2IO3C

Crystal structure of human senp2 in complex with rangap1-sumo-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESSSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
total genus 43
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2io3C00
5D2MC 1KPSB 2GRQB 1Z5SC 3UIPC 3UIOC 2IO3C 2GRNB 2IY0C 2GRPB 2GRRB 2GROB 3UINC 2IO2C
chains in the Genus database with same CATH superfamily
1HO8A 3CVVA 3SBSA 5AQAA 1YMPA 2LNIA 3DPDA 3UQ3A 3O4ZA 2Y1LE 1IHBA 4BX9A 1MYOA 3BQOA 1KLXA 2OCCE 1NP7A 3TWWA 5J90A 3FTZA 1D9SA 4I1AA 4UWGA 1ZU2A 2J49A 2VTBB 4JVSA 1N4RA 5ENQD 2LAIA 4WNFA 4F1PA 1E96B 5JJ7A 3CK8A 3T9KA 5FINA 3SZ7A 2JLBA 4M7CA 3QWVA 3FH8A 4XI0A 1UG3A 1UN8A 2GROB 2OOEA 1O5MA 2GRMA 3CIAA 1EPUA 5HQ8A 1OCCE 4ILIA 2KXPC 4FULA 4KZ0A 1N0RA 3CSTA 5ENOD 3ZYQA 1Q2ZA 5CECB 3PZ1A 3D9PA 3CKBA 3ZPJA 3V30A 1FT2A 2J9QA 4KYOB 1H19A 3BEEA 1QZ2A 2XGSA 3MKRA 2YHEA 1TJFA 2YINA 2WXKA 3CV0A 2QZAA 4W9RA 5JMND 2X3MA 1ZB1A 2WQ7A 3LCAA 4O6FA 4KT6B 5D0QD 1O1TA 2HM8A 3Q4AB 3MEKA 2MOWA 3TAXA 5ARGA 4K03A 3QC1A 3TXMA 3PRZA 4I43A 4L1BA 2XEHA 4L7TA 3UTMA 4JW1A 3SNXA 4HOUA 3WXXA 5AJDA 1FT1A 4U0SA 5FZSA 3FUHA 3MKQA 3ESKA 5EN5D 2WXRA 3PEUB 3LKUA 2WXLA 3RRUA 3S7DA 3DSSA 3P2BA 3L17A 1W3BA 2IOLA 4GTRA 2WXJA 4Z68A 1IQUA 4BERA 2RFAA 2UY1A 2DYRE 3S7BA 3UI2A 3UIPC 1N4PA 3FU0A 5LCWC 2NXPA 3U4TA 2KATA 3CK9A 3L6AA 3ZN3A 3T8MA 4AY5A 2P9LG 2X38A 2WXMA 3SGHA 2VQ2A 3VTXA 2GGFA 3IXEA 4JB8P 4UWKA 4BWRA 4A55A 4AEZC 4DI3A 2XCBA 3Q79A 3IV0A 4GPMA 1OWMA 2Y3AA 3SFYA 3ZRHA 2I1JA 1UOHA 4GPKA 4NQ0A 4A63B 3LVQE 4NACA 4DLQA 5EKQD 3ULEG 4J6IA 2FF4A 2XS8A 4HRLA 3HRAA 3KD7A 4LG6A 4G1TA 1MX2A 2WXNA 3JQ0A 3I4RB 1OXJA 2NSZA 3ZXPA 1FCHA 3CVQA 1UJKA 1HFAA 3E33A 1D8EA 2MYOA 4APOA 4A1GA 4HNAD 4B89A 2FO7A 4GTMA 3Q7FA 1H0AA 1N95A 2JEKA 3E30A 1NA3A 2AXUA 3QDNA 4LEUA 4H7YA 3CKCA 2PQRA 3RK6A 2E2EA 5KJMA 2GRQB 1SQMA 4HFGA 3ZNGA 4HRNA 2VSYA 2UWJG 4EPZA 2P2CP 2DZNA 4DPRA 3FH5A 4JD2G 2RD0A 1QYMA 3N71A 4AJWA 4N2QA 2FO1E 3DXKG 2WVIA 3EHQA 4QFVA 2XRZA 2J09A 3EIQC 5KJNA 1K1BA 5BV1A 1JWGA 2BUGA 2OEVA 5C1DA 2XPIA 3GZ2A 2WMNA 1WAO1 2I9CA 1N94A 4FLBA 5EYLA 2PQNA 1IHGA 2GRRB 1KT0A 2X6KA 3DXMG 2L6BA 2DYSE 2EIME 4LSZE 5CBNA 2LO6A 1UJJA 2OV8A 3RO2A 3HIZA 1VDYA 4Q94A 1IKND 5HKPA 3AAAC 4GTTA 1MHQA 1WM5A 1Z3YA 1O1RA 2XGOA 3HXBA 4PUCA 4N3BA 1A17A 4AXHA 1X5BA 1JCSA 2VSOE 1Z5SC 4K5AB 4XE0A 1OWPA 2L9BA 1LD8A 1XNFA 2P9KG 1RW2A 4BSZB 3IHYA 2XEEA 4AV7A 3FU3A 1PY1A 1RZ4A 4HLLA 3AS4A 3R7RA 4IN3B 3FTVA 4U96D 1OWOA 3E32A 4C0EA 2KM4A 1B89A 4IULA 4I1MA 2VTBA 1EDUA 4FJYA 5CCMA 5FWQA 2XZTG 2L6JA 4G25A 5B1BE 5HI7A 3ESLA 3V31A 4GMLA 4CRWA 3LVRE 4TXPA 4U95D 2WQHA 3BU8A 3D9LA 4ILGA 4HI8A 4GTOA 2LUHA 3EJNA 3NAWA 3MV3B 5ENPD 3MYVA 4U8VD 4Y6CA 4N5CA 4HOSA 3LY7A 5FIOA 3ZHEB 5IY5E 3R9MA 2A5EA 3RRNB 2IJGX 5CRUA 3Q9UC 4Y6WA 3ZUVB 4WNGA 5ARFA 4BESA 1JUQA 2YNQA 1TR4A 3CHRA 4CDNA 4HQDA 3P1UA 3B13A 3LS8A 