2A 4UI9C 4BY6A 2GGFA 3U9WA 5FZQA 1E96B 4Y6CA 3TGOA 4PDXA 4JXTA 3HIZA 4J8DA 3RO2A 3U4TA 4JA7A 3GW4A 3GZSA 3ZHEA 4ILIA 3MV3B 3FU0A 4KZ0A 2E0IA 4N2QA 4ILHB 1ZBPA 2L0IA 2VQ2A 4EBAA 3KS2A 1MQSA 4I2ZA 4B89A 2I9CA 3HHMA 1INZA 3VLDA 4AV7A 4ANVA 1PAQA 3CSTA 1OWPA 3S2AA 4MKTA 4AEZC 1E90A 3L17A 4NQ0A 1NA3A 3GZ1A 3B7UX 3PRZA 2IQCA 4JA9A 4ME2A 4N3AA 3CVYA 4DPRA 2ZU6B 1E7UA 3LCAA 4BX9A 5CCMA 3KAEA 3FTXA 4GAAA 3CKBA 4PH4B 3G2TA 3MX3A 4JVSA 5T3RA 3MV2B 3CVWA 4G11A 3NQPA 2IU1A 4E85A 4MLPA 2AW6A 3FTVA 3G2WA 3ZYMA 3R7RA 3G2SA 3FU6A 4PUCA 4YNDA 5BV1A 1S0PA 3EDTB 1E8YA 2WQ6A 2WMOA 4J0UA 2LSUA 2YHEA 2ILRA 1UN8A 4FLBA 4BTBA 4I1OB 5J90A 3IHVA 4APOA 2GRMA 3QDNA 1MHQA 2BTDA 1UJKA 2VSNA 3FHEA 1WY6A 2R5SA 3AS4A 3APFA 3FUDA 2WXIA 3MYVA 5FT9A 3EJNA 3ZYKA 2CHZA 3D9PA 3LKUA 4JW1A 3QC1A 3C98A 3CVVA 3TXNA 3IBEA 3ML8A 3FWVA 2WXGA 3CLJA 2CFZA 1KT0A 2IJGX 4HS2A 4XI9A 4GMLA 4XI0A 2I6HA 3PVLA 5G04C 3RRMB 5AJDA 1QQEA 2M63A 2J4DA 2GRLA 4TV3A 5CMWA 3CHPA 4ANUA 4AP2A 4N2SA 2VTBB 4I1MA 3PNLB 3CVXA 1HF8A 2LAIA 4EPZA 2VSOE 2VGYA 1HH8A 3TAXA 2MHKA 3ZVVA 4AY5A 3UPVA 3LPZA 5CCLA 3R7QA 4CGVA 4B94A 5FQ8A 4A3TA 4XIFA 2CHWA 2WXOA 3D9MA 4F7AA 3L08A 3LJ3A 1E8WA 4IN3B 3FFLA 1HS6A 3LXUX 4I2WA 3ZW3A 5A6CA 5JHBA 2UY1B 2QFCA 3FU3A 3MA5A 2DBAA 4MS6A 1HZ4A 3LY8A 4B0ZA 3G2VA 3ULQA 4DI4A 4A3VA 3SF4A 3DBSA 1SQMA 4UWHA 4UWGA 5M72A 2YINA 1N54A 2KCVA 4EECA 5A23A 1FVFA 3OXGA 3CHQA 4W9RA 5G05C 3SD5A 1DNPA 3CR3A 4A1GA 4BX8A 4JEHA 3FULA 3CVNA 5G2NA 3NZUA 3GYZA 4HLEA 3T5XA 4A1SA 3UT4A 1LF8A 5G55A 2IOLA 4BFRA 5E75A 3UX4A 3CEQA 2C2LA 2RG8A 2LAHA 3CQCB 2FF4A 4A55A 3CSFA 3LYAA 3TG5A 2J07A 1OUVA 3D9IA 4LRZA 4NRHB 3RK6A 2FEZA 4U0ZA 5EKQD 4CRWA 4DLOA 3FDHA 3CK9A 4U07A 1P5QA 3LY7A 2C0LA 2ONDA 3JCKC 4GYWA 1YA0A 2VTBA 2MRIA 2DIWA 1IQRA 3QKYA 3VTYA 2CG2A 2BUGA 1U3CA 2CFUA 4XZ4A 4JPSA 4D10C 3FUJA 5D0OD 4H7XA 4EBAG 3BG0B 5DIZA 5J08A 3Q5MA 4K03A 3MJWA 4N5CA 2PQNA 1ELRA 2UY1A 2E2EA 1B89A 3NZSA 2L6JA 1KLXA 2KC7A 3CHSA 2IOSA 2VYIA 4IULA 3ZN3A 3K9IA 4I43A 3CQGB 1Z3YA 4EQFA 1JPLA 4U0SA 3PZDA 2XQ0A 3FU5A 4WNEA 3BG1B 4N3CA 5A7DB 4JL0A 3PH0C 4FLHA 2A4ZA 2IONA 3CVPA 2AWIA 4KZCA 4UI9J 3ESKA 4LEUA 3ASFA 4BTAA 2WXHA 2FULA 3CVLA 4L7TA 2NSZA 2XGMA 4UQYA 5T8IA 4TRQA 5LFAA 3SFZA 1H2VC 3GZ2A 3AS8A 4CCAA 3SNXA 3LDZA 4EZKA 3FH5A 3FUHA 3VTXA 1N52A 2KZTA 3FTYA 3CVQA 3D9JA 1HO8A 4JZYA 3SBTB 4ILGA 3FUKA 3E4BA 4FULA 2AXUA 3AU4A 1UG3A 1UN9A 3EHMA 5AENA 3P2BA 3SHFA 2I1KA 5DBKA 4PS7A 4Q96A 3FUMA 2PL2A 1HG2A 1SZAA 4Q94A 2J9QA 4UQZA 3ML9A 5FZSA 1WAO1 5EX0A 4HORA 2XPZA 4E6HA 4AOFA 2PM6A 1EF1C 5KCMA 3ZFWA 4I6JA 3B13A 2OV8A 4GB9A 4FC8A 4L1BA 4L23A 2HR2A 2R17C 3QAQA 1PC2A 3RRNB 2KM4A 2X6IA 4ACKA 3I3NA 4V3IA 4WWPA 4B8CB 3L22A 2AXVA 2OOEA 4G1TA 3UQ3A 4CDRA 3LEWA 5FQ4A 2KATA 4NACA 4RSYA 3EIJA 3FEYA 3FTUA 4RVBA 4RG9A 4GA0A 4JHKA 4J8SA 2OVBA 2XRZA 3KEZA 4IRUA 4I6EA 3MEKA 5ENNA 2R59A 4ANWA 2KCKA 3FEXA 5BPPA 2PZIA 3SZ7A 4XX5A 2VGXA 5LCWC 1L5JA 3UT8A 1WM5A 2CHXA 2LO6A 3T5VA 5HQ8A 1H6KA 4EZJA 5KJKA 3QB2A 3ENEA 4J8EA 3RIBA 1JWFA 4YVOA 5LOZA 3CKCA 4GCNA 4TUUA 5C1DA 2I1JA 3EHNA 2X6KA 5G04J 5KJMA 4IYPA 3RU0A 3L54A 3FP3A 5E76A 4UI9K 4HOUA 2X38A 4G23A 1JUQA 2YQ8A 2Y3AA 4G2VA 5HI7A 4CDNA 4ANXA 2YNQA 5FWQA 3VLFA 4KVMA 3BEEA 3TL5A 1H2UA 1U3DA 3RO3A 1Y6IA 4GYOA 2FBNA 5BNWA 2RD0A 3RJVA 4F1SA 4BT9A 3FUFA 4U0UA 4O6FA 4N39A 4Q69A 4HVBA 4P29A 4UQXA 1HE8A 2WXQA 1XGWA 3P1UA 3SBSA 2HO1A 2LNIA 3FTZA 3Q15A 3Q47B 2X3MA 3AU5A 5G05J 