2IO3C

Crystal structure of human senp2 in complex with rangap1-sumo-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESSSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
total genus 43
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2io3C00
5D2MC 2GROB 2IO3C 3UINC 2GRQB 1Z5SC 2IY0C 3UIOC 3UIPC 1KPSB 2GRRB 2IO2C 2GRPB 2GRNB
chains in the Genus database with same CATH superfamily
1E90A 4IRUA 3NBNB 3ONKA 2IU1A 5T8IA 3E32A 3L17A 5ENSD 2WVIA 2VTBA 2WXRA 2P9LG 5KCMA 4DUIA 5B1AE 3HHMA 2PL2A 3MKQA 4NQ0A 5AQ9A 4DJAA 1GW6A 2B0OE 3D9HA 4B8AA 4E6HA 3FEXA 4MS6A 3CGHA 3PS6A 4APOA 3V2OA 3PEUB 5G55A 3TXMA 2ETBA 1L5JA 3HXEA 4OVVA 2AJAA 3Q4AB 4KVOA 3EDTB 4KZCA 3JXIA 2J4DA 1MX4A 4FHKA 2KC7A 1ZU2A 5CMYA 4JHRA 3C72A 3EU5A 1N11A 4F1SA 2J09A 2EQXA 4L23A 5CEDB 1OT8A 4RVBA 3L16A 2AXUA 2QY7A 3KSQA 3FH7A 3AG1E 2LUHA 5LCWC 3FTSA 1PC2A 3LCAA 1MYOA 3QJZA 4ANWA 2X6HA 2GRMA 3NOGD 3S2AA 3ESLA 5JA4D 4KVMA 2LAHA 2DCPA 3FU0A 4U95D 1H6PA 3UTMA 4GZ3A 5DBKA 4AJWA 2IQCA 3B7RL 5JJ7A 2VSNA 5ARGA 1QNFA 2BUGA 3FULA 3VTXA 3CVPA 2KCKA 4GTOA 2XPIA 4CT4A 2C0LA 2E2EA 3GZ1A 2Y3AA 4PS7A 1N9AA 1TNBA 5KJMA 1HFAA 3FHEA 4HRLA 4GTVA 1TN6A 1D8DA 4HLEA 3B7TA 3AJIA 4BSXA 3FEYA 4ILHB 4JHKA 3URZA 3ASNE 2R17C 4ME2A 5ENPD 2ETCA 3Q47B 3JCKC 3C3QA 4F53A 4TV3A 5JJTA 4BESA 1OWNA 5D0OD 3MKQB 2XEHA 4MLPA 2P9SG 2WXHA 4GTRA 4JB8P 3U4TA 1EDUA 3LY8A 3L82A 1OCZE 3D3MA 3D9IA 2F8XK 4O1PA 3E4BA 4B8CB 4G26A 2J07A 4G11A 1WM5A 2CFZA 4FU3A 4N2SA 2IEJA 4YDEA 1V55E 1ZB1A 2P9NG 2L0IA 5LCWJ 1N52A 3UT7A 2GRNB 4GYOA 1TN7A 3CHPA 2WQ7A 3ULQA 4F3VA 1LD7A 4GMJA 1D8EA 4CZ2D 3NZSA 3DSTA 4K5CA 1HU3A 5EN5D 3U64A 5B1BE 3PZ3A 4DK5A 4N3AA 3ASFA 1X81A 1EPUA 2LNIA 4GYYA 1EF1C 4CDNA 4HOQA 2CG3A 2OOEA 3FU5A 5C1DA 3LPZA 3APCA 3CK9A 3ZW3A 4U63A 2L0TB 4XKCA 2WMNA 1BD8A 3ZKJA 3ASHA 1O5MA 2BKKB 4J8SA 4YVOA 3TWUA 4EQFA 3EHNA 2FBNA 4LNUD 3IEGA 3ASGA 4O60A 3JQ0A 3ML8A 1MX2A 5D0QD 3DRAA 3WXXA 4EZKA 5ITZF 2WQ6A 1E7VA 2C2LA 4HNAD 2GROB 3CKBA 4FLHA 3J5QB 1N54A 5HI7A 3GYZA 3CVLA 3ML9A 4AEZC 4KYOB 4IYPA 3EUVA 3KEAA 1U2VG 5LX8A 1N4SA 3ZFWA 2FF4A 2F37A 1MQSA 4QQIA 3FUJA 4AY6A 4HORA 4HOTA 2P9UG 4FJZA 4JL0A 1N4RA 3EIQC 2WQHA 4O1OA 4BT9A 3APDA 4F1PA 3LVRE 3P1UA 4BETA 1JCQA 3PH0C 3UM3A 3TWTA 3PZ4A 4APFA 3ABLE 3HXDA 2RG8A 2DZNA 4GU5A 4HI9A 3RO3A 2YINA 4P29A 3DSUA 5AQBA 2DVWA 4DX1A 5G04J 2PZIA 4UWGA 2X6JA 4JA9A 3TGOA 1HS6A 2CHWA 2AXZA 3QNKA 2XZTG 1KPSB 4H7XA 2UY1B 1UN9A 1OUVA 2ILRA 4HQDA 5E75A 3CR3A 4IN3B 4TUMA 4WWOA 3FTZA 1X5BA 3LYAA 4BERA 4BTBA 3FTVA 4N3BA 5HS0A 5FIOA 1SZ9A 1ELWA 3E33A 5AN8A 4OYSA 2IO2C 3UIOC 4U0UA 4I17A 3CK7A 5E76A 4GPMA 2P9PG 5FWQA 1N4QA 5CBNA 1QQEA 4GTPA 3V30A 5CCLA 4G8LA 1IKND 2VGXA 4DPRA 3Q78A 1INZA 3Q75A 5ANRA 3QOUA 2A5UA 2R03A 5T3RA 3UKRG 2LXLA 3ASDA 4KZ0A 4XI0A 3ZXPA 3FUKA 5BPPA 4I6JA 2R59A 2HR2A 4XKBA 2OVBA 3CHRA 3QWVA 5AENA 1HZ4A 4C9BB 3HXFA 4CDRA 1DNPA 3UQ3A 