4CRWA

Complex of human ddx6 (reca-c) and cnot1 (mif4g)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
226
structure length
226
Chain Sequence
b'EENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title A Ddx6-Cnot1 Complex and W-Binding Pockets in Cnot9 Reveal Direct Links between Mirna Target Recognition and Silencing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 94
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4crwA00
2HM8A 2IONA 2VSOE 5ANRA 2IOSA 2RG8A 3EIJA 4B8AA 3JUIA 2KZTA 4B89A 3RK6A 2I2OA 1H2VC 2GGFA 1N54A 3FEYA 4IULA 4B8CB 1H2UA 4GMJA 2VSXE 1N52A 2IU1A 4C9BB 4JHKA 2ZU6B 1UG3A 4JHJA 4LUNU 2NSZA 3FEXA 3EIQC 2KZTB 3L6AA 1PAQA 1HU3A 1H6KA 2FULA 1UW4B 4CEMA 4CRWA 1H2TC 4GMLA 4CT4A 3D3MA 2IOLA
chains in the Genus database with same CATH superfamily
4UUCA 5BW8C 5E75A 3QKYA 2VJ8A 2R59A 3SBTB 3U64A 3NBNB 3AG1E 3G2SA 2LSVA 3JQ0A 2DIWA 2IFUA 2KC7A 5LFAA 3C98A 3ASNE 3AS4A 2VSXE 4ATGA 3Q79A 2NSZA 4G2VA 4MKTA 4O1OA 2RFAA 4EECA 4HS2A 3ZU7B 3FY4A 1N4RA 4C48B 3UMVA 2AXVA 5T3RA 3R7RA 5HQ8A 2E0IA 4WAFA 3MCXA 4RG9A 2XCBA 2LO6A 5ARGA 2OOEA 4C9BB 4G8LA 3SFZA 4GZ5A 3ZYQA 4QQIA 1UW4B 3CLJA 4ACLA 5EIDA 2DZOA 2ZGDA 4LNGA 2WMOA 3I4GA 3ZGQA 3PH0C 4FLBA 4I2ZA 3T8MA 3IHVA 4K03A 3HVEA 2X38A 5BUZA 3HXCA 5KNGA 2I9CA 3RU0A 3NZSA 2AJAA 3X2QE 5LP0A 4XKBA 3CV0A 5B1AE 4JZYA 1O1RA 4LRZA 5AIJA 2GRRB 4HVBA 4G25A 3V2OA 1MX2A 3B7SA 2GRPB 4CT4A 1V54E 3LS8A 2P9SG 4G8KA 2YNQA 1MJ0A 3B7BA 4O1PA 1EPUA 1WM5A 3CGHA 5G04J 4F53A 4OVUA 3QWWA 4APOA 3LCAA 2RD0A 3LDZA 3P2BA 4F6RD 3SQVA 1Z3YA 2KZTA 1G3NB 4Y6CA 3UXGA 2XENA 4KMOA 3ULYA 5CECB 1QQEA 1BU9A 3ULQA 2AVPA 4HI9A 1TN6A 2KATA 4M7CA 5C1DA 2WXOA 5FINA 2CG3A 4MBGA 1QYMA 4AIFA 3CVXA 1NA0A 4B94A 3G2VA 4LNBA 4JPSA 4GAAA 3SD5A 4UI9J 1PC2A 3FU6A 2X6KA 4AY5A 4GB9A 4BETA 1U2VG 2VTBB 2FBNA 4JD2G 3TXNA 4N3CA 4KYOB 1IXVA 3UX4A 5KJKA 4F1PA 4GZCA 5EDSA 3HRAA 1H2VC 1K1AA 4A55A 2CHWA 3NF1A 1DNPA 2MYOA 1Z5SC 4JEUA 1H6PA 3IV0A 1ZBPA 4GMLA 2QYJA 3CVWA 1SZ9A 4CT0A 1TN8A 3HIZA 3VLFA 3UT7A 4HOTA 4UWLA 5EIBE 1BI8B 4L9PA 2DWZA 5C2YA 4Q69A 3PZ1A 2B0OE 3HXFA 2H6HA 4PS7A 4HB5A 3RRMB 2Y3AA 1OWLA 3PEVB 4KBQA 4A3TA 4BWRA 1QZ2A 1O5MA 2RG8A 4Z68A 5FJYA 3EU9A 4BTAA 3WXXA 3CR3A 3F6QA 2GW1A 3VTYA 3FH8A 4I9EA 5ENSD 5FZRA 3UINC 4DLQA 4LG6A 1HU3A 1H6KA 3FUHA 3ENEA 3C3RA 5FQ8A 3ZPJA 3CVPA 3S2AA 3N71A 1LD8A 2H6IA 4EHMA 3CVNA 2QC9A 5FIOA 4I6JA 4IN3B 3ZRHA 4ILGA 3CHQA 3NOGD 4I1AA 3PEUB 2OEWA 1UN9A 4GZ6A 3EHQA 2X6IA 2YQ8A 2HE0A 1S64A 3PZ2A 3L9TA 4RLYA 4GCNA 4MLPA 3LY8A 3ZUVB 3Q78A 5KJNA 4I43A 4J8FA 3R9AB 3EDTB 3D9IA 1GW6A 4HOQA 5CCLA 1OCOE 3L16A 3MEKA 4F3VA 4GTSA 2BKGA 2OCCE 3DSSA 4OYSA 3D9OA 1JWGA 2WXHA 3DWLG 1OWNA 1INZA 1FT2A 2KCVA 2WXFA 5FZSA 3FUMA 3ZYLA 4HQDA 3VLEA 4I6EA 4JEHA 2I1JA 4AVXA 2HR2A 3ONKA 3RK6A 3TL5A 1IHBA 3DXMG 1E90A 3TWUA 4U0UA 4U0SA 2Y4UA 1NP7A 2ILRA 4XIFA 5FQ6A 4DRXE 3IKOB 5A6CA 1BLXB 3CEQA 2C0LA 3E32A 4J8DA 1KT0A 4V3IA 3B13A 3B95A 5BV1A 3GW4A 4CYMD 2R05A 2QFCA 1WY6A 4D10C 5LOZA 3CKBA 2KXPC 3ESKA 2NC9A 3MYVA 4CGVA 3IXEA 5ENTD 3JUIA 4DI4A 5HKPA 3GZSA 1X5BA 2XQ0A 3PUJA 4GTQA 3CQCB 2X6HA 4BT9A 3EIQC 5JHBA 2X3MA 3FWVA 4GA0A 3PDNA 1IYGA 5EKQD 2QZAA 3RKVA 2UY1B 2MHKA 5T4YA 2DYRE 4EZLA 5BXUA 1EYHA 1NFIE 2IQCA 1IQUA 2JEKA 3CHMA 2AW6A 1JPLA 5BT1A 1SZAA 5KWDA 2FF4A 3QDNA 2AXUA 3D3MA 4FHJA 5EYLA 1TNYA 1N4PA 2VSOE 3BG1B 1E8ZA 4F7AA 2WQ6A 2AWIA 3APFA 2VTBA 3Q7FA 5B3SE 1S63A 4G23A 5ANLA 2LAIA 3Q15A 4UI9K 3L6AA 3RJVA 2ETBA 2EILE 4DX2A 3DPDA 3ZW3A 3G2WA 2GRQB 2WXKA 4TXQA 3FUEA 3PNTB 1NZNA 4FP7A 2HYZA 2DYSE 3Q49B 4K5CA 3CHOA 3VLDA 2WPVA 3URZA 2WB2A 2WM9A 4XEIG 3O4ZA 3MKQA 3NOCD 3T9KA 2XS8A 2KCKA 3ZHEB 4BSZB 2C2LA 3FEYA 4GYOA 3TWSA 4GMJA 2BTDA 4J7WA 3E34A 4APFA 4ZFHA 3ZNGA 1KT1A 5CHEE 4TUMA 4L2YA 3EU5A 3RO3A 4AJWA 3ZXPA 1HX8A 4HNAD 3ZIMA 3UUXA 3ABME 1DCQA 4UQYA 4JHKA 3L22A 4GYYA 1H6OA 4U7EB 4WNDA 3FTWA 3I5PA 4NIKA 5CRUA 4ACKA 3FH7A 1DVPA 4P29A 3JCKC 1O1SA 4G1TA 2DBAA 3UIPC 3ZXSA 2PZIA 2YHEA 3D9NA 4FULA 4I2WA 3FH5A 1A17A 3W9FA 4DX6D 2IOLA 3IHYA 5JA4D 1HF8A 3Q4AB 3HXDA 1OXJA 3PZ4A 2LXMA 3QB2A 3ASGA 2EINE 1YCSB 2OVFA 3D9JA 2GGFA 2P9LG 1KLXA 3JQ1A 2B6CA 1HH8A 1TNBA 2M63A 4Q94A 3MZLB 2P9NG 1DCEA 4UQZA 3TWTA 4OVVA 1AP7A 1IQRA 1OWPA 2HM8A 5KJLA 4O60A 4OAVB 3ISMC 3Q75A 4GPMA 2EIME 3BQOA 5HRYA 3ESLA 3LVRE 3EHNA 4GCOA 2XCCA 3FTUA 2XEVA 4WNGA 4DPRA 4JHRA 4O6FA 4EBAA 3UKUG 2VGXA 3AU4A 4W9RA 2Y0BG 4HBDA 1BI7B 3PZDA 1E7UA 4HOUA 1N54A 2J09A 3BG0B 4UWHA 4YDWA 3UT4A 3LYAA 4ZHBA 1UG3A 2J8SD 4RG6A 4L7TA 4LCTA 4DUIA 5EYPF 4N2QA 3PUKA 3UQ3A 3FHEA 3C3OA 4AEZC 3FFLA 4Q96A 4YNDA 3JXJA 4CDMA 2WQHA 3CHSA 3FTVA 5ENPD 3Q9UC 2VSNA 2CG2A 3TWWA 5KBAA 5EILA 3LKUA 5D66A 5J08A 4IRUA 2QY7A 1K8KG 2Y4TA 3QK0A 4JL0A 2I1KA 3D9PA 4DJAA 1HXIA 2XRYA 3TXMA 2UY1A 2AXZA 3FUDA 1QNFA 1Z6TA 5FQ4A 2FO1E 3L17A 5DIZA 