1WG0A 3CVXA 3NOGD 3QAQA 4LNBA 3FEXA 1QQEA 4A1SA 3U66A 3JXJA 5FQ8A 2VSXE 2XZDG 3ONKA 3V79K 4DX5D 5FTPA 4U04A 2WXIA 3JUIA 4EZLA 4JXTA 3ABME 2P9SG 4GA1A 2GRNB 4JPSA 3ULQA 5EDSA 2IONA 5AN8A 5HRYA 4DX1A 3MCXA 1OCRE 3GYZA 2LXLA 4TV3A 2X6HA 4RG6A 3ZEFA 1MX6A 5A7DB 5EX3A 4HB5A 4LCTA 2FEZA 3ASNE 1SZAA 4G8LA 1HF8A 4LRZA 2Y4UA 3T8KA 3RAUA 3ULYA 4YVOA 3PE3A 3JUEA 4I1OB 3TJPA 2F8XK 5JA4D 4G2VA 4LNGA 3TWQA 5B1AE 3V2OA 3B7BA 3UM3A 1NFIE 2F37A 3ASHA 3UT4A 4U7EB 4AY6A 3CVPA 2IO2C 3G2WA 3E37A 3FUEA 2R05A 4K5BA 1OCZE 2WB2A 4G8KA 4N5QA 3TWVA 2YQ8A 5B3SE 3NZSA 4UI9C 4DRXE 4TXRA 3B95A 1UN9A 3FUDA 2XRYA 3EIJA 2B6CA 4O1PA 5EX0A 3RRMB 5AQ7A 2C0MA 4EBAA 3KSQA 4YDOA 2YHCA 4B93B 1Y8MA 5AYWD 3S7FA 4AOFA 2DBAA 3I5PA 4ANWA 4OVVA 3ZIMA 4JEHA 5G05J 2V5FA 1HS6A 2XS1A 1KPSB 5JJ6A 3FH7A 2ZIRA 3NZUA 1A5EA 5ENRD 3UM2A 3X2QE 5G2NA 2P58C 3CEQA 2J07A 1TNUA 3LJNA 2AVPA 2EIJE 3AG1E 3HXDA 5EIDA 2ZGGA 2LSVA 5FJYA 3SI5A 3PH0C 2P9UG 3D9OA 2KCKA 4NURA 1PC2A 5ANLA 4L23A 1NA0A 5CMYA 3AS5A 4RLYA 3KS2A 3LXUX 2IY0C 4BT9A 2BKKB 4I6GA 3UKUG 1IXVA 2WPVA 4WWPA 3MV2B 1ELKA 5AARA 5KCMA 5KNHD 3BUAA 3FU6A 2BTDA 2DWZA 2WXFA 5A6CA 5BNWA 5E75A 4FHKA 4CGWA 3TWTA 4ME2A 3IKOB 4BT8A 4I9CA 3BG0B 1HZ4A 3PVLA 3ZXSA 3T5VA 4J8SA 4F53A 4HXIA 2V4LA 4MLPA 4PS8A 1D8DA 1S0PA 1S64A 3FEYA 4RQIA 1IQRA 4JHRA 2DCPA 4PH4B 2KCLA 5AQ9A 3MJWA 4FP7A 1MJ0A 5CERB 1TNBA 2ETAA 3L13A 3PZ4A 3GW4A 4GYYA 4MBGA 1HXIA 2Y69E 2PNNA 3DSVA 3DEOA 4P29A 4RSYA 4MRUA 2EQXA 2OEWA 2WXQA 1JCRA 3QARA 3R7QA 2GW1A 3Q15A 2AJAA 4UWFA 1KZPA 2KC7A 4J8FA 3CGHA 3ABLE 4DLOA 3B7TA 2I2OA 3NOCD 2EILE 5HS0A 1NI1A 3PNLB 2ILRA 3KEAA 3LPZA 4R7LA 2HR2A 1ZBPA 4I6JA 3SHFA 3CVNA 4KVMA 3UPVA 1TNYA 5G04C 4IYPA 4KVOA 1E7VA 3ZW3A 1OCOE 2DIWA 5BV0A 2FULA 3UT7A 3LEWA 4K0RA 5A23A 4C9BB 4ANVA 4KZCA 1INZA 2OVFA 4ACKA 3L08A 4E85A 1E7UA 1V55E 3Q73A 3ZHEA 3ZU7B 2GRPB 5DIZA 3SY2A 4I2ZA 1ELRA 3ENEA 3NQPA 3L82A 4GMJA 4G24A 1N52A 5JJTA 2V4HC 2WMOA 3UKRG 3L54A 2V8SE 1QBQA 4ANXA 2XHEA 3CVLA 3SFZA 5EIBE 4DI4A 3ASDA 3MZLB 3IHVA 3S7JA 5KNGA 2CFUA 1EYHA 4MKTA 4F6RD 5ITZF 3GZSA 4G26A 3NBNB 4GTVA 2ZISA 1E8WA 3CHQA 3HG0D 3QWWA 3F6QA 2H6GA 1X81A 3PZ2A 1PAQA 3OTNA 4YDEA 4GCNA 3AJIA 4HRMB 2XCCA 5ENTD 3LY9A 1FPPA 3Q9NC 3CVWA 4PS3A 2H6IA 3G2VA 3K9IA 1E8YA 3DSTA 4N39A 1OUVA 4IRUA 4XKCA 3TG4A 3ZGQA 1TN7A 4QQIA 4WUYA 3QKYA 4OVUA 2PM7A 1K1AA 5D2MC 4CZ2D 2CG2A 3VLFA 5JHBA 3ASFA 3FDHA 2HYZA 4HI9A 3TGOA 3FTXA 1S63A 4ZHBA 3D3MA 4BEPA 4ATGA 1DC2A 4JZYA 1Y6IA 4L2YA 4URKA 3D9KA 1SW6A 4B8CB 3FUNA 1S70B 5D0OD 3I4GA 3MGBA 1TJCA 1AWCB 4O1OA 4PDXA 2L0IA 2VGXA 1BU9A 1WY6A 3LY8A 2EINE 3RIBA 4J8YA 3CLJA 3FTUA 2R59A 1K3ZD 4EBAG 2B0OE 3OXLA 1SA4A 2WXGA 1TYQG 4LUNU 3AG3E 5E76A 1P5QA 4GU5A 3L22A 4BFRA 4FA6A 3ONLA 3E4BA 4AVXA 4HOTA 1MX4A 4CDMA 4MS6A 3MA5A 5FZQA 4B94A 1FVHA 5KJKA 1BI8B 5T8IA 4BSXA 3C3QA 3FUIA 3ZYLA 4WNEA 3PREA 3TWSA 3UUXA 2CFZA 4YNDA 3ZFWA 3HVEA 