4C0EA 2EQXA 1DVPA 2GW1A 2I2OA 3PREA 2KZTB 4QFVA 4F3VA 2HYZA 3L16A 1W3BA 2X6JA 4C9BB 4JEUA 1A17A 2P58C 4DK5A 1JWGA 4BWRA 2PQRA 3L6AA 3B7TA 1E7VA 4OYSA 4JC8A 2DCPA 5ARGA 3DPDA 3ZPJA 4CT4A 3MKQB 3U3WA 3ASHA 3ONLA 4WNFA 3U64A 2XRYA 2Y4TA 4GZDA 3UT7A 4WNGA 4DI3A 5JJ6A 5EDSA 1BPOA 1X5BA 3S7DA 4FHJA 3ONKA 3LY9A 1UJJA 2A5UA 2J09A 3IKOB 5AYWD 3APCA 3CVUA 4CEMA 4AXHA 4N3BA 2HM8A 1TJFA 4L2LA 2WQHA 2WPVA 2VJ8A 4DJAA 1OWOA 3PE3A 3SI5A 3UMVA 3TXMA 2WXRA 3AS5A 3QOUA 4FU3A 4JHRA 2JLBA 1Z3XA 1IQUA 3LS8A 2V5FA 2XCCA 3PS6A 3OXLA 4U63A 3WXXA 3PUJA 1VDYA 3HVEA 4BT8A 4FJZA 4GZ3A 4GZ5A 2VGXB 3TG4A 4OVVA 1EYHA 2WVIA 5JHAA 3CHMA 4R7LA 3S7BA 3ZIMA 3JQ0A 3CHOA 2WXPA 5EX3A 5FQ6A 2XPYA 3VLEA 3FH7A 1UW4B 4HOTA 1QNFA 3MKQA 5CMYA 5D0QD 2XGOA 1HFAA 2V0PA 2WXNA 3FUNA 3S7JA 3OXFA 2WM9A 3HDXA 3QNKA 5FZRA 4LCTA 3Q49B 4ABNA 2UWJG 5BV0A 3G2UA 3SGHA 2Q7FA 3FY4A 1HX8A 4ATGA 4AIFA 4JHJA 3APDA 4XE0A 4UWKA 2MOWA 4M3OA 3O4ZA 1GW6A 1ZU2A 4KT6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDU A;  1JPL A;  3G2T A;  3CLJ A;  1SZ9 A;  3ONK A;  1DVP A;  3ZYL A;  3D9K A;  3D9N A;  4AVX A;  3G2V A;  1JUQ A;  4NAC A;  2L0I A;  2QY7 A;  4HFG A;  4Q96 A;  3G2W A;  3ZYM A;  2DIW A;  1H0A A;  2BF0 X;  1HG2 A;  3G2S A;  1SZA A;  4GZC A;  5CMY A;  3ZYQ A;  1HFA A;  4Q94 A;  5CMW A;  4FU3 A;  1INZ A;  1JWG A;  3D9O A;  1PY1 A;  2DCP A;  1ELK A;  5LP0 A;  2L0T B;  2LO6 A;  4FLB A;  3G2U A;  3ONL A;  1HF8 A;  1LF8 A;  1HX8 A;  3RRU A;  5J08 A;  2V8S E;  1MHQ A;  1UJK A;  1VDY A;  4GZD A;  1HG5 A;  3LDZ A;  1JWF A;  3D9L A;  2MOW A;  3ZYK A;  5LOZ A;  1XGW A;  3D9P A;  1X5B A;  2KM4 A;  3D9J A;  3D9I A;  1EYH A;  3D9M A;  4JXT A;  1UJJ A; 
#chains in the Genus database with same CATH topology
 1EDU A;  2LSV A;  3TWX A;  3ASD A;  3I4R B;  2LXL A;  4URK A;  4RG6 A;  3R9A B;  2QY7 A;  4WWO A;  3N71 A;  3EU5 A;  4XKB A;  3DSV A;  2FI7 A;  2Y0B G;  1BU9 A;  3MZL B;  2LXM A;  4C0M A;  4HXI A;  2X6F A;  1K1B A;  3OTN A;  3ZYL A;  4AVX A;  3T8M A;  1OWM A;  3UKR G;  1EPU A;  1N94 A;  3AG3 E;  5LCW J;  2WMN A;  1BD8 A;  1H0A A;  1TNU A;  2BF0 X;  3SQV A;  3RKV A;  4OVU A;  2VSY A;  4GTQ A;  4LG6 A;  2XZD G;  3B7R L;  2V8S E;  3Q7F A;  4RLY A;  4YDE A;  4J6I A;  3CGH A;  4FA6 A;  1IKN D;  5T4Y A;  4GZ6 A;  3Q73 A;  1FPP A;  4FHK A;  3HG0 D;  1OWN A;  4GZC A;  3HXF A;  2FO7 A;  4I9C A;  3CIA A;  1IYG A;  4WUY A;  3RRU A;  2IF4 A;  4U8H A;  2Y4U A;  4GCO A;  5AJL A;  2ETA A;  5B1B E;  2JAB A;  1N11 A;  1MZC A;  4HQD A;  3ZU7 B;  3CHR A;  2QYJ A;  3V31 A;  3RSE G;  2XCB A;  1PY1 A;  4GYY A;  4U95 D;  3QJZ A;  3QAR A;  1QZ2 A;  1JCQ A;  3U9W A;  1N0R A;  4PDX A;  4J8D A;  3RO2 A;  3ZHE A;  4ILI A;  1V54 E;  4KZ0 A;  3F6Q A;  4ILH B;  3KSL A;  1ZBP A;  3CST A;  3EHR A;  4MKT A;  3GZ1 A;  4DPR A;  3TWV A;  1E7U A;  5CCM A;  1BI8 B;  3FTX A;  4GAA A;  3MV2 B;  4O1P A;  2IU1 A;  4MLP A;  5EYP F;  3FTV A;  3ZYM A;  1S0P A;  4J0U A;  2LSU A;  2YHE A;  4I1O B;  3QWV A;  2BTD A;  2VSN A;  1WY6 A;  3FUD A;  2WXI A;  5FT9 A;  5ENO D;  3UM3 A;  3CVV A;  3ML8 A;  3FWV A;  4HS2 A;  4GTP A;  5G04 C;  5AJD A;  4Z68 A;  4F6R D;  2DYS E;  4I1M A;  3PNL B;  4HRM B;  2VSO E;  3ZVV A;  4AY5 A;  4I2W A;  2QFC A;  1N4P A;  2DBA A;  2Y69 E;  1BI7 B;  4LNB A;  3DBS A;  3ABL E;  2QC9 A;  4A1G A;  4JEH A;  3T8K A;  5G2N A;  3GYZ A;  3UT4 A;  5CRU A;  5G55 A;  2IOL A;  4BFR A;  