1MZCA 5FZQA 3DEOA 1TNZA 4G26A 3NZUA 5JJ6A 3TG4A 2V4HC 4B89A 2WXPA 4EPZA 1A5EA 1OCZE 1OUVA 2WXRA 3TWXA 1YMPA 1QBQA 3TWRA 4XI0A 3FUFA 2L6BA 3QARA 1U3DA 3PVLA 4GMRA 1JUQA 3FTZA 3FTSA 3QJZA 4CDRA 3D9MA 4AV7A 2WXNA 3J5PA 4GZDA 4U04A 4K5BA 3RRUA 1SA5A 4B8CB 1H2UA 2IY0C 2F8YA 2MRIA 1LD7A 3FEXA 5ENRD 3CSTA 3GZ1A 2VSYA 2PQRA 2NYJA 3ZYKA 3E4BA 3FU5A 3SZ7A 5CBNA 4QFVA 2YHCA 3LY7A 5A7DB 2IOSA 2GRMA 2XS1A 4BESA 1TN7A 1WAO1 3QNKA 3ONLA 2IJGX 3MKRA 4K0RA 1PAQA 3P1UA 2H6FA 5ANRA 1VDYA 3SF4A 3T5VA 3MGBA 4EZJA 4B8AA 2DVWA 4FLHA 4CCAA 3PE3A 3EUVA 4GTRA 4I1MA 3CVQA 1HG2A 3MV3B 1EF1C 2EIKE 4CRWA 5A23A 1MX4A 4RVBA 2F8XK 2P9UG 4UQXA 4WWOA 4N5CA 3L13A 4NURA 3OXLA 3G2UA 3DBSA 4L23A 1HFAA 4LERA 3NAWA 3L08A 1JCQA 2PQNA 3EHMA 2Q7FA 3UIOC 2Y1LE 3SHFA 4IULA 3CSFA 4CGWA 2J4BA 2VQ2A 1FPPA 1ELRA 2XPZA 3B7RL 4X8QA 3PRZA 3DSUA 1ZU2A 4HRMB 4U96D 4TUUA 5LCWC 3T5XA 4G24A 1N94A 5G55A 3V31A 5AQBA 1NI1A 4I6GA 4XI9A 4I9CA 4URKA 2HO1A 3U9WA 4U63A 2F0YA 1YYHA 4BX9A 3OXGA 3MJWA 5AQAA 5JJTA 2XHEA 1H0AA 3EJNA 2MOWA 3Q9NC 3E37A 4GTTA 2J9QA 4KT6B 3KAEA 5FTPA 4ANXA 4YDYA 4TXRA 1BD8A 4RSYA 2X6JA 5AN8A 1TR4A 3FUKA 3UKRG 3O48A 4EZKA 1N0RA 4C0EA 1HE8A 4DX5D 4FHKA 4N39A 3TAXA 3ASHA 3LVQE 5H7PA 3FU0A 4DLOA 1OCRE 3ASFA 3C5RA 1MHQA 2OVBA 3AU5A 3OXFA 3CVYA 4ATZD 4JA7A 3EHRA 3I3NA 4GYWA 3ZN3A 3TWQA 4HOSA 1UJJA 4A1SA 1MX6A 3HDXA 4I17A 5AYWD 4HXIA 1JWFA 3ASOE 1N9AA 3CK8A 1IKND 4GTMA 2X6FA 3AG3E 1TNOA 5KCMA 1WG0A 4J0UA 4K5AB 3S7DA 2XZTG 3PE4A 4J8EA 3TJPA 2UWJG 2KZTB 3LJNA 3ULEG 3LEWA 3FUIA 5E76A 3LJ3A 2H6GA 4KZCA 1UOHA 2FEZA 3JXIA 1Y6IA 2QYUA 2XRZA 4XZ4A 1RW2A 3IBEA 2V5QC 3FTYA 2IONA 1UJKA 1ELWA 3V30A 3QOUA 3VTXA 3BU8A 3UM1A 1E96B 1PY1A 2R03A 2R2LA 5EX3A 3DXKG 3UT8A 5BV0A 4EBAG 3CVUA 4ME2A 1SQMA 1HG5A 5HS0A 4GU5A 4JXTA 1D8DA 5HI7A 3DSWA 1HZ4A 5B1BE 4MRUA 1MYOA 4PUCA 5AQ9A 4KXKB 4TRQA 1B89A 4PS3A 4KVMA 1XNFA 5JJ7A 2XGSA 3V79K 1Q2ZA 3AJIA 1SW6A 1L5JA 2CFZA 3FP3A 4DI3A 2LXLA 3DSXA 4FJYA 3SFYA 4Y6WA 2BUGA 5D0OD 2P9KG 3R7QA 2P2CP 1X81A 4GTVA 2LNIA 4BEPA 5AQ7A 5J90A 3APDA 5T8IA 1H2TC 4WWPA 3SBSA 1LF8A 4JVSA 4WWNA 3DSTA 5CEDB 2DZNA 3TG5A 5AARA 1N95A 1OWMA 4J8YA 3S7BA 3CVLA 3WG7E 4DK5A 3TWVA 4H7XA 4YVQC 3UI2A 3LXUX 1ZB1A 4OAUC 4PDXA 2ONDA 3AS8A 4GA2A 5JMND 3QWPA 2WMNA 3HXBA 3FUJA 1JCRA 5G05C 2R5SA 5EX0A 3CIAA 3J5QB 1N0QA 3SI5A 3V2XA 2C0MA 3FULA 2F37A 2EIJE 2WXJA 4EQFA 2XGMA 3ML9A 3KD7A 3UTMA 4N2SA 3HXEA 2ZU6B 5ARFA 4F1SA 4ILHB 4FADA 1BPOA 4HRNA 1S70B 3U3WA 4GTPA 4L2LA 1DC2A 4JA9A 2XEHA 4HI8A 3CVVA 2J07A 3L82A 1XGWA 5LCWJ 2P9PG 5CMYA 4BFRA 1SA4A 2KBXA 4HORA 2OEVA 4FU3A 3L54A 3KS2A 1H19A 2ZXWE 4MS6A 2IO3C 4JB8P 1LTXA 4FA6A 4E6HA 4CZ2D 5EN5D 5BNWA 2Y69E 5KNHD 5CERB 5BXOA 4LNUD 2WXIA 1S0PA 4AY6A 2IU1A 3ZKJA 3ABKE 1D9SA 1TEZA 1OY3D 3DEPA 1E8YA 4TV3A 2PM6A 1N4SA 1P5QA 3OAWA 3PZ3A 3KSLA 4U8YD 4H7YA 4ANUA 4DX7D 1KZOA 5ENNA 3KEZA 3FUNA 2L0TB 4PS8A 1HO8A 5CCMA 1WDYA 2BKKB 2R17C 2J49A 4U07A 4J8SA 4N3BA 3HYMB 4U8HA 2WXLA 1O1TA 3GZ2A 4N5QA 4TXPA 2GROB 3MX3A 5LX8A 2WXQA 3FTXA 5M72A 3K9IA 4C0MA 4CEMA 3D9LA 4WNFA 4NRHB 4BT8A 2GRLA 3PS6A 2J4DA 4BY6A 4GTOA 2CHZA 4M3OA 3RO2A 3SNXA 3S7JA 4U0ZA 2LSUA 3SFXA 3DSVA 4GA1A 4CDNA 4FC8A 1AWCB 4ANVA 4JHJA 1K1BA 3ZHEA 1NL4A 3AAAC 3QWVA 5ITZF 2V4LA 2OV8A 3UM3A 5IY5E 2WVIA 3ABLE 5AJLA 2IF4A 3MKQB 4U8VD 3MA5A 2P9IG 3LY9A 1IHGA 3DPYA 4BERA 1KZPA 5D2MC 4AXHA 5CBOA 3NQPA 4BSXA 4B0ZA 1TJCA 2IO2C 3D9HA 2DCPA 3R9MA 1K3ZD 4XE0A 3KEAA 2IEJA 4IYPA 1SVXA 3AS5A 3SGHA 4DX1A 1U3CA 3RAUA 3QC1A 2XPIA 4NACA 3KSQA 3DRAA 1N52A 4R7LA 4BTBA 5CRVA 3HG0D 2CFUA 1TYQG 2NXPA 2XPYA 3UM0A 4A3VA 2ZGGA 2ZIRA 1JCSA 3SO8A 4JW1A 3RRNB 1N11A 1Z3XA 4GPKA 1OT8A 4ILIA 2FI7A 3FU3A 4UWGA 2ETCA 4J6IA 3B7UX 3D9KA 1E8WA 3RIBA 4LEUA 5JHAA 3TGOA 2A4ZA 4KZ0A 2V8SE 1TNUA 1MQSA 1RZ4A 1D8EA 5AENA 1HS6A 3PREA 3CQGB 5KJMA 4JC8A 3PNLB 5G05J 4RQIA 5CEAA 4UWKA 3HVEB 2VGYA 5G04C 3LPZA 4AM9A 1KPSB 2WXGA 3EIJA 2V5FA 2LAHA 2GRNB 1YA0A 1OWOA 2VGXB 1FT1A 3RSEG 4XKCA 4PH4B 2WXMA 4ABNA 2VGEA 3UPVA 3Q5MA 4HLEA 1ELKA 3B7TA 3HHMA 5FQ7A 4N3AA 1FVFA 2I2OA 1EDUA 4FJZA 3I4RB 4NQ0A 2XZDG 2ETAA 4I1OB 4UI9C 1W3BA 5AJDA 2JLBA 2KM4A 1NA3A 2RFMA 4A63B 2J08A 3Q47B 4L1BA 1E7VA 4WNEA 3T8KA 3JYSA 4BX8A 5FWQA 4YVOA 3S7FA 3OTNA 3AG4E 3ML8A 2R02A 1FVHA 3C3QA 4GZ3A 2L6JA 3E33A 5AAOA 2PNNA 2PL2A 5FT9A 1FCHA 1UN8A 4G11A 2KCLA 5ENQD 4A1GA 2WQ7A 3CK9A 3W9GA 4HRLA 5DBKA 1N4QA 3CK7A 2EQXA 1Y8MA 4B93B 3ZFWA 2XEEA 1OCCE 4HFGA 3AG2E 3IEGA 3FDHA 3CHPA 4E85A 2ZISA 3APCA 5BPPA 2FO7A 2E2EA 2JABA 3NB2A 2P58C 3ZYMA 4ANWA 3U4TA 3ZVVA 4HLLA 2I6HA 3CHRA 3ZEFA 4AP2A 3BUAA 3Q73A 3UM2A 3E30A 2L9BA 2L0IA 3G2TA 2CHXA 4KVOA 3SY2A 3CKCA 3QAQA 3U66A 2LUHA 3JUEA 3BEEA 5G2NA 4LUNU 2RKKA 4U95D 4YDOA 5CMWA 3Q7AA 2A5UA 1V55E 4AOFA 2BEDA 3C72A 4LSZE 2V0PA 1E8XA 3MV2B 2VYIA 4YDEA 2PM7A 2XGOA 5ENOD 4UWFA 3GYZA 2A5EA 3ASDA 5D0QD 2BF0X 2FULA 2YINA 4WUYA 1TJFA 4XX5A
