1INZA

Solution structure of the epsin n-terminal homology (enth) domain of human epsin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
GSSRMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPS15-INTERACTING PORTEIN(EPSIN)
publication title Solution structure of the epsin N-terminal homology (ENTH) domain of human epsin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2000-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1inzA00
3ONLA 2MOWA 1HG2A 3ZYKA 3ONKA 3G2UA 1JWFA 1MHQA 1SZAA 1EDUA 5LOZA 1XGWA 2L0IA 3D9KA 1JPLA 3D9MA 2BF0X 1DVPA 5LP0A 3D9LA 1X5BA 5CMYA 1JWGA 1PY1A 3D9IA 3G2TA 3D9NA 1H0AA 3D9PA 1VDYA 1HX8A 4FU3A 2KM4A 4Q94A 3ZYLA 1SZ9A 2L0TB 2QY7A 1JUQA 3G2WA 1EYHA 2DCPA 1HG5A 3D9OA 3G2VA 4FLBA 3ZYMA 4AVXA 2DIWA 3D9JA 3G2SA 1LF8A 1HFAA 2LO6A 1UJKA 4JXTA 1INZA 1UJJA 1HF8A 5J08A 4GZDA 4GZCA 2V8SE 4HFGA 4NACA 3LDZA 5CMWA 4Q96A 3RRUA 3ZYQA 1ELKA 3CLJA
chains in the Genus database with same CATH superfamily
1MQSA 4GTTA 3FTZA 3Q78A 2H6HA 4GYOA 3CKBA 2VGXA 3JYSA 4LCTA 3PNLB 1X81A 5EN5D 3FUNA 3UI2A 4OYSA 3BQOA 1HG5A 4KBQA 3B7BA 3HXEA 3DWLG 4AIFA 3HVEB 3LVRE 5DIZA 4EZLA 1BI7B 3ASFA 1DCEA 3HRAA 3UM2A 3HDXA 2P9IG 1HG2A 2WXHA 3NOCD 4ILHB 3I4GA 4GAAA 4KZ0A 4JL0A 2FO7A 4WWOA 4BY6A 1N0QA 4ANUA 2AXUA 1U3DA 3RKVA 1A5EA 3R9AB 3SO8A 3QOUA 1UOHA 4XIFA 1P5QA 3ULQA 4G25A 2LAIA 5AAOA 2MRIA 4J8DA 4GPMA 4PDXA 3G2WA 3L17A 3CQGB 3TG4A 4LEUA 2LSVA 1INZA 2P9UG 3I5PA 1N95A 4A55A 5JJTA 3MKQB 1TR4A 2FI7A 5CECB 4TUMA 4JPSA 4AJWA 4BEPA 3AAAC 3F6QA 2OOEA 1D9SA 2EIME 5EIBE 1OCCE 4KXKB 4CT0A 1MX2A 4RVBA 3UT7A 1E8ZA 2IF4A 3L13A 3KEZA 4APOA 2OVFA 2VGEA 3CLJA 1TJFA 1FVFA 3I3NA 3Q7FA 3ABKE 5C1DA 3FTUA 3TGOA 1BD8A 4G23A 3DSVA 4J6IA 1MJ0A 2XS8A 4G11A 4ACLA 5FIOA 3KS2A 3Q4AB 3RU0A 4F6RD 3ABME 3GYZA 2RKKA 2WXRA 2V8SE 3KSLA 4HRNA 2P9SG 5KJLA 2ETBA 4U0UA 5CBOA 4BTBA 3ZXSA 4RQIA 1QYMA 3B7TA 1TN6A 3QDNA 4L23A 3FUHA 2GRPB 4J8FA 3SQVA 5ENPD 2IY0C 4DX5D 2I1JA 3PH0C 4WWNA 3DRAA 4I9EA 4IRUA 4UQYA 3FTWA 3ZEFA 4YVOA 3OXGA 1JCSA 3DSTA 3JCKC 2L0TB 2VJ8A 2H6IA 4U8HA 3JXIA 1TJCA 3EIJA 2KCKA 3ZW3A 4EZJA 2J08A 4GTRA 5LFAA 4UI9C 5FZRA 4TV3A 2QC9A 3AS8A 4RG9A 4UUCA 4GMRA 1SVXA 3APCA 3G2UA 2GGFA 1K1BA 4DI4A 2L6BA 3OAWA 4I17A 5CMYA 2F0YA 1ELRA 3SHFA 3VLDA 2UY1B 4NRHB 2WQ7A 2YNQA 2JABA 3FWVA 4FJYA 4BT9A 1ELKA 2Y1LE 3WXXA 2IO2C 5LP0A 4GMLA 5AENA 3FTSA 4EECA 3ENEA 5EILA 5FQ8A 2XPIA 4IN3B 1D8EA 2V0PA 2IQCA 5FWQA 3L22A 4UI9K 3CVNA 4ZFHA 4C0MA 3MEKA 4ABNA 3U4TA 4AOFA 2QZAA 5HS0A 4GZ3A 3FUMA 3KD7A 2A5EA 1S63A 3PZ1A 2R03A 4N5CA 2R17C 3HHMA 5JMND 1H6OA 2J8SD 3ZKJA 4PUCA 5D2MC 3PVLA 3T8KA 2ZU6B 1UJJA 4GZ6A 4YDWA 4U8VD 2KCLA 5IY5E 1NFIE 1OWNA 3FP3A 5CRUA 3SZ7A 4KT6B 4C9BB 4JB8P 3LJ3A 5JHBA 4B8CB 2RG8A 2YINA 4YDYA 5LX8A 3PEUB 3TAXA 4J8EA 3PZDA 4NIKA 3CVUA 3QB2A 3SFZA 5BXOA 5T4YA 5KNGA 3PUJA 4GTOA 4ACKA 2VYIA 2Y3AA 3T9KA 4GPKA 3TWQA 2F8XK 3FTXA 5FJYA 2BKKB 3FTYA 4UI9J 4UQZA 3L08A 4U7EB 2WXPA 1WY6A 3CSTA 2WXNA 2IFUA 3IHYA 2B0OE 2IOSA 3DPYA 4BETA 4GTPA 2VTBB 1JWGA 4PS8A 3MGBA 4FLHA 1FT1A 5M72A 1KZOA 3PZ2A 5CMWA 2V4HC 2PQNA 2Y69E 4G24A 4WNFA 3EHQA 2R2LA 5KJMA 2PM7A 2PQRA 4F7AA 3PZ3A 3O48A 2WB2A 2KATA 4ANVA 5FQ6A 2P2CP 3E37A 5KJKA 3EU5A 4BTAA 1WAO1 2AVPA 3PNTB 3ZYLA 1BU9A 3RIBA 3HXFA 4HBDA 2XCCA 5G2NA 2FULA 5KCMA 3MX3A 4F1PA 2P9PG 4I9CA 1YMPA 3C3RA 3DSUA 1HE8A 1OWLA 3V31A 1JCQA 2ETAA 1UN9A 1WM5A 1UG3A 3ESLA 3RK6A 4EHMA 2ZGDA 2KC7A 5ENSD 3U3WA 1FT2A 3FUIA 2WXMA 4MS6A 3EHRA 4U0ZA 1NZNA 2WXGA 4XI0A 4GCOA 4M7CA 2IONA 2AJAA 4TXQA 2VSXE 2CHXA 1QBQA 5LCWJ 2VGYA 3S7FA 3C5RA 3ABLE 5D66A 3CEQA 1N11A 3TJPA 4KYOB 4UWHA 4BFRA 5CCMA 2HO1A 4OAUC 5HI7A 1OT8A 2YHCA 5CEAA 1IYGA 1MYOA 4O60A 2J4DA 4LERA 2MHKA 3QK0A 5G04J 2IOLA 4PS3A 4Q94A 2P9LG 1TNOA 3QC1A 2I2OA 1KLXA 4QFVA 3TWWA 4EQFA 2XZDG 2GRRB 3PUKA 1O5MA 3J5QB 2OVBA 2H6GA 5AN8A 1HS6A 2ZGGA 5B1AE 1OWMA 5B3SE 3CK7A 3MKQA 5BXUA 5HQ8A 4FHKA 4WNEA 3TWUA 3B95A 1QZ2A 2XEEA 3ZN3A 4HOTA 2ILRA 3MV3B 3ML9A 4HQDA 1HFAA 2XZTG 5AQ7A 2X6JA 3NQPA 4IYPA 2C0LA 5ENOD 4JEHA 2XHEA 4N5QA 1MX4A 3SBTB 2MYOA 2ZISA 3U66A 5JHAA 4JC8A 4GZ5A 2CFZA 4F3VA 3K9IA 4CZ2D 3D9LA 3CVPA 5AYWD 4JD2G 2KXPC 2Q7FA 4B0ZA 3CHRA 4Y6WA 3FU6A 4HI8A 4GMJA 4URKA 2WVIA 3BEEA 1A17A 2V5QC 1NP7A 3ULYA 3UM0A 1SA4A 2J49A 4TXRA 4XKCA 3DSXA 4F1SA 3FY4A 2XRYA 5ENTD 3DSWA 2OCCE 4B94A 4CRWA 1WG0A 1N0RA 4AV7A 2A4ZA 3OTNA 2C0MA 4OVVA 3B7RL 4KVMA 1O1RA 3GZ1A 2HE0A 5ANRA 2VSNA 4BX8A 1K1AA 3UTMA 3L54A 2ETCA 2CFUA 3TXMA 4JEUA 3L6AA 4CDRA 3IXEA 3EUVA 2L0IA 4X8QA 4HLLA 4WNDA 4NQ0A 5EDSA 1MX6A 3B7UX 4HLEA 3C3QA 4N3AA 1OY3D 2QY7A 5KWDA 1TNBA 2L9BA 2DYSE 2F8YA 2WQ6A 2V5FA 3RSEG 4ANXA 4DX6D 3D3MA 3CHMA 4PS7A 4U96D 3FDHA 3ASHA 3UKRG 3MCXA 1TEZA 4FP7A 5KJNA 2KCVA 3OXFA 1OCOE 4O1PA 3ULEG 2HR2A 2JLBA 2XPZA 3FU0A 1E7UA 1NI1A 1TN7A 3FFLA 4CCAA 1TYQG 3MYVA 3NZSA 1E8WA 3VLEA 1GW6A 1NA3A 4YDEA 3ML8A 4U0SA 3P2BA 