4CRWA

Complex of human ddx6 (reca-c) and cnot1 (mif4g)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
226
structure length
226
Chain Sequence
EENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title A Ddx6-Cnot1 Complex and W-Binding Pockets in Cnot9 Reveal Direct Links between Mirna Target Recognition and Silencing
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4crwA00
1H6KA 1N54A 2IONA 2I2OA 4B89A 2HM8A 4LUNU 3D3MA 5ANRA 1H2VC 2KZTA 1H2TC 2NSZA 1UG3A 3FEXA 2RG8A 4B8CB 4CEMA 3EIJA 4C9BB 4JHKA 2GGFA 2FULA 2ZU6B 3L6AA 2VSXE 4CT4A 1HU3A 3EIQC 4CRWA 1PAQA 4JHJA 3FEYA 4GMJA 2IOSA 3JUIA 4GMLA 2KZTB 4IULA 3RK6A 4B8AA 2IU1A 2VSOE 1UW4B 1H2UA 2IOLA 1N52A
chains in the Genus database with same CATH superfamily
1TNZA 1TN8A 3E33A 4LNUD 2DYRE 4F3VA 3ASDA 3CHOA 2XPYA 3UMVA 3CHPA 4I6GA 4JHKA 2DBAA 2LSVA 2R02A 4I2WA 4JXTA 3TAXA 3LJ3A 1LD8A 3L17A 4YDYA 2YHEA 2VGEA 3TWQA 2V8SE 2WXHA 3D9OA 5EKQD 1INZA 4ATGA 5JA4D 1H6PA 2HM8A 4BTAA 4EHMA 2LSUA 3UXGA 5AJDA 1RZ4A 5EDSA 4I6JA 3L08A 2WXPA 4X8QA 3PRZA 4C48B 5LP0A 4BERA 3PZ4A 2IJGX 4H7YA 2XS8A 3CK9A 2QY7A 2RD0A 3EHMA 1KT1A 3FU6A 4WNEA 3G2SA 4U0SA 3D9MA 3L82A 3NQPA 2H6FA 3AG3E 2H6IA 1AWCB 3OXLA 4ILGA 4P29A 4R7LA 2WM9A 3EU9A 3RSEG 4ZFHA 4RLYA 2VGXA 3TL5A 3U66A 3FH5A 3RRUA 1TYQG 3HYMB 2BKGA 3Q75A 3SBTB 4FP7A 4UWKA 3TGOA 1BLXB 3UKUG 4AM9A 3CSFA 1ELWA 1GW6A 2WXLA 2QYUA 2AXUA 3V2OA 5IY5E 1L5JA 4NQ0A 3U64A 5EX0A 4AJWA 3QWWA 2FF4A 4CDNA 1SA4A 4DK5A 1YCSB 3TG4A 3CVVA 2MRIA 4G8KA 2WXKA 5FINA 4EBAA 1D9SA 3V30A 5CMYA 5CMWA 4DJAA 5B1AE 2DVWA 3F6QA 4Q96A 3LS8A 4L23A 3SY2A 4L2YA 5ANRA 3TG5A 3APCA 2WMNA 3TXMA 4U7EB 4IN3B 3ZGQA 3D9IA 4RQIA 5ITZF 3CVNA 2X38A 4FLHA 3ZYKA 3FTSA 4GZ3A 5CHEE 2R59A 3LDZA 4JPSA 3JQ0A 3SZ7A 4OAVB 3ZYQA 2AWIA 3CVUA 2I1KA 2V4HC 2P9UG 1N4SA 2L6BA 5BW8C 2GRRB 3CVPA 3LJNA 2Y0BG 4HRMB 4L9PA 3CSTA 1YMPA 4FHJA 4OVVA 3TWSA 1N4RA 3FTZA 4EPZA 1DCEA 4N39A 4GTTA 4QFVA 1TEZA 2KBXA 4JEUA 1QZ2A 4JA9A 2X6JA 4J8YA 4HLEA 3MV3B 3ZPJA 2AXVA 3P1UA 3CR3A 3JUIA 4K0RA 2XEHA 3ZXPA 4UUCA 3FUHA 4UWGA 3NBNB 2V4LA 3UINC 4UI9J 2FO7A 2XEVA 3N71A 4C9BB 4I43A 3AG4E 3UT7A 5J90A 2EQXA 2XCCA 3RRNB 4L1BA 2R05A 1K3ZD 3ZHEA 4GPMA 3LKUA 3S7BA 3CQGB 2J08A 4DLQA 4KZ0A 1K1AA 1FCHA 4KBQA 3GYZA 3BQOA 3HHMA 4KVMA 5KNHD 3FHEA 4PUCA 4GTRA 4BX9A 2LO6A 4TXRA 2EIJE 1FVFA 3CHMA 3SF4A 2DZNA 3MCXA 2J07A 4G23A 4GTPA 4DX1A 5FQ4A 1U3DA 1ELRA 5DBKA 4U07A 2WVIA 2BF0X 1N9AA 3JXIA 1IYGA 4AVXA 5FQ6A 4GCNA 4F1PA 3D9LA 4FJYA 4BFRA 2GROB 2KATA 2CHXA 3DXMG 2PL2A 4WWNA 3C3QA 2XS1A 3QDNA 4GTOA 3VTXA 3HIZA 4ATZD 5FIOA 3B13A 2Q7FA 3L9TA 2RFMA 4BY6A 5AQ9A 1U3CA 2ZGGA 5A7DB 4FADA 4GTVA 3BG0B 4KT6B 4KVOA 3PZ3A 4B8CB 5JHAA 2BKKB 3ONKA 1FT1A 3EUVA 4U95D 3PREA 3ZKJA 2JLBA 4J7WA 3SFZA 2CHZA 4GA0A 4KYOB 4PS8A 3CVXA 3Q49B 3JXJA 1SZ9A 5FZQA 4TUUA 3B7RL 3B7SA 2YNQA 3FWVA 1DVPA 2E2EA 1JCSA 2CHWA 1O1TA 3ASHA 5EN5D 2J49A 2LAIA 2M63A 2PQNA 4B0ZA 3LCAA 2VSNA 5DIZA 5J08A 4JC8A 1NZNA 4EZJA 3E30A 4DX5D 3PE4A 3UIOC 1NP7A 1O1SA 3FU5A 4A1SA 3AU5A 1OWLA 1TNBA 2A5EA 2XZTG 1TJFA 3ZUVB 2BUGA 3S7FA 1OCOE 1O1RA 4QQIA 3CVYA 3RKVA 4GPKA 5AIJA 3KSLA 4U96D 2QC9A 3FUIA 4Q69A 4HVBA 3HXEA 2WXMA 3VLDA 3UKRG 4JHJA 4K5BA 1HZ4A 1Q2ZA 4ACLA 3NZUA 4DRXE 2KCVA 2XGMA 1WDYA 4JW1A 4RSYA 5ENNA 2QYJA 3IHVA 1W3BA 1A5EA 1HH8A 1EDUA 5CEAA 4O6FA 3DRAA 4YVOA 2XGOA 3D9KA 3W9GA 5G04J 2KC7A 4LRZA 1FVHA 4XEIG 3FU0A 5AARA 2IQCA 4JL0A 1AP7A 3ESLA 2ETAA 4U0ZA 1S64A 1OWMA 5G04C 4GAAA 4GA1A 1S70B 3SQVA 5D0OD 3T8KA 4MS6A 2EINE 4FULA 2FBNA 4I1AA 3SGHA 3PE3A 2XPIA 3D3MA 4N3AA 1BD8A 1X81A 3UT4A 1DCQA 2V0PA 3UX4A 4DI4A 3AG1E 2DCPA 3ABLE 3G2VA 3PUKA 1BU9A 3O4ZA 3IEGA 4M7CA 1N52A 3GZSA 4CZ2D 3JQ1A 4E85A 2P9LG 1N94A 5LCWJ 3P2BA 4WWPA 1N95A 4HRLA 2PM6A 4DX7D 5FZRA 1ZB1A 2AXZA 1UJKA 3FTXA 3SD5A 3B7TA 1B89A 5LCWC 4XI9A 4HNAD 4L2LA 3Q47B 3JYSA 1MX4A 3ZEFA 3R7QA 4B93B 4MBGA 1MX2A 2OCCE 2ZGDA 1E8WA 4TV3A 5CCMA 3KEZA 5HQ8A 5BV0A 4LERA 2PNNA 1FT2A 3FUNA 2KZTB 5CRUA 2UY1A 4HS2A 4J6IA 4CT0A 5AENA 3FH7A 5G2NA 2KCKA 4K5CA 3ESKA 3CHRA 2ONDA 3DXKG 4G2VA 2OEVA 2A4ZA 2XPZA 1SZAA 5ANLA 4ME2A 1Z5SC 3RRMB 2IO2C 4ACKA 1OT8A 3UI2A 3QARA 1ZBPA 5BXUA 1TN6A 5FZSA 1S0PA 2RG8A 3MV2B 3I3NA 5EIBE 4B94A 1TNOA 3FUJA 1H6OA 3HXBA 5EILA 4WAFA 1H19A 3FTYA 3E37A 3DSWA 3Q9NC 4Q94A 4UWFA 5FQ7A 5LX8A 4WNGA 1OCRE 3C98A 3DBSA 1NA3A 1K8KG 3AS5A 3PVLA 3MJWA 4G26A 3QK0A 1NA0A 4FU3A 1ELKA 3JCKC 4FLBA 4YDOA 4C0EA 2EILE 2OV8A 2RFAA 3EJNA 4GMLA 3C3RA 4O1PA 3EU5A 3MKQA 1N54A 4A1GA 3FUMA 2KXPC 3RO2A 2P9PG 2P9IG 3CQCB 4IYPA 3ISMC 3QJZA 3I4RB 2IF4A 3CLJA 5BT1A 3PZ2A 3ASOE 2IONA 3UTMA 1A17A 3CK8A 4I9EA 2GRNB 4HXIA 3TXNA 1PY1A 3FUFA 4O1OA 5HKPA 4N2QA 3CV0A 2WXQA 3Q15A 1E8XA 2KM4A 3V2XA 2IOLA 3DWLG 3FU3A 4DI3A 4HB5A 2X6KA 1TN7A 2AW6A 2P2CP 5ENPD 5AJLA 3LEWA 1JWGA 2ZIRA 1N0RA 2J09A 2J4BA 