1MZCA

Co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 33a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein Farnesyltransferase alpha Subunit
publication title Dual Protein Farnesyltransferase-Geranylgeranyltransferase-I Inhibitors as Potential Cancer Chemotherapeutic Agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 128
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1mzcA00
3Q78A 2H6IA 1SA4A 1JCSA 3E32A 1O5MA 1KZPA 3KSQA 3DSUA 1TNUA 1JCQA 1O1RA 1TNOA 3HXFA 3PZ2A 2ZISA 2BEDA 4GTTA 1JCRA 3E33A 2IEJA 3SFYA 4GTOA 2H6FA 1FT1A 1QBQA 1S63A 3HXBA 3HXCA 3DSTA 4GTSA 3DSSA 3E37A 1D8DA 3DSXA 1LD8A 3HXDA 1O1TA 1N9AA 1X81A 3DPYA 4GTMA 1LD7A 1TN8A 1D8EA 3Q7FA 4L9PA 2F0YA 3C72A 3PZ3A 3DSVA 1FPPA 1N4SA 2H6HA 1N94A 1N4QA 1TN7A 1DCEA 4GTPA 3Q73A 4LNGA 1NL4A 3E34A 2R2LA 2H6GA 4GTQA 2ZIRA 1N95A 1TNZA 3Q79A 1FT2A 1TNYA 3E30A 3KSLA 3DSWA 1LTXA 1KZOA 4GTVA 1O1SA 1S64A 3HXEA 4GTRA 3PZ4A 3DRAA 1N4RA 1SA5A 1NI1A 1TN6A 4YDOA 1TNBA 3Q75A 1N4PA 3SFXA 4YDEA 4LNBA 3EU5A 3PZ1A 4EHMA 4MBGA 3Q7AA 3EUVA 1MZCA
chains in the Genus database with same CATH superfamily
2B6CA 2XCBA 3ZPJA 3FUIA 1OY3D 1MX6A 3MV3B 2XGSA 5DBKA 2CHWA 4AP2A 4WNFA 2Y4TA 2IF4A 3GYZA 2BTDA 1D8DA 3Q47B 3RJVA 4GPKA 4NIKA 2MHKA 3FUMA 2GRQB 4FLHA 3FUKA 2B0OE 3ZXSA 2AXZA 3G2VA 4PS3A 5AQ7A 3AJIA 3E34A 2XGOA 4XIFA 2QFCA 3CEQA 3B7RL 4UI9C 2L6JA 1NA0A 4O6FA 3R9AB 3P2BA 3NAWA 1WAO1 3S7JA 3TWVA 1HG2A 4JPSA 5CBNA 1H2VC 1INZA 3IHYA 1N4RA 4HFGA 2NYJA 1SZAA 1JWGA 4ZHBA 3CHPA 4GA0A 4AEZC 4O1OA 2FO1E 5AQ9A 3L16A 4LSZE 5CMWA 4MBGA 5EILA 3Q7AA 2P9SG 3CKCA 3D9LA 4I2ZA 4N2SA 2J8SD 3UKRG 3ZYLA 3WG7E 4M7CA 2ETAA 5FJYA 2F37A 4OVUA 3OXFA 2CFZA 3DSSA 1MHQA 4NURA 4BY6A 3PE4A 3RKVA 1YCSB 3PNLB 1E8WA 2ETBA 3UT8A 1MQSA 1D8EA 1UOHA 2VJ8A 4OYSA 5KJNA 4IN3B 4U7EB 2V5QC 2LO6A 4J8SA 4HBDA 4DX2A 2GGFA 4RG9A 4YVOA 5HI7A 3Q73A 3EHNA 1FVFA 3IV0A 3NZSA 1TNZA 1Z5SC 3SY2A 3I3NA 2XEVA 3RRUA 4TV3A 3ONLA 4BEPA 5LX8A 4UWGA 2DWZA 3CK8A 3DRAA 4AJWA 1E90A 3AS8A 4GYOA 4AM9A 1U3DA 1N54A 3AG4E 3CVQA 2OEWA 1OWOA 1DC2A 3GZSA 3CLJA 3L54A 3V79K 1XNFA 3D9NA 3LVQE 1TEZA 4DLOA 3D9JA 4MKTA 5JJ7A 3ONKA 4EZJA 2WM9A 3AG1E 4HLLA 4A55A 3PEVB 5FZSA 4JEUA 3L08A 1AWCB 2A4ZA 2V8SE 4B0ZA 3CSTA 4O60A 3PREA 2DCPA 4DI4A 1RW2A 3S2AA 5ITZF 4AV7A 4L9PA 5FINA 5EX0A 3D9PA 3PDNA 4J6IA 4WNGA 4YNDA 1DCEA 3VLEA 4GTPA 4LNGA 4HOQA 3JXJA 1N0RA 5FQ6A 3IXEA 3QNKA 1IQRA 2P9NG 5HKPA 4IRUA 2MOWA 2JEKA 2L0IA 2XCCA 3BU8A 3ABKE 3Q79A 1FT2A 4JHJA 3RO3A 3LYAA 4BTBA 3EHRA 2FF4A 4AY6A 3J5QB 3QOUA 5D66A 3ML9A 4KVMA 3GW4A 3SHFA 3CHSA 3SFXA 3TG5A 2WXJA 2VGYA 3PZ1A 2GRNB 4ANWA 4GA2A 4WUYA 3FUFA 3I5PA 4UWFA 3JUEA 2HE0A 3G2UA 3UM3A 5CRUA 1Z3YA 4ABNA 3E33A 4I1MA 4BETA 1OCZE 5KCMA 3IEGA 1S70B 2IO2C 2R03A 3ASOE 4GAAA 3PNTB 4HQDA 2WXRA 3C72A 4G8KA 2WXFA 3U3WA 2H6HA 4L2LA 3ULQA 3BUAA 5CMYA 4N2QA 2VSOE 5ENNA 5G2NA 5CCMA 5ENTD 2AVPA 4CYMD 3JQ1A 1H2TC 4CDNA 3LY9A 4V3IA 3RRMB 1N52A 1KLXA 3CVLA 3F6QA 4FLBA 1EPUA 5G55A 2HM8A 1BLXB 4A3VA 4FJYA 3VTYA 4UI9K 5ARGA 1S64A 4UWLA 5CECB 5HRYA 3SO8A 5EIBE 3APDA 3AAAC 1EDUA 3UMVA 4L2YA 5A7DB 1DCQA 1VDYA 4HXIA 2YNQA 3MEKA 2YHEA 4JZYA 3TWWA 2WXLA 2ZGGA 3Q78A 3RRNB 2H6IA 4DX6D 3QDNA 4DI3A 3KSQA 2DBAA 1HG5A 4J8FA 1TNOA 4OVVA 2BEDA 4PUCA 