5B1BE 3PREA 2Y4TA 3P1UA 4KZCA 2EINE 4MLPA 1UW4B 1IQUA 2LXMA 2QFCA 3KAEA 3N71A 4G2VA 4DX2A 4WWPA 3JQ1A 4FA6A 3MV2B 5KBAA 2CG2A 1JWFA 4DLQA 3C3OA 4DRXE 4P29A 3LXUX 4CT4A 5ITZF 2NSZA 3G2VA 4G26A 5ENQD 2DWZA 2XEHA 2PM6A 3APFA 5E76A 3TWTA 5EYLA 4HVBA 4I1OB 3R7RA 4H7XA 2KBXA 3CV0A 4OAVB 3HXBA 3AG1E 3ZYKA 1N4RA 2WM9A 3FUFA 1X5BA 3AU5A 3C72A 3QKYA 2DCPA 4BX9A 2VSYA 2AW6A 2E2EA 2LXLA 2QYJA 4QQIA 1Y8MA 4HRMB 3S7JA 4R7LA 3SBSA 2WQHA 3QAQA 1QQEA 5CBNA 5AQBA 3T5VA 3HG0D 2A5UA 3AU4A 2LAHA 3AS5A 3PDNA 3CSFA 4DK5A 2F37A 3EIQC 3TWRA 3Q9UC 4AY6A 3FUJA 2R05A 4CYMD 1EDUA 2WMNA 2J07A 3ASGA 4JZYA 2NYJA 1H0AA 3DPDA 2FBNA 4G8LA 4I6GA 3ZHEA 1D8DA 3Q73A 2I1KA 4JVSA 1SW6A 3FUEA 5CRVA 2XCBA 3UQ3A 2LUHA 3UPVA 4BERA 3FH5A 3QWVA 4HI9A 3ZUVB 3DEPA 1JUQA 2DZOA 5LCWC 2X38A 5J90A 5D0QD 3TL5A 1ZBPA 4RSYA 3DEOA 2LSUA 2MOWA 2EIJE 5AQAA 3NAWA 4N3CA 2IU1A 1KPSB 4LRZA 4V3IA 5G04C 3CR3A 2R59A 3TWSA 3SI5A 1HF8A 3SY2A 3FEYA 4H7YA 1H2VC 4Q96A 1U2VG 1BLXB 4GCNA 3CVXA 4BT8A 3ZPJA 3DBSA 1LD7A 5EYPF 1YA0A 1Z6TA 4DX7D 1HZ4A 3D9JA 4J8YA 1LF8A 2I6HA 3FEXA 3RJVA 2GRLA 4YVQC 4K0RA 4FHJA 3PZ4A 3RO3A 3FU3A 4GTMA 2WXKA 4K03A 4GA2A 5E75A 3SGHA 1B89A 2EIKE 1DC2A 4U8YD 4FC8A 4UQXA 3ASNE 2Y4UA 4XE0A 5FQ7A 3C98A 4GTVA 4N2QA 4HORA 2AXVA 3IV0A 2BF0X 4IULA 3MJWA 3D9PA 4FU3A 1UN8A 5HRYA 1Z3YA 5ENRD 4GA0A 1IKND 4XX5A 4N2SA 1FCHA 4JHJA 3ZVVA 3NB2A 3NZUA 1K8KG 2KZTB 1KT0A 2DYRE 2BEDA 4JA7A 4ATGA 1JPLA 3D9MA 1VDYA 5G55A 2HYZA 3JUIA 3BG0B 2ZXWE 2CHZA 1UJKA 4JXTA 4FULA 4WAFA 4Z68A 1LD8A 2R02A 5BV0A 3EDTB 5LOZA 4I6EA 3Q5MA 1HX8A 4A3TA 5JJ7A 1YYHA 3HVEA 4FJZA 1S64A 2L6JA 3W9FA 3UT4A 4WNGA 3TWVA 2DZNA 2ZIRA 4N3BA 3NOGD 2WXIA 4OVUA 3Q9NC 3ZFWA 3J5PA 3L16A 4FADA 3UM1A 3L9TA 2BKGA 4Q69A 2OEWA 2WXQA 2EQXA 3DXMG 4I6JA 4L1BA 2X6FA 3CQCB 5EX0A 1E7VA 2J09A 4E6HA 3LS8A 5A7DB 1XGWA 3CVVA 2V4LA 1NA0A 3EU9A 1OCZE 3RAUA 3E34A 3CHSA 4O1OA 3JQ0A 4AVXA 4GU5A 3LY9A 1V55E 1IXVA 3ESKA 4DJAA 5FTPA 1O1SA 3BG1B 3U64A 4CEMA 5JA4D 3EHNA 4K5CA 4J7WA 2BUGA 2GRQB 3TG5A 3L82A 1DNPA 2PZIA 4G8KA 2IEJA 1W3BA 4L9PA 4L7TA 1RW2A 1ZB1A 3RRUA 3O4ZA 4KVOA 5BT1A 4KMOA 4G1TA 3UIOC 3V2OA 3G2TA 3QNKA 5BW8C 3AG2E 2WXOA 2OEVA 2WXJA 5AQ9A 1HXIA 2BTDA 3E32A 1EPUA 4D10C 3LJNA 4TRQA 3ONKA 2WPVA 2XEVA 3IBEA 4I43A 3UKUG 2YQ8A 1N4PA 3RRMB 4U95D 1DCQA 2AXZA 3Q75A 3CIAA 1SZ9A 3RRNB 4NURA 3HXDA 2GW1A 3AS4A 3EJNA 4GYYA 1OWPA 4B93B 3CK8A 4BWRA 3ISMC 4LNUD 1TNUA 4AP2A 3DSSA 2XGOA 1RZ4A 4FLBA 4EBAG 1H6KA 4JW1A 4ME2A 3S2AA 1H2TC 5EKQD 3RO2A 4LSZE 1H19A 5FZQA 3SFYA 3LYAA 2OV8A 3CHQA 3CVYA 5AJLA 4HXIA 3FU5A 3MKRA 1Z5SC 2PL2A 2UY1A 1YCSB 4NACA 5A6CA 4L2LA 4W9RA 3FUDA 3UM3A 1ELWA 3FTVA 4A1GA 5BUZA 1LTXA 3CHPA 2XGSA 2KM4A 3VTXA 3LEWA 2FO1E 2X3MA 2XENA 4ILGA 3SF4A 1AP7A 1AWCB 2RFMA 1N4QA 4DPRA 4EPZA 4EZKA 4XKBA 2R5SA 2GROB 1SA5A 3APDA 1XNFA 3D9NA 2VGXB 1HU3A 4BSXA 3G2SA 3LKUA 1Q2ZA 5J08A 4A3VA 4C0EA 3SD5A 4E85A 3UX4A 3Q47B 3KSQA 3HXCA 3KEAA 3Q49B 2FF4A 1N9AA 2X6KA 4ILIA 1KZPA 5C2YA 4DX1A 2H6FA 5BNWA 3ZRHA 1OWOA 1BI8B 3E33A 2B6CA 4GA1A 4BESA 4RLYA 4RG6A 3LDZA 4O6FA 5EX3A 3UXGA 2XS1A 2UWJG 3AG3E 1WDYA 4MRUA 1SZAA 1DVPA 3IKOB 4DLOA 4CGWA 3U9WA 2M63A 4GTSA 1U3CA 1H6PA 2J9QA 4ATZD 1V54E 5AARA 1E8YA 4LG6A 3ZGQA 4GZCA 4A1SA 3V2XA 3Q15A 3PS6A 2J4BA 2GRNB 2P58C 2RD0A 4U63A 4I2ZA 1G3NB 4JA9A 4HOQA 2DVWA 3ZYMA 3FH7A 5D0OD 1K3ZD 2WXLA 3MZLB 3E30A 1TNYA 4I1AA 2I9CA 2ONDA 3B13A 2VQ2A 4UWGA 2AWIA 2XQ0A 3QWWA 5HKPA 3WG7E 2VTBA 3QJZA 4UWLA 5H7PA 4GZDA 4L2YA 1Z3XA 5DBKA 3AG4E 2QYUA 1MZCA 4EBAA 2P9NG 3AJIA 3SFXA 5A23A 3LY7A 1JCRA 4N39A 4APFA 4AEZC 4AM9A 4GB9A 4LNBA 4UWKA 3R9MA 5ANLA 2IO3C 4HOUA 5G05C 4YNDA 4HOSA 2XPYA 5CCLA 1FPPA 1MHQA 3UUXA 2CHWA 3QARA 3NF1A 3UT8A 1TNZA 3E4BA 5FQ4A 2XRZA 3ZXPA 3CKCA 3LY8A 1IHBA 2KZTA 3GW4A 4DUIA 2WMOA 3PE4A 4B8AA 3D9HA 4K5AB 3FH8A 3ZIMA 3FULA 4BSZB 4UWFA 4ANWA 3S7BA 3Q7AA 4K5BA 1O1TA 4HFGA 3PEVB 3BU8A 5ARFA 3CVLA 4J8SA 3W9GA 4U07A 1SQMA 4HB5A 3Q79A 5BV1A 4I2WA 2P9KG 1OUVA 3HIZA 4GYWA 2Y0BG 5T8IA 4TUUA 5CEDB 3T5XA 4U04A 2PNNA 3LVQE 3CVWA 3LCAA 1S0PA 2NXPA 1E90A 3ZNGA 1OXJA 3PE3A 2YHEA 1HH8A 2X6HA 4XI9A 4LUNU 1FVHA 1PAQA 3CK9A 3B7SA 2XGMA 1IHGA 5CERB 1EF1C 3OXLA 3UINC 1N52A 4C48B 5FT9A 2NC9A 2LNIA 4TXPA 1N94A 3VTYA 1Y6IA 3CVQA 4M3OA 2C2LA 4MBGA 2IJGX 3EHMA 3ZHEB 4HNAD 3LPZA 5EIDA 5FZSA 5CHEE 1TN8A 2E0IA 3GZ2A 3V30A 2CG3A 5T3RA 1PC2A 4XEIG 1EYHA 1S70B 4LNGA 4CDMA 5G05J 2LO6A 2HM8A 2EILE 4DI3A 2WXFA 3ONLA 5AJDA 3JXJA 1HO8A 5FINA 1IQRA 2FEZA 5AIJA 4HS2A 3ZYQA 3FHEA 3I4RB 4F53A 3SNXA 4GTQA 3GZSA 4ZHBA 1PY1A 3D9IA 2VSOE 3VLFA 1E8XA 3ZU7B 1N54A 3PRZA 3URZA 4A63B 3DXKG 4HRLA 3QWPA 3IHVA 3ASOE 2X6IA 1L5JA 4YDOA 1N4SA 1H2UA 5ARGA 3IEGA 4JHRA 4B89A 1BPOA 4AXHA 3NBNB 4I1MA 5JJ6A 3T8MA 3S7DA 4MKTA 5ENNA 5KNHD 3CHOA 3HYMB 3D9KA 1KT1A 3TXNA 2RFAA 2GRMA 3V79K 3D9OA 3UIPC 3BUAA 2DIWA 4CGVA 4JHKA 3CGHA 2DBAA 1QNFA 4J0UA 4WUYA 3X2QE 1E96B 4PH4B 3ASDA 1NL4A 4AY5A 3R7QA 3FUKA 3UMVA 3JUEA 1OCRE 5BPPA 4Y6CA 4XZ4A 2JEKA 3TWXA 1ZU2A 4CDNA 3MA5A
