1MZCA

Co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 33a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Farnesyltransferase alpha Subunit
publication title Dual Protein Farnesyltransferase-Geranylgeranyltransferase-I Inhibitors as Potential Cancer Chemotherapeutic Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 128
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1mzcA00
2IEJA 3PZ3A 1N4RA 3E37A 3HXFA 3PZ2A 1FPPA 4GTMA 1N94A 1TN6A 1S64A 3DSXA 4GTRA 4GTSA 4EHMA 1FT2A 3Q7FA 3HXEA 1DCEA 3HXCA 3E32A 1LD8A 3DSTA 1O1RA 3DPYA 4GTOA 1JCQA 2ZIRA 3E33A 1FT1A 1N4SA 3Q79A 2F0YA 2BEDA 3DSSA 4YDOA 1SA5A 1NI1A 1NL4A 1O5MA 3DSUA 3Q75A 1N9AA 2ZISA 4GTTA 3SFXA 3Q7AA 1KZPA 2R2LA 3HXBA 1MZCA 1SA4A 4GTQA 3KSQA 4LNBA 1X81A 3SFYA 3Q78A 3HXDA 1D8DA 3E34A 1O1TA 4YDEA 1QBQA 3EUVA 4L9PA 1S63A 2H6HA 1D8EA 1TNOA 1TN8A 2H6FA 3PZ4A 1JCSA 2H6GA 4GTPA 1O1SA 2H6IA 3PZ1A 3E30A 1TNZA 1TNBA 1LD7A 1TN7A 3DSVA 4GTVA 1N95A 1N4PA 4LNGA 1N4QA 1KZOA 3DRAA 1JCRA 1TNUA 3EU5A 1TNYA 3Q73A 1LTXA 3KSLA 3DSWA 3C72A 4MBGA
chains in the Genus database with same CATH superfamily
4FJZA 4L1BA 4I1MA 4N2SA 4GTMA 4UWGA 1TN6A 2BUGA 5EX0A 3PS6A 1INZA 5KJKA 4GTRA 5G05C 4XE0A 1YCSB 4JXTA 2VQ2A 3OXFA 1PY1A 2UY1B 4BTAA 2PM6A 2RKKA 2R17C 2RFAA 4IYPA 3V31A 4UI9C 1JCQA 4O1PA 1MHQA 4ME2A 3WG7E 4E85A 2X6JA 5HI7A 3UM2A 1SA5A 3ZIMA 4HB5A 4Y6WA 5CECB 4A1GA 1AP7A 5AENA 1N9AA 4I6EA 3D9MA 3R9MA 1MZCA 2R05A 2QYUA 2J49A 1OCOE 3FP3A 3PNTB 2WXMA 2EILE 3NBNB 3LKUA 2ZXWE 1IKND 3FULA 3CK9A 3LPZA 5HQ8A 3T5VA 1MYOA 1HZ4A 3PZ1A 1N95A 2VTBB 1Z3XA 5A7DB 3DXMG 3TAXA 3KSLA 2RFMA 3IEGA 3FTSA 1U3DA 4BSZB 1TJCA 4DI3A 5KNGA 3SO8A 3SBSA 3CHSA 3ONKA 2I9CA 4V3IA 2QC9A 5EDSA 3IV0A 3T5XA 4J7WA 4J8FA 4G8KA 3S2AA 1YMPA 5M72A 4UUCA 2HE0A 2ZGGA 2VJ8A 5CCMA 4B94A 3IBEA 4N2QA 2Y1LE 3T9KA 3B7SA 4JB8P 1Y8MA 5DBKA 3R7RA 4CGWA 1IHGA 4JVSA 3I5PA 4FHJA 4F53A 3FUEA 3FH7A 1S70B 4QQIA 4GCOA 3FU0A 1HE8A 2GW1A 2CFUA 4KZ0A 5AN8A 3LJ3A 4KVMA 4G8LA 2CHXA 4F1SA 1HFAA 1UJKA 4G2VA 3P1UA 5EX3A 5J90A 5CMYA 4GZ6A 3S7FA 1IHBA 1KPSB 4B8AA 3MX3A 4U0UA 2M63A 4CDNA 1TNYA 2WXJA 4A63B 4WNEA 2IEJA 2XPIA 1A17A 5AARA 4X8QA 1RW2A 1B89A 2WQ6A 2LNIA 3FTUA 3BG1B 3Q5MA 1MJ0A 4AIFA 4KYOB 2DBAA 4BWRA 4WUYA 1K1AA 3PZDA 4FLHA 4I6GA 5BPPA 1H19A 3EIQC 4LNUD 4PS3A 4U8HA 2WMNA 3IHYA 2R59A 3QWPA 5BV0A 4APFA 3CKBA 3VLFA 4G25A 4YNDA 3RU0A 1U3CA 3Q47B 2XEHA 3ML9A 3PUJA 2WXIA 4EBAA 4J8EA 4UWFA 1O1TA 5HRYA 1QBQA 5T3RA 3HYMB 2I6HA 1IXVA 2WXHA 3FY4A 4GZCA 3MEKA 3FWVA 1EF1C 2V4HC 2H6FA 3PZ4A 2LAHA 2GRNB 3ASDA 4N5QA 4I9CA 3ZXPA 5BXUA 1O1SA 3ZVVA 2IFUA 3D3MA 4JZYA 4I6JA 3TG4A 4PDXA 4KBQA 4N3AA 5CBOA 5T4YA 2P9KG 4D10C 1E8ZA 2J08A 3QB2A 4TXPA 5JA4D 3SQVA 2J07A 3HXFA 3TXNA 2KCLA 5E75A 1H6PA 1H6OA 2ZGDA 4LSZE 5FWQA 3ZPJA 3S7DA 1OWNA 3UT7A 3PNLB 2KM4A 4AJWA 4NRHB 3QKYA 3EHRA 2KZTA 2WXOA 1OWLA 2RG8A 3RIBA 5AQAA 1QZ2A 3G2UA 3D9PA 3FTYA 1HU3A 2WQ7A 2BEDA 3RAUA 1FVHA 5JHAA 3PH0C 4NACA 3CGHA 2OVBA 2I1JA 4UI9K 3LYAA 3LVQE 1EDUA 3L16A 3PREA 3TJPA 3FUNA 3JYSA 5BUZA 3KS2A 1MX6A 2WXPA 4PH4B 1UOHA 3DEPA 3EDTB 1WY6A 2V4LA 5LX8A 2B6CA 4HS2A 3AU4A 1D8EA 4GA2A 4JD2G 4ILGA 3NQPA 2VGEA 5FT9A 2VGXA 3TWQA 5B3SE 4FLBA 3PDNA 4YDYA 2XEVA 3FU3A 4BX9A 2NSZA 1PAQA 3D9JA 2CFZA 2QFCA 