5E75 A;  2C2L A;  3HXB A;  3LYA A;  2J07 A;  3D9I A;  3RK6 A;  5EKQ D;  3SY2 A;  4DX6 D;  3FDH A;  1P5Q A;  2C0L A;  2MRI A;  1IQR A;  4N5Q A;  2BUG A;  4XZ4 A;  4TUM A;  5DIZ A;  5J08 A;  2PQN A;  1ELR A;  4TXQ A;  1KLX A;  2IOS A;  3K9I A;  4EQF A;  3DSU A;  3ASO E;  4U8Y D;  3PH0 C;  2AWI A;  3E33 A;  4BTA A;  2IEJ A;  1NL4 A;  2NSZ A;  3DPY A;  2XGM A;  4TRQ A;  3SFZ A;  1N52 A;  3D9J A;  4JZY A;  4QQI A;  3AU4 A;  1UG3 A;  1NFI E;  2ZGD A;  4Q96 A;  3L82 A;  2PL2 A;  1OXJ A;  3X2Q E;  4UQZ A;  1AWC B;  5FZS A;  4E6H A;  1EF1 C;  3B13 A;  4GB9 A;  1V55 E;  2R17 C;  1OCR E;  3QAQ A;  3RRN B;  4V3I A;  4WWP A;  3L22 A;  2OOE A;  4DRX E;  3UQ3 A;  5FQ4 A;  4RVB A;  4J7W A;  3KEZ A;  1SA4 A;  1IHB A;  2PZI A;  4LNU D;  2VGX A;  2LO6 A;  5HQ8 A;  3EHN A;  2KXP C;  5G04 J;  4IYP A;  4G23 A;  2PNN A;  2Y3A A;  5FWQ A;  1U3D A;  3RO3 A;  1Y6I A;  4BEP A;  2RD0 A;  4F1S A;  1DC2 A;  4HVB A;  4UQX A;  1XGW A;  2HE0 A;  2X3M A;  3AU5 A;  2EQX A;  1DVP A;  2GW1 A;  3ISM C;  3EU9 A;  3L16 A;  1SVX A;  2DZN A;  1OCZ E;  4OYS A;  4X8Q A;  2DCP A;  3ZPJ A;  3DPD A;  5HRY A;  3UT7 A;  3HRA A;  3S7D A;  3ONK A;  3UI2 A;  3IKO B;  4GTT A;  3V79 K;  1OWO A;  3PE3 A;  4FU3 A;  4JHR A;  3PS6 A;  3HVE A;  2VGX B;  2RFA A;  2WVI A;  5FQ6 A;  5KWD A;  3MKQ A;  5D0Q D;  2WXN A;  3AG1 E;  3FUN A;  5FZR A;  3Q49 B;  2UWJ G;  5BV0 A;  2ZIR A;  2H6F A;  4KT6 B;  5ANR A;  3OAW A;  3O48 A;  4L2Y A;  2XHE A;  3PE4 A;  4G8L A;  5JJT A;  2XEV A;  3W9F A;  3FH8 A;  2GRR B;  5C2Y A;  2AVP A;  2ZGG A;  3BU8 A;  5BUZ A;  1E8X A;  2WQ7 A;  3ABK E;  2V4L A;  4HI9 A;  5FIN A;  3ZGQ A;  4K5C A;  4KMO A;  3V2O A;  4AM9 A;  3CK7 A;  1RZ4 A;  1NP7 A;  2A5E A;  3I4G A;  2XEH A;  4LUN U;  2P9K G;  3ZEF A;  3D9N A;  4KYO B;  1TJC A;  4Y6W A;  4CT0 A;  3WG7 E;  3JYS A;  4DUI A;  5LX8 A;  5BXU A;  4GA1 A;  3BUA A;  3Q4A B;  2NC9 A;  4U04 A;  2YHC A;  1OY3 D;  4WND A;  2WB2 A;  3ZKJ A;  3HVE B;  4I1A A;  4I9E A;  4ATZ D;  4KBQ A;  2AXZ A;  5ENR D;  4GMJ A;  3FUE A;  3QK0 A;  3ZRH A;  3TWU A;  4LER A;  1KT1 A;  5KJL A;  5BW8 C;  1Y8M A;  2P9N G;  1HXI A;  1OCC E;  3PEU B;  4YDW A;  4M7C A;  4UWL A;  4CGW A;  3CK8 A;  5KJN A;  5FJY A;  2WXF A;  2J4B A;  3PDN A;  2IFU A;  2L9B A;  5AIJ A;  3PNT B;  2R02 A;  1FVH A;  3IXE A;  4K0R A;  4BY6 A;  3HXC A;  4Y6C A;  5FZQ A;  3GZS A;  4EBA A;  4I2Z A;  4B89 A;  5BXO A;  4A63 B;  2I9C A;  5EN5 D;  4ANV A;  1PAQ A;  3S2A A;  4NQ0 A;  1NA3 A;  4ME2 A;  4N3A A;  2ZU6 B;  3LCA A;  3KAE A;  2P9P G;  3KEA A;  3NQP A;  2AW6 A;  1UOH A;  3G2S A;  4YND A;  4MBG A;  4O1O A;  2B6C A;  1MHQ A;  1UJK A;  3FHE A;  1JCS A;  3MYV A;  3EJN A;  3D9P A;  3QC1 A;  1YCS B;  2WXG A;  2CFZ A;  4XEI G;  2IJG X;  4GML A;  3RRM B;  3PVL A;  4ANU A;  2VTB B;  3CVX A;  2LAI A;  2VGY A;  1HH8 A;  1D8E A;  3TAX A;  3LPZ A;  1DCE A;  4CGV A;  2V5Q C;  3TWR A;  5ENT D;  5CEC B;  5FQ8 A;  4A3T A;  4XIF A;  3TWQ A;  3L08 A;  3LJ3 A;  2UY1 B;  3MA5 A;  3LY8 A;  2XS1 A;  3G2V A;  3ULQ A;  4A3V A;  1TNY A;  2F8X K;  2YIN A;  1N54 A;  5A23 A;  1FVF A;  1DNP A;  1TN6 A;  3CVN A;  4A1S A;  2RG8 A;  2LAH A;  5CEA A;  3PZ3 A;  4HNA D;  3CSF A;  5AQA A;  4NRH B;  3T9K A;  3CK9 A;  3JCK C;  4GYW A;  2KBX A;  3VTY A;  2CG2 A;  1O1T A;  2CFU A;  4H7X A;  4EBA G;  3BG0 B;  4K03 A;  3MJW A;  4G8K A;  3NZS A;  1TR4 A;  2KC7 A;  2VYI A;  3C3O