chains in the Genus database with same CATH topology
1MQSA 3UX4A 3Q47B 3FTZA 4GYOA 1UN9A 3FH5A 3QWVA 1WM5A 1UG3A 3CKBA 3ESLA 2VGXA 3Q49B 3RK6A 3JYSA 2FF4A 2X6KA 4ILIA 4LCTA 3PNLB 5C2YA 3FUNA 5BNWA 4OYSA 2KC7A 1JUQA 5LCWC 3U3WA 1HG5A 2X38A 3FUIA 3ZRHA 4KBQA 2WXMA 1OWOA 5J90A 4GA1A 4AIFA 3HVEB 4MS6A 3LVRE 5DIZA 4EZLA 3ASFA 4RG6A 4U0ZA 3LDZA 4O6FA 1NZNA 2WXGA 4XI0A 5EX3A 4GCOA 2IONA 5D0QD 2UWJG 3TL5A 4MRUA 3HDXA 1ZBPA 2VSXE 4RSYA 2LSUA 2MOWA 1HG2A 2CHXA 2WXHA 5LCWJ 1SZAA 1DVPA 3IKOB 3I4GA 2VGYA 4ILHB 3S7FA 4N3CA 2M63A 4GAAA 4KZ0A 3U9WA 4JL0A 1U3CA 2FO7A 3CEQA 2IU1A 3TJPA 4KYOB 4UWHA 4BFRA 4WWOA 4BY6A 5CCMA 4LRZA 2HO1A 2J9QA 4V3IA 5HI7A 5G04C 3CR3A 2R59A 3SI5A 1E8YA 1HF8A 3ZGQA 4GZCA 4A1SA 2YHCA 4ANUA 1IYGA 3FEYA 4H7YA 1H2VC 4Q96A 2AXUA 2J4DA 3Q15A 3PS6A 4GCNA 4LERA 1U3DA 2J4BA 2MHKA 3RKVA 3CVXA 4CGWA 3R9AB 3QOUA 4BT8A 3ZPJA 4XIFA 3DBSA 1P5QA 2P58C 2RD0A 3QK0A 5G04J 2IOLA 4PS3A 4U63A 3ULQA 4I2ZA 4G25A 2LAIA 1YA0A 2MRIA 4Q94A 4J8DA 4JA9A 4HOQA 4PDXA 1Z6TA 3G2WA 3L17A 3QC1A 3CQGB 2I2OA 3ZYMA 1HZ4A 3D9JA 3TG4A 3FH7A 5D0OD 1LF8A 2WXLA 2I6HA 2LSVA 3FEXA 1KLXA 3MZLB 4I1AA 4LEUA 3RJVA 1INZA 2GRLA 4QFVA 3I5PA 4YVQC 2I9CA 2ONDA 4EQFA 4A55A 4K0RA 5JJTA 3B13A 4FHJA 2VQ2A 4UWGA 2AWIA 3MKQB 3FU3A 2XQ0A 3QWWA 3RO3A 3PUKA 2FI7A 2WXKA 2VTBA 3QJZA 4JPSA 4AJWA 4K03A 4GA2A 2OVBA 4UWLA 2OOEA 5E75A 1HS6A 3SGHA 1B89A 1OWMA 4CT0A 4KXKB 4RVBA 3UT7A 1E8ZA 4GZDA 2IF4A 3L13A 4FC8A 4L2YA 1Z3XA 3KEZA 4UQXA 2OVFA 5DBKA 4APOA 2Y4UA 4XE0A 5FQ7A 3CK7A 3MKQA 3C98A 4N2QA 4EBAA 3CLJA 5HQ8A 1TJFA 1FVFA 3I3NA 4FHKA 4WNEA 5C1DA 5A23A 3FTUA 3TGOA 3LY7A 4G23A 4HORA 2AXVA 4J6IA 3IV0A 1QZ2A 2BF0X 4IULA 4N39A 3MJWA 4G11A 3D9PA 4FU3A 4ACLA 1UN8A 3KS2A 3ZN3A 4APFA 4AEZC 3Q4AB 4AM9A 4GB9A 3RU0A 2ILRA 3MV3B 4HOTA 3ML9A 1Z3YA 1HFAA 3GYZA 4UWKA 2X6JA 3NQPA 4GA0A 2C0LA 2WXRA 4IYPA 5ANLA 2V8SE 4JEHA 2XHEA 5KJLA 4XX5A 4N2SA 4HOUA 1FCHA 4JHJA 5G05C 3ZVVA 4YNDA 3NZUA 4U0UA 3SBTB 4HOSA 2KZTB 3U66A 2XPYA 5CCLA 1KT0A 5JHAA 4BTBA 1MHQA 4JC8A 4GZ5A 2CFZA 3ZXSA 4F3VA 4JA7A 3UUXA 4ATGA 1JPLA 2CHWA 3D9MA 3K9IA 3D9LA 3B7TA 3CVPA 3QARA 1VDYA 3QDNA 5AYWD 3NF1A 5G55A 4L23A 3FUHA 2HYZA 3JUIA 3UT8A 3E4BA 2Q7FA 4J8FA 5FQ4A 3BG0B 2XRZA 4B0ZA 3CHRA 4Y6WA 3FU6A 2CHZA 1UJKA 4JXTA 4GMJA 4URKA 2WVIA 3CKCA 4FULA 4WAFA 3BEEA 1A17A 3LY8A 1NP7A 2I1JA 2KZTA 3PH0C 4WWNA 5BV0A 3MA5A 4I9EA 3GW4A 4IRUA 2J49A 2WMOA 3PE4A 4B8AA 3EDTB 4UQYA 3FTWA 3ZEFA 4XKCA 4YVOA 3FH8A 5LOZA 4I6EA 3OXGA 3Q5MA 4F1SA 3ZIMA 3JCKC 3FY4A 1HX8A 3FULA 4A3TA 2L0TB 2XRYA 4UWFA 2VJ8A 5JJ7A 3HVEA 4FJZA 4U8HA 4ANWA 2L6JA 3S7BA 1TJCA 3EIJA 4B94A 2KCKA 3ZW3A 4EZJA 3UT4A 2J08A 4HFGA 4CRWA 5LFAA 4UI9C 4WNGA 3PEVB 5ARFA 5FZRA 3CVLA 4TV3A 4AV7A 4J8SA 2A4ZA 3AS8A 4RG9A 3OTNA 4U07A 1SQMA 2C0MA 4OVVA 4N3BA 3APCA 3B7RL 3G2UA 4KVMA 2GGFA 2WXIA 5BV1A 4OVUA 4DI4A 3OAWA 4I17A 5CMYA 3GZ1A 4I2WA 1OUVA 3ZFWA 3L16A 4FADA 5ANRA 1ELRA 3HIZA 2VSNA 3SHFA 4Q69A 4GYWA 3VLDA 4BX8A 2UY1B 2WXQA 4NRHB 5T8IA 2EQXA 2WQ7A 2YNQA 3FWVA 4I6JA 4FJYA 4TUUA 4BT9A 3L54A 1ELKA 2CFUA 3T5XA 4L1BA 2X6FA 3CQCB 4U04A 3TXMA 4JEUA 5EX0A 3LVQE 1E7VA 3CVWA 2J09A 3L6AA 3WXXA 4CDRA 3LCAA 4E6HA 1S0PA 2NXPA 1E90A 3LS8A 5A7DB 1XGWA 2L0IA 2V4LA 3CVVA 5LP0A 4WNDA 4NQ0A 5EDSA 3PE3A 1NA0A 3B7UX 4HLEA 2YHEA 4N3AA 1HH8A 4GMLA 3CHSA 5AENA 2QY7A 2X6HA 3FTSA 4XI9A 3JQ0A 4AVXA 4LUNU 4EECA 1FVHA 3ENEA 1PAQA 2L9BA 3CK9A 4GU5A 3B7SA 3LY9A 2XGMA 2WQ6A 3ESKA 1IHGA 5FQ8A 4DJAA 2V5FA 5FTPA 2XPIA 4IN3B 2V0PA 2IQCA 1EF1C 3BG1B 3L22A 5FWQA 3OXLA 4ANXA 4UI9K 3U64A 4CEMA 3CVNA 3EHNA 1N52A 2BUGA 2NC9A 5FT9A 3TG5A 2LNIA 1DNPA 4C0MA 2PZIA 3D3MA 3MEKA 3CHMA 4PS7A 3VTYA 4ABNA 3U4TA 1Y6IA 3CVQA 4M3OA 2C2LA 4AOFA 3FDHA 3ASHA 4GZ3A 3FUMA 3MCXA 1TEZA 4FP7A 1W3BA 3KD7A 2IJGX 3EHMA 3ZHEB 4L7TA 5KJNA 2KCVA 3OXFA 3RRUA 2HR2A 2JLBA 3LPZA 3O4ZA 2XPZA 4KVOA 4N5CA 4DLOA 2R17C 5FZSA 3HHMA 5CHEE 5BT1A 3FU0A 1E7UA 4KMOA 4G1TA 2E0IA 3GZ2A 3FFLA 2CG3A 5T3RA 4CCAA 3MYVA 3G2TA 3QNKA 3NZSA 1PC2A 1E8WA 4PUCA 3PVLA 5BW8C 1EYHA 4CDMA 3VLEA 2WXOA 5G05J 2LO6A 2ZU6B 1UJJA 2WXJA 2HM8A 4GZ6A 1HXIA 1GW6A 1NA3A 2BTDA 3ML8A 4U0SA 2KCLA 1EPUA 3P2BA 4D10C 3SZ7A 1OWNA 3FP3A 4DI3A 4KT6B 2WXFA 3ONLA 4TRQA 3PREA 4C9BB 3ONKA 2Y4TA 5AJDA 2WPVA 2XEVA 3P1UA 4KZCA 3LJ3A 4MLPA 3IBEA 4I43A 5JHBA 1HO8A 1UW4B 4B8CB 2YQ8A 3RRMB 2AXZA 1IQRA 2RG8A 3CIAA 2YINA 1SZ9A 2FEZA 1IQUA 3RRNB 4NURA 5LX8A 3PEUB 3TAXA 4J8EA 2QFCA 3KAEA 3N71A 2GW1A 3PZDA 4G2VA 5AIJA 4HS2A 3CVUA 3QB2A 3SFZA 3ZYQA 3AS4A 3EJNA 4WWPA 4FA6A 3MV2B 4GYYA 5T4YA 1OWPA 3FHEA 3PUJA 2CG2A 3I4RB 4ACKA 1JWFA 3CK8A 4F53A 3SNXA 4BWRA 4DLQA 2VYIA 3GZSA 2Y3AA 1PY1A 3D9IA 4GPKA 2VSOE 3FTXA 3VLFA 4AP2A 4P29A 3LXUX 4CT4A 2XGOA 1E8XA 2NSZA 3G2VA 4G26A 4FLBA 3FTYA 5FJYA 4EBAG 2PM6A 3APFA 4UQZA 1N54A 3L08A 