5AAOA 5JJ7A 3CKBA 2NYJA 4APFA 4JHRA 2KCLA 5T8IA 4XKCA 4I1MA 3OTNA 5E75A 2XQ0A 3IKOB 4DX6D 2WXNA 4UWLA 3QKYA 2PZIA 3Q9UC 2VGYA 4JZYA 2Y1LE 2NC9A 3ZRHA 4LUNU 1UOHA 1V55E 2L0IA 1XGWA 3QOUA 3Q78A 3RU0A 3FEYA 2GRPB 4HBDA 4HOTA 2P9NG 3DEOA 4JD2G 3JUEA 4F53A 1YA0A 4F6RD 3NAWA 3G2WA 4G11A 1H2VC 3SHFA 4LCTA 2OVFA 3ZXSA 3PZDA 4YDWA 4BEPA 3UM2A 3UM0A 5C1DA 3CVQA 4TRQA 2IO3C 3CVLA 1IHBA 1OXJA 4UI9C 2XRYA 1JWFA 3RAUA 1WG0A 2GGFA 4G8LA 2V5FA 2WXIA 3QWPA 4LNGA 2IEJA 3S7JA 2DWZA 2C0MA 4JVSA 5M72A 2H6HA 4AY6A 3ASGA 5CCLA 1HG5A 3KD7A 1Y8MA 5B3SE 2L0TB 4HOSA 3EHRA 3EHNA 3TJPA 4MLPA 2F8XK 1E7VA 4IULA 5LFAA 1LD7A 3ASNE 4I9CA 3ZIMA 4ANXA 2DYSE 3PS6A 2IFUA 3EIJA 4G25A 5B1BE 3CVWA 3T5XA 2IOSA 4U0UA 1WY6A 4J0UA 4AIFA 2XZDG 2Y4TA 5ARFA 5CBOA 5CEDB 2BTDA 4GTSA 3T8MA 1KPSB 5G55A 2HYZA 1UG3A 3FEXA 1N4QA 5ENSD 4KMOA 3J5QB 1E7UA 3GW4A 3L13A 1MQSA 3AS4A 3QAQA 3ZFWA 4MRUA 4JEHA 3T5VA 5T3RA 5HI7A 2R17C 3KSQA 1WM5A 2HE0A 2OVBA 3V31A 3KS2A 3CEQA 4U04A 4XI0A 5FQ8A 2Y3AA 3DEPA 4FJZA 4NRHB 2I9CA 1KZPA 4KXKB 4JB8P 3LPZA 3ZNGA 2LAHA 3IXEA 5AQBA 1WAO1 3I5PA 1JCRA 3UT8A 2YQ8A 4TXPA 2H6GA 3HRAA 3W9FA 4ANVA 2XHEA 3SFYA 3EIQC 3LYAA 3FDHA 3MYVA 3MZLB 5D66A 4GZ5A 5FWQA 2P9SG 2MOWA 4OYSA 4RVBA 3PNLB 4CEMA 4LEUA 1QBQA 3SFXA 3C72A 4K5AB 2BEDA 5CECB 1LF8A 3CGHA 2HO1A 4BETA 2QFCA 3ULYA 5G05J 1KLXA 4XX5A 2XENA 2GRMA 3IHYA 1DNPA 1E8YA 5D2MC 3FUDA 4N5CA 2WXJA 4GTMA 4GMJA 2WMOA 5H7PA 3G2TA 3KEAA 2ETCA 1SW6A 5G05C 3UPVA 1UW4B 4EECA 3BU8A 1Z3YA 3VTYA 3ZW3A 5ENRD 3UQ3A 3OXGA 3U4TA 4BESA 4J8SA 5KBAA 4CT4A 5KJKA 4Y6CA 4HQDA 1LTXA 2AVPA 4PS7A 4HFGA 5BNWA 3DSUA 4U8VD 4JA7A 4DLOA 3R9AB 1K1BA 1NL4A 4ABNA 5LOZA 2NSZA 4J8FA 4BTBA 3TWTA 3ULQA 2JEKA 5FJYA 5HRYA 1X5BA 4FC8A 3TWXA 3V79K 4DPRA 3MGBA 2OEWA 3NF1A 5E76A 4HORA 1UJJA 2F0YA 4YVQC 3ABME 2UWJG 3U3WA 4GYYA 1HS6A 2JABA 2R03A 3MA5A 2ZU6B 4L7TA 4GU5A 1EPUA 4WNDA 4G1TA 4RG9A 4CGWA 3C5RA 2WXOA 1H0AA 2IY0C 1N11A 2B6CA 5KJNA 1HO8A 3ML9A 4LG6A 4LNBA 3NB2A 1OCCE 5CERB 3LY8A 4Z68A 2X6FA 3ZN3A 2GRQB 3B7UX 4GYOA 1TR4A 4GCOA 5ENTD 5AQ7A 3HVEB 1TNYA 1KT0A 4HOUA 2F8YA 5ENOD 3URZA 4K03A 1H2UA 5AN8A 2GW1A 1BI7B 3VLFA 2WQ7A 4BSXA 4UI9K 4N5QA 3X2QE 4XZ4A 3MKRA 2EIKE 3DSXA 1G3NB 3NOGD 1HE8A 3E4BA 3UUXA 1VDYA 4N2SA 3GZ2A 4F1SA 4UQYA 4GMRA 1SQMA 1MJ0A 1Z6TA 3TWUA 4UQXA 2F37A 4CGVA 4AXHA 2AJAA 2DIWA 5KNGA 3FH8A 3IBEA 3WXXA 4W9RA 3ENEA 3SNXA 4I2ZA 2CFZA 4BT9A 4GB9A 1OWPA 4U8YD 5BV1A 5BXOA 4LSZE 2XCBA 4DUIA 4E6HA 4V3IA 1PC2A 1MZCA 3Q5MA 3RO3A 4HRNA 1SVXA 3T9KA 3Q73A 2VQ2A 3ZYLA 2ILRA 4I6EA 3LXUX 5KWDA 2HR2A 3C3OA 3ONLA 2V5QC 3QB2A 4AV7A 4GYWA 2WXRA 3MX3A 3HDXA 4I17A 1MX6A 2I6HA 4EBAG 3SO8A 3CKCA 4XKBA 3FTUA 1UN8A 3FY4A 2MHKA 5CBNA 3UM3A 4U63A 2EIME 5A23A 2WQ6A 4WWOA 1H2TC 4UWHA 4WUYA 1JCQA 1JUQA 3ZHEB 3ZYMA 1HG2A 5BUZA 2KZTA 4N3BA 1NFIE 5HS0A 3BG1B 4AY5A 3L22A 4AEZC 3L16A 3HVEA 2FO1E 4M3OA 4ANUA 1UN9A 3U9WA 3CK7A 4A63B 4KZCA 4D10C 5T4YA 1IQRA 2WPVA 4XIFA 3APFA 2ETBA 4IRUA 4C0MA 2ZXWE 1PAQA 3OXFA 1IQUA 3Q7AA 3ML8A 5JJ6A 1IXVA 4H7XA 1EYHA 2X3MA 3HXFA 1H6KA 2A5UA 2J8SD 2L9BA 1OUVA 1IHGA 3FULA 2YINA 3QWVA 3B7BA 2Y69E 2RKKA 4OAUC 3KAEA 4Y6WA 4A55A 1S63A 3ASFA 3HG0D 4PDXA 5C2YA 3L6AA 3MEKA 4NACA 5CRVA 2X6IA 1QQEA 2R5SA 2E0IA 2IU1A 3AU4A 3PEVB 3TWRA 1V54E 3NZSA 1HXIA 2PM7A 2WXGA 4A3VA 4CDRA 4BX8A 2B0OE 3AS8A 3LY9A 4WNFA 1XNFA 3E32A 4ZHBA 4MKTA 4ILHB 4BT8A 3UM1A 5AYWD 4BWRA 3APDA 3FFLA 3DPDA 3DSVA 1Z3XA 2LXMA 3O48A 3PH0C 1E8ZA 3PDNA 4OVUA 3PUJA 3DPYA 3I4GA 1HF8A 3K9IA 3TWWA 3QNKA 3UIPC 4RG6A 1D8EA 4GZCA 1E90A 2ZISA 3VLEA 2J4DA 4EZKA 1FPPA 4AOFA 2VTBB 5BPPA 2XGSA 4I1OB 4URKA 4HOQA 4ILIA 2VYIA 3CHSA 4EQFA 3J5PA 5ENQD 2WXFA 3Q79A 4GZDA 5FTPA 4PH4B 3D9NA 1D8DA 2MYOA 4U8HA 4A3TA 4GZ6A 5A6CA 5KCMA 2DZOA 5JMND 1OCZE 5FT9A 2VJ8A 3S2AA 2X6HA 2J9QA 1HFAA 3RK6A 2LUHA 3G2UA 1JPLA 1N0QA 2LNIA 3SI5A 3ZU7B 4CYMD 1OWNA 3OAWA 5EYPF 5AQAA 3HXDA 1MHQA 4G24A 4HI8A 5EX3A 3HXCA 3CIAA 3D9JA 4DX2A 2I2OA 4B89A 1BPOA 1OY3D 3Q7FA 3BUAA 1BI8B 3QC1A 2VSXE 4ANWA 4HLLA 1O5MA 2P58C 3WG7E 1KZOA 2XEEA 2PQRA 2XRZA 3LVRE 5JHBA 1TJCA 2WB2A 1E96B 2P9KG 1DC2A 4O60A 3L54A 4J8DA 4NURA 3FP3A 3DSTA 1NI1A 3R9MA 2CFUA 1RW2A 2C2LA 5EYLA 5KJLA 4FHKA 2VTBA 2UY1B 2WQHA 5EIDA 4TXQA 3ULEG 1P5QA 3LY7A 2LXLA 4GTQA 3NOCD 4BSZB 2VSOE 2C0LA 2R2LA 3S7DA 2GRLA 4YDEA 1QYMA 2FULA 4UQZA 4NIKA 3TWVA 3LVQE 2I1JA 3BEEA 4XE0A 4GA2A 3PNTB 3PZ1A 1TNUA 5JJTA 3FTVA 2CG3A 1QNFA 4APOA 2QZAA 1SA5A 4YNDA 1IKND 2FEZA 5ARGA 4J8EA 3PEUB 2OOEA 3EDTB 2VSYA 4CCAA 5D0QD 1EF1C 4TUMA 4B8AA 4FA6A 2VGXB 1MYOA 2CG2A 4N3CA 2NXPA 3SBSA 2FI7A 1HX8A 5KJMA 3EHQA 3AG2E 4PS3A 2L6JA 3CHQA 2Y4UA 1N4PA 3RIBA 3RJVA 3Q4AB 2YHCA 3D9HA 3AJIA 3FTWA 3IV0A 3D9PA 3MKQB 3FUKA 1OWOA 3ZVVA 1HU3A 1ZU2A 1U2VG 3R7RA 4CDMA 1Y6IA 3AAAC 3GZ1A 4AP2A 3FUEA 4F7AA 4CRWA 4EZLA 3E34A 1YYHA 3ABKE 3B95A 3DSSA 4HI9A