4L9PA 1ELWA 1AP7A 3HXCA 2RFMA 5KJLA 4RG9A 4OAUC 4YVQC 5BXOA 2ONDA 2J4DA 1E8ZA 2PZIA 3KSLA 1TEZA 1OT8A 2H6HA 2ZGDA 4F1SA 1E90A 2PL2A 2QYUA 3CVYA 5M72A 3D9HA 3CHPA 3RKVA 3CSFA 4EZJA 4UQZA 4BTBA 2QY7A 3BG1B 3SD5A 4E6HA 4U8YD 3OAWA 4LNUD 4I9EA 2EIKE 2R2LA 3ZKJA 3I3NA 2WXOA 3VLDA 4F3VA 3AU4A 3Q78A 4RVBA 1H6OA 2R17C 4UQYA 4CDRA 2E0IA 3FUKA 3UM1A 4HORA 4TUMA 3FUMA 2A4ZA 3EHMA 3HDXA 1KT1A 2AXVA 3D9MA 3RSEG 4ACLA 3PE4A 3LJ3A 3UX4A 2Q7FA 5CBOA 4DX7D 2XQ0A 1H2TC 4HBDA 3FTWA 5JHAA 2IF4A 3CK7A 3DPYA 4EZKA 2CG3A 2FI7A 4YDWA 2J4BA 3DEPA 2C2LA 2VGXB 2WXPA 3TWUA 3EDTB 1QNFA 4NIKA 3PUJA 1KZOA 3C5RA 4N3CA 3VTYA 4U0ZA 4Q96A 3MX3A 5T3RA 4B8AA 4JC8A 4OYSA 2KBXA 3FP3A 2AWIA 3J5PA 2XPYA 4GZCA 3TG5A 2F8YA 5FQ6A 2IQCA 1U3DA 3IBEA 1XGWA 4GZ5A 2Y4TA 3EUVA 3CR3A 4C48B 4JEUA 4GYWA 1DCEA 5BW8C 3NB2A 4GA0A 4KXKB 4FADA 3JQ1A 2QYJA 4WWNA 2CHXA 2NYJA 4V3IA 5LP0A 2HO1A 4HVBA 3DRAA 3UT8A 2X6JA 5AENA 2RG8A 3EHRA 3FHEA 4Q69A 1DCQA 2I6HA 1DNPA 3QNKA 3HVEB 3APDA 3U64A 2VJ8A 5CCLA 3QB2A 1BD8A 2OVBA 4GZ6A 4I6EA 3RU0A 4X8QA 2BKGA 3DSWA 3C72A 2XPZA 4J8EA 3B7UX 3D9JA 1HX8A 2P9NG 3Q5MA 2KZTB 2IU1A 3ISMC 1G3NB 3L16A 3C3OA 3V2XA 4UWHA 3C3RA 3AG4E 4CCAA 3D9IA 5CMWA 5H7PA 1JWFA 4KMOA 1EF1C 2VGYA 3PZDA 4WAFA 2J08A 2LAHA 3ASGA 1BPOA 5CEDB 4I2WA 3AS8A 3AU5A 4CYMD 2L0TB 1N9AA 2C0LA 3FULA 4FLHA 5ANRA 1FVFA 2CHZA 4XZ4A 4F7AA 1N4QA 3KEZA 4XKBA 1Z6TA 1TNOA 3HXFA 2QFCA 3UM0A 2WM9A 1LF8A 5LFAA 2J8SD 3L9TA 5T4YA 4PS7A 4OAVB 4HLEA 3FTSA 3O48A 3Q75A 4XEIG 3RJVA 1YA0A 2DVWA 3JCKC 1UW4B 3PUKA 1N11A 5J08A 3UINC 5AJLA 2P9PG 3PS6A 4J8DA 3HYMB 4AP2A 3QWPA 3EU9A 5C2YA 1L5JA 5FQ4A 3R9AB 4JA9A 4DK5A 1TNZA 4XX5A 1N54A 3SO8A 5KWDA 3OXGA 4GTPA 1O1SA 1DVPA 4CT0A 3Q49B 4DJAA 3AG2E 5EYPF 1SVXA 4TXQA 3ML8A 1K8KG 4FC8A 2KCVA 1N4SA 4HS2A 4CGVA 5BXUA 2RKKA 1U2VG 3SF4A 4B0ZA 3URZA 3UIOC 3S2AA 4UWLA 2H6FA 3DSXA 4EHMA 2IO3C 1BLXB 4LERA 1OWNA 3CQCB 3EU5A 4WNDA 3U9WA 1HG2A 3QOUA 1TN8A 1LTXA 5FQ7A 1HU3A 2R03A 3FUFA 2HE0A 4G23A 1TN6A 2A5UA 3G2TA 3RO3A 4FHJA 4M3OA 5FT9A 3CHOA 2PM6A 4AM9A 1MZCA 2X6IA 3TWRA 4HOQA 2IFUA 4KBQA 2WQ6A 4GA2A 2JABA 3UXGA 5CRVA 3W9GA 1IYGA 2AXZA 3W9FA 2V0PA 1N0QA 4U0UA 1GW6A 5AAOA 3FTYA 4YDYA 4BETA 2P9IG 2VSNA 4C0MA 4UUCA 4UI9J 2MRIA 5ENNA 3MKQB 2LXMA 2R5SA 3HHMA 3D9NA 4DUIA 3CQGB 3APCA 4BY6A 3OXFA 5G05C 5D66A 5LOZA 4EQFA 1JPLA 1U3CA 2UY1B 1YCSB 1OY3D 2BF0X 2WXHA 4GAAA 5CEAA 4FU3A 2BEDA 3SFXA 3ABKE 4ANUA 1BI7B 3PDNA 4O60A 2F0YA 3C98A 4A3TA 1E8XA 2IOSA 3ML9A 3TXNA 3LDZA 4DX2A 2I1KA 1JCQA 3B7SA 1YYHA 5BPPA 5BT1A 2ZXWE 2AW6A 1H2UA 5BUZA 3TL5A 3EHNA 2GRLA 4U07A 4GB9A 4ATZD 3CVUA 4H7XA 3DSUA 2QC9A 3J5QB 3FU5A 3DBSA 5KBAA 3ZYKA 4GTQA 4GTSA 2CHWA 1H6PA 2LSUA 4GMRA 3SQVA 4JHJA 2ETCA 5AQBA 2DZOA 3G2UA 3VLEA 3QK0A 4GCOA 4UQXA 3KAEA 4ILHB 1NZNA 3LYAA 1HG5A 2ETBA 4FJZA 3TWXA 1V54E 4XI9A 4DX6D 4U8HA 4I17A 4NRHB 4L2LA 3CHSA 4CT4A 3QJZA 4JHKA 1HH8A 3PEVB 3FUJA 