2IO3C

Crystal structure of human senp2 in complex with rangap1-sumo-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESSSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
molecule keywords Sentrin-specific protease 2
total genus 43
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2io3C00
5D2MC 1KPSB 3UIPC 2GRPB 2GRNB 2GRRB 2GROB 1Z5SC 2IO2C 2GRQB 3UIOC 3UINC 2IY0C 2IO3C
chains in the Genus database with same CATH superfamily
1TNOA 2DWZA 4BT8A 4BTAA 2I1KA 3PDNA 1SA5A 4QFVA 4KVOA 4OVVA 3B95A 3CHPA 4HQDA 3D9OA 2WXIA 3D9HA 4BESA 3JCKC 1N0QA 2X6HA 3CQGB 1MX2A 3CVUA 1EPUA 4I9CA 3KAEA 3DPYA 3AG2E 3HIZA 3LDZA 1BU9A 4F6RD 3Q75A 4JEUA 3HG0D 1ZBPA 3DSSA 5AJLA 2X3MA 4YDWA 5G04C 5AJDA 3SNXA 4HFGA 3ZPJA 4DRXE 2H6FA 2YHEA 5B3SE 3QARA 4M7CA 4U95D 3UM0A 1SVXA 1OCRE 5ENTD 5EKQD 2HE0A 4J8SA 3ULQA 3EJNA 5KNGA 1S0PA 2P9NG 4JHRA 3ULEG 3CV0A 4UWFA 5ENPD 1TNZA 1JWGA 4I2ZA 2AJAA 3PZ2A 2X6IA 4CZ2D 3UT7A 2LUHA 3HXBA 3QOUA 1K8KG 3NAWA 4DX1A 3FULA 3OXGA 5ARGA 3NZUA 4L23A 2IONA 3PE3A 4GTMA 4GTTA 1EDUA 5JJTA 4F1PA 2FULA 4WNEA 4F1SA 4HOTA 1DCQA 1HXIA 4WAFA 2H6HA 3B7UX 2IEJA 2XGSA 3AS8A 3UINC 2XHEA 2LXLA 4J8FA 1W3BA 3O4ZA 4I43A 2WXFA 3TWSA 4YDOA 3CSTA 1X5BA 3EHMA 2H6IA 4HRMB 3ZU7B 3CVNA 4JA7A 2GW1A 1OWMA 1V54E 5CCMA 4G11A 3LY9A 2XCCA 4DI3A 3C72A 4L1BA 3ZNGA 3SFYA 4XI9A 3QWPA 3NOCD 3GZ1A 4GTOA 2XGOA 3E4BA 4DUIA 3E37A 1UG3A 1FVHA 3P1UA 3DSTA 3NBNB 2KM4A 4K0RA 3HVEB 3I4RB 4ANVA 5G04J 3L22A 4WNFA 3U9WA 1E90A 3EIJA 2VYIA 4FADA 4N2SA 3TG4A 2GRQB 2ZU6B 3FWVA 5LX8A 1Y8MA 3JYSA 2VSYA 2J49A 5AARA 3TJPA 4E85A 4U0SA 5HI7A 4CT4A 4F7AA 3V31A 2EINE 2NXPA 3MKRA 3JXIA 4J6IA 3ZXPA 1NA3A 3TWRA 4GPMA 4DJAA 1BI7B 4B94A 2QC9A 2IO2C 5ENRD 4BERA 2EIJE 3UIPC 2R59A 4TXPA 4A55A 5G2NA 4ABNA 3C3OA 4PS3A 4YDEA 3PNTB 4O1PA 3P2BA 5T3RA 2AXUA 1WDYA 3ZXSA 4XKBA 5ENOD 2MOWA 3FTVA 1LD8A 4YVOA 4FLHA 2E2EA 2KATA 2NYJA 1KT1A 4GMRA 5J90A 3ZRHA 2F8XK 3FTUA 3DSXA 3PZDA 3LVQE 1UJJA 4DX7D 3GW4A 2J07A 4U8YD 1HO8A 5T8IA 3AG4E 4L9PA 1OUVA 3ASHA 1MZCA 3HXFA 2R17C 4GA0A 3F6QA 5LFAA 3L82A 3O48A 4GTRA 3CLJA 4HI8A 1TJCA 3OTNA 2BEDA 5AIJA 4DK5A 3FH5A 4WNGA 2UY1B 1UW4B 3CK8A 5D66A 2F0YA 3UXGA 4HRNA 2WXJA 1JWFA 2ZXWE 3ZEFA 4CT0A 2R2LA 3LY7A 3ZHEB 1N94A 3E34A 4GTVA 3PZ3A 2X38A 4G2VA 4UI9J 4TXQA 4C0EA 1D8EA 4RG6A 5CMWA 2EILE 3FUEA 2VGEA 3L16A 3RIBA 4NIKA 1MJ0A 3L17A 4LNUD 1O1RA 2OEWA 4BEPA 3ZYQA 2B0OE 2P9LG 4ILHB 5A7DB 4APFA 3CVWA 3PS6A 1UJKA 3DSVA 2HYZA 2R05A 4PDXA 2EIKE 4ATGA 3CVVA 1KZOA 2J4DA 4DI4A 3TGOA 3SGHA 2WPVA 2QZAA 3APDA 3FTSA 2XQ0A 1H6OA 3GZ2A 4CEMA 2X6KA 1N54A 2H6GA 4BX8A 3RO2A 3HXCA 1Q2ZA 2WXPA 4IRUA 2ZIRA 3AG1E 2WQ6A 2AXVA 3D9LA 3TWWA 3TAXA 3C5RA 5BPPA 4BX9A 1X81A 2A5UA 4AEZC 3LJNA 3CHOA 4Y6CA 3TXNA 1SQMA 1KZPA 3DXMG 1BLXB 4HS2A 3VTYA 2DZOA 3UIOC 3RJVA 3B7RL 4U04A 3SBTB 3QB2A 3L9TA 5A23A 3TXMA 2FF4A 2XZTG 4GMLA 4TV3A 1H6KA 5AQAA 3SQVA 3D9PA 1FCHA 