3PRZA 4UI9J 5E76A 1H6KA 2WXPA 1WY6A 4JW1A 3CSTA 4HVBA 2WXNA 4ME2A 3URZA 3S2AA 4I1OB 1H2TC 2IFUA 5EKQD 3R7RA 3RO2A 3IHYA 4H7XA 2IOSA 3QWPA 3CV0A 3IHVA 2X6IA 1H19A 5FZQA 1L5JA 3ZYKA 3LYAA 2WM9A 2OV8A 3CHQA 3FUFA 3CVYA 1X5BA 2VTBB 1H2UA 1JWGA 5ARGA 3AU5A 3IEGA 5AJLA 3QKYA 4HXIA 4PS8A 3FU5A 3MGBA 3MKRA 2DCPA 4FLHA 4BX9A 2PL2A 2UY1A 4JHRA 4B89A 1BPOA 4AXHA 2VSYA 2AW6A 2E2EA 4I1MA 5JJ6A 4NACA 5A6CA 1Y8MA 4L2LA 3S7DA 3T8MA 5CMWA 5M72A 4MKTA 5ENNA 4R7LA 4W9RA 3CHOA 3S7JA 2PQNA 3SBSA 2WQHA 3FUDA 3QAQA 4G24A 1QQEA 4WNFA 1ELWA 3HYMB 3T5VA 2A5UA 3AU4A 3D9KA 3FTVA 4A1GA 5BUZA 3CHPA 2XGSA 1KT1A 3TXNA 2LAHA 3AS5A 5KJMA 2KM4A 2PM7A 2PQRA 2GRMA 3PDNA 3D9OA 3VTXA 3LEWA 2DIWA 4F7AA 3CSFA 2X3MA 4CGVA 4JHKA 3CGHA 2DBAA 3O48A 4ILGA 3SF4A 4DK5A 2WB2A 1QNFA 2KATA 4J0UA 3EIQC 4ANVA 4WUYA 5FQ6A 1E96B 4PH4B 3ASDA 4AY5A 4AY6A 3R7QA 3FUJA 3FUKA 3UMVA 4DPRA 5KJKA 4EPZA 4EZKA 4XKBA 1EDUA 2WMNA 2R5SA 2J07A 3ASGA 4BTAA 1WAO1 3APDA 1XNFA 2AVPA 4JZYA 3D9NA 1H0AA 3PNTB 5BPPA 3ZYLA 4E85A 2VGXB 2FBNA 3DPDA 4I6GA 3ZHEA 4Y6CA 3RIBA 4XZ4A 1HU3A 4BSXA 2JEKA 3G2SA 3LKUA 2XCCA 5G2NA 2FULA 2I1KA 5KCMA 5J08A 3MX3A 4JVSA 4A3VA 3FUEA 4C0EA 4I9CA 1ZU2A 3SD5A 2XCBA 3UQ3A 4CDNA 1HE8A 1OWLA 3UPVA 3JQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL A;  2MOW A;  1HG2 A;  3ZYK A;  3ONK A;  3G2U A;  1JWF A;  1MHQ A;  1SZA A;  1EDU A;  5LOZ A;  1XGW A;  2L0I A;  3D9K A;  1JPL A;  3D9M A;  2BF0 X;  1DVP A;  5LP0 A;  3D9L A;  1X5B A;  5CMY A;  1JWG A;  1PY1 A;  3D9I A;  3G2T A;  3D9N A;  1H0A A;  3D9P A;  1VDY A;  1HX8 A;  4FU3 A;  2KM4 A;  4Q94 A;  3ZYL A;  1SZ9 A;  2L0T B;  2QY7 A;  1JUQ A;  3G2W A;  1EYH A;  2DCP A;  1HG5 A;  3D9O A;  3G2V A;  4FLB A;  3ZYM A;  4AVX A;  2DIW A;  3D9J A;  3G2S A;  1LF8 A;  1HFA A;  2LO6 A;  1UJK A;  4JXT A;  1INZ A;  1UJJ A;  1HF8 A;  5J08 A;  4GZD A;  4GZC A;  2V8S E;  4HFG A;  4NAC A;  3LDZ A;  5CMW A;  4Q96 A;  3RRU A;  3ZYQ A;  1ELK A;  3CLJ A; 
#chains in the Genus database with same CATH topology
 1MQS A;  4GTT A;  3FTZ A;  3Q78 A;  2H6H A;  4GYO A;  3CKB A;  2VGX A;  3JYS A;  4LCT A;  3PNL B;  1X81 A;  5EN5 D;  3FUN A;  3UI2 A;  4OYS A;  3BQO A;  1HG5 A;  4KBQ A;  3B7B A;  3HXE A;  3DWL G;  4AIF A;  3HVE B;  3LVR E;  5DIZ A;  4EZL A;  1BI7 B;  3ASF A;  1DCE A;  3HRA A;  3UM2 A;  3HDX A;  2P9I G;  1HG2 A;  2WXH A;  3NOC D;  4ILH B;  3I4G A;  4GAA A;  4KZ0 A;  4JL0 A;  2FO7 A;  4WWO A;  4BY6 A;  1N0Q A;  4ANU A;  2AXU A;  1U3D A;  3RKV A;  1A5E A;  3R9A B;  3SO8 A;  3QOU A;  1UOH A;  4XIF A;  1P5Q A;  3ULQ A;  4G25 A;  2LAI A;  5AAO A;  2MRI A;  4J8D A;  4GPM A;  4PDX A;  3G2W A;  3L17 A;  3CQG B;  3TG4 A;  4LEU A;  2LSV A;  1INZ A;  2P9U G;  3I5P A;  1N95 A;  4A55 A;  5JJT A;  3MKQ B;  1TR4 A;  2FI7 A;  5CEC B;  4TUM A;  4JPS A;  4AJW A;  4BEP A;  3AAA C;  3F6Q A;  2OOE A;  1D9S A;  2EIM E;  5EIB E;  1OCC E;  4KXK B;  4CT0 A;  1MX2 A;  4RVB A;  3UT7 A;  1E8Z A;  2IF4 A;  3L13 A;  3KEZ A;  4APO A;  2OVF A;  2VGE A;  3CLJ A;  1TJF A;  1FVF A;  3I3N A;  3Q7F A;  3ABK E;  5C1D A;  3FTU A;  3TGO A;  1BD8 A;  4G23 A;  3DSV A;  4J6I A;  1MJ0 A;  2XS8 A;  4G11 A;  4ACL A;  5FIO A;  3KS2 A;  3Q4A B;  3RU0 A;  4F6R D;  3ABM E;  3GYZ A;  2RKK A;  2WXR A;  2V8S E;  3KSL A;  4HRN A;  2P9S G;  5KJL A;  2ETB A;  4U0U A;  5CBO A;  4BTB A;  3ZXS A;  4RQI A;  1QYM A;  3B7T A;  1TN6 A;  3QDN A;  4L23 A;  3FUH A;  2GRP B;  4J8F A;  3SQV A;  5ENP D;  2IY0 C;  4DX5 D;  2I1J A;  3PH0 C;  4WWN A;  3DRA A;  4I9E A;  4IRU A;  4UQY A;  3FTW A;  3ZEF A;  4YVO A;  3OXG A;  1JCS A;  3DST A;  3JCK C;  2L0T B;  2VJ8 A;  2H6I A;  4U8H A;  3JXI A;  1TJC A;  3EIJ A;  2KCK A;  3ZW3 A;  4EZJ A;  2J08 A;  4GTR A;  5LFA A;  4UI9 C;  5FZR A;  4TV3 A;  2QC9 A;  3AS8 A;  4RG9 A;  4UUC A;  4GMR A;  1SVX A;  3APC A;  3G2U A;  2GGF A;  1K1B A;  4DI4 A;  2L6B A;  3OAW A;  4I17 A;  5CMY A;  2F0Y A;  1ELR A;  3SHF A;  3VLD A;  2UY1 B;  4NRH B;  2WQ7 A;  2YNQ A;  2JAB A;  3FWV A;  4FJY A;  4BT9 A;  1ELK A;  2Y1L E;  3WXX A;  2IO2 C;  5LP0 A;  4GML A;  5AEN A;  3FTS A;  4EEC A;  3ENE A;  5EIL A;  5FQ8 A;  2XPI A;  4IN3 B;  1D8E A;  2V0P A;  2IQC A;  5FWQ A;  3L22 A;  4UI9 K;  3CVN A;  4ZFH A;  4C0M A;  3MEK A;  4ABN A;  3U4T A;  4AOF A;  2QZA A;  5HS0 A;  4GZ3 A;  3FUM A;  3KD7 A;  2A5E A;  1S63 A;  3PZ1 A;  2R03 A;  4N5C A;  2R17 C;  3HHM A;  5JMN D;  1H6O A;  2J8S D;  3ZKJ A;  4PUC A;  5D2M C;  3PVL A;  3T8K A;  2ZU6 B;  1UJJ A;  4GZ6 A;  4YDW A;  4U8V D;  2KCL A;  5IY5 E;  1NFI E;  1OWN A;  3FP3 A;  5CRU A;  3SZ7 A;  4KT6 B;  4C9B B;  4JB8 P;  3LJ3 A;  5JHB A;  4B8C B;  2RG8 A;  2YIN A;  4YDY A;  5LX8 A;  3PEU B;  3TAX A;  4J8E A;  3PZD A;  4NIK A;  3CVU A;  3QB2 A;  3SFZ A;  5BXO A;  5T4Y A;  5KNG A;  3PUJ A;  4GTO A;  4ACK A;  2VYI A;  2Y3A A;  3T9K A;  4GPK