1MZCA

Co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 33a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
313
structure length
313
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Farnesyltransferase alpha Subunit
publication title Dual Protein Farnesyltransferase-Geranylgeranyltransferase-I Inhibitors as Potential Cancer Chemotherapeutic Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 128
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1mzcA00
3DPYA 1LD7A 3DSTA 4MBGA 1N4PA 1QBQA 3Q79A 4LNBA 3HXEA 2R2LA 1O1TA 2BEDA 3EUVA 1D8EA 1KZOA 1DCEA 1D8DA 1TNYA 3C72A 1TNOA 3DSWA 4GTVA 1FT2A 3Q73A 1O1SA 1S63A 2H6HA 2IEJA 3DRAA 3DSXA 3HXCA 1LTXA 1X81A 3Q7AA 1FT1A 3KSQA 4EHMA 3PZ4A 4GTSA 3Q7FA 4GTTA 3HXFA 3E33A 3KSLA 3DSVA 1N4SA 2ZISA 1LD8A 1TN7A 4GTRA 3SFXA 3E34A 3DSSA 1O5MA 3E32A 3PZ1A 1O1RA 3HXBA 3EU5A 4L9PA 3PZ2A 1N4RA 1N9AA 1JCRA 1TN8A 4GTQA 1NL4A 3SFYA 2H6FA 1MZCA 1FPPA 1S64A 3E30A 4GTOA 4YDEA 1TNZA 1TNBA 2ZIRA 1TN6A 3PZ3A 3Q78A 1JCQA 4GTMA 1SA4A 2H6GA 1TNUA 3E37A 1N94A 1JCSA 4GTPA 3HXDA 4YDOA 4LNGA 2H6IA 3Q75A 1KZPA 1SA5A 2F0YA 1N95A 3DSUA 1N4QA 1NI1A
chains in the Genus database with same CATH superfamily
5CHEE 2NYJA 1D9SA 1JPLA 5AQ9A 2XPZA 5CERB 3VLFA 3B13A 3SNXA 4KYOB 4N39A 1IHGA 1O1SA 1X5BA 3AU4A 3FUNA 4BTBA 3UIPC 3CSFA 4AP2A 4WUYA 5ENTD 4GMLA 3FHEA 1LTXA 3UX4A 4N3BA 1V54E 3KSQA 1E8YA 3S7FA 1HZ4A 4GYWA 3WXXA 3DXKG 4PS8A 2DZOA 2YQ8A 4DUIA 3KSLA 4EZKA 5G55A 2GRMA 1KLXA 4A1SA 3QAQA 4W9RA 5CRUA 4HOSA 2Y0BG 5BNWA 3O4ZA 3EHRA 4DX7D 1SW6A 4RQIA 3R9AB 3CVLA 4L9PA 4YVOA 1Z6TA 5BT1A 1FPPA 2VJ8A 3IKOB 4L2LA 5FIOA 3E30A 5J90A 2VGXB 3UXGA 3ZFWA 3FDHA 4GTMA 2WXKA 3T8KA 2CHWA 1ZU2A 2Y1LE 5EX0A 4TUUA 2WMNA 3LVRE 4ANWA 2FBNA 1INZA 3DSUA 4FJZA 1HFAA 3SY2A 4EECA 2AXZA 3FTSA 3D9JA 3GZ1A 2F37A 4FHKA 2VSYA 3SBTB 5KBAA 1KZOA 3IV0A 4ABNA 3UINC 4BERA 3R7RA 4WNDA 2E0IA 3FEXA 2DIWA 3ML8A 3PZ4A 3ZNGA 3MCXA 4HXIA 3JUIA 1ELWA 5B1BE 5HRYA 2I6HA 3KS2A 1IYGA 1KPSB 5BW8C 1SQMA 2B0OE 4QQIA 2EQXA 2WXPA 4G8KA 4XI0A 4N2QA 5LFAA 4U7EB 4WNGA 2YINA 1Z5SC 4A3VA 5H7PA 1OCRE 3HIZA 1OWPA 3ZHEB 3PZ2A 4JXTA 2KCLA 4HI9A 4HRNA 2Y4UA 4ANXA 2VSXE 4GA2A 2H6GA 4J0UA 1TNUA 3E37A 2EIKE 1HG2A 3Q15A 1JCSA 4G24A 4A1GA 4GU5A 3ASGA 4IN3B 1HE8A 5KWDA 4NIKA 3J5QB 2KZTB 2EIME 4MBGA 5ENPD 1KT1A 5C2YA 4A63B 1D8EA 4OVVA 2P2CP 1OCZE 4PH4B 3CVWA 1MX2A 4DX1A 3CK8A 4X8QA 3TGOA 4DX6D 4LUNU 1ELKA 3QKYA 3C5RA 3DPDA 2M63A 3UIOC 3ISMC 2IOSA 3LXUX 4ACKA 4GA1A 4HB5A 3CSTA 3K9IA 1UJKA 4HS2A 2PQNA 5D0OD 2L6BA 2XS1A 2Y4TA 2DZNA 4UI9K 2KZTA 5B1AE 3GZ2A 4I9EA 1E7UA 4J8YA 2I1KA 4HORA 2J8SD 3E4BA 3R9MA 2XEVA 3HG0D 1BLXB 3PDNA 1HH8A 3CVVA 4GZ6A 1TNZA 4UUCA 2WXNA 3JQ1A 3QARA 2XRZA 2L0IA 3QWWA 2XEHA 2YHCA 2PM6A 2IU1A 4BY6A 4G25A 2AJAA 3FUJA 1Y6IA 3HVEB 3ABKE 4I6GA 5AN8A 4Q69A 4N5CA 2P9LG 4HNAD 1JWGA 2HM8A 3EUVA 1U3CA 2XCBA 4ANUA 3MX3A 4M3OA 1FCHA 3C72A 1K3ZD 5ITZF 1TNOA 4FHJA 1DNPA 2H6HA 4ZFHA 2WXIA 1A17A 3DRAA 3C3RA 3HXCA 3BEEA 3RIBA 3ZIMA 1X81A 4U95D 4U8VD 4I2ZA 3ZYKA 2LSVA 4GA0A 5CBOA 1N4SA 2XZDG 2GRQB 2C2LA 3IEGA 3DSSA 4UWGA 3MV3B 3PE3A 4DLQA 3D3MA 4KVMA 3UMVA 4DX5D 3IXEA 4UQZA 3KEZA 2VQ2A 3FUMA 3D9PA 5AQAA 4EQFA 5LX8A 5BUZA 4I6EA 3RAUA 3MGBA 4B93B 3L9TA 3UKUG 3G2VA 4TXRA 2XPIA 3MEKA 4BSXA 