2AW6A 2WXKA 2R5SA 4WWPA 5FJYA 3ZGQA 2WMOA 3QDNA 4ANWA 2VTBB 3FU0A 4GZ6A 5EIDA 1D9SA 3HXDA 2WXMA 3Q9UC 2WXNA 4K5CA 4JHKA 5EYPF 3ML8A 2YQ8A 3IKOB 3T8KA 1IYGA 2XPYA 3CHSA 3R9MA 3RU0A 1QQEA 2WM9A 5ARFA 4I6GA 2J09A 4LNBA 2XS8A 4ACLA 3T8MA 2DZNA 4B93B 2GRNB 4WWOA 4XE0A 3Q47B 3ULYA 2IJGX 3KEZA 2VGYA 3IHYA 4HI9A 4B0ZA 3BUAA 2PNNA 4AP2A 2ETBA 2GRLA 2XPIA 5CBOA 2J9QA 3LJ3A 5JJ6A 3WG7E 3LXUX 4LCTA 4FU3A 4GU5A 3I3NA 1MHQA 3CKCA 4APOA 3EDTB 1N4PA 3FUDA 4B8CB 1EYHA 4XI0A 2OVFA 2RFAA 2PQNA 5E75A 1SZAA 3DEPA 3JQ1A 3BEEA 2XRZA 2LNIA 5FZQA 4GZ3A 1SZ9A 4RQIA 1B89A 1BI8B 3MKQA 3TWVA 4NRHB 4N3AA 3I4GA 1N4QA 1SW6A 3FY4A 1N4SA 2PM7A 1TN7A 3LKUA 4RLYA 1JUQA 1WAO1 2VSOE 3DRAA 3ASDA 3PREA 4ACKA 4GZDA 3ABKE 4FHJA 2XZDG 5AQ9A 3W9FA 2PL2A 3DSUA 4PH4B 1KLXA 3JQ0A 4FJZA 5KJNA 2WXRA 2RG8A 4J7WA 2X6JA 3S7DA 1WM5A 4I1MA 2DYSE 2IQCA 3QNKA 1U3DA 1OCOE 3SFXA 4JEHA 2Y69E 4A1SA 5FQ7A 2P58C 4GCNA 2BKKB 4YDYA 1U2VG 1HZ4A 4J0UA 1S70B 1JCQA 3BQOA 1MYOA 2F8YA 4ANXA 2KBXA 3FUJA 4GMJA 2Y0BG 5C1DA 4AVXA 2C2LA 2HR2A 3HDXA 2AXZA 2EQXA 4U96D 2V0PA 4FJYA 3NF1A 1HX8A 4B8AA 3ZIMA 5M72A 1E8WA 2GROB 4JL0A 5HKPA 1BPOA 1E96B 1TJFA 4FHKA 2L0TB 5ANRA 2PZIA 3UT8A 1N52A 1WY6A 2NSZA 3FUHA 3DSWA 1HH8A 1N9AA 1OXJA 1TNYA 3KEAA 2WMNA 5ENSD 2WXOA 3DPDA 3L6AA 5CMYA 3SBSA 1IQUA 3EU5A 4EECA 3HXEA 2CFZA 4GA2A 3ZW3A 2AVPA 4HOUA 3MV2B 5JJ7A 4Z68A 4ILIA 5KJKA 1IQRA 5FQ8A 2FI7A 2P9KG 4JZYA 4N3CA 4AV7A 1NA0A 1UN8A 5BXUA 3ESKA 4TXRA 3LS8A 2B6CA 2CHXA 4JD2G 4O6FA 4BSXA 2XEVA 4YVQC 3R7RA 4NURA 1AWCB 3LYAA 1GW6A 2YHCA 3LY8A 3QK0A 2Q7FA 3FU5A 3UQ3A 4FULA 4EZKA 3AS4A 4FP7A 3T5XA 2LAHA 2WVIA 1Z3YA 4NACA 5B1BE 3LPZA 1DCEA 3G2TA 3UI2A 3ESLA 3KSQA 3J5PA 4G26A 4ILGA 2P9SG 2GRRB 4LEUA 1E8YA 3UKUG 3HHMA 1OWPA 4XX5A 4PUCA 4U8VD 3KSLA 1N4RA 5FINA 3ABLE 5DBKA 2VTBA 4XIFA 4JW1A 4GA1A 2QY7A 3NOGD 3IEGA 3EU9A 3Q73A 3J5QB 2CG2A 3NQPA 4FLBA 3MYVA 2Y4UA 4TUMA 2ZISA 4MKTA 2I1JA 3EHNA 2GGFA 3WXXA 1ELRA 3ZKJA 4UI9C 2V4HC 1A5EA 4CRWA 3PZ1A 4J8EA 2GRMA 2VSXE 2UWJG 4BY6A 4B89A 4HB5A 1EF1C 3V79K 3URZA 3RRUA 2AWIA 1Y6IA 3ABME 1DC2A 3PUJA 3KS2A 4C9BB 1MX4A 3CQCB 4KBQA 2DIWA 2QYUA 5JHAA 3MCXA 3AU5A 5FZRA 1OCCE 5EIBE 1D8DA 3ZYMA 3BG0B 4BETA 1TYQG 3JUIA 4HNAD 3FHEA 1TEZA 4JPSA 2J4BA 2BKGA 4HLLA 1PY1A 3FTYA 3Q9NC 4N39A 4AIFA 1UN9A 3MJWA 4G23A 3UUXA 2JLBA 3ZN3A 1N0RA 3ONLA 4C0MA 2VGXA 3SI5A 5D0OD 4AXHA 2XRYA 1QBQA 4ANUA 5BV1A 2L9BA 2L6JA 2Y3AA 4LSZE 4LUNU 5DIZA 4PS7A 4GTSA 1E7VA 1HE8A 4CDRA 1HF8A 5CBNA 2DYRE 3CVYA 1DNPA 5CRVA 3D9IA 3ONKA 5KWDA 5CCLA 1U3CA 1S63A 5KJLA 2I6HA 4QQIA 4G25A 4HLEA 4ATZD 4KXKB 2IOLA 4KT6B 3FH8A 2IOSA 3VLEA 3QAQA 5FTPA 3FUNA 4GTPA 2PM6A 2RKKA 4BWRA 3L54A 4AJWA 1TR4A 1TN6A 3Q5MA 4DPRA 3TWTA 4ME2A 4TUUA 3E33A 4N3BA 4U0ZA 3GYZA 3QWVA 4D10C 3FUIA 2JABA 3IXEA 3OAWA 4UI9K 2ZGDA 3K9IA 3QKYA 3HVEA 3AG3E 1YA0A 3D9KA 1ELWA 2RFMA 2R03A 4FC8A 4AOFA 3Q79A 4A3VA 4G1TA 2CHZA 4JC8A 2CHWA 