A;  3TWQ A;  2F8X K;  3FTX A;  5FJY A;  2BKK B;  3FTY A;  4UI9 J;  4UQZ A;  3L08 A;  4U7E B;  2WXP A;  1WY6 A;  3CST A;  2WXN A;  2IFU A;  3IHY A;  2B0O E;  2IOS A;  3DPY A;  4BET A;  4GTP A;  2VTB B;  1JWG A;  4PS8 A;  3MGB A;  4FLH A;  1FT1 A;  5M72 A;  1KZO A;  3PZ2 A;  5CMW A;  2V4H C;  2PQN A;  2Y69 E;  4G24 A;  4WNF A;  3EHQ A;  2R2L A;  5KJM A;  2PM7 A;  2PQR A;  4F7A A;  3PZ3 A;  3O48 A;  2WB2 A;  2KAT A;  4ANV A;  5FQ6 A;  2P2C P;  3E37 A;  5KJK A;  3EU5 A;  4BTA A;  1WAO 1;  2AVP A;  3PNT B;  3ZYL A;  1BU9 A;  3RIB A;  3HXF A;  4HBD A;  2XCC A;  5G2N A;  2FUL A;  5KCM A;  3MX3 A;  4F1P A;  2P9P G;  4I9C A;  1YMP A;  3C3R A;  3DSU A;  1HE8 A;  1OWL A;  3V31 A;  1JCQ A;  2ETA A;  1UN9 A;  1WM5 A;  1UG3 A;  3ESL A;  3RK6 A;  4EHM A;  2ZGD A;  2KC7 A;  5ENS D;  3U3W A;  1FT2 A;  3FUI A;  2WXM A;  4MS6 A;  3EHR A;  4U0Z A;  1NZN A;  2WXG A;  4XI0 A;  4GCO A;  4M7C A;  2ION A;  2AJA A;  4TXQ A;  2VSX E;  2CHX A;  1QBQ A;  5LCW J;  2VGY A;  3S7F A;  3C5R A;  3ABL E;  5D66 A;  3CEQ A;  1N11 A;  3TJP A;  4KYO B;  4UWH A;  4BFR A;  5CCM A;  2HO1 A;  4OAU C;  5HI7 A;  1OT8 A;  2YHC A;  5CEA A;  1IYG A;  1MYO A;  4O60 A;  2J4D A;  4LER A;  2MHK A;  3QK0 A;  5G04 J;  2IOL A;  4PS3 A;  4Q94 A;  2P9L G;  1TNO A;  3QC1 A;  2I2O A;  1KLX A;  4QFV A;  3TWW A;  4EQF A;  2XZD G;  2GRR B;  3PUK A;  1O5M A;  3J5Q B;  2OVB A;  2H6G A;  5AN8 A;  1HS6 A;  2ZGG A;  5B1A E;  1OWM A;  5B3S E;  3CK7 A;  3MKQ A;  5BXU A;  5HQ8 A;  4FHK A;  4WNE A;  3TWU A;  3B95 A;  1QZ2 A;  2XEE A;  3ZN3 A;  4HOT A;  2ILR A;  3MV3 B;  3ML9 A;  4HQD A;  1HFA A;  2XZT G;  5AQ7 A;  2X6J A;  3NQP A;  4IYP A;  2C0L A;  5ENO D;  4JEH A;  2XHE A;  4N5Q A;  1MX4 A;  3SBT B;  2MYO A;  2ZIS A;  3U66 A;  5JHA A;  4JC8 A;  4GZ5 A;  2CFZ A;  4F3V A;  3K9I A;  4CZ2 D;  3D9L A;  3CVP A;  5AYW D;  4JD2 G;  2KXP C;  2Q7F A;  4B0Z A;  3CHR A;  4Y6W A;  3FU6 A;  4HI8 A;  4GMJ A;  4URK A;  2WVI A;  3BEE A;  1A17 A;  2V5Q C;  1NP7 A;  3ULY A;  3UM0 A;  1SA4 A;  2J49 A;  4TXR A;  4XKC A;  3DSX A;  4F1S A;  3FY4 A;  2XRY A;  5ENT D;  3DSW A;  2OCC E;  4B94 A;  4CRW A;  1WG0 A;  1N0R A;  4AV7 A;  2A4Z A;  3OTN A;  2C0M A;  4OVV A;  3B7R L;  4KVM A;  1O1R A;  3GZ1 A;  2HE0 A;  5ANR A;  2VSN A;  4BX8 A;  1K1A A;  3UTM A;  3L54 A;  2ETC A;  2CFU A;  3TXM A;  4JEU A;  3L6A A;  4CDR A;  3IXE A;  3EUV A;  2L0I A;  4X8Q A;  4HLL A;  4WND A;  4NQ0 A;  5EDS A;  1MX6 A;  3B7U X;  4HLE A;  3C3Q A;  4N3A A;  1OY3 D;  2QY7 A;  5KWD A;  1TNB A;  2L9B A;  2DYS E;  2F8Y A;  2WQ6 A;  2V5F A;  3RSE G;  4ANX A;  4DX6 D;  3D3M A;  3CHM A;  4PS7 A;  4U96 D;  3FDH A;  3ASH A;  3UKR G;  3MCX A;  1TEZ A;  4FP7 A;  5KJN A;  2KCV A;  3OXF A;  1OCO E;  4O1P A;  3ULE G;  2HR2 A;  2JLB A;  2XPZ A;  3FU0 A;  1E7U A;  1NI1 A;  1TN7 A;  3FFL A;  4CCA A;  1TYQ G;  3MYV A;  3NZS A;  1E8W A;  3VLE A;  1GW6 A;  1NA3 A;  4YDE A;  3ML8 A;  4U0S A;  3P2B A;  5B1B E;  3PRE A;  2Y4T A;  3P1U A;  4KZC A;  2EIN E;  4MLP A;  1UW4 B;  1IQU A;  2LXM A;  2QFC A;  3KAE A;  3N71 A;  4G2V A;  4DX2 A;  4WWP A;  3JQ1 A;  4FA6 A;  3MV2 B;  5KBA A;  2CG2 A;  1JWF A;  4DLQ A;  3C3O A;  4DRX E;  4P29 A;  3LXU X;  4CT4 A;  5ITZ F;  2NSZ A;  3G2V A;  4G26 A;  5ENQ D;  2DWZ A;  2XEH A;  2PM6 A;  3APF A;  5E76 A;  3TWT A;  5EYL A;  4HVB A;  4I1O B;  3R7R A;  4H7X A;  2KBX A;  3CV0 A;  4OAV B;  3HXB A;  3AG1 E;  3ZYK A;  1N4R A;  2WM9 A;  3FUF A;  1X5B A;  3AU5 A;  3C72 A;  3QKY A;  2DCP A;  4BX9 A;  2VSY A;  2AW6 A;  2E2E A;  2LXL A;  2QYJ A;  4QQI A;  1Y8M A;  4HRM B;  3S7J A;  4R7L A;  3SBS A;  2WQH A;  3QAQ A;  1QQE A;  5CBN A;  5AQB A;  3T5V A;  3HG0 D;  2A5U A;  3AU4 A;  2LAH A;  3AS5 A;  3PDN A;  3CSF A;  4DK5 A;  2F37 A;  3EIQ C;  3TWR A;  3Q9U C;  4AY6 A;  3FUJ A;  2R05 A;  4CYM D;  1EDU A;  2WMN A;  2J07 A;  3ASG A;  4JZY A;  2NYJ A;  1H0A A;  3DPD A;  2FBN A;  4G8L A;  4I6G A;  3ZHE A;  1D8D A;  3Q73 A;  2I1K A;  4JVS A;  1SW6 A;  3FUE A;  5CRV A;  2XCB A;  3UQ3 A;  2LUH A;  3UPV A;  4BER A;  3FH5 A;  3QWV A;  4HI9 A;  3ZUV B;  3DEP A;  1JUQ A;  2DZO A;  5LCW C;  2X38 A;  5J90 A;  5D0Q D;  3TL5 A;  1ZBP A;  4RSY A;  3DEO A;  2LSU A;  2MOW A;  2EIJ E;  5AQA A;  3NAW A;  4N3C A;  2IU1 A;  1KPS B;  4LRZ A;  4V3I A;  5G04 C;  3CR3 A;  2R59 A;  3TWS A;  3SI5 A;  1HF8 A;  3SY2 A;  3FEY A;  4H7Y A;  1H2V C;  4Q96 A;  1U2V G;  1BLX B;  4GCN A;  3CVX A;  4BT8 A;  3ZPJ A;  3DBS A;  1LD7 A;  5EYP F;  1YA0 A;  1Z6T A;  4DX7 D;  1HZ4 A;  3D9J A;  4J8Y A;  1LF8 A;  2I6H A;  3FEX A;  3RJV A;  2GRL A;  4YVQ C;  4K0R A;  4FHJ A;  3PZ4 A;  3RO3 A;  3FU3 A;  4GTM A;  2WXK A;  4K03 A;  4GA2 A;  5E75 A;  3SGH A;  1B89 A;  2EIK E;  1DC2 A;  4U8Y D;  4FC8 A;  4UQX A;  3ASN E;  2Y4U A;  4XE0 A;  5FQ7 A;  3C98 A;  4GTV A;  4N2Q A;  4HOR