2NC9A 5LX8A 4ABNA 2FBNA 3ASOE 5G55A 4D10C 2MHKA 2VGEA 4JL0A 3B7RL 3FFLA 4EECA 3ZYMA 3DWLG 4J7WA 1H2VC 3PNTB 5LCWJ 1MQSA 4U63A 1SA5A 2X6FA 4JA7A 3HXEA 3FY4A 2IEJA 2Y0BG 1OWLA 4GZDA 2V5QC 3PZ3A 3E34A 4BX8A 5CHEE 4ZFHA 4N2SA 4XIFA 5AIJA 4BTAA 5EILA 3Q47B 1SZ9A 3FWVA 4WWOA 2VYIA 2XGMA 4GYOA 4A3VA 3G2SA 1WDYA 2M63A 4J0UA 4APFA 4TUUA 4TRQA 3ZVVA 3NF1A 4UI9K 3SBTB 2KZTA 3GZ1A 5ENSD 3IEGA 4GZ3A 3T5XA 4G11A 4K5CA 3JXIA 5DBKA 3JYSA 5G04J 3WG7E 2XEVA 5FZRA 3UMVA 4CEMA 2R02A 3Q7AA 1NL4A 3U3WA 1HE8A 3APFA 2XENA 4AIFA 1Z3XA 4N3AA 1H6KA 3CHMA 1LD7A 2ZU6B
chains in the Genus database with same CATH topology
5D2MC 1KPSB 2GRQB 1Z5SC 3UIPC 3UIOC 2IO3C 2GRNB 2IY0C 2GRPB 2GRRB 2GROB 3UINC 2IO2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2M C;  1KPS B;  2GRQ B;  1Z5S C;  3UIP C;  3UIO C;  2IO3 C;  2GRN B;  2IY0 C;  2GRP B;  2GRR B;  2GRO B;  3UIN C;  2IO2 C; 
#chains in the Genus database with same CATH topology
 1HO8 A;  3CVV A;  3SBS A;  5AQA A;  1YMP A;  2LNI A;  3DPD A;  3UQ3 A;  3O4Z A;  2Y1L E;  1IHB A;  4BX9 A;  1MYO A;  3BQO A;  1KLX A;  2OCC E;  1NP7 A;  3TWW A;  5J90 A;  3FTZ A;  1D9S A;  4I1A A;  4UWG A;  1ZU2 A;  2J49 A;  2VTB B;  4JVS A;  1N4R A;  5ENQ D;  2LAI A;  4WNF A;  4F1P A;  1E96 B;  5JJ7 A;  3CK8 A;  3T9K A;  5FIN A;  3SZ7 A;  2JLB A;  4M7C A;  3QWV A;  3FH8 A;  4XI0 A;  1UG3 A;  1UN8 A;  2GRO B;  2OOE A;  1O5M A;  2GRM A;  3CIA A;  1EPU A;  5HQ8 A;  1OCC E;  4ILI A;  2KXP C;  4FUL A;  4KZ0 A;  1N0R A;  3CST A;  5ENO D;  3ZYQ A;  1Q2Z A;  5CEC B;  3PZ1 A;  3D9P A;  3CKB A;  3ZPJ A;  3V30 A;  1FT2 A;  2J9Q A;  4KYO B;  1H19 A;  3BEE A;  1QZ2 A;  2XGS A;  3MKR A;  2YHE A;  1TJF A;  2YIN A;  2WXK A;  3CV0 A;  2QZA A;  4W9R A;  5JMN D;  2X3M A;  1ZB1 A;  2WQ7 A;  3LCA A;  4O6F A;  4KT6 B;  5D0Q D;  1O1T A;  2HM8 A;  3Q4A B;  3MEK A;  2MOW A;  3TAX A;  5ARG A;  4K03 A;  3QC1 A;  3TXM A;  3PRZ A;  4I43 A;  4L1B A;  2XEH A;  4L7T A;  3UTM A;  4JW1 A;  3SNX A;  4HOU A;  3WXX A;  5AJD A;  1FT1 A;  4U0S A;  5FZS A;  3FUH A;  3MKQ A;  3ESK A;  5EN5 D;  2WXR A;  3PEU B;  3LKU A;  2WXL A;  3RRU A;  3S7D A;  3DSS A;  3P2B A;  3L17 A;  1W3B A;  2IOL A;  4GTR A;  2WXJ A;  4Z68 A;  1IQU A;  4BER A;  2RFA A;  2UY1 A;  2DYR E;  3S7B A;  3UI2 A;  3UIP C;  1N4P A;  3FU0 A;  5LCW C;  2NXP A;  3U4T A;  2KAT A;  3CK9 A;  3L6A A;  3ZN3 A;  3T8M A;  4AY5 A;  2P9L G;  2X38 A;  2WXM A;  3SGH A;  2VQ2 A;  3VTX A;  2GGF A;  3IXE A;  4JB8 P;  4UWK A;  4BWR A;  4A55 A;  4AEZ C;  4DI3 A;  2XCB A;  3Q79 A;  3IV0 A;  4GPM A;  1OWM A;  2Y3A A;  3SFY A;  3ZRH A;  2I1J A;  1UOH A;  4GPK A;  4NQ0 A;  4A63 B;  3LVQ E;  4NAC A;  4DLQ A;  5EKQ D;  3ULE G;  4J6I A;  2FF4 A;  2XS8 A;  4HRL A;  3HRA A;  3KD7 A;  4LG6 A;  4G1T A;  1MX2 A;  2WXN A;  3JQ0 A;  3I4R B;  1OXJ A;  2NSZ A;  3ZXP A;  1FCH A;  3CVQ A;  1UJK A;  1HFA A;  3E33 A;  1D8E A;  2MYO A;  4APO A;  4A1G A;  4HNA D;  4B89 A;  2FO7 A;  4GTM A;  3Q7F A;  1H0A A;  1N95 A;  2JEK A;  3E30 A;  1NA3 A;  2AXU A;  3QDN A;  4LEU A;  4H7Y A;  3CKC A;  2PQR A;  3RK6 A;  2E2E A;  5KJM A;  2GRQ B;  1SQM A;  4HFG A;  3ZNG A;  4HRN A;  2VSY A;  2UWJ G;  4EPZ A;  2P2C P;  2DZN A;  4DPR A;  3FH5 A;  4JD2 G;  2RD0 A;  1QYM A;  3N71 A;  4AJW A;  4N2Q A;  2FO1 E;  3DXK G;  2WVI A;  3EHQ A;  4QFV A;  2XRZ A;  2J09 A;  3EIQ C;  5KJN A;  1K1B A;  5BV1 A;  1JWG A;  2BUG A;  2OEV A;  5C1D A;  2XPI A;  3GZ2 A;  2WMN A;  1WAO 1;  2I9C A;  1N94 A;  4FLB A;  5EYL A;  2PQN A;  1IHG A;  2GRR B;  1KT0 A;  2X6K A;  3DXM G;  2L6B A;  2DYS E;  2EIM E;  4LSZ E;  5CBN A;  2LO6 A;  1UJJ A;  2OV8 A;  3RO2 A;  3HIZ A;  1VDY A;  4Q94 A;  1IKN D;  5HKP A;  3AAA C;  4GTT A;  1MHQ A;  1WM5 A;  1Z3Y A;  1O1R A;  2XGO A;  3HXB A;  4PUC A;  4N3B A;  1A17 A;  4AXH A;  1X5B A;  1JCS A;  2VSO E;  1Z5S C;  4K5A B;  4XE0 A;  1OWP A;  2L9B A;  1LD8 A;  1XNF A;  2P9K G;  1RW2 A;  4BSZ B;  3IHY A;  2XEE A;  4AV7 A;  3FU3 A;  1PY1 A;  1RZ4 A;  4HLL A;  3AS4 A;  3R7R A;  4IN3 B;  3FTV A;  4U96 D;  1OWO A;  3E32 A;  4C0E A;  2KM4 A;  1B89 A;  4IUL A;  4I1M A;  2VTB A;  1EDU A;  4FJY A;  5CCM A;  5FWQ A;  2XZT G;  2L6J A;  4G25 A;  5B1B E;  5HI7 A;  3ESL A;  3V31 A;  4GML A;  4CRW A;  3LVR E;  4TXP A;  4U95 D;  2WQH A;  3BU8 A;  3D9L A;  4ILG A;  4HI8 A;  4GTO A;  2LUH A;  3EJN A;  3NAW A;  3MV3 B;  5ENP D;  3MYV A;  4U8V D;  4Y6C A;  4N5C A;  4HOS A;  3LY7 A;  5FIO A;  3ZHE B;  5IY5 E;  3R9M A;  2A5E A;  3RRN B;  2IJG X;  5CRU A;  3Q9U C;  4Y6W A;  3ZUV B;  4WNG A;  5ARF A;  4BES A;  1JUQ A;  2YNQ A;  1TR4 A;  3CHR A;  4CDN A;  4HQD A;  3P1U A;  3B13 A;  3LS8 A;  1WG0 A;  3CVX A;  3NOG D;  3QAQ A;  4LNB A;  3FEX A;  1QQE A;  4A1S A;  3U66 A;  3JXJ A;  5FQ8 A;  2VSX E;  2XZD G;  3ONK A;  3V79 K;  4DX5 D;  5FTP A;  4U04 A;  2WXI A;  3JUI A;  4EZL A;  4JXT A;  3ABM E;  2P9S G;  4GA1 A;  2GRN B;  4JPS A;  3ULQ A;  5EDS A;  2ION A;  5AN8 A;  5HRY A;  4DX1 A;  3MCX A;  1OCR E;  3GYZ A;  2LXL A;  4TV3 A;  2X6H A;  4RG6 A;  3ZEF A;  1MX6 A;  5A7D B;  5EX3 A;  4HB5 A;  4LCT A;  2FEZ A;  3ASN E;  1SZA A;  4G8L A;  1HF8 A;  4LRZ A;  2Y4U A;  3T8K A;  3RAU A;  3ULY A;  4YVO A;  3PE3 A;  3JUE A;  4I1O B;  3TJP A;  2F8X K;  5JA4 D;  4G2V A;  4LNG A;  3TWQ A;  5B1A E;  3V2O A;  3B7B A;  3UM3 A;  1NFI E;  2F37 A;  3ASH A;  3UT4 A;  4U7E B;  4AY6 A;  3CVP A;  2IO2 C;  3G2W A;  3E37 A;  3FUE A;  2R05 A;  4K5B A;  1OCZ E;  2WB2 A;  4G8K A;  4N5Q A;  3TWV A;  2YQ8 A;  5B3S E;  3NZS A;  4UI9 C;  4DRX E;  4TXR A;  3B95 A;  1UN9 A;  3FUD A;  2XRY A;  3EIJ A;  2B6C A;  4O1P A;  5EX0 A;  3RRM B;  5AQ7 A;  2C0M A;  4EBA A;  3KSQ A;  4YDO A;  2YHC A;  4B93 B;  1Y8M A;  5AYW D;  3S7F A;  4AOF A;  2DBA A;  3I5P A;  4ANW