4CRWA

Complex of human ddx6 (reca-c) and cnot1 (mif4g)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
226
structure length
226
Chain Sequence
EENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title A Ddx6-Cnot1 Complex and W-Binding Pockets in Cnot9 Reveal Direct Links between Mirna Target Recognition and Silencing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 94
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4crwA00
1H2TC 2ZU6B 2KZTA 4LUNU 1H6KA 4JHJA 3RK6A 3EIQC 3L6AA 2IU1A 1N54A 2GGFA 1N52A 4C9BB 2KZTB 5ANRA 4B8AA 2IONA 2I2OA 4CRWA 1UW4B 4CT4A 4IULA 2NSZA 2VSXE 4B89A 4JHKA 1HU3A 2IOLA 1PAQA 2HM8A 1H2UA 3FEYA 1H2VC 4GMLA 4CEMA 4GMJA 4B8CB 2FULA 2IOSA 3D3MA 3FEXA 2VSOE 1UG3A 2RG8A 3EIJA 3JUIA
chains in the Genus database with same CATH superfamily
2VSNA 3Q47B 2HE0A 3FUEA 4OAVB 3HXCA 3L54A 1S64A 1MJ0A 2DWZA 4PS3A 1HU3A 4MLPA 3DSSA 4ZHBA 2GRRB 4CT0A 2J9QA 5BPPA 3D9NA 1JCSA 4URKA 1KZPA 3DEOA 5FZRA 1ELKA 2OEVA 1ZBPA 2PQNA 2CFUA 3EHRA 1QQEA 2IEJA 1PY1A 2GGFA 4LRZA 2KC7A 3RIBA 3IHYA 3I4GA 4ILHB 4HOUA 5LCWJ 3ASNE 5ENRD 3VTXA 5KJMA 3NOCD 3GZ2A 3EU9A 2A5UA 3ENEA 3OAWA 4GZ3A 1JWGA 1LTXA 3JQ1A 3RRUA 3C72A 5KBAA 1INZA 4E85A 4J8FA 5EIDA 2PM7A 3ULEG 5CHEE 4O60A 2JEKA 4UWKA 4A63B 1DVPA 2C2LA 2WXQA 2V4HC 3DSVA 3GYZA 1N95A 2DZOA 3AS4A 2YNQA 2XEEA 3FHEA 4N2QA 2YHEA 2BKGA 2AJAA 1N54A 1O1RA 1TJFA 2VTBB 3HYMB 3QWWA 3PDNA 2BEDA 1N0RA 3CHMA 2HR2A 2LXMA 5ENPD 3RRMB 4PS7A 2ZGGA 3FH5A 3GZSA 3UT4A 2VJ8A 3DPYA 1OUVA 3HXFA 5AARA 3ZYQA 2J8SD 2QY7A 2P9NG 4JEHA 2LNIA 1S70B 2KXPC 4FJYA 1NI1A 4YDEA 4J6IA 3ABLE 3ZIMA 4CGVA 4F1PA 3TXMA 2FEZA 1HG2A 1SW6A 3FTWA 3CK7A 1NA3A 2L6BA 2I6HA 2UY1A 3CVPA 3LY7A 4BX8A 1MQSA 4HBDA 5H7PA 3FUIA 4KVMA 3L82A 1BI7B 2OVBA 3FUHA 5FQ4A 4BY6A 5BXOA 2EIKE 3JYSA 3OXLA 3VLDA 1WM5A 5FQ7A 3ZN3A 2YHCA 3ML9A 1VDYA 4DX2A 1UW4B 4IULA 3UX4A 2ZIRA 4EZKA 3QJZA 4G23A 4IN3B 4UWHA 4F53A 3UQ3A 2OV8A 2ETAA 5AQ7A 4DK5A 4HVBA 4A55A 5D0OD 4B8AA 1IYGA 4ANWA 2CHZA 1TEZA 2AXUA 2CHXA 4ANXA 2Y0BG 4KXKB 4JHRA 4W9RA 3I4RB 3ABKE 3CGHA 4GZCA 3MEKA 3JXIA 5BW8C 5ENSD 2WB2A 3RO2A 4TUUA 1H6OA 5AYWD 3IV0A 5D0QD 5CCLA 2M63A 2IQCA 2A4ZA 3OXFA 1K1BA 3HVEB 3DXMG 3D9LA 4B93B 2XHEA 1QYMA 1S63A 3AG1E 3TWQA 2WPVA 4I2WA 5EX3A 3NAWA 1E90A 4G8LA 2DIWA 2KCKA 2MRIA 2BKKB 4ILGA 2KBXA 2V5FA 2XEHA 2E2EA 2KCLA 3V79K 2EIJE 2J4BA 3DBSA 4XZ4A 3PS6A 1XNFA 2AXZA 2GRQB 4GMRA 3GW4A 2QYJA 3ZEFA 3SBTB 3EDTB 4J8SA 4U63A 5KJKA 2P58C 1Z3XA 1DNPA 2RFAA 