A;  2AXV A;  3IV0 A;  2BF0 X;  4IUL A;  3MJW A;  3D9P A;  4FU3 A;  1UN8 A;  5HRY A;  1Z3Y A;  5ENR D;  4GA0 A;  1IKN D;  4XX5 A;  4N2S A;  1FCH A;  4JHJ A;  3ZVV A;  3NB2 A;  3NZU A;  1K8K G;  2KZT B;  1KT0 A;  2DYR E;  2BED A;  4JA7 A;  4ATG A;  1JPL A;  3D9M A;  1VDY A;  5G55 A;  2HYZ A;  3JUI A;  3BG0 B;  2ZXW E;  2CHZ A;  1UJK A;  4JXT A;  4FUL A;  4WAF A;  4Z68 A;  1LD8 A;  2R02 A;  5BV0 A;  3EDT B;  5LOZ A;  4I6E A;  3Q5M A;  1HX8 A;  4A3T A;  5JJ7 A;  1YYH A;  3HVE A;  4FJZ A;  1S64 A;  2L6J A;  3W9F A;  3UT4 A;  4WNG A;  3TWV A;  2DZN A;  2ZIR A;  4N3B A;  3NOG D;  2WXI A;  4OVU A;  3Q9N C;  3ZFW A;  3J5P A;  3L16 A;  4FAD A;  3UM1 A;  3L9T A;  2BKG A;  4Q69 A;  2OEW A;  2WXQ A;  2EQX A;  3DXM G;  4I6J A;  4L1B A;  2X6F A;  3CQC B;  5EX0 A;  1E7V A;  2J09 A;  4E6H A;  3LS8 A;  5A7D B;  1XGW A;  3CVV A;  2V4L A;  1NA0 A;  3EU9 A;  1OCZ E;  3RAU A;  3E34 A;  3CHS A;  4O1O A;  3JQ0 A;  4AVX A;  4GU5 A;  3LY9 A;  1V55 E;  1IXV A;  3ESK A;  4DJA A;  5FTP A;  1O1S A;  3BG1 B;  3U64 A;  4CEM A;  5JA4 D;  3EHN A;  4K5C A;  4J7W A;  2BUG A;  2GRQ B;  3TG5 A;  3L82 A;  1DNP A;  2PZI A;  4G8K A;  2IEJ A;  1W3B A;  4L9P A;  4L7T A;  1RW2 A;  1ZB1 A;  3RRU A;  3O4Z A;  4KVO A;  5BT1 A;  4KMO A;  4G1T A;  3UIO C;  3V2O A;  3G2T A;  3QNK A;  5BW8 C;  3AG2 E;  2WXO A;  2OEV A;  2WXJ A;  5AQ9 A;  1HXI A;  2BTD A;  3E32 A;  1EPU A;  4D10 C;  3LJN A;  4TRQ A;  3ONK A;  2WPV A;  2XEV A;  3IBE A;  4I43 A;  3UKU G;  2YQ8 A;  1N4P A;  3RRM B;  4U95 D;  1DCQ A;  2AXZ A;  3Q75 A;  3CIA A;  1SZ9 A;  3RRN B;  4NUR A;  3HXD A;  2GW1 A;  3AS4 A;  3EJN A;  4GYY A;  1OWP A;  4B93 B;  3CK8 A;  4BWR A;  3ISM C;  4LNU D;  1TNU A;  4AP2 A;  3DSS A;  2XGO A;  1RZ4 A;  4FLB A;  4EBA G;  1H6K A;  4JW1 A;  4ME2 A;  3S2A A;  1H2T C;  5EKQ D;  3RO2 A;  4LSZ E;  1H19 A;  5FZQ A;  3SFY A;  3LYA A;  2OV8 A;  3CHQ A;  3CVY A;  5AJL A;  4HXI A;  3FU5 A;  3MKR A;  1Z5S C;  2PL2 A;  2UY1 A;  1YCS B;  4NAC A;  5A6C A;  4L2L A;  4W9R A;  3FUD A;  3UM3 A;  1ELW A;  3FTV A;  4A1G A;  5BUZ A;  1LTX A;  3CHP A;  2XGS A;  2KM4 A;  3VTX A;  3LEW A;  2FO1 E;  2X3M A;  2XEN A;  4ILG A;  3SF4 A;  1AP7 A;  1AWC B;  2RFM A;  1N4Q A;  4DPR A;  4EPZ A;  4EZK A;  4XKB A;  2R5S A;  2GRO B;  1SA5 A;  3APD A;  1XNF A;  3D9N A;  2VGX B;  1HU3 A;  4BSX A;  3G2S A;  3LKU A;  1Q2Z A;  5J08 A;  4A3V A;  4C0E A;  3SD5 A;  4E85 A;  3UX4 A;  3Q47 B;  3KSQ A;  3HXC A;  3KEA A;  3Q49 B;  2FF4 A;  1N9A A;  2X6K A;  4ILI A;  1KZP A;  5C2Y A;  4DX1 A;  2H6F A;  5BNW A;  3ZRH A;  1OWO A;  1BI8 B;  3E33 A;  2B6C A;  4GA1 A;  4BES A;  4RLY A;  4RG6 A;  3LDZ A;  4O6F A;  5EX3 A;  3UXG A;  2XS1 A;  2UWJ G;  3AG3 E;  1WDY A;  4MRU A;  1SZA A;  1DVP A;  3IKO B;  4DLO A;  4CGW A;  3U9W A;  2M63 A;  4GTS A;  1U3C A;  1H6P A;  2J9Q A;  4ATZ D;  1V54 E;  5AAR A;  1E8Y A;  4LG6 A;  3ZGQ A;  4GZC A;  4A1S A;  3V2X A;  3Q15 A;  3PS6 A;  2J4B A;  2GRN B;  2P58 C;  2RD0 A;  4U63 A;  4I2Z A;  1G3N B;  4JA9 A;  4HOQ A;  2DVW A;  3ZYM A;  3FH7 A;  5D0O D;  1K3Z D;  2WXL A;  3MZL B;  3E30 A;  1TNY A;  4I1A A;  2I9C A;  2OND A;  3B13 A;  2VQ2 A;  4UWG A;  2AWI A;  2XQ0 A;  3QWW A;  5HKP A;  3WG7 E;  2VTB A;  3QJZ A;  4UWL A;  5H7P A;  4GZD A;  4L2Y A;  1Z3X A;  5DBK A;  3AG4 E;  2QYU A;  1MZC A;  4EBA A;  2P9N G;  3AJI A;  3SFX A;  5A23 A;  3LY7 A;  1JCR A;  4N39 A;  4APF A;  4AEZ C;  4AM9 A;  4GB9 A;  4LNB A;  4UWK A;  3R9M A;  5ANL A;  2IO3 C;  4HOU A;  5G05 C;  4YND A;  4HOS A;  2XPY A;  5CCL A;  1FPP A;  1MHQ A;  3UUX A;  2CHW A;  3QAR A;  3NF1 A;  3UT8 A;  1TNZ A;  3E4B A;  5FQ4 A;  2XRZ A;  3ZXP A;  3CKC A;  3LY8 A;  1IHB A;  2KZT A;  3GW4 A;  4DUI A;  2WMO A;  3PE4 A;  4B8A A;  3D9H A;  4K5A B;  3FH8 A;  3ZIM A;  3FUL A;  4BSZ B;  4UWF A;  4ANW A;  3S7B A;  3Q7A A;  4K5B A;  1O1T A;  4HFG A;  3PEV B;  3BU8 A;  5ARF A;  3CVL A;  4J8S A;  3W9G A;  4U07 A;  1SQM A;  4HB5 A;  3Q79 A;  5BV1 A;  4I2W A;  2P9K G;  1OUV A;  3HIZ A;  4GYW A;  2Y0B G;  5T8I A;  4TUU A;  5CED B;  3T5X A;  4U04 A;  2PNN A;  3LVQ E;  3CVW A;  3LCA A;  1S0P A;  2NXP A;  1E90 A;  3ZNG A;  1OXJ A;  3PE3 A;  2YHE A;  1HH8 A;  2X6H A;  4XI9 A;  4LUN U;  1FVH A;  1PAQ A;  3CK9 A;  3B7S A;  2XGM A;  1IHG A;  5CER B;  1EF1 C;  3OXL A;  3UIN C;  1N52 A;  4C48 B;  5FT9 A;  2NC9 A;  2LNI A;  4TXP A;  1N94 A;  3VTY A;  1Y6I A;  3CVQ A;  4M3O A;  2C2L A;  4MBG A;  2IJG X;  3EHM A;  3ZHE B;  4HNA D;  3LPZ A;  5EID A;  5FZS A;  5CHE E;  1TN8 A;  2E0I A;  3GZ2 A;  3V30 A;  2CG3 A;  5T3R A;  1PC2 A;  4XEI G;  1EYH A;  1S70 B;  4LNG A;  4CDM A;  5G05 J;  2LO6 A;  2HM8 A;  2EIL E;  4DI3 A;  2WXF A;  3ONL A;  5AJD A;  3JXJ A;  1HO8 A;  5FIN A;  1IQR A;  2FEZ A;  5AIJ A;  4HS2 A;  3ZYQ A;  3FHE A;  3I4R B;  4F53 A;  3SNX A;  4GTQ A;  3GZS A;  4ZHB A;  1PY1 A;  3D9I A;  2VSO E;  3VLF A;  1E8X A;  3ZU7 B;  1N54 A;  3PRZ A;  3URZ A;  4A63 B;  3DXK G;  4HRL A;  3QWP A;  3IHV A;  3ASO E;  2X6I A;  1L5J A;  4YDO A;  1N4S A;  1H2U A;  5ARG A;  3IEG A;  4JHR A;  4B89 A;  1BPO A;  4AXH A;  3NBN B;  4I1M A;  5JJ6 A;  3T8M A;  3S7D A;  4MKT A;  5ENN A;  5KNH D;  3CHO A;  3HYM B;  3D9K A;  1KT1 A;  3TXN A;  2RFA A;  2GRM A;  3V79 K;  3D9O A;  3UIP C;  3BUA A;  2DIW A;  4CGV A;  4JHK A;  3CGH A;  2DBA A;  1QNF A;  4J0U A;  4WUY A;  3X2Q E;  1E96 B;  4PH4 B;  3ASD A;  1NL4 A;  4AY5 A;  3R7Q A;  3FUK A;  3UMV A;  3JUE A;  1OCR E;  5BPP A;  4Y6C A;  4XZ4 A;  2JEK A;  3TWX A;  1ZU2 A;  4CDN A;  3MA5 A; 
