2IO3C

Crystal structure of human senp2 in complex with rangap1-sumo-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESSSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding, hydrolase
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2io3C00
2GRPB 5D2MC 3UIPC 2IO3C 2GRRB 3UIOC 1KPSB 2GRQB 2GROB 3UINC 2IO2C 1Z5SC 2IY0C 2GRNB
chains in the Genus database with same CATH superfamily
3D3MA 3UM0A 4CYMD 3R9AB 4KXKB 4BWRA 4A63B 3R7QA 4B8CB 3CVWA 3ZHEA 1DCQA 3ABLE 5FWQA 3EIQC 3ZYMA 3QOUA 5G04J 3WXXA 1BLXB 1IHBA 3C3OA 3ZHEB 4JPSA 1BPOA 3MJWA 3QAQA 4N3BA 1HXIA 1E8XA 4GMLA 3TWWA 1HE8A 4GB9A 2RD0A 3MKQA 3ISMC 4HXIA 4CDMA 4UUCA 5AQAA 5ENPD 4Y6CA 1JCQA 4J0UA 3SZ7A 5FIOA 2L6JA 4KZCA 1UOHA 3S7BA 3MKQB 2LXMA 2P9KG 3E4BA 2ETAA 3CVLA 3E33A 2Q7FA 3FUFA 3EU5A 3SBTB 5J90A 4ANWA 2Y1LE 5HS0A 4FLBA 4OAUC 3CSTA 5CMWA 5LP0A 1OCOE 4Q94A 4WNGA 3JUIA 3E30A 4K5AB 2V8SE 3VTYA 3FH7A 3MA5A 4I9EA 5LCWJ 2VSNA 3MZLB 3SGHA 2WMNA 1OWOA 3DBSA 2VSXE 1ZU2A 3L17A 4ABNA 4G2VA 2BF0X 2L6BA 4WNFA 4WWOA 4TUMA 4J7WA 3C5RA 3SD5A 2PZIA 5AENA 5D0OD 3RIBA 4HOUA 1TJFA 4ANUA 3T5VA 3FUIA 1UN8A 3LEWA 4DI3A 1E90A 2XGSA 3HXDA 2WQHA 5JA4D 5CECB 3ZU7B 4G1TA 4KT6B 3KAEA 3RRNB 5T4YA 5BUZA 1TR4A 3ENEA 4LNGA 5CERB 5LFAA 1N4SA 3JYSA 4HS2A 4FJYA 4DRXE 3GW4A 4BTBA 4JC8A 3OTNA 4Q96A 4GTMA 1U2VG 3QNKA 5HRYA 3RKVA 3CKBA 4N5QA 1JWFA 4BX8A 2NYJA 4KBQA 2H6GA 1HH8A 1Z3XA 2YHEA 4EPZA 3UTMA 4F53A 2OV8A 3NOCD 2YNQA 3L9TA 4YDWA 3CK8A 4CDNA 1DCEA 1JUQA 4H7YA 4AVXA 1H6KA 3PEVB 3UMVA 2WM9A 3DSWA 2KCLA 3G2VA 2CFUA 2P9LG 5FZSA 4F1SA 3Q4AB 3IHYA 4RVBA 3ZVVA 5KJLA 4BTAA 3K9IA 3LPZA 3V2OA 5BXUA 3Q78A 4ME2A 4ACLA 1QZ2A 2V5QC 2VSOE 1EDUA 5FT9A 1K1BA 2WXRA 4XZ4A 5D0QD 3SF4A 4FC8A 4O6FA 4QFVA 3PNLB 1Y6IA 4Y6WA 5ITZF 3G2WA 4A1SA 3T5XA 3QWWA 3CK7A 3UT7A 2WXFA 2CFZA 3JQ1A 3W9GA 1NA0A 3DPDA 3KSLA 1MX6A 3DXMG 2A5EA 3UX4A 4AJWA 3UPVA 5CRUA 2BKKB 5HKPA 3ZEFA 2PNNA 4I1AA 1OWLA 3FHEA 2DVWA 5A23A 5BV1A 3CKCA 4A3VA 3TWSA 3IHVA 4KVMA 5T8IA 3FY4A 1H0AA 2A5UA 3DSTA 1UJJA 4UWLA 3RO3A 4JL0A 1N0QA 3FFLA 4EHMA 2WXJA 2OEVA 3BU8A 4FHKA 3CHMA 3PE3A 4GZ5A 2KM4A 3VTXA 3ESLA 3F6QA 3HG0D 4A3TA 3D9IA 2NC9A 3UM2A 3E34A 1QQEA 4EZJA 2AW6A 3J5QB 5KNGA 4U0UA 5E76A 4J6IA 1OWMA 2KC7A 4RG6A 4M7CA 2I1KA 3J5PA 3DPYA 3FH8A 5ARGA 5M72A 3EU9A 2J9QA 3MEKA 3D9NA 2AXUA 4PS3A 1ELRA 1TJCA 4JHRA 1FCHA 4JEHA 5EYLA 1Z3YA 3L13A 3EHMA 5ENSD 5CEAA 4GYWA 4GCOA 3CHSA 3ASFA 2H6HA 3UM1A 2I9CA 1QYMA 2GGFA 3QWVA 4GMRA 4DLQA 4FHJA 1K1AA 1N11A 2PQNA 4C0MA 3W9FA 2ONDA 1YCSB 2BUGA 1SQMA 1E7VA 1N54A 4Z68A 4CDRA 2I2OA 4KYOB 3UUXA 3QARA 1LD7A 3R7RA 3Q75A 3PZ3A 4I1MA 1MX4A 2R5SA 3JUEA 4LCTA 2VYIA 3SQVA 4B0ZA 3PUJA 2KBXA 4APFA 2HO1A 4J8DA 3EUVA 3QB2A 3PZ4A 4N3CA 4CEMA 5IY5E 5FQ6A 4ANXA 4ILGA 4CGVA 4N2SA 2B6CA 2M63A 3DXKG 3B7UX 3EIJA 3FH5A 4RLYA 2LAIA 3FU6A 2FI7A 1IHGA 3PRZA 4BT9A 4J8EA 4L7TA 2XRYA 3SFYA 4E6HA 2DIWA 3D9PA 