4RG9A 2P2CP 3ASOE 3PRZA 4JXTA 3SHFA 4UQYA 4E6HA 2UY1A 1H2VC 5D0QD 3G2VA 4N2QA 4HORA 3LVRE 2P9PG 5JA4D 1OWNA 4UWLA 3BU8A 5G05J 3ENEA 5FT9A 1TNBA 3RAUA 2LAIA 4U07A 4EZJA 4A3TA 2WB2A 3E30A 2FO7A 4I2WA 4EZLA 5KNHD 4EPZA 4V3IA 4CGVA 2XGMA 1HFAA 4BTBA 2XEEA 5JHBA 4O1OA 4AY5A 1TN8A 1MX6A 4UQZA 3FUFA 5CRUA 3APCA 3CVLA 4HOQA 3APFA 3PNLB 3MX3A 4CDNA 4A1GA 4W9RA 5IY5E 2FO1E 3HYMB 4RSYA 4IULA 2KCKA 4XEIG 3PZ4A 3EUVA 1Z5SC 4UWHA 3ZVVA 2KZTB 1JCRA 1FPPA 2KXPC 3L08A 2WXGA 3FTWA 3ZFWA 2OCCE 2A5EA 1DVPA 4U8HA 4GTQA 1JPLA 5BXOA 2BUGA 3CHMA 5AQ7A 1OWLA 5ENNA 3TL5A 1N11A 3PE4A 1ZB1A 3I5PA 3G2SA 2HO1A 2R02A 3S7FA 4I1OB 1ELKA 1AP7A 3PVLA 2I2OA 2J8SD 3OXFA 3DWLG 1IKND 4K5BA 4G8LA 2XCBA 2ETAA 5AQBA 4DX5D 3FDHA 3Q4AB 5FZSA 2OV8A 3NZSA 3Q7AA 4HVBA 1O5MA 4KZCA 4Q94A 4JB8P 1KT0A 3ZYKA 1TNUA 3DXKG 3AS5A 1INZA 3AAAC 4UUCA 5CEAA 2VGXB 5FQ6A 4EHMA 1HG2A 4DLQA 3QC1A 3CVPA 3CEQA 2VQ2A 3D9NA 2WXQA 4GB9A 4I6EA 1H6PA 3W9GA 3Q78A 5G05C 3CIAA 2OEVA 2WQ7A 4H7YA 4ZFHA 4F3VA 2KC7A 2ZGGA 1MQSA 3CR3A 4U63A 4TRQA 5KCMA 2EIME 3D3MA 5JMND 1NP7A 4L2LA 3ML9A 3CHRA 4GYYA 2XPZA 3TG5A 4CCAA 4AY6A 4KZ0A 3D9MA 3CVXA 1P5QA 4BFRA 2JEKA 3JUEA 4R7LA 3DEOA 5CEDB 2LSVA 4G24A 1H2TC 4DX6D 5CHEE 1YYHA 4RVBA 1E8XA 2M63A 3AU4A 2L0IA 1Z3XA 5BW8C 5LCWJ 3ASFA 5J08A 3R9AB 4UWGA 3CGHA 4I6JA 3U66A 1N95A 5LCWC 4A63B 3SFZA 3KD7A 4G8KA 3EHQA 1RZ4A 3ASGA 2RD0A 5BV0A 2XS1A 1ZU2A 1FVFA 5CERB 5HRYA 3IHVA 4GAAA 2Y1LE 1LTXA 5CECB 3UX4A 2MYOA 4OAVB 3V30A 2IU1A 4GCOA 5BT1A 2V8SE 5ITZF 3FH7A 4ZHBA 1YMPA 4HOSA 2QYJA 4CYMD 2ILRA 4C48B 4HXIA 1IHBA 2OVBA 2HM8A 5EN5D 4MLPA 4I9EA 2PQRA 3S2AA 4CDMA 4LRZA 1FT2A 1E7UA 4MBGA 3MZLB 1S64A 1PC2A 4MS6A 2BTDA 5A6CA 2OOEA 1XNFA 5ANLA 2GRPB 4LERA 3TWQA 4BSZB 3G2UA 3L13A 2KCLA 3DBSA 3LCAA 5EDSA 4GZ5A 2YNQA 2FEZA 3SD5A 4Q69A 1FT1A 1QNFA 5LP0A 2CFUA 2V5QC 4EBAA 3V2XA 1HU3A 5HQ8A 2P9UG 1YCSB 2FBNA 3X2QE 4H7XA 3VTXA 3SZ7A 3FTZA 2IFUA 2MRIA 3SO8A 4DX2A 4DLOA 4WWNA 3FU6A 4IYPA 4M3OA 5D2MC 3C98A 5ENQD 2VSNA 5HS0A 2E0IA 2IF4A 3FEXA 1K3ZD 3RKVA 3B7BA 5T4YA 3AJIA 5KBAA 1O1TA 3UT4A 3FP3A 2CG3A 2X6FA 2BF0X 5EX0A 3OXLA 3S7JA 4O60A 4Y6WA 3V2OA 3FFLA 3UM1A 1JCSA 1L5JA 3CKBA 5H7PA 2NC9A 5B1AE 3UM2A 4EBAG 3ISMC 4MRUA 4BT9A 2XEHA 4AM9A 5G55A 3CK7A 1OT8A 1VDYA 3PEUB 3FU3A 4WUYA 5AN8A 1UOHA 2DBAA 3RK6A 2I9CA 3CSFA 4L7TA 1QYMA 1HS6A 2WXLA 4J8DA 1RW2A 1OCZE 2QFCA 4JA9A 4UQXA 4XZ4A 4Q96A 4L2YA 3ZYLA 3E32A 2WQHA 1O1SA 2WXHA 4U0UA 3UPVA 1IXVA 1WG0A 3TWUA 3SF4A 3R7QA 1QZ2A 2Y4TA 3U3WA 3Q15A 3MV3B 5BNWA 2C0MA 4K03A 4KVMA 3MGBA 4LG6A 1IHGA 3FUMA 2KCVA 2IO3C 3EIQC 1LF8A 3EHRA 3FEYA 4JVSA 1LD7A 2YINA 3D9JA 3SY2A 3FUKA 5LOZA 3QWWA 4J8YA 3JXJA 2J08A 4KMOA 1H19A 3C3RA 2ONDA 3CK9A 3RRMB 1OY3D 5AYWD 3UKRG 4OVUA 3C3QA 2IY0C 3QJZA 5EILA 5EX3A 4HRLA 3VLDA 4HBDA 3ZHEA 4JHJA 5EYLA 3CVQA 2V4LA 3CHQA 2ETCA 3U4TA 1HG5A 2DVWA 3NB2A 3MKQB 3B13A 3IV0A 2LSUA 3UMVA 5AENA 2F37A 3B7SA 3UTMA 