4UQXA 2WXKA 2XQ0A 3DXMG 4K5AB 3BQOA 3URZA 5CHEE 1MJ0A 4FULA 4ZFHA 4A1SA 2IOSA 2J07A 3MGBA 3EIQC 2V5FA 2IY0C 3DEOA 5KNHD 2AWIA 4U04A 1P5QA 2IFUA 5B1AE 4JW1A 3ZU7B 2C0LA 3ZYQA 4ATGA 4U0ZA 5CEAA 2WB2A 5AN8A 5E75A 4CGWA 3ZFWA 1JUQA 4B94A 4E6HA 5FT9A 3ZHEA 1TNYA 3MJWA 4GZ5A 3LJ3A 4GZ3A 3Q5MA 4HB5A 4AIFA 1X5BA 1WG0A 4EECA 3T5VA 4JA9A 2VGXA 4G23A 3QWPA 3W9GA 3CK9A 4I2WA 2YHCA 1H6OA 3TGOA 3MKQA 2KBXA 2WVIA 2LAHA 4FHKA 1HZ4A 1OCRE 4WNDA 1JCQA 3PZ2A 1YYHA 4I1OB 2V4HC 4HI8A 3D9KA 3I4RB 4JEHA 5BXOA 5BV1A 3HXBA 4XZ4A 4N3BA 2L6BA 4JA7A 4WWNA 4I9CA 1A5EA 1N9AA 3R7QA 4ACKA 2PL2A 3LPZA 3N71A 4U0SA 4ME2A 3ZIMA 1TN8A 2CG3A 3S7DA 3Q7FA 3NBNB 3CV0A 4HS2A 3FUHA 2WXGA 4XX5A 3FY4A 5FWQA 2BKKB 4UQYA 3SD5A 5EKQD 2OOEA 3RIBA 2XZTG 4C0MA 4Z68A 3FH8A 4YVQC 3ZKJA 3PRZA 2ZU6B 2QYJA 1K8KG 2OEVA 3TWTA 4JD2G 1E96B 4JHKA 2VTBA 3UUXA 3EHMA 4L1BA 2J9QA 3MA5A 3UTMA 2RFMA 4CDRA 4F53A 3ULYA 3C3QA 3TXMA 5J08A 3CVUA 5AAOA 3UM2A 4A1GA 1XGWA 5BT1A 3ABLE 3JXIA 3D9IA 4U0UA 4U63A 4ATZD 4N5QA 3FTZA 1OUVA 3CVPA 3E32A 4IYPA 5AQAA 3QJZA 2NSZA 1SQMA 3B95A 5T3RA 3HG0D 4KZCA 4WNEA 3T8KA 3Q15A 3ZHEB 2QY7A 3FTXA 2P2CP 3JQ0A 2KC7A 1BI8B 4ILIA 3MYVA 2WQHA 3G2WA 2AXUA 3ZXPA 2HYZA 4BERA 4XKBA 3GZ2A 3QKYA 3NB2A 4KBQA 2Y0BG 4F3VA 5AENA 3QK0A 2IOLA 2QC9A 1UN8A 4O1PA 4APFA 2PZIA 2VGXB 1N4QA 2BUGA 3ISMC 3MKQB 2F8XK 4K03A 1PAQA 3OXLA 1QYMA 3ASHA 1NA3A 5LFAA 5EYPF 4WWOA 5JHAA 5FQ4A 2EIKE 4TXQA 4K0RA 1O1SA 5T4YA 2XPZA 4NQ0A 2OVFA 1WY6A 4YDOA 5KBAA 3PUJA 1S0PA 2VQ2A 2XRZA 3HYMB 4LNBA 1L5JA 5BW8C 4FHJA 2FO7A 1QZ2A 1Y6IA 1MX4A 4EZLA 4HOTA 3IHVA 1GW6A 1OWNA 2EINE 3APCA 4CRWA 3HXFA 4KMOA 4LUNU 4F1SA 3L82A 2VYIA 4N3CA 2H6FA 1QBQA 4G11A 2VTBB 3DBSA 1YA0A 4Q94A 4OAUC 5FTPA 3LKUA 2KM4A 1E8ZA 4I6EA 5T8IA 2VGEA 2F0YA 1OWMA 3PZ3A 2X6IA 4LRZA 4NACA 2NXPA 4YDYA 3LY7A 4KT6B 2HR2A 4EPZA 5FQ7A 1H6KA 3QAQA 4KVOA 4GMRA 2LUHA 4UQZA 2PM6A 4ANVA 3ASDA 3CR3A 3E30A 3KSLA 3Q4AB 1V55E 4GYYA 4F7AA 4ILHB 2R02A 1UJJA 4BSXA 3ML8A 3HRAA 4HOUA 4MS6A 1JPLA 3FUJA 3L9TA 4UUCA 3APFA 4EQFA 4LERA 2C2LA 3Q9UC 5ENSD 2P9IG 3CSFA 3AS4A 3TL5A 5G04J 4JL0A 2FI7A 2XPIA 1ELWA 1TNUA 2CG2A 3KEZA 3E4BA 2ZISA 3DWLG 1JCRA 2DZOA 3FEXA 2XEHA 1S63A 5ARFA 1UN9A 3QWWA 2I9CA 4DX1A 4J8DA 4BT8A 2KATA 3ZVVA 3D9OA 5KJLA 3D3MA 1LD7A 1BI7B 4L7TA 2R05A 2P9PG 3RK6A 3ZNGA 1K3ZD 1HX8A 3ASFA 2OVBA 3L22A 3EHQA 5H7PA 4J8EA 2X3MA 3FTWA 4U8YD 2J4BA 3FP3A 4J7WA 2OCCE 5KWDA 3FTSA 3C3OA 2LNIA 4CEMA 4FA6A 4BTAA 3V2XA 2P9LG 2P58C 3W9FA 5HQ8A 3EU9A 5D0QD 2R17C 4KZ0A 2DVWA 3ZYMA 2F8YA 3FFLA 2WMNA 4GTRA 2WPVA 1OWLA 2V4LA 3T8MA 4E85A 5A6CA 5KJKA 4G2VA 4F6RD 5ENRD 3Q75A 1U2VG 3FDHA 3CHMA 4JC8A 1HE8A 2ONDA 3T5XA 4ILGA 5D0OD 3NZUA 3ASNE 3OAWA 1E7VA 4BESA 3CVNA 5J90A 2HO1A 2WXQA 3SBSA 4G26A 4K5CA 3LEWA 3PUKA 3UI2A 1TYQG 4DX5D 2EILE 3DSXA 4DK5A 3ZW3A 2ETCA 3EIJA 1LF8A 3DPYA 3O48A 4C0EA 1UG3A 5LCWJ 3I4GA 4PDXA 1N11A 4QFVA 3TWQA 4U95D 2AJAA 3HVEA 3SNXA 2VSNA 2DYSE 4TXPA 5EN5D 4KYOB 1N94A 5AQBA 1TN7A 4DUIA 4BWRA 1QNFA 5ENPD 1IQUA 4L23A 3RSEG 3UT4A 2R2LA 3R7RA 2I1JA 4P29A 4HRNA 5LP0A 1OCOE 3L17A 5JMND 2XS1A 5AARA 2WXMA 2X6HA 3CHQA 1ELRA 4K5BA 4G8LA 3G2SA 4GTVA 4M3OA 4N39A 3ESKA 4C9BB 2CHXA 3T9KA 4FC8A 4G1TA 3RO2A 3SFZA 1EF1C 3CIAA 3WXXA 2GRMA 1HO8A 3TAXA 1JWFA 3DXKG 1HH8A 2FULA 3UIPC 