2L9BA 3NBNB 4F1PA 3B7RL 1TN6A 1N95A 3ZNGA 3ONLA 3TJPA 3RAUA 1AP7A 4I6JA 3ZYLA 2IO3C 2EIME 3UKUG 1V54E 3ULQA 4C48B 1KT0A 1NL4A 3AU4A 4UWFA 1B89A 1EF1C 5FQ8A 4FU3A 3CVUA 3C72A 3CVYA 4V3IA 2ZIRA 4J8YA 4N2QA 4GAAA 2GRQB 3E37A 3HRAA 4O1OA 1KT1A 2UY1A 3D9HA 3E32A 1EYHA 4B8AA 4U8YD 4OAVB 4DX5D 4AIFA 3HXFA 4I17A 4EECA 3CSFA 2OEWA 1KZOA 1N4RA 1IQUA 3EHQA 3AU5A 1DC2A 2UY1B 3Q47B 4RQIA 3B13A 4G11A 4LEUA 2I6HA 4KZ0A 3FUHA 2MYOA 3ULYA 3LKUA 1JPLA 5G2NA 3QK0A 4U0SA 3SFXA 3UT8A 1S70B 4NACA 2CHXA 2P9SG 4DI4A 3I3NA 2OOEA 5EIBE 4I2ZA 3L22A 4ZFHA 2ETBA 5EN5D 3D9JA 2WMOA 3TAXA 4I1OB 2DZNA 1X81A 3NF1A 1XGWA 5AJLA 3G2TA 5JHAA 2AXVA 4WWNA 4AP2A 2BEDA 4TRQA 3FUDA 4DPRA 3C3QA 3TL5A 3EHRA 1Y8MA 4FP7A 4DX6D 1LD8A 2XS1A 4XIFA 3ZFWA 3FUMA 3U9WA 2XEVA 1HS6A 3S2AA 3FULA 3CVXA 3LDZA 3KD7A 3NZUA 4KVOA 4K0RA 2DWZA 3FTWA 1H6PA 3I5PA 3FUJA 4HNAD 1INZA 3T8KA 1NP7A 4ACKA 3PS6A 5E75A 4BERA 3S7FA 4N5CA 2VSYA 3LY7A 5KCMA 2HM8A 1PY1A 2IJGX 4ATZD 4PS8A 3UI2A 3Q7AA 3Q73A 2WXQA 4NURA 3DSUA 4GTVA 4NQ0A 2AJAA 3KEZA 3T9KA 4GTTA 3VLFA 3DRAA 5KBAA 1HX8A 4UI9K 2XEEA 4GZDA 3CR3A 2CHWA 1D8EA 5G55A 5ANLA 4GZCA 1W3BA 3QWPA 4TV3A 1V55E 3SFZA 2Y4TA 2KATA 3P1UA 3MCXA 2ZGGA 2KCVA 4NRHB 1OCZE 3DWLG 3CVNA 4BX9A 1PC2A 4ILHB 4GA0A 3C98A 1XNFA 2ETCA 4QQIA 2P9NG 3ZIMA 2HE0A 2BKGA 3RRUA 4GYYA 2GRLA 3PH0C 1LTXA 2J49A 4GTQA 5AQ9A 4Q69A 3TWQA 2LO6A 4OYSA 2KCKA 3Q49B 2IONA 4CZ2D 2VQ2A 2ZGDA 4MLPA 2RFMA 4ILIA 3IBEA 1NFIE 3UXGA 4H7XA 1RZ4A 1YMPA 3OXGA 3SBSA 1WM5A 4UWKA 3UQ3A 3ASOE 2RFAA 4G23A 2QYJA 3FUKA 2R2LA 2XGOA 1WY6A 1MJ0A 5BPPA 4O60A 3CK9A 2WXHA 3ABME 4HI8A 3IKOB 2FF4A 2XRZA 2P2CP 4GTPA 1L5JA 4JHJA 1K8KG 1NZNA 2H6FA 2PQRA 4CT4A 1S0PA 3Q9NC 4G26A 1O1RA 1OY3D 3AS8A 4CGWA 1MX2A 4BETA 3MV2B 1BI7B 1Q2ZA 3BG0B 1TEZA 4E85A 4U95D 4LRZA 1O5MA 2CG3A 5FTPA 3TG5A 3ASHA 4GZ6A 3FTUA 3FEXA 1RW2A 4CCAA 4HLLA 2LUHA 4JVSA 4YNDA 3HXEA 1OWPA 1MZCA 1H2UA 3JXJA 5CEDB 4AV7A 1TN7A 4C0EA 4I9CA 4UWHA 4FLHA 3CHRA 3QDNA 3TWRA 4JZYA 4F3VA 1HG5A 2R02A 2H6IA 4EBAG 5ENNA 2WXLA 3HVEB 1UG3A 2F37A 4U7EB 2VGEA 5AARA 4AY5A 3OXFA 3ZN3A 2FBNA 3DSSA 3FTSA 2XPZA 3I4GA 2LAHA 3ZW3A 5G05J 3AS5A 3FTYA 4ATGA 4AM9A 2J8SD 2MRIA 4U8HA 1DVPA 5BV0A 3NB2A 3UKRG 3CVVA 1D8DA 5EILA 1QNFA 3PZDA 4HVBA 2QFCA 2JABA 3AG3E 4CRWA 5FJYA 4U96D 4G25A 2V5FA 3L82A 3ML9A 3PDNA 1HFAA 2JLBA 1D9SA 3APCA 5AQBA 5CCLA 3LJNA 4R7LA 3FUNA 3GZSA 1TNBA 2XPIA 3PEUB 2FO1E 4DJAA 3Q15A 4HFGA 3GYZA 4UQXA 1TNYA 3BQOA 3ZKJA 3CQGB 2ZU6B 1NA3A 2X3MA 4GMJA 4JA9A 2LXLA 1BI8B 2WPVA 3QC1A 3JCKC 3ASNE 3AG2E 4G8LA 4LSZE 5EKQD 2YINA 5EYPF 4B89A 4GU5A 1Z6TA 4HLEA 4O1PA 1MQSA 3U64A 4APOA 1FT2A 4PUCA 4GPKA 3TXNA 5EX0A 2EILE 3CVPA 1TYQG 4BFRA 3SHFA 3LS8A 2WXPA 4BSZB 2VGXA 2WXKA 1GW6A 3UT4A 3WG7E 5CCMA 1N52A 2P58C 5JJTA 3ONKA 4J8SA 2VGXB 2WXMA 5FQ4A 2XGMA 1E8WA 3ZXPA 2KZTB 4U04A 2GRPB 3O4ZA 1E96B 1SZAA 4DX1A 4U8VD 1H2VC 1H2TC 4GA1A 3CLJA 3TWUA 