#chains in the Genus database with same CATH homology
 1MQS A;  3UX4 A;  3Q47 B;  3FTZ A;  4GYO A;  1UN9 A;  3FH5 A;  3QWV A;  1WM5 A;  1UG3 A;  3CKB A;  3ESL A;  2VGX A;  3Q49 B;  3RK6 A;  3JYS A;  2FF4 A;  2X6K A;  4ILI A;  4LCT A;  3PNL B;  5C2Y A;  3FUN A;  5BNW A;  4OYS A;  2KC7 A;  1JUQ A;  5LCW C;  3U3W A;  1HG5 A;  2X38 A;  3FUI A;  3ZRH A;  4KBQ A;  2WXM A;  1OWO A;  5J90 A;  4GA1 A;  4AIF A;  3HVE B;  4MS6 A;  3LVR E;  5DIZ A;  4EZL A;  3ASF A;  4RG6 A;  4U0Z A;  3LDZ A;  4O6F A;  1NZN A;  2WXG A;  4XI0 A;  5EX3 A;  4GCO A;  2ION A;  5D0Q D;  2UWJ G;  3TL5 A;  4MRU A;  3HDX A;  1ZBP A;  2VSX E;  4RSY A;  2LSU A;  2MOW A;  1HG2 A;  2CHX A;  2WXH A;  5LCW J;  1SZA A;  1DVP A;  3IKO B;  3I4G A;  2VGY A;  4ILH B;  3S7F A;  4N3C A;  2M63 A;  4GAA A;  4KZ0 A;  3U9W A;  4JL0 A;  1U3C A;  2FO7 A;  3CEQ A;  2IU1 A;  3TJP A;  4KYO B;  4UWH A;  4BFR A;  4WWO A;  4BY6 A;  5CCM A;  4LRZ A;  2HO1 A;  2J9Q A;  4V3I A;  5HI7 A;  5G04 C;  3CR3 A;  2R59 A;  3SI5 A;  1E8Y A;  1HF8 A;  3ZGQ A;  4GZC A;  4A1S A;  2YHC A;  4ANU A;  1IYG A;  3FEY A;  4H7Y A;  1H2V C;  4Q96 A;  2AXU A;  2J4D A;  3Q15 A;  3PS6 A;  4GCN A;  4LER A;  1U3D A;  2J4B A;  2MHK A;  3RKV A;  3CVX A;  4CGW A;  3R9A B;  3QOU A;  4BT8 A;  3ZPJ A;  4XIF A;  3DBS A;  1P5Q A;  2P58 C;  2RD0 A;  3QK0 A;  5G04 J;  2IOL A;  4PS3 A;  4U63 A;  3ULQ A;  4I2Z A;  4G25 A;  2LAI A;  1YA0 A;  2MRI A;  4Q94 A;  4J8D A;  4JA9 A;  4HOQ A;  4PDX A;  1Z6T A;  3G2W A;  3L17 A;  3QC1 A;  3CQG B;  2I2O A;  3ZYM A;  1HZ4 A;  3D9J A;  3TG4 A;  3FH7 A;  5D0O D;  1LF8 A;  2WXL A;  2I6H A;  2LSV A;  3FEX A;  1KLX A;  3MZL B;  4I1A A;  4LEU A;  3RJV A;  1INZ A;  2GRL A;  4QFV A;  3I5P A;  4YVQ C;  2I9C A;  2OND A;  4EQF A;  4A55 A;  4K0R A;  5JJT A;  3B13 A;  4FHJ A;  2VQ2 A;  4UWG A;  2AWI A;  3MKQ B;  3FU3 A;  2XQ0 A;  3QWW A;  3RO3 A;  3PUK A;  2FI7 A;  2WXK A;  2VTB A;  3QJZ A;  4JPS A;  4AJW A;  4K03 A;  4GA2 A;  2OVB A;  4UWL A;  2OOE A;  5E75 A;  1HS6 A;  3SGH A;  1B89 A;  1OWM A;  4CT0 A;  4KXK B;  4RVB A;  3UT7 A;  1E8Z A;  4GZD A;  2IF4 A;  3L13 A;  4FC8 A;  4L2Y A;  1Z3X A;  3KEZ A;  4UQX A;  2OVF A;  5DBK A;  4APO A;  2Y4U A;  4XE0 A;  5FQ7 A;  3CK7 A;  3MKQ A;  3C98 A;  4N2Q A;  4EBA A;  3CLJ A;  5HQ8 A;  1TJF A;  1FVF A;  3I3N A;  4FHK A;  4WNE A;  5C1D A;  5A23 A;  3FTU A;  3TGO A;  3LY7 A;  4G23 A;  4HOR A;  2AXV A;  4J6I A;  3IV0 A;  1QZ2 A;  2BF0 X;  4IUL A;  4N39 A;  3MJW A;  4G11 A;  3D9P A;  4FU3 A;  4ACL A;  1UN8 A;  3KS2 A;  3ZN3 A;  4APF A;  4AEZ C;  3Q4A B;  4AM9 A;  4GB9 A;  3RU0 A;  2ILR A;  3MV3 B;  4HOT A;  3ML9 A;  1Z3Y A;  1HFA A;  3GYZ A;  4UWK A;  2X6J A;  3NQP A;  4GA0 A;  2C0L A;  2WXR A;  4IYP A;  5ANL A;  2V8S E;  4JEH A;  2XHE A;  5KJL A;  4XX5 A;  4N2S A;  4HOU A;  1FCH A;  4JHJ A;  5G05 C;  3ZVV A;  4YND A;  3NZU A;  4U0U A;  3SBT B;  4HOS A;  2KZT B;  3U66 A;  2XPY A;  5CCL A;  1KT0 A;  5JHA A;  4BTB A;  1MHQ A;  4JC8 A;  4GZ5 A;  2CFZ A;  3ZXS A;  4F3V A;  4JA7 A;  3UUX A;  4ATG A;  1JPL A;  2CHW A;  3D9M A;  3K9I A;  3D9L A;  3B7T A;  3CVP A;  3QAR A;  1VDY A;  3QDN A;  5AYW D;  3NF1 A;  5G55 A;  4L23 A;  3FUH A;  2HYZ A;  3JUI A;  3UT8 A;  3E4B A;  2Q7F A;  4J8F A;  5FQ4 A;  3BG0 B;  2XRZ A;  4B0Z A;  3CHR A;  4Y6W A;  3FU6 A;  2CHZ A;  1UJK A;  4JXT A;  4GMJ A;  4URK A;  2WVI A;  3CKC A;  4FUL A;  4WAF A;  3BEE A;  1A17 A;  3LY8 A;  1NP7 A;  2I1J A;  2KZT A;  3PH0 C;  4WWN A;  5BV0 A;  3MA5 A;  4I9E A;  3GW4 A;  4IRU A;  2J49 A;  2WMO A;  3PE4 A;  4B8A A;  3EDT B;  4UQY A;  3FTW A;  3ZEF A;  4XKC A;  4YVO A;  3FH8 A;  5LOZ A;  4I6E A;  3OXG A;  3Q5M A;  4F1S A;  3ZIM A;  3JCK C;  3FY4 A;  1HX8 A;  3FUL A;  4A3T A;  2L0T B;  2XRY A;  4UWF A;  2VJ8 A;  5JJ7 A;  3HVE A;  4FJZ A;  4U8H A;  4ANW A;  2L6J A;  3S7B A;  1TJC A;  3EIJ A;  4B94 A;  2KCK A;  3ZW3 A;  4EZJ A;  3UT4 A;  2J08 A;  4HFG A;  4CRW A;  5LFA A;  4UI9 C;  4WNG A;  3PEV B;  5ARF A;  5FZR A;  3CVL A;  4TV3 A;  4AV7 A;  4J8S A;  2A4Z A;  3AS8 A;  4RG9 A;  3OTN A;  4U07 A;  1SQM A;  2C0M A;  4OVV A;  4N3B A;  3APC A;  3B7R