3EU5A 2A5EA 3TWXA 2E2EA 2X38A 4HORA 2J09A 5JJTA 2RKKA 2BF0X 4N3AA 2WQ7A 3DSUA 1BD8A 3KAEA 3ASGA 2DYRE 2YINA 1TR4A 3FTUA 5AJDA 5KNGA 3V30A 3FUEA 4GPMA 1TJCA 4RLYA 3DSTA 4GTSA 3AU5A 3ZYKA 3LCAA 4G24A 3MZLB 4CT4A 3DEPA 1IYGA 3QB2A 3U66A 2ZGDA 2PNNA 4HNAD 3U4TA 4GZDA 4BFRA 4DPRA 5ENQD 3DSVA 5CCLA 4GA1A 4GYWA 1FCHA 1A17A 5JJ6A 2ZIRA 1K1AA 3FWVA 3CVYA 3PE3A 1V54E 3FU0A 1WM5A 2E0IA 1ZB1A 2IJGX 3NF1A 1LTXA 2AW6A 2KCVA 2P9KG 3CGHA 1KT0A 3QC1A 1SA5A 1UW4B 3FTVA 3TG4A 3LJNA 3Q9NC 3HVEB 2EIME 4JVSA 3B7TA 1SW6A 2V0PA 1UJKA 2RG8A 4HRMB 1MZCA 4XI0A 4KXKB 1SA4A 1ZBPA 1O5MA 3MV2B 3DPDA 1Z6TA 3RU0A 3KS2A 2FBNA 5ENOD 3AG2E 2FEZA 4R7LA 3X2QE 4CZ2D 3HHMA 3IBEA 2CHZA 4XEIG 1AP7A 5A23A 3SBTB 5FQ8A 2LSVA 3KD7A 3HDXA 3UPVA 1X81A 4UWHA 2XPYA 5EDSA 2R59A 3B7SA 3R9MA 3SI5A 2QZAA 1SZ9A 4DX7D 1BU9A 1WDYA 4YDWA 1KT1A 3B7UX 1N4SA 5ANLA 3UKUG 2WMOA 2XZDG 3LDZA 3PEUB 1H6PA 1OCCE 5D2MC 1FVHA 1NL4A 3BEEA 4ACLA 2H6GA 3SZ7A 2WXHA 3TWSA 1H2UA 2KCKA 1DVPA 3LY8A 3KEAA 3OXGA 3DSWA 5BV0A 1IKND 4FP7A 5CBOA 1RZ4A 3GZ1A 3HXEA 4XKCA 4UI9J 4TUUA 4WWPA 2Q7FA 4LNUD 1H19A 4EBAA 4RQIA 1IHBA 3CVXA 1NZNA 4H7XA 4HVBA 2I2OA 2J4DA 2KZTA 2WXPA 5BPPA 4BX8A 5BUZA 4APOA 3CVVA 4EBAG 1OWPA 3FU5A 1PC2A 2IONA 4FADA 3NOGD 4CGVA 3TXNA 4ANUA 5DIZA 2VSXE 3FH7A 4I43A 4CDMA 3B7BA 4XE0A 4RSYA 3SFYA 1U3CA 4GTOA 4GMJA 3HXCA 4RVBA 5AIJA 5CEDB 2XEEA 3E37A 2NC9A 2UWJG 2XGMA 1O1TA 5E76A 1QQEA 2Y1LE 4U8HA 1G3NB 5B3SE 2KXPC 3ABME 3JYSA 1N0QA 3CHOA 4JB8P 4TXRA 1IXVA 3V31A 2GRLA 5IY5E 5ANRA 4NRHB 3BG0B 4LEUA 3ZN3A 4PS8A 3FH5A 4EZKA 2X6JA 4TRQA 3SF4A 1KPSB 3FUDA 4AXHA 2R5SA 4I1AA 3QARA 4GZCA 3Q49B 2AXVA 2XRYA 3MX3A 4AVXA 2LXMA 1KZOA 4WAFA 5CERB 5BNWA 4B8CB 4DRXE 3UM0A 3PH0C 2I1KA 4GCOA 3B13A 4J8YA 5G04C 3V2OA 4FJZA 1HXIA 3D9HA 3LVRE 2BKGA 1NP7A 2PQRA 3LS8A 1OT8A 3FULA 1HU3A 2IO3C 3AS5A 3CVWA 4EHMA 5AYWD 3U9WA 3NQPA 4JXTA 2RD0A 3SGHA 4GMLA 3TWUA 1JCSA 2J49A 3L6AA 5EIDA 4QQIA 1Z3XA 4GTTA 4MRUA 1E8XA 2DIWA 5CRVA 3C5RA 4UWKA 4B89A 1FT1A 2OV8A 3TWRA 2L0TB 2IU1A 5AJLA 1LD8A 3TJPA 4C48B 3QWVA 1IHGA 3CKBA 3HXDA 3FUNA 1K1BA 2PM7A 3LXUX 4CT0A 3PZDA 3G2TA 2KZTB 4A3TA 2ZXWE 1FPPA 5FZRA 3HIZA 1DNPA 3D9MA 1MYOA 2XS8A 2EIJE 3UM1A 2A5UA 1SVXA 2GW1A 3UXGA 3JUIA 3ZEFA 2Y3AA 1OXJA 4I9EA 5M72A 1ZU2A 2VSYA 4ANXA 1HFAA 1B89A 4GZ6A 2DZNA 3FEYA 4B93B 3MKRA 3AU4A 2RFAA 4J0UA 3UINC 5EYLA 1NI1A 4H7YA 1TN6A 5C1DA 4AOFA 1TNBA 2CFUA 3FU6A 4U8VD 5FZQA 4YDEA 4D10C 2GROB 2ILRA 4MLPA 4G25A 4HOSA 3EDTB 1W3BA 1H0AA 2C0MA 3VLFA 3C98A 1O1RA 3ZRHA 4U96D 4LG6A 5LCWC 3VTXA 1D9SA 3O4ZA 2WXIA 4F1PA 4BX9A 3UQ3A 2XENA 3FHEA 4HI9A 3ZGQA 2JLBA 4I6JA 2UY1A 3CHRA 2IQCA 3ENEA 3UX4A 3CK7A 4JHRA 3FU3A 4OAVB 3U64A 1HF8A 1E7UA 4AY5A 2I6HA 4XI9A 4Q69A 2MRIA 5KJMA 1MX2A 2GRRB 3AG3E 1N95A 2KCLA 2WXNA 1YMPA 4RG6A 3P1UA 4DLQA 3MCXA 2PQNA 4GU5A 4Y6WA 3UT7A 4GB9A 3PZ4A 4B8AA 4W9RA 4X8QA 2YQ8A 3SQVA 1N4PA 4IULA 2QYUA 2Y4UA 2P9UG 2LXLA 4N5CA 4URKA 5JHBA 5BXUA 1TJFA 4HLEA 1KZPA 3J5PA 3RAUA 1NFIE 3K9IA 4I17A 3BG1B 3L13A 3JCKC 2IEJA 4Q96A 4TUMA 3ZUVB 3PVLA 5C2YA 2X6KA 3FTYA 3NOCD 3PS6A 4U07A 1HS6A 3ESLA 5LOZA 4GTMA 3ULEG 2Y69E 5JA4D 3C3RA 2M63A 4LCTA 5HS0A 2WQ6A 3UIOC 2GRPB 3VLDA 4BT9A 2WXOA 2J08A 5G05C 2LAIA 3OTNA 4I6GA 3S7BA 2L9BA 2MYOA 4FU3A 4GTQA 2XHEA 5EX3A 2EQXA 3IKOB 4DJAA 1BPOA 1ELKA 1PY1A 3S7FA 4HRLA 1EYHA 5FIOA 1Q2ZA 2JABA 2UY1B 3CQCB 4PS7A 4Y6CA 4A63B 1E8YA 2LSUA 1Y8MA 5B1BE 3CQGB 5G05J 3EUVA 3EJNA 4PH4B 4GCNA 4CCAA 4BSZB 2X6FA