A;  4OVV A;  3ZIM A;  4JEH A;  5G05 J;  2V5F A;  1HS6 A;  2XS1 A;  1KPS B;  5JJ6 A;  3FH7 A;  2ZIR A;  3NZU A;  1A5E A;  5ENR D;  3UM2 A;  3X2Q E;  5G2N A;  2P58 C;  3CEQ A;  2J07 A;  1TNU A;  3LJN A;  2AVP A;  2EIJ E;  3AG1 E;  3HXD A;  5EID A;  2ZGG A;  2LSV A;  5FJY A;  3SI5 A;  3PH0 C;  2P9U G;  3D9O A;  2KCK A;  4NUR A;  1PC2 A;  5ANL A;  4L23 A;  1NA0 A;  5CMY A;  3AS5 A;  4RLY A;  3KS2 A;  3LXU X;  2IY0 C;  4BT9 A;  2BKK B;  4I6G A;  3UKU G;  1IXV A;  2WPV A;  4WWP A;  3MV2 B;  1ELK A;  5AAR A;  5KCM A;  5KNH D;  3BUA A;  3FU6 A;  2BTD A;  2DWZ A;  2WXF A;  5A6C A;  5BNW A;  5E75 A;  4FHK A;  4CGW A;  3TWT A;  4ME2 A;  3IKO B;  4BT8 A;  4I9C A;  3BG0 B;  1HZ4 A;  3PVL A;  3ZXS A;  3T5V A;  4J8S A;  4F53 A;  4HXI A;  2V4L A;  4MLP A;  4PS8 A;  1D8D A;  1S0P A;  1S64 A;  3FEY A;  4RQI A;  1IQR A;  4JHR A;  2DCP A;  4PH4 B;  2KCL A;  5AQ9 A;  3MJW A;  4FP7 A;  1MJ0 A;  5CER B;  1TNB A;  2ETA A;  3L13 A;  3PZ4 A;  3GW4 A;  4GYY A;  4MBG A;  1HXI A;  2Y69 E;  2PNN A;  3DSV A;  3DEO A;  4P29 A;  4RSY A;  4MRU A;  2EQX A;  2OEW A;  2WXQ A;  1JCR A;  3QAR A;  3R7Q A;  2GW1 A;  3Q15 A;  2AJA A;  4UWF A;  1KZP A;  2KC7 A;  4J8F A;  3CGH A;  3ABL E;  4DLO A;  3B7T A;  2I2O A;  3NOC D;  2EIL E;  5HS0 A;  1NI1 A;  3PNL B;  2ILR A;  3KEA A;  3LPZ A;  4R7L A;  2HR2 A;  1ZBP A;  4I6J A;  3SHF A;  3CVN A;  4KVM A;  3UPV A;  1TNY A;  5G04 C;  4IYP A;  4KVO A;  1E7V A;  3ZW3 A;  1OCO E;  2DIW A;  5BV0 A;  2FUL A;  3UT7 A;  3LEW A;  4K0R A;  5A23 A;  4C9B B;  4ANV A;  4KZC A;  1INZ A;  2OVF A;  4ACK A;  3L08 A;  4E85 A;  1E7U A;  1V55 E;  3Q73 A;  3ZHE A;  3ZU7 B;  2GRP B;  5DIZ A;  3SY2 A;  4I2Z A;  1ELR A;  3ENE A;  3NQP A;  3L82 A;  4GMJ A;  4G24 A;  1N52 A;  5JJT A;  2V4H C;  2WMO A;  3UKR G;  3L54 A;  2V8S E;  1QBQ A;  4ANX A;  2XHE A;  3CVL A;  3SFZ A;  5EIB E;  4DI4 A;  3ASD A;  3MZL B;  3IHV A;  3S7J A;  5KNG A;  2CFU A;  1EYH A;  4MKT A;  4F6R D;  5ITZ F;  3GZS A;  4G26 A;  3NBN B;  4GTV A;  2ZIS A;  1E8W A;  3CHQ A;  3HG0 D;  3QWW A;  3F6Q A;  2H6G A;  1X81 A;  3PZ2 A;  1PAQ A;  3OTN A;  4YDE A;  4GCN A;  3AJI A;  4HRM B;  2XCC A;  5ENT D;  3LY9 A;  1FPP A;  3Q9N C;  3CVW A;  4PS3 A;  2H6I A;  3G2V A;  3K9I A;  1E8Y A;  3DST A;  4N39 A;  1OUV A;  4IRU A;  4XKC A;  3TG4 A;  3ZGQ A;  1TN7 A;  4QQI A;  4WUY A;  3QKY A;  4OVU A;  2PM7 A;  1K1A A;  5D2M C;  4CZ2 D;  2CG2 A;  3VLF A;  5JHB A;  3ASF A;  3FDH A;  2HYZ A;  4HI9 A;  3TGO A;  3FTX A;  1S63 A;  4ZHB A;  3D3M A;  4BEP A;  4ATG A;  1DC2 A;  4JZY A;  1Y6I A;  4L2Y A;  4URK A;  3D9K A;  1SW6 A;  4B8C B;  3FUN A;  1S70 B;  5D0O D;  3I4G A;  3MGB A;  1TJC A;  1AWC B;  4O1O A;  4PDX A;  2L0I A;  2VGX A;  1BU9 A;  1WY6 A;  3LY8 A;  2EIN E;  3RIB A;  4J8Y A;  3CLJ A;  3FTU A;  2R59 A;  1K3Z D;  4EBA G;  2B0O E;  3OXL A;  1SA4 A;  2WXG A;  