chains in the Genus database with same CATH topology
1JUQA 3ZHEB 4AY6A 3ZYMA 1HG2A 3CVYA 3ASGA 3RKVA 4GPKA 5BUZA 2KZTA 5AIJA 5CCLA 1HG5A 4N3BA 4F3VA 3ASDA 3BG1B 3FUIA 3KD7A 1Y8MA 3CHOA 2XPYA 3UMVA 3L22A 4AY5A 4Q69A 3CHPA 4I6GA 4AEZC 4HVBA 4JHKA 2L0TB 2WXMA 3VLDA 2DBAA 2LSVA 4HOSA 4I2WA 4JXTA 3EHNA 3L16A 4JHJA 3TAXA 3TJPA 3HVEA 3LJ3A 3L17A 4MLPA 1HZ4A 4JEUA 2YHEA 1E7VA 4IULA 4M3OA 5LFAA 4ACLA 2V8SE 2WXHA 3NZUA 4ANUA 2KCVA 4I9CA 3D9OA 1UN9A 3ZIMA 5EKQD 2XGMA 4ATGA 1INZA 3U9WA 3CK7A 4ANXA 2HM8A 3PS6A 4JW1A 4KZCA 4RSYA 5ENNA 4BTAA 5T4YA 4D10C 1IQRA 2IFUA 2LSUA 3IHVA 5AJDA 1W3BA 2WPVA 4XIFA 3APFA 5EDSA 1HH8A 3EIJA 1EDUA 4O6FA 4I6JA 4IRUA 3L08A 2WXPA 3PRZA 4G25A 4YVOA 4C0MA 3T5XA 3CVWA 2XGOA 1PAQA 3OXFA 1IQUA 3D9KA 5LP0A 2IOSA 5G04J 2IJGX 3ML8A 4U0UA 1WY6A 4J0UA 2KC7A 4H7YA 4LRZA 5JJ6A 4AIFA 1FVHA 2Y4TA 4H7XA 5ARFA 1EYHA 3CK9A 2X3MA 2BTDA 3T8MA 2QY7A 1H6KA 2RD0A 3EHMA 3FU0A 2A5UA 1KT1A 3FU6A 4WNEA 3G2SA 5G55A 2IQCA 4U0SA 4JL0A 2HYZA 3D9MA 3NQPA 1UG3A 2L9BA 3FEXA 3ESLA 1OUVA 1IHGA 3FULA 4KMOA 4U0ZA 3OXLA 1OWMA 4ILGA 1E7UA 2YINA 3GW4A 3L13A 3QWVA 4P29A 1MQSA 3AS4A 4GAAA 4R7LA 3QAQA 3ZFWA 4GA1A 2WM9A 4MRUA 4JEHA 5D0OD 3T5VA 5T3RA 4MS6A 4FULA 2FBNA 4I1AA 3KAEA 3SGHA 3PE3A 2XPIA 2VGXA 3D3MA 4N3AA 4Y6WA 3TL5A 5HI7A 4A55A 2R17C 3ASFA 3UT4A 3U66A 3FH5A 1WM5A 4PDXA 3RRUA 2OVBA 3HYMB 5C2YA 3SBTB 2V0PA 3KS2A 3UX4A 3L6AA 4FP7A 4DI4A 3MEKA 2DCPA 3CEQA 4UWKA 4U04A 3TGOA 4XI0A 5FQ8A 4NACA 2Y3AA 2X6IA 3G2VA 1QQEA 2R5SA 3PUKA 2E0IA 4FJZA 2I9CA 3O4ZA 4NRHB 4AM9A 3IEGA 2IU1A 3AU4A 3CSFA 1ELWA 3PEVB 4KXKB 1GW6A 1N52A 3GZSA 3LPZA 2WXLA 1HXIA 3NZSA 2PM7A 2WXGA 2LAHA 4A3VA 4CDRA 4BX8A 3JQ1A 4E85A 2AXUA 1WAO1 3I5PA 3AS8A 5LCWJ 3P2BA 4WWPA 3UT8A 2YQ8A 2PM6A 3LY9A 4ANVA 4WNFA 2XHEA 1XNFA 5FZRA 4MKTA 2AXZA 4ILHB 4BT8A 1UJKA 3FTXA 3SD5A 1L5JA 3EIQC 3LYAA 3B7TA 5AYWD 3FDHA 4NQ0A 3U64A 3MYVA 5EX0A 3MZLB 4BWRA 1B89A 3APDA 4GZ5A 4AJWA 3FFLA 4XI9A 5FWQA 5LCWC 3DPDA 3QWWA 2FF4A 2MOWA 4L2LA 4CDNA 1Z3XA 3Q47B 3JYSA 4OYSA 3O48A 3PH0C 4RVBA 3ZEFA 1E8ZA 3PNLB 3R7QA 4CEMA 4LEUA 3PDNA 4OVUA 3PUJA 4DK5A 3I4GA 1HF8A 3TG4A 3CVVA 1E8WA 3K9IA 4TV3A 3QNKA 3KEZA 5CCMA 5HQ8A 1LF8A 3CGHA 2MRIA 5BV0A 4LERA 4RG6A 2HO1A 2WXKA 4EBAA 4GZCA 1E90A 5FJYA 3FUNA 2KZTB 5CMYA 2UY1A 5CMWA 4DJAA 4HS2A 4J6IA 2QFCA 4Q96A 3VLEA 4CT0A 3LS8A 5AENA 2J4DA 3FH7A 4L23A 5G2NA 2KCKA 4EZKA 4L2YA 5ANRA 5G05J 1KLXA 4XX5A 3ESKA 3TG5A 4AOFA 3APCA 2WMNA 2VTBB 5BPPA 2GRMA 2XGSA 3CHRA 3TXMA 4I1OB 4IN3B 3ZGQA 2ONDA 4URKA 4G2VA 3D9IA 4HOQA 3IHYA 4ILIA 2A4ZA 2XPZA 1DNPA 1SZAA 1E8YA 3FUDA 4N5CA 3CVNA 2WXJA 2X38A 2VYIA 3CHSA 5ANLA 4FLHA 4GMJA 3ZYKA 2WXFA 4ME2A 4EQFA 2WMOA 3G2TA 3FTSA 3RRMB 4GZ3A 5CHEE 4GZDA 5G05C 3UPVA 5FTPA 1UW4B 4PH4B 4ACKA 3D9NA 4EECA 4U8HA 4A3TA 1Z3YA 3QARA 1ZBPA 2R59A 5FZSA 3VTYA 3ZW3A 3LDZA 1S0PA 4JPSA 2RG8A 4GZ6A 3JQ0A 3SZ7A 3MV2B 5A6CA 3ZYQA 3UQ3A 3OXGA 5KCMA 3U4TA 2AWIA 4J8SA 3CVUA 2I1KA 3I3NA 4CT4A 5KJKA 5FT9A 4Y6CA 2VJ8A 4B94A 3FUJA 5BW8C 3CVPA 3S2AA 2AVPA 2X6HA 2J9QA 1H19A 4WAFA 1HFAA 3FTYA 4PS7A 3RK6A 4HFGA 5BNWA 3CSTA 3G2UA 1JPLA 4JA7A 4Q94A 4DLOA 4FHJA 3R9AB 4OVVA 2LNIA 3SI5A 4ABNA 4UWFA 5FQ7A 5LX8A 3FTZA 2NSZA 5LOZA 4J8FA 4EPZA 1OWNA 4BTBA 4WNGA 3OAWA 4N39A 3ULQA 3C98A 4QFVA 3DBSA 1TEZA 1NA3A 1QZ2A 2JEKA 3AS5A 3MJWA 3PVLA 3QK0A 1NA0A 2X6JA 4G26A 1X5BA 4FC8A 4FU3A 1MHQA 1ELKA 4G24A 3JCKC 3MGBA 4FLBA 4C0EA 4DPRA 4HLEA 3MV3B 3NF1A 4JA9A 2AXVA 2OV8A 3P1UA 3CR3A 3ZPJA 3JUIA 3EJNA 4GMLA 4K0RA 5E76A 5EX3A 4HORA 3CIAA 1UJJA 3FUHA 3D9JA 3MKQA 1N54A 4UWGA 4A1GA 2I2OA 4B89A 1BPOA 4YVQC 2UWJG 3FUMA 2V4LA 3U3WA 4GYYA 3RO2A 4UI9J 2FO7A 2XEVA 1HS6A 3CQCB 3N71A 4C9BB 3MA5A 2ZU6B 4I43A 3QC1A 4IYPA 2VSXE 3UT7A 5J90A 2EQXA 4L7TA 3QJZA 4ANWA 4GU5A 3I4RB 1EPUA 2XCCA 2IF4A 3CLJA 5BT1A 2P58C 4WNDA 4G1TA 3RRNB 2IONA 1A17A 4RG9A 4CGWA 3CK8A 2WXOA 4L1BA 1H0AA 4I9EA 2PQRA 4HXIA 3TXNA 5KJNA 2XRZA 1PY1A 1HO8A 3ZHEA 3ML9A 3FUFA 3LVRE 3LKUA 1TJCA 5JHBA 2WB2A 1E96B 3S7BA 4N2QA 3CQGB 2J08A 3CV0A 4DLQA 3LY8A 4KZ0A 1FCHA 4KBQA 3GYZA 2WXQA 3Q15A 1E8XA 2KM4A 2X6FA 3ZN3A 3B7UX 3HHMA 4KVMA 2IOLA 3FHEA 3L54A 4J8DA 4PUCA 4NURA 4BX9A 3FP3A 2LO6A 4GYOA 3FU3A 4GCOA 1FVFA 3CHMA 3SF4A 3MCXA 2CFUA 2J07A 4G23A 2C2LA 3HVEB 5FQ4A 5KJLA 4DI3A 4FHKA 1KT0A 2VTBA 1U3DA 1ELRA 2X6KA 5DBKA 2UY1B 4U07A 2WQHA 2WVIA 2BF0X 1P5QA 1IYGA 3LY7A 4HOUA 2AW6A 4AVXA 5FQ6A 4GCNA 3URZA 3D9LA 5AJLA 2VSOE 4K03A 2C0LA 4FJYA 3LEWA 1JWGA 1H2UA 2GW1A 4BFRA 2J09A 2J4BA 3S7DA 2KATA 2CHXA 5JJ7A 3VLFA 2WQ7A 3CKBA 4BSXA 4APFA 2GRLA 4JHRA 2KCLA 5T8IA 2PL2A 4UI9K 4I1MA 3OTNA 4XKCA 4WWNA 5E75A 3QDNA 2XQ0A 3IKOB 2FULA 4UQZA 3VTXA 3HIZA 2WXNA 4XZ4A 4UWLA 3QKYA 3MKRA 2PZIA 2Q7FA 3B13A 2VGYA 3LVQE 2I1JA 4BY6A 4JZYA 1U3CA 3BEEA 1HE8A 4XE0A 4GA2A 3PNTB 5A7DB 3E4BA 4FADA 3UUXA 2NC9A 1VDYA 5JJTA 3BG0B 3ZRHA 