chains in the Genus database with same CATH topology
3ESKA 5BNWA 5BW8C 5E75A 2NC9A 3MYVA 3QKYA 4CGVA 2VJ8A 4RVBA 2R59A 3JUIA 3SBTB 4UQXA 4WWOA 4DI4A 3GZSA 1X5BA 2XQ0A 3U64A 3PUJA 4N5CA 3CQCB 3L13A 4NURA 2WXIA 1S0PA 4AY6A 2IU1A 2X6HA 3OXLA 3G2SA 1TEZA 3G2UA 4BT9A 2LSVA 3EIQC 3DBSA 3JQ0A 1E8YA 4TV3A 2PM6A 5JHBA 2X3MA 1P5QA 3FWVA 3OAWA 3PDNA 4GA0A 4L23A 1IYGA 2DIWA 5EKQD 1HFAA 4LERA 2IFUA 4H7YA 3RKVA 2KC7A 3L08A 2UY1B 2PQNA 5LFAA 3EHMA 3C98A 2MHKA 4ANUA 2Q7FA 5T4YA 4EZLA 3SHFA 4IULA 3CSFA 1EYHA 2J4BA 3AS4A 4CGWA 2IQCA 1IQUA 2JEKA 2VQ2A 2VSXE 5ENNA 4ATGA 3CHMA 3KEZA 1ELRA 3FUNA 2AW6A 2L0TB 2XPZA 1JPLA 4PS8A 1HO8A 2NSZA 3B7RL 5CCMA 4G2VA 5BT1A 1SZAA 2FF4A 3QDNA 4MKTA 2AXUA 3D3MA 4FHJA 4EECA 2R17C 2J49A 3PRZA 4HS2A 2VSOE 3BG1B 1ZU2A 1E8ZA 3FY4A 4U07A 4TUUA 4F7AA 2WQ6A 2AWIA 4J8SA 3APFA 3UMVA 4N3BA 2VTBA 5LCWC 2AXVA 3HYMB 4U8HA 2WXLA 5LOZA 5T3RA 3R7RA 3T5XA 5HQ8A 2E0IA 4G24A 3GZ2A 4WAFA 3MCXA 4RG9A 4G23A 2XCBA 2LO6A 5ANLA 5G55A 5ARGA 2OOEA 4C9BB 3SFZA 3MX3A 4I6GA 4XI9A 4I9CA 4URKA 5LX8A 2LAIA 2WXQA 3Q15A 4GZ5A 3ZYQA 3FTXA 4UI9K 3L6AA 3K9IA 2HO1A 3U9WA 4C0MA 4CEMA 5M72A 1UW4B 3CLJA 4ACLA 3D9LA 4WNFA 4NRHB 4BT8A 4U63A 2GRLA 3PS6A 2J4DA 3RJVA 4BY6A 2CHZA 2WMOA 4BX9A 4M3OA 3I4GA 3RO2A 3ZGQA 3OXGA 3MJWA 3DPDA 5JJTA 2XHEA 3G2WA 3PH0C 3SNXA 3ZW3A 2WXKA 3S7JA 1H0AA 3EJNA 4U0ZA 4FLBA 2MOWA 4I2ZA 3T8MA 3IHVA 2LSUA 3FUEA 1NZNA 3HVEA 3PNTB 4K03A 4FP7A 2HYZA 4GA1A 4CDNA 4FC8A 2J9QA 3Q49B 4ANVA 2X38A 4KT6B 5BUZA 3KAEA 3CHOA 4JHJA 5FTPA 3ZHEA 4ANXA 2I9CA 3RU0A 3VLDA 2WPVA 3NZSA 3URZA 2WB2A 4RSYA 2X6JA 3QWVA 2WM9A 3FUKA 5LP0A 4XKBA 3CV0A 3O4ZA 4JZYA 2V4LA 3O48A 2OV8A 4EZKA 3MKQA 4C0EA 4LRZA 2KCKA 3ZHEB 1HE8A 2WVIA 5AIJA 5AJLA 4FHKA 4N39A 2C2LA 3TAXA 3FEYA 2IF4A 4GYOA 3ASHA 4GMJA 2BTDA 4HVBA 4G25A 3LVQE 3FU0A 4APFA 4DLOA 3MKQB 3B7SA 3ASFA 3VTYA 3MA5A 4CT4A 1MHQA 3LS8A 1KT1A 3LY9A 2OVBA 5CHEE 3AU5A 3OXFA 1IHGA 3CVYA 4JA7A 4L2YA 2YNQA 3I3NA 4AXHA 3RO3A 4GYWA 3NQPA 4AJWA 4BSXA 3ZN3A 4HOSA 1EPUA 1HX8A 4B0ZA 1WM5A 1UJJA 3CGHA 1TJCA 3ZIMA 5G04J 4A1SA 3UUXA 4F53A 3HDXA 4UQYA 4JHKA 4I17A 3L22A 5AYWD 2DCPA 4GYYA 4OVUA 3QWWA 4APOA 3LCAA 3FTWA 4WNDA 4HXIA 4XE0A 3I5PA 1JWFA 3CK8A 4IYPA 2RD0A 3LDZA 4ACKA 3FH7A 3P2BA 1DVPA 4P29A 3JCKC 1Z3YA 2X6FA 4G1TA 3AS5A 3SGHA 2KZTA 2DBAA 4Y6CA 5KCMA 1U3CA 4KMOA 3ZXSA 3QC1A 2PZIA 4J0UA 2XPIA 2YHEA 4NACA 3D9NA 1N52A 4FULA 4I2WA 4R7LA 4BTBA 3FH5A 3S7DA 1A17A 3PE4A 4J8EA 3TJPA 1QQEA 2UWJG 2KZTB 3ULQA 2AVPA 2CFUA 2KATA 5C1DA 2WXOA 2NXPA 2IOLA 3IHYA 3LEWA 2XPYA 3FUIA 1HF8A 2CG3A 3Q4AB 5E76A 3LJ3A 4A3VA 4AIFA 3CVXA 1NA0A 3QB2A 3ASGA 4KZCA 4B94A 3G2VA 4JPSA 2FEZA 1Y6IA 2OVFA 3D9JA 4GAAA 3SD5A 2GGFA 4UI9J 1KLXA 4JW1A 1PC2A 3JQ1A 3RRNB 1Z3XA 2XRZA 3FU6A 4GPKA 4XZ4A 1HH8A 2X6KA 2M63A 4ILIA 2FI7A 4AY5A 4Q94A 3FU3A 4GB9A 4UWGA 3MZLB 4UQZA 4J6IA 2FBNA 2VTBB 3B7UX 3TXNA 3IBEA 4N3CA 4DPRA 3D9KA 4OVVA 1E8WA 3FTYA 4KYOB 1IQRA 1OWPA 2HM8A 2IONA 1UJKA 3UX4A 1ELWA 3RIBA 4LEUA 5JHAA 5KJLA 3QOUA 3TGOA 2A4ZA 5KJKA 4KZ0A 2V8SE 4GZCA 1MQSA 5EDSA 3VTXA 1H2VC 3ESLA 4A55A 2CHWA 1E96B 3LVRE 3NF1A 1DNPA 5AENA 1PY1A 1HS6A 4JEUA 3EHNA 5EX3A 3PREA 4GCOA 2XCCA 3FTUA 3UT8A 5BV0A 4EBAG 3CQGB 3IV0A 1ZBPA 5KJMA 4GMLA 4JC8A 2XEVA 3PNLB 4WNGA 5G05J 3CVWA 3CVUA 1SZ9A 4ME2A 1SQMA 1HG5A 4UWKA 3HVEB 4JHRA 4GU5A 4JXTA 2VGYA 4O6FA 3LPZA 5G04C 4CT0A 4EBAA 4AM9A 2VGXA 2WXGA 3AU4A 3HIZA 4W9RA 3VLFA 3EIJA 2V5FA 5HI7A 3UT7A 4HOTA 2LAHA 1HZ4A 3PZDA 1E7UA 4HOUA 1N54A 4MRUA 4UWLA 1YA0A 2J09A 3BG0B 4UWHA 4PUCA 1OWOA 5C2YA 4KXKB 3UT4A 3LYAA 4TRQA 2VGXB 1UG3A 4Q69A 4RG6A 4XKCA 4L7TA 4LCTA 4PH4B 2WXMA 4PS7A 1B89A 4PS3A 4ABNA 3RRMB 3Q5MA 3UPVA 4N2QA 4KVMA 4HLEA 1XNFA 3PUKA 1ELKA 3B7TA 3UQ3A 5JJ7A 3HHMA 2Y3AA 1OWLA 3PEVB 3FHEA 4KBQA 4A3TA 4AEZC 2XGSA 4N3AA 1QZ2A 3FFLA 5FQ7A 2RG8A 4BWRA 5FJYA 1L5JA 2CFZA 1FVFA 3FP3A 4Q96A 4YNDA 4DI3A 4BTAA 2I2OA 4CDMA 3WXXA 3CR3A 2WQHA 4FJYA 1EDUA 2GW1A 3CHSA 3FTVA 3FH8A 3I4RB 2BUGA 4FJZA 4I9EA 4NQ0A 4Y6WA 5D0OD 5FZRA 2VSNA 3R7QA 2CG2A 2LNIA 4DLQA 3LKUA 5J90A 1HU3A 1H6KA 3APDA 5T8IA 5J08A 1H2TC 4I1OB 3FUHA 4WWPA 3SBSA 1LF8A 3ENEA 4JVSA 4UI9C 5FQ8A 1W3BA 4IRUA 2JLBA 2QY7A 5AJDA 4WWNA 3ZPJA 2Y4TA 2KM4A 1NA3A 3CVPA 3TG5A 3QK0A 3S2AA 3N71A 2J08A 4JL0A 1OWMA 3Q47B 4L1BA 2I1KA 1E7VA 3D9PA 4WNEA 4DJAA 3JYSA 1HXIA 3S7BA 2XRYA 3CVNA 3CVLA 3TXMA 4BX8A 2UY1A 5FWQA 2AXZA 3FUDA 4I6JA 4YVOA 3OTNA 4IN3B 3S7FA 4DK5A 3ZRHA 1QNFA 4ILGA 3CHQA 1Z6TA 3ML8A 4H7XA 5FQ4A 4YVQC 4I1AA 3PEUB 3L17A 1FVHA 5DIZA 4GZ3A 2L6JA 3LXUX 5FZQA 1UN9A 4GZ6A 2X6IA 2YQ8A 4G26A 4PDXA 2ONDA 3NZUA 5JJ6A 2PL2A 3TG4A 3AS8A 4GA2A 4B89A 3QWPA 5FT9A 2WMNA 2WXPA 1FCHA 1UN8A 4GCNA 4G11A 4MLPA 4EPZA 2KCLA 3FUJA 4A1GA 2WQ7A 5G05C 3LY8A 3CK9A 5KJNA 4I43A 4J8FA 1OUVA 2R5SA 3R9AB 3EDTB 5DBKA 3CK7A 2EQXA 