1RW2A 3FUNA 3NQPA 3IHYA 5CEAA 3NZUA 3PZDA 2NYJA 3W9FA 3PZ1A 4CYMD 1BI8B 1SA5A 2MOWA 3UT4A 4L2LA 1B89A 4DLOA 1HH8A 5FT9A 1NZNA 2JLBA 3KAEA 3PEVB 3CIAA 4G8KA 3D9NA 3CHMA 4MRUA 3D9PA 4YVQC 3HXCA 5CRVA 3R9MA 1JWGA 1H2TC 3Q5MA 3E30A 2KCLA 5G05C 2XEEA 3CHSA 3KSLA 4ACKA 2WMOA 4V3IA 4RQIA 3DSWA 4B89A 2WXMA 1H19A 4I9CA 1OWOA 2GRQB 1UN8A 2ZISA 1WY6A 2FO7A 3ZRHA 3LJ3A 4CGVA 3SFZA 5D2MC 1TJCA 2QC9A 2V4LA 2WB2A 2HE0A 1WG0A 4WUYA 4DRXE 2GGFA 3KS2A 1FPPA 4AM9A 2ZU6B 4FP7A 4K0RA 5C2YA 3SFYA 1Z6TA 3FU6A 1JCSA 5AQAA 4A55A 1E8XA 4TXQA 4JZYA 2JABA 5CRUA 3JUEA 3RIBA 4PDXA 2AWIA 2HO1A 4XZ4A 3C3RA 3PNLB 2DWZA 2EINE 3MEKA 4OAUC 3LS8A 5AIJA 1NA3A 3L22A 3SZ7A 3TAXA 4PH4B 1RZ4A 4EBAA 2NC9A 4ANXA 4DI4A 2WXQA 4EPZA 3AG3E 4DX6D 2X6IA 2HYZA 3BEEA 2V5QC 5EYLA 1N0QA 5AYWD 5A7DB 4I43A 4RSYA 3RJVA 1OWPA 1D9SA 3BG1B 2P2CP 3APFA 2P58C 4IULA 4DLQA 4NURA 4AVXA 3QDNA 4ANVA 2XPYA 4K5AB 1YA0A 3CVYA 4JD2G 2H6FA 3T9KA 2MRIA 2XS8A 3D9LA 3ENEA 3ZN3A 1HXIA 5G05J 2EIJE 3S7JA 3PDNA 4UUCA 3CVXA 1NA0A 3GZ2A 5BV0A 1K1BA 3PVLA 4WNEA 3TWVA 2H6GA 3DEPA 4UI9C 3Q15A 3TWQA 4J0UA 5CECB 1TEZA 4URKA 3UUXA 1UW4B 1KZPA 4HBDA 4PS8A 4B0ZA 3FUEA 3SF4A 3L13A 4O6FA 3I4RB 4BEPA 2GRPB 3L9TA 1U3DA 4BTAA 2AW6A 2NSZA 1XNFA 3ABKE 3HVEA 3RRMB 3Q73A 2RFAA 1OCOE 3ESKA 5BUZA 3SQVA 5KJLA 3LKUA 2WXIA 1JUQA 2VJ8A 1NP7A 4YDOA 3SY2A 3VTYA 3DEOA 4CEMA 3QAQA 4RLYA 3R7QA 3FFLA 5KNHD 2I1KA 4CGWA 3HG0D 2I9CA 4A63B 1FT2A 3LEWA 1BLXB 4BSZB 3ZEFA 3PRZA 3U3WA 1NFIE 2VTBB 3C3OA 4JVSA 3ZPJA 2VGYA 4UWLA 1SZAA 1WDYA 3DXMG 3LY9A 4HRMB 2IOLA 2JEKA 4LG6A 3ULEG 3B7UX 4GMLA 4U96D 3IKOB 3PREA 1ZBPA 5KWDA 4GCNA 4AXHA 2DYRE 5LFAA 5EX0A 5ARFA 4UI9J 2V0PA 5CHEE 4FC8A 3R9AB 4B93B 3AS4A 4A1GA 4U07A 4TXPA 2V4HC 4GZ6A 5FZSA 4LNGA 3SGHA 4UQYA 3UI2A 2J08A 4ATZD 4JHJA 1JWFA 4LNBA 4N39A 1UJJA 2M63A 4I2WA 1N0RA 4I9EA 3NAWA 2DYSE 5KBAA 1E8WA 1K8KG 3DSXA 5LOZA 5ENOD 1EYHA 3VLFA 4RG9A 3BUAA 3DWLG 3UT8A 2WXKA 3CSFA 3S7BA 4UWFA 1P5QA 2WXGA 1ELRA 3SBSA 3C98A 1SW6A 3SBTB 4YDYA 4ZHBA 4HOSA 1AWCB 4U0ZA 4DX5D 3Q7FA 2MYOA 3RK6A 3CV0A 4U7EB 3ZIMA 5H7PA 3EHRA 3OAWA 3LDZA 1TR4A 1KT0A 3CQCB 3Q9UC 5KNGA 2MHKA 5IY5E 1HO8A 1HF8A 4UQXA 2GW1A 3O4ZA 3O48A 2WXPA 3P2BA 1Y6IA 1YMPA 4J8DA 3S7DA 4BX9A 4EZLA 1HG2A 2Y4UA 1FVFA 1O1SA 4LERA 2I2OA 4L7TA 2KXPC 1H2UA 2L9BA 4HRNA 1S64A 4EECA 3SD5A 2P9KG 4M3OA 1QBQA 2XQ0A 3DPYA 3EHQA 3FUHA 4AIFA 4QFVA 2XS1A 1V54E 3SHFA 5EX3A 5AJLA 3G2UA 3EIJA 3V79K 1S70B 3PNTB 4K5BA 2C0MA 2ETAA 2CFUA 3AU4A 3K9IA 3SFXA 1SVXA 5FINA 5FZRA 4Q96A 4BFRA 3VLDA 2AVPA 1FCHA 5ENTD 4PUCA 4KMOA 5B3SE 5HKPA 3AS8A 4GB9A 3OXGA 4I1OB 2R2LA 3E37A 4BY6A 2KZTA 4FLBA 2YNQA 3TG4A 5FTPA 1K1AA 2VSYA 1WAO1 4LCTA 4ABNA 2EILE 4EZJA 3RKVA 2BEDA 4BT8A 4C0MA 3EJNA 2IJGX 4XIFA 4FULA 4J6IA 1OCRE 1IHGA 3FTYA 1TNOA 1LF8A 3WG7E 4ANUA 5D66A 3ULYA 3ZXSA 3RRUA 4Q94A 1O1TA 3Q49B 2DZOA 2F0YA 3FTXA 2XRYA 4Y6CA 1HG5A 2XENA 4I2ZA 3N71A 2H6IA 2WXNA 3SO8A 3B13A 4YDWA 5J90A 2L6JA 3L54A 3IHVA 3MA5A 4GYWA 3HXBA 1E7UA 3CHOA 2P9IG 5LP0A 4G25A 5JHAA 2XGOA 3FUIA 1S63A 4GAAA 1Z5SC 4GZ5A 4JEUA 4RG6A 2XGMA 3CVQA 3HRAA 3RSEG 3DPDA 4Q69A 4B94A 2CHXA 2X3MA 2L6BA 1YYHA 3MYVA 4KBQA 3QARA 5AQ7A 3X2QE 3I3NA 2KCVA 2PNNA 4GCOA 2VSXE 3T5VA 3L6AA 5KJKA 4HXIA 1DC2A 4BWRA 1OXJA 4U8VD 2XRZA 4NACA 3MV2B 3RU0A 5AARA 4CT0A 1NI1A 3MZLB 4GA0A 3ZU7B 4LUNU 3TWXA 2E0IA 3FP3A 2AXVA 4G23A 4X8QA 4HS2A 2J8SD 2RKKA 3G2WA 3E34A 2LAIA 5EIDA 3OXLA 3MGBA 3RAUA 3Q9NC 3W9GA 3GW4A 1LTXA 4E85A 5M72A 2KZTB 4FHJA 3MCXA 2J49A 2X6FA 2Y4TA 2RD0A 4XEIG 3JXJA 3NB2A 1Z3XA 1G3NB 3ASOE 3QK0A 3FTUA 2ZGDA 5ENQD 3FUFA 3I4GA 3QKYA 3U9WA 4DX7D 2FI7A 5AAOA 5ENRD 1UOHA 3VLEA 3CEQA 4L9PA 3RRNB 3DXKG 1LD8A 4NRHB 3SNXA 2WXJA 5G2NA 2VGXB 3D9OA 2LSVA 1UG3A 3IXEA 2UWJG 4F6RD 3HDXA 4HOUA 3ZGQA 5ANLA 2IF4A 4GTMA 5BW8C 5HRYA 3ZUVB 3ZHEA 3ZVVA 2XZDG 3JQ1A 5FQ4A 3CVVA 5EIBE 1A17A 3UIPC 1TYQG 2PQNA 2WM9A 4JC8A 3PE3A 4PS3A 2RFMA 4KT6B 3ZYMA 1H6KA 3LY7A 1IYGA 1IQUA 4GTSA 1OY3D 3CVWA 2R02A 3MJWA 2FEZA 5FZQA 2XCBA 4CCAA 1MJ0A 3LVQE 2QYUA 3FTWA 2VYIA 4UWHA 5FQ8A 1H0AA 2ZXWE 4OVUA 2CHZA 2WPVA 2V5FA 1IHBA 4CDMA 2YHEA 2LSUA 4KXKB 4HVBA 4A3VA 3S7FA 3TXNA 2A4ZA 4J7WA 4GZCA 4AP2A 2KATA 3RO2A 3DBSA 5ENNA 3QC1A 2R5SA 3EHMA 2ONDA 2IFUA 4UI9K 4FJYA 4A1SA 2DBAA 3EU9A 4I6GA 4N2QA 3ZYLA 1KLXA 4R7LA 5DIZA 1JCRA 3LXUX 5BXUA 5CBOA 1K3ZD 3L08A 1E8YA 3CQGB 2IY0C 4I6EA 3T5XA 2QFCA 4Z68A 3AG2E 3ABME 2DIWA 2NXPA 2XCCA 2IONA 4OAVB 1Y8MA 1N4PA 2Q7FA 3PUKA 3UM0A 2I1JA 2IO3C 5FQ6A 1NL4A 2HM8A 2GRRB 3PE4A 4H7YA 4HLLA 2ZGGA 1KT1A 3B95A 3FDHA 2VGEA 3FH5A 3ZHEB 1E8ZA 1H2VC 4JW1A 5CERB 1QZ2A 3U66A 3TL5A 5AJDA 4D10C 4MBGA 4WNGA 3KEZA 2Y1LE 1QYMA 3NOCD 1TNZA 5KJNA 3MX3A 1BPOA 4GZDA 3MKRA 3UINC 2B6CA 4G24A 4TXRA 1TNUA 1Z3YA 1S0PA 4J8YA 3AAAC 1VDYA 3B7SA 3QWWA 4LSZE 3AS5A 1O1RA 3GZSA 5EILA 2OV8A 3MV3B 4ZFHA 4BX8A 4A3TA 2UY1A 4ACLA 3CLJA 2PM6A 4TRQA 3D9KA 4GA2A 2V8SE 1UJKA 3HVEB 1AP7A 4Y6WA 5EKQD 3UM2A 2J9QA 3TWWA 1PAQA 3OTNA 4LEUA 5G04C 5T4YA 3UM1A 4XX5A 4AOFA 1BI7B 4ILGA 4GA1A 5BT1A 2OEWA 3UXGA 4GTQA 2OVFA 3OXFA 3FU3A 3ZNGA 2Y0BG 1OWMA 2QYJA 3TJPA 1Q2ZA 5FQ7A 3R7RA 4XE0A 4WNFA 2EIME 2VQ2A 3FUDA 1HE8A 4N5QA 4CRWA 2XHEA 2QZAA 3DSSA 2FULA 2LO6A 4JA7A 3HIZA 3FUMA 4U04A 3FY4A 4U8YD 2WXFA 4M7CA 5BNWA 2YQ8A 1ELKA 2FO1E 3FH8A 3NF1A 3BU8A 4JXTA 2A5EA 1MX6A 4XI9A 1H6OA 4L1BA 5A23A 3ZYKA 4WAFA 4HFGA 4N5CA 1XGWA 3ISMC 3LJNA 2X38A 3SI5A 2YHCA 4UWKA 3JYSA 4DI3A 4GPKA 1JPLA 3IBEA 2BF0X 3QB2A 4U0SA 3B7BA 3TWRA 4AV7A 4FA6A 3CK8A 4GMRA 5JMND 3CVUA 4FADA 4MKTA 3UKUG 4K03A 3BG0B 3CVNA 1FVHA 2IOSA 2KBXA 4G1TA 4UQZA 4LRZA 1DVPA 1E96B 3D9JA 4GTTA 3G2VA 1IXVA 3AG4E 2LXMA 2VSOE 4WWPA 4L2YA 3I5PA 2PQRA 3D9MA 4W9RA 3T8KA 1OCCE 1TN8A 2PM7A 2XEVA 1MHQA 4JPSA 3Q79A 3IV0A 1DCEA 2WXOA 3V2XA 3PUJA 5BV1A 4HI8A 1DCQA 5JHBA 1OWLA 3F6QA 4C48B 3T8MA 5FJYA 5EYPF 