4N2SA 3FTVA 2CG3A 3GZ2A 1QNFA 4KT6B 4LUNU 4APOA 4F1SA 4KVOA 4YNDA 4UQYA 2L0IA 1SQMA 2FEZA 4B8CB 5JHAA 1Z6TA 3ONKA 1XGWA 3QOUA 4UQXA 3PREA 4AXHA 5ARGA 4CGVA 2DIWA 4J8EA 3PEUB 2OOEA 3FH8A 3EDTB 2VSYA 3IBEA 4CCAA 3RU0A 3FEYA 3WXXA 5D0QD 4W9RA 4HOTA 3ENEA 3SNXA 1EF1C 4B8AA 4FA6A 2VGXB 4I2ZA 2JLBA 4F53A 1YA0A 2CG2A 4N3CA 2CFZA 4BT9A 2NXPA 3SFZA 3SBSA 2CHZA 2FI7A 1HX8A 4GA0A 4GB9A 5KJMA 4KYOB 1OWPA 3G2WA 4G11A 1H2VC 3SHFA 4PS3A 2L6JA 4PS8A 5BV1A 3CVXA 3CHQA 2Y4UA 1SZ9A 3Q49B 3RIBA 3RJVA 5FZQA 3Q4AB 2XCBA 4LCTA 2OVFA 4TUUA 2YHCA 3PZDA 3B7RL 3ZXSA 3B7SA 4V3IA 1PC2A 4E6HA 2YNQA 3FTWA 3Q5MA 3FWVA 3RO3A 1DVPA 3D9PA 3IV0A 3MKQB 5C1DA 2E2EA 3CVQA 4TRQA 2CHWA 2VQ2A 3CVLA 3FUKA 1OWOA 3ASHA 3ZVVA 3ZYLA 2ILRA 5G04C 1HU3A 2J49A 4I6EA 3LXUX 2LAIA 2HR2A 1ZU2A 4UI9C 2M63A 2PQNA 3ONLA 4B0ZA 3QB2A 3LCAA 2VSNA 3R7RA 4CDMA 5DIZA 1Y6IA 2XRYA 4AV7A 4GYWA 1JWFA 2WXRA 3MX3A 3HDXA 4I17A 5J08A 2I6HA 4EBAG 4JC8A 1NZNA 3GZ1A 2GGFA 3CKCA 4XKBA 4AP2A 4EZJA 3FTUA 3FUEA 4F7AA 1UN8A 3FY4A 4CRWA 3PE4A 2V5FA 2WXIA 3QWPA 4EZLA 1NP7A 2MHKA 3FU5A 4U63A 3S7JA 3AU5A 4A1SA 1OWLA 2C0MA 4JVSA 5A23A 5M72A 2WQ6A 1TJFA 4WWOA 1H2TC 4UWHA 4WUYA 2BUGA 3S7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6K A;  1N54 A;  2ION A;  2I2O A;  4B89 A;  2HM8 A;  4LUN U;  3D3M A;  5ANR A;  1H2V C;  2KZT A;  1H2T C;  2NSZ A;  1UG3 A;  3FEX A;  2RG8 A;  4B8C B;  4CEM A;  3EIJ A;  4C9B B;  4JHK A;  2GGF A;  2FUL A;  2ZU6 B;  3L6A A;  2VSX E;  4CT4 A;  1HU3 A;  3EIQ C;  4CRW A;  1PAQ A;  4JHJ A;  3FEY A;  4GMJ A;  2IOS A;  3JUI A;  4GML A;  2KZT B;  4IUL A;  3RK6 A;  4B8A A;  2IU1 A;  2VSO E;  1UW4 B;  1H2U A;  2IOL A;  1N52 A; 
#chains in the Genus database with same CATH topology
 1TNZ A;  1TN8 A;  3E33 A;  4LNU D;  2DYR E;  4F3V A;  3ASD A;  3CHO A;  2XPY A;  3UMV A;  3CHP A;  4I6G A;  4JHK A;  2DBA A;  2LSV A;  2R02 A;  4I2W A;  4JXT A;  3TAX A;  3LJ3 A;  1LD8 A;  3L17 A;  4YDY A;  2YHE A;  2VGE A;  3TWQ A;  2V8S E;  2WXH A;  3D9O A;  5EKQ D;  1INZ A;  4ATG A;  5JA4 D;  1H6P A;  2HM8 A;  4BTA A;  4EHM A;  2LSU A;  3UXG A;  5AJD A;  1RZ4 A;  5EDS A;  4I6J A;  3L08 A;  2WXP A;  4X8Q A;  3PRZ A;  4C48 B;  5LP0 A;  4BER A;  3PZ4 A;  2IJG X;  4H7Y A;  2XS8 A;  3CK9 A;  2QY7 A;  2RD0 A;  3EHM A;  1KT1 A;  3FU6 A;  4WNE A;  3G2S A;  4U0S A;  3D9M A;  3L82 A;  3NQP A;  2H6F A;  3AG3 E;  2H6I A;  1AWC B;  3OXL A;  4ILG A;  4P29 A;  4R7L A;  2WM9 A;  3EU9 A;  3RSE G;  4ZFH A;  4RLY A;  2VGX A;  3TL5 A;  3U66 A;  3FH5 A;  3RRU A;  1TYQ G;  3HYM B;  2BKG A;  3Q75 A;  3SBT B;  4FP7 A;  4UWK A;  3TGO A;  1BLX B;  3UKU G;  4AM9 A;  3CSF A;  1ELW A;  1GW6 A;  2WXL A;  2QYU A;  2AXU A;  3V2O A;  5IY5 E;  1L5J A;  4NQ0 A;  3U64 A;  5EX0 A;  4AJW A;  3QWW A;  2FF4 A;  4CDN A;  1SA4 A;  4DK5 A;  1YCS B;  3TG4 A;  3CVV A;  2MRI A;  4G8K A;  2WXK A;  5FIN A;  4EBA A;  1D9S A;  3V30 A;  5CMY A;  5CMW A;  4DJA A;  5B1A E;  2DVW A;  3F6Q A;  4Q96 A;  3LS8 A;  4L23 A;  3SY2 A;  4L2Y A;  5ANR A;  3TG5 A;  3APC A;  2WMN A;  3TXM A;  4U7E B;  4IN3 B;  3ZGQ A;  3D9I A;  4RQI A;  5ITZ F;  3CVN A;  2X38 A;  4FLH A;  3ZYK A;  3FTS A;  4GZ3 A;  5CHE E;  2R59 A;  3LDZ A;  4JPS A;  3JQ0 A;  3SZ7 A;  4OAV B;  3ZYQ A;  2AWI A;  3CVU A;  2I1K A;  2V4H C;  2P9U G;  1N4S A;  2L6B A;  5BW8 C;  2GRR B;  3CVP A;  3LJN A;  2Y0B G;  4HRM B;  4L9P A;  3CST A;  1YMP A;  4FHJ A;  4OVV A;  3TWS A;  1N4R A;  3FTZ A;  4EPZ A;  1DCE A;  4N39 A;  4GTT A;  4QFV A;  1TEZ A;  2KBX A;  4JEU A;  1QZ2 A;  4JA9 A;  2X6J A;  4J8Y A;  4HLE A;  3MV3 B;  3ZPJ A;  2AXV A;  3P1U A;  3CR3 A;  3JUI A;  4K0R A;  2XEH A;  3ZXP A;  4UUC A;  3FUH A;  4UWG A;  3NBN B;  2V4L A;  3UIN C;  4UI9 J;  2FO7 A;  2XEV A;  3N71 A;  4C9B B;  4I43 A;  3AG4 E;  3UT7 A;  5J90 A;  2EQX A;  2XCC A;  3RRN B;  4L1B A;  2R05 A;  1K3Z D;  3ZHE A;  4GPM A;  3LKU A;  3S7B A;  3CQG B;  2J08 A;  4DLQ A;  4KZ0 A;  1K1A A;  1FCH A;  4KBQ A;  3GYZ A;  3BQO A;  3HHM A;  4KVM A;  5KNH D;  3FHE A;  4PUC A;  4GTR A;  4BX9 A;  2LO6 A;  4TXR A;  2EIJ E;  1FVF A;  3CHM A;  3SF4 A;  2DZN A;  3MCX A;  2J07 A;  4G23 A;  4GTP A;  4DX1 A;  5FQ4 A;  1U3D A;  1ELR A;  5DBK A;  4U07 A;  2WVI A;  2BF0 X;  1N9A A;  3JXI A;  1IYG A;  4AVX A;  5FQ6 A;  4GCN A;  4F1P A;  3D9L A;  4FJY A;  4BFR A;  2GRO B;  2KAT A;  2CHX A;  3DXM G;  2PL2 A;  4WWN A;  3C3Q A;  2XS1 A;  3QDN A;  4GTO A;  3VTX A;  3HIZ A;  4ATZ D;  5FIO A;  3B13 A;  2Q7F A;  3L9T A;  2RFM A;  4BY6 A;  5AQ9 A;  1U3C A;  2ZGG A;  5A7D B;  4FAD A;  4GTV A;  3BG0 B;  4KT6 B;  4KVO A;  3PZ3 A;  4B8C B;  5JHA A;  2BKK B;  3ONK A;  1FT1 A;  3EUV A;  4U95 D;  3PRE A;  3ZKJ A;  2JLB A;  4J7W A;  3SFZ A;  2CHZ A;  4GA0 A;  4KYO B;  4PS8 A;  3CVX A;  3Q49 B;  3JXJ A;  1SZ9 