L;  3G2U A;  4KVM A;  2GGF A;  2WXI A;  5BV1 A;  4OVU A;  4DI4 A;  3OAW A;  4I17 A;  5CMY A;  3GZ1 A;  4I2W A;  1OUV A;  3ZFW A;  3L16 A;  4FAD A;  5ANR A;  1ELR A;  3HIZ A;  2VSN A;  3SHF A;  4Q69 A;  4GYW A;  3VLD A;  4BX8 A;  2UY1 B;  2WXQ A;  4NRH B;  5T8I A;  2EQX A;  2WQ7 A;  2YNQ A;  3FWV A;  4I6J A;  4FJY A;  4TUU A;  4BT9 A;  3L54 A;  1ELK A;  2CFU A;  3T5X A;  4L1B A;  2X6F A;  3CQC B;  4U04 A;  3TXM A;  4JEU A;  5EX0 A;  3LVQ E;  1E7V A;  3CVW A;  2J09 A;  3L6A A;  3WXX A;  4CDR A;  3LCA A;  4E6H A;  1S0P A;  2NXP A;  1E90 A;  3LS8 A;  5A7D B;  1XGW A;  2L0I A;  2V4L A;  3CVV A;  5LP0 A;  4WND A;  4NQ0 A;  5EDS A;  3PE3 A;  1NA0 A;  3B7U X;  4HLE A;  2YHE A;  4N3A A;  1HH8 A;  4GML A;  3CHS A;  5AEN A;  2QY7 A;  2X6H A;  3FTS A;  4XI9 A;  3JQ0 A;  4AVX A;  4LUN U;  4EEC A;  1FVH A;  3ENE A;  1PAQ A;  2L9B A;  3CK9 A;  4GU5 A;  3B7S A;  3LY9 A;  2XGM A;  2WQ6 A;  3ESK A;  1IHG A;  5FQ8 A;  4DJA A;  2V5F A;  5FTP A;  2XPI A;  4IN3 B;  2V0P A;  2IQC A;  1EF1 C;  3BG1 B;  3L22 A;  5FWQ A;  3OXL A;  4ANX A;  4UI9 K;  3U64 A;  4CEM A;  3CVN A;  3EHN A;  1N52 A;  2BUG A;  2NC9 A;  5FT9 A;  3TG5 A;  2LNI A;  1DNP A;  4C0M A;  2PZI A;  3D3M A;  3MEK A;  3CHM A;  4PS7 A;  3VTY A;  4ABN A;  3U4T A;  1Y6I A;  3CVQ A;  4M3O A;  2C2L A;  4AOF A;  3FDH A;  3ASH A;  4GZ3 A;  3FUM A;  3MCX A;  1TEZ A;  4FP7 A;  1W3B A;  3KD7 A;  2IJG X;  3EHM A;  3ZHE B;  4L7T A;  5KJN A;  2KCV A;  3OXF A;  3RRU A;  2HR2 A;  2JLB A;  3LPZ A;  3O4Z A;  2XPZ A;  4KVO A;  4N5C A;  4DLO A;  2R17 C;  5FZS A;  3HHM A;  5CHE E;  5BT1 A;  3FU0 A;  1E7U A;  4KMO A;  4G1T A;  2E0I A;  3GZ2 A;  3FFL A;  2CG3 A;  5T3R A;  4CCA A;  3MYV A;  3G2T A;  3QNK A;  3NZS A;  1PC2 A;  1E8W A;  4PUC A;  3PVL A;  5BW8 C;  1EYH A;  4CDM A;  3VLE A;  2WXO A;  5G05 J;  2LO6 A;  2ZU6 B;  1UJJ A;  2WXJ A;  2HM8 A;  4GZ6 A;  1HXI A;  1GW6 A;  1NA3 A;  2BTD A;  3ML8 A;  4U0S A;  2KCL A;  1EPU A;  3P2B A;  4D10 C;  3SZ7 A;  1OWN A;  3FP3 A;  4DI3 A;  4KT6 B;  2WXF A;  3ONL A;  4TRQ A;  3PRE A;  4C9B B;  3ONK A;  2Y4T A;  5AJD A;  2WPV A;  2XEV A;  3P1U A;  4KZC A;  3LJ3 A;  4MLP A;  3IBE A;  4I43 A;  5JHB A;  1HO8 A;  1UW4 B;  4B8C B;  2YQ8 A;  3RRM B;  2AXZ A;  1IQR A;  2RG8 A;  3CIA A;  2YIN A;  1SZ9 A;  2FEZ A;  1IQU A;  3RRN B;  4NUR A;  5LX8 A;  3PEU B;  3TAX A;  4J8E A;  2QFC A;  3KAE A;  3N71 A;  2GW1 A;  3PZD A;  4G2V A;  5AIJ A;  4HS2 A;  3CVU A;  3QB2 A;  3SFZ A;  3ZYQ A;  3AS4 A;  3EJN A;  4WWP A;  4FA6 A;  3MV2 B;  4GYY A;  5T4Y A;  1OWP A;  3FHE A;  3PUJ A;  2CG2 A;  3I4R B;  4ACK A;  1JWF A;  3CK8 A;  4F53 A;  3SNX A;  4BWR A;  4DLQ A;  2VYI A;  3GZS A;  2Y3A A;  1PY1 A;  3D9I A;  4GPK A;  2VSO E;  3FTX A;  3VLF A;  4AP2 A;  4P29 A;  3LXU X;  4CT4 A;  2XGO A;  1E8X A;  2NSZ A;  3G2V A;  4G26 A;  4FLB A;  3FTY A;  5FJY A;  4EBA G;  2PM6 A;  3APF A;  4UQZ A;  1N54 A;  3L08 A;  3PRZ A;  4UI9 J;  5E76 A;  1H6K A;  2WXP A;  1WY6 A;  4JW1 A;  3CST A;  4HVB A;  2WXN A;  4ME2 A;  3URZ A;  3S2A A;  4I1O B;  1H2T C;  2IFU A;  5EKQ D;  3R7R A;  3RO2 A;  3IHY A;  4H7X A;  2IOS A;  3QWP A;  3CV0 A;  3IHV A;  2X6I A;  1H19 A;  5FZQ A;  1L5J A;  3ZYK A;  3LYA A;  2WM9 A;  2OV8 A;  3CHQ A;  3FUF A;  3CVY A;  1X5B A;  2VTB B;  1H2U A;  1JWG A;  5ARG A;  3AU5 A;  3IEG A;  5AJL A;  3QKY A;  4HXI A;  4PS8 A;  3FU5 A;  3MGB A;  3MKR A;  2DCP A;  4FLH A;  4BX9 A;  2PL2 A;  2UY1 A;  4JHR A;  4B89 A;  1BPO A;  4AXH A;  2VSY A;  2AW6 A;  2E2E A;  4I1M A;  5JJ6 A;  4NAC A;  5A6C A;  1Y8M A;  4L2L A;  3S7D A;  3T8M A;  5CMW A;  5M72 A;  4MKT A;  5ENN A;  4R7L A;  4W9R A;  3CHO A;  3S7J A;  2PQN A;  3SBS A;  2WQH A;  3FUD A;  3QAQ A;  4G24 A;  1QQE A;  4WNF A;  1ELW A;  3HYM B;  3T5V A;  2A5U A;  3AU4 A;  3D9K A;  3FTV A;  4A1G A;  5BUZ A;  3CHP A;  2XGS A;  1KT1 A;  3TXN A;  2LAH A;  3AS5 A;  5KJM A;  2KM4 A;  2PM7 A;  2PQR A;  2GRM A;  3PDN A;  3D9O A;  3VTX A;  3LEW A;  2DIW A;  4F7A A;  3CSF A;  2X3M A;  4CGV A;  4JHK A;  3CGH A;  2DBA A;  3O48 A;  4ILG A;  3SF4 A;  4DK5 A;  2WB2 A;  1QNF A;  2KAT A;  4J0U A;  3EIQ C;  4ANV A;  4WUY A;  5FQ6 A;  1E96 B;  4PH4 B;  3ASD A;  4AY5 A;  4AY6 A;  3R7Q A;  3FUJ A;  3FUK A;  3UMV A;  4DPR A;  5KJK A;  4EPZ A;  4EZK A;  4XKB A;  1EDU A;  2WMN A;  2R5S A;  2J07 A;  3ASG A;  4BTA A;  1WAO 1;  3APD A;  1XNF A;  2AVP A;  4JZY A;  3D9N A;  1H0A A;  3PNT B;  5BPP A;  3ZYL A;  4E85 A;  2VGX B;  2FBN A;  3DPD A;  4I6G A;  3ZHE A;  4Y6C A;  3RIB A;  4XZ4 A;  1HU3 A;  4BSX A;  2JEK A;  3G2S A;  3LKU A;  2XCC A;  5G2N A;  2FUL A;  2I1K A;  5KCM A;  5J08 A;  3MX3 A;  4JVS A;  4A3V A;  3FUE A;  4C0E A;  4I9C A;  1ZU2 A;  3SD5 A;  2XCB A;  3UQ3 A;  4CDN A;  1HE8 A;  1OWL A;  3UPV A;  3JQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...