3Q7FA 3PEVB 1NZNA 1NL4A 5FWQA 4UWKA 3N71A 4P29A 1E8ZA 3BG1B 1OWOA 5C2YA 1A17A 1NFIE 2DCPA 3GZSA 4GYOA 4GYWA 2KZTA 4I1AA 1NI1A 4KYOB 3S7BA 4NQ0A 2V5FA 3PUKA 1V55E 3IBEA 3G2WA 4PS8A 3RO3A 1KPSB 4OAUC 2LO6A 5KJMA 3VLFA 1BD8A 2XENA 4N5CA 1K1BA 1G3NB 3RRNB 4K5AB 3LEWA 4F53A 4GPKA 2P9IG 5FQ4A 4I17A 3HRAA 3T5VA 4U7EB 5E76A 3ASNE 3UM3A 1H0AA 2LXMA 4OYSA 4XKCA 5BUZA 4URKA 1Z6TA 2MHKA 2VJ8A 3FTXA 4LNGA 3PH0C 4YNDA 3TWXA 4FA6A 1SA4A 5AAOA 4EQFA 1H2UA 4IN3B 3Q49B 3B7TA 3MEKA 1XGWA 3T9KA 1PAQA 5FIOA 4GZCA 4N5QA 2A4ZA 2L6BA 4WNDA 4X8QA 1K1AA 4CGWA 3MA5A 3U64A 3RSEG 2C0LA 3ZUVB
chains in the Genus database with same CATH topology
5D2MC 1KPSB 3UIPC 2GRPB 2GRNB 2GRRB 2GROB 1Z5SC 2IO2C 2GRQB 3UIOC 3UINC 2IY0C 2IO3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2M C;  1KPS B;  3UIP C;  2GRP B;  2GRN B;  2GRR B;  2GRO B;  1Z5S C;  2IO2 C;  2GRQ B;  3UIO C;  3UIN C;  2IY0 C;  2IO3 C; 
#chains in the Genus database with same CATH topology
 1TNO A;  2DWZ A;  4BT8 A;  4BTA A;  2I1K A;  3PDN A;  1SA5 A;  4QFV A;  4KVO A;  4OVV A;  3B95 A;  3CHP A;  4HQD A;  3D9O A;  2WXI A;  3D9H A;  4BES A;  3JCK C;  1N0Q A;  2X6H A;  3CQG B;  1MX2 A;  3CVU A;  1EPU A;  4I9C A;  3KAE A;  3DPY A;  3AG2 E;  3HIZ A;  3LDZ A;  1BU9 A;  4F6R D;  3Q75 A;  4JEU A;  3HG0 D;  1ZBP A;  3DSS A;  5AJL A;  2X3M A;  4YDW A;  5G04 C;  5AJD A;  3SNX A;  4HFG A;  3ZPJ A;  4DRX E;  2H6F A;  2YHE A;  5B3S E;  3QAR A;  4M7C A;  4U95 D;  3UM0 A;  1SVX A;  1OCR E;  5ENT D;  5EKQ D;  2HE0 A;  4J8S A;  3ULQ A;  3EJN A;  5KNG A;  1S0P A;  2P9N G;  4JHR A;  3ULE G;  3CV0 A;  4UWF A;  5ENP D;  1TNZ A;  1JWG A;  4I2Z A;  2AJA A;  3PZ2 A;  2X6I A;  4CZ2 D;  3UT7 A;  2LUH A;  3HXB A;  3QOU A;  1K8K G;  3NAW A;  4DX1 A;  3FUL A;  3OXG A;  5ARG A;  3NZU A;  4L23 A;  2ION A;  3PE3 A;  4GTM A;  4GTT A;  1EDU A;  5JJT A;  4F1P A;  2FUL A;  4WNE A;  4F1S A;  4HOT A;  1DCQ A;  1HXI A;  4WAF A;  2H6H A;  3B7U X;  2IEJ A;  2XGS A;  3AS8 A;  3UIN C;  2XHE A;  2LXL A;  4J8F A;  1W3B A;  3O4Z A;  4I43 A;  2WXF A;  3TWS A;  4YDO A;  3CST A;  1X5B A;  3EHM A;  2H6I A;  4HRM B;  3ZU7 B;  3CVN A;  4JA7 A;  2GW1 A;  1OWM A;  1V54 E;  5CCM A;  4G11 A;  3LY9 A;  2XCC A;  4DI3 A;  3C72 A;  4L1B A;  3ZNG A;  3SFY A;  4XI9 A;  3QWP A;  3NOC D;  3GZ1 A;  4GTO A;  2XGO A;  3E4B A;  4DUI A;  3E37 A;  1UG3 A;  1FVH A;  3P1U A;  3DST A;  3NBN B;  2KM4 A;  4K0R A;  3HVE B;  3I4R B;  4ANV A;  5G04 J;  3L22 A;  4WNF A;  3U9W A;  1E90 A;  3EIJ A;  2VYI A;  4FAD A;  4N2S A;  3TG4 A;  2GRQ B;  2ZU6 B;  3FWV A;  5LX8 A;  1Y8M A;  3JYS A;  2VSY A;  2J49 A;  5AAR A;  3TJP A;  4E85 A;  4U0S A;  5HI7 A;  4CT4 A;  4F7A A;  3V31 A;  2EIN E;  2NXP A;  3MKR A;  3JXI A;  4J6I A;  3ZXP A;  1NA3 A;  3TWR A;  4GPM A;  4DJA A;  1BI7 B;  4B94 A;  2QC9 A;  2IO2 C;  5ENR D;  4BER A;  2EIJ E;  3UIP