5EX0A 1Y8MA 2WXRA 3D9IA 1GW6A 3CIAA 4HOQA 4XI0A 3FUFA 3QARA 5CCLA 1U3DA 3PVLA 3SI5A 2C0MA 1JUQA 3FTZA 3ZFWA 3FTSA 3L16A 3MEKA 3FULA 3QJZA 4HFGA 4CDRA 4F3VA 3IEGA 3D9MA 2WXJA 3FDHA 2WXNA 4AV7A 3CHPA 4GZDA 4U04A 3RRUA 4E85A 4EQFA 2XGMA 4B8CB 1H2UA 3ML9A 4OYSA 3D9OA 2MRIA 3KD7A 1JWGA 3APCA 4N2SA 2WXHA 2ZU6B 5BPPA 1OWNA 2FO7A 5ARFA 2E2EA 4ILHB 4F1SA 3FEXA 4FADA 3CSTA 3GZ1A 1BPOA 2P58C 2VSYA 3ZYMA 4ANWA 2PQRA 3U4TA 1INZA 2KCVA 3ZYKA 3ZVVA 2WXFA 3E4BA 4L2LA 3FU5A 5FZSA 3SZ7A 3U3WA 2I6HA 3CHRA 3FUMA 2YHCA 4JA9A 4QFVA 3ZEFA 3ZYLA 4AP2A 3LY7A 5A7DB 3VLEA 2IOSA 4I6EA 4JEHA 2I1JA 3CVVA 4AVXA 2GRMA 2HR2A 2L9BA 3ONKA 2L0IA 3G2TA 3RK6A 3TL5A 2CHXA 4KVOA 3CKCA 3QAQA 3U66A 2J07A 1WAO1 1E90A 3QNKA 1XGWA 4U0UA 3BEEA 4U0SA 3ONLA 5LCWJ 5G2NA 4LUNU 2Y4UA 2IJGX 3MKRA 5CMYA 1NP7A 2ILRA 4K0RA 5CMWA 1PAQA 4XIFA 5FQ6A 4BFRA 2A5UA 4AOFA 3P1UA 3IKOB 2V0PA 5ANRA 1E8XA 4HORA 5A6CA 4FU3A 1VDYA 3CEQA 3SF4A 3MGBA 3T5VA 3MV2B 2VYIA 4EZJA 4B8AA 2C0LA 3L54A 2PM7A 3KS2A 4J8DA 1KT0A 2XGOA 1H19A 4FLHA 3B13A 4V3IA 4CCAA 4UWFA 4MS6A 5BV1A 3GYZA 3PE3A 3GW4A 4I1MA 3ASDA 3CVQA 1HG2A 3MV3B 5D0QD 1EF1C 2QFCA 4FA6A 2BF0X 4E6HA 1WY6A 4CRWA 2FULA 2YINA 4WUYA 4D10C 5A23A 1TJFA 3CKBA 4XX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HM8 A;  2ION A;  2VSO E;  5ANR A;  2IOS A;  2RG8 A;  3EIJ A;  4B8A A;  3JUI A;  2KZT A;  4B89 A;  3RK6 A;  2I2O A;  1H2V C;  2GGF A;  1N54 A;  3FEY A;  4IUL A;  4B8C B;  1H2U A;  4GMJ A;  2VSX E;  1N52 A;  2IU1 A;  4C9B B;  4JHK A;  2ZU6 B;  1UG3 A;  4JHJ A;  4LUN U;  2NSZ A;  3FEX A;  3EIQ C;  2KZT B;  3L6A A;  1PAQ A;  1HU3 A;  1H6K A;  2FUL A;  1UW4 B;  4CEM A;  4CRW A;  1H2T C;  4GML A;  4CT4 A;  3D3M A;  2IOL A; 
#chains in the Genus database with same CATH topology
 4UUC A;  5BW8 C;  5E75 A;  3QKY A;  2VJ8 A;  2R59 A;  3SBT B;  3U64 A;  3NBN B;  3AG1 E;  3G2S A;  2LSV A;  3JQ0 A;  2DIW A;  2IFU A;  2KC7 A;  5LFA A;  3C98 A;  3ASN E;  3AS4 A;  2VSX E;  4ATG A;  3Q79 A;  2NSZ A;  4G2V A;  4MKT A;  4O1O A;  2RFA A;  4EEC A;  4HS2 A;  3ZU7 B;  3FY4 A;  1N4R A;  4C48 B;  3UMV A;  2AXV A;  5T3R A;  3R7R A;  5HQ8 A;  2E0I A;  4WAF A;  3MCX A;  4RG9 A;  2XCB A;  2LO6 A;  5ARG A;  2OOE A;  4C9B B;  4G8L A;  3SFZ A;  4GZ5 A;  3ZYQ A;  4QQI A;  1UW4 B;  3CLJ A;  4ACL A;  5EID A;  2DZO A;  2ZGD A;  4LNG A;  2WMO A;  3I4G A;  3ZGQ A;  3PH0 C;  4FLB A;  4I2Z A;  3T8M A;  3IHV A;  4K03 A;  3HVE A;  2X38 A;  5BUZ A;  3HXC A;  5KNG A;  2I9C A;  3RU0 A;  3NZS A;  2AJA A;  3X2Q E;  5LP0 A;  4XKB A;  3CV0 A;  5B1A E;  4JZY A;  1O1R A;  4LRZ A;  5AIJ A;  2GRR B;  4HVB A;  4G25 A;  3V2O A;  1MX2 A;  3B7S A;  2GRP B;  4CT4 A;  1V54 E;  3LS8 A;  2P9S G;  4G8K A;  2YNQ A;  1MJ0 A;  3B7B A;  4O1P A;  1EPU A;  1WM5 A;  3CGH A;  5G04 J;  4F53 A;  4OVU A;  3QWW A;  4APO A;  3LCA A;  2RD0 A;  3LDZ A;  3P2B A;  4F6R D;  3SQV A;  1Z3Y A;  2KZT A;  1G3N B;  4Y6C A;  3UXG A;  2XEN A;  4KMO A;  3ULY A;  5CEC B;  1QQE A;  1BU9 A;  3ULQ A;  2AVP A;  4HI9 A;  1TN6 A;  2KAT A;  4M7C A;  5C1D A;  2WXO A;  5FIN A;  2CG3 A;  4MBG A;  1QYM A;  4AIF A;  3CVX A;  1NA0 A;  4B94 A;  3G2V A;  4LNB A;  4JPS A;  4GAA A;  3SD5 A;  4UI9 J;  1PC2 A;  3FU6 A;  2X6K A;  4AY5 A;  4GB9 A;  4BET A;  1U2V G;  2VTB B;  2FBN A;  4JD2 G;  3TXN A;  4N3C A;  4KYO B;  1IXV A;  3UX4 A;  5KJK A;  4F1P A;  4GZC A;  5EDS A;  3HRA A;  1H2V C;  1K1A A;  4A55 A;  2CHW A;  3NF1 A;  1DNP A;  2MYO A;  1Z5S C;  4JEU A;  1H6P A;  3IV0 A;  1ZBP A;  4GML A;  2QYJ A;  3CVW A;  1SZ9 A;  4CT0 A;  1TN8 A;  3HIZ A;  3VLF A;  3UT7 A;  4HOT A;  4UWL A;  5EIB E;  1BI8 B;  4L9P A;  2DWZ A;  5C2Y A;  4Q69 A;  3PZ1 A;  2B0O E;  3HXF A;  2H6H A;  4PS7 A;  4HB5 A;  3RRM B;  2Y3A A;  1OWL A;  3PEV B;  4KBQ A;  4A3T A;  4BWR A;  1QZ2 A;  1O5M A;  2RG8 A;  4Z68 A;  5FJY A;  3EU9 A;  4BTA A;  3WXX A;  3CR3 A;  3F6Q A;  2GW1 A;  3VTY A;  3FH8 A;  4I9E A;  5ENS D;  5FZR A;  3UIN C;  4DLQ A;  4LG6 A;  1HU3 A;  1H6K A;  3FUH A;  3ENE A;  3C3R A;  5FQ8 A;  3ZPJ A;  3CVP A;  3S2A A;  3N71 A;  1LD8 A;  2H6I A;  4EHM A;  3CVN A;  2QC9 A;  5FIO A;  4I6J A;  4IN3 B;  3ZRH A;  4ILG A;  3CHQ A;  3NOG D;  4I1A A;  3PEU B;  2OEW A;  1UN9 A;  4GZ6 A;  3EHQ A;  2X6I A;  2YQ8 A;  2HE0 A;  1S64 A;  3PZ2 A;  3L9T A;  4RLY A;  4GCN A;  4MLP A;  3LY8 A;  3ZUV B;  3Q78 A;  5KJN A;  4I43 A;  4J8F A;  3R9A B;  3EDT B;  3D9I A;  1GW6 A;  4HOQ A;  5CCL A;  1OCO E;  3L16 A;  3MEK A;  4F3V A;  4GTS A;  2BKG A;  2OCC E;  3DSS A;  4OYS A;  3D9O A;  1JWG A;  2WXH A;  3DWL G;  1OWN A;  1INZ A;  1FT2 A;  2KCV A;  2WXF A;  5FZS A;  3FUM A;  3ZYL A;  4HQD A;  3VLE A;  4I6E A;  4JEH A;  2I1J A;  4AVX A;  2HR2 A;  3ONK A;  3RK6 A;  3TL5 A;  1IHB A;  3DXM G;  1E90 A;  3TWU A;  4U0U A;  4U0S A;  2Y4U