3RRUA 1UN8A 3B95A 2WPVA 3B7BA 1EF1C 3CR3A 4I6JA 4PS7A 4C0MA 4Y6CA 3Q75A 3UM2A 5DBKA 3S7JA 5AAOA 2F0YA 3MKRA 1ELRA 4N3CA 2ETAA 2R2LA 2Y3AA 4F3VA 4DRXE 5ENOD 4F7AA 1S0PA 3TWVA 3FTYA 2ETCA 5CBNA 5EILA 5FZSA 2OVFA 3ZU7B 1DCQA 3TAXA 4BETA 4K5AB 3EDTB 2BKKB 2XEEA 5CECB 4C48B 3ABLE 2CHXA 4MRUA 4J8FA 4XEIG 2J07A 4BSZB 3FH7A 4ZHBA 4LCTA 1LD8A 4CRWA 2DYRE 2A4ZA 3L16A 3NOGD 4JA7A 2KBXA 3ZXSA 1IQUA 4APFA 4JZYA 2GRRB 2LSUA 4JB8P 1OY3D 1N4RA 3VLDA 4Y6WA 4NRHB 4RLYA 2WVIA 5HI7A 2H6FA 2XCCA 3QDNA 3OXFA 4GMJA 4HLLA 2IO2C 1OWOA 1S70B 3EIJA 2FI7A 2FEZA 3J5PA 2WXLA 4GTPA 4U07A 2F8YA 2KCVA 2AWIA 4AXHA 1H0AA 5B3SE 1MQSA 3URZA 2WXRA 3DEPA 4KXKB 1WAO1 3D9OA 1DC2A 3SO8A 3G2WA 4L7TA 2LXLA 2F8XK 3C3OA 5AENA 2C0MA 3ULYA 3I3NA 4HI8A 1D8DA 3ZVVA 3LYAA 5CRVA 2LUHA 3L17A 4HBDA 3P2BA 3ULEG 3AS5A 5J08A 3DSXA 4IRUA 4UWLA 2OVBA 3L82A 5EKQD 4OYSA 4OVUA 4CGVA 3LY7A 4QFVA 1E96B 2HYZA 5CEDB 3AG3E 3KAEA 3ZN3A 4JL0A 3UM0A 3ZRHA 4LSZE 3SI5A 5ARFA 4ANVA 3MYVA 4FLBA 2MOWA 5FQ4A 4NURA 5FJYA 4F53A 2OCCE 3L22A 3HXBA 1OWMA 4LG6A 3TWTA 3DWLG 4JW1A 1E8XA 4ME2A 3D9KA 3NQPA 4FJYA 1E7VA 2J08A 4O1PA 4FC8A 5LOZA 1EYHA 3FULA 3KEAA 1H6OA 1H2UA 4FU3A 4P29A 3RO2A 3FTZA 2WQ7A 3BG0B 3FUIA 2P9PG 2KXPC 1BD8A 1G3NB 4J8SA 2CG2A 1UW4B 1DCEA 1LD7A 3DSTA 3FTWA 4N5QA 3FFLA 3JQ0A 3TXMA 3LCAA 1NZNA 2KCKA 3TJPA 5D66A 1H19A 4MS6A 5ENQD 3Q73A 2JEKA 3ZYLA 2LNIA 4APOA 5JHAA 2RG8A 5EN5D 5FWQA 4E85A 2VTBB 4JA9A 2YNQA 3CHMA 1HG5A 1OCCE 1MJ0A 2WXMA 4G8LA 1L5JA 1HX8A 4CCAA 3NOCD 4K0RA 2P9UG 4OAVB 3AU5A 1TEZA 2NC9A 2VGXA 2RKKA 1IKND 4EZLA 3NZUA 4NACA 1TYQG 3JXIA 2ZGDA 3AS4A 3B7TA 2UY1B 3QWVA 1AWCB 2KATA 2UWJG 3SFYA 3SGHA 4U04A 4CEMA 4J8EA 3CIAA 4IULA 4I2WA 5A6CA 4B89A 4GMRA 4BEPA 4CT4A 3TG4A 2XPYA 5BV0A 2VTBA 3FU3A 4GZ3A 2WQ6A 4I1AA 2LO6A 1PY1A 4YNDA 5HQ8A 3JCKC 4J7WA 1KZPA 1EDUA 3MKQB 1UN9A 4RVBA 4HLEA 1N4QA 4LNUD 3CGHA 3QOUA 1QYMA 1O1TA 3Q49B 3CKCA 4LERA 3TWSA 4PDXA 5KCMA 2PQRA 2KC7A 2PL2A 3HHMA 2AXUA 2IF4A 2UY1A 4AY5A 3RU0A 2HO1A 2XS8A 4KVOA 5LP0A 3T9KA 2EILE 4XIFA 3Q7AA 4ILHB 3MZLB 4GTSA 5ANLA 3Q7FA 1U3DA 3R7QA 5CMYA 3GZSA 2RD0A 5G04J 2V0PA 3ZHEA 5FQ7A 4ILIA 1WG0A 2BF0X 1TN7A 5FQ8A 3S7BA 3MKQA 2CG3A 5LCWJ 1TJFA 1OXJA 4L2YA 3SQVA 1N0QA 5BXOA 2P9NG 1HF8A 2X6KA 3C98A 4CDRA 4EPZA 1JWFA 4GZDA 4CZ2D 3PE4A 2CFZA 4YDEA 4UI9J 4GPMA 5G2NA 1RW2A 1ZB1A 4I43A 3SFZA 4KZCA 3V79K 2R17C 4U96D 4CDMA 4F6RD 5A23A 1PC2A 3LY9A 5E75A 2LXMA 4XI9A 4AJWA 2WMOA 1Q2ZA 3IHYA 4A3TA 4GTVA 1NI1A 3BG1B 3TWXA 1QBQA 2OEVA 3Q79A 4TRQA 4B8CB 3CKBA 3ZEFA 2I9CA 3N71A 2VYIA 2GRLA 3AJIA 2QYJA 4CGWA 4KZ0A 4PUCA 1E8ZA 3ESKA 2P58C 4JD2G 4DX2A 2HR2A 3CHRA 4RSYA 3HDXA 4Z68A 3Q9UC 4DK5A 3EJNA 4CT0A 3JUEA 1UOHA 3ASOE 4I1OB 5EYPF 2X6IA 2CHZA 4EZJA 1YMPA 4HOUA 3ASDA 3FTUA 5AIJA 4GTQA 1NL4A 3SF4A 5CEAA 5KJNA 2IONA 4J8DA 5AQBA 3V2OA 3ZGQA 2DYSE 3HVEA 4G11A 4B94A 4L1BA 3PRZA 3O48A 1N94A 3TXNA 2A5EA 2WXOA 4YDOA 1XNFA 1MHQA 1OT8A 3ASHA 3PZDA 4AY6A 2LAHA 1QQEA 3W9GA 3NZSA 3B7SA 2ZU6B 2IFUA 4N3AA 3S7DA 1PAQA 1RZ4A 3KD7A 2JLBA 3AG1E 5CCMA 5JJTA 5HKPA 4G23A 2Y69E 4WAFA 1NA3A 5JMND 4L23A 4G26A 3S2AA 4UQYA 5M72A 2OOEA 4U8YD 3MJWA 3ZYQA 3L54A 3EIQC 4BX8A 4BX9A 5CMWA 3UT8A 3UM1A 2JABA 3SFXA 3AG2E 4C9BB 1O5MA 4K03A 3BU8A 5D2MC 3JXJA 4JHRA 3PUKA 2GGFA 3FUKA 3TG5A 2FF4A 