chains in the Genus database with same CATH topology
3Q78A 2H6IA 1SA4A 1JCSA 3E32A 1O5MA 1KZPA 3KSQA 3DSUA 1TNUA 1JCQA 1O1RA 1TNOA 3HXFA 3PZ2A 2ZISA 2BEDA 4GTTA 1JCRA 3E33A 2IEJA 3SFYA 4GTOA 2H6FA 1FT1A 1QBQA 1S63A 3HXBA 3HXCA 3DSTA 4GTSA 3DSSA 3E37A 1D8DA 3DSXA 1LD8A 3HXDA 1O1TA 1N9AA 1X81A 3DPYA 4GTMA 1LD7A 1TN8A 1D8EA 3Q7FA 4L9PA 2F0YA 3C72A 3PZ3A 3DSVA 1FPPA 1N4SA 2H6HA 1N94A 1N4QA 1TN7A 1DCEA 4GTPA 3Q73A 4LNGA 1NL4A 3E34A 2R2LA 2H6GA 4GTQA 2ZIRA 1N95A 1TNZA 3Q79A 1FT2A 1TNYA 3E30A 3KSLA 3DSWA 1LTXA 1KZOA 4GTVA 1O1SA 1S64A 3HXEA 4GTRA 3PZ4A 3DRAA 1N4RA 1SA5A 1NI1A 1TN6A 4YDOA 1TNBA 3Q75A 1N4PA 3SFXA 4YDEA 4LNBA 3EU5A 3PZ1A 4EHMA 4MBGA 3Q7AA 3EUVA 1MZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q78 A;  2H6I A;  1SA4 A;  1JCS A;  3E32 A;  1O5M A;  1KZP A;  3KSQ A;  3DSU A;  1TNU A;  1JCQ A;  1O1R A;  1TNO A;  3HXF A;  3PZ2 A;  2ZIS A;  2BED A;  4GTT A;  1JCR A;  3E33 A;  2IEJ A;  3SFY A;  4GTO A;  2H6F A;  1FT1 A;  1QBQ A;  1S63 A;  3HXB A;  3HXC A;  3DST A;  4GTS A;  3DSS A;  3E37 A;  1D8D A;  3DSX A;  1LD8 A;  3HXD A;  1O1T A;  1N9A A;  1X81 A;  3DPY A;  4GTM A;  1LD7 A;  1TN8 A;  1D8E A;  3Q7F A;  4L9P A;  2F0Y A;  3C72 A;  3PZ3 A;  3DSV A;  1FPP A;  1N4S A;  2H6H A;  1N94 A;  1N4Q A;  1TN7 A;  1DCE A;  4GTP A;  3Q73 A;  4LNG A;  1NL4 A;  3E34 A;  2R2L A;  2H6G A;  4GTQ A;  2ZIR A;  1N95 A;  1TNZ A;  3Q79 A;  1FT2 A;  1TNY A;  3E30 A;  3KSL A;  3DSW A;  1LTX A;  1KZO A;  4GTV A;  1O1S A;  1S64 A;  3HXE A;  4GTR A;  3PZ4 A;  3DRA A;  1N4R A;  1SA5 A;  1NI1 A;  1TN6 A;  4YDO A;  1TNB A;  3Q75 A;  1N4P A;  3SFX A;  4YDE A;  4LNB A;  3EU5 A;  3PZ1 A;  4EHM A;  4MBG A;  3Q7A A;  3EUV A;  1MZC A; 
#chains in the Genus database with same CATH topology
 2B6C A;  2XCB A;  3ZPJ A;  3FUI A;  1OY3 D;  1MX6 A;  3MV3 B;  2XGS A;  5DBK A;  2CHW A;  4AP2 A;  4WNF A;  2Y4T A;  2IF4 A;  3GYZ A;  2BTD A;  1D8D A;  3Q47 B;  3RJV A;  4GPK A;  4NIK A;  2MHK A;  3FUM A;  2GRQ B;  4FLH A;  3FUK A;  2B0O E;  3ZXS A;  2AXZ A;  3G2V A;  4PS3 A;  5AQ7 A;  3AJI A;  3E34 A;  2XGO A;  4XIF A;  2QFC A;  3CEQ A;  3B7R L;  4UI9 C;  2L6J A;  1NA0 A;  4O6F A;  3R9A B;  3P2B A;  3NAW A;  1WAO 1;  3S7J A;  3TWV A;  1HG2 A;  4JPS A;  5CBN A;  1H2V C;  1INZ A;  3IHY A;  1N4R A;  4HFG A;  2NYJ A;  1SZA A;  1JWG A;  4ZHB A;  3CHP A;  4GA0 A;  4AEZ C;  4O1O A;  2FO1 E;  5AQ9 A;  3L16 A;  4LSZ E;  5CMW A;  4MBG A;  5EIL A;  3Q7A A;  2P9S G;  3CKC A;  3D9L A;  4I2Z A;  4N2S A;  2J8S D;  3UKR G;  3ZYL A;  3WG7 E;  4M7C A;  2ETA A;  5FJY A;  2F37 A;  4OVU A;  3OXF A;  2CFZ A;  3DSS A;  1MHQ A;  4NUR A;  4BY6 A;  3PE4 A;  3RKV A;  1YCS B;  3PNL B;  1E8W A;  2ETB A;  3UT8 A;  1MQS A;  1D8E A;  1UOH A;  2VJ8 A;  4OYS A;  5KJN A;  4IN3 B;  4U7E B;  2V5Q C;  2LO6 A;  4J8S A;  4HBD A;  4DX2 A;  2GGF A;  4RG9 A;  4YVO A;  5HI7 A;  3Q73 A;  3EHN A;  1FVF A;  3IV0 A;  3NZS A;  1TNZ A;  1Z5S C;  3SY2 A;  3I3N A;  2XEV A;  3RRU A;  4TV3 A;  3ONL A;  4BEP A;  5LX8 A;  4UWG A;  2DWZ A;  3CK8 A;  