4EZKA 1TNOA 1MYOA 2XEHA 4L2YA 3EJNA 3ZPJA 2OVFA 1S63A 5CBOA 3OAWA 5JJ6A 4K5CA 3SY2A 3RO2A 3APFA 5KNHD 4PH4B 2FULA 4XKBA 1IKND 1TN8A 4IULA 3PE4A 3G2SA 4G8KA 1H6OA 5B3SE 3APDA 3TXMA 4OVUA 3HXCA 2R05A 5A7DB 1DNPA 2XS8A 4GPMA 2WB2A 1KPSB 2J4BA 3CQCB 3HDXA 5EX3A 4HRLA 5ENOD 5CHEE 3FP3A 3L08A 3B95A 1U3CA 1HF8A 4LERA 2V4HC 4PDXA 5AAOA 4WNDA 4G24A 4MKTA 1FVHA 1WDYA 1N4QA 2AVPA 5JJ7A 3HIZA 3TWXA 3FUEA 4HI9A 4IRUA 2DYRE 2AXZA 4UWGA 3DEOA 3V2XA 2GRMA 3FDHA 2P9UG 1HG2A 2IF4A 2V0PA 3JQ0A 4JB8P 5CBNA 2DBAA 3FWVA 4GA2A 2X6HA 5FZRA 2QC9A 4P29A 1FVFA 4BY6A 4HRNA 3ULEG 2E0IA 2EINE 3EHNA 3RU0A 3ZXSA 2X6KA 2LNIA 2GRRB 3U66A 3DSXA 5JMND 3NZSA 3RRMB 4BESA 4YDYA 4JHKA 5HI7A 3LY9A 3D9KA 1OCRE 5BNWA 3U3WA 4L1BA 4IYPA 3B7BA 4WAFA 4HBDA 3UIPC 3PUKA 2PL2A 2PM7A 3CGHA 4UQYA 4DUIA 1OWNA 3TG4A 1E8ZA 1TNUA 2F8XK 2HYZA 2XQ0A 1JCSA 3NOGD 3PVLA 4A1GA 1G3NB 2XCBA 5KWDA 2XCCA 4DX2A 1BU9A 3X2QE 1Z5SC 4HRMB 5B1AE 1HZ4A 3AS4A 4EBAA 3UM3A 2GW1A 2IFUA 1N9AA 2RG8A 2WXGA 4I43A 4JEUA 4CT0A 4UQZA 5LOZA 4MBGA 3RJVA 3URZA 3ASGA 3D9LA 2IY0C 5G05C 2WVIA 3N71A 5ENRD 3BUAA 3KSQA 3RSEG 3IV0A 1OUVA 1P5QA 4K5BA 2I1JA 4LNUD 1KZPA 2J07A 3CHQA 3SNXA 5FZQA 2HR2A 1X5BA 4K03A 1A17A 5ENQD 2XZTG 2Y3AA 3MKRA 5J08A 2PM6A 4GTOA 3S7DA 4UI9J 2IOSA 3MYVA 3FEYA 2ZXWE 5AQ7A 4FADA 4TXPA 2AWIA 5CRVA 3S7JA 2OVBA 3U4TA 5ANRA 2MOWA 1MHQA 4HQDA 4BT8A 2R59A 2C2LA 4LG6A 3EDTB 4WNEA 4MRUA 1KLXA 2X6IA 5T3RA 1U3DA 1H19A 2ZISA 3ZYKA 3O48A 5C1DA 1UW4B 1IQRA 4WWPA 1SVXA 3FU3A 2DCPA 4URKA 3SI5A 1AWCB 2NSZA 4HORA 5ARFA 4AY6A 2WQ7A 2QY7A 2WXNA 2B0OE 2X6JA 1O1SA 4XEIG 1N94A 3V31A 1SW6A 2X6FA 3TWTA 2QZAA 3LXUX 1BD8A 3GZ1A 3B7TA 1LF8A 4RG9A 4ZHBA 4FULA 4GTSA 1ELKA 2UWJG 3JXIA 3ESKA 3D9OA 1EPUA 3B7SA 5HQ8A 3VLEA 4N39A 3FTVA 3T8MA 1YA0A 4EZLA 4XX5A 4AOFA 1UN9A 2R17C 3CVQA 3PREA 4MS6A 2QYUA 1O1TA 2XZDG 1N0RA 4YDOA 3HVEA 1E7UA 4C9BB 3AJIA 2IQCA 1ELWA 1WG0A 4TUUA 4LUNU 4A55A 4B94A 2A4ZA 5B1BE 4XE0A 5A6CA 4X8QA 4IN3B 3SO8A 1HU3A 4HOQA 4JW1A 2ILRA 5ENTD 3LVRE 5FINA 1SZ9A 2EIJE 1IYGA 5AN8A 3MX3A 1N4PA 5KJNA 5AIJA 2IO2C 4YDEA 4B93B 3L54A 5D2MC 3Q79A 3L6AA 3Q9UC 2GRNB 4U63A 2DZOA 4F6RD 5H7PA 3ZUVB 2L0IA 4F7AA 5CMYA 2VJ8A 3LVQE 4I6EA 3CHPA 3ABKE 4U0ZA 5KJKA 1NI1A 2XPYA 3MV3B 2KXPC 4RSYA 2DYSE 3HXBA 3ASDA 3HHMA 3R9MA 3BEEA 4WUYA 4J8FA 2JEKA 3V79K 3KEAA 3C3RA 1IXVA 3CHOA 3L16A 4GCNA 1OXJA 2IEJA 3NQPA 5AYWD 3G2UA 3QKYA 4EQFA 2YQ8A 2VGYA 4L23A 2P9IG 2Y4UA 3NAWA 3TWVA 2CHZA 5FQ7A 3QJZA 3ML8A 2R03A 3D9MA 4AEZC 3OXLA 5G04C 2P9PG 4U07A 3VLDA 2IU1A 2XHEA 1SA5A 2J09A 3RK6A 1SA4A 4JD2G 3DEPA 4W9RA 4KMOA 4HOTA 5EIDA 4BEPA 1JWGA 2WXIA 3MGBA 2GROB 1OT8A 1JCRA 2E2EA 2KZTA 3CIAA 2NXPA 3ZGQA 3CV0A 5JHBA 4I6GA 2FEZA 3CEQA 1FPPA 2J08A 1OCCE 3BG1B 1A5EA 2WQ6A 4XI9A 1WAO1 4TXQA 2F0YA 3Q5MA 2F8YA 5LX8A 3ZRHA 4NIKA 2XENA 3PNTB 2J4DA 1E8YA 4HOSA 2L0TB 2OCCE 2LSVA 4DX7D 4PS7A 4M3OA 1K3ZD 5BT1A 3V30A 4DLOA 