2PZIA 4LRZA 3FH8A 1U2VG 4RG9A 4O6FA 2WB2A 3PZ3A 5KJKA 4ATZD 4FP7A 3PUJA 3SD5A 2WXHA 2ZXWE 3FWVA 3SBSA 4I1MA 1Z3YA 2OEWA 3CHPA 4JPSA 2IJGX 5BPPA 1SVXA 1SA5A 3HYMB 5E76A 3APCA 3IHVA 4JVSA 2IQCA 1HU3A 1JUQA 2BEDA 2QFCA 2L6JA 1SZAA 3PNLB 2KM4A 3QC1A 4TUMA 3Q9NC 3PH0C 4WNFA 5LCWC 5FQ6A 4UWKA 4I9CA 3PNTB 1WDYA 5EYLA 3UKRG 5KNHD 3QB2A 2XZTG 4BT8A 1AP7A 3PREA 1WY6A 3V31A 2X6FA 1N54A 3PZ1A 5IY5E 1O1RA 5EIDA 4HOQA 2FULA 3UM3A 3ULQA 1B89A 4KMOA 1IXVA 3G2SA 3OXLA 3UT7A 2GROB 1TJCA 3T5XA 3RRMB 1JCRA 3CVPA 2PM7A 2X3MA 3Q47B 2XGSA 3PEUB 4AOFA 3VTYA 3UPVA 2NXPA 4BFRA 4DLOA 1JCQA 1NP7A 1SA4A 4Q96A 1UJJA 3QWPA 1E90A 5FTPA 2WXJA 2R03A 3MA5A 3L6AA 2XQ0A 2RFMA 2YHEA 5AYWD 4GZCA 3ZKJA 3NB2A 4F1SA 4Q94A 4I17A 3RK6A 1KT0A 3EHMA 2VSOE 5EX3A 4MKTA 3U4TA 2Q7FA 5JJ7A 3L08A 2BKGA 1HO8A 3BUAA 4JHJA 1YA0A 4ILGA 3F6QA 2NSZA 2XHEA 5JHBA 4AVXA 1FT1A 3D9MA 3ML9A 3IBEA 3BQOA 4ACLA 3DEOA 5G05J 3X2QE 4XKBA 3CVQA 1SZ9A 2J9QA 3DBSA 4O1OA 4D10C 4URKA 2X38A 3FEYA 4WWPA 2GRNB 2DBAA 5T4YA 3MV2B 2I2OA 2IY0C 4OAUC 3D9LA 3D9NA 5DIZA 2EINE 3ONLA 4FLHA 3RKVA 3T8MA 4GPKA 3AG4E 3UQ3A 4DJAA 3LKUA 3FUFA 1TNBA 3LS8A 4U8HA 5ENNA 2EIJE 4UWHA 2AXVA 3PVLA 2P9IG 4LNGA 1Y8MA 2DCPA 3TWWA 2ETBA 2VGYA 4GCNA 2AW6A 4R7LA 4FA6A 1VDYA 3FUEA 4WNEA 2RFAA 1XGWA 5BXUA 4J6IA 4DI3A 1MYOA 4FULA 5CCLA 1OWNA 2J49A 2J4DA 3RSEG 3FTXA 1HXIA 4CDNA 3FP3A 5D0QD 3HXFA 1H6PA 3E33A 3VTXA 1GW6A 3FUDA 3I4GA 3DSVA 3QJZA 4KT6B 3ASFA 2BUGA 4GTRA 5JJ6A 3JYSA 4BESA 4GYYA 2L0TB 2P9KG 3SHFA 2ONDA 3I5PA 4EBAA 2ZGGA 3FU5A 4GCOA 4LEUA 3ZUVB 1V55E 3FY4A 1MZCA 5FZQA 1K1AA 5AARA 3U9WA 5KJMA 2J09A 1FVHA 4HFGA 1K1BA 4XZ4A 1EPUA 2GRPB 3ZYMA 3LDZA 2FO7A 3ZW3A 1IHBA 4U0UA 4CYMD 1P5QA 3DPYA 2VGEA 4JC8A 1N4PA 3TWQA 2IO3C 4K5CA 3HXEA 4BT9A 5T3RA 4A55A 4DPRA 2QY7A 1NFIE 5EIBE 3CQCB 5JA4D 2HE0A 2IEJA 2I1JA 3LEWA 4GYOA 2FO1E 3L13A 4B0ZA 5KJLA 2WXQA 4JEHA 1E8WA 3Q4AB 3ASNE 1BPOA 4EBAG 4YDWA 3P1UA 2XRYA 1H2VC 2XGOA 3G2UA 3ESLA 3SZ7A 1QZ2A 3TWUA 5AJDA 3PEVB 5BV1A 2PNNA 3RO3A 2ZISA 2L9BA 4RG6A 3UT4A 4HQDA 3QNKA 3V30A 3TL5A 4G1TA 1ZBPA 3FU6A 4GB9A 2V5FA 4AEZC 4U63A 3Q5MA 4TXPA 4BTAA 1DVPA 3FH5A 2P9SG 2IOLA 1TN8A 1BI7B 3CVYA 4XKCA 2MRIA 5HS0A 3PS6A 3UUXA 4GTOA 4AV7A 2DWZA 2WXFA 3CHQA 3LPZA 3ABME 2ZIRA 5ENRD 3Q78A 1WM5A 4UWFA 4XE0A 2LAIA 3EU9A 3FU0A 3U3WA 3C3QA 2H6IA 1H2TC 3T5VA 3EHQA 3D9IA 2MHKA 3V2XA 1N52A 3ZPJA 2DVWA 4TV3A 3CHOA 4XX5A 2WXGA 2C0LA 5G05C 3U64A 3CK9A 1TNYA 1FT2A 3CVUA 3CK7A 3CLJA 1W3BA 4DI4A 4EHMA 1YCSB 4TXQA 2R05A 3DXMG 3CQGB 4B8AA 5ARGA 2BTDA 3B7RL 3OTNA 4HVBA 3ENEA 4JEUA 5FINA 4WWNA 3RJVA 2A5UA 4YVQC 3CVNA 3LJNA 4ATGA 3E34A 4U0SA 2R5SA 4NQ0A 3VLEA 2X6HA 3OXGA 1BI8B 3NBNB 2WQHA 3OAWA 4C0EA 3EU5A 3UI2A 4U0ZA 3CHSA 5C1DA 1TR4A 1S64A 2QYUA 1TN6A 5AQ7A 5ANRA 1MX4A 3CVXA 2VSNA 3RRNB 4HOTA 5T8IA 4BWRA 3NF1A 1Z3XA 3I4RB 3D9HA 3HXDA 3LVQE 4HRMB 1UG3A 3UTMA 2OV8A 5EDSA 1IQRA 1K8KG 2R59A 1OCOE 2XENA 1N11A 1N95A 4N2SA 3FTVA 4IYPA 4F1PA 5A7DB 3TWRA 1NA0A 3APDA 2R02A 4LNBA 3HRAA 3LJ3A 1BU9A 3WG7E 2V4LA 3APFA 3GYZA 1QNFA 2X6JA 3DSWA 3QK0A 1S63A 5AJLA 4M7CA 5FZRA 4AM9A 2V4HC 2B6CA 4H7XA 3U66A 2J4BA 4KBQA 1OWLA 4GTTA 4H7YA 4GAAA 4UQXA 5G04C 3ONKA 2CFUA 1H6KA 2XGMA 5FT9A 2V5QC 1MX6A 3B7UX 3E32A 3ZXPA 2E2EA 3EHNA 4HRLA 1LF8A 2MYOA 4K5BA 4FADA 4MLPA 3LY8A 3G2TA 4G2VA 1N9AA 2GW1A 3FUHA 3CEQA 2QC9A 3NAWA 1N0RA 4O60A 5KNGA 4PS3A 4GZ5A 3AS8A 5ENSD 4UI9C 2V8SE 4WWOA 1A5EA 1YYHA 2ILRA 4JHKA 4V3IA 2WM9A 3AAAC 1HS6A 3W9FA 4YDYA 2AVPA 4E6HA 3CV0A 3GW4A 1FVFA 2QZAA 1OUVA 4AIFA