C;  2R59 A;  4TXP A;  4A55 A;  5G2N A;  4ABN A;  3C3O A;  4PS3 A;  4YDE A;  3PNT B;  4O1P A;  3P2B A;  5T3R A;  2AXU A;  1WDY A;  3ZXS A;  4XKB A;  5ENO D;  2MOW A;  3FTV A;  1LD8 A;  4YVO A;  4FLH A;  2E2E A;  2KAT A;  2NYJ A;  1KT1 A;  4GMR A;  5J90 A;  3ZRH A;  2F8X K;  3FTU A;  3DSX A;  3PZD A;  3LVQ E;  1UJJ A;  4DX7 D;  3GW4 A;  2J07 A;  4U8Y D;  1HO8 A;  5T8I A;  3AG4 E;  4L9P A;  1OUV A;  3ASH A;  1MZC A;  3HXF A;  2R17 C;  4GA0 A;  3F6Q A;  5LFA A;  3L82 A;  3O48 A;  4GTR A;  3CLJ A;  4HI8 A;  1TJC A;  3OTN A;  2BED A;  5AIJ A;  4DK5 A;  3FH5 A;  4WNG A;  2UY1 B;  1UW4 B;  3CK8 A;  5D66 A;  2F0Y A;  3UXG A;  4HRN A;  2WXJ A;  1JWF A;  2ZXW E;  3ZEF A;  4CT0 A;  2R2L A;  3LY7 A;  3ZHE B;  1N94 A;  3E34 A;  4GTV A;  3PZ3 A;  2X38 A;  4G2V A;  4UI9 J;  4TXQ A;  4C0E A;  1D8E A;  4RG6 A;  5CMW A;  2EIL E;  3FUE A;  2VGE A;  3L16 A;  3RIB A;  4NIK A;  1MJ0 A;  3L17 A;  4LNU D;  1O1R A;  2OEW A;  4BEP A;  3ZYQ A;  2B0O E;  2P9L G;  4ILH B;  5A7D B;  4APF A;  3CVW A;  3PS6 A;  1UJK A;  3DSV A;  2HYZ A;  2R05 A;  4PDX A;  2EIK E;  4ATG A;  3CVV A;  1KZO A;  2J4D A;  4DI4 A;  3TGO A;  3SGH A;  2WPV A;  2QZA A;  3APD A;  3FTS A;  2XQ0 A;  1H6O A;  3GZ2 A;  4CEM A;  2X6K A;  1N54 A;  2H6G A;  4BX8 A;  3RO2 A;  3HXC A;  1Q2Z A;  2WXP A;  4IRU A;  2ZIR A;  3AG1 E;  2WQ6 A;  2AXV A;  3D9L A;  3TWW A;  3TAX A;  3C5R A;  5BPP A;  4BX9 A;  1X81 A;  2A5U A;  4AEZ C;  3LJN A;  3CHO A;  4Y6C A;  3TXN A;  1SQM A;  1KZP A;  3DXM G;  1BLX B;  4HS2 A;  3VTY A;  2DZO A;  3UIO C;  3RJV A;  3B7R L;  4U04 A;  3SBT B;  3QB2 A;  3L9T A;  5A23 A;  3TXM A;  2FF4 A;  2XZT G;  4GML A;  4TV3 A;  1H6K A;  5AQA A;  3SQV A;  3D9P A;  1FCH A;  2AW6 A;  2WXK A;  2R5S A;  4WWP A;  5FJY A;  3ZGQ A;  2WMO A;  3QDN A;  4ANW A;  2VTB B;  3FU0 A;  4GZ6 A;  5EID A;  1D9S A;  3HXD A;  2WXM A;  3Q9U C;  2WXN A;  4K5C A;  4JHK A;  5EYP F;  3ML8 A;  2YQ8 A;  3IKO B;  3T8K A;  1IYG A;  2XPY A;  3CHS A;  3R9M A;  3RU0 A;  1QQE A;  2WM9 A;  5ARF A;  4I6G A;  2J09 A;  4LNB A;  2XS8 A;  4ACL A;  3T8M A;  2DZN A;  4B93 B;  2GRN B;  4WWO A;  4XE0 A;  3Q47 B;  3ULY A;  2IJG X;  3KEZ A;  2VGY A;  3IHY A;  4HI9 A;  4B0Z A;  3BUA A;  2PNN A;  4AP2 A;  2ETB A;  2GRL A;  2XPI A;  5CBO A;  2J9Q A;  3LJ3 A;  5JJ6 A;  3WG7 E;  3LXU X;  4LCT A;  4FU3 A;  4GU5 A;  3I3N A;  1MHQ A;  3CKC A;  4APO A;  3EDT B;  1N4P A;  3FUD A;  4B8C B;  1EYH A;  4XI0 A;  2OVF A;  2RFA A;  2PQN A;  5E75 A;  1SZA A;  3DEP A;  3JQ1 A;  3BEE A;  2XRZ A;  2LNI A;  5FZQ A;  4GZ3 A;  1SZ9 A;  4RQI A;  1B89 A;  1BI8 B;  3MKQ A;  3TWV A;  4NRH B;  4N3A A;  3I4G A;  1N4Q A;  1SW6 A;  3FY4 A;  1N4S A;  2PM7 A;  1TN7 A;  3LKU A;  4RLY A;  1JUQ A;  1WAO 1;  2VSO E;  3DRA A;  3ASD A;  3PRE A;  4ACK A;  4GZD A;  3ABK E;  4FHJ A;  2XZD G;  5AQ9 A;  3W9F A;  2PL2 A;  3DSU A;  4PH4 