3DRA A;  4AJW A;  1E90 A;  3AS8 A;  4GYO A;  4AM9 A;  1U3D A;  1N54 A;  3AG4 E;  3CVQ A;  2OEW A;  1OWO A;  1DC2 A;  3GZS A;  3CLJ A;  3L54 A;  3V79 K;  1XNF A;  3D9N A;  3LVQ E;  1TEZ A;  4DLO A;  3D9J A;  4MKT A;  5JJ7 A;  3ONK A;  4EZJ A;  2WM9 A;  3AG1 E;  4HLL A;  4A55 A;  3PEV B;  5FZS A;  4JEU A;  3L08 A;  1AWC B;  2A4Z A;  2V8S E;  4B0Z A;  3CST A;  4O60 A;  3PRE A;  2DCP A;  4DI4 A;  1RW2 A;  3S2A A;  5ITZ F;  4AV7 A;  4L9P A;  5FIN A;  5EX0 A;  3D9P A;  3PDN A;  4J6I A;  4WNG A;  4YND A;  1DCE A;  3VLE A;  4GTP A;  4LNG A;  4HOQ A;  3JXJ A;  1N0R A;  5FQ6 A;  3IXE A;  3QNK A;  1IQR A;  2P9N G;  5HKP A;  4IRU A;  2MOW A;  2JEK A;  2L0I A;  2XCC A;  3BU8 A;  3ABK E;  3Q79 A;  1FT2 A;  4JHJ A;  3RO3 A;  3LYA A;  4BTB A;  3EHR A;  2FF4 A;  4AY6 A;  3J5Q B;  3QOU A;  5D66 A;  3ML9 A;  4KVM A;  3GW4 A;  3SHF A;  3CHS A;  3SFX A;  3TG5 A;  2WXJ A;  2VGY A;  3PZ1 A;  2GRN B;  4ANW A;  4GA2 A;  4WUY A;  3FUF A;  3I5P A;  4UWF A;  3JUE A;  2HE0 A;  3G2U A;  3UM3 A;  5CRU A;  1Z3Y A;  4ABN A;  3E33 A;  4I1M A;  4BET A;  1OCZ E;  5KCM A;  3IEG A;  1S70 B;  2IO2 C;  2R03 A;  3ASO E;  4GAA A;  3PNT B;  4HQD A;  2WXR A;  3C72 A;  4G8K A;  2WXF A;  3U3W A;  2H6H A;  4L2L A;  3ULQ A;  3BUA A;  5CMY A;  4N2Q A;  2VSO E;  5ENN A;  5G2N A;  5CCM A;  5ENT D;  2AVP A;  4CYM D;  3JQ1 A;  1H2T C;  4CDN A;  3LY9 A;  4V3I A;  3RRM B;  1N52 A;  1KLX A;  3CVL A;  3F6Q A;  4FLB A;  1EPU A;  5G55 A;  2HM8 A;  1BLX B;  4A3V A;  4FJY A;  3VTY A;  4UI9 K;  5ARG A;  1S64 A;  4UWL A;  5CEC B;  5HRY A;  3SO8 A;  5EIB E;  3APD A;  3AAA C;  1EDU A;  3UMV A;  4L2Y A;  5A7D B;  1DCQ A;  1VDY A;  4HXI A;  2YNQ A;  3MEK A;  2YHE A;  4JZY A;  3TWW A;  2WXL A;  2ZGG A;  3Q78 A;  3RRN B;  2H6I A;  4DX6 D;  3QDN A;  4DI3 A;  3KSQ A;  2DBA A;  1HG5 A;  4J8F A;  1TNO A;  4OVV A;  2BED A;  4PUC A;  4UQX A;  2WXK A;  2XQ0 A;  3DXM G;  4K5A B;  3BQO A;  3URZ A;  5CHE E;  1MJ0 A;  4FUL A;  4ZFH A;  4A1S A;  2IOS A;  2J07 A;  3MGB A;  3EIQ C;  2V5F A;  2IY0 C;  3DEO A;  5KNH D;  2AWI A;  4U04 A;  1P5Q A;  2IFU A;  5B1A E;  4JW1 A;  3ZU7 B;  2C0L A;  3ZYQ A;  4ATG A;  4U0Z A;  5CEA A;  2WB2 A;  5AN8 A;  5E75 A;  4CGW A;  3ZFW A;  1JUQ A;  4B94 A;  4E6H A;  5FT9 A;  3ZHE A;  1TNY A;  3MJW A;  4GZ5 A;  3LJ3 A;  4GZ3 A;  3Q5M A;  4HB5 A;  4AIF A;  1X5B A;  1WG0 A;  4EEC A;  3T5V A;  4JA9 A;  2VGX A;  4G23 A;  3QWP A;  3W9G A;  3CK9 A;  4I2W A;  2YHC A;  1H6O A;  3TGO A;  3MKQ A;  2KBX A;  2WVI A;  2LAH A;  4FHK A;  1HZ4 A;  1OCR E;  4WND A;  1JCQ A;  3PZ2 A;  1YYH A;  4I1O B;  2V4H C;  4HI8 A;  3D9K A;  3I4R B;  4JEH A;  5BXO A;  5BV1 A;  3HXB A;  4XZ4 A;  4N3B A;  2L6B A;  4JA7 A;  4WWN A;  4I9C A;  1A5E A;  1N9A A;  3R7Q A;  4ACK A;  2PL2 A;  3LPZ A;  3N71 A;  4U0S A;  4ME2 A;  3ZIM A;  1TN8 A;  2CG3 A;  3S7D A;  3Q7F A;  3NBN B;  3CV0 A;  4HS2 A;  3FUH A;  2WXG A;  4XX5 A;  3FY4 A;  5FWQ A;  2BKK B;  4UQY A;  3SD5 A;  5EKQ D;  2OOE A;  3RIB A;  2XZT G;  4C0M A;  4Z68 A;  3FH8 A;  4YVQ C;  3ZKJ A;  3PRZ A;  2ZU6 B;  2QYJ A;  1K8K G;  2OEV A;  3TWT A;  4JD2 G;  1E96 B;  4JHK A;  2VTB A;  3UUX A;  3EHM A;  4L1B A;  2J9Q A;  3MA5 A;  3UTM A;  2RFM A;  4CDR A;  4F53 A;  3ULY