chains in the Genus database with same CATH topology
3DPYA 1LD7A 3DSTA 4MBGA 1N4PA 1QBQA 3Q79A 4LNBA 3HXEA 2R2LA 1O1TA 2BEDA 3EUVA 1D8EA 1KZOA 1DCEA 1D8DA 1TNYA 3C72A 1TNOA 3DSWA 4GTVA 1FT2A 3Q73A 1O1SA 1S63A 2H6HA 2IEJA 3DRAA 3DSXA 3HXCA 1LTXA 1X81A 3Q7AA 1FT1A 3KSQA 4EHMA 3PZ4A 4GTSA 3Q7FA 4GTTA 3HXFA 3E33A 3KSLA 3DSVA 1N4SA 2ZISA 1LD8A 1TN7A 4GTRA 3SFXA 3E34A 3DSSA 1O5MA 3E32A 3PZ1A 1O1RA 3HXBA 3EU5A 4L9PA 3PZ2A 1N4RA 1N9AA 1JCRA 1TN8A 4GTQA 1NL4A 3SFYA 2H6FA 1MZCA 1FPPA 1S64A 3E30A 4GTOA 4YDEA 1TNZA 1TNBA 2ZIRA 1TN6A 3PZ3A 3Q78A 1JCQA 4GTMA 1SA4A 2H6GA 1TNUA 3E37A 1N94A 1JCSA 4GTPA 3HXDA 4YDOA 4LNGA 2H6IA 3Q75A 1KZPA 1SA5A 2F0YA 1N95A 3DSUA 1N4QA 1NI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPY A;  1LD7 A;  3DST A;  4MBG A;  1N4P A;  1QBQ A;  3Q79 A;  4LNB A;  3HXE A;  2R2L A;  1O1T A;  2BED A;  3EUV A;  1D8E A;  1KZO A;  1DCE A;  1D8D A;  1TNY A;  3C72 A;  1TNO A;  3DSW A;  4GTV A;  1FT2 A;  3Q73 A;  1O1S A;  1S63 A;  2H6H A;  2IEJ A;  3DRA A;  3DSX A;  3HXC A;  1LTX A;  1X81 A;  3Q7A A;  1FT1 A;  3KSQ A;  4EHM A;  3PZ4 A;  4GTS A;  3Q7F A;  4GTT A;  3HXF A;  3E33 A;  3KSL A;  3DSV A;  1N4S A;  2ZIS A;  1LD8 A;  1TN7 A;  4GTR A;  3SFX A;  3E34 A;  3DSS A;  1O5M A;  3E32 A;  3PZ1 A;  1O1R A;  3HXB A;  3EU5 A;  4L9P A;  3PZ2 A;  1N4R A;  1N9A A;  1JCR A;  1TN8 A;  4GTQ A;  1NL4 A;  3SFY A;  2H6F A;  1MZC A;  1FPP A;  1S64 A;  3E30 A;  4GTO A;  4YDE A;  1TNZ A;  1TNB A;  2ZIR A;  1TN6 A;  3PZ3 A;  3Q78 A;  1JCQ A;  4GTM A;  1SA4 A;  2H6G A;  1TNU A;  3E37 A;  1N94 A;  1JCS A;  4GTP A;  3HXD A;  4YDO A;  4LNG A;  2H6I A;  3Q75 A;  1KZP A;  1SA5 A;  2F0Y A;  1N95 A;  3DSU A;  1N4Q A;  1NI1 A; 
#chains in the Genus database with same CATH topology
 5CHE E;  2NYJ A;  1D9S A;  1JPL A;  5AQ9 A;  2XPZ A;  5CER B;  3VLF A;  3B13 A;  3SNX A;  4KYO B;  4N39 A;  1IHG A;  1O1S A;  1X5B A;  3AU4 A;  3FUN A;  4BTB A;  3UIP C;  3CSF A;  4AP2 A;  4WUY A;  5ENT D;  4GML A;  3FHE A;  1LTX A;  3UX4 A;  4N3B A;  1V54 E;  3KSQ A;  1E8Y A;  3S7F A;  1HZ4 A;  4GYW A;  3WXX A;  3DXK G;  4PS8 A;  2DZO A;  2YQ8 A;  4DUI A;  3KSL A;  4EZK A;  5G55 A;  2GRM A;  1KLX A;  4A1S A;  3QAQ A;  4W9R A;  5CRU A;  4HOS A;  2Y0B G;  5BNW A;  3O4Z A;  3EHR A;  4DX7 D;  1SW6 A;  4RQI A;  3R9A B;  3CVL A;  4L9P A;  4YVO A;  1Z6T A;  5BT1 A;  1FPP A;  2VJ8 A;  3IKO B;  4L2L A;  5FIO A;  3E30 A;  5J90 A;  2VGX B;  3UXG A;  3ZFW A;  3FDH A;  4GTM A;  2WXK A;  3T8K A;  2CHW A;  1ZU2 A;  2Y1L E;  5EX0 A;  4TUU A;  2WMN A;  3LVR E;  4ANW A;  2FBN A;  1INZ A;  3DSU A;  4FJZ A;  1HFA A;  3SY2 A;  4EEC A;  2AXZ A;  3FTS A;  3D9J A;  3GZ1 A;  2F37 A;  4FHK A;  2VSY A;  3SBT B;  5KBA A;  1KZO A;  3IV0 A;  4ABN A;  3UIN C;  4BER A;  3R7R A;  4WND A;  2E0I A;  3FEX A;  2DIW A;  3ML8 A;  3PZ4 A;  3ZNG A;  3MCX A;  4HXI A;  3JUI A;  1ELW A;  5B1B E;  5HRY A;  2I6H A;  3KS2 A;  1IYG A;  1KPS B;  5BW8 C;  1SQM A;  2B0O E;  4QQI A;  2EQX A;  2WXP A;  4G8K A;  