A;  3FU5 A;  2ION A;  3CVP A;  2OCC E;  5AQ7 A;  4UQY A;  5T8I A;  2OEV A;  1O5M A;  3ZNG A;  2Y1L E;  3AJI A;  2AXU A;  5AEN A;  3FUM A;  2VGE A;  4Q94 A;  3UM0 A;  2OV8 A;  5FIO A;  3I3N A;  2DZO A;  4GA0 A;  4IRU A;  4I6E A;  4YDO A;  4ANW A;  3SZ7 A;  1L5J A;  1WM5 A;  2CHX A;  3T5V A;  5KNH D;  3QB2 A;  4J8E A;  1JWF A;  4YVO A;  5LOZ A;  3CKC A;  2L6B A;  4TUU A;  2I1J A;  5KJM A;  2X6K A;  5E76 A;  1TN7 A;  3EUV A;  5HI7 A;  4CDN A;  4ANX A;  1S70 B;  4KVM A;  4GYO A;  3RJV A;  4BT9 A;  3FUF A;  2ETB A;  2XZT G;  4N39 A;  1LTX A;  4J8Y A;  4P29 A;  3SBS A;  3P1U A;  2LNI A;  3Q15 A;  3Q47 B;  3DSX A;  4C0E A;  2XEN A;  4F3V A;  4K5B A;  1O1R A;  2HYZ A;  4JEU A;  3Q9U C;  2PQR A;  1YYH A;  3U64 A;  2Y4T A;  4GZD A;  4GTS A;  4TXP A;  4WNG A;  1MYO A;  1WDY A;  2A5U A;  5AYW D;  3CVU A;  4U7E B;  5JA4 D;  1MX2 A;  4U96 D;  2HM8 A;  1TJF A;  2WQH A;  2EIJ E;  2VJ8 A;  3UMV A;  3TXM A;  1MJ0 A;  3R9M A;  3AS5 A;  3E30 A;  5IY5 E;  2V5F A;  2XCC A;  2P2C P;  4U63 A;  3WXX A;  3JUE A;  5B3S E;  3PUJ A;  1VDY A;  2OEW A;  4BT8 A;  5JHA A;  3CHM A;  3ZIM A;  3ZUV B;  3CHO A;  5B1A E;  3ABM E;  3VLE A;  1TN8 A;  3S7J A;  3OXF A;  3HDX A;  4ABN A;  4AIF A;  4JHJ A;  4DX2 A;  4UWK A;  1TNO A;  4M3O A;  3O4Z A;  4GMR A;  2IY0 C;  5EIB E;  3D9K A;  3ESL A;  1QYM A;  5FQ7 A;  4KXK B;  1OWL A;  4H7Y A;  2J49 A;  3QWW A;  3FTS A;  3MKR A;  4MRU A;  4EZL A;  5D2M C;  3ASG A;  1SA5 A;  2ZXW E;  3EHQ A;  1BLX B;  3PZ4 A;  1Z6T A;  4GU5 A;  1NZN A;  4JD2 G;  4HOQ A;  3QWP A;  3MCX A;  5ENS D;  2H6G A;  4GPK A;  4FJY A;  4G24 A;  3JQ1 A;  3PEV B;  3DST A;  1H19 A;  3DSW A;  3FUI A;  1TEZ A;  3DEO A;  3LVQ E;  4NUR A;  1IHG A;  3EIQ C;  2XPI A;  4BSX A;  1ELW A;  3AG2 E;  3IEG A;  3SO8 A;  4DLQ A;  5CED B;  5D66 A;  5CRV A;  2GRO B;  2L0T B;  4BER A;  3Q9N C;  3HYM B;  5AQB A;  1HG5 A;  3TJP A;  1MX4 A;  3NAW A;  4UWF A;  5ANL A;  4KVO A;  4WWN A;  3ULY A;  4PS3 A;  5FTP A;  3NBN B;  3FTW A;  4HFG A;  3ZYQ A;  1H6P A;  4CDM A;  1N95 A;  4FAD A;  2PM7 A;  1MX6 A;  4G25 A;  2WXK A;  2R05 A;  3LVR E;  1N9A A;  2GGF A;  1E96 B;  4EHM A;  4JXT A;  4JA7 A;  2E0I A;  2BKK B;  3KS2 A;  1RW2 A;  3AG4 E;  4AV7 A;  3L17 A;  4B93 B;  3PRZ A;  2IQC A;  4DX1 A;  5HS0 A;  3CVY A;  3V2X A;  4HRL A;  1D8D A;  4BX9 A;  3CKB A;  4JVS A;  5T3R A;  3CVW A;  3UTM A;  3Q78 A;  4TXR A;  4G11 A;  4E85 A;  3DSS A;  3G2W A;  3B95 A;  1OT8 A;  3R7R A;  3FU6 A;  4PUC A;  5BV1 A;  3EDT B;  4GTV A;  1E8Y A;  2XEE A;  4FLB A;  1UN8 A;  5KNG A;  5J90 A;  4APO A;  2GRM A;  3QDN A;  3AS4 A;  3APF A;  3UIO C;  4JW1 A;  3C98 A;  3IBE A;  3CLJ A;  4O60 A;  4XI9 A;  3DEP A;  2I6H A;  1QQE A;  2J4D A;  2GRL A;  5H7P A;  3CHP A;  4AP2 A;  4OAU C;  5EYL A;  4EPZ A;  2MHK A;  3UPV A;  5CCL A;  3V30 A;  1AP7 A;  4B94 A;  4F7A A;  1E8W A;  5A6C A;  3LXU X;  1HS6 A;  3ZW3 A;  4NIK A;  4B0Z A;  4DI4 A;  4CZ2 D;  3SF4 A;  1SQM A;  4UWG A;  2KCV A;  3OXG A;  5EID A;  5G05 C;  3SD5 A;  3CR3 A;  4BX8 A;  3NZU A;  1N0Q A;  3T5X A;  2ETC A;  4HLE A;  2DVW A;  2F37 A;  2GRN B;  3CEQ A;  4A55 A;  3TG5 A;  2NYJ A;  1OUV A;  2FEZ A;  4U0Z A;  4U07 A;  2OND A;  4F1P A;  1X81 A;  2VTB A;  3QKY A;  4JPS A;  3FUJ A;  5D0O D;  3Q5M A;  4N5C A;  1WG0 A;  4K5A B;  2UY1 A;  1B89 A;  2RFM A;  2L6J A;  3CHS A;  2F0Y A;  3ZN3 A;  4I43 A;  1JPL A;  4N3C A;  4JL0 