A;  1NP7 A;  2ILR A;  4XIF A;  5FQ6 A;  4DRX E;  3IKO B;  5A6C A;  1BLX B;  3CEQ A;  2C0L A;  3E32 A;  4J8D A;  1KT0 A;  4V3I A;  3B13 A;  3B95 A;  5BV1 A;  3GW4 A;  4CYM D;  2R05 A;  2QFC A;  1WY6 A;  4D10 C;  5LOZ A;  3CKB A;  2KXP C;  3ESK A;  2NC9 A;  3MYV A;  4CGV A;  3IXE A;  5ENT D;  3JUI A;  4DI4 A;  5HKP A;  3GZS A;  1X5B A;  2XQ0 A;  3PUJ A;  4GTQ A;  3CQC B;  2X6H A;  4BT9 A;  3EIQ C;  5JHB A;  2X3M A;  3FWV A;  4GA0 A;  3PDN A;  1IYG A;  5EKQ D;  2QZA A;  3RKV A;  2UY1 B;  2MHK A;  5T4Y A;  2DYR E;  4EZL A;  5BXU A;  1EYH A;  1NFI E;  2IQC A;  1IQU A;  2JEK A;  3CHM A;  2AW6 A;  1JPL A;  5BT1 A;  1SZA A;  5KWD A;  2FF4 A;  3QDN A;  2AXU A;  3D3M A;  4FHJ A;  5EYL A;  1TNY A;  1N4P A;  2VSO E;  3BG1 B;  1E8Z A;  4F7A A;  2WQ6 A;  2AWI A;  3APF A;  2VTB A;  3Q7F A;  5B3S E;  1S63 A;  4G23 A;  5ANL A;  2LAI A;  3Q15 A;  4UI9 K;  3L6A A;  3RJV A;  2ETB A;  2EIL E;  4DX2 A;  3DPD A;  3ZW3 A;  3G2W A;  2GRQ B;  2WXK A;  4TXQ A;  3FUE A;  3PNT B;  1NZN A;  4FP7 A;  2HYZ A;  2DYS E;  3Q49 B;  4K5C A;  3CHO A;  3VLD A;  2WPV A;  3URZ A;  2WB2 A;  2WM9 A;  4XEI G;  3O4Z A;  3MKQ A;  3NOC D;  3T9K A;  2XS8 A;  2KCK A;  3ZHE B;  4BSZ B;  2C2L A;  3FEY A;  4GYO A;  3TWS A;  4GMJ A;  2BTD A;  4J7W A;  3E34 A;  4APF A;  4ZFH A;  3ZNG A;  1KT1 A;  5CHE E;  4TUM A;  4L2Y A;  3EU5 A;  3RO3 A;  4AJW A;  3ZXP A;  1HX8 A;  4HNA D;  3ZIM A;  3UUX A;  3ABM E;  1DCQ A;  4UQY A;  4JHK A;  3L22 A;  4GYY A;  1H6O A;  4U7E B;  4WND A;  3FTW A;  3I5P A;  4NIK A;  5CRU A;  4ACK A;  3FH7 A;  1DVP A;  4P29 A;  3JCK C;  1O1S A;  4G1T A;  2DBA A;  3UIP C;  3ZXS A;  2PZI A;  2YHE A;  3D9N A;  4FUL A;  4I2W A;  3FH5 A;  1A17 A;  3W9F A;  4DX6 D;  2IOL A;  3IHY A;  5JA4 D;  1HF8 A;  3Q4A B;  3HXD A;  1OXJ A;  3PZ4 A;  2LXM A;  3QB2 A;  3ASG A;  2EIN E;  1YCS B;  2OVF A;  3D9J A;  2GGF A;  2P9L G;  1KLX A;  3JQ1 A;  2B6C A;  1HH8 A;  1TNB A;  2M63 A;  4Q94 A;  3MZL B;  2P9N G;  1DCE A;  4UQZ A;  3TWT A;  4OVV A;  1AP7 A;  1IQR A;  1OWP A;  2HM8 A;  5KJL A;  4O60 A;  4OAV B;  3ISM C;  3Q75 A;  4GPM A;  2EIM E;  3BQO A;  5HRY A;  3ESL A;  3LVR E;  3EHN A;  4GCO A;  2XCC A;  3FTU A;  2XEV A;  4WNG A;  4DPR A;  4JHR A;  4O6F A;  4EBA A;  3UKU G;  2VGX A;  3AU4 A;  4W9R A;  2Y0B G;  4HBD A;  1BI7 B;  3PZD A;  1E7U A;  4HOU A;  1N54 A;  2J09 A;  3BG0 B;  4UWH A;  4YDW A;  3UT4 A;  3LYA A;  4ZHB A;  1UG3 A;  2J8S D;  4RG6 A;  4L7T A;  4LCT A;  4DUI A;  5EYP F;  4N2Q A;  3PUK A;  3UQ3 A;  3FHE A;  3C3O A;  4AEZ C;  3FFL A;  4Q96 A;  4YND A;  3JXJ A;  4CDM A;  2WQH A;  3CHS A;  3FTV A;  5ENP D;  3Q9U C;  2VSN A;  2CG2 A;  3TWW A;  5KBA A;  5EIL A;  3LKU A;  5D66 A;  5J08 A;  4IRU A;  2QY7 A;  1K8K G;  2Y4T A;  3QK0 A;  4JL0 A;  2I1K A;  3D9P A;  4DJA A;  1HXI A;  2XRY A;  3TXM A;  2UY1 A;  2AXZ A;  3FUD A;  1QNF A;  1Z6T A;  5FQ4 A;  2FO1 E;  3L17 A;  5DIZ A;  1MZC A;  5FZQ A;  3DEO A;  1TNZ A;  4G26 A;  3NZU A;  5JJ6 A;  3TG4 A;  2V4H C;  4B89 A;  2WXP A;  4EPZ A;  1A5E A;  1OCZ E;  1OUV A;  2WXR A;  3TWX A;  1YMP A;  1QBQ A;  3TWR A;  4XI0 A;  3FUF A;  2L6B A;  3QAR A;  1U3D A;  3PVL A;  4GMR A;  1JUQ A;  3FTZ A;  3FTS A;  3QJZ A;  4CDR A;  3D9M A;  4AV7 A;  2WXN A;  3J5P A;  4GZD A;  4U04 A;  4K5B A;  3RRU A;  1SA5 A;  4B8C B;  1H2U A;  2IY0 C;  2F8Y A;  2MRI A;  1LD7 A;  3FEX A;  5ENR D;  3CST A;  3GZ1 A;  2VSY A;  2PQR A;  2NYJ A;  3ZYK A;  3E4B A;  3FU5 A;  3SZ7 A;  5CBN A;  4QFV A;  2YHC A;  3LY7 A;  5A7D B;  2IOS A;  2GRM A;  2XS1 A;  4BES A;  1TN7 A;  1WAO 1;  3QNK A;  3ONL A;  2IJG X;  3MKR A;  4K0R A;  1PAQ A;  3P1U A;  2H6F A;  5ANR A;  1VDY A;  3SF4 A;  3T5V A;  3MGB A;  4EZJ A;  4B8A A;  2DVW A;  4FLH A;  4CCA A;  3PE3 A;  3EUV A;  4GTR A;  4I1M A;  3CVQ A;  1HG2 A;  3MV3 B;  1EF1 C;  2EIK E;  4CRW A;  5A23 A;  1MX4 A;  4RVB A;  2F8X K;  2P9U G;  4UQX A;  4WWO A;  4N5C A;  3L13 A;  4NUR A;  3OXL A;  3G2U A;  3DBS A;  4L23 A;  1HFA A;  4LER A;  3NAW A;  3L08 A;  1JCQ A;  2PQN A;  3EHM A;  2Q7F A;  3UIO C;  2Y1L E;  3SHF A;  4IUL A;  3CSF A;  4CGW A;  2J4B A;  2VQ2 A;  1FPP A;  1ELR A;  2XPZ A;  3B7R L;  4X8Q A;  3PRZ A;  3DSU A;  1ZU2 A;  4HRM B;  4U96 D;  4TUU A;  5LCW C;  3T5X A;  4G24 A;  1N94 A;  5G55 A;  3V31 A;  5AQB A;  1NI1 A;  4I6G A;  4XI9 A;  4I9C A;  4URK A;  2HO1 A;  3U9W A;  4U63 A;  2F0Y A;  1YYH A;  4BX9 A;  3OXG A;  3MJW A;  5AQA A;  5JJT A;  2XHE A;  1H0A A;  3EJN A;  2MOW A;  3Q9N C;  3E37 A;  4GTT A;  2J9Q A;  4KT6 B;  3KAE A;  5FTP A;  4ANX A;  4YDY A;  4TXR A;  1BD8 A;  4RSY A;  2X6J A;  5AN8 A;  1TR4 A;  3FUK A;  3UKR G;  3O48 A;  4EZK A;  1N0R A;  4C0E A;  1HE8 A;  4DX5 D;  4FHK A;  4N39 A;  3TAX A;  3ASH A;  3LVQ E;  5H7P A;  3FU0 A;  4DLO A;  1OCR E;  