1TYQ G;  4LUN U;  3AG3 E;  5E76 A;  1P5Q A;  4GU5 A;  3L22 A;  4BFR A;  4FA6 A;  3ONL A;  3E4B A;  4AVX A;  4HOT A;  1MX4 A;  4CDM A;  4MS6 A;  3MA5 A;  5FZQ A;  4B94 A;  1FVH A;  5KJK A;  1BI8 B;  5T8I A;  4BSX A;  3C3Q A;  3FUI A;  3ZYL A;  4WNE A;  3PRE A;  3TWS A;  3UUX A;  2CFZ A;  4YND A;  3ZFW A;  3HVE A;  4L9P A;  1ELW A;  1AP7 A;  3HXC A;  2RFM A;  5KJL A;  4RG9 A;  4OAU C;  4YVQ C;  5BXO A;  2OND A;  2J4D A;  1E8Z A;  2PZI A;  3KSL A;  1TEZ A;  1OT8 A;  2H6H A;  2ZGD A;  4F1S A;  1E90 A;  2PL2 A;  2QYU A;  3CVY A;  5M72 A;  3D9H A;  3CHP A;  3RKV A;  3CSF A;  4EZJ A;  4UQZ A;  4BTB A;  2QY7 A;  3BG1 B;  3SD5 A;  4E6H A;  4U8Y D;  3OAW A;  4LNU D;  4I9E A;  2EIK E;  2R2L A;  3ZKJ A;  3I3N A;  2WXO A;  3VLD A;  4F3V A;  3AU4 A;  3Q78 A;  4RVB A;  1H6O A;  2R17 C;  4UQY A;  4CDR A;  2E0I A;  3FUK A;  3UM1 A;  4HOR A;  4TUM A;  3FUM A;  2A4Z A;  3EHM A;  3HDX A;  1KT1 A;  2AXV A;  3D9M A;  3RSE G;  4ACL A;  3PE4 A;  3LJ3 A;  3UX4 A;  2Q7F A;  5CBO A;  4DX7 D;  2XQ0 A;  1H2T C;  4HBD A;  3FTW A;  5JHA A;  2IF4 A;  3CK7 A;  3DPY A;  4EZK A;  2CG3 A;  2FI7 A;  4YDW A;  2J4B A;  3DEP A;  2C2L A;  2VGX B;  2WXP A;  3TWU A;  3EDT B;  1QNF A;  4NIK A;  3PUJ A;  1KZO A;  3C5R A;  4N3C A;  3VTY A;  4U0Z A;  4Q96 A;  3MX3 A;  5T3R A;  4B8A A;  4JC8 A;  4OYS A;  2KBX A;  3FP3 A;  2AWI A;  3J5P A;  2XPY A;  4GZC A;  3TG5 A;  2F8Y A;  5FQ6 A;  2IQC A;  1U3D A;  3IBE A;  1XGW A;  4GZ5 A;  2Y4T A;  3EUV A;  3CR3 A;  4C48 B;  4JEU A;  4GYW A;  1DCE A;  5BW8 C;  3NB2 A;  4GA0 A;  4KXK B;  4FAD A;  3JQ1 A;  2QYJ A;  4WWN A;  2CHX A;  2NYJ A;  4V3I A;  5LP0 A;  2HO1 A;  4HVB A;  3DRA A;  3UT8 A;  2X6J A;  5AEN A;  2RG8 A;  3EHR A;  3FHE A;  4Q69 A;  1DCQ A;  2I6H A;  1DNP A;  3QNK A;  3HVE B;  3APD A;  3U64 A;  2VJ8 A;  5CCL A;  3QB2 A;  1BD8 A;  2OVB A;  4GZ6 A;  4I6E A;  3RU0 A;  4X8Q A;  2BKG A;  3DSW A;  3C72 A;  2XPZ A;  4J8E A;  3B7U X;  3D9J A;  1HX8 A;  2P9N G;  3Q5M A;  2KZT B;  2IU1 A;  3ISM C;  1G3N B;  3L16 A;  3C3O A;  3V2X A;  4UWH A;  3C3R A;  3AG4 E;  4CCA A;  3D9I A;  5CMW A;  5H7P A;  1JWF A;  4KMO A;  1EF1 C;  2VGY A;  3PZD A;  4WAF A;  2J08 A;  2LAH A;  3ASG A;  1BPO A;  5CED B;  4I2W A;  3AS8 A;  3AU5 A;  4CYM D;  2L0T B;  1N9A A;  2C0L A;  3FUL A;  4FLH A;  5ANR A;  1FVF A;  2CHZ A;  4XZ4 A;  4F7A A;  1N4Q A;  3KEZ A;  4XKB A;  1Z6T A;  1TNO A;  3HXF A;  2QFC A;  3UM0 A;  2WM9 A;  1LF8 A;  5LFA A;  2J8S D;  3L9T A;  5T4Y A;  4PS7 A;  4OAV B;  4HLE A;  3FTS A;  3O48 A;  3Q75 A;  4XEI G;  3RJV A;  1YA0 A;  2DVW A;  3JCK C;  1UW4 B;  3PUK A;  1N11 A;  5J08 A;  3UIN C;  5AJL A;  2P9P G;  3PS6 A;  4J8D A;  3HYM B;  4AP2 A;  3QWP A;  3EU9 A;  5C2Y A;  1L5J A;  5FQ4 A;  3R9A B;  4JA9 A;  4DK5 A;  1TNZ A;  4XX5 A;  1N54 A;  3SO8 A;  5KWD A;  3OXG A;  4GTP A;  1O1S A;  1DVP A;  4CT0 