2C0LA 1KT0A 5G05J 4N39A 1JUQA 1DCQA 1HO8A 2QZAA 4F6RD 3D9LA 4GTSA 1A5EA 1E8XA 2P9LG 4ANUA 5D0QD 5T8IA 2GGFA 1DCEA 5FINA 2BF0X 2BKKB 3ZEFA 4DK5A 4RQIA 4B93B 1Z3YA 1N0QA 1WAO1 4BSXA 1OWOA 3G2VA 5ANRA 4ABNA 2OVFA 3RO2A 1YYHA 3KD7A 4YDOA 4A55A 2XS8A 3ASNE 3DEOA 5KJMA 2ETBA 4GMRA 3CVUA 2J8SD 3SF4A 3KSQA 3MKRA 3ML8A 1UN9A 2YNQA 4OVUA 4U8YD 2P2CP 2VSXE 1HX8A 2F8YA 1GW6A 5JJ7A 1E96B 4K5BA 2C2LA 1P5QA 1S0PA 3AG4E 3KEZA 4OAVB 3V2XA 4AVXA 5EIDA 5CBNA 3QC1A 4HRMB 3FUMA 2DVWA 4H7XA 1XNFA 5HKPA 2UY1A 3W9GA 1N11A 4L7TA 4YVOA 3E37A 2WXFA 3R7QA 5IY5E 1FVFA 5JJ6A 3DXKG 1ZBPA 3CVXA 2HO1A 2MHKA 2NXPA 4HRLA 3UM0A 2P9UG 2V0PA 3ENEA 4U04A 3DSTA 4XKCA 1SW6A 2YINA 3VLDA 3TWUA 3FU6A 4GAAA 2XZTG 2PNNA 4KT6B 4AOFA 3FU5A 4LRZA 3MYVA 3FFLA 3CV0A 1ELKA 1BI8B 2XZDG 3UUXA 3FTWA 2YHEA 4YDEA 4DX1A 4WWNA 3FDHA 4ATGA 4OVVA 1H6KA 2VSOE 4Q96A 4HOTA 1H2TC 4LEUA 1S63A 1Z6TA 2V5FA 3G2WA 2L9BA 2WXKA 2CG2A 3LEWA 3ZXSA 3L13A 2MOWA 1VDYA 4E6HA 3CVWA 4FU3A 3O48A 2XCCA 3PEUB 3CHOA 4URKA 3NB2A 4YVQC 4GYYA 3ASFA 3S7JA 3RK6A 1FPPA 3I3NA 5BW8C 4CYMD 4EZLA 1OCCE 4G24A 3HRAA 4GPMA 3K9IA 3JUEA 3PE4A 2VSNA 2IONA 3Q7FA 1BPOA 3UX4A 1K8KG 4LCTA 2LXLA 2DYRE 5D0OD 3QNKA 4GMJA 4NQ0A 3SY2A 1PC2A 5BT1A 4B0ZA 3OTNA 4UQXA 4KMOA 3Q15A 4MLPA 3AS5A 4JEUA 4RSYA 4J8DA 1KLXA 2R02A 3AJIA 1SZAA 3ZNGA 1WDYA 5CMWA 3C3RA 4ILHB 5EKQD 5FJYA 4GB9A 2WB2A 1BD8A 1OUVA 2ZU6B 3APCA 3CVNA 1NA0A 1JWGA 4IN3B 3UI2A 1HH8A 3MJWA 1TN8A 5LCWC 4IULA 4HVBA 1QYMA 3LXUX 1SQMA 2Y0BG 2H6IA 3PE3A 1QNFA 1TNBA 3ASHA 1TN7A 2F8XK 1Q2ZA 2KCKA 1AWCB 3CVPA 4BTBA 2DZOA 4TUMA 3JCKC 2R03A 1UW4B 3AS4A 3APFA 4Q94A 5CRVA 1ELRA 1OT8A 3SHFA 3DWLG 4ACKA 1JPLA 4AY5A 2A5UA 4I2ZA 4MKTA 4JW1A 2E0IA 1U2VG 4O60A 3ZW3A 2BKGA 3VLEA 1NFIE 2VYIA 3FUIA 3TWSA 1MQSA 3JQ1A 3U3WA 4B8CB 5ENTD 2IJGX 5EIBE 3VTXA 4GCNA 3MKQA 2Y4UA 4HXIA 3X2QE 3L54A 2JLBA 1SVXA 4IRUA 3TL5A 4B89A 2ZISA 5AQ7A 2AW6A 2WMOA 3LY7A 2BTDA 2WVIA 3SFYA 3UINC 2ILRA 5AQBA 4GA0A 4XEIG 3F6QA 4I1OB 3PRZA 3KAEA 3CVVA 3TGOA 4JHKA 5BNWA 4CCAA 1EYHA 3UQ3A 2XS1A 3L22A 3S7BA 4OYSA 2PQRA 2L0TB 3ZUVB 3RRUA 4BFRA 5HS0A 3IXEA 1W3BA 3ZHEA 1N4QA 4EQFA 1TNUA 3BU8A 3AG3E 4DPRA 3U66A 3CHQA 5EN5D 2KXPC 2PZIA 3PZ3A 3HHMA 3BG0B 4KXKB 2XQ0A 3V2OA 3C3OA 3ZYKA 3HDXA 3FH8A 2A4ZA 3MV2B 3SNXA 3IHVA 4JL0A 4J0UA 3DBSA 1K1BA 1Z5SC 2OEWA 5AIJA 3U4TA 4K0RA 4N3BA 4I17A 3FUDA 3QK0A 4K5AB 2NYJA 5ARGA 3G2SA 4EBAG 4BT8A 3L82A 4NURA 3FUHA 4HLLA 2KC7A 4M7CA 4TXQA 4EZJA 4CGVA 2PL2A 5KCMA 3T8KA 2XHEA 4LERA 3FUFA 1G3NB 4FADA 4GZDA 4C0MA 4GTTA 3SFXA 1IQUA 5C2YA 4ZHBA 4DX2A 1N52A 3UTMA 5FZQA 2XPYA 4UWKA 2HM8A 4UQZA 3FH5A 2CG3A 5EILA 4EZKA 3HXDA 1D8DA 4UQYA 4DLOA 5EYPF 3GW4A 4CDMA 4U0SA 2GRRB 4HNAD 2QY7A 2ETCA 3R9AB 3U64A 5AQ9A 2XCBA 4PS8A 4AXHA 2F37A 3BEEA 3AU5A 4JA7A 5FIOA 4DX5D 1LD7A 3CVYA 2DCPA 2KATA 4GTVA 5ENNA 1NP7A 3EHNA 1KZOA 4XKBA 3NOCD 3UKUG 2EIKE 4GYWA 1ELWA 3DSWA 2DZNA 4DX6D 3SD5A 3ZYMA 2V8SE 3ABKE 3B7BA 2AXVA 4L2YA 1E8YA 4JA9A 4EHMA 2V5QC 4TRQA 1BI7B 4JHJA 1UN8A 2WPVA 4C0EA 3LJNA 4OAUC 1L5JA 2IF4A 2KZTB 1E8WA 3V30A 3EJNA 3WXXA 4C9BB 1FT1A 3L17A 1LF8A 5FTPA 1KT1A 3Q79A 2F0YA 2FEZA 2LUHA 1UG3A 4H7YA 5FZSA 3Q75A 5CEDB 4Y6CA 3D9IA 2JABA 2R2LA 3IKOB 1SA4A 2FULA 4DJAA 4BESA 1D9SA 1X81A 3D9OA 3Q78A 3TXMA 3BUAA 3GZ1A 2OV8A 