B;  1KLX A;  3JQ0 A;  4FJZ A;  5KJN A;  2WXR A;  2RG8 A;  4J7W A;  2X6J A;  3S7D A;  1WM5 A;  4I1M A;  2DYS E;  2IQC A;  3QNK A;  1U3D A;  1OCO E;  3SFX A;  4JEH A;  2Y69 E;  4A1S A;  5FQ7 A;  2P58 C;  4GCN A;  2BKK B;  4YDY A;  1U2V G;  1HZ4 A;  4J0U A;  1S70 B;  1JCQ A;  3BQO A;  1MYO A;  2F8Y A;  4ANX A;  2KBX A;  3FUJ A;  4GMJ A;  2Y0B G;  5C1D A;  4AVX A;  2C2L A;  2HR2 A;  3HDX A;  2AXZ A;  2EQX A;  4U96 D;  2V0P A;  4FJY A;  3NF1 A;  1HX8 A;  4B8A A;  3ZIM A;  5M72 A;  1E8W A;  2GRO B;  4JL0 A;  5HKP A;  1BPO A;  1E96 B;  1TJF A;  4FHK A;  2L0T B;  5ANR A;  2PZI A;  3UT8 A;  1N52 A;  1WY6 A;  2NSZ A;  3FUH A;  3DSW A;  1HH8 A;  1N9A A;  1OXJ A;  1TNY A;  3KEA A;  2WMN A;  5ENS D;  2WXO A;  3DPD A;  3L6A A;  5CMY A;  3SBS A;  1IQU A;  3EU5 A;  4EEC A;  3HXE A;  2CFZ A;  4GA2 A;  3ZW3 A;  2AVP A;  4HOU A;  3MV2 B;  5JJ7 A;  4Z68 A;  4ILI A;  5KJK A;  1IQR A;  5FQ8 A;  2FI7 A;  2P9K G;  4JZY A;  4N3C A;  4AV7 A;  1NA0 A;  1UN8 A;  5BXU A;  3ESK A;  4TXR A;  3LS8 A;  2B6C A;  2CHX A;  4JD2 G;  4O6F A;  4BSX A;  2XEV A;  4YVQ C;  3R7R A;  4NUR A;  1AWC B;  3LYA A;  1GW6 A;  2YHC A;  3LY8 A;  3QK0 A;  2Q7F A;  3FU5 A;  3UQ3 A;  4FUL A;  4EZK A;  3AS4 A;  4FP7 A;  3T5X A;  2LAH A;  2WVI A;  1Z3Y A;  4NAC A;  5B1B E;  3LPZ A;  1DCE A;  3G2T A;  3UI2 A;  3ESL A;  3KSQ A;  3J5P A;  4G26 A;  4ILG A;  2P9S G;  2GRR B;  4LEU A;  1E8Y A;  3UKU G;  3HHM A;  1OWP A;  4XX5 A;  4PUC A;  4U8V D;  3KSL A;  1N4R A;  5FIN A;  3ABL E;  5DBK A;  2VTB A;  4XIF A;  4JW1 A;  4GA1 A;  2QY7 A;  3NOG D;  3IEG A;  3EU9 A;  3Q73 A;  3J5Q B;  2CG2 A;  3NQP A;  4FLB A;  3MYV A;  2Y4U A;  4TUM A;  2ZIS A;  4MKT A;  2I1J A;  3EHN A;  2GGF A;  3WXX A;  1ELR A;  3ZKJ A;  4UI9 C;  2V4H C;  1A5E A;  4CRW A;  3PZ1 A;  4J8E A;  2GRM A;  2VSX E;  2UWJ G;  4BY6 A;  4B89 A;  4HB5 A;  1EF1 C;  3V79 K;  3URZ A;  3RRU A;  2AWI A;  1Y6I A;  3ABM E;  1DC2 A;  3PUJ A;  3KS2 A;  4C9B B;  1MX4 A;  3CQC B;  4KBQ A;  2DIW A;  2QYU A;  5JHA A;  3MCX A;  3AU5 A;  5FZR A;  1OCC E;  5EIB E;  1D8D A;  3ZYM A;  3BG0 B;  4BET A;  1TYQ G;  3JUI A;  4HNA D;  3FHE A;  1TEZ A;  4JPS A;  2J4B A;  2BKG A;  4HLL A;  1PY1 A;  3FTY A;  3Q9N C;  4N39 A;  4AIF A;  1UN9 A;  3MJW A;  4G23 A;  3UUX A;  2JLB A;  3ZN3 A;  1N0R A;  3ONL A;  4C0M A;  2VGX A;  3SI5 A;  5D0O D;  4AXH A;  2XRY A;  1QBQ A;  4ANU A;  5BV1 A;  2L9B A;  2L6J A;  2Y3A A;  4LSZ E;  4LUN U;  5DIZ A;  4PS7 A;  4GTS A;  1E7V A;  1HE8 A;  4CDR A;  1HF8 A;  5CBN A;  2DYR E;  3CVY A;  1DNP A;  5CRV A;  3D9I A;  3ONK A;  5KWD A;  5CCL A;  1U3C A;  1S63 A;  5KJL A;  2I6H A;  4QQI A;  4G25 A;  4HLE A;  4ATZ D;  4KXK B;  2IOL A;  4KT6 B;  3FH8 A;  2IOS A;  3VLE A;  3QAQ A;  5FTP A;  3FUN A;  4GTP A;  2PM6 A;  2RKK A;  4BWR A;  3L54 A;  4AJW A;  1TR4 A;  1TN6 A;  3Q5M A;  4DPR A;  3TWT A;  4ME2 