A;  5FZQ A;  4TUU A;  3B7R L;  3B7S A;  2YNQ A;  3FWV A;  1DVP A;  2E2E A;  1JCS A;  2CHW A;  1O1T A;  3ASH A;  5EN5 D;  2J49 A;  2LAI A;  2M63 A;  2PQN A;  4B0Z A;  3LCA A;  2VSN A;  5DIZ A;  5J08 A;  4JC8 A;  1NZN A;  4EZJ A;  3E30 A;  4DX5 D;  3PE4 A;  3UIO C;  1NP7 A;  1O1S A;  3FU5 A;  4A1S A;  3AU5 A;  1OWL A;  1TNB A;  2A5E A;  2XZT G;  1TJF A;  3ZUV B;  2BUG A;  3S7F A;  1OCO E;  1O1R A;  4QQI A;  3CVY A;  3RKV A;  4GPK A;  5AIJ A;  3KSL A;  4U96 D;  2QC9 A;  3FUI A;  4Q69 A;  4HVB A;  3HXE A;  2WXM A;  3VLD A;  3UKR G;  4JHJ A;  4K5B A;  1HZ4 A;  1Q2Z A;  4ACL A;  3NZU A;  4DRX E;  2KCV A;  2XGM A;  1WDY A;  4JW1 A;  4RSY A;  5ENN A;  2QYJ A;  3IHV A;  1W3B A;  1A5E A;  1HH8 A;  1EDU A;  5CEA A;  4O6F A;  3DRA A;  4YVO A;  2XGO A;  3D9K A;  3W9G A;  5G04 J;  2KC7 A;  4LRZ A;  1FVH A;  4XEI G;  3FU0 A;  5AAR A;  2IQC A;  4JL0 A;  1AP7 A;  3ESL A;  2ETA A;  4U0Z A;  1S64 A;  1OWM A;  5G04 C;  4GAA A;  4GA1 A;  1S70 B;  3SQV A;  5D0O D;  3T8K A;  4MS6 A;  2EIN E;  4FUL A;  2FBN A;  4I1A A;  3SGH A;  3PE3 A;  2XPI A;  3D3M A;  4N3A A;  1BD8 A;  1X81 A;  3UT4 A;  1DCQ A;  2V0P A;  3UX4 A;  4DI4 A;  3AG1 E;  2DCP A;  3ABL E;  3G2V A;  3PUK A;  1BU9 A;  3O4Z A;  3IEG A;  4M7C A;  1N52 A;  3GZS A;  4CZ2 D;  3JQ1 A;  4E85 A;  2P9L G;  1N94 A;  5LCW J;  3P2B A;  4WWP A;  1N95 A;  4HRL A;  2PM6 A;  4DX7 D;  5FZR A;  1ZB1 A;  2AXZ A;  1UJK A;  3FTX A;  3SD5 A;  3B7T A;  1B89 A;  5LCW C;  4XI9 A;  4HNA D;  4L2L A;  3Q47 B;  3JYS A;  1MX4 A;  3ZEF A;  3R7Q A;  4B93 B;  4MBG A;  1MX2 A;  2OCC E;  2ZGD A;  1E8W A;  4TV3 A;  5CCM A;  3KEZ A;  5HQ8 A;  5BV0 A;  4LER A;  2PNN A;  1FT2 A;  3FUN A;  2KZT B;  5CRU A;  2UY1 A;  4HS2 A;  4J6I A;  4CT0 A;  5AEN A;  3FH7 A;  5G2N A;  2KCK A;  4K5C A;  3ESK A;  3CHR A;  2OND A;  3DXK G;  4G2V A;  2OEV A;  2A4Z A;  2XPZ A;  1SZA A;  5ANL A;  4ME2 A;  1Z5S C;  3RRM B;  2IO2 C;  4ACK A;  1OT8 A;  3UI2 A;  3QAR A;  1ZBP A;  5BXU A;  1TN6 A;  5FZS A;  1S0P A;  2RG8 A;  3MV2 B;  3I3N A;  5EIB E;  4B94 A;  1TNO A;  3FUJ A;  1H6O A;  3HXB A;  5EIL A;  4WAF A;  1H19 A;  3FTY A;  3E37 A;  3DSW A;  3Q9N C;  4Q94 A;  4UWF A;  5FQ7 A;  5LX8 A;  4WNG A;  1OCR E;  3C98 A;  3DBS A;  1NA3 A;  1K8K G;  3AS5 A;  3PVL A;  3MJW A;  4G26 A;  3QK0 A;  1NA0 A;  4FU3 A;  1ELK A;  3JCK C;  4FLB A;  4YDO A;  4C0E A;  2EIL E;  2OV8 A;  2RFA A;  3EJN A;  4GML A;  3C3R A;  4O1P A;  3EU5 A;  3MKQ A;  1N54 A;  4A1G A;  3FUM A;  2KXP C;  3RO2 A;  2P9P G;  2P9I G;  3CQC B;  4IYP A;  3ISM C;  3QJZ A;  3I4R B;  2IF4 A;  3CLJ A;  5BT1 A;  3PZ2 A;  3ASO E;  2ION A;  3UTM A;  1A17 A;  3CK8 A;  4I9E A;  2GRN B;  4HXI A;  3TXN A;  1PY1 A;  3FUF A;  4O1O A;  5HKP A;  4N2Q A;  3CV0 A;  2WXQ A;  3Q15 A;  1E8X A;  2KM4 A;  3V2X A;  2IOL A;  3DWL G;  3FU3 A;  4DI3 A;  4HB5 A;  2X6K A;  1TN7 A;  2AW6 A;  2P2C P;  5ENP D;  5AJL A;  3LEW A;  1JWG A;  2ZIR A;  1N0R A;  2J09 A;  2J4B A;  5AAO A;  5JJ7 A;  3CKB A;  2NYJ A;  4APF A;  4JHR A;  2KCL A;  5T8I A;  4XKC A;  4I1M A;  3OTN A;  5E75 A;  2XQ0 A;  3IKO B;  4DX6 D;  2WXN A;  4UWL A;  3QKY A;  2PZI A;  3Q9U C;  2VGY A;  4JZY A;  2Y1L E;  2NC9 A;  3ZRH A;  4LUN U;  1UOH A;  1V55 E;  2L0I A;  1XGW A;  3QOU A;  3Q78 A;  3RU0 A;  3FEY A;  2GRP B;  4HBD A;  4HOT A;  2P9N G;  3DEO A;  4JD2 G;  3JUE A;  4F53 A;  1YA0 A;  4F6R D;  3NAW A;  3G2W A;  4G11 A;  1H2V C;  3SHF A;  4LCT A;  2OVF A;  3ZXS A;  3PZD A;  4YDW A;  4BEP A;  3UM2 A;  3UM0 A;  5C1D A;  3CVQ A;  4TRQ A;  2IO3 C;  3CVL A;  1IHB A;  1OXJ A;  4UI9 C;  2XRY A;  1JWF A;  3RAU A;  1WG0 A;  2GGF A;  4G8L A;  2V5F A;  2WXI A;  3QWP A;  4LNG A;  2IEJ A;  3S7J A;  2DWZ A;  2C0M A;  4JVS A;  5M72 A;  2H6H A;  4AY6 A;  3ASG A;  5CCL A;  1HG5 A;  3KD7 A;  1Y8M A;  5B3S E;  2L0T B;  4HOS A;  3EHR A;  3EHN A;  3TJP A;  4MLP A;  2F8X K;  1E7V A;  4IUL A;  5LFA A;  1LD7 A;  3ASN E;  4I9C A;  3ZIM A;  4ANX A;  2DYS E;  3PS6 A;  2IFU A;  3EIJ A;  4G25 A;  5B1B E;  3CVW A;  3T5X A;  2IOS A;  4U0U A;  1WY6 A;  4J0U A;  4AIF A;  2XZD G;  2Y4T A;  5ARF A;  5CBO A;  5CED B;  2BTD A;  4GTS A;  3T8M A;  1KPS B;  5G55 A;  2HYZ A;  1UG3 A;  3FEX A;  1N4Q A;  5ENS D;  4KMO A;  3J5Q B;  1E7U A;  3GW4 A;  3L13 A;  1MQS A;  3AS4 A;  3QAQ A;  3ZFW A;  4MRU A;  4JEH A;  3T5V A;  5T3R A;  5HI7 A;  2R17 C;  3KSQ A;  1WM5 A;  2HE0 A;  2OVB A;  3V31 A;  3KS2 A;  3CEQ A;  4U04 A;  4XI0 A;  5FQ8 A;  2Y3A A;  3DEP A;  4FJZ A;  4NRH B;  2I9C A;  1KZP A;  4KXK B;  4JB8 P;  3LPZ A;  3ZNG A;  2LAH A;  3IXE A;  5AQB A;  1WAO 1;  3I5P A;  1JCR A;  3UT8 A;  2YQ8 A;  4TXP A;  2H6G A;  3HRA A;  3W9F A;  4ANV A;  2XHE A;  3SFY A;  3EIQ C;  3LYA A;  3FDH A;  3MYV A;  3MZL B;  5D66 A;  4GZ5 A;  5FWQ A;  2P9S