A;  3Q49 B;  4DJA A;  3AG2 E;  5EYP F;  1SVX A;  4TXQ A;  3ML8 A;  1K8K G;  4FC8 A;  2KCV A;  1N4S A;  4HS2 A;  4CGV A;  5BXU A;  2RKK A;  1U2V G;  3SF4 A;  4B0Z A;  3URZ A;  3UIO C;  3S2A A;  4UWL A;  2H6F A;  3DSX A;  4EHM A;  2IO3 C;  1BLX B;  4LER A;  1OWN A;  3CQC B;  3EU5 A;  4WND A;  3U9W A;  1HG2 A;  3QOU A;  1TN8 A;  1LTX A;  5FQ7 A;  1HU3 A;  2R03 A;  3FUF A;  2HE0 A;  4G23 A;  1TN6 A;  2A5U A;  3G2T A;  3RO3 A;  4FHJ A;  4M3O A;  5FT9 A;  3CHO A;  2PM6 A;  4AM9 A;  1MZC A;  2X6I A;  3TWR A;  4HOQ A;  2IFU A;  4KBQ A;  2WQ6 A;  4GA2 A;  2JAB A;  3UXG A;  5CRV A;  3W9G A;  1IYG A;  2AXZ A;  3W9F A;  2V0P A;  1N0Q A;  4U0U A;  1GW6 A;  5AAO A;  3FTY A;  4YDY A;  4BET A;  2P9I G;  2VSN A;  4C0M A;  4UUC A;  4UI9 J;  2MRI A;  5ENN A;  3MKQ B;  2LXM A;  2R5S A;  3HHM A;  3D9N A;  4DUI A;  3CQG B;  3APC A;  4BY6 A;  3OXF A;  5G05 C;  5D66 A;  5LOZ A;  4EQF A;  1JPL A;  1U3C A;  2UY1 B;  1YCS B;  1OY3 D;  2BF0 X;  2WXH A;  4GAA A;  5CEA A;  4FU3 A;  2BED A;  3SFX A;  3ABK E;  4ANU A;  1BI7 B;  3PDN A;  4O60 A;  2F0Y A;  3C98 A;  4A3T A;  1E8X A;  2IOS A;  3ML9 A;  3TXN A;  3LDZ A;  4DX2 A;  2I1K A;  1JCQ A;  3B7S A;  1YYH A;  5BPP A;  5BT1 A;  2ZXW E;  2AW6 A;  1H2U A;  5BUZ A;  3TL5 A;  3EHN A;  2GRL A;  4U07 A;  4GB9 A;  4ATZ D;  3CVU A;  4H7X A;  3DSU A;  2QC9 A;  3J5Q B;  3FU5 A;  3DBS A;  5KBA A;  3ZYK A;  4GTQ A;  4GTS A;  2CHW A;  1H6P A;  2LSU A;  4GMR A;  3SQV A;  4JHJ A;  2ETC A;  5AQB A;  2DZO A;  3G2U A;  3VLE A;  3QK0 A;  4GCO A;  4UQX A;  3KAE A;  4ILH B;  1NZN A;  3LYA A;  1HG5 A;  2ETB A;  4FJZ A;  3TWX A;  1V54 E;  4XI9 A;  4DX6 D;  4U8H A;  4I17 A;  4NRH B;  4L2L A;  3CHS A;  4CT4 A;  3QJZ A;  4JHK A;  1HH8 A;  3PEV B;  3FUJ A;  2NC9 A;  5LX8 A;  4ABN A;  2FBN A;  3ASO E;  5G55 A;  4D10 C;  2MHK A;  2VGE A;  4JL0 A;  3B7R L;  3FFL A;  4EEC A;  3ZYM A;  3DWL G;  4J7W A;  1H2V C;  3PNT B;  5LCW J;  1MQS A;  4U63 A;  1SA5 A;  2X6F A;  4JA7 A;  3HXE A;  3FY4 A;  2IEJ A;  2Y0B G;  1OWL A;  4GZD A;  2V5Q C;  3PZ3 A;  3E34 A;  4BX8 A;  5CHE E;  4ZFH A;  4N2S A;  4XIF A;  5AIJ A;  4BTA A;  5EIL A;  3Q47 B;  1SZ9 A;  3FWV A;  4WWO A;  2VYI A;  2XGM A;  4GYO A;  4A3V A;  3G2S A;  1WDY A;  2M63 A;  4J0U A;  4APF A;  4TUU A;  4TRQ A;  3ZVV A;  3NF1 A;  4UI9 K;  3SBT B;  2KZT A;  3GZ1 A;  5ENS D;  3IEG A;  4GZ3 A;  3T5X A;  4G11 A;  4K5C A;  3JXI A;  5DBK A;  3JYS A;  5G04 J;  3WG7 E;  2XEV A;  5FZR A;  3UMV A;  4CEM A;  2R02 A;  3Q7A A;  1NL4 A;  3U3W A;  1HE8 A;  3APF A;  2XEN A;  4AIF A;  1Z3X A;  4N3A A;  1H6K A;  3CHM A;  1LD7 A;  2ZU6 B; 
#chains in the Genus database with same CATH homology
 5D2M C;  1KPS B;  2GRQ B;  1Z5S C;  3UIP C;  3UIO C;  2IO3 C;  2GRN B;  2IY0 C;  2GRP B;  2GRR B;  2GRO B;  3UIN C;  2IO2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...