3ASF A;  3C5R A;  1MHQ A;  2OVB A;  3AU5 A;  3OXF A;  3CVY A;  4ATZ D;  4JA7 A;  3EHR A;  3I3N A;  4GYW A;  3ZN3 A;  3TWQ A;  4HOS A;  1UJJ A;  4A1S A;  1MX6 A;  3HDX A;  4I17 A;  5AYW D;  4HXI A;  1JWF A;  3ASO E;  1N9A A;  3CK8 A;  1IKN D;  4GTM A;  2X6F A;  3AG3 E;  1TNO A;  5KCM A;  1WG0 A;  4J0U A;  4K5A B;  3S7D A;  2XZT G;  3PE4 A;  4J8E A;  3TJP A;  2UWJ G;  2KZT B;  3LJN A;  3ULE G;  3LEW A;  3FUI A;  5E76 A;  3LJ3 A;  2H6G A;  4KZC A;  1UOH A;  2FEZ A;  3JXI A;  1Y6I A;  2QYU A;  2XRZ A;  4XZ4 A;  1RW2 A;  3IBE A;  2V5Q C;  3FTY A;  2ION A;  1UJK A;  1ELW A;  3V30 A;  3QOU A;  3VTX A;  3BU8 A;  3UM1 A;  1E96 B;  1PY1 A;  2R03 A;  2R2L A;  5EX3 A;  3DXK G;  3UT8 A;  5BV0 A;  4EBA G;  3CVU A;  4ME2 A;  1SQM A;  1HG5 A;  5HS0 A;  4GU5 A;  4JXT A;  1D8D A;  5HI7 A;  3DSW A;  1HZ4 A;  5B1B E;  4MRU A;  1MYO A;  4PUC A;  5AQ9 A;  4KXK B;  4TRQ A;  1B89 A;  4PS3 A;  4KVM A;  1XNF A;  5JJ7 A;  2XGS A;  3V79 K;  1Q2Z A;  3AJI A;  1SW6 A;  1L5J A;  2CFZ A;  3FP3 A;  4DI3 A;  2LXL A;  3DSX A;  4FJY A;  3SFY A;  4Y6W A;  2BUG A;  5D0O D;  2P9K G;  3R7Q A;  2P2C P;  1X81 A;  4GTV A;  2LNI A;  4BEP A;  5AQ7 A;  5J90 A;  3APD A;  5T8I A;  1H2T C;  4WWP A;  3SBS A;  1LF8 A;  4JVS A;  4WWN A;  3DST A;  5CED B;  2DZN A;  3TG5 A;  5AAR A;  1N95 A;  1OWM A;  4J8Y A;  3S7B A;  3CVL A;  3WG7 E;  4DK5 A;  3TWV A;  4H7X A;  4YVQ C;  3UI2 A;  3LXU X;  1ZB1 A;  4OAU C;  4PDX A;  2OND A;  3AS8 A;  4GA2 A;  5JMN D;  3QWP A;  2WMN A;  3HXB A;  3FUJ A;  1JCR A;  5G05 C;  2R5S A;  5EX0 A;  3CIA A;  3J5Q B;  1N0Q A;  3SI5 A;  3V2X A;  2C0M A;  3FUL A;  2F37 A;  2EIJ E;  2WXJ A;  4EQF A;  2XGM A;  3ML9 A;  3KD7 A;  3UTM A;  4N2S A;  3HXE A;  2ZU6 B;  5ARF A;  4F1S A;  4ILH B;  4FAD A;  1BPO A;  4HRN A;  1S70 B;  3U3W A;  4GTP A;  4L2L A;  1DC2 A;  4JA9 A;  2XEH A;  4HI8 A;  3CVV A;  2J07 A;  3L82 A;  1XGW A;  5LCW J;  2P9P G;  5CMY A;  4BFR A;  1SA4 A;  2KBX A;  4HOR A;  2OEV A;  4FU3 A;  3L54 A;  3KS2 A;  1H19 A;  2ZXW E;  4MS6 A;  2IO3 C;  4JB8 P;  1LTX A;  4FA6 A;  4E6H A;  4CZ2 D;  5EN5 D;  5BNW A;  2Y69 E;  5KNH D;  5CER B;  5BXO A;  4LNU D;  2WXI A;  1S0P A;  4AY6 A;  2IU1 A;  3ZKJ A;  3ABK E;  1D9S A;  1TEZ A;  1OY3 D;  3DEP A;  1E8Y A;  4TV3 A;  2PM6 A;  1N4S A;  1P5Q A;  3OAW A;  3PZ3 A;  3KSL A;  4U8Y D;  4H7Y A;  4ANU A;  4DX7 D;  1KZO A;  5ENN A;  3KEZ A;  3FUN A;  2L0T B;  4PS8 A;  1HO8 A;  5CCM A;  1WDY A;  2BKK B;  2R17 C;  2J49 A;  4U07 A;  4J8S A;  4N3B A;  3HYM B;  4U8H A;  2WXL A;  1O1T A;  3GZ2 A;  4N5Q A;  4TXP A;  2GRO B;  3MX3 A;  5LX8 A;  2WXQ A;  3FTX A;  5M72 A;  3K9I A;  4C0M A;  4CEM A;  3D9L A;  4WNF A;  4NRH B;  4BT8 A;  2GRL A;  3PS6 A;  2J4D A;  4BY6 A;  4GTO A;  2CHZ A;  4M3O A;  3RO2 A;  3SNX A;  3S7J A;  4U0Z A;  2LSU A;  3SFX A;  3DSV A;  4GA1 A;  4CDN A;  4FC8 A;  1AWC B;  4ANV A;  4JHJ A;  1K1B A;  3ZHE A;  1NL4 A;  3AAA C;  3QWV A;  5ITZ F;  2V4L A;  2OV8 A;  3UM3 A;  5IY5 E;  2WVI A;  3ABL E;  5AJL A;  2IF4 A;  3MKQ B;  4U8V D;  3MA5 A;  2P9I G;  3LY9 A;  1IHG A;  3DPY A;  4BER A;  1KZP A;  5D2M C;  4AXH A;  5CBO A;  3NQP A;  4BSX A;  4B0Z A;  1TJC A;  2IO2 C;  3D9H A;  2DCP A;  3R9M A;  1K3Z D;  4XE0 A;  3KEA A;  2IEJ A;  4IYP A;  1SVX A;  3AS5 A;  3SGH A;  4DX1 A;  1U3C A;  3RAU A;  3QC1 A;  2XPI A;  4NAC A;  3KSQ A;  3DRA A;  1N52 A;  4R7L A;  4BTB A;  5CRV A;  3HG0 D;  2CFU A;  1TYQ G;  2NXP A;  2XPY A;  3UM0 A;  4A3V A;  2ZGG A;  2ZIR A;  1JCS A;  3SO8 A;  4JW1 A;  3RRN B;  1N11 A;  1Z3X A;  4GPK A;  1OT8 A;  4ILI A;  2FI7 A;  3FU3 A;  4UWG A;  2ETC A;  4J6I A;  3B7U X;  3D9K A;  1E8W A;  3RIB A;  4LEU A;  5JHA A;  3TGO A;  2A4Z A;  4KZ0 A;  2V8S E;  1TNU A;  1MQS A;  1RZ4 A;  1D8E A;  5AEN A;  1HS6 A;  3PRE A;  3CQG B;  5KJM A;  4JC8 A;  3PNL B;  5G05 J;  4RQI A;  5CEA A;  4UWK A;  3HVE B;  2VGY A;  5G04 C;  3LPZ A;  4AM9 A;  1KPS B;  2WXG A;  3EIJ A;  2V5F A;  2LAH A;  2GRN B;  1YA0 A;  1OWO A;  2VGX B;  1FT1 A;  3RSE G;  4XKC A;  4PH4 B;  2WXM A;  4ABN A;  2VGE A;  3UPV A;  3Q5M A;  4HLE A;  1ELK A;  3B7T A;  3HHM A;  5FQ7 A;  4N3A A;  1FVF A;  2I2O A;  1EDU A;  4FJZ A;  3I4R B;  4NQ0 A;  2XZD G;  2ETA A;  4I1O B;  4UI9 C;  1W3B A;  5AJD A;  2JLB A;  2KM4 A;  1NA3 A;  2RFM A;  4A63 B;  2J08 A;  3Q47 B;  4L1B A;  1E7V A;  4WNE A;  3T8K A;  3JYS A;  4BX8 A;  5FWQ A;  4YVO A;  3S7F A;  3OTN A;  3AG4 E;  3ML8 A;  2R02 A;  1FVH A;  3C3Q A;  4GZ3 A;  2L6J A;  3E33 A;  5AAO A;  2PNN A;  2PL2 A;  5FT9 A;  1FCH A;  1UN8 A;  4G11 A;  2KCL A;  5ENQ D;  4A1G A;  2WQ7 A;  3CK9 A;  3W9G A;  4HRL A;  5DBK A;  1N4Q A;  3CK7 A;  2EQX A;  1Y8M A;  4B93 B;  3ZFW A;  2XEE A;  1OCC E;  4HFG A;  3AG2 E;  3IEG A;  3FDH A;  3CHP A;  4E85 A;  2ZIS A;  3APC A;  5BPP A;  2FO7 A;  2E2E A;  2JAB A;  3NB2 A;  2P58 C;  3ZYM A;  4ANW A;  3U4T A;  3ZVV A;  4HLL A;  2I6H A;  3CHR A;  3ZEF A;  4AP2 A;  3BUA A;  3Q73 A;  3UM2 A;  3E30 A;  2L9B A;  2L0I A;  3G2T A;  2CHX A;  4KVO A;  3SY2 A;  3CKC A;  3QAQ A;  3U66 A;  2LUH A;  3JUE A;  3BEE A;  5G2N A;  4LUN U;  2RKK A;  4U95 D;  4YDO A;  5CMW A;  3Q7A A;  2A5U A;  1V55 E;  4AOF A;  2BED A;  3C72 A;  4LSZ E;  2V0P A;  1E8X A;  3MV2 B;  2VYI A;  4YDE A;  2PM7 A;  2XGO A;  5ENO D;  4UWF A;  3GYZ A;  2A5E A;  3ASD A;  5D0Q D;  2BF0 X;  2FUL A;  2YIN A;  4WUY A;  1TJF A;  4XX5 A; 