G;  2MOW A;  4OYS A;  4RVB A;  3PNL B;  4CEM A;  4LEU A;  1QBQ A;  3SFX A;  3C72 A;  4K5A B;  2BED A;  5CEC B;  1LF8 A;  3CGH A;  2HO1 A;  4BET A;  2QFC A;  3ULY A;  5G05 J;  1KLX A;  4XX5 A;  2XEN A;  2GRM A;  3IHY A;  1DNP A;  1E8Y A;  5D2M C;  3FUD A;  4N5C A;  2WXJ A;  4GTM A;  4GMJ A;  2WMO A;  5H7P A;  3G2T A;  3KEA A;  2ETC A;  1SW6 A;  5G05 C;  3UPV A;  1UW4 B;  4EEC A;  3BU8 A;  1Z3Y A;  3VTY A;  3ZW3 A;  5ENR D;  3UQ3 A;  3OXG A;  3U4T A;  4BES A;  4J8S A;  5KBA A;  4CT4 A;  5KJK A;  4Y6C A;  4HQD A;  1LTX A;  2AVP A;  4PS7 A;  4HFG A;  5BNW A;  3DSU A;  4U8V D;  4JA7 A;  4DLO A;  3R9A B;  1K1B A;  1NL4 A;  4ABN A;  5LOZ A;  2NSZ A;  4J8F A;  4BTB A;  3TWT A;  3ULQ A;  2JEK A;  5FJY A;  5HRY A;  1X5B A;  4FC8 A;  3TWX A;  3V79 K;  4DPR A;  3MGB A;  2OEW A;  3NF1 A;  5E76 A;  4HOR A;  1UJJ A;  2F0Y A;  4YVQ C;  3ABM E;  2UWJ G;  3U3W A;  4GYY A;  1HS6 A;  2JAB A;  2R03 A;  3MA5 A;  2ZU6 B;  4L7T A;  4GU5 A;  1EPU A;  4WND A;  4G1T A;  4RG9 A;  4CGW A;  3C5R A;  2WXO A;  1H0A A;  2IY0 C;  1N11 A;  2B6C A;  5KJN A;  1HO8 A;  3ML9 A;  4LG6 A;  4LNB A;  3NB2 A;  1OCC E;  5CER B;  3LY8 A;  4Z68 A;  2X6F A;  3ZN3 A;  2GRQ B;  3B7U X;  4GYO A;  1TR4 A;  4GCO A;  5ENT D;  5AQ7 A;  3HVE B;  1TNY A;  1KT0 A;  4HOU A;  2F8Y A;  5ENO D;  3URZ A;  4K03 A;  1H2U A;  5AN8 A;  2GW1 A;  1BI7 B;  3VLF A;  2WQ7 A;  4BSX A;  4UI9 K;  4N5Q A;  3X2Q E;  4XZ4 A;  3MKR A;  2EIK E;  3DSX A;  1G3N B;  3NOG D;  1HE8 A;  3E4B A;  3UUX A;  1VDY A;  4N2S A;  3GZ2 A;  4F1S A;  4UQY A;  4GMR A;  1SQM A;  1MJ0 A;  1Z6T A;  3TWU A;  4UQX A;  2F37 A;  4CGV A;  4AXH A;  2AJA A;  2DIW A;  5KNG A;  3FH8 A;  3IBE A;  3WXX A;  4W9R A;  3ENE A;  3SNX A;  4I2Z A;  2CFZ A;  4BT9 A;  4GB9 A;  1OWP A;  4U8Y D;  5BV1 A;  5BXO A;  4LSZ E;  2XCB A;  4DUI A;  4E6H A;  4V3I A;  1PC2 A;  1MZC A;  3Q5M A;  3RO3 A;  4HRN A;  1SVX A;  3T9K A;  3Q73 A;  2VQ2 A;  3ZYL A;  2ILR A;  4I6E A;  3LXU X;  5KWD A;  2HR2 A;  3C3O A;  3ONL A;  2V5Q C;  3QB2 A;  4AV7 A;  4GYW A;  2WXR A;  3MX3 A;  3HDX A;  4I17 A;  1MX6 A;  2I6H A;  4EBA G;  3SO8 A;  3CKC A;  4XKB A;  3FTU A;  1UN8 A;  3FY4 A;  2MHK A;  5CBN A;  3UM3 A;  4U63 A;  2EIM E;  5A23 A;  2WQ6 A;  4WWO A;  1H2T C;  4UWH A;  4WUY A;  1JCQ A;  1JUQ A;  3ZHE B;  3ZYM A;  1HG2 A;  5BUZ A;  2KZT A;  4N3B A;  1NFI E;  5HS0 A;  3BG1 B;  4AY5 A;  3L22 A;  4AEZ C;  3L16 A;  3HVE A;  2FO1 E;  4M3O A;  4ANU A;  1UN9 A;  3U9W A;  3CK7 A;  4A63 B;  4KZC A;  4D10 C;  5T4Y A;  1IQR A;  2WPV A;  4XIF A;  3APF A;  2ETB A;  4IRU A;  4C0M A;  2ZXW E;  1PAQ A;  3OXF A;  1IQU A;  3Q7A A;  3ML8 A;  5JJ6 A;  1IXV A;  4H7X A;  1EYH A;  2X3M A;  3HXF A;  1H6K A;  2A5U A;  2J8S D;  2L9B A;  1OUV A;  1IHG A;  3FUL A;  2YIN A;  3QWV A;  3B7B A;  2Y69 E;  2RKK A;  4OAU C;  3KAE A;  4Y6W A;  4A55 A;  1S63 A;  3ASF A;  3HG0 D;  4PDX A;  5C2Y A;  3L6A A;  3MEK A;  4NAC A;  5CRV A;  2X6I A;  1QQE A;  2R5S A;  2E0I A;  2IU1 A;  3AU4 A;  3PEV B;  3TWR A;  1V54 E;  3NZS A;  1HXI A;  2PM7 A;  2WXG A;  4A3V A;  4CDR A;  4BX8 A;  2B0O E;  3AS8 A;  3LY9 A;  4WNF A;  1XNF A;  3E32 A;  4ZHB A;  4MKT A;  4ILH B;  4BT8 A;  3UM1 A;  5AYW D;  4BWR A;  3APD A;  3FFL A;  3DPD A;  3DSV A;  1Z3X A;  2LXM A;  3O48 A;  3PH0 C;  1E8Z A;  3PDN A;  4OVU A;  3PUJ A;  3DPY A;  3I4G A;  1HF8 A;  3K9I A;  3TWW A;  3QNK A;  3UIP C;  4RG6 A;  1D8E A;  4GZC A;  1E90 A;  2ZIS A;  3VLE A;  2J4D A;  4EZK A;  1FPP A;  4AOF A;  2VTB B;  5BPP A;  2XGS A;  4I1O B;  4URK A;  4HOQ A;  4ILI A;  2VYI A;  3CHS A;  4EQF A;  3J5P A;  5ENQ D;  2WXF A;  3Q79 A;  4GZD A;  5FTP A;  4PH4 B;  3D9N A;  1D8D A;  2MYO A;  4U8H A;  4A3T A;  4GZ6 A;  5A6C A;  5KCM A;  2DZO A;  5JMN D;  1OCZ E;  5FT9 A;  2VJ8 A;  3S2A A;  2X6H A;  2J9Q A;  1HFA A;  3RK6 A;  2LUH A;  3G2U A;  1JPL A;  1N0Q A;  2LNI A;  3SI5 A;  3ZU7 B;  4CYM D;  1OWN A;  3OAW A;  5EYP F;  5AQA A;  3HXD A;  1MHQ A;  4G24 A;  4HI8 A;  5EX3 A;  3HXC A;  3CIA A;  3D9J A;  4DX2 A;  2I2O A;  4B89 A;  1BPO A;  1OY3 D;  3Q7F A;  3BUA A;  1BI8 B;  3QC1 A;  2VSX E;  4ANW A;  4HLL A;  1O5M A;  2P58 C;  3WG7 E;  1KZO A;  2XEE A;  2PQR A;  2XRZ A;  3LVR E;  5JHB A;  1TJC A;  2WB2 A;  1E96 B;  2P9K G;  1DC2 A;  4O60 A;  3L54 A;  4J8D A;  4NUR A;  3FP3 A;  3DST A;  1NI1 A;  3R9M A;  2CFU A;  1RW2 A;  2C2L A;  5EYL A;  5KJL A;  4FHK A;  2VTB A;  2UY1 B;  2WQH A;  5EID A;  4TXQ A;  3ULE G;  1P5Q A;  3LY7 A;  2LXL A;  4GTQ A;  3NOC D;  4BSZ B;  2VSO E;  2C0L A;  2R2L A;  3S7D A;  2GRL A;  4YDE A;  1QYM A;  2FUL A;  4UQZ A;  4NIK A;  3TWV A;  3LVQ E;  2I1J A;  3BEE A;  4XE0 A;  4GA2 A;  3PNT B;  3PZ1 A;  1TNU A;  5JJT A;  3FTV A;  2CG3 A;  1QNF A;  4APO A;  2QZA A;  1SA5 A;  4YND A;  1IKN D;  2FEZ A;  5ARG A;  4J8E A;  3PEU B;  2OOE A;  3EDT B;  2VSY A;  4CCA A;  5D0Q D;  1EF1 C;  4TUM A;  4B8A A;  4FA6 A;  2VGX B;  1MYO A;  2CG2 A;  4N3C A;  2NXP A;  3SBS A;  2FI7 A;  1HX8 A;  5KJM A;  3EHQ A;  3AG2 E;  4PS3 A;  2L6J A;  3CHQ A;  2Y4U A;  1N4P A;  3RIB A;  3RJV A;  3Q4A B;  2YHC A;  3D9H A;  3AJI A;  3FTW A;  3IV0 A;  3D9P A;  3MKQ B;  3FUK A;  1OWO A;  3ZVV A;  1HU3 A;  1ZU2 A;  1U2V G;  3R7R A;  4CDM A;  1Y6I A;  3AAA C;  3GZ1 A;  4AP2 A;  3FUE A;  4F7A A;  4CRW A;  4EZL A;  3E34 A;  1YYH A;  3ABK E;  3B95 A;  3DSS A;  4HI9 A; 