1QBQA 4TXRA 4ANVA 1FT1A 2WXOA 4JA7A 3AAAC 4LNBA 3LJ3A 3TGOA 3UIOC 4L9PA 4JXTA 3AG4E 1ZB1A 2VTBA 4YVQC 3FTZA 5LCWC 1VDYA 5DBKA 2BTDA 4UI9C 2CG2A 2X38A 2YHCA 3FU0A 5BXOA 2EQXA 4FA6A 1PAQA 4BSXA 3IEGA 2RKKA 5DIZA 2VTBB 3LCAA 3FU5A 3ZYQA 3AG1E 4I2WA 4XI0A 1TNZA 3IXEA 2C0LA 3DSVA 1YYHA 4FJZA 5D66A 2FO7A 2Y69E 4D10C 4GZ3A 2MHKA 3FTXA 2V4LA 3PZ1A 3I4RB 1UJKA 5EDSA 3GZ2A 3LYAA 4HB5A 4YVOA 3LY8A 5C2YA 5AJDA 1HO8A 1ZBPA 4AXHA 3KS2A 5KJMA 1S64A 4L2LA 3UINC 3PZ2A 4GTRA 4XKCA 3HYMB 4N3AA 3P2BA 3Q7FA 5BW8C 2LSUA 4DK5A 4GYOA 2Y0BG 4OVVA 2C0MA 2IOLA 2EIKE
chains in the Genus database with same CATH topology
2GRPB 5D2MC 3UIPC 2IO3C 2GRRB 3UIOC 1KPSB 2GRQB 2GROB 3UINC 2IO2C 1Z5SC 2IY0C 2GRNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRP B;  5D2M C;  3UIP C;  2IO3 C;  2GRR B;  3UIO C;  1KPS B;  2GRQ B;  2GRO B;  3UIN C;  2IO2 C;  1Z5S C;  2IY0 C;  2GRN B; 
#chains in the Genus database with same CATH topology
 3D3M A;  3UM0 A;  4CYM D;  3R9A B;  4KXK B;  4BWR A;  4A63 B;  3R7Q A;  4B8C B;  3CVW A;  3ZHE A;  1DCQ A;  3ABL E;  5FWQ A;  3EIQ C;  3ZYM A;  3QOU A;  5G04 J;  3WXX A;  1BLX B;  1IHB A;  3C3O A;  3ZHE B;  4JPS A;  1BPO A;  3MJW A;  3QAQ A;  4N3B A;  1HXI A;  1E8X A;  4GML A;  3TWW A;  1HE8 A;  4GB9 A;  2RD0 A;  3MKQ A;  3ISM C;  4HXI A;  4CDM A;  4UUC A;  5AQA A;  5ENP D;  4Y6C A;  1JCQ A;  4J0U A;  3SZ7 A;  5FIO A;  2L6J A;  4KZC A;  1UOH A;  3S7B A;  3MKQ B;  2LXM A;  2P9K G;  3E4B A;  2ETA A;  3CVL A;  3E33 A;  2Q7F A;  3FUF A;  3EU5 A;  3SBT B;  5J90 A;  4ANW A;  2Y1L E;  5HS0 A;  4FLB A;  4OAU C;  3CST A;  5CMW A;  5LP0 A;  1OCO E;  4Q94 A;  4WNG A;  3JUI A;  3E30 A;  4K5A B;  2V8S E;  3VTY A;  3FH7 A;  3MA5 A;  4I9E A;  5LCW J;  2VSN A;  3MZL B;  3SGH A;  2WMN A;  1OWO A;  3DBS A;  2VSX E;  1ZU2 A;  3L17 A;  4ABN A;  4G2V A;  2BF0 X;  2L6B A;  4WNF A;  4WWO A;  4TUM A;  4J7W A;  3C5R A;  3SD5 A;  2PZI A;  5AEN A;  5D0O D;  3RIB A;  4HOU A;  1TJF A;  4ANU A;  3T5V A;  3FUI A;  1UN8 A;  3LEW A;  4DI3 A;  1E90 A;  2XGS A;  3HXD A;  2WQH A;  5JA4 D;  5CEC B;  3ZU7 B;  4G1T A;  4KT6 B;  3KAE A;  3RRN B;  5T4Y A;  5BUZ A;  1TR4 A;  3ENE A;  4LNG A;  5CER B;  5LFA A;  1N4S A;  3JYS A;  4HS2 A;  4FJY A;  4DRX E;  3GW4 A;  4BTB A;  4JC8 A;  3OTN A;  4Q96 A;  4GTM A;  1U2V G;  3QNK A;  5HRY A;  3RKV A;  3CKB A;  4N5Q A;  1JWF A;  4BX8 A;  2NYJ A;  4KBQ A;  2H6G A;  1HH8 A;  1Z3X A;  2YHE A;  4EPZ A;  3UTM A;  4F53 A;  2OV8 A;  3NOC D;  2YNQ A;  3L9T A;  4YDW A;  3CK8 A;  4CDN A;  1DCE A;  1JUQ A;  4H7Y A;  4AVX A;  1H6K A;  3PEV B;  3UMV A;  2WM9 A;  3DSW A;  2KCL A;  3G2V A;  2CFU A;  2P9L G;  5FZS A;  4F1S A;  3Q4A B;  3IHY A;  4RVB A;  3ZVV A;  5KJL A;  4BTA A;  3K9I A;  3LPZ A;  3V2O A;  5BXU A;  3Q78 A;  4ME2 A;  4ACL A;  1QZ2 A;  2V5Q C;  2VSO E;  1EDU A;  5FT9 A;  1K1B A;  2WXR A;  