A;  4TUU A;  3E33 A;  4N3B A;  4U0Z A;  3GYZ A;  3QWV A;  4D10 C;  3FUI A;  2JAB A;  3IXE A;  3OAW A;  4UI9 K;  2ZGD A;  3K9I A;  3QKY A;  3HVE A;  3AG3 E;  1YA0 A;  3D9K A;  1ELW A;  2RFM A;  2R03 A;  4FC8 A;  4AOF A;  3Q79 A;  4A3V A;  4G1T A;  2CHZ A;  4JC8 A;  2CHW A;  4RG9 A;  2P2C P;  3ASO E;  3PRZ A;  4JXT A;  3SHF A;  4UQY A;  4E6H A;  2UY1 A;  1H2V C;  5D0Q D;  3G2V A;  4N2Q A;  4HOR A;  3LVR E;  2P9P G;  5JA4 D;  1OWN A;  4UWL A;  3BU8 A;  5G05 J;  3ENE A;  5FT9 A;  1TNB A;  3RAU A;  2LAI A;  4U07 A;  4EZJ A;  4A3T A;  2WB2 A;  3E30 A;  2FO7 A;  4I2W A;  4EZL A;  5KNH D;  4EPZ A;  4V3I A;  4CGV A;  2XGM A;  1HFA A;  4BTB A;  2XEE A;  5JHB A;  4O1O A;  4AY5 A;  1TN8 A;  1MX6 A;  4UQZ A;  3FUF A;  5CRU A;  3APC A;  3CVL A;  4HOQ A;  3APF A;  3PNL B;  3MX3 A;  4CDN A;  4A1G A;  4W9R A;  5IY5 E;  2FO1 E;  3HYM B;  4RSY A;  4IUL A;  2KCK A;  4XEI G;  3PZ4 A;  3EUV A;  1Z5S C;  4UWH A;  3ZVV A;  2KZT B;  1JCR A;  1FPP A;  2KXP C;  3L08 A;  2WXG A;  3FTW A;  3ZFW A;  2OCC E;  2A5E A;  1DVP A;  4U8H A;  4GTQ A;  1JPL A;  5BXO A;  2BUG A;  3CHM A;  5AQ7 A;  1OWL A;  5ENN A;  3TL5 A;  1N11 A;  3PE4 A;  1ZB1 A;  3I5P A;  3G2S A;  2HO1 A;  2R02 A;  3S7F A;  4I1O B;  1ELK A;  1AP7 A;  3PVL A;  2I2O A;  2J8S D;  3OXF A;  3DWL G;  1IKN D;  4K5B A;  4G8L A;  2XCB A;  2ETA A;  5AQB A;  4DX5 D;  3FDH A;  3Q4A B;  5FZS A;  2OV8 A;  3NZS A;  3Q7A A;  4HVB A;  1O5M A;  4KZC A;  4Q94 A;  4JB8 P;  1KT0 A;  3ZYK A;  1TNU A;  3DXK G;  3AS5 A;  1INZ A;  3AAA C;  4UUC A;  5CEA A;  2VGX B;  5FQ6 A;  4EHM A;  1HG2 A;  4DLQ A;  3QC1 A;  3CVP A;  3CEQ A;  2VQ2 A;  3D9N A;  2WXQ A;  4GB9 A;  4I6E A;  1H6P A;  3W9G A;  3Q78 A;  5G05 C;  3CIA A;  2OEV A;  2WQ7 A;  4H7Y A;  4ZFH A;  4F3V A;  2KC7 A;  2ZGG A;  1MQS A;  3CR3 A;  4U63 A;  4TRQ A;  5KCM A;  2EIM E;  3D3M A;  5JMN D;  1NP7 A;  4L2L A;  3ML9 A;  3CHR A;  4GYY A;  2XPZ A;  3TG5 A;  4CCA A;  4AY6 A;  4KZ0 A;  3D9M A;  3CVX A;  1P5Q A;  4BFR A;  2JEK A;  3JUE A;  4R7L A;  3DEO A;  5CED B;  2LSV A;  4G24 A;  1H2T C;  4DX6 D;  5CHE E;  1YYH A;  4RVB A;  1E8X A;  2M63 A;  3AU4 A;  2L0I A;  1Z3X A;  5BW8 C;  5LCW J;  3ASF A;  5J08 A;  3R9A B;  4UWG A;  3CGH A;  4I6J A;  3U66 A;  1N95 A;  5LCW C;  4A63 B;  3SFZ A;  3KD7 A;  4G8K A;  3EHQ A;  1RZ4 A;  3ASG A;  2RD0 A;  5BV0 A;  2XS1 A;  1ZU2 A;  1FVF A;  5CER B;  5HRY A;  3IHV A;  4GAA A;  2Y1L E;  1LTX A;  5CEC B;  3UX4 A;  2MYO A;  4OAV B;  3V30 A;  2IU1 A;  4GCO A;  5BT1 A;  2V8S E;  5ITZ F;  3FH7 A;  4ZHB A;  1YMP A;  4HOS A;  2QYJ A;  4CYM D;  2ILR A;  4C48 B;  4HXI A;  1IHB A;  2OVB A;  2HM8 A;  5EN5 D;  4MLP A;  4I9E A;  2PQR A;  3S2A A;  4CDM A;  4LRZ A;  1FT2 A;  1E7U A;  4MBG A;  3MZL B;  1S64 A;  1PC2 A;  4MS6 A;  2BTD A;  5A6C A;  2OOE A;  1XNF A;  5ANL A;  2GRP B;  4LER A;  3TWQ A;  4BSZ B;  3G2U