4CEMA 5B1AE 2FBNA 4CT4A 4JEHA 1HXIA 4HI9A 3C5RA 2L6JA 2EINE 4FP7A 3LDZA 2XENA 2WXQA 3E30A 5KBAA 3L6AA 2R5SA 4WNGA 3CSFA 4TXRA 3FTVA 4HORA 4A1SA 5A23A 1V54E 3LY9A 3RJVA 3CQGB 4WAFA 4BETA 2FI7A 4MBGA 4CRWA 4HOUA 1N4RA 5JJTA 2RD0A 3ABLE 1S64A 2DWZA 1TJFA 3DSXA 4ATZD 2QYJA 1TR4A 3B7UX 2XGOA 5D66A 4U63A 2IOSA 2CHZA 1ZU2A 3E32A 5G04J 1H2UA 3VTYA 1LD8A 3N71A 5LP0A 4AP2A 1TEZA 1WG0A 1N4SA 4O6FA 1H0AA 3B7RL 2J4DA 3P2BA 5ENOD 3LVRE 4HFGA 2P9SG 3UKRG 4ACLA 3CLJA 5G55A 3QWVA 3O4ZA 3MCXA 5LCWJ 3ULEG 2X6KA 4PS7A 3RKVA 3ZU7B 3MZLB 4U96D 1TNOA 5CRUA 3C98A 2Y3AA 5AYWD 4ZFHA 2P9NG 1E7UA 3LY8A 3J5QB 1N4PA 3PEVB 4LNGA 2VTBA 3CHPA 4JHRA 3TWWA 2AVPA 4ANWA 2Y4TA 3EU5A 2C0MA 3Q73A 4CT0A 3C72A 3ZYQA 2LAIA 4HOSA 5A6CA 3AAAC 1N94A 3OXGA 2LSUA 1SZ9A 3MGBA 4GYOA 3TWTA 4G23A 3GYZA 4Z68A 3CVQA 3UPVA 5BXOA 2XGSA 1FCHA 3HVEB 2LO6A 2GRQB 2IQCA 5ENPD 2EIME 3CEQA 3UIOC 4GTOA 4RG9A 5EYLA 1BU9A 5J08A 2WXNA 3SFZA 3URZA 3L9TA 1Y6IA 1MX2A 3FUJA 3TG5A 1KZPA 3NZUA 4HOQA 3CK8A 4LNBA 2EIJE 2JEKA 4MS6A 1NZNA 4JPSA 3ZRHA 2XRYA 3EU9A 2ETAA 4ANVA 5H7PA 5G04C 4HBDA 4FC8A 4JC8A 5AJLA 3CHRA 1JCSA 4AEZC 5AJDA 2OOEA 4GPKA 2IY0C 1N54A 3J5PA 4WNDA 3T8MA 4J8SA 4A3VA 4APOA 2X6IA 3DRAA 4DI4A 1X5BA 4N5CA 4AV7A 4RVBA 1OWPA 3GZ2A 2L6BA 4I43A 5AAOA 4NIKA 2I1KA 2L0IA 5LOZA 4TV3A 2WXGA 1UJJA 3FEXA 3RRMB 2J09A 5ENQD 4ILIA 4UWLA 4G26A 3BQOA 4XX5A 3B95A 2FO1E 1ZB1A 4I2WA 3ZKJA 5ENSD 3CKCA 4G1TA 5DIZA 2KBXA 5G2NA 3HIZA 1DNPA 2EQXA 4XI0A 1NI1A 1NL4A 4U7EB 4DLQA 4Q69A 4U8VD 1DC2A 2AXUA 3HXBA 5ITZF 2IOLA 1OCZE 4AY6A 3L08A 3E34A 3Q9UC 4ANXA 2X6FA 2YHCA 4L2LA 4GZ5A 4BY6A 3ZGQA 5FQ7A 4UWHA 3D9KA 1DVPA 2OCCE 3PVLA 4RLYA 1IYGA 1TNZA 3UMVA 3UM1A 4DX7D 3LS8A 2GRPB 3SZ7A 3ASGA 2XPZA 3GZSA 2Y69E 5CEAA 3AG1E 4XI9A 3SGHA 2MRIA 2X6HA 3ZFWA 3ULYA 3UIPC 3ESKA 4TUUA 3C3QA 2J9QA 4HQDA 4YDWA 4PUCA 3SI5A 2FF4A 1HF8A 3HXEA 3HXCA 4HLEA 4XZ4A 2KCVA 3E33A 3MKQB 2AXZA 1HG5A 5CERB 3Q4AB 3TWXA 2WXLA 3ABME 4BEPA 1N0RA 1IQRA 3Q9NC 3CHMA 5E76A 4BX8A 3ESLA 5ARFA 4GTQA 4DUIA 1K3ZD 4K5CA 5C1DA 2XEEA 3APDA 3CK7A 3CSTA 4J8YA 2AWIA 2P58C 2E2EA 2YQ8A 3TWVA 3AG2E 3FHEA 4U07A 2X38A 3OXLA 3EHQA 4KVOA 5B1BE 3KEAA 2PQNA 4BERA 4QFVA 4U95D 3RSEG 3ULQA 2XRZA 1HG2A 3FTZA 4GU5A 4WWOA 4GMLA 3JXJA 3ZHEB 2LXMA 3D9HA 3ZYLA 4FA6A 5JMND 4HI8A 4I1AA 4XIFA 2VSYA 2Q7FA 3PZ2A 3NF1A 2GROB 1YA0A 3QAQA 4F1PA 1QQEA 5CCLA 1MX4A 5KWDA 1EPUA 3I4RB 2FO7A 2OEVA 3E4BA 5JHBA 3CVLA 3D9NA 1OCRE 3DPDA 2UWJG 3FEYA 3QWWA 3DPYA 4I9EA 4MRUA 2HR2A 1OY3D 4R7LA 4FJYA 3MV3B 2HYZA 3JQ0A 4F7AA 1O5MA 3CQCB 3Q7AA 3CIAA 3MA5A 3HG0D 3LCAA 3UT4A 3QOUA 4CZ2D 2XGMA 4W9RA 1E90A 2MYOA 3UM3A 1NA3A 3QARA 4RG6A 1H2VC 3EUVA 4M3OA 2I2OA 1RZ4A 4AM9A 3G2TA 2P9IG 3ASOE 2ONDA 4WNFA 4CDRA 2H6GA 1E7VA 1JWFA 1WM5A 4GTPA 4N3CA 4UI9J 2PM7A 5FQ4A 3FUKA 4DRXE 2X3MA 1JCRA 3JXIA 1LTXA 3AS8A 2A5EA 3ONLA 2IU1A 4O1OA 4BT9A 5KJNA 2J4BA 3QDNA 2VGYA 4LUNU 4L23A 3UT8A 3CR3A 2GRMA 2VGXB 4J6IA 1TYQG 3ZN3A 4A3TA 3NAWA 1FT2A 3B13A 4KZCA 2GRLA 1HS6A 4C48B 2LSVA 4P29A 4GA1A 2IO3C 3Q49B 5ANLA 1O1RA 2CHWA 4FULA 3V79K 4WWPA 2ZIRA 3TWRA 1XGWA 2DYSE 5LFAA 4GZ3A 3UXGA 3EHMA 3DSSA 2WM9A 3B7TA 3DSUA 3PUKA 3EIJA 1BLXB 2DIWA 3RO3A 3SBTB 3QJZA 5KNHD 2P9PG 5D2MC 1V55E 3ISMC 2AJAA 4U0ZA 4EECA 4LG6A 2NC9A 4K03A 4HRNA 5FZRA 5BV1A 3JUIA 4L9PA 3I4GA 3NZSA 2H6HA 3OAWA 3FTXA 5ENRD 2WQHA 3RRNB 4F3VA 2B0OE 5FQ8A 1OWMA 3W9FA 2IO2C 4EPZA 1OXJA 4FHKA 5CHEE 2WXRA 3DSVA 4G11A 5FQ6A 3NOGD 3U9WA 3HVEA 5KJLA