4XZ4 A;  5D0Q D;  3SF4 A;  4FC8 A;  4O6F A;  4QFV A;  3PNL B;  1Y6I A;  4Y6W A;  5ITZ F;  3G2W A;  4A1S A;  3T5X A;  3QWW A;  3CK7 A;  3UT7 A;  2WXF A;  2CFZ A;  3JQ1 A;  3W9G A;  1NA0 A;  3DPD A;  3KSL A;  1MX6 A;  3DXM G;  2A5E A;  3UX4 A;  4AJW A;  3UPV A;  5CRU A;  2BKK B;  5HKP A;  3ZEF A;  2PNN A;  4I1A A;  1OWL A;  3FHE A;  2DVW A;  5A23 A;  5BV1 A;  3CKC A;  4A3V A;  3TWS A;  3IHV A;  4KVM A;  5T8I A;  3FY4 A;  1H0A A;  2A5U A;  3DST A;  1UJJ A;  4UWL A;  3RO3 A;  4JL0 A;  1N0Q A;  3FFL A;  4EHM A;  2WXJ A;  2OEV A;  3BU8 A;  4FHK A;  3CHM A;  3PE3 A;  4GZ5 A;  2KM4 A;  3VTX A;  3ESL A;  3F6Q A;  3HG0 D;  4A3T A;  3D9I A;  2NC9 A;  3UM2 A;  3E34 A;  1QQE A;  4EZJ A;  2AW6 A;  3J5Q B;  5KNG A;  4U0U A;  5E76 A;  4J6I A;  1OWM A;  2KC7 A;  4RG6 A;  4M7C A;  2I1K A;  3J5P A;  3DPY A;  3FH8 A;  5ARG A;  5M72 A;  3EU9 A;  2J9Q A;  3MEK A;  3D9N A;  2AXU A;  4PS3 A;  1ELR A;  1TJC A;  4JHR A;  1FCH A;  4JEH A;  5EYL A;  1Z3Y A;  3L13 A;  3EHM A;  5ENS D;  5CEA A;  4GYW A;  4GCO A;  3CHS A;  3ASF A;  2H6H A;  3UM1 A;  2I9C A;  1QYM A;  2GGF A;  3QWV A;  4GMR A;  4DLQ A;  4FHJ A;  1K1A A;  1N11 A;  2PQN A;  4C0M A;  3W9F A;  2OND A;  1YCS B;  2BUG A;  1SQM A;  1E7V A;  1N54 A;  4Z68 A;  4CDR A;  2I2O A;  4KYO B;  3UUX A;  3QAR A;  1LD7 A;  3R7R A;  3Q75 A;  3PZ3 A;  4I1M A;  1MX4 A;  2R5S A;  3JUE A;  4LCT A;  2VYI A;  3SQV A;  4B0Z A;  3PUJ A;  2KBX A;  4APF A;  2HO1 A;  4J8D A;  3EUV A;  3QB2 A;  3PZ4 A;  4N3C A;  4CEM A;  5IY5 E;  5FQ6 A;  4ANX A;  4ILG A;  4CGV A;  4N2S A;  2B6C A;  2M63 A;  3DXK G;  3B7U X;  3EIJ A;  3FH5 A;  4RLY A;  2LAI A;  3FU6 A;  2FI7 A;  1IHG A;  3PRZ A;  4BT9 A;  4J8E A;  4L7T A;  2XRY A;  3SFY A;  4E6H A;  2DIW A;  3D9P A;  2L9B A;  3NBN B;  4F1P A;  3B7R L;  1TN6 A;  1N95 A;  3ZNG A;  3ONL A;  3TJP A;  3RAU A;  1AP7 A;  4I6J A;  3ZYL A;  2IO3 C;  2EIM E;  3UKU G;  1V54 E;  3ULQ A;  4C48 B;  1KT0 A;  1NL4 A;  3AU4 A;  4UWF A;  1B89 A;  1EF1 C;  5FQ8 A;  4FU3 A;  3CVU A;  3C72 A;  3CVY A;  4V3I A;  2ZIR A;  4J8Y A;  4N2Q A;  4GAA A;  2GRQ B;  3E37 A;  3HRA A;  4O1O A;  1KT1 A;  2UY1 A;  3D9H A;  3E32 A;  1EYH A;  4B8A A;  4U8Y D;  4OAV B;  4DX5 D;  4AIF A;  3HXF A;  4I17 A;  4EEC A;  3CSF A;  2OEW A;  1KZO A;  1N4R A;  1IQU A;  3EHQ A;  3AU5 A;  1DC2 A;  2UY1 B;  3Q47 B;  4RQI A;  3B13 A;  4G11 A;  4LEU A;  2I6H A;  4KZ0 A;  3FUH A;  2MYO A;  3ULY A;  3LKU A;  1JPL A;  5G2N A;  3QK0 A;  4U0S A;  3SFX A;  3UT8 A;  1S70 B;  4NAC A;  2CHX A;  2P9S G;  4DI4 A;  3I3N A;  2OOE A;  5EIB E;  4I2Z A;  3L22 A;  4ZFH A;  2ETB A;  5EN5 D;  3D9J A;  2WMO A;  3TAX A;  4I1O B;  2DZN A;  1X81 A;  3NF1 A;  1XGW A;  5AJL A;  3G2T A;  5JHA A;  2AXV A;  4WWN A;  4AP2 A;  2BED A;  4TRQ A;  3FUD A;  4DPR A;  3C3Q A;  3TL5 A;  3EHR A;  1Y8M A;  4FP7 A;  4DX6 D;  1LD8 A;  2XS1 