A;  3L13 A;  2KCL A;  3DBS A;  3LCA A;  5EDS A;  4GZ5 A;  2YNQ A;  2FEZ A;  3SD5 A;  4Q69 A;  1FT1 A;  1QNF A;  5LP0 A;  2CFU A;  2V5Q C;  4EBA A;  3V2X A;  1HU3 A;  5HQ8 A;  2P9U G;  1YCS B;  2FBN A;  3X2Q E;  4H7X A;  3VTX A;  3SZ7 A;  3FTZ A;  2IFU A;  2MRI A;  3SO8 A;  4DX2 A;  4DLO A;  4WWN A;  3FU6 A;  4IYP A;  4M3O A;  5D2M C;  3C98 A;  5ENQ D;  2VSN A;  5HS0 A;  2E0I A;  2IF4 A;  3FEX A;  1K3Z D;  3RKV A;  3B7B A;  5T4Y A;  3AJI A;  5KBA A;  1O1T A;  3UT4 A;  3FP3 A;  2CG3 A;  2X6F A;  2BF0 X;  5EX0 A;  3OXL A;  3S7J A;  4O60 A;  4Y6W A;  3V2O A;  3FFL A;  3UM1 A;  1JCS A;  1L5J A;  3CKB A;  5H7P A;  2NC9 A;  5B1A E;  3UM2 A;  4EBA G;  3ISM C;  4MRU A;  4BT9 A;  2XEH A;  4AM9 A;  5G55 A;  3CK7 A;  1OT8 A;  1VDY A;  3PEU B;  3FU3 A;  4WUY A;  5AN8 A;  1UOH A;  2DBA A;  3RK6 A;  2I9C A;  3CSF A;  4L7T A;  1QYM A;  1HS6 A;  2WXL A;  4J8D A;  1RW2 A;  1OCZ E;  2QFC A;  4JA9 A;  4UQX A;  4XZ4 A;  4Q96 A;  4L2Y A;  3ZYL A;  3E32 A;  2WQH A;  1O1S A;  2WXH A;  4U0U A;  3UPV A;  1IXV A;  1WG0 A;  3TWU A;  3SF4 A;  3R7Q A;  1QZ2 A;  2Y4T A;  3U3W A;  3Q15 A;  3MV3 B;  5BNW A;  2C0M A;  4K03 A;  4KVM A;  3MGB A;  4LG6 A;  1IHG A;  3FUM A;  2KCV A;  2IO3 C;  3EIQ C;  1LF8 A;  3EHR A;  3FEY A;  4JVS A;  1LD7 A;  2YIN A;  3D9J A;  3SY2 A;  3FUK A;  5LOZ A;  3QWW A;  4J8Y A;  3JXJ A;  2J08 A;  4KMO A;  1H19 A;  3C3R A;  2OND A;  3CK9 A;  3RRM B;  1OY3 D;  5AYW D;  3UKR G;  4OVU A;  3C3Q A;  2IY0 C;  3QJZ A;  5EIL A;  5EX3 A;  4HRL A;  3VLD A;  4HBD A;  3ZHE A;  4JHJ A;  5EYL A;  3CVQ A;  2V4L A;  3CHQ A;  2ETC A;  3U4T A;  1HG5 A;  2DVW A;  3NB2 A;  3MKQ B;  3B13 A;  3IV0 A;  2LSU A;  3UMV A;  5AEN A;  2F37 A;  3B7S A;  3UTM A;  3Q7F A;  3PEV B;  1NZN A;  1NL4 A;  5FWQ A;  4UWK A;  3N71 A;  4P29 A;  1E8Z A;  3BG1 B;  1OWO A;  5C2Y A;  1A17 A;  1NFI E;  2DCP A;  3GZS A;  4GYO A;  4GYW A;  2KZT A;  4I1A A;  1NI1 A;  4KYO B;  3S7B A;  4NQ0 A;  2V5F A;  3PUK A;  1V55 E;  3IBE A;  3G2W A;  4PS8 A;  3RO3 A;  1KPS B;  4OAU C;  2LO6 A;  5KJM A;  3VLF A;  1BD8 A;  2XEN A;  4N5C A;  1K1B A;  1G3N B;  3RRN B;  4K5A B;  3LEW A;  4F53 A;  4GPK A;  2P9I G;  5FQ4 A;  4I17 A;  3HRA A;  3T5V A;  4U7E B;  5E76 A;  3ASN E;  3UM3 A;  1H0A A;  2LXM A;  4OYS A;  4XKC A;  5BUZ A;  4URK A;  1Z6T A;  2MHK A;  2VJ8 A;  3FTX A;  4LNG A;  3PH0 C;  4YND A;  3TWX A;  4FA6 A;  1SA4 A;  5AAO A;  4EQF A;  1H2U A;  4IN3 B;  3Q49 B;  3B7T A;  3MEK A;  1XGW A;  3T9K A;  1PAQ A;  5FIO A;  4GZC A;  4N5Q A;  2A4Z A;  2L6B A;  4WND A;  4X8Q A;  1K1A A;  4CGW A;  3MA5 A;  3U64 A;  3RSE G;  2C0L A;  3ZUV B; 
#chains in the Genus database with same CATH homology
 5D2M C;  1KPS B;  3UIP C;  2GRP B;  2GRN B;  2GRR B;  2GRO B;  1Z5S C;  2IO2 C;  2GRQ B;  3UIO C;  3UIN C;  2IY0 C;  2IO3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...