chains in the Genus database with same CATH topology
2IEJA 3PZ3A 1N4RA 3E37A 3HXFA 3PZ2A 1FPPA 4GTMA 1N94A 1TN6A 1S64A 3DSXA 4GTRA 4GTSA 4EHMA 1FT2A 3Q7FA 3HXEA 1DCEA 3HXCA 3E32A 1LD8A 3DSTA 1O1RA 3DPYA 4GTOA 1JCQA 2ZIRA 3E33A 1FT1A 1N4SA 3Q79A 2F0YA 2BEDA 3DSSA 4YDOA 1SA5A 1NI1A 1NL4A 1O5MA 3DSUA 3Q75A 1N9AA 2ZISA 4GTTA 3SFXA 3Q7AA 1KZPA 2R2LA 3HXBA 1MZCA 1SA4A 4GTQA 3KSQA 4LNBA 1X81A 3SFYA 3Q78A 3HXDA 1D8DA 3E34A 1O1TA 4YDEA 1QBQA 3EUVA 4L9PA 1S63A 2H6HA 1D8EA 1TNOA 1TN8A 2H6FA 3PZ4A 1JCSA 2H6GA 4GTPA 1O1SA 2H6IA 3PZ1A 3E30A 1TNZA 1TNBA 1LD7A 1TN7A 3DSVA 4GTVA 1N95A 1N4PA 4LNGA 1N4QA 1KZOA 3DRAA 1JCRA 1TNUA 3EU5A 1TNYA 3Q73A 1LTXA 3KSLA 3DSWA 3C72A 4MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IEJ A;  3PZ3 A;  1N4R A;  3E37 A;  3HXF A;  3PZ2 A;  1FPP A;  4GTM A;  1N94 A;  1TN6 A;  1S64 A;  3DSX A;  4GTR A;  4GTS A;  4EHM A;  1FT2 A;  3Q7F A;  3HXE A;  1DCE A;  3HXC A;  3E32 A;  1LD8 A;  3DST A;  1O1R A;  3DPY A;  4GTO A;  1JCQ A;  2ZIR A;  3E33 A;  1FT1 A;  1N4S A;  3Q79 A;  2F0Y A;  2BED A;  3DSS A;  4YDO A;  1SA5 A;  1NI1 A;  1NL4 A;  1O5M A;  3DSU A;  3Q75 A;  1N9A A;  2ZIS A;  4GTT A;  3SFX A;  3Q7A A;  1KZP A;  2R2L A;  3HXB A;  1MZC A;  1SA4 A;  4GTQ A;  3KSQ A;  4LNB A;  1X81 A;  3SFY A;  3Q78 A;  3HXD A;  1D8D A;  3E34 A;  1O1T A;  4YDE A;  1QBQ A;  3EUV A;  4L9P A;  1S63 A;  2H6H A;  1D8E A;  1TNO A;  1TN8 A;  2H6F A;  3PZ4 A;  1JCS A;  2H6G A;  4GTP A;  1O1S A;  2H6I A;  3PZ1 A;  3E30 A;  1TNZ A;  1TNB A;  1LD7 A;  1TN7 A;  3DSV A;  4GTV A;  1N95 A;  1N4P A;  4LNG A;  1N4Q A;  1KZO A;  3DRA A;  1JCR A;  1TNU A;  3EU5 A;  1TNY A;  3Q73 A;  1LTX A;  3KSL A;  3DSW A;  3C72 A;  4MBG A; 
#chains in the Genus database with same CATH topology
 4FJZ A;  4L1B A;  4I1M A;  4N2S A;  4GTM A;  4UWG A;  1TN6 A;  2BUG A;  5EX0 A;  3PS6 A;  1INZ A;  5KJK A;  4GTR A;  5G05 C;  4XE0 A;  1YCS B;  4JXT A;  2VQ2 A;  3OXF A;  1PY1 A;  2UY1 B;  4BTA A;  2PM6 A;  2RKK A;  2R17 C;  2RFA A;  4IYP A;  3V31 A;  4UI9 C;  1JCQ A;  4O1P A;  1MHQ A;  4ME2 A;  3WG7 E;  4E85 A;  2X6J A;  5HI7 A;  3UM2 A;  1SA5 A;  3ZIM A;  4HB5 A;  4Y6W A;  5CEC B;  4A1G A;  1AP7 A;  5AEN A;  1N9A A;  4I6E A;  3D9M A;  3R9M A;  1MZC A;  2R05 A;  2QYU A;  2J49 A;  1OCO E;  3FP3 A;  3PNT B;  2WXM A;  2EIL E;  3NBN B;  3LKU A;  2ZXW E;  1IKN D;  3FUL A;  3CK9 A;  3LPZ A;  5HQ8 A;  3T5V A;  1MYO A;  1HZ4 A;  3PZ1 A;  1N95 A;  2VTB B;  1Z3X A;  5A7D B;  3DXM G;  3TAX A;  3KSL A;  2RFM A;  3IEG A;  3FTS A;  1U3D A;  4BSZ B;  1TJC A;  4DI3 A;  5KNG A;  3SO8 A;  3SBS A;  3CHS A;  3ONK A;  2I9C A;  4V3I A;  2QC9 A;  5EDS A;  3IV0 A;  3T5X A;  4J7W A;  4J8F A;  4G8K A;  3S2A A;  1YMP A;  5M72 A;  4UUC A;  2HE0 A;  2ZGG A;  2VJ8 A;  5CCM A;  4B94 A;  3IBE A;  4N2Q A;  2Y1L E;  3T9K A;  3B7S A;  4JB8 P;  1Y8M A;  5DBK A;  3R7R A;  4CGW A;  1IHG A;  4JVS A;  3I5P A;  4FHJ A;  4F53 A;  3FUE A;  3FH7 A;  1S70 B;  4QQI A;  4GCO A;  3FU0 A;  1HE8 A;  2GW1 A;  2CFU A;  4KZ0 A;  5AN8 A;  3LJ3 A;  4KVM