3HYMB 3CHQA 3UPVA 3PZ2A 4ATGA 1SQMA 4NIKA 3G2TA 1IQRA 2ZIRA 3CSTA 3J5PA 3TWSA 2OEVA 3FWVA 3Q7AA 2H6HA 3G2SA 2OCCE 2I6HA 1TNYA 4WWNA 3UX4A 3ZYQA 2WXLA 4WNDA 4J8EA 3C5RA 5J08A 2R05A 1BU9A 1N95A 4JEHA 1MZCA 2GRLA 2J4BA 4F7AA 5CMWA 1FT1A 4U8HA 4I1MA 3V31A 2BKGA 5EDSA 3KD7A 3ONLA 4AY5A 2KM4A 2EIKE 2F8YA 5A6CA 2CG2A 4DX2A 2Y69E 1U3CA 5JJ6A 4I1AA 3AU5A 1SA4A 2BTDA 4YNDA 3CKCA 3TG5A 3QWPA 3UMVA 1A5EA 4J8FA 1KZOA 1PY1A 5CCMA 4TUUA 4HB5A 4N3CA 1HX8A 4ILIA 3JUIA 5BXOA 4EHMA 2X6KA 4EBAG 1YCSB 5HQ8A 2XGSA 1W3BA 3DSVA 2XPZA 4C0EA 1TJFA 1N94A 3BQOA 4G2VA
chains in the Genus database with same CATH topology
5D2MC 2GROB 2IO3C 3UINC 2GRQB 1Z5SC 2IY0C 3UIOC 3UIPC 1KPSB 2GRRB 2IO2C 2GRPB 2GRNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2M C;  2GRO B;  2IO3 C;  3UIN C;  2GRQ B;  1Z5S C;  2IY0 C;  3UIO C;  3UIP C;  1KPS B;  2GRR B;  2IO2 C;  2GRP B;  2GRN B; 
#chains in the Genus database with same CATH topology
 1E90 A;  4IRU A;  3NBN B;  3ONK A;  2IU1 A;  5T8I A;  3E32 A;  3L17 A;  5ENS D;  2WVI A;  2VTB A;  2WXR A;  2P9L G;  5KCM A;  4DUI A;  5B1A E;  3HHM A;  2PL2 A;  3MKQ A;  4NQ0 A;  5AQ9 A;  4DJA A;  1GW6 A;  2B0O E;  3D9H A;  4B8A A;  4E6H A;  3FEX A;  4MS6 A;  3CGH A;  3PS6 A;  4APO A;  3V2O A;  3PEU B;  5G55 A;  3TXM A;  2ETB A;  1L5J A;  3HXE A;  4OVV A;  2AJA A;  3Q4A B;  4KVO A;  3EDT B;  4KZC A;  3JXI A;  2J4D A;  1MX4 A;  4FHK A;  2KC7 A;  1ZU2 A;  5CMY A;  4JHR A;  3C72 A;  3EU5 A;  1N11 A;  4F1S A;  2J09 A;  2EQX A;  4L23 A;  5CED B;  1OT8 A;  4RVB A;  3L16 A;  2AXU A;  2QY7 A;  3KSQ A;  3FH7 A;  3AG1 E;  2LUH A;  5LCW C;  3FTS A;  1PC2 A;  3LCA A;  1MYO A;  3QJZ A;  4ANW A;  2X6H A;  2GRM A;  3NOG D;  3S2A A;  3ESL A;  5JA4 D;  4KVM A;  2LAH A;  2DCP A;  3FU0 A;  4U95 D;  1H6P A;  3UTM A;  4GZ3 A;  5DBK A;  4AJW A;  2IQC A;  3B7R L;  5JJ7 A;  2VSN A;  5ARG A;  1QNF A;  2BUG A;  3FUL A;  3VTX A;  3CVP A;  2KCK A;  4GTO A;  2XPI A;  4CT4 A;  2C0L A;  2E2E A;  3GZ1 A;  2Y3A A;  4PS7 A;  1N9A A;  1TNB A;  5KJM A;  1HFA A;  3FHE A;  4HRL A;  4GTV A;  1TN6 A;  1D8D A;  4HLE A;  3B7T A;  3AJI A;  4BSX A;  3FEY A;  4ILH B;  4JHK A;  3URZ A;  3ASN E;  2R17 C;  4ME2 A;  5ENP D;  2ETC A;  3Q47 B;  3JCK C;  3C3Q A;  4F53 A;  4TV3 A;  5JJT A;  4BES A;  1OWN A;  5D0O D;  3MKQ B;  2XEH A;  4MLP A;  2P9S G;  2WXH A;  4GTR A;  4JB8 P;  3U4T A;  1EDU A;  3LY8 A;  3L82 A;  1OCZ E;  3D3M A;  3D9I A;  2F8X K;  4O1P A;  3E4B A;  4B8C B;  4G26 A;  2J07 A;  4G11 A;  1WM5 A;  2CFZ A;  4FU3 A;  4N2S A;  2IEJ A;  4YDE A;  1V55 E;  1ZB1 A;  2P9N G;  2L0I A;  5LCW J;  1N52 A;  3UT7 A;  2GRN B;  4GYO A;  1TN7 A;  3CHP A;  2WQ7 A;  3ULQ A;  4F3V A;  1LD7 A;  4GMJ A;  1D8E A;  4CZ2 D;  3NZS A;  3DST A;  4K5C A;  1HU3 A;  5EN5 D;  3U64 A;  5B1B E;  3PZ3 A;  4DK5 A;  4N3A A;  3ASF A;  1X81 A;  1EPU A;  2LNI A;  