4XI0 A;  4N2Q A;  5LFA A;  4U7E B;  4WNG A;  2YIN A;  1Z5S C;  4A3V A;  5H7P A;  1OCR E;  3HIZ A;  1OWP A;  3ZHE B;  3PZ2 A;  4JXT A;  2KCL A;  4HI9 A;  4HRN A;  2Y4U A;  4ANX A;  2VSX E;  4GA2 A;  2H6G A;  4J0U A;  1TNU A;  3E37 A;  2EIK E;  1HG2 A;  3Q15 A;  1JCS A;  4G24 A;  4A1G A;  4GU5 A;  3ASG A;  4IN3 B;  1HE8 A;  5KWD A;  4NIK A;  3J5Q B;  2KZT B;  2EIM E;  4MBG A;  5ENP D;  1KT1 A;  5C2Y A;  4A63 B;  1D8E A;  4OVV A;  2P2C P;  1OCZ E;  4PH4 B;  3CVW A;  1MX2 A;  4DX1 A;  3CK8 A;  4X8Q A;  3TGO A;  4DX6 D;  4LUN U;  1ELK A;  3QKY A;  3C5R A;  3DPD A;  2M63 A;  3UIO C;  3ISM C;  2IOS A;  3LXU X;  4ACK A;  4GA1 A;  4HB5 A;  3CST A;  3K9I A;  1UJK A;  4HS2 A;  2PQN A;  5D0O D;  2L6B A;  2XS1 A;  2Y4T A;  2DZN A;  4UI9 K;  2KZT A;  5B1A E;  3GZ2 A;  4I9E A;  1E7U A;  4J8Y A;  2I1K A;  4HOR A;  2J8S D;  3E4B A;  3R9M A;  2XEV A;  3HG0 D;  1BLX B;  3PDN A;  1HH8 A;  3CVV A;  4GZ6 A;  1TNZ A;  4UUC A;  2WXN A;  3JQ1 A;  3QAR A;  2XRZ A;  2L0I A;  3QWW A;  2XEH A;  2YHC A;  2PM6 A;  2IU1 A;  4BY6 A;  4G25 A;  2AJA A;  3FUJ A;  1Y6I A;  3HVE B;  3ABK E;  4I6G A;  5AN8 A;  4Q69 A;  4N5C A;  2P9L G;  4HNA D;  1JWG A;  2HM8 A;  3EUV A;  1U3C A;  2XCB A;  4ANU A;  3MX3 A;  4M3O A;  1FCH A;  3C72 A;  1K3Z D;  5ITZ F;  1TNO A;  4FHJ A;  1DNP A;  2H6H A;  4ZFH A;  2WXI A;  1A17 A;  3DRA A;  3C3R A;  3HXC A;  3BEE A;  3RIB A;  3ZIM A;  1X81 A;  4U95 D;  4U8V D;  4I2Z A;  3ZYK A;  2LSV A;  4GA0 A;  5CBO A;  1N4S A;  2XZD G;  2GRQ B;  2C2L A;  3IEG A;  3DSS A;  4UWG A;  3MV3 B;  3PE3 A;  4DLQ A;  3D3M A;  4KVM A;  3UMV A;  4DX5 D;  3IXE A;  4UQZ A;  3KEZ A;  2VQ2 A;  3FUM A;  3D9P A;  5AQA A;  4EQF A;  5LX8 A;  5BUZ A;  4I6E A;  3RAU A;  3MGB A;  4B93 B;  3L9T A;  3UKU G;  3G2V A;  4TXR A;  2XPI A;  3MEK A;  4BSX A;  3RRU A;  1UN8 A;  3B95 A;  2WPV A;  3B7B A;  1EF1 C;  3CR3 A;  4I6J A;  4PS7 A;  4C0M A;  4Y6C A;  3Q75 A;  3UM2 A;  5DBK A;  3S7J A;  5AAO A;  2F0Y A;  3MKR A;  1ELR A;  4N3C A;  2ETA A;  2R2L A;  2Y3A A;  4F3V A;  4DRX E;  5ENO D;  4F7A A;  1S0P A;  3TWV A;  3FTY A;  2ETC A;  5CBN A;  5EIL A;  5FZS A;  2OVF A;  3ZU7 B;  1DCQ A;  3TAX A;  4BET A;  4K5A B;  3EDT B;  2BKK B;  2XEE A;  5CEC B;  4C48 B;  3ABL E;  2CHX A;  4MRU A;  4J8F A;  4XEI G;  2J07 A;  4BSZ B;  3FH7 A;  4ZHB A;  4LCT A;  1LD8 A;  4CRW A;  2DYR E;  2A4Z A;  3L16 A;  3NOG D;  4JA7 A;  2KBX A;  3ZXS A;  1IQU A;  4APF A;  4JZY A;  2GRR B;  2LSU A;  4JB8 P;  1OY3 D;  1N4R A;  3VLD A;  4Y6W A;  4NRH B;  4RLY A;  2WVI A;  5HI7 A;  2H6F A;  2XCC A;  3QDN A;  3OXF A;  4GMJ A;  4HLL A;  2IO2 C;  1OWO A;  1S70 B;  3EIJ A;  2FI7 A;  2FEZ A;  3J5P A;  2WXL A;  4GTP A;  4U07 A;  2F8Y A;  2KCV A;  2AWI A;  4AXH A;  1H0A A;  5B3S E;  1MQS A;  3URZ A;  2WXR A;  3DEP A;  4KXK B;  1WAO 1;  3D9O A;  1DC2 A;  3SO8 A;  3G2W A;  4L7T A;  2LXL A;  2F8X K;  3C3O A;  5AEN A;  2C0M A;  3ULY A;  3I3N A;  4HI8 A;  1D8D A;  3ZVV A;  3LYA A;  5CRV A;  2LUH A;  3L17 A;  4HBD A;  3P2B A;  3ULE G;  3AS5 A;  5J08 A;  3DSX A;  4IRU A;  4UWL A;  2OVB A;  3L82 A;  5EKQ D;  4OYS A;  4OVU A;  4CGV A;  3LY7 A;  4QFV A;  1E96 B;  2HYZ A;  5CED B;  3AG3 E;  3KAE A;  3ZN3 A;  4JL0 A;  3UM0 A;  3ZRH A;  4LSZ E;  3SI5 A;  5ARF A;  4ANV A;  3MYV A;  4FLB A;  2MOW A;  5FQ4 A;  4NUR A;  5FJY A;  4F53 A;  2OCC E;  3L22 A;  3HXB A;  1OWM A;  4LG6 A;  3TWT A;  3DWL G;  4JW1 A;  1E8X A;  4ME2 A;  3D9K A;  3NQP A;  4FJY A;  1E7V A;  2J08 A;  4O1P A;  4FC8 A;  5LOZ A;  1EYH A;  3FUL A;  3KEA A;  1H6O A;  1H2U A;  4FU3 A;  4P29 A;  3RO2 A;  3FTZ A;  2WQ7 A;  3BG0 B;  3FUI A;  2P9P G;  2KXP C;  1BD8 A;  1G3N B;  4J8S A;  2CG2 A;  1UW4 B;  1DCE A;  1LD7 A;  3DST A;  3FTW A;  4N5Q A;  3FFL A;  3JQ0 A;  3TXM A;  3LCA A;  1NZN A;  2KCK A;  3TJP A;  5D66 A;  1H19 A;  4MS6 A;  5ENQ D;  3Q73 A;  2JEK A;  3ZYL A;  2LNI A;  4APO A;  5JHA A;  2RG8 A;  5EN5 D;  5FWQ A;  4E85 A;  2VTB B;  4JA9 A;  2YNQ A;  3CHM A;  1HG5 A;  1OCC E;  1MJ0 A;  2WXM A;  4G8L A;  1L5J A;  1HX8 A;  4CCA A;  3NOC D;  4K0R A;  2P9U G;  4OAV B;  3AU5 A;  1TEZ A;  2NC9 A;  2VGX A;  2RKK A;  1IKN D;  4EZL A;  3NZU A;  4NAC A;  1TYQ G;  3JXI A;  2ZGD A;  3AS4 A;  3B7T A;  2UY1 B;  3QWV A;  1AWC B;  2KAT A;  2UWJ G;  3SFY A;  3SGH A;  4U04 A;  4CEM A;  4J8E A;  3CIA A;  4IUL A;  4I2W A;  5A6C A;  4B89 A;  4GMR A;  4BEP A;  4CT4 A;  3TG4 A;  2XPY A;  5BV0 A;  2VTB A;  3FU3 A;  4GZ3 A;  2WQ6 A;  4I1A A;  2LO6 A;  1PY1 A;  4YND A;  5HQ8 A;  3JCK C;  4J7W A;  1KZP A;  1EDU A;  3MKQ B;  1UN9 A;  4RVB A;  4HLE A;  1N4Q A;  4LNU D;  3CGH A;  3QOU A;  1QYM A;  1O1T A;  3Q49 B;  3CKC A;  4LER A;  3TWS A;  4PDX A;  5KCM A;  2PQR A;  2KC7 A;  2PL2 A;  3HHM A;  2AXU A;  2IF4 A;  2UY1 A;  4AY5 A;  3RU0 A;  2HO1 A;  2XS8 A;  4KVO A;  5LP0 A;  3T9K A;  2EIL E;  4XIF A;  3Q7A A;  4ILH B;  3MZL B;  4GTS A;  5ANL A;  3Q7F A;  1U3D A;  3R7Q A;  5CMY A;  3GZS A;  2RD0 A;  5G04 J;  2V0P A;  3ZHE A;  5FQ7 A;  4ILI A;  1WG0 A;  2BF0 X;  1TN7 A;  5FQ8 A;  3S7B A;  3MKQ A;  2CG3 A;  5LCW J;  1TJF A;  1OXJ A;  4L2Y A;  3SQV A;  1N0Q A;  5BXO A;  2P9N G;  1HF8 A;  2X6K A;  3C98 A;  4CDR A;  4EPZ A;  1JWF A;  4GZD A;  4CZ2 D;  3PE4 A;  2CFZ A;  4YDE A;  4UI9 J;  4GPM A;  5G2N A;  1RW2 A;  1ZB1 A;  4I43 A;  3SFZ A;  4KZC A;  3V79 K;  2R17 C;  4U96 D;  4CDM A;  4F6R D;  5A23 A;  1PC2 A;  3LY9 A;  5E75 A;  2LXM A;  4XI9 A;  4AJW A;  2WMO A;  1Q2Z A;  3IHY A;  4A3T A;  4GTV A;  1NI1 A;  3BG1 B;  3TWX A;  1QBQ A;  2OEV A;  3Q79 A;  4TRQ A;  4B8C B;  3CKB A;  3ZEF A;  2I9C A;  3N71 A;  2VYI A;  2GRL A;  3AJI A;  2QYJ A;  4CGW A;  4KZ0 A;  4PUC A;  1E8Z A;  3ESK A;  2P58 C;  4JD2 G;  4DX2 A;  2HR2 A;  3CHR A;  4RSY A;  3HDX A;  4Z68 A;  3Q9U C;  4DK5 A;  3EJN A;  4CT0 A;  3JUE A;  1UOH A;  3ASO E;  4I1O B;  5EYP F;  2X6I A;  2CHZ A;  4EZJ A;  1YMP A;  4HOU A;  3ASD A;  3FTU A;  5AIJ A;  4GTQ A;  1NL4 A;  3SF4 A;  5CEA A;  5KJN A;  2ION A;  4J8D A;  5AQB A;  3V2O A;  3ZGQ A;  2DYS E;  3HVE A;  4G11 A;  4B94 A;  4L1B A;  3PRZ A;  3O48 A;  1N94 A;  3TXN A;  2A5E A;  2WXO A;  4YDO A;  1XNF A;  1MHQ A;  1OT8 A;  3ASH A;  3PZD A;  4AY6 A;  2LAH A;  1QQE A;  3W9G A;  3NZS A;  3B7S A;  2ZU6 B;  2IFU A;  4N3A A;  3S7D A;  1PAQ A;  1RZ4 A;  3KD7 A;  2JLB A;  3AG1 E;  5CCM A;  5JJT A;  5HKP A;  4G23 A;  2Y69 E;  4WAF A;  1NA3 A;  5JMN D;  4L23 A;  4G26 A;  3S2A A;  4UQY A;  5M72 A;  2OOE A;  4U8Y D;  3MJW A;  3ZYQ A;  3L54 A;  3EIQ C;  4BX8 A;  4BX9 A;  5CMW A;  3UT8 A;  3UM1 A;  2JAB A;  3SFX A;  3AG2 E;  4C9B B;  1O5M A;  4K03 A;  3BU8 A;  5D2M C;  3JXJ A;  4JHR A;  3PUK A;  2GGF A;  3FUK A;  3TG5 A;  2FF4 A;  2PZI A;  4LRZ A;  3FH8 A;  1U2V G;  4RG9 A;  4O6F A;  2WB2 A;  3PZ3 A;  5KJK A;  4ATZ D;  4FP7 A;  3PUJ A;  3SD5 A;  2WXH A;  2ZXW E;  3FWV A;  3SBS A;  4I1M A;  1Z3Y A;  2OEW A;  3CHP A;  4JPS A;  2IJG X;  5BPP A;  1SVX A;  1SA5 A;  3HYM B;  5E76 A;  3APC A;  3IHV A;  4JVS A;  2IQC A;  1HU3 A;  1JUQ A;  2BED A;  2QFC A;  2L6J A;  1SZA A;  3PNL B;  2KM4 A;  3QC1 A;  4TUM A;  3Q9N C;  3PH0 C;  4WNF A;  5LCW C;  5FQ6 A;  4UWK A;  4I9C A;  3PNT B;  1WDY A;  5EYL A;  3UKR G;  5KNH D;  3QB2 A;  2XZT G;  4BT8 A;  1AP7 A;  3PRE A;  1WY6 A;  3V31 A;  2X6F A;  1N54 A;  3PZ1 A;  5IY5 E;  1O1R A;  5EID A;  4HOQ A;  2FUL A;  3UM3 A;  3ULQ A;  1B89 A;  4KMO A;  1IXV A;  3G2S A;  3OXL A;  3UT7 A;  2GRO B;  1TJC A;  3T5X A;  3RRM B;  1JCR A;  3CVP A;  2PM7 A;  2X3M A;  3Q47 B;  2XGS A;  3PEU B;  4AOF A;  3VTY A;  3UPV A;  2NXP A;  4BFR A;  4DLO A;  1JCQ A;  1NP7 A;  1SA4 A;  4Q96 A;  1UJJ A;  3QWP A;  1E90 A;  5FTP A;  2WXJ A;  2R03 A;  3MA5 A;  3L6A A;  2XQ0 A;  2RFM A;  2YHE A;  5AYW D;  4GZC A;  3ZKJ A;  3NB2 A;  4F1S A;  4Q94 A;  4I17 A;  3RK6 A;  1KT0 A;  3EHM A;  2VSO E;  5EX3 A;  4MKT A;  3U4T A;  2Q7F A;  5JJ7 A;  3L08 A;  2BKG A;  1HO8 A;  3BUA A;  4JHJ A;  1YA0 A;  4ILG A;  3F6Q A;  2NSZ A;  2XHE A;  5JHB A;  4AVX A;  1FT1 A;  3D9M A;  3ML9 A;  3IBE A;  3BQO A;  4ACL A;  3DEO A;  5G05 J;  3X2Q E;  4XKB A;  3CVQ A;  1SZ9 A;  2J9Q A;  3DBS A;  4O1O A;  4D10 C;  4URK A;  2X38 A;  3FEY A;  4WWP A;  2GRN B;  2DBA A;  5T4Y A;  3MV2 B;  2I2O A;  2IY0 C;  4OAU C;  3D9L A;  3D9N A;  5DIZ A;  2EIN E;  3ONL A;  4FLH A;  3RKV A;  3T8M A;  4GPK A;  3AG4 E;  3UQ3 A;  4DJA A;  3LKU A;  3FUF A;  1TNB A;  3LS8 A;  4U8H A;  5ENN A;  2EIJ E;  4UWH A;  2AXV A;  3PVL A;  2P9I G;  4LNG A;  1Y8M A;  2DCP A;  3TWW A;  2ETB A;  2VGY A;  4GCN A;  2AW6 A;  4R7L A;  4FA6 A;  1VDY A;  3FUE A;  4WNE A;  2RFA A;  1XGW A;  5BXU A;  4J6I A;  4DI3 A;  1MYO A;  4FUL A;  5CCL A;  1OWN A;  2J49 A;  2J4D A;  3RSE G;  3FTX A;  1HXI A;  4CDN A;  3FP3 A;  5D0Q D;  3HXF A;  1H6P A;  3E33 A;  3VTX A;  1GW6 A;  3FUD A;  3I4G A;  3DSV A;  3QJZ A;  4KT6 B;  3ASF A;  2BUG A;  4GTR A;  5JJ6 A;  3JYS A;  4BES A;  4GYY A;  2L0T B;  2P9K G;  3SHF A;  2OND A;  3I5P A;  4EBA A;  2ZGG A;  3FU5 A;  4GCO A;  4LEU A;  3ZUV B;  1V55 E;  3FY4 A;  1MZC A;  5FZQ A;  1K1A A;  5AAR A;  3U9W A;  5KJM A;  2J09 A;  1FVH A;  4HFG A;  1K1B A;  4XZ4 A;  1EPU A;  2GRP B;  3ZYM A;  3LDZ A;  2FO7 A;  3ZW3 A;  1IHB A;  4U0U A;  4CYM D;  1P5Q A;  3DPY A;  2VGE A;  4JC8 A;  1N4P A;  3TWQ A;  2IO3 C;  4K5C A;  3HXE A;  4BT9 A;  5T3R A;  4A55 A;  4DPR A;  2QY7 A;  1NFI E;  5EIB E;  3CQC B;  5JA4 D;  2HE0 A;  2IEJ A;  2I1J A;  3LEW A;  4GYO A;  2FO1 E;  3L13 A;  4B0Z A;  5KJL A;  2WXQ A;  4JEH A;  1E8W A;  3Q4A B;  3ASN E;  1BPO A;  4EBA G;  4YDW A;  3P1U A;  2XRY A;  1H2V C;  2XGO A;  3G2U A;  3ESL A;  3SZ7 A;  1QZ2 A;  3TWU A;  5AJD A;  3PEV B;  5BV1 A;  2PNN A;  3RO3 A;  2ZIS A;  2L9B A;  4RG6 A;  3UT4 A;  4HQD A;  3QNK A;  3V30 