A;  1Q2Z A;  2EIK E;  4KZC A;  1K8K G;  4LEU A;  3ASF A;  3CVL A;  3AS8 A;  4DX7 D;  3LDZ A;  3FH5 A;  3FTY A;  4FUL A;  3E4B A;  1KZP A;  1UN9 A;  3EHM A;  3P2B A;  3SHF A;  2I1K A;  5DBK A;  1LD8 A;  3C3Q A;  1HG2 A;  1SZA A;  2J9Q A;  3ML9 A;  1WAO 1;  4HOR A;  2PM6 A;  2P9S G;  3C3R A;  4I6J A;  1K1A A;  2HR2 A;  2KM4 A;  2X6I A;  3TWT A;  3Q75 A;  4B8C B;  4CDR A;  3C72 A;  3LEW A;  1N4S A;  4RG9 A;  4JHK A;  2OVB A;  2XRZ A;  3MEK A;  5ENN A;  2KCK A;  3FEX A;  4XX5 A;  1NI1 A;  3UT8 A;  3B7B A;  2LUH A;  4OAV B;  3L54 A;  2X38 A;  1JUQ A;  3DRA A;  4G2V A;  2YNQ A;  1G3N B;  3VLF A;  3TL5 A;  2BED A;  5BNW A;  1D9S A;  1LD7 A;  4O6F A;  1HE8 A;  2QYU A;  3UM1 A;  1K3Z D;  3JXJ A;  5G05 J;  1N4R A;  2I2O A;  3PRE A;  3KSQ A;  1H6O A;  2X6J A;  3HXE A;  3SFY A;  3TWS A;  4C9B B;  1A17 A;  2P58 C;  4DK5 A;  1JWG A;  3B7T A;  3J5Q B;  4JC8 A;  5ARG A;  4CT4 A;  3U3W A;  2H6I A;  3ONL A;  4WNF A;  2XRY A;  4DI3 A;  5JJ6 A;  1BPO A;  1X5B A;  1UJJ A;  4HBD A;  2J09 A;  3APC A;  1TNZ A;  4CEM A;  2WPV A;  4DJA A;  3SI5 A;  2WXR A;  3QOU A;  4DX5 D;  1IQU A;  3LS8 A;  1KPS B;  4FJZ A;  4GZ3 A;  3PZ2 A;  4GZ5 A;  1EYH A;  5EX3 A;  2DYR E;  3FH7 A;  4HOT A;  3TWW A;  1HFA A;  2V0P A;  4L9P A;  2WM9 A;  3QNK A;  4LCT A;  3NOG D;  3SGH A;  2Q7F A;  3FY4 A;  1HX8 A;  4ATG A;  2MYO A;  4XE0 A;  1GW6 A;  1ZU2 A;  3ASN E;  2VSX E;  3URZ A;  4UUC A;  3IV0 A;  1XNF A;  3I5P A;  4ACL A;  1YMP A;  3ZXS A;  4J8F A;  5JJ7 A;  4FP7 A;  2OVF A;  4G26 A;  1O1S A;  4APF A;  3B7S A;  3UUX A;  1ELK A;  3UIN C;  1S64 A;  1IXV A;  4BSZ B;  4CYM D;  5CBN A;  1HU3 A;  1NA0 A;  2QZA A;  1FCH A;  5BT1 A;  1TNB A;  2XGS A;  3S7F A;  3BQO A;  5CER B;  2JEK A;  2DWZ A;  4ZFH A;  5ARF A;  3D9O A;  2X6H A;  1FT2 A;  4AJW A;  1H2T C;  2GRP B;  2WXJ A;  1ZB1 A;  5CHE E;  4JB8 P;  4BET A;  4YVQ C;  4GA2 A;  4B8A A;  2C0M A;  3PUK A;  3D3M A;  3IHY A;  3NF1 A;  4GPM A;  2NXP A;  3ZHE B;  2CG3 A;  3KD7 A;  4YDY A;  4I6G A;  3D9L A;  4AY6 A;  2EIM E;  3DWL G;  4F53 A;  1E8Z A;  4HOS A;  1SZ9 A;  3U66 A;  2WXM A;  4WAF A;  2AJA A;  3L9T A;  3MGB A;  4XKC A;  4I17 A;  3CV0 A;  3NOC D;  2J8S D;  4PS8 A;  2WXL A;  3L13 A;  5LP0 A;  5CBO A;  3JUI A;  2KCL A;  2J08 A;  2H6H A;  4UI9 C;  5ENQ D;  3TGO A;  3HIZ A;  5HKP A;  3U4T A;  3GW4 A;  3MV3 B;  3FU0 A;  4N2Q A;  2L0I A;  2VQ2 A;  1MQS A;  3HHM A;  3VLD A;  1OWP A;  4AEZ C;  5ENP D;  3RAU A;  1E90 A;  3B7U X;  3DXM G;  4JA9 A;  3UKU G;  4PH4 B;  3D9H A;  3G2T A;  3MX3 A;  4HB5 A;  2P9L G;  2XS8 A;  4HI8 A;  2WQ6 A;  2F8Y A;  2WMO A;  4BTB A;  4HLL A;  2ILR A;  3IHV A;  5AAR A;  2R5S A;  3SFX A;  3ZYK A;  2CHZ A;  3LKU A;  3TXN A;  3ULE G;  1KT0 A;  4GTO A;  4XI0 A;  2M63 A;  4TV3 A;  5CMW A;  1A5E A;  4N2S A;  2IO2 C;  1HF8 A;  3UXG A;  3R7Q A;  3ZXP A;  2CHW A;  2WXO A;  3D9M A;  1INZ A;  4IN3 B;  3FFL A;  5JHB A;  3FU3 A;  4MS6 A;  1HZ4 A;  1JCR A;  5AN8 A;  1SW6 A;  4UWH A;  5M72 A;  4EEC A;  3CHQ A;  4W9R A;  3FUL A;  2IO3 C;  2FO1 E;  3E34 A;  1LF8 A;  3UX4 A;  2GRQ B;  5JMN D;  1S63 A;  3CQC B;  2FF4 A;  4LRZ A;  4CRW A;  4DLO A;  5ITZ F;  1OCO E;  3LY7 A;  1YA0 A;  2DIW A;  4GTM A;  1U3C A;  4D10 C;  4RQI A;  3AAA C;  2E2E A;  1TYQ G;  4U8V D;  4IUL A;  3CQG B;  3UIP C;  1Z3Y A;  4ZHB A;  4U0S A;  3PZD A;  3E32 A;  2XQ0 A;  4WNE A;  3BG1 B;  5A7D B;  4FLH A;  2A4Z A;  