A;  4G8L A;  2CHX A;  4F1S A;  1HFA A;  1UJK A;  4G2V A;  3P1U A;  5EX3 A;  5J90 A;  5CMY A;  4GZ6 A;  3S7F A;  1IHB A;  1KPS B;  4B8A A;  3MX3 A;  4U0U A;  2M63 A;  4CDN A;  1TNY A;  2WXJ A;  4A63 B;  4WNE A;  2IEJ A;  2XPI A;  1A17 A;  5AAR A;  4X8Q A;  1RW2 A;  1B89 A;  2WQ6 A;  2LNI A;  3FTU A;  3BG1 B;  3Q5M A;  1MJ0 A;  4AIF A;  4KYO B;  2DBA A;  4BWR A;  4WUY A;  1K1A A;  3PZD A;  4FLH A;  4I6G A;  5BPP A;  1H19 A;  3EIQ C;  4LNU D;  4PS3 A;  4U8H A;  2WMN A;  3IHY A;  2R59 A;  3QWP A;  5BV0 A;  4APF A;  3CKB A;  3VLF A;  4G25 A;  4YND A;  3RU0 A;  1U3C A;  3Q47 B;  2XEH A;  3ML9 A;  3PUJ A;  2WXI A;  4EBA A;  4J8E A;  4UWF A;  1O1T A;  5HRY A;  1QBQ A;  5T3R A;  3HYM B;  2I6H A;  1IXV A;  2WXH A;  3FY4 A;  4GZC A;  3MEK A;  3FWV A;  1EF1 C;  2V4H C;  2H6F A;  3PZ4 A;  2LAH A;  2GRN B;  3ASD A;  4N5Q A;  4I9C A;  3ZXP A;  5BXU A;  1O1S A;  3ZVV A;  2IFU A;  3D3M A;  4JZY A;  4I6J A;  3TG4 A;  4PDX A;  4KBQ A;  4N3A A;  5CBO A;  5T4Y A;  2P9K G;  4D10 C;  1E8Z A;  2J08 A;  3QB2 A;  4TXP A;  5JA4 D;  3SQV A;  2J07 A;  3HXF A;  3TXN A;  2KCL A;  5E75 A;  1H6P A;  1H6O A;  2ZGD A;  4LSZ E;  5FWQ A;  3ZPJ A;  3S7D A;  1OWN A;  3UT7 A;  3PNL B;  2KM4 A;  4AJW A;  4NRH B;  3QKY A;  3EHR A;  2KZT A;  2WXO A;  1OWL A;  2RG8 A;  3RIB A;  5AQA A;  1QZ2 A;  3G2U A;  3D9P A;  3FTY A;  1HU3 A;  2WQ7 A;  2BED A;  3RAU A;  1FVH A;  5JHA A;  3PH0 C;  4NAC A;  3CGH A;  2OVB A;  2I1J A;  4UI9 K;  3LYA A;  3LVQ E;  1EDU A;  3L16 A;  3PRE A;  3TJP A;  3FUN A;  3JYS A;  5BUZ A;  3KS2 A;  1MX6 A;  2WXP A;  4PH4 B;  1UOH A;  3DEP A;  3EDT B;  1WY6 A;  2V4L A;  5LX8 A;  2B6C A;  4HS2 A;  3AU4 A;  1D8E A;  4GA2 A;  4JD2 G;  4ILG A;  3NQP A;  2VGE A;  5FT9 A;  2VGX A;  3TWQ A;  5B3S E;  4FLB A;  3PDN A;  4YDY A;  2XEV A;  3FU3 A;  4BX9 A;  2NSZ A;  1PAQ A;  3D9J A;  2CFZ A;  2QFC A;  2C0L A;  1KT0 A;  5G05 J;  4N39 A;  1JUQ A;  1DCQ A;  1HO8 A;  2QZA A;  4F6R D;  3D9L A;  4GTS A;  1A5E A;  1E8X A;  2P9L G;  4ANU A;  5D0Q D;  5T8I A;  2GGF A;  1DCE A;  5FIN A;  2BF0 X;  2BKK B;  3ZEF A;  4DK5 A;  4RQI A;  4B93 B;  1Z3Y A;  1N0Q A;  1WAO 1;  4BSX A;  1OWO A;  3G2V A;  5ANR A;  4ABN A;  2OVF A;  3RO2 A;  1YYH A;  3KD7 A;  4YDO A;  4A55 A;  2XS8 A;  3ASN E;  3DEO A;  5KJM A;  2ETB A;  4GMR A;  3CVU A;  2J8S D;  3SF4 A;  3KSQ A;  3MKR A;  3ML8 A;  1UN9 A;  2YNQ A;  4OVU A;  4U8Y D;  2P2C P;  2VSX E;  1HX8 A;  2F8Y A;  1GW6 A;  5JJ7 A;  1E96 B;  4K5B A;  2C2L A;  1P5Q A;  1S0P A;  3AG4 E;  3KEZ A;  4OAV B;  3V2X A;  4AVX A;  5EID A;  5CBN A;  3QC1 A;  4HRM B;  3FUM A;  2DVW A;  4H7X A;  1XNF A;  5HKP A;  2UY1 A;  3W9G A;  1N11 A;  4L7T A;  4YVO A;  3E37 A;  2WXF A;  3R7Q A;  5IY5 E;  1FVF A;  5JJ6 A;  3DXK G;  1ZBP A;  3CVX A;  2HO1 A;  2MHK A;  2NXP A;  4HRL A;  3UM0 A;  2P9U G;  2V0P A;  3ENE A;  4U04 A;  3DST A;  4XKC A;  1SW6 A;  2YIN A;  3VLD A;  3TWU A;  3FU6 A;  4GAA A;  2XZT G;  2PNN A;  4KT6 B;  4AOF A;  3FU5 A;  4LRZ A;  3MYV A;  3FFL A;  3CV0 A;  1ELK A;  1BI8 B;  2XZD G;  3UUX A;  3FTW A;  2YHE A;  4YDE A;  4DX1 A;  4WWN A;  3FDH A;  4ATG A;  4OVV A;  1H6K A;  2VSO E;  4Q96 A;  4HOT A;  1H2T C;  4LEU A;  1S63 A;  1Z6T A;  2V5F A;  3G2W