A;  4XIF A;  3ZFW A;  3FUM A;  3U9W A;  2XEV A;  1HS6 A;  3S2A A;  3FUL A;  3CVX A;  3LDZ A;  3KD7 A;  3NZU A;  4KVO A;  4K0R A;  2DWZ A;  3FTW A;  1H6P A;  3I5P A;  3FUJ A;  4HNA D;  1INZ A;  3T8K A;  1NP7 A;  4ACK A;  3PS6 A;  5E75 A;  4BER A;  3S7F A;  4N5C A;  2VSY A;  3LY7 A;  5KCM A;  2HM8 A;  1PY1 A;  2IJG X;  4ATZ D;  4PS8 A;  3UI2 A;  3Q7A A;  3Q73 A;  2WXQ A;  4NUR A;  3DSU A;  4GTV A;  4NQ0 A;  2AJA A;  3KEZ A;  3T9K A;  4GTT A;  3VLF A;  3DRA A;  5KBA A;  1HX8 A;  4UI9 K;  2XEE A;  4GZD A;  3CR3 A;  2CHW A;  1D8E A;  5G55 A;  5ANL A;  4GZC A;  1W3B A;  3QWP A;  4TV3 A;  1V55 E;  3SFZ A;  2Y4T A;  2KAT A;  3P1U A;  3MCX A;  2ZGG A;  2KCV A;  4NRH B;  1OCZ E;  3DWL G;  3CVN A;  4BX9 A;  1PC2 A;  4ILH B;  4GA0 A;  3C98 A;  1XNF A;  2ETC A;  4QQI A;  2P9N G;  3ZIM A;  2HE0 A;  2BKG A;  3RRU A;  4GYY A;  2GRL A;  3PH0 C;  1LTX A;  2J49 A;  4GTQ A;  5AQ9 A;  4Q69 A;  3TWQ A;  2LO6 A;  4OYS A;  2KCK A;  3Q49 B;  2ION A;  4CZ2 D;  2VQ2 A;  2ZGD A;  4MLP A;  2RFM A;  4ILI A;  3IBE A;  1NFI E;  3UXG A;  4H7X A;  1RZ4 A;  1YMP A;  3OXG A;  3SBS A;  1WM5 A;  4UWK A;  3UQ3 A;  3ASO E;  2RFA A;  4G23 A;  2QYJ A;  3FUK A;  2R2L A;  2XGO A;  1WY6 A;  1MJ0 A;  5BPP A;  4O60 A;  3CK9 A;  2WXH A;  3ABM E;  4HI8 A;  3IKO B;  2FF4 A;  2XRZ A;  2P2C P;  4GTP A;  1L5J A;  4JHJ A;  1K8K G;  1NZN A;  2H6F A;  2PQR A;  4CT4 A;  1S0P A;  3Q9N C;  4G26 A;  1O1R A;  1OY3 D;  3AS8 A;  4CGW A;  1MX2 A;  4BET A;  3MV2 B;  1BI7 B;  1Q2Z A;  3BG0 B;  1TEZ A;  4E85 A;  4U95 D;  4LRZ A;  1O5M A;  2CG3 A;  5FTP A;  3TG5 A;  3ASH A;  4GZ6 A;  3FTU A;  3FEX A;  1RW2 A;  4CCA A;  4HLL A;  2LUH A;  4JVS A;  4YND A;  3HXE A;  1OWP A;  1MZC A;  1H2U A;  3JXJ A;  5CED B;  4AV7 A;  1TN7 A;  4C0E A;  4I9C A;  4UWH A;  4FLH A;  3CHR A;  3QDN A;  3TWR A;  4JZY A;  4F3V A;  1HG5 A;  2R02 A;  2H6I A;  4EBA G;  5ENN A;  2WXL A;  3HVE B;  1UG3 A;  2F37 A;  4U7E B;  2VGE A;  5AAR A;  4AY5 A;  3OXF A;  3ZN3 A;  2FBN A;  3DSS A;  3FTS A;  2XPZ A;  3I4G A;  2LAH A;  3ZW3 A;  5G05 J;  3AS5 A;  3FTY A;  4ATG A;  4AM9 A;  2J8S D;  2MRI A;  4U8H A;  1DVP A;  5BV0 A;  3NB2 A;  3UKR G;  3CVV A;  1D8D A;  5EIL A;  1QNF A;  3PZD A;  4HVB A;  2QFC A;  2JAB A;  3AG3 E;  4CRW A;  5FJY A;  4U96 D;  4G25 A;  2V5F A;  3L82 A;  3ML9 A;  3PDN A;  1HFA A;  2JLB A;  1D9S A;  3APC A;  5AQB A;  5CCL A;  3LJN A;  4R7L A;  3FUN A;  3GZS A;  1TNB A;  2XPI A;  3PEU B;  2FO1 E;  4DJA A;  3Q15 A;  4HFG A;  3GYZ A;  4UQX A;  1TNY A;  3BQO A;  3ZKJ A;  3CQG B;  2ZU6 B;  1NA3 A;  2X3M A;  4GMJ A;  4JA9 A;  2LXL A;  1BI8 B;  2WPV A;  3QC1 A;  3JCK C;  3ASN E;  3AG2 E;  4G8L A;  4LSZ E;  5EKQ D;  2YIN A;  5EYP F;  4B89 A;  4GU5 A;  1Z6T A;  4HLE A;  4O1P A;  1MQS A;  3U64 A;  4APO A;  1FT2 A;  4PUC A;  4GPK A;  3TXN A;  5EX0 A;  2EIL E;  3CVP A;  1TYQ G;  