2P9I G;  4UI9 J;  3ESK A;  3C5R A;  2WXH A;  2FUL A;  4L7T A;  5LFA A;  1H2V C;  3GZ2 A;  4CCA A;  3SNX A;  4EZK A;  3FUH A;  3VTX A;  2KZT A;  3CVQ A;  1DCQ A;  1HO8 A;  3SBT B;  4ILG A;  3FUK A;  3E37 A;  1KZO A;  2V4H C;  4PS7 A;  5EX0 A;  2XPZ A;  4AOF A;  5KCM A;  3ZFW A;  4FC8 A;  4L1B A;  4L23 A;  2BKG A;  1PC2 A;  4ACK A;  2AXV A;  4G1T A;  1QBQ A;  1FT1 A;  2KAT A;  4NAC A;  4RSY A;  3EIJ A;  3FEY A;  3FTU A;  1U2V G;  5AAO A;  4J8S A;  3PZ1 A;  2R59 A;  5BPP A;  5LCW C;  1H6K A;  4EZJ A;  5KJK A;  3ENE A;  4LSZ E;  3RIB A;  4GCN A;  4C48 B;  5C1D A;  3RU0 A;  3FP3 A;  4UI9 K;  2ZIS A;  4HOU A;  2YQ8 A;  3BEE A;  3Q7A A;  2EIN E;  4GTR A;  1H2U A;  2FBN A;  3W9G A;  2P9U G;  5AQ9 A;  4U0U A;  4Q69 A;  3NB2 A;  2WXQ A;  2HO1 A;  3FTZ A;  1Z5S C;  2KZT B;  4QFV A;  1N4Q A;  2R03 A;  2EIL E;  1W3B A;  3UM2 A;  4BWR A;  3L6A A;  1E7V A;  3MKQ B;  3J5P A;  3ASH A;  3JXI A;  5EDS A;  4FHJ A;  3LY9 A;  4HRN A;  4AXH A;  4N3B A;  4L2L A;  3LJN A;  2R2L A;  3HXD A;  2JLB A;  1Z3X A;  3OXL A;  3TG4 A;  4OVV A;  4R7L A;  3S7B A;  3DXK G;  3JQ0 A;  5EIL A;  2WXP A;  2XPY A;  1UW4 B;  1QNF A;  3Q79 A;  5CMY A;  2XGO A;  4LNG A;  5KBA A;  2B0O E;  4BES A;  3G2U A;  3APD A;  2MOW A;  2RKK A; 
#chains in the Genus database with same CATH homology
 1EDU A;  3OAW A;  5ANR A;  2VSX E;  3URZ A;  3O48 A;  4L2Y A;  2XHE A;  3IV0 A;  1XNF A;  2LSV A;  3D9K A;  3ESL A;  3I5P A;  4ACL A;  3PE4 A;  3ASD A;  3ZXS A;  3I4R B;  4J8F A;  4URK A;  4RG6 A;  5JJ7 A;  4FP7 A;  3R9A B;  5JJT A;  2QY7 A;  2XEV A;  4WWO A;  2OVF A;  4G26 A;  3N71 A;  3FH8 A;  5C2Y A;  4APF A;  2AVP A;  3B7S A;  5FQ7 A;  4KXK B;  1OWL A;  3UUX A;  4H7Y A;  2J49 A;  3QWW A;  4XKB A;  1ELK A;  1E8X A;  5BUZ A;  2WQ7 A;  3FTS A;  3MKR A;  4MRU A;  4EZL A;  2V4L A;  2FI7 A;  3ZGQ A;  4KMO A;  3ASG A;  3MZL B;  4AM9 A;  3CK7 A;  1HU3 A;  4C0M A;  1Z6T A;  4HXI A;  1NP7 A;  1NA0 A;  1NZN A;  4GU5 A;  1FCH A;  3I4G A;  4HOQ A;  3QWP A;  2X6F A;  4LUN U;  3OTN A;  3ZEF A;  3ZYL A;  5BT1 A;  4AVX A;  3D9N A;  2XGS A;  3T8M A;  3MCX A;  1OWM A;  3S7F A;  1EPU A;  5LCW J;  4KYO B;  2WMN A;  1TJC A;  4Y6W A;  4CT0 A;  2JEK A;  1H0A A;  2BF0 X;  4GPK A;  3JYS A;  4FJY A;  5ARF A;  3RKV A;  4G24 A;  4OVU A;  2VSY A;  5LX8 A;  3D9O A;  3JQ1 A;  4GA1 A;  3Q4A B;  3PEV B;  1H19 A;  2X6H A;  4AJW A;  2NC9 A;  3B7R L;  4U04 A;  2V8S E;  1H2T C;  2YHC A;  2WXJ A;  3FUI A;  4J6I A;  4WND A;  1TEZ A;  2WB2 A;  3LVQ E;  5CHE E;  3CGH A;  4NUR A;  4FA6 A;  1IHG A;  3EIQ C;  5T4Y A;  4YVQ C;  4GZ6 A;  2XPI A;  4GA2 A;  4B8A A;  3HVE B;  4I1A A;  2C0M A;  4FHK A;  4I9E A;  4BSX A;  4KBQ A;  2AXZ A;  1ELW A;  3PUK A;  3D3M A;  3IHY A;  3NF1 A;  4GMJ A;  3IEG A;  2NXP A;  3FUE A;  1OWN A;  3QK0 A;  3ZRH A;  4DLQ A;  4GZC A;  3ZHE B;  2FO7 A;  4I9C A;  3CIA A;  4LER A;  2CG3 A;  2L0T B;  1IYG A;  4WUY A;  3RRU A;  1KT1 A;  3KD7 A;  3HYM B;  2IF4 A;  1HG5 A;  2Y4U A;  4I6G A;  4U8H A;  4GCO A;  3D9L A;  5KJL A;  5BW8 C;  1Y8M A;  5AJL A;  3TJP A;  1HXI A;  4AY6 A;  3QWV A;  4UWF A;  5ANL A;  3PEU B;  4KVO A;  4F53 A;  1E8Z A;  4WWN A;  4HOS A;  1SZ9 A;  4UWL A;  3U66 A;  4CGW A;  4PS3 A;  5FTP A;  3CK8 A;  2WXM A;  4WAF A;  5KJN A;  5FJY A;  2WXF A;  2J4B A;  3FTW A;  3PDN A;  3CHR A;  4HFG A;  3MGB A;  4XKC A;  4I17 A;  3CV0 A;  3ZYQ A;  4CDM A;  2IFU A;  