A;  2L9B A;  2WXK A;  2CG2 A;  3LEW A;  3ZXS A;  3L13 A;  2MOW A;  1VDY A;  4E6H A;  3CVW A;  4FU3 A;  3O48 A;  2XCC A;  3PEU B;  3CHO A;  4URK A;  3NB2 A;  4YVQ C;  4GYY A;  3ASF A;  3S7J A;  3RK6 A;  1FPP A;  3I3N A;  5BW8 C;  4CYM D;  4EZL A;  1OCC E;  4G24 A;  3HRA A;  4GPM A;  3K9I A;  3JUE A;  3PE4 A;  2VSN A;  2ION A;  3Q7F A;  1BPO A;  3UX4 A;  1K8K G;  4LCT A;  2LXL A;  2DYR E;  5D0O D;  3QNK A;  4GMJ A;  4NQ0 A;  3SY2 A;  1PC2 A;  5BT1 A;  4B0Z A;  3OTN A;  4UQX A;  4KMO A;  3Q15 A;  4MLP A;  3AS5 A;  4JEU A;  4RSY A;  4J8D A;  1KLX A;  2R02 A;  3AJI A;  1SZA A;  3ZNG A;  1WDY A;  5CMW A;  3C3R A;  4ILH B;  5EKQ D;  5FJY A;  4GB9 A;  2WB2 A;  1BD8 A;  1OUV A;  2ZU6 B;  3APC A;  3CVN A;  1NA0 A;  1JWG A;  4IN3 B;  3UI2 A;  1HH8 A;  3MJW A;  1TN8 A;  5LCW C;  4IUL A;  4HVB A;  1QYM A;  3LXU X;  1SQM A;  2Y0B G;  2H6I A;  3PE3 A;  1QNF A;  1TNB A;  3ASH A;  1TN7 A;  2F8X K;  1Q2Z A;  2KCK A;  1AWC B;  3CVP A;  4BTB A;  2DZO A;  4TUM A;  3JCK C;  2R03 A;  1UW4 B;  3AS4 A;  3APF A;  4Q94 A;  5CRV A;  1ELR A;  1OT8 A;  3SHF A;  3DWL G;  4ACK A;  1JPL A;  4AY5 A;  2A5U A;  4I2Z A;  4MKT A;  4JW1 A;  2E0I A;  1U2V G;  4O60 A;  3ZW3 A;  2BKG A;  3VLE A;  1NFI E;  2VYI A;  3FUI A;  3TWS A;  1MQS A;  3JQ1 A;  3U3W A;  4B8C B;  5ENT D;  2IJG X;  5EIB E;  3VTX A;  4GCN A;  3MKQ A;  2Y4U A;  4HXI A;  3X2Q E;  3L54 A;  2JLB A;  1SVX A;  4IRU A;  3TL5 A;  4B89 A;  2ZIS A;  5AQ7 A;  2AW6 A;  2WMO A;  3LY7 A;  2BTD A;  2WVI A;  3SFY A;  3UIN C;  2ILR A;  5AQB A;  4GA0 A;  4XEI G;  3F6Q A;  4I1O B;  3PRZ A;  3KAE A;  3CVV A;  3TGO A;  4JHK A;  5BNW A;  4CCA A;  1EYH A;  3UQ3 A;  2XS1 A;  3L22 A;  3S7B A;  4OYS A;  2PQR A;  2L0T B;  3ZUV B;  3RRU A;  4BFR A;  5HS0 A;  3IXE A;  1W3B A;  3ZHE A;  1N4Q A;  4EQF A;  1TNU A;  3BU8 A;  3AG3 E;  4DPR A;  3U66 A;  3CHQ A;  5EN5 D;  2KXP C;  2PZI A;  3PZ3 A;  3HHM A;  3BG0 B;  4KXK B;  2XQ0 A;  3V2O A;  3C3O A;  3ZYK A;  3HDX A;  3FH8 A;  2A4Z A;  3MV2 B;  3SNX A;  3IHV A;  4JL0 A;  4J0U A;  3DBS A;  1K1B A;  1Z5S C;  2OEW A;  5AIJ A;  3U4T A;  4K0R A;  4N3B A;  4I17 A;  3FUD A;  3QK0 A;  4K5A B;  2NYJ A;  5ARG A;  3G2S A;  4EBA G;  4BT8 A;  3L82 A;  4NUR A;  3FUH A;  4HLL A;  2KC7 A;  4M7C A;  4TXQ A;  4EZJ A;  4CGV A;  2PL2 A;  5KCM A;  3T8K A;  2XHE A;  4LER A;  3FUF A;  1G3N B;  4FAD A;  4GZD A;  4C0M A;  4GTT A;  3SFX A;  1IQU A;  5C2Y A;  4ZHB A;  4DX2 A;  1N52 A;  3UTM A;  5FZQ A;  2XPY A;  4UWK A;  2HM8 A;  4UQZ A;  3FH5 A;  2CG3 A;  5EIL A;  4EZK A;  3HXD A;  1D8D A;  4UQY A;  4DLO A;  5EYP F;  3GW4 A;  4CDM A;  4U0S A;  2GRR B;  4HNA D;  2QY7 A;  2ETC A;  3R9A B;  3U64 A;  5AQ9 A;  2XCB A;  4PS8 A;  4AXH A;  2F37 A;  3BEE A;  3AU5 A;  4JA7 A;  5FIO A;  4DX5 D;  1LD7 A;  3CVY A;  2DCP A;  2KAT A;  4GTV A;  5ENN A;  1NP7 A;  3EHN A;  1KZO A;  4XKB A;  3NOC D;  3UKU G;  2EIK E;  4GYW A;  1ELW A;  3DSW A;  2DZN A;  4DX6 D;  3SD5 A;  3ZYM A;  2V8S E;  3ABK E;  3B7B A;  2AXV A;  4L2Y A;  1E8Y A;  4JA9 A;  4EHM A;  2V5Q C;  4TRQ A;  1BI7 B;  4JHJ A;  1UN8 A;  2WPV A;  4C0E A;  3LJN A;  4OAU C;  1L5J A;  2IF4 A;  2KZT B;  1E8W A;  3V30 A;  3EJN A;  3WXX A;  4C9B B;  1FT1 A;  3L17 A;  1LF8 