A;  3TL5 A;  4G1T A;  1ZBP A;  3FU6 A;  4GB9 A;  2V5F A;  4AEZ C;  4U63 A;  3Q5M A;  4TXP A;  4BTA A;  1DVP A;  3FH5 A;  2P9S G;  2IOL A;  1TN8 A;  1BI7 B;  3CVY A;  4XKC A;  2MRI A;  5HS0 A;  3PS6 A;  3UUX A;  4GTO A;  4AV7 A;  2DWZ A;  2WXF A;  3CHQ A;  3LPZ A;  3ABM E;  2ZIR A;  5ENR D;  3Q78 A;  1WM5 A;  4UWF A;  4XE0 A;  2LAI A;  3EU9 A;  3FU0 A;  3U3W A;  3C3Q A;  2H6I A;  1H2T C;  3T5V A;  3EHQ A;  3D9I A;  2MHK A;  3V2X A;  1N52 A;  3ZPJ A;  2DVW A;  4TV3 A;  3CHO A;  4XX5 A;  2WXG A;  2C0L A;  5G05 C;  3U64 A;  3CK9 A;  1TNY A;  1FT2 A;  3CVU A;  3CK7 A;  3CLJ A;  1W3B A;  4DI4 A;  4EHM A;  1YCS B;  4TXQ A;  2R05 A;  3DXM G;  3CQG B;  4B8A A;  5ARG A;  2BTD A;  3B7R L;  3OTN A;  4HVB A;  3ENE A;  4JEU A;  5FIN A;  4WWN A;  3RJV A;  2A5U A;  4YVQ C;  3CVN A;  3LJN A;  4ATG A;  3E34 A;  4U0S A;  2R5S A;  4NQ0 A;  3VLE A;  2X6H A;  3OXG A;  1BI8 B;  3NBN B;  2WQH A;  3OAW A;  4C0E A;  3EU5 A;  3UI2 A;  4U0Z A;  3CHS A;  5C1D A;  1TR4 A;  1S64 A;  2QYU A;  1TN6 A;  5AQ7 A;  5ANR A;  1MX4 A;  3CVX A;  2VSN A;  3RRN B;  4HOT A;  5T8I A;  4BWR A;  3NF1 A;  1Z3X A;  3I4R B;  3D9H A;  3HXD A;  3LVQ E;  4HRM B;  1UG3 A;  3UTM A;  2OV8 A;  5EDS A;  1IQR A;  1K8K G;  2R59 A;  1OCO E;  2XEN A;  1N11 A;  1N95 A;  4N2S A;  3FTV A;  4IYP A;  4F1P A;  5A7D B;  3TWR A;  1NA0 A;  3APD A;  2R02 A;  4LNB A;  3HRA A;  3LJ3 A;  1BU9 A;  3WG7 E;  2V4L A;  3APF A;  3GYZ A;  1QNF A;  2X6J A;  3DSW A;  3QK0 A;  1S63 A;  5AJL A;  4M7C A;  5FZR A;  4AM9 A;  2V4H C;  2B6C A;  4H7X A;  3U66 A;  2J4B A;  4KBQ A;  1OWL A;  4GTT A;  4H7Y A;  4GAA A;  4UQX A;  5G04 C;  3ONK A;  2CFU A;  1H6K A;  2XGM A;  5FT9 A;  2V5Q C;  1MX6 A;  3B7U X;  3E32 A;  3ZXP A;  2E2E A;  3EHN A;  4HRL A;  1LF8 A;  2MYO A;  4K5B A;  4FAD A;  4MLP A;  3LY8 A;  3G2T A;  4G2V A;  1N9A A;  2GW1 A;  3FUH A;  3CEQ A;  2QC9 A;  3NAW A;  1N0R A;  4O60 A;  5KNG A;  4PS3 A;  4GZ5 A;  3AS8 A;  5ENS D;  4UI9 C;  2V8S E;  4WWO A;  1A5E A;  1YYH A;  2ILR A;  4JHK A;  4V3I A;  2WM9 A;  3AAA C;  1HS6 A;  3W9F A;  4YDY A;  2AVP A;  4E6H A;  3CV0 A;  3GW4 A;  1FVF A;  2QZA A;  1OUV A;  4AIF A; 
#chains in the Genus database with same CATH homology
 3DPY A;  1LD7 A;  3DST A;  4MBG A;  1N4P A;  1QBQ A;  3Q79 A;  4LNB A;  3HXE A;  2R2L A;  1O1T A;  2BED A;  3EUV A;  1D8E A;  1KZO A;  1DCE A;  1D8D A;  1TNY A;  3C72 A;  1TNO A;  3DSW A;  4GTV A;  1FT2 A;  3Q73 A;  1O1S A;  1S63 A;  2H6H A;  2IEJ A;  3DRA A;  3DSX A;  3HXC A;  1LTX A;  1X81 A;  3Q7A A;  1FT1 A;  3KSQ A;  4EHM A;  3PZ4 A;  4GTS A;  3Q7F A;  4GTT A;  3HXF A;  3E33 A;  3KSL A;  3DSV A;  1N4S A;  2ZIS A;  1LD8 A;  1TN7 A;  4GTR A;  3SFX A;  3E34 A;  3DSS A;  1O5M A;  3E32 A;  3PZ1 A;  1O1R A;  3HXB A;  3EU5 A;  4L9P A;  3PZ2 A;  1N4R A;  1N9A A;  1JCR A;  1TN8 A;  4GTQ A;  1NL4 A;  3SFY A;  2H6F A;  1MZC A;  1FPP A;  1S64 A;  3E30 A;  4GTO A;  4YDE A;  1TNZ A;  1TNB A;  2ZIR A;  1TN6 A;  3PZ3 A;  3Q78 A;  1JCQ A;  4GTM A;  1SA4 A;  2H6G A;  1TNU A;  3E37 A;  1N94 A;  1JCS A;  4GTP A;  3HXD A;  4YDO A;  4LNG A;  2H6I A;  3Q75 A;  1KZP A;  1SA5 A;  2F0Y A;  1N95 A;  3DSU A;  1N4Q A;  1NI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...