2L9B A;  4PS8 A;  4FAD A;  2WXL A;  5AIJ A;  2XCB A;  2PM7 A;  1PY1 A;  4GYY A;  3L13 A;  3PNT B;  5LP0 A;  3JUI A;  4G25 A;  2KCL A;  3QJZ A;  3QAR A;  1FVH A;  2WXK A;  4K0R A;  2J08 A;  3LVR E;  1QZ2 A;  4UI9 C;  4BY6 A;  2GGF A;  3U9W A;  5FZQ A;  1E96 B;  4Y6C A;  3TGO A;  4PDX A;  4JXT A;  3HIZ A;  4J8D A;  3RO2 A;  3U4T A;  4JA7 A;  3GW4 A;  3GZS A;  3ZHE A;  4ILI A;  3MV3 B;  3FU0 A;  4KZ0 A;  2E0I A;  4N2Q A;  4ILH B;  1ZBP A;  2L0I A;  2VQ2 A;  4EBA A;  3KS2 A;  1MQS A;  4I2Z A;  4B89 A;  2I9C A;  3HHM A;  1INZ A;  3VLD A;  4AV7 A;  4ANV A;  1PAQ A;  3CST A;  1OWP A;  3S2A A;  4MKT A;  4AEZ C;  1E90 A;  3L17 A;  4NQ0 A;  1NA3 A;  3GZ1 A;  3B7U X;  3PRZ A;  2IQC A;  4JA9 A;  4ME2 A;  4N3A A;  3CVY A;  4DPR A;  2ZU6 B;  1E7U A;  3LCA A;  4BX9 A;  5CCM A;  3KAE A;  3FTX A;  4GAA A;  3CKB A;  4PH4 B;  3G2T A;  3MX3 A;  4JVS A;  5T3R A;  3MV2 B;  3CVW A;  4G11 A;  3NQP A;  2IU1 A;  4E85 A;  4MLP A;  2AW6 A;  3FTV A;  3G2W A;  3ZYM A;  3R7R A;  3G2S A;  3FU6 A;  4PUC A;  4YND A;  5BV1 A;  1S0P A;  3EDT B;  1E8Y A;  2WQ6 A;  2WMO A;  4J0U A;  2LSU A;  2YHE A;  2ILR A;  1UN8 A;  4FLB A;  4BTB A;  4I1O B;  5J90 A;  3IHV A;  4APO A;  2GRM A;  3QDN A;  1MHQ A;  2BTD A;  1UJK A;  2VSN A;  3FHE A;  1WY6 A;  2R5S A;  3AS4 A;  3APF A;  3FUD A;  2WXI A;  3MYV A;  5FT9 A;  3EJN A;  3ZYK A;  2CHZ A;  3D9P A;  3LKU A;  4JW1 A;  3QC1 A;  3C98 A;  3CVV A;  3TXN A;  3IBE A;  3ML8 A;  3FWV A;  2WXG A;  3CLJ A;  2CFZ A;  1KT0 A;  2IJG X;  4HS2 A;  4XI9 A;  4GML A;  4XI0 A;  2I6H A;  3PVL A;  5G04 C;  3RRM B;  5AJD A;  1QQE A;  2M63 A;  2J4D A;  2GRL A;  4TV3 A;  5CMW A;  3CHP A;  4ANU A;  4AP2 A;  4N2S A;  2VTB B;  4I1M A;  3PNL B;  3CVX A;  1HF8 A;  2LAI A;  4EPZ A;  2VSO E;  2VGY A;  1HH8 A;  3TAX A;  2MHK A;  3ZVV A;  4AY5 A;  3UPV A;  3LPZ A;  5CCL A;  3R7Q A;  4CGV A;  4B94 A;  5FQ8 A;  4A3T A;  4XIF A;  2CHW A;  2WXO A;  3D9M A;  4F7A A;  3L08 A;  3LJ3 A;  1E8W A;  4IN3 B;  3FFL A;  1HS6 A;  3LXU X;  4I2W A;  3ZW3 A;  5A6C A;  5JHB A;  2UY1 B;  2QFC A;  3FU3 A;  3MA5 A;  2DBA A;  4MS6 A;  1HZ4 A;  3LY8 A;  4B0Z A;  3G2V A;  3ULQ A;  4DI4 A;  4A3V A;  3SF4 A;  3DBS A;  1SQM A;  4UWH A;  4UWG A;  5M72 A;  2YIN A;  1N54 A;  2KCV A;  4EEC A;  5A23 A;  1FVF A;  3OXG A;  3CHQ A;  4W9R A;  5G05 C;  3SD5 A;  1DNP A;  3CR3 A;  4A1G A;  4BX8 A;  4JEH A;  3FUL A;  3CVN A;  5G2N A;  3NZU A;  3GYZ A;  4HLE A;  3T5X A;  4A1S A;  3UT4 A;  1LF8 A;  5G55 A;  2IOL A;  4BFR A;  5E75 A;  3UX4 A;  3CEQ A;  2C2L A;  2RG8 A;  2LAH A;  3CQC B;  2FF4 A;  4A55 A;  3CSF A;  3LYA A;  3TG5 A;  2J07 A;  1OUV A;  3D9I A;  4LRZ A;  4NRH B;  3RK6 A;  2FEZ A;  4U0Z A;  5EKQ D;  4CRW A;  4DLO A;  3FDH A;  3CK9 A;  4U07 A;  1P5Q A;  3LY7 A;  2C0L A;  2OND A;  3JCK C;  4GYW A;  1YA0 A;  2VTB A;  2MRI A;  2DIW A;  1IQR A;  3QKY A;  3VTY A;  2CG2 A;  2BUG A;  1U3C A;  2CFU A;  4XZ4 A;  4JPS A;  4D10 C;  3FUJ A;  5D0O D;  4H7X A;  4EBA G;  3BG0 B;  5DIZ A;  5J08 A;  3Q5M A;  4K03 A;  3MJW A;  4N5C A;  2PQN A;  1ELR A;  2UY1 A;  2E2E A;  1B89 A;  3NZS A;  2L6J A;  1KLX A;  2KC7 A;  3CHS A;  2IOS A;  2VYI A;  4IUL A;  3ZN3 A;  3K9I A;  4I43 A;  3CQG B;  1Z3Y A;  4EQF A;  1JPL A;  4U0S A;  3PZD A;  2XQ0 A;  3FU5 A;  4WNE A;  3BG1 B;  4N3C A;  5A7D B;  4JL0 A;  3PH0 C;  4FLH A;  2A4Z A;  2ION A;  3CVP A;  2AWI A;  4KZC A;  4UI9 J;  3ESK