A;  5FTP A;  1KT1 A;  3Q79 A;  2F0Y A;  2FEZ A;  2LUH A;  1UG3 A;  4H7Y A;  5FZS A;  3Q75 A;  5CED B;  4Y6C A;  3D9I A;  2JAB A;  2R2L A;  3IKO B;  1SA4 A;  2FUL A;  4DJA A;  4BES A;  1D9S A;  1X81 A;  3D9O A;  3Q78 A;  3TXM A;  3BUA A;  3GZ1 A;  2OV8 A;  4CEM A;  5B1A E;  2FBN A;  4CT4 A;  4JEH A;  1HXI A;  4HI9 A;  3C5R A;  2L6J A;  2EIN E;  4FP7 A;  3LDZ A;  2XEN A;  2WXQ A;  3E30 A;  5KBA A;  3L6A A;  2R5S A;  4WNG A;  3CSF A;  4TXR A;  3FTV A;  4HOR A;  4A1S A;  5A23 A;  1V54 E;  3LY9 A;  3RJV A;  3CQG B;  4WAF A;  4BET A;  2FI7 A;  4MBG A;  4CRW A;  4HOU A;  1N4R A;  5JJT A;  2RD0 A;  3ABL E;  1S64 A;  2DWZ A;  1TJF A;  3DSX A;  4ATZ D;  2QYJ A;  1TR4 A;  3B7U X;  2XGO A;  5D66 A;  4U63 A;  2IOS A;  2CHZ A;  1ZU2 A;  3E32 A;  5G04 J;  1H2U A;  3VTY A;  1LD8 A;  3N71 A;  5LP0 A;  4AP2 A;  1TEZ A;  1WG0 A;  1N4S A;  4O6F A;  1H0A A;  3B7R L;  2J4D A;  3P2B A;  5ENO D;  3LVR E;  4HFG A;  2P9S G;  3UKR G;  4ACL A;  3CLJ A;  5G55 A;  3QWV A;  3O4Z A;  3MCX A;  5LCW J;  3ULE G;  2X6K A;  4PS7 A;  3RKV A;  3ZU7 B;  3MZL B;  4U96 D;  1TNO A;  5CRU A;  3C98 A;  2Y3A A;  5AYW D;  4ZFH A;  2P9N G;  1E7U A;  3LY8 A;  3J5Q B;  1N4P A;  3PEV B;  4LNG A;  2VTB A;  3CHP A;  4JHR A;  3TWW A;  2AVP A;  4ANW A;  2Y4T A;  3EU5 A;  2C0M A;  3Q73 A;  4CT0 A;  3C72 A;  3ZYQ A;  2LAI A;  4HOS A;  5A6C A;  3AAA C;  1N94 A;  3OXG A;  2LSU A;  1SZ9 A;  3MGB A;  4GYO A;  3TWT A;  4G23 A;  3GYZ A;  4Z68 A;  3CVQ A;  3UPV A;  5BXO A;  2XGS A;  1FCH A;  3HVE B;  2LO6 A;  2GRQ B;  2IQC A;  5ENP D;  2EIM E;  3CEQ A;  3UIO C;  4GTO A;  4RG9 A;  5EYL A;  1BU9 A;  5J08 A;  2WXN A;  3SFZ A;  3URZ A;  3L9T A;  1Y6I A;  1MX2 A;  3FUJ A;  3TG5 A;  1KZP A;  3NZU A;  4HOQ A;  3CK8 A;  4LNB A;  2EIJ E;  2JEK A;  4MS6 A;  1NZN A;  4JPS A;  3ZRH A;  2XRY A;  3EU9 A;  2ETA A;  4ANV A;  5H7P A;  5G04 C;  4HBD A;  4FC8 A;  4JC8 A;  5AJL A;  3CHR A;  1JCS A;  4AEZ C;  5AJD A;  2OOE A;  4GPK A;  2IY0 C;  1N54 A;  3J5P A;  4WND A;  3T8M A;  4J8S A;  4A3V A;  4APO A;  2X6I A;  3DRA A;  4DI4 A;  1X5B A;  4N5C A;  4AV7 A;  4RVB A;  1OWP A;  3GZ2 A;  2L6B A;  4I43 A;  5AAO A;  4NIK A;  2I1K A;  2L0I A;  5LOZ A;  4TV3 A;  2WXG A;  1UJJ A;  3FEX A;  3RRM B;  2J09 A;  5ENQ D;  4ILI A;  4UWL A;  4G26 A;  3BQO A;  4XX5 A;  3B95 A;  2FO1 E;  1ZB1 A;  4I2W A;  3ZKJ A;  5ENS D;  3CKC A;  4G1T A;  5DIZ A;  2KBX A;  5G2N A;  3HIZ A;  1DNP A;  2EQX A;  4XI0 A;  1NI1 A;  1NL4 A;  4U7E B;  4DLQ A;  4Q69 A;  4U8V D;  1DC2 A;  2AXU A;  3HXB A;  5ITZ F;  2IOL A;  1OCZ E;  4AY6 A;  3L08 A;  3E34 A;  3Q9U C;  4ANX A;  2X6F A;  2YHC A;  4L2L A;  4GZ5 A;  4BY6 A;  3ZGQ A;  5FQ7 A;  4UWH A;  3D9K A;  1DVP A;  2OCC E;  3PVL A;  4RLY A;  1IYG A;  1TNZ A;  3UMV A;  3UM1 A;  4DX7 D;  3LS8 A;  2GRP B;  3SZ7 A;  3ASG A;  2XPZ A;  3GZS A;  2Y69 E;  5CEA A;  3AG1 E;  4XI9 A;  3SGH A;  2MRI A;  2X6H A;  3ZFW A;  3ULY A;  3UIP C;  3ESK A;  4TUU A;  3C3Q A;  2J9Q A;  4HQD A;  4YDW A;  4PUC A;  3SI5 A;  2FF4 A;  1HF8 A;  3HXE A;  3HXC A;  4HLE A;  4XZ4 A;  2KCV A;  3E33 A;  3MKQ B;  2AXZ A;  1HG5 A;  5CER B;  3Q4A B;  3TWX A;  2WXL A;  3ABM E;  4BEP A;  1N0R A;  1IQR A;  3Q9N C;  3CHM A;  5E76 A;  4BX8 