4BFR A;  3SHF A;  3LS8 A;  2WXP A;  4BSZ B;  2VGX A;  2WXK A;  1GW6 A;  3UT4 A;  3WG7 E;  5CCM A;  1N52 A;  2P58 C;  5JJT A;  3ONK A;  4J8S A;  2VGX B;  2WXM A;  5FQ4 A;  2XGM A;  1E8W A;  3ZXP A;  2KZT B;  4U04 A;  2GRP B;  3O4Z A;  1E96 B;  1SZA A;  4DX1 A;  4U8V D;  1H2V C;  1H2T C;  4GA1 A;  3CLJ A;  3TWU A;  4EZK A;  1TNO A;  1MYO A;  2XEH A;  4L2Y A;  3EJN A;  3ZPJ A;  2OVF A;  1S63 A;  5CBO A;  3OAW A;  5JJ6 A;  4K5C A;  3SY2 A;  3RO2 A;  3APF A;  5KNH D;  4PH4 B;  2FUL A;  4XKB A;  1IKN D;  1TN8 A;  4IUL A;  3PE4 A;  3G2S A;  4G8K A;  1H6O A;  5B3S E;  3APD A;  3TXM A;  4OVU A;  3HXC A;  2R05 A;  5A7D B;  1DNP A;  2XS8 A;  4GPM A;  2WB2 A;  1KPS B;  2J4B A;  3CQC B;  3HDX A;  5EX3 A;  4HRL A;  5ENO D;  5CHE E;  3FP3 A;  3L08 A;  3B95 A;  1U3C A;  1HF8 A;  4LER A;  2V4H C;  4PDX A;  5AAO A;  4WND A;  4G24 A;  4MKT A;  1FVH A;  1WDY A;  1N4Q A;  2AVP A;  5JJ7 A;  3HIZ A;  3TWX A;  3FUE A;  4HI9 A;  4IRU A;  2DYR E;  2AXZ A;  4UWG A;  3DEO A;  3V2X A;  2GRM A;  3FDH A;  2P9U G;  1HG2 A;  2IF4 A;  2V0P A;  3JQ0 A;  4JB8 P;  5CBN A;  2DBA A;  3FWV A;  4GA2 A;  2X6H A;  5FZR A;  2QC9 A;  4P29 A;  1FVF A;  4BY6 A;  4HRN A;  3ULE G;  2E0I A;  2EIN E;  3EHN A;  3RU0 A;  3ZXS A;  2X6K A;  2LNI A;  2GRR B;  3U66 A;  3DSX A;  5JMN D;  3NZS A;  3RRM B;  4BES A;  4YDY A;  4JHK A;  5HI7 A;  3LY9 A;  3D9K A;  1OCR E;  5BNW A;  3U3W A;  4L1B A;  4IYP A;  3B7B A;  4WAF A;  4HBD A;  3UIP C;  3PUK A;  2PL2 A;  2PM7 A;  3CGH A;  4UQY A;  4DUI A;  1OWN A;  3TG4 A;  1E8Z A;  1TNU A;  2F8X K;  2HYZ A;  2XQ0 A;  1JCS A;  3NOG D;  3PVL A;  4A1G A;  1G3N B;  2XCB A;  5KWD A;  2XCC A;  4DX2 A;  1BU9 A;  3X2Q E;  1Z5S C;  4HRM B;  5B1A E;  1HZ4 A;  3AS4 A;  4EBA A;  3UM3 A;  2GW1 A;  2IFU A;  1N9A A;  2RG8 A;  2WXG A;  4I43 A;  4JEU A;  4CT0 A;  4UQZ A;  5LOZ A;  4MBG A;  3RJV A;  3URZ A;  3ASG A;  3D9L A;  2IY0 C;  5G05 C;  2WVI A;  3N71 A;  5ENR D;  3BUA A;  3KSQ A;  3RSE G;  3IV0 A;  1OUV A;  1P5Q A;  4K5B A;  2I1J A;  4LNU D;  1KZP A;  2J07 A;  3CHQ A;  3SNX A;  5FZQ A;  2HR2 A;  1X5B A;  4K03 A;  1A17 A;  5ENQ D;  2XZT G;  2Y3A A;  3MKR A;  5J08 A;  2PM6 A;  4GTO A;  3S7D A;  4UI9 J;  2IOS A;  3MYV A;  3FEY A;  2ZXW E;  5AQ7 A;  4FAD A;  4TXP A;  2AWI A;  5CRV A;  3S7J A;  2OVB A;  3U4T A;  5ANR A;  2MOW A;  1MHQ A;  4HQD A;  4BT8 A;  2R59 A;  2C2L A;  4LG6 A;  3EDT B;  4WNE A;  4MRU A;  1KLX A;  2X6I A;  5T3R A;  1U3D A;  1H19 A;  2ZIS A;  3ZYK A;  3O48 A;  5C1D A;  1UW4 B;  1IQR A;  4WWP A;  1SVX A;  3FU3 A;  2DCP A;  4URK A;  3SI5 A;  1AWC B;  2NSZ A;  4HOR A;  5ARF A;  4AY6 A;  2WQ7 A;  2QY7 A;  2WXN A;  2B0O E;  2X6J A;  1O1S A;  4XEI G;  1N94 A;  3V31 A;  1SW6 A;  2X6F A;  3TWT A;  2QZA A;  3LXU X;  1BD8 A;  3GZ1 A;  3B7T A;  1LF8 A;  4RG9 A;  4ZHB A;  4FUL A;  4GTS A;  1ELK A;  2UWJ G;  3JXI