4GYY A;  1EF1 C;  4CDN A;  4HOQ A;  2CG3 A;  2OOE A;  3FU5 A;  5C1D A;  3LPZ A;  3APC A;  3CK9 A;  3ZW3 A;  4U63 A;  2L0T B;  4XKC A;  2WMN A;  1BD8 A;  3ZKJ A;  3ASH A;  1O5M A;  2BKK B;  4J8S A;  4YVO A;  3TWU A;  4EQF A;  3EHN A;  2FBN A;  4LNU D;  3IEG A;  3ASG A;  4O60 A;  3JQ0 A;  3ML8 A;  1MX2 A;  5D0Q D;  3DRA A;  3WXX A;  4EZK A;  5ITZ F;  2WQ6 A;  1E7V A;  2C2L A;  4HNA D;  2GRO B;  3CKB A;  4FLH A;  3J5Q B;  1N54 A;  5HI7 A;  3GYZ A;  3CVL A;  3ML9 A;  4AEZ C;  4KYO B;  4IYP A;  3EUV A;  3KEA A;  1U2V G;  5LX8 A;  1N4S A;  3ZFW A;  2FF4 A;  2F37 A;  1MQS A;  4QQI A;  3FUJ A;  4AY6 A;  4HOR A;  4HOT A;  2P9U G;  4FJZ A;  4JL0 A;  1N4R A;  3EIQ C;  2WQH A;  4O1O A;  4BT9 A;  3APD A;  4F1P A;  3LVR E;  3P1U A;  4BET A;  1JCQ A;  3PH0 C;  3UM3 A;  3TWT A;  3PZ4 A;  4APF A;  3ABL E;  3HXD A;  2RG8 A;  2DZN A;  4GU5 A;  4HI9 A;  3RO3 A;  2YIN A;  4P29 A;  3DSU A;  5AQB A;  2DVW A;  4DX1 A;  5G04 J;  2PZI A;  4UWG A;  2X6J A;  4JA9 A;  3TGO A;  1HS6 A;  2CHW A;  2AXZ A;  3QNK A;  2XZT G;  1KPS B;  4H7X A;  2UY1 B;  1UN9 A;  1OUV A;  2ILR A;  4HQD A;  5E75 A;  3CR3 A;  4IN3 B;  4TUM A;  4WWO A;  3FTZ A;  1X5B A;  3LYA A;  4BER A;  4BTB A;  3FTV A;  4N3B A;  5HS0 A;  5FIO A;  1SZ9 A;  1ELW A;  3E33 A;  5AN8 A;  4OYS A;  2IO2 C;  3UIO C;  4U0U A;  4I17 A;  3CK7 A;  5E76 A;  4GPM A;  2P9P G;  5FWQ A;  1N4Q A;  5CBN A;  1QQE A;  4GTP A;  3V30 A;  5CCL A;  4G8L A;  1IKN D;  2VGX A;  4DPR A;  3Q78 A;  1INZ A;  3Q75 A;  5ANR A;  3QOU A;  2A5U A;  2R03 A;  5T3R A;  3UKR G;  2LXL A;  3ASD A;  4KZ0 A;  4XI0 A;  3ZXP A;  3FUK A;  5BPP A;  4I6J A;  2R59 A;  2HR2 A;  4XKB A;  2OVB A;  3CHR A;  3QWV A;  5AEN A;  1HZ4 A;  4C9B B;  3HXF A;  4CDR A;  1DNP A;  3UQ3 A;  1RW2 A;  3FUN A;  3NQP A;  3IHY A;  5CEA A;  3NZU A;  3PZD A;  2NYJ A;  3W9F A;  3PZ1 A;  4CYM D;  1BI8 B;  1SA5 A;  2MOW A;  3UT4 A;  4L2L A;  1B89 A;  4DLO A;  1HH8 A;  5FT9 A;  1NZN A;  2JLB A;  3KAE A;  3PEV B;  3CIA A;  4G8K A;  3D9N A;  3CHM A;  4MRU A;  3D9P A;  4YVQ C;  3HXC A;  5CRV A;  3R9M A;  1JWG A;  1H2T C;  3Q5M A;  3E30 A;  2KCL A;  5G05 C;  2XEE A;  3CHS A;  3KSL A;  4ACK A;  2WMO A;  4V3I A;  4RQI A;  3DSW A;  4B89 A;  2WXM A;  1H19 A;  4I9C A;  1OWO A;  2GRQ B;  1UN8 A;  2ZIS A;  1WY6 A;  2FO7 A;  3ZRH A;  3LJ3 A;  4CGV A;  3SFZ A;  5D2M C;  1TJC A;  2QC9 A;  2V4L A;  2WB2 A;  2HE0 A;  1WG0 A;  4WUY A;  4DRX E;  2GGF A;  3KS2 A;  1FPP A;  4AM9 A;  2ZU6 B;  4FP7 A;  4K0R A;  5C2Y A;  3SFY A;  1Z6T A;  3FU6 A;  1JCS A;  5AQA A;  4A55 A;  1E8X A;  4TXQ A;  4JZY A;  2JAB A;  5CRU A;  3JUE A;  3RIB A;  4PDX A;  2AWI A;  2HO1 A;  4XZ4 A;  3C3R A;  3PNL B;  2DWZ A;  2EIN E;  3MEK A;  4OAU C;  3LS8 A;  5AIJ A;  1NA3 A;  3L22 A;  3SZ7 A;  3TAX A;  4PH4 B;  1RZ4 A;  4EBA A;  2NC9 A;  4ANX A;  4DI4 A;  2WXQ A;  4EPZ A;  3AG3 