#chains in the Genus database with same CATH homology
 1JUQ A;  3ZHE B;  4AY6 A;  3ZYM A;  1HG2 A;  3CVY A;  3ASG A;  3RKV A;  4GPK A;  5BUZ A;  2KZT A;  5AIJ A;  5CCL A;  1HG5 A;  4N3B A;  4F3V A;  3ASD A;  3BG1 B;  3FUI A;  3KD7 A;  1Y8M A;  3CHO A;  2XPY A;  3UMV A;  3L22 A;  4AY5 A;  4Q69 A;  3CHP A;  4I6G A;  4AEZ C;  4HVB A;  4JHK A;  2L0T B;  2WXM A;  3VLD A;  2DBA A;  2LSV A;  4HOS A;  4I2W A;  4JXT A;  3EHN A;  3L16 A;  4JHJ A;  3TAX A;  3TJP A;  3HVE A;  3LJ3 A;  3L17 A;  4MLP A;  1HZ4 A;  4JEU A;  2YHE A;  1E7V A;  4IUL A;  4M3O A;  5LFA A;  4ACL A;  2V8S E;  2WXH A;  3NZU A;  4ANU A;  2KCV A;  4I9C A;  3D9O A;  1UN9 A;  3ZIM A;  5EKQ D;  2XGM A;  4ATG A;  1INZ A;  3U9W A;  3CK7 A;  4ANX A;  2HM8 A;  3PS6 A;  4JW1 A;  4KZC A;  4RSY A;  5ENN A;  4BTA A;  5T4Y A;  4D10 C;  1IQR A;  2IFU A;  2LSU A;  3IHV A;  5AJD A;  1W3B A;  2WPV A;  4XIF A;  3APF A;  5EDS A;  1HH8 A;  3EIJ A;  1EDU A;  4O6F A;  4I6J A;  4IRU A;  3L08 A;  2WXP A;  3PRZ A;  4G25 A;  4YVO A;  4C0M A;  3T5X A;  3CVW A;  2XGO A;  1PAQ A;  3OXF A;  1IQU A;  3D9K A;  5LP0 A;  2IOS A;  5G04 J;  2IJG X;  3ML8 A;  4U0U A;  1WY6 A;  4J0U A;  2KC7 A;  4H7Y A;  4LRZ A;  5JJ6 A;  4AIF A;  1FVH A;  2Y4T A;  4H7X A;  5ARF A;  1EYH A;  3CK9 A;  2X3M A;  2BTD A;  3T8M A;  2QY7 A;  1H6K A;  2RD0 A;  3EHM A;  3FU0 A;  2A5U A;  1KT1 A;  3FU6 A;  4WNE A;  3G2S A;  5G55 A;  2IQC A;  4U0S A;  4JL0 A;  2HYZ A;  3D9M A;  3NQP A;  1UG3 A;  2L9B A;  3FEX A;  3ESL A;  1OUV A;  1IHG A;  3FUL A;  4KMO A;  4U0Z A;  3OXL A;  1OWM A;  4ILG A;  1E7U A;  2YIN A;  3GW4 A;  3L13 A;  3QWV A;  4P29 A;  1MQS A;  3AS4 A;  4GAA A;  4R7L A;  3QAQ A;  3ZFW A;  4GA1 A;  2WM9 A;  4MRU A;  4JEH A;  5D0O D;  3T5V A;  5T3R A;  4MS6 A;  4FUL A;  2FBN A;  4I1A A;  3KAE A;  3SGH A;  3PE3 A;  2XPI A;  2VGX A;  3D3M A;  4N3A A;  4Y6W A;  3TL5 A;  5HI7 A;  4A55 A;  2R17 C;  3ASF A;  3UT4 A;  3U66 A;  3FH5 A;  1WM5 A;  4PDX A;  3RRU A;  2OVB A;  3HYM B;  5C2Y A;  3SBT B;  2V0P A;  3KS2 A;  3UX4 A;  3L6A A;  4FP7 A;  4DI4 A;  3MEK A;  2DCP A;  3CEQ A;  4UWK A;  4U04 A;  3TGO A;  4XI0 A;  5FQ8 A;  4NAC A;  2Y3A A;  2X6I A;  3G2V A;  1QQE A;  2R5S A;  3PUK A;  2E0I A;  4FJZ A;  2I9C A;  3O4Z A;  4NRH B;  4AM9 A;  3IEG A;  2IU1 A;  3AU4 A;  3CSF A;  1ELW A;  3PEV B;  4KXK B;  1GW6 A;  1N52 A;  3GZS A;  3LPZ A;  2WXL A;  1HXI A;  3NZS A;  2PM7 A;  2WXG A;  2LAH A;  4A3V A;  4CDR A;  4BX8 A;  3JQ1 A;  4E85 A;  2AXU A;  1WAO 1;  3I5P A;  3AS8 A;  5LCW J;  3P2B A;  4WWP A;  3UT8 A;  2YQ8 A;  2PM6 A;  3LY9 A;  4ANV A;  4WNF A;  2XHE A;  1XNF A;  5FZR A;  4MKT A;  2AXZ A;  4ILH B;  4BT8 A;  1UJK A;  3FTX A;  3SD5 A;  1L5J A;  3EIQ C;  3LYA A;  3B7T A;  5AYW D;  3FDH A;  4NQ0 A;  3U64 A;  3MYV A;  5EX0 A;  3MZL B;  4BWR A;  1B89 A;  3APD A;  4GZ5 A;  4AJW A;  3FFL A;  4XI9 A;  5FWQ A;  5LCW C;  3DPD A;  3QWW A;  2FF4 A;  2MOW A;  4L2L A;  4CDN A;  1Z3X A;  3Q47 B;  3JYS A;  4OYS A;  3O48 A;  3PH0 C;  4RVB A;  3ZEF A;  1E8Z A;  3PNL B;  3R7Q A;  4CEM A;  4LEU A;  3PDN A;  4OVU A;  3PUJ A;  4DK5 A;  3I4G A;  1HF8 A;  3TG4 A;  3CVV A;  1E8W A;  3K9I A;  4TV3 A;  3QNK A;  3KEZ A;  5CCM A;  5HQ8 A;  1LF8 A;  3CGH A;  2MRI A;  5BV0 A;  4LER A;  4RG6 A;  2HO1 A;  2WXK A;  4EBA A;  4GZC A;  1E90 A;  5FJY A;  3FUN A;  2KZT B;  5CMY A;  2UY1 A;  5CMW A;  4DJA A;  4HS2 A;  4J6I A;  2QFC A;  4Q96 A;  3VLE A;  4CT0 A;  3LS8 A;  5AEN A;  2J4D A;  3FH7 A;  4L23 A;  5G2N A;  2KCK A;  4EZK A;  4L2Y A;  5ANR A;  5G05 J;  1KLX A;  4XX5 A;  3ESK A;  3TG5 A;  4AOF A;  3APC A;  2WMN A;  2VTB B;  5BPP A;  2GRM A;  2XGS A;  3CHR A;  3TXM A;  4I1O B;  4IN3 B;  3ZGQ A;  2OND A;  4URK A;  4G2V A;  3D9I A;  4HOQ A;  3IHY A;  4ILI A;  2A4Z A;  2XPZ A;  1DNP A;  1SZA A;  1E8Y A;  3FUD A;  4N5C A;  3CVN A;  2WXJ A;  2X38 A;  2VYI A;  3CHS A;  5ANL A;  4FLH A;  4GMJ A;  3ZYK A;  2WXF A;  4ME2 A;  4EQF A;  2WMO A;  3G2T A;  3FTS A;  3RRM B;  4GZ3 A;  5CHE E;  4GZD A;  5G05 C;  3UPV A;  5FTP A;  1UW4 B;  4PH4 B;  4ACK A;  3D9N A;  4EEC A;  4U8H A;  4A3T A;  1Z3Y A;  3QAR A;  1ZBP A;  2R59 A;  5FZS A;  3VTY A;  3ZW3 A;  3LDZ A;  1S0P