4B8CB 2AWIA 3E37A 2DYSE 2WXPA 3ABME 4JD2G 2IY0C 4HFGA 4HOTA 2GRMA 5ITZF 4K5CA 4XKBA 3ESLA 2QC9A 4DLQA 3L08A 2WXHA 4X8QA 3C3QA 5EYLA 2LUHA 3CVYA 1MYOA 4GYOA 3FUFA 1TNBA 3QK0A 3ASDA 2OVFA 4XEIG 4CDNA 2CFZA 2VTBA 2H6FA 5FIOA 1SA5A 5KNHD 2LAIA 2VGEA 5C2YA 2PNNA 3KSQA 4I43A 4U8YD 4GMJA 4U8HA 2Y4TA 3CHOA 3TWSA 4AJWA 3MKQB 3SFYA 2C0LA 1YMPA 1OCRE 5D66A 1YYHA 1O1TA 1Y8MA 4JZYA 4GA0A 1W3BA 1HH8A 4JC8A 3MV3B 4L2YA 2MHKA 1SZAA 3ZVVA 3DPDA 1K8KG 5CRUA 3CK8A 3CHPA 1D9SA 1OT8A 2JLBA 3FH7A 2P9SG 2P2CP 2AXVA 5DIZA 4ATZD 3HRAA 2XGSA 3SBSA 5G05C 4K03A 3UIPC 4HOSA 2J4DA 3KEZA 4TRQA 3CKBA 3EIQC 1NFIE 3C3OA 3TWTA 5FZSA 4JHKA 1H0AA 3AAAC 3ZUVB 5ARGA 3UINC 1FPPA 4UQZA 4WNGA 3S7FA 5G55A 4N3AA 3UKUG 4G25A 5CECB 5HKPA 2LSVA 3EJNA 3SZ7A 1X5BA 1IHGA 4RVBA 2XQ0A 2IOLA 2FULA 3SF4A 1UJJA 2XPYA 3CHQA 1ELWA 4U0SA 3FUJA 4CYMD 1HO8A 2E0IA 4AP2A 2C0MA 3RRNB 3SNXA 4BT9A 3TG5A 3FTSA 3TGOA 2WXIA 3PREA 2WXJA 3KAEA 1QZ2A 4F3VA 4UWLA 5CBOA 1HE8A 2WXOA 1N9AA 3MGBA 3UT8A 2XGOA 1FVHA 1ELRA 2A5EA 2XENA 3ASHA 2ZXWE 1A5EA 2H6HA 5FZQA 5CEAA 5LFAA 4UUCA 4FHJA 4ZFHA 2DCPA 1KZOA 2IF4A 2DZNA 4L23A 3D9MA 1N4QA 3ASOE 5AIJA 2B0OE 4YVOA 3L16A 5IY5E 1U3DA 3DRAA 3ZYMA 3AU4A 3AG4E 4H7XA 4BSXA 1PC2A 4G26A 1IXVA 2IU1A 4BX9A 4TV3A 3G2UA 5G04C 3BG0B 2HO1A 4LNBA 3KD7A 5HS0A 1H2VC 5AJDA 5EIBE 2WMNA 3TG4A 4KMOA 3UTMA 1E8YA 3VLFA 4N5CA 3PZDA 3ZXSA 2PZIA 4U7EB 1N52A 4WNEA 4EPZA 3GZ1A 3QARA 1V54E 5KJLA 2ONDA 4GTQA 4YVQC 2WXMA 4JA7A 1JPLA 2XRYA 5AJLA 2X6JA 1TN6A 3D3MA 3L9TA 4K0RA 4PH4B 3ZNGA 4EECA 1Q2ZA 2LXLA 3Q7FA 4APFA 4JXTA 4ME2A 1DC2A 1Z6TA 3LJNA 2GRLA 1AWCB 3FEYA 4GCNA 3T5VA 4QFVA 4GPKA 3NB2A 2YQ8A 3UM0A 4A3TA 4HXIA 4EHMA 2XEVA 4GB9A 1OCOE 3RK6A 4BFRA 5EYPF 3QWVA 4AOFA 3D9OA 3UKRG 4TXRA 1DCQA 4DX1A 1N4SA 1H2TC 1IKND 2J07A 5EKQD 4Y6CA 4UI9K 2LO6A 2XZDG 3APCA 4XX5A 3LVRE 4GTTA 3DEPA 3JXJA 1U3CA 4GMLA 3HHMA 3ZKJA 2P9IG 1UN8A 3ZU7B 1UOHA 3UI2A 1KT0A 4RSYA 3JUIA 2R17C 3B95A 3B7BA 4BEPA 3B7TA 3CVLA 1FVFA 3Q4AB 1ZB1A 1WY6A 5JHAA 3TJPA 4G24A 4GZ6A 3S7JA 1V55E 2H6GA 4GYYA 3CR3A 4HB5A 3ZW3A 3E34A 2IOSA 4V3IA 5M72A 5A6CA 3FU0A 3SFXA 3LVQE 2KATA 2ZU6B 3KSLA 3L6AA 2R59A 3WG7E 2MOWA 3ZGQA 4EQFA 4FP7A 4FA6A 3ZHEA 1LF8A 3APDA 3ESKA 4XE0A 4DUIA 4R7LA 3QWPA 2VGYA 3HG0D 5JA4D 4YDOA 3PNTB 4G11A 1K1AA 3J5QB 4JVSA 3P2BA 3CEQA 5FWQA 4J8YA 3MX3A 2J09A 4FULA 4FU3A 1UJKA 3TWUA 2J49A 1NP7A 2I9CA 2ZISA 4JPSA 3ASFA 5AENA 4PDXA 2WMOA 3BG1B 5JJ7A 3EHNA 4G8KA 3L13A 2QZAA 4N3CA 3QC1A 4U8VD 2XS1A 3SQVA 4AV7A 4Q96