A;  3C3Q A;  3TXM A;  5J08 A;  3CVU A;  5AAO A;  3UM2 A;  4A1G A;  1XGW A;  5BT1 A;  3ABL E;  3JXI A;  3D9I A;  4U0U A;  4U63 A;  4ATZ D;  4N5Q A;  3FTZ A;  1OUV A;  3CVP A;  3E32 A;  4IYP A;  5AQA A;  3QJZ A;  2NSZ A;  1SQM A;  3B95 A;  5T3R A;  3HG0 D;  4KZC A;  4WNE A;  3T8K A;  3Q15 A;  3ZHE B;  2QY7 A;  3FTX A;  2P2C P;  3JQ0 A;  2KC7 A;  1BI8 B;  4ILI A;  3MYV A;  2WQH A;  3G2W A;  2AXU A;  3ZXP A;  2HYZ A;  4BER A;  4XKB A;  3GZ2 A;  3QKY A;  3NB2 A;  4KBQ A;  2Y0B G;  4F3V A;  5AEN A;  3QK0 A;  2IOL A;  2QC9 A;  1UN8 A;  4O1P A;  4APF A;  2PZI A;  2VGX B;  1N4Q A;  2BUG A;  3ISM C;  3MKQ B;  2F8X K;  4K03 A;  1PAQ A;  3OXL A;  1QYM A;  3ASH A;  1NA3 A;  5LFA A;  5EYP F;  4WWO A;  5JHA A;  5FQ4 A;  2EIK E;  4TXQ A;  4K0R A;  1O1S A;  5T4Y A;  2XPZ A;  4NQ0 A;  2OVF A;  1WY6 A;  4YDO A;  5KBA A;  3PUJ A;  1S0P A;  2VQ2 A;  2XRZ A;  3HYM B;  4LNB A;  1L5J A;  5BW8 C;  4FHJ A;  2FO7 A;  1QZ2 A;  1Y6I A;  1MX4 A;  4EZL A;  4HOT A;  3IHV A;  1GW6 A;  1OWN A;  2EIN E;  3APC A;  4CRW A;  3HXF A;  4KMO A;  4LUN U;  4F1S A;  3L82 A;  2VYI A;  4N3C A;  2H6F A;  1QBQ A;  4G11 A;  2VTB B;  3DBS A;  1YA0 A;  4Q94 A;  4OAU C;  5FTP A;  3LKU A;  2KM4 A;  1E8Z A;  4I6E A;  5T8I A;  2VGE A;  2F0Y A;  1OWM A;  3PZ3 A;  2X6I A;  4LRZ A;  4NAC A;  2NXP A;  4YDY A;  3LY7 A;  4KT6 B;  2HR2 A;  4EPZ A;  5FQ7 A;  1H6K A;  3QAQ A;  4KVO A;  4GMR A;  2LUH A;  4UQZ A;  2PM6 A;  4ANV A;  3ASD A;  3CR3 A;  3E30 A;  3KSL A;  3Q4A B;  1V55 E;  4GYY A;  4F7A A;  4ILH B;  2R02 A;  1UJJ A;  4BSX A;  3ML8 A;  3HRA A;  4HOU A;  4MS6 A;  1JPL A;  3FUJ A;  3L9T A;  4UUC A;  3APF A;  4EQF A;  4LER A;  2C2L A;  3Q9U C;  5ENS D;  2P9I G;  3CSF A;  3AS4 A;  3TL5 A;  5G04 J;  4JL0 A;  2FI7 A;  2XPI A;  1ELW A;  1TNU A;  2CG2 A;  3KEZ A;  3E4B A;  2ZIS A;  3DWL G;  1JCR A;  2DZO A;  3FEX A;  2XEH A;  1S63 A;  5ARF A;  1UN9 A;  3QWW A;  2I9C A;  4DX1 A;  4J8D A;  4BT8 A;  2KAT A;  3ZVV A;  3D9O A;  5KJL A;  3D3M A;  1LD7 A;  1BI7 B;  4L7T A;  2R05 A;  2P9P G;  3RK6 A;  3ZNG A;  1K3Z D;  1HX8 A;  3ASF A;  2OVB A;  3L22 A;  3EHQ A;  5H7P A;  4J8E A;  2X3M A;  3FTW A;  4U8Y D;  2J4B A;  3FP3 A;  4J7W A;  2OCC E;  5KWD A;  3FTS A;  3C3O A;  2LNI A;  4CEM A;  4FA6 A;  4BTA A;  3V2X A;  2P9L G;  2P58 C;  3W9F A;  5HQ8 A;  3EU9 A;  5D0Q D;  2R17 C;  4KZ0 A;  2DVW A;  3ZYM A;  2F8Y A;  3FFL A;  2WMN A;  4GTR A;  2WPV A;  1OWL A;  2V4L A;  3T8M A;  4E85 A;  5A6C A;  5KJK A;  4G2V A;  4F6R D;  5ENR D;  3Q75 A;  1U2V G;  3FDH A;  3CHM A;  4JC8 A;  1HE8 A;  2OND A;  3T5X A;  4ILG A;  5D0O D;  3NZU A;  3ASN E;  3OAW A;  1E7V A;  4BES A;  3CVN A;  5J90 A;  2HO1 A;  2WXQ A;  3SBS A;  4G26 A;  4K5C A;  3LEW A;  3PUK A;  3UI2 A;  1TYQ G;  4DX5 D;  2EIL E;  3DSX A;  4DK5 A;  3ZW3 A;  2ETC A;  3EIJ A;  1LF8 A;  3DPY A;  3O48 A;  4C0E A;  1UG3 A;  5LCW J;  3I4G A;  4PDX A;  1N11 A;  4QFV A;  3TWQ A;  4U95 D;  2AJA A;  3HVE A;  3SNX A;  2VSN A;  2DYS E;  4TXP A;  5EN5 D;  4KYO B;  1N94 A;  5AQB A;  1TN7 A;  4DUI A;  4BWR A;  1QNF A;  5ENP D;  1IQU A;  4L23 A;  3RSE G;  3UT4 A;  2R2L A;  3R7R A;  2I1J A;  4P29 A;  4HRN A;  5LP0 A;  1OCO E;  3L17 A;  5JMN D;  2XS1 A;  5AAR A;  2WXM