A;  4LEU A;  3ASF A;  4BTA A;  2WXH A;  2FUL A;  3CVL A;  4L7T A;  2NSZ A;  2XGM A;  4UQY A;  5T8I A;  4TRQ A;  5LFA A;  3SFZ A;  1H2V C;  3GZ2 A;  3AS8 A;  4CCA A;  3SNX A;  3LDZ A;  4EZK A;  3FH5 A;  3FUH A;  3VTX A;  1N52 A;  2KZT A;  3FTY A;  3CVQ A;  3D9J A;  1HO8 A;  4JZY A;  3SBT B;  4ILG A;  3FUK A;  3E4B A;  4FUL A;  2AXU A;  3AU4 A;  1UG3 A;  1UN9 A;  3EHM A;  5AEN A;  3P2B A;  3SHF A;  2I1K A;  5DBK A;  4PS7 A;  4Q96 A;  3FUM A;  2PL2 A;  1HG2 A;  1SZA A;  4Q94 A;  2J9Q A;  4UQZ A;  3ML9 A;  5FZS A;  1WAO 1;  5EX0 A;  4HOR A;  2XPZ A;  4E6H A;  4AOF A;  2PM6 A;  1EF1 C;  5KCM A;  3ZFW A;  4I6J A;  3B13 A;  2OV8 A;  4GB9 A;  4FC8 A;  4L1B A;  4L23 A;  2HR2 A;  2R17 C;  3QAQ A;  1PC2 A;  3RRN B;  2KM4 A;  2X6I A;  4ACK A;  3I3N A;  4V3I A;  4WWP A;  4B8C B;  3L22 A;  2AXV A;  2OOE A;  4G1T A;  3UQ3 A;  4CDR A;  3LEW A;  5FQ4 A;  2KAT A;  4NAC A;  4RSY A;  3EIJ A;  3FEY A;  3FTU A;  4RVB A;  4RG9 A;  4GA0 A;  4JHK A;  4J8S A;  2OVB A;  2XRZ A;  3KEZ A;  4IRU A;  4I6E A;  3MEK A;  5ENN A;  2R59 A;  4ANW A;  2KCK A;  3FEX A;  5BPP A;  2PZI A;  3SZ7 A;  4XX5 A;  2VGX A;  5LCW C;  1L5J A;  3UT8 A;  1WM5 A;  2CHX A;  2LO6 A;  3T5V A;  5HQ8 A;  1H6K A;  4EZJ A;  5KJK A;  3QB2 A;  3ENE A;  4J8E A;  3RIB A;  1JWF A;  4YVO A;  5LOZ A;  3CKC A;  4GCN A;  4TUU A;  5C1D A;  2I1J A;  3EHN A;  2X6K A;  5G04 J;  5KJM A;  4IYP A;  3RU0 A;  3L54 A;  3FP3 A;  5E76 A;  4UI9 K;  4HOU A;  2X38 A;  4G23 A;  1JUQ A;  2YQ8 A;  2Y3A A;  4G2V A;  5HI7 A;  4CDN A;  4ANX A;  2YNQ A;  5FWQ A;  3VLF A;  4KVM A;  3BEE A;  3TL5 A;  1H2U A;  1U3D A;  3RO3 A;  1Y6I A;  4GYO A;  2FBN A;  5BNW A;  2RD0 A;  3RJV A;  4F1S A;  4BT9 A;  3FUF A;  4U0U A;  4O6F A;  4N39 A;  4Q69 A;  4HVB A;  4P29 A;  4UQX A;  1HE8 A;  2WXQ A;  1XGW A;  3P1U A;  3SBS A;  2HO1 A;  2LNI A;  3FTZ A;  3Q15 A;  3Q47 B;  2X3M A;  3AU5 A;  5G05 J;  4C0E A;  2EQX A;  1DVP A;  2GW1 A;  2I2O A;  3PRE A;  2KZT B;  4QFV A;  4F3V A;  2HYZ A;  3L16 A;  1W3B A;  2X6J A;  4C9B B;  4JEU A;  1A17 A;  2P58 C;  4DK5 A;  1JWG A;  4BWR A;  2PQR A;  3L6A A;  3B7T A;  1E7V A;  4OYS A;  4JC8 A;  2DCP A;  5ARG A;  3DPD A;  3ZPJ A;  4CT4 A;  3MKQ B;  3U3W A;  3ASH A;  3ONL A;  4WNF A;  3U64 A;  2XRY A;  2Y4T A;  4GZD A;  3UT7 A;  4WNG A;  4DI3 A;  5JJ6 A;  5EDS A;  1BPO A;  1X5B A;  3S7D A;  4FHJ A;  3ONK A;  3LY9 A;  1UJJ A;  2A5U A;  2J09 A;  3IKO B;  5AYW D;  3APC A;  3CVU A;  4CEM A;  4AXH A;  4N3B A;  2HM8 A;  1TJF A;  4L2L A;  2WQH A;  2WPV A;  2VJ8 A;  4DJA A;  1OWO A;  3PE3 A;  3SI5 A;  3UMV A;  3TXM A;  2WXR A;  3AS5 A;  3QOU A;  4FU3 A;  4JHR A;  2JLB A;  1Z3X A;  1IQU A;  3LS8 A;  2V5F A;  2XCC A;  3PS6 A;  3OXL A;  4U63 A;  3WXX A;  3PUJ A;  1VDY A;  3HVE A;  4BT8 A;  4FJZ A;  4GZ3 A;  4GZ5 A;  2VGX B;  3TG4 A;  4OVV A;  1EYH A;  2WVI A;  5JHA A;  3CHM A;  4R7L A;  3S7B A;  3ZIM A;  3JQ0 A;  3CHO A;  2WXP A;  5EX3 A;  5FQ6 A;  2XPY A;  3VLE A;  3FH7 A;  1UW4 B;  4HOT A;  1QNF A;  3MKQ A;  5CMY A;  5D0Q D;  2XGO A;  1HFA A;  2V0P A;  2WXN A;  3FUN A;  3S7J A;  3OXF A;  2WM9 A;  3HDX A;  3QNK A;  5FZR A;  4LCT A;  3Q49 B;  4ABN A;  2UWJ G;  5BV0 A;  3G2U A;  3SGH A;  2Q7F A;  3FY4 A;  1HX8 A;  4ATG A;  4AIF A;  4JHJ A;  3APD A;  4XE0 A;  4UWK A;  2MOW A;  4M3O A;  3O4Z A;  1GW6 A;  1ZU2 A;  4KT6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...