#chains in the Genus database with same CATH homology
 3ESK A;  5BNW A;  5BW8 C;  5E75 A;  2NC9 A;  3MYV A;  3QKY A;  4CGV A;  2VJ8 A;  4RVB A;  2R59 A;  3JUI A;  3SBT B;  4UQX A;  4WWO A;  4DI4 A;  3GZS A;  1X5B A;  2XQ0 A;  3U64 A;  3PUJ A;  4N5C A;  3CQC B;  3L13 A;  4NUR A;  2WXI A;  1S0P A;  4AY6 A;  2IU1 A;  2X6H A;  3OXL A;  3G2S A;  1TEZ A;  3G2U A;  4BT9 A;  2LSV A;  3EIQ C;  3DBS A;  3JQ0 A;  1E8Y A;  4TV3 A;  2PM6 A;  5JHB A;  2X3M A;  1P5Q A;  3FWV A;  3OAW A;  3PDN A;  4GA0 A;  4L23 A;  1IYG A;  2DIW A;  5EKQ D;  1HFA A;  4LER A;  2IFU A;  4H7Y A;  3RKV A;  2KC7 A;  3L08 A;  2UY1 B;  2PQN A;  5LFA A;  3EHM A;  3C98 A;  2MHK A;  4ANU A;  2Q7F A;  5T4Y A;  4EZL A;  3SHF A;  4IUL A;  3CSF A;  1EYH A;  2J4B A;  3AS4 A;  4CGW A;  2IQC A;  1IQU A;  2JEK A;  2VQ2 A;  2VSX E;  5ENN A;  4ATG A;  3CHM A;  3KEZ A;  1ELR A;  3FUN A;  2AW6 A;  2L0T B;  2XPZ A;  1JPL A;  4PS8 A;  1HO8 A;  2NSZ A;  3B7R L;  5CCM A;  4G2V A;  5BT1 A;  1SZA A;  2FF4 A;  3QDN A;  4MKT A;  2AXU A;  3D3M A;  4FHJ A;  4EEC A;  2R17 C;  2J49 A;  3PRZ A;  4HS2 A;  2VSO E;  3BG1 B;  1ZU2 A;  1E8Z A;  3FY4 A;  4U07 A;  4TUU A;  4F7A A;  2WQ6 A;  2AWI A;  4J8S A;  3APF A;  3UMV A;  4N3B A;  2VTB A;  5LCW C;  2AXV A;  3HYM B;  4U8H A;  2WXL A;  5LOZ A;  5T3R A;  3R7R A;  3T5X A;  5HQ8 A;  2E0I A;  4G24 A;  3GZ2 A;  4WAF A;  3MCX A;  4RG9 A;  4G23 A;  2XCB A;  2LO6 A;  5ANL A;  5G55 A;  5ARG A;  2OOE A;  4C9B B;  3SFZ A;  3MX3 A;  4I6G A;  4XI9 A;  4I9C A;  4URK A;  5LX8 A;  2LAI A;  2WXQ A;  3Q15 A;  4GZ5 A;  3ZYQ A;  3FTX A;  4UI9 K;  3L6A A;  3K9I A;  2HO1 A;  3U9W A;  4C0M A;  4CEM A;  5M72 A;  1UW4 B;  3CLJ A;  4ACL A;  3D9L A;  4WNF A;  4NRH B;  4BT8 A;  4U63 A;  2GRL A;  3PS6 A;  2J4D A;  3RJV A;  4BY6 A;  2CHZ A;  2WMO A;  4BX9 A;  4M3O A;  3I4G A;  3RO2 A;  3ZGQ A;  3OXG A;  3MJW A;  3DPD A;  5JJT A;  2XHE A;  3G2W A;  3PH0 C;  3SNX A;  3ZW3 A;  2WXK A;  3S7J A;  1H0A A;  3EJN A;  4U0Z A;  4FLB A;  2MOW A;  4I2Z A;  3T8M A;  3IHV A;  2LSU A;  3FUE A;  1NZN A;  3HVE A;  3PNT B;  4K03 A;  4FP7 A;  2HYZ A;  4GA1 A;  4CDN A;  4FC8 A;  2J9Q A;  3Q49 B;  4ANV A;  2X38 A;  4KT6 B;  5BUZ A;  3KAE A;  3CHO A;  4JHJ A;  5FTP A;  3ZHE A;  4ANX A;  2I9C A;  3RU0 A;  3VLD A;  2WPV A;  3NZS A;  3URZ A;  2WB2 A;  4RSY A;  2X6J A;  3QWV A;  2WM9 A;  3FUK A;  5LP0 A;  4XKB A;  3CV0 A;  3O4Z A;  4JZY A;  2V4L A;  3O48 A;  2OV8 A;  4EZK A;  3MKQ A;  4C0E A;  4LRZ A;  2KCK A;  3ZHE B;  1HE8 A;  2WVI A;  5AIJ A;  5AJL A;  4FHK A;  4N39 A;  2C2L A;  3TAX A;  3FEY A;  2IF4 A;  4GYO A;  3ASH A;  4GMJ A;  2BTD A;  4HVB A;  4G25 A;  3LVQ E;  3FU0 A;  4APF A;  4DLO A;  3MKQ B;  3B7S A;  3ASF A;  3VTY A;  3MA5 A;  4CT4 A;  1MHQ A;  3LS8 A;  1KT1 A;  3LY9 A;  2OVB A;  5CHE E;  3AU5 A;  3OXF A;  1IHG A;  3CVY A;  4JA7 A;  4L2Y A;  2YNQ A;  3I3N A;  4AXH A;  3RO3 A;  4GYW A;  3NQP A;  4AJW A;  4BSX A;  3ZN3 A;  4HOS A;  1EPU A;  1HX8 A;  4B0Z A;  1WM5 A;  1UJJ A;  3CGH A;  1TJC A;  3ZIM A;  5G04 J;  4A1S A;  3UUX A;  4F53 A;  3HDX A;  4UQY A;  4JHK A;  4I17 A;  3L22 A;  5AYW D;  2DCP A;  4GYY A;  4OVU A;  3QWW A;  4APO A;  3LCA A;  3FTW A;  4WND A;  4HXI A;  4XE0 A;  3I5P A;  1JWF A;  3CK8 A;  4IYP A;  2RD0 A;  3LDZ A;  4ACK A;  3FH7 A;  3P2B A;  1DVP A;  4P29 A;  3JCK C;  1Z3Y A;  2X6F A;  4G1T A;  3AS5 A;  3SGH A;  2KZT A;  2DBA A;  4Y6C A;  5KCM A;  1U3C A;  4KMO A;  3ZXS A;  3QC1 A;  2PZI A;  4J0U A;  2XPI A;  2YHE A;  4NAC A;  3D9N A;  1N52 A;  4FUL A;  4I2W A;  4R7L A;  4BTB A;  3FH5 A;  3S7D A;  1A17 A;  3PE4 A;  4J8E A;  3TJP A;  1QQE A;  2UWJ G;  2KZT B;  3ULQ A;  2AVP A;  2CFU A;  2KAT A;  5C1D A;  2WXO A;  2NXP A;  2IOL A;  3IHY A;  3LEW A;  2XPY A;  3FUI A;  1HF8 A;  2CG3 A;  3Q4A B;  5E76 A;  3LJ3 A;  4A3V A;  4AIF A;  3CVX A;  1NA0 A;  3QB2 A;  3ASG A;  4KZC A;  4B94 A;  3G2V A;  4JPS A;  2FEZ A;  1Y6I A;  2OVF A;  3D9J A;  4GAA A;  3SD5 A;  2GGF A;  4UI9 J;  1KLX A;  4JW1 A;  1PC2 A;  3JQ1 A;  3RRN B;  1Z3X A;  2XRZ A;  3FU6 A;  4GPK A;  4XZ4 A;  1HH8 A;  2X6K A;  2M63 A;  4ILI A;  2FI7 A;  4AY5 A;  4Q94 A;  3FU3 A;  4GB9 A;  4UWG A;  3MZL