A;  2X6H A;  3CHQ A;  1ELR A;  4K5B A;  4G8L A;  3G2S A;  4GTV A;  4M3O A;  4N39 A;  3ESK A;  4C9B B;  2CHX A;  3T9K A;  4FC8 A;  4G1T A;  3RO2 A;  3SFZ A;  1EF1 C;  3CIA A;  3WXX A;  2GRM A;  1HO8 A;  3TAX A;  1JWF A;  3DXK G;  1HH8 A;  2FUL A;  3UIP C;  3EU5 A;  2A5E A;  3TWX A;  2E2E A;  2X38 A;  4HOR A;  2J09 A;  5JJT A;  2RKK A;  2BF0 X;  4N3A A;  2WQ7 A;  3DSU A;  1BD8 A;  3KAE A;  3ASG A;  2DYR E;  2YIN A;  1TR4 A;  3FTU A;  5AJD A;  5KNG A;  3V30 A;  3FUE A;  4GPM A;  1TJC A;  4RLY A;  3DST A;  4GTS A;  3AU5 A;  3ZYK A;  3LCA A;  4G24 A;  3MZL B;  4CT4 A;  3DEP A;  1IYG A;  3QB2 A;  3U66 A;  2ZGD A;  2PNN A;  4HNA D;  3U4T A;  4GZD A;  4BFR A;  4DPR A;  5ENQ D;  3DSV A;  5CCL A;  4GA1 A;  4GYW A;  1FCH A;  1A17 A;  5JJ6 A;  2ZIR A;  1K1A A;  3FWV A;  3CVY A;  3PE3 A;  1V54 E;  3FU0 A;  1WM5 A;  2E0I A;  1ZB1 A;  2IJG X;  3NF1 A;  1LTX A;  2AW6 A;  2KCV A;  2P9K G;  3CGH A;  1KT0 A;  3QC1 A;  1SA5 A;  1UW4 B;  3FTV A;  3TG4 A;  3LJN A;  3Q9N C;  3HVE B;  2EIM E;  4JVS A;  3B7T A;  1SW6 A;  2V0P A;  1UJK A;  2RG8 A;  4HRM B;  1MZC A;  4XI0 A;  4KXK B;  1SA4 A;  1ZBP A;  1O5M A;  3MV2 B;  3DPD A;  1Z6T A;  3RU0 A;  3KS2 A;  2FBN A;  5ENO D;  3AG2 E;  2FEZ A;  4R7L A;  3X2Q E;  4CZ2 D;  3HHM A;  3IBE A;  2CHZ A;  4XEI G;  1AP7 A;  5A23 A;  3SBT B;  5FQ8 A;  2LSV A;  3KD7 A;  3HDX A;  3UPV A;  1X81 A;  4UWH A;  2XPY A;  5EDS A;  2R59 A;  3B7S A;  3R9M A;  3SI5 A;  2QZA A;  1SZ9 A;  4DX7 D;  1BU9 A;  1WDY A;  4YDW A;  1KT1 A;  3B7U X;  1N4S A;  5ANL A;  3UKU G;  2WMO A;  2XZD G;  3LDZ A;  3PEU B;  1H6P A;  1OCC E;  5D2M C;  1FVH A;  1NL4 A;  3BEE A;  4ACL A;  2H6G A;  3SZ7 A;  2WXH A;  3TWS A;  1H2U A;  2KCK A;  1DVP A;  3LY8 A;  3KEA A;  3OXG A;  3DSW A;  5BV0 A;  1IKN D;  4FP7 A;  5CBO A;  1RZ4 A;  3GZ1 A;  3HXE A;  4XKC A;  4UI9 J;  4TUU A;  4WWP A;  2Q7F A;  4LNU D;  1H19 A;  4EBA A;  4RQI A;  1IHB A;  3CVX A;  1NZN A;  4H7X A;  4HVB A;  2I2O A;  2J4D A;  2KZT A;  2WXP A;  5BPP A;  4BX8 A;  5BUZ A;  4APO A;  3CVV A;  4EBA G;  1OWP A;  3FU5 A;  1PC2 A;  2ION A;  4FAD A;  3NOG D;  4CGV A;  3TXN A;  4ANU A;  5DIZ A;  2VSX E;  3FH7 A;  4I43 A;  4CDM A;  3B7B A;  4XE0 A;  4RSY A;  3SFY A;  1U3C A;  4GTO A;  4GMJ A;  3HXC A;  4RVB A;  5AIJ A;  5CED B;  2XEE A;  3E37 A;  2NC9 A;  2UWJ G;  2XGM A;  1O1T A;  5E76 A;  1QQE A;  2Y1L E;  4U8H A;  1G3N B;  5B3S E;  2KXP C;  3ABM E;  3JYS A;  1N0Q A;  3CHO A;  4JB8 P;  4TXR A;  1IXV A;  3V31 A;  2GRL A;  5IY5 E;  5ANR A;  4NRH B;  3BG0 B;  4LEU A;  3ZN3 A;  4PS8 A;  3FH5 A;  4EZK A;  2X6J A;  4TRQ A;  3SF4 A;  1KPS B;  3FUD A;  4AXH A;  2R5S A;  4I1A A;  3QAR A;  4GZC A;  3Q49 B;  2AXV A;  2XRY A;  3MX3 A;  4AVX A;  2LXM A;  1KZO A;  4WAF A;  5CER B;  5BNW A;  4B8C B;  4DRX E;  3UM0 A;  3PH0 C;  2I1K A;  4GCO A;  3B13 A;  4J8Y A;  5G04 C;  3V2O A;  4FJZ A;  1HXI A;  3D9H A;  3LVR E;  2BKG A;  1NP7 A;  2PQR A;  3LS8 A;  1OT8 A;  3FUL A;  1HU3 A;  2IO3 C;  3AS5 A;  3CVW A;  4EHM A;  5AYW D;  3U9W A;  3NQP A;  4JXT A;  2RD0 A;  3SGH A;  4GML A;  3TWU A;  1JCS A;  2J49 A;  3L6A A;  5EID A;  4QQI A;  1Z3X A;  4GTT A;  4MRU A;  1E8X A;  2DIW A;  5CRV A;  3C5R A;  4UWK A;  4B89 A;  1FT1 