A;  3ESL A;  5ARF A;  4GTQ A;  4DUI A;  1K3Z D;  4K5C A;  5C1D A;  2XEE A;  3APD A;  3CK7 A;  3CST A;  4J8Y A;  2AWI A;  2P58 C;  2E2E A;  2YQ8 A;  3TWV A;  3AG2 E;  3FHE A;  4U07 A;  2X38 A;  3OXL A;  3EHQ A;  4KVO A;  5B1B E;  3KEA A;  2PQN A;  4BER A;  4QFV A;  4U95 D;  3RSE G;  3ULQ A;  2XRZ A;  1HG2 A;  3FTZ A;  4GU5 A;  4WWO A;  4GML A;  3JXJ A;  3ZHE B;  2LXM A;  3D9H A;  3ZYL A;  4FA6 A;  5JMN D;  4HI8 A;  4I1A A;  4XIF A;  2VSY A;  2Q7F A;  3PZ2 A;  3NF1 A;  2GRO B;  1YA0 A;  3QAQ A;  4F1P A;  1QQE A;  5CCL A;  1MX4 A;  5KWD A;  1EPU A;  3I4R B;  2FO7 A;  2OEV A;  3E4B A;  5JHB A;  3CVL A;  3D9N A;  1OCR E;  3DPD A;  2UWJ G;  3FEY A;  3QWW A;  3DPY A;  4I9E A;  4MRU A;  2HR2 A;  1OY3 D;  4R7L A;  4FJY A;  3MV3 B;  2HYZ A;  3JQ0 A;  4F7A A;  1O5M A;  3CQC B;  3Q7A A;  3CIA A;  3MA5 A;  3HG0 D;  3LCA A;  3UT4 A;  3QOU A;  4CZ2 D;  2XGM A;  4W9R A;  1E90 A;  2MYO A;  3UM3 A;  1NA3 A;  3QAR A;  4RG6 A;  1H2V C;  3EUV A;  4M3O A;  2I2O A;  1RZ4 A;  4AM9 A;  3G2T A;  2P9I G;  3ASO E;  2OND A;  4WNF A;  4CDR A;  2H6G A;  1E7V A;  1JWF A;  1WM5 A;  4GTP A;  4N3C A;  4UI9 J;  2PM7 A;  5FQ4 A;  3FUK A;  4DRX E;  2X3M A;  1JCR A;  3JXI A;  1LTX A;  3AS8 A;  2A5E A;  3ONL A;  2IU1 A;  4O1O A;  4BT9 A;  5KJN A;  2J4B A;  3QDN A;  2VGY A;  4LUN U;  4L23 A;  3UT8 A;  3CR3 A;  2GRM A;  2VGX B;  4J6I A;  1TYQ G;  3ZN3 A;  4A3T A;  3NAW A;  1FT2 A;  3B13 A;  4KZC A;  2GRL A;  1HS6 A;  4C48 B;  2LSV A;  4P29 A;  4GA1 A;  2IO3 C;  3Q49 B;  5ANL A;  1O1R A;  2CHW A;  4FUL A;  3V79 K;  4WWP A;  2ZIR A;  3TWR A;  1XGW A;  2DYS E;  5LFA A;  4GZ3 A;  3UXG A;  3EHM A;  3DSS A;  2WM9 A;  3B7T A;  3DSU A;  3PUK A;  3EIJ A;  1BLX B;  2DIW A;  3RO3 A;  3SBT B;  3QJZ A;  5KNH D;  2P9P G;  5D2M C;  1V55 E;  3ISM C;  2AJA A;  4U0Z A;  4EEC A;  4LG6 A;  2NC9 A;  4K03 A;  4HRN A;  5FZR A;  5BV1 A;  3JUI A;  4L9P A;  3I4G A;  3NZS A;  2H6H A;  3OAW A;  3FTX A;  5ENR D;  2WQH A;  3RRN B;  4F3V A;  2B0O E;  5FQ8 A;  1OWM A;  3W9F A;  2IO2 C;  4EPZ A;  1OXJ A;  4FHK A;  5CHE E;  2WXR A;  3DSV A;  4G11 A;  5FQ6 A;  3NOG D;  3U9W A;  3HVE A;  5KJL A; 
#chains in the Genus database with same CATH homology
 2IEJ A;  3PZ3 A;  1N4R A;  3E37 A;  3HXF A;  3PZ2 A;  1FPP A;  4GTM A;  1N94 A;  1TN6 A;  1S64 A;  3DSX A;  4GTR A;  4GTS A;  4EHM A;  1FT2 A;  3Q7F A;  3HXE A;  1DCE A;  3HXC A;  3E32 A;  1LD8 A;  3DST A;  1O1R A;  3DPY A;  4GTO A;  1JCQ A;  2ZIR A;  3E33 A;  1FT1 A;  1N4S A;  3Q79 A;  2F0Y A;  2BED A;  3DSS A;  4YDO A;  1SA5 A;  1NI1 A;  1NL4 A;  1O5M A;  3DSU A;  3Q75 A;  1N9A A;  2ZIS A;  4GTT A;  3SFX A;  3Q7A A;  1KZP A;  2R2L A;  3HXB A;  1MZC A;  1SA4 A;  4GTQ A;  3KSQ A;  4LNB A;  1X81 A;  3SFY A;  3Q78 A;  3HXD A;  1D8D A;  3E34 A;  1O1T A;  4YDE A;  1QBQ A;  3EUV A;  4L9P A;  1S63 A;  2H6H A;  1D8E A;  1TNO A;  1TN8 A;  2H6F A;  3PZ4 A;  1JCS A;  2H6G A;  4GTP A;  1O1S A;  2H6I A;  3PZ1 A;  3E30 A;  1TNZ A;  1TNB A;  1LD7 A;  1TN7 A;  3DSV A;  4GTV A;  1N95 A;  1N4P A;  4LNG A;  1N4Q A;  1KZO A;  3DRA A;  1JCR A;  1TNU A;  3EU5 A;  1TNY A;  3Q73 A;  1LTX A;  3KSL A;  3DSW A;  3C72 A;  4MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...