A;  3ESK A;  3D9O A;  1EPU A;  3B7S A;  5HQ8 A;  3VLE A;  4N39 A;  3FTV A;  3T8M A;  1YA0 A;  4EZL A;  4XX5 A;  4AOF A;  1UN9 A;  2R17 C;  3CVQ A;  3PRE A;  4MS6 A;  2QYU A;  1O1T A;  2XZD G;  1N0R A;  4YDO A;  3HVE A;  1E7U A;  4C9B B;  3AJI A;  2IQC A;  1ELW A;  1WG0 A;  4TUU A;  4LUN U;  4A55 A;  4B94 A;  2A4Z A;  5B1B E;  4XE0 A;  5A6C A;  4X8Q A;  4IN3 B;  3SO8 A;  1HU3 A;  4HOQ A;  4JW1 A;  2ILR A;  5ENT D;  3LVR E;  5FIN A;  1SZ9 A;  2EIJ E;  1IYG A;  5AN8 A;  3MX3 A;  1N4P A;  5KJN A;  5AIJ A;  2IO2 C;  4YDE A;  4B93 B;  3L54 A;  5D2M C;  3Q79 A;  3L6A A;  3Q9U C;  2GRN B;  4U63 A;  2DZO A;  4F6R D;  5H7P A;  3ZUV B;  2L0I A;  4F7A A;  5CMY A;  2VJ8 A;  3LVQ E;  4I6E A;  3CHP A;  3ABK E;  4U0Z A;  5KJK A;  1NI1 A;  2XPY A;  3MV3 B;  2KXP C;  4RSY A;  2DYS E;  3HXB A;  3ASD A;  3HHM A;  3R9M A;  3BEE A;  4WUY A;  4J8F A;  2JEK A;  3V79 K;  3KEA A;  3C3R A;  1IXV A;  3CHO A;  3L16 A;  4GCN A;  1OXJ A;  2IEJ A;  3NQP A;  5AYW D;  3G2U A;  3QKY A;  4EQF A;  2YQ8 A;  2VGY A;  4L23 A;  2P9I G;  2Y4U A;  3NAW A;  3TWV A;  2CHZ A;  5FQ7 A;  3QJZ A;  3ML8 A;  2R03 A;  3D9M A;  4AEZ C;  3OXL A;  5G04 C;  2P9P G;  4U07 A;  3VLD A;  2IU1 A;  2XHE A;  1SA5 A;  2J09 A;  3RK6 A;  1SA4 A;  4JD2 G;  3DEP A;  4W9R A;  4KMO A;  4HOT A;  5EID A;  4BEP A;  1JWG A;  2WXI A;  3MGB A;  2GRO B;  1OT8 A;  1JCR A;  2E2E A;  2KZT A;  3CIA A;  2NXP A;  3ZGQ A;  3CV0 A;  5JHB A;  4I6G A;  2FEZ A;  3CEQ A;  1FPP A;  2J08 A;  1OCC E;  3BG1 B;  1A5E A;  2WQ6 A;  4XI9 A;  1WAO 1;  4TXQ A;  2F0Y A;  3Q5M A;  2F8Y A;  5LX8 A;  3ZRH A;  4NIK A;  2XEN A;  3PNT B;  2J4D A;  1E8Y A;  4HOS A;  2L0T B;  2OCC E;  2LSV A;  4DX7 D;  4PS7 A;  4M3O A;  1K3Z D;  5BT1 A;  3V30 A;  4DLO A;  1QBQ A;  4TXR A;  4ANV A;  1FT1 A;  2WXO A;  4JA7 A;  3AAA C;  4LNB A;  3LJ3 A;  3TGO A;  3UIO C;  4L9P A;  4JXT A;  3AG4 E;  1ZB1 A;  2VTB A;  4YVQ C;  3FTZ A;  5LCW C;  1VDY A;  5DBK A;  2BTD A;  4UI9 C;  2CG2 A;  2X38 A;  2YHC A;  3FU0 A;  5BXO A;  2EQX A;  4FA6 A;  1PAQ A;  4BSX A;  3IEG A;  2RKK A;  5DIZ A;  2VTB B;  3LCA A;  3FU5 A;  3ZYQ A;  3AG1 E;  4I2W A;  4XI0 A;  1TNZ A;  3IXE A;  2C0L A;  3DSV A;  1YYH A;  4FJZ A;  5D66 A;  2FO7 A;  2Y69 E;  4D10 C;  4GZ3 A;  2MHK A;  3FTX A;  2V4L A;  3PZ1 A;  3I4R B;  1UJK A;  5EDS A;  3GZ2 A;  3LYA A;  4HB5 A;  4YVO A;  3LY8 A;  5C2Y A;  5AJD A;  1HO8 A;  1ZBP A;  4AXH A;  3KS2 A;  5KJM A;  1S64 A;  4L2L A;  3UIN C;  3PZ2 A;  4GTR A;  4XKC A;  3HYM B;  4N3A A;  3P2B A;  3Q7F A;  5BW8 C;  2LSU A;  4DK5 A;  4GYO A;  2Y0B G;  4OVV A;  2C0M A;  2IOL A;  2EIK E; 
#chains in the Genus database with same CATH homology
 2GRP B;  5D2M C;  3UIP C;  2IO3 C;  2GRR B;  3UIO C;  1KPS B;  2GRQ B;  2GRO B;  3UIN C;  2IO2 C;  1Z5S C;  2IY0 C;  2GRN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...