A;  2OV8 A;  3TWR A;  2L0T B;  2IU1 A;  5AJL A;  1LD8 A;  3TJP A;  4C48 B;  3QWV A;  1IHG A;  3CKB A;  3HXD A;  3FUN A;  1K1B A;  2PM7 A;  3LXU X;  4CT0 A;  3PZD A;  3G2T A;  2KZT B;  4A3T A;  2ZXW E;  1FPP A;  5FZR A;  3HIZ A;  1DNP A;  3D9M A;  1MYO A;  2XS8 A;  2EIJ E;  3UM1 A;  2A5U A;  1SVX A;  2GW1 A;  3UXG A;  3JUI A;  3ZEF A;  2Y3A A;  1OXJ A;  4I9E A;  5M72 A;  1ZU2 A;  2VSY A;  4ANX A;  1HFA A;  1B89 A;  4GZ6 A;  2DZN A;  3FEY A;  4B93 B;  3MKR A;  3AU4 A;  2RFA A;  4J0U A;  3UIN C;  5EYL A;  1NI1 A;  4H7Y A;  1TN6 A;  5C1D A;  4AOF A;  1TNB A;  2CFU A;  3FU6 A;  4U8V D;  5FZQ A;  4YDE A;  4D10 C;  2GRO B;  2ILR A;  4MLP A;  4G25 A;  4HOS A;  3EDT B;  1W3B A;  1H0A A;  2C0M A;  3VLF A;  3C98 A;  1O1R A;  3ZRH A;  4U96 D;  4LG6 A;  5LCW C;  3VTX A;  1D9S A;  3O4Z A;  2WXI A;  4F1P A;  4BX9 A;  3UQ3 A;  2XEN A;  3FHE A;  4HI9 A;  3ZGQ A;  2JLB A;  4I6J A;  2UY1 A;  3CHR A;  2IQC A;  3ENE A;  3UX4 A;  3CK7 A;  4JHR A;  3FU3 A;  4OAV B;  3U64 A;  1HF8 A;  1E7U A;  4AY5 A;  2I6H A;  4XI9 A;  4Q69 A;  2MRI A;  5KJM A;  1MX2 A;  2GRR B;  3AG3 E;  1N95 A;  2KCL A;  2WXN A;  1YMP A;  4RG6 A;  3P1U A;  4DLQ A;  3MCX A;  2PQN A;  4GU5 A;  4Y6W A;  3UT7 A;  4GB9 A;  3PZ4 A;  4B8A A;  4W9R A;  4X8Q A;  2YQ8 A;  3SQV A;  1N4P A;  4IUL A;  2QYU A;  2Y4U A;  2P9U G;  2LXL A;  4N5C A;  4URK A;  5JHB A;  5BXU A;  1TJF A;  4HLE A;  1KZP A;  3J5P A;  3RAU A;  1NFI E;  3K9I A;  4I17 A;  3BG1 B;  3L13 A;  3JCK C;  2IEJ A;  4Q96 A;  4TUM A;  3ZUV B;  3PVL A;  5C2Y A;  2X6K A;  3FTY A;  3NOC D;  3PS6 A;  4U07 A;  1HS6 A;  3ESL A;  5LOZ A;  4GTM A;  3ULE G;  2Y69 E;  5JA4 D;  3C3R A;  2M63 A;  4LCT A;  5HS0 A;  2WQ6 A;  3UIO C;  2GRP B;  3VLD A;  4BT9 A;  2WXO A;  2J08 A;  5G05 C;  2LAI A;  3OTN A;  4I6G A;  3S7B A;  2L9B A;  2MYO A;  4FU3 A;  4GTQ A;  2XHE A;  5EX3 A;  2EQX A;  3IKO B;  4DJA A;  1BPO A;  1ELK A;  1PY1 A;  3S7F A;  4HRL A;  1EYH A;  5FIO A;  1Q2Z A;  2JAB A;  2UY1 B;  3CQC B;  4PS7 A;  4Y6C A;  4A63 B;  1E8Y A;  2LSU A;  1Y8M A;  5B1B E;  3CQG B;  5G05 J;  3EUV A;  3EJN A;  4PH4 B;  4GCN A;  4CCA A;  4BSZ B;  2X6F A; 
#chains in the Genus database with same CATH homology
 3Q78 A;  2H6I A;  1SA4 A;  1JCS A;  3E32 A;  1O5M A;  1KZP A;  3KSQ A;  3DSU A;  1TNU A;  1JCQ A;  1O1R A;  1TNO A;  3HXF A;  3PZ2 A;  2ZIS A;  2BED A;  4GTT A;  1JCR A;  3E33 A;  2IEJ A;  3SFY A;  4GTO A;  2H6F A;  1FT1 A;  1QBQ A;  1S63 A;  3HXB A;  3HXC A;  3DST A;  4GTS A;  3DSS A;  3E37 A;  1D8D A;  3DSX A;  1LD8 A;  3HXD A;  1O1T A;  1N9A A;  1X81 A;  3DPY A;  4GTM A;  1LD7 A;  1TN8 A;  1D8E A;  3Q7F A;  4L9P A;  2F0Y A;  3C72 A;  3PZ3 A;  3DSV A;  1FPP A;  1N4S A;  2H6H A;  1N94 A;  1N4Q A;  1TN7 A;  1DCE A;  4GTP A;  3Q73 A;  4LNG A;  1NL4 A;  3E34 A;  2R2L A;  2H6G A;  4GTQ A;  2ZIR A;  1N95 A;  1TNZ A;  3Q79 A;  1FT2 A;  1TNY A;  3E30 A;  3KSL A;  3DSW A;  1LTX A;  1KZO A;  4GTV A;  1O1S A;  1S64 A;  3HXE A;  4GTR A;  3PZ4 A;  3DRA A;  1N4R A;  1SA5 A;  1NI1 A;  1TN6 A;  4YDO A;  1TNB A;  3Q75 A;  1N4P A;  3SFX A;  4YDE A;  4LNB A;  3EU5 A;  3PZ1 A;  4EHM A;  4MBG A;  3Q7A A;  3EUV A;  1MZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...