E;  4DX6 D;  2X6I A;  2HYZ A;  3BEE A;  2V5Q C;  5EYL A;  1N0Q A;  5AYW D;  5A7D B;  4I43 A;  4RSY A;  3RJV A;  1OWP A;  1D9S A;  3BG1 B;  2P2C P;  3APF A;  2P58 C;  4IUL A;  4DLQ A;  4NUR A;  4AVX A;  3QDN A;  4ANV A;  2XPY A;  4K5A B;  1YA0 A;  3CVY A;  4JD2 G;  2H6F A;  3T9K A;  2MRI A;  2XS8 A;  3D9L A;  3ENE A;  3ZN3 A;  1HXI A;  5G05 J;  2EIJ E;  3S7J A;  3PDN A;  4UUC A;  3CVX A;  1NA0 A;  3GZ2 A;  5BV0 A;  1K1B A;  3PVL A;  4WNE A;  3TWV A;  2H6G A;  3DEP A;  4UI9 C;  3Q15 A;  3TWQ A;  4J0U A;  5CEC B;  1TEZ A;  4URK A;  3UUX A;  1UW4 B;  1KZP A;  4HBD A;  4PS8 A;  4B0Z A;  3FUE A;  3SF4 A;  3L13 A;  4O6F A;  3I4R B;  4BEP A;  2GRP B;  3L9T A;  1U3D A;  4BTA A;  2AW6 A;  2NSZ A;  1XNF A;  3ABK E;  3HVE A;  3RRM B;  3Q73 A;  2RFA A;  1OCO E;  3ESK A;  5BUZ A;  3SQV A;  5KJL A;  3LKU A;  2WXI A;  1JUQ A;  2VJ8 A;  1NP7 A;  4YDO A;  3SY2 A;  3VTY A;  3DEO A;  4CEM A;  3QAQ A;  4RLY A;  3R7Q A;  3FFL A;  5KNH D;  2I1K A;  4CGW A;  3HG0 D;  2I9C A;  4A63 B;  1FT2 A;  3LEW A;  1BLX B;  4BSZ B;  3ZEF A;  3PRZ A;  3U3W A;  1NFI E;  2VTB B;  3C3O A;  4JVS A;  3ZPJ A;  2VGY A;  4UWL A;  1SZA A;  1WDY A;  3DXM G;  3LY9 A;  4HRM B;  2IOL A;  2JEK A;  4LG6 A;  3ULE G;  3B7U X;  4GML A;  4U96 D;  3IKO B;  3PRE A;  1ZBP A;  5KWD A;  4GCN A;  4AXH A;  2DYR E;  5LFA A;  5EX0 A;  5ARF A;  4UI9 J;  2V0P A;  5CHE E;  4FC8 A;  3R9A B;  4B93 B;  3AS4 A;  4A1G A;  4U07 A;  4TXP A;  2V4H C;  4GZ6 A;  5FZS A;  4LNG A;  3SGH A;  4UQY A;  3UI2 A;  2J08 A;  4ATZ D;  4JHJ A;  1JWF A;  4LNB A;  4N39 A;  1UJJ A;  2M63 A;  4I2W A;  1N0R A;  4I9E A;  3NAW A;  2DYS E;  5KBA A;  1E8W A;  1K8K G;  3DSX A;  5LOZ A;  5ENO D;  1EYH A;  3VLF A;  4RG9 A;  3BUA A;  3DWL G;  3UT8 A;  2WXK A;  3CSF A;  3S7B A;  4UWF A;  1P5Q A;  2WXG A;  1ELR A;  3SBS A;  3C98 A;  1SW6 A;  3SBT B;  4YDY A;  4ZHB A;  4HOS A;  1AWC B;  4U0Z A;  4DX5 D;  3Q7F A;  2MYO A;  3RK6 A;  3CV0 A;  4U7E B;  3ZIM A;  5H7P A;  3EHR A;  3OAW A;  3LDZ A;  1TR4 A;  1KT0 A;  3CQC B;  3Q9U C;  5KNG A;  2MHK A;  5IY5 E;  1HO8 A;  1HF8 A;  4UQX A;  2GW1 A;  3O4Z A;  3O48 A;  2WXP A;  3P2B A;  1Y6I A;  1YMP A;  4J8D A;  3S7D A;  4BX9 A;  4EZL A;  1HG2 A;  2Y4U A;  1FVF A;  1O1S A;  4LER A;  2I2O A;  4L7T A;  2KXP C;  1H2U A;  2L9B A;  4HRN A;  1S64 A;  4EEC A;  3SD5 A;  2P9K G;  4M3O A;  1QBQ A;  2XQ0 A;  3DPY A;  3EHQ A;  3FUH A;  4AIF A;  4QFV A;  2XS1 A;  1V54 E;  3SHF A;  5EX3 A;  5AJL A;  3G2U A;  3EIJ A;  3V79 K;  1S70 B;  3PNT B;  4K5B A;  2C0M A;  2ETA A;  2CFU A;  3AU4 A;  3K9I A;  3SFX A;  1SVX A;  5FIN A;  5FZR A;  4Q96 A;  4BFR A;  3VLD A;  2AVP A;  1FCH A;  5ENT D;  4PUC A;  4KMO A;  5B3S E;  5HKP A;  3AS8 A;  4GB9 A;  3OXG A;  4I1O B;  2R2L A;  3E37 A;  4BY6 A;  2KZT A;  4FLB A;  2YNQ A;  3TG4 A;  5FTP A;  1K1A A;  2VSY A;  1WAO 1;  4LCT A;  