B;  4UQZ A;  4J6I A;  2FBN A;  2VTB B;  3B7U X;  3TXN A;  3IBE A;  4N3C A;  4DPR A;  3D9K A;  4OVV A;  1E8W A;  3FTY A;  4KYO B;  1IQR A;  1OWP A;  2HM8 A;  2ION A;  1UJK A;  3UX4 A;  1ELW A;  3RIB A;  4LEU A;  5JHA A;  5KJL A;  3QOU A;  3TGO A;  2A4Z A;  5KJK A;  4KZ0 A;  2V8S E;  4GZC A;  1MQS A;  5EDS A;  3VTX A;  1H2V C;  3ESL A;  4A55 A;  2CHW A;  1E96 B;  3LVR E;  3NF1 A;  1DNP A;  5AEN A;  1PY1 A;  1HS6 A;  4JEU A;  3EHN A;  5EX3 A;  3PRE A;  4GCO A;  2XCC A;  3FTU A;  3UT8 A;  5BV0 A;  4EBA G;  3CQG B;  3IV0 A;  1ZBP A;  5KJM A;  4GML A;  4JC8 A;  2XEV A;  3PNL B;  4WNG A;  5G05 J;  3CVW A;  3CVU A;  1SZ9 A;  4ME2 A;  1SQM A;  1HG5 A;  4UWK A;  3HVE B;  4JHR A;  4GU5 A;  4JXT A;  2VGY A;  4O6F A;  3LPZ A;  5G04 C;  4CT0 A;  4EBA A;  4AM9 A;  2VGX A;  2WXG A;  3AU4 A;  3HIZ A;  4W9R A;  3VLF A;  3EIJ A;  2V5F A;  5HI7 A;  3UT7 A;  4HOT A;  2LAH A;  1HZ4 A;  3PZD A;  1E7U A;  4HOU A;  1N54 A;  4MRU A;  4UWL A;  1YA0 A;  2J09 A;  3BG0 B;  4UWH A;  4PUC A;  1OWO A;  5C2Y A;  4KXK B;  3UT4 A;  3LYA A;  4TRQ A;  2VGX B;  1UG3 A;  4Q69 A;  4RG6 A;  4XKC A;  4L7T A;  4LCT A;  4PH4 B;  2WXM A;  4PS7 A;  1B89 A;  4PS3 A;  4ABN A;  3RRM B;  3Q5M A;  3UPV A;  4N2Q A;  4KVM A;  4HLE A;  1XNF A;  3PUK A;  1ELK A;  3B7T A;  3UQ3 A;  5JJ7 A;  3HHM A;  2Y3A A;  1OWL A;  3PEV B;  3FHE A;  4KBQ A;  4A3T A;  4AEZ C;  2XGS A;  4N3A A;  1QZ2 A;  3FFL A;  5FQ7 A;  2RG8 A;  4BWR A;  5FJY A;  1L5J A;  2CFZ A;  1FVF A;  3FP3 A;  4Q96 A;  4YND A;  4DI3 A;  4BTA A;  2I2O A;  4CDM A;  3WXX A;  3CR3 A;  2WQH A;  4FJY A;  1EDU A;  2GW1 A;  3CHS A;  3FTV A;  3FH8 A;  3I4R B;  2BUG A;  4FJZ A;  4I9E A;  4NQ0 A;  4Y6W A;  5D0O D;  5FZR A;  2VSN A;  3R7Q A;  2CG2 A;  2LNI A;  4DLQ A;  3LKU A;  5J90 A;  1HU3 A;  1H6K A;  3APD A;  5T8I A;  5J08 A;  1H2T C;  4I1O B;  3FUH A;  4WWP A;  3SBS A;  1LF8 A;  3ENE A;  4JVS A;  4UI9 C;  5FQ8 A;  1W3B A;  4IRU A;  2JLB A;  2QY7 A;  5AJD A;  4WWN A;  3ZPJ A;  2Y4T A;  2KM4 A;  1NA3 A;  3CVP A;  3TG5 A;  3QK0 A;  3S2A A;  3N71 A;  2J08 A;  4JL0 A;  1OWM A;  3Q47 B;  4L1B A;  2I1K A;  1E7V A;  3D9P A;  4WNE A;  4DJA A;  3JYS A;  1HXI A;  3S7B A;  2XRY A;  3CVN A;  3CVL A;  3TXM A;  4BX8 A;  2UY1 A;  5FWQ A;  2AXZ A;  3FUD A;  4I6J A;  4YVO A;  3OTN A;  4IN3 B;  3S7F A;  4DK5 A;  3ZRH A;  1QNF A;  4ILG A;  3CHQ A;  1Z6T A;  3ML8 A;  4H7X A;  5FQ4 A;  4YVQ C;  4I1A A;  3PEU B;  3L17 A;  1FVH A;  5DIZ A;  4GZ3 A;  2L6J A;  3LXU X;  5FZQ A;  1UN9 A;  4GZ6 A;  2X6I A;  2YQ8 A;  4G26 A;  4PDX A;  2OND A;  3NZU A;  5JJ6 A;  2PL2 A;  3TG4 A;  3AS8 A;  4GA2 A;  4B89 A;  3QWP A;  5FT9 A;  2WMN A;  2WXP A;  1FCH A;  1UN8 A;  4GCN A;  4G11 A;  4MLP A;  4EPZ A;  2KCL A;  3FUJ A;  4A1G A;  2WQ7 A;  5G05 C;  3LY8 A;  3CK9 A;  5KJN A;  4I43 A;  4J8F A;  1OUV A;  2R5S A;  3R9A B;  3EDT B;  5DBK A;  3CK7 A;  2EQX A;  5EX0 A;  1Y8M A;  2WXR A;  3D9I A;  1GW6 A;  3CIA A;  4HOQ A;  4XI0 A;  3FUF A;  3QAR A;  5CCL A;  1U3D A;  3PVL A;  3SI5 A;  2C0M A;  1JUQ A;  3FTZ A;  3ZFW A;  3FTS A;  3L16 A;  3MEK A;  3FUL A;  3QJZ A;  4HFG A;  4CDR A;  4F3V A;  3IEG A;  3D9M A;  2WXJ A;  3FDH A;  2WXN A;  4AV7 A;  3CHP A;  4GZD A;  4U04 A;  3RRU A;  4E85 A;  4EQF A;  2XGM A;  4B8C B;  1H2U A;  3ML9 A;  4OYS A;  3D9O A;  2MRI A;  3KD7 A;  1JWG A;  3APC A;  4N2S A;  2WXH A;  2ZU6 B;  5BPP A;  1OWN A;  2FO7 A;  5ARF A;  2E2E A;  4ILH B;  4F1S A;  3FEX A;  4FAD A;  3CST A;  3GZ1 A;  1BPO A;  2P58 C;  2VSY A;  3ZYM A;  4ANW A;  2PQR A;  3U4T A;  1INZ A;  2KCV A;  3ZYK A;  3ZVV A;  2WXF A;  3E4B A;  4L2L A;  3FU5 A;  5FZS A;  3SZ7 A;  3U3W A;  2I6H A;  3CHR A;  3FUM A;  2YHC A;  4JA9 A;  4QFV A;  3ZEF A;  3ZYL A;  4AP2 A;  3LY7 A;  5A7D B;  3VLE A;  2IOS A;  4I6E A;  4JEH A;  2I1J A;  3CVV A;  4AVX A;  2GRM A;  2HR2 A;  2L9B A;  3ONK A;  2L0I A;  3G2T A;  3RK6 A;  3TL5 A;  2CHX A;  4KVO A;  3CKC A;  3QAQ A;  3U66 A;  2J07 A;  1WAO 1;  1E90 A;  3QNK A;  1XGW A;  4U0U A;  3BEE A;  4U0S A;  3ONL A;  5LCW J;  5G2N A;  4LUN U;  2Y4U A;  2IJG X;  3MKR A;  5CMY A;  1NP7 A;  2ILR A;  4K0R A;  5CMW A;  1PAQ A;  4XIF A;  5FQ6 A;  4BFR A;  2A5U A;  4AOF A;  3P1U A;  3IKO B;  2V0P A;  5ANR A;  1E8X A;  4HOR A;  5A6C A;  4FU3 A;  1VDY A;  3CEQ A;  3SF4 A;  3MGB A;  3T5V A;  3MV2 B;  2VYI A;  4EZJ A;  4B8A A;  2C0L A;  3L54 A;  2PM7 A;  3KS2 A;  4J8D A;  1KT0 A;  2XGO A;  1H19 A;  4FLH A;  3B13 A;  4V3I A;  4CCA A;  4UWF A;  4MS6 A;  5BV1 A;  3GYZ A;  3PE3 A;  3GW4 A;  4I1M A;  3ASD A;  3CVQ A;  1HG2 A;  3MV3 B;  5D0Q D;  1EF1 C;  2QFC A;  4FA6 A;  2BF0 X;  4E6H A;  1WY6 A;  4CRW A;  2FUL A;  2YIN A;  4WUY A;  4D10 C;  5A23 A;  1TJF A;  3CKB A;  4XX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...