A;  4JPS A;  2RG8 A;  4GZ6 A;  3JQ0 A;  3SZ7 A;  3MV2 B;  5A6C A;  3ZYQ A;  3UQ3 A;  3OXG A;  5KCM A;  3U4T A;  2AWI A;  4J8S A;  3CVU A;  2I1K A;  3I3N A;  4CT4 A;  5KJK A;  5FT9 A;  4Y6C A;  2VJ8 A;  4B94 A;  3FUJ A;  5BW8 C;  3CVP A;  3S2A A;  2AVP A;  2X6H A;  2J9Q A;  1H19 A;  4WAF A;  1HFA A;  3FTY A;  4PS7 A;  3RK6 A;  4HFG A;  5BNW A;  3CST A;  3G2U A;  1JPL A;  4JA7 A;  4Q94 A;  4DLO A;  4FHJ A;  3R9A B;  4OVV A;  2LNI A;  3SI5 A;  4ABN A;  4UWF A;  5FQ7 A;  5LX8 A;  3FTZ A;  2NSZ A;  5LOZ A;  4J8F A;  4EPZ A;  1OWN A;  4BTB A;  4WNG A;  3OAW A;  4N39 A;  3ULQ A;  3C98 A;  4QFV A;  3DBS A;  1TEZ A;  1NA3 A;  1QZ2 A;  2JEK A;  3AS5 A;  3MJW A;  3PVL A;  3QK0 A;  1NA0 A;  2X6J A;  4G26 A;  1X5B A;  4FC8 A;  4FU3 A;  1MHQ A;  1ELK A;  4G24 A;  3JCK C;  3MGB A;  4FLB A;  4C0E A;  4DPR A;  4HLE A;  3MV3 B;  3NF1 A;  4JA9 A;  2AXV A;  2OV8 A;  3P1U A;  3CR3 A;  3ZPJ A;  3JUI A;  3EJN A;  4GML A;  4K0R A;  5E76 A;  5EX3 A;  4HOR A;  3CIA A;  1UJJ A;  3FUH A;  3D9J A;  3MKQ A;  1N54 A;  4UWG A;  4A1G A;  2I2O A;  4B89 A;  1BPO A;  4YVQ C;  2UWJ G;  3FUM A;  2V4L A;  3U3W A;  4GYY A;  3RO2 A;  4UI9 J;  2FO7 A;  2XEV A;  1HS6 A;  3CQC B;  3N71 A;  4C9B B;  3MA5 A;  2ZU6 B;  4I43 A;  3QC1 A;  4IYP A;  2VSX E;  3UT7 A;  5J90 A;  2EQX A;  4L7T A;  3QJZ A;  4ANW A;  4GU5 A;  3I4R B;  1EPU A;  2XCC A;  2IF4 A;  3CLJ A;  5BT1 A;  2P58 C;  4WND A;  4G1T A;  3RRN B;  2ION A;  1A17 A;  4RG9 A;  4CGW A;  3CK8 A;  2WXO A;  4L1B A;  1H0A A;  4I9E A;  2PQR A;  4HXI A;  3TXN A;  5KJN A;  2XRZ A;  1PY1 A;  1HO8 A;  3ZHE A;  3ML9 A;  3FUF A;  3LVR E;  3LKU A;  1TJC A;  5JHB A;  2WB2 A;  1E96 B;  3S7B A;  4N2Q A;  3CQG B;  2J08 A;  3CV0 A;  4DLQ A;  3LY8 A;  4KZ0 A;  1FCH A;  4KBQ A;  3GYZ A;  2WXQ A;  3Q15 A;  1E8X A;  2KM4 A;  2X6F A;  3ZN3 A;  3B7U X;  3HHM A;  4KVM A;  2IOL A;  3FHE A;  3L54 A;  4J8D A;  4PUC A;  4NUR A;  4BX9 A;  3FP3 A;  2LO6 A;  4GYO A;  3FU3 A;  4GCO A;  1FVF A;  3CHM A;  3SF4 A;  3MCX A;  2CFU A;  2J07 A;  4G23 A;  2C2L A;  3HVE B;  5FQ4 A;  5KJL A;  4DI3 A;  4FHK A;  1KT0 A;  2VTB A;  1U3D A;  1ELR A;  2X6K A;  5DBK A;  2UY1 B;  4U07 A;  2WQH A;  2WVI A;  2BF0 X;  1P5Q A;  1IYG A;  3LY7 A;  4HOU A;  2AW6 A;  4AVX A;  5FQ6 A;  4GCN A;  3URZ A;  3D9L A;  5AJL A;  2VSO E;  4K03 A;  2C0L A;  4FJY A;  3LEW A;  1JWG A;  1H2U A;  2GW1 A;  4BFR A;  2J09 A;  2J4B A;  3S7D A;  2KAT A;  2CHX A;  5JJ7 A;  3VLF A;  2WQ7 A;  3CKB A;  4BSX A;  4APF A;  2GRL A;  4JHR A;  2KCL A;  5T8I A;  2PL2 A;  4UI9 K;  4I1M A;  3OTN A;  4XKC A;  4WWN A;  5E75 A;  3QDN A;  2XQ0 A;  3IKO B;  2FUL A;  4UQZ A;  3VTX A;  3HIZ A;  2WXN A;  4XZ4 A;  4UWL A;  3QKY A;  3MKR A;  2PZI A;  2Q7F A;  3B13 A;  2VGY A;  3LVQ E;  2I1J A;  4BY6 A;  4JZY A;  1U3C A;  3BEE A;  1HE8 A;  4XE0 A;  4GA2 A;  3PNT B;  5A7D B;  3E4B A;  4FAD A;  3UUX A;  2NC9 A;  1VDY A;  5JJT A;  3BG0 B;  3ZRH A;  4N2S A;  3FTV A;  2CG3 A;  3GZ2 A;  1QNF A;  4KT6 B;  4LUN U;  4APO A;  4F1S A;  4KVO A;  4YND A;  4UQY A;  2L0I A;  1SQM A;  2FEZ A;  4B8C B;  5JHA A;  1Z6T A;  3ONK A;  1XGW A;  3QOU A;  4UQX A;  3PRE A;  4AXH A;  5ARG A;  4CGV A;  2DIW A;  4J8E A;  3PEU B;  2OOE A;  3FH8 A;  3EDT B;  2VSY A;  3IBE A;  4CCA A;  3RU0 A;  3FEY A;  3WXX A;  5D0Q D;  4W9R A;  4HOT A;  3ENE A;  3SNX A;  1EF1 C;  4B8A A;  4FA6 A;  2VGX B;  4I2Z A;  2JLB A;  4F53 A;  1YA0 A;  2CG2 A;  4N3C A;  2CFZ A;  4BT9 A;  2NXP A;  3SFZ A;  3SBS A;  2CHZ A;  2FI7 A;  1HX8 A;  4GA0 A;  4GB9 A;  5KJM A;  4KYO B;  1OWP A;  3G2W A;  4G11 A;  1H2V C;  3SHF A;  4PS3 A;  2L6J A;  4PS8 A;  5BV1 A;  3CVX A;  3CHQ A;  2Y4U A;  1SZ9 A;  3Q49 B;  3RIB A;  3RJV A;  5FZQ A;  3Q4A B;  2XCB A;  4LCT A;  2OVF A;  4TUU A;  2YHC A;  3PZD A;  3B7R L;  3ZXS A;  3B7S A;  4V3I A;  1PC2 A;  4E6H A;  2YNQ A;  3FTW A;  3Q5M A;  3FWV A;  3RO3 A;  1DVP A;  3D9P A;  3IV0 A;  3MKQ B;  5C1D A;  2E2E A;  3CVQ A;  4TRQ A;  2CHW A;  2VQ2 A;  3CVL A;  3FUK A;  1OWO A;  3ASH A;  3ZVV A;  3ZYL A;  2ILR A;  5G04 C;  1HU3 A;  2J49 A;  4I6E A;  3LXU X;  2LAI A;  2HR2 A;  1ZU2 A;  4UI9 C;  2M63 A;  2PQN A;  3ONL A;  4B0Z A;  3QB2 A;  3LCA A;  2VSN A;  3R7R A;  4CDM A;  5DIZ A;  1Y6I A;  2XRY A;  4AV7 A;  4GYW A;  1JWF A;  2WXR A;  3MX3 A;  3HDX A;  4I17 A;  5J08 A;  2I6H A;  4EBA G;  4JC8 A;  1NZN A;  3GZ1 A;  2GGF A;  3CKC A;  4XKB A;  4AP2 A;  4EZJ A;  3FTU A;  3FUE A;  4F7A A;  1UN8 A;  3FY4 A;  4CRW A;  3PE4 A;  2V5F A;  2WXI A;  3QWP A;  4EZL A;  1NP7 A;  2MHK A;  3FU5 A;  4U63 A;  3S7J A;  3AU5 A;  4A1S A;  1OWL A;  2C0M A;  4JVS A;  5A23 A;  5M72 A;  2WQ6 A;  1TJF A;  4WWO A;  1H2T C;  4UWH A;  4WUY A;  2BUG A;  3S7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...