4ABN A;  2EIL E;  4EZJ A;  3RKV A;  2BED A;  4BT8 A;  4C0M A;  3EJN A;  2IJG X;  4XIF A;  4FUL A;  4J6I A;  1OCR E;  1IHG A;  3FTY A;  1TNO A;  1LF8 A;  3WG7 E;  4ANU A;  5D66 A;  3ULY A;  3ZXS A;  3RRU A;  4Q94 A;  1O1T A;  3Q49 B;  2DZO A;  2F0Y A;  3FTX A;  2XRY A;  4Y6C A;  1HG5 A;  2XEN A;  4I2Z A;  3N71 A;  2H6I A;  2WXN A;  3SO8 A;  3B13 A;  4YDW A;  5J90 A;  2L6J A;  3L54 A;  3IHV A;  3MA5 A;  4GYW A;  3HXB A;  1E7U A;  3CHO A;  2P9I G;  5LP0 A;  4G25 A;  5JHA A;  2XGO A;  3FUI A;  1S63 A;  4GAA A;  1Z5S C;  4GZ5 A;  4JEU A;  4RG6 A;  2XGM A;  3CVQ A;  3HRA A;  3RSE G;  3DPD A;  4Q69 A;  4B94 A;  2CHX A;  2X3M A;  2L6B A;  1YYH A;  3MYV A;  4KBQ A;  3QAR A;  5AQ7 A;  3X2Q E;  3I3N A;  2KCV A;  2PNN A;  4GCO A;  2VSX E;  3T5V A;  3L6A A;  5KJK A;  4HXI A;  1DC2 A;  4BWR A;  1OXJ A;  4U8V D;  2XRZ A;  4NAC A;  3MV2 B;  3RU0 A;  5AAR A;  4CT0 A;  1NI1 A;  3MZL B;  4GA0 A;  3ZU7 B;  4LUN U;  3TWX A;  2E0I A;  3FP3 A;  2AXV A;  4G23 A;  4X8Q A;  4HS2 A;  2J8S D;  2RKK A;  3G2W A;  3E34 A;  2LAI A;  5EID A;  3OXL A;  3MGB A;  3RAU A;  3Q9N C;  3W9G A;  3GW4 A;  1LTX A;  4E85 A;  5M72 A;  2KZT B;  4FHJ A;  3MCX A;  2J49 A;  2X6F A;  2Y4T A;  2RD0 A;  4XEI G;  3JXJ A;  3NB2 A;  1Z3X A;  1G3N B;  3ASO E;  3QK0 A;  3FTU A;  2ZGD A;  5ENQ D;  3FUF A;  3I4G A;  3QKY A;  3U9W A;  4DX7 D;  2FI7 A;  5AAO A;  5ENR D;  1UOH A;  3VLE A;  3CEQ A;  4L9P A;  3RRN B;  3DXK G;  1LD8 A;  4NRH B;  3SNX A;  2WXJ A;  5G2N A;  2VGX B;  3D9O A;  2LSV A;  1UG3 A;  3IXE A;  2UWJ G;  4F6R D;  3HDX A;  4HOU A;  3ZGQ A;  5ANL A;  2IF4 A;  4GTM A;  5BW8 C;  5HRY A;  3ZUV B;  3ZHE A;  3ZVV A;  2XZD G;  3JQ1 A;  5FQ4 A;  3CVV A;  5EIB E;  1A17 A;  3UIP C;  1TYQ G;  2PQN A;  2WM9 A;  4JC8 A;  3PE3 A;  4PS3 A;  2RFM A;  4KT6 B;  3ZYM A;  1H6K A;  3LY7 A;  1IYG A;  1IQU A;  4GTS A;  1OY3 D;  3CVW A;  2R02 A;  3MJW A;  2FEZ A;  5FZQ A;  2XCB A;  4CCA A;  1MJ0 A;  3LVQ E;  2QYU A;  3FTW A;  2VYI A;  4UWH A;  5FQ8 A;  1H0A A;  2ZXW E;  4OVU A;  2CHZ A;  2WPV A;  2V5F A;  1IHB A;  4CDM A;  2YHE A;  2LSU A;  4KXK B;  4HVB A;  4A3V A;  3S7F A;  3TXN A;  2A4Z A;  4J7W A;  4GZC A;  4AP2 A;  2KAT A;  3RO2 A;  3DBS A;  5ENN A;  3QC1 A;  2R5S A;  3EHM A;  2OND A;  2IFU A;  4UI9 K;  4FJY A;  4A1S A;  2DBA A;  3EU9 A;  4I6G A;  4N2Q A;  3ZYL A;  1KLX A;  4R7L A;  5DIZ A;  1JCR A;  3LXU X;  5BXU A;  5CBO A;  1K3Z D;  3L08 A;  1E8Y A;  3CQG B;  2IY0 C;  4I6E A;  3T5X A;  2QFC A;  4Z68 A;  3AG2 E;  3ABM E;  2DIW A;  2NXP A;  2XCC A;  2ION A;  4OAV B;  1Y8M A;  1N4P A;  2Q7F A;  3PUK A;  3UM0 A;  2I1J A;  2IO3 C;  5FQ6 A;  1NL4 A;  2HM8 A;  2GRR B;  3PE4 A;  4H7Y A;  4HLL A;  2ZGG A;  1KT1 A;  3B95 A;  3FDH A;  2VGE A;  3FH5 A;  3ZHE B;  1E8Z A;  1H2V C;  4JW1 A;  5CER B;  1QZ2 A;  3U66 A;  3TL5 A;  5AJD A;  4D10 C;  4MBG A;  4WNG A;  3KEZ A;  2Y1L E;  1QYM A;  3NOC D;  1TNZ A;  5KJN A;  3MX3 A;  1BPO A;  4GZD A;  3MKR A;  3UIN C;  2B6C A;  4G24 A;  4TXR A;  1TNU A;  1Z3Y A;  1S0P A;  4J8Y A;  3AAA C;  1VDY A;  3B7S A;  3QWW A;  4LSZ E;  3AS5 A;  1O1R A;  3GZS A;  5EIL A;  2OV8 A;  3MV3 B;  4ZFH A;  4BX8 A;  4A3T A;  2UY1 A;  4ACL A;  3CLJ A;  2PM6 A;  4TRQ A;  3D9K A;  4GA2 A;  2V8S E;  1UJK A;  3HVE B;  1AP7 A;  4Y6W A;  5EKQ D;  3UM2 A;  2J9Q A;  3TWW A;  1PAQ A;  3OTN A;  4LEU A;  5G04 C;  5T4Y A;  3UM1 A;  4XX5 A;  4AOF A;  1BI7 B;  4ILG A;  4GA1 A;  5BT1 A;  2OEW A;  3UXG A;  4GTQ A;  2OVF A;  3OXF A;  3FU3 A;  3ZNG A;  2Y0B G;  1OWM A;  2QYJ A;  3TJP A;  1Q2Z A;  5FQ7 A;  3R7R A;  4XE0 A;  4WNF A;  2EIM E;  2VQ2 A;  3FUD A;  1HE8 A;  4N5Q A;  4CRW A;  2XHE A;  2QZA A;  3DSS A;  2FUL A;  2LO6 A;  4JA7 A;  3HIZ A;  3FUM A;  4U04 A;  3FY4 A;  4U8Y D;  2WXF A;  4M7C A;  5BNW A;  2YQ8 A;  1ELK A;  2FO1 E;  3FH8 A;  3NF1 A;  3BU8 A;  4JXT A;  2A5E A;  1MX6 A;  4XI9 A;  1H6O A;  4L1B A;  5A23 A;  3ZYK A;  4WAF A;  4HFG A;  4N5C A;  1XGW A;  3ISM C;  3LJN A;  2X38 A;  3SI5 A;  2YHC A;  4UWK A;  3JYS A;  4DI3 A;  4GPK A;  1JPL A;  3IBE A;  2BF0 X;  3QB2 A;  4U0S A;  3B7B A;  3TWR A;  4AV7 A;  4FA6 A;  3CK8 A;  4GMR A;  5JMN D;  3CVU A;  4FAD A;  4MKT A;  3UKU G;  4K03 A;  3BG0 B;  3CVN A;  1FVH A;  2IOS A;  2KBX A;  4G1T A;  4UQZ A;  4LRZ A;  1DVP A;  1E96 B;  3D9J A;  4GTT A;  3G2V A;  1IXV A;  3AG4 E;  2LXM A;  2VSO E;  4WWP A;  4L2Y A;  3I5P A;  2PQR A;  3D9M A;  4W9R A;  3T8K A;  1OCC E;  1TN8 A;  2PM7 A;  2XEV A;  1MHQ A;  4JPS A;  3Q79 A;  3IV0 A;  1DCE A;  2WXO A;  3V2X A;  3PUJ A;  5BV1 A;  4HI8 A;  1DCQ A;  5JHB A;  1OWL A;  3F6Q A;  4C48 B;  3T8M A;  5FJY A;  5EYP F;  3HYM B;  3CHQ A;  3UPV A;  3PZ2 A;  4ATG A;  1SQM A;  4NIK A;  3G2T A;  1IQR A;  2ZIR A;  3CST A;  3J5P A;  3TWS A;  2OEV A;  3FWV A;  3Q7A A;  2H6H A;  3G2S A;  2OCC E;  2I6H A;  1TNY A;  4WWN A;  3UX4 A;  3ZYQ A;  2WXL A;  4WND A;  4J8E A;  3C5R A;  5J08 A;  2R05 A;  1BU9 A;  1N95 A;  4JEH A;  1MZC A;  2GRL A;  2J4B A;  4F7A A;  5CMW A;  1FT1 A;  4U8H A;  4I1M A;  3V31 A;  2BKG A;  5EDS A;  3KD7 A;  3ONL A;  4AY5 A;  2KM4 A;  2EIK E;  2F8Y A;  5A6C A;  2CG2 A;  4DX2 A;  2Y69 E;  1U3C A;  5JJ6 A;  4I1A A;  3AU5 A;  1SA4 A;  2BTD A;  4YND A;  3CKC A;  3TG5 A;  3QWP A;  3UMV A;  1A5E A;  4J8F A;  1KZO A;  1PY1 A;  5CCM A;  4TUU A;  4HB5 A;  4N3C A;  1HX8 A;  4ILI A;  3JUI A;  5BXO A;  4EHM A;  2X6K A;  4EBA G;  1YCS B;  5HQ8 A;  2XGS A;  1W3B A;  3DSV A;  2XPZ A;  4C0E A;  1TJF A;  1N94 A;  3BQO A;  4G2V A; 
#chains in the Genus database with same CATH homology
 5D2M C;  2GRO B;  2IO3 C;  3UIN C;  2GRQ B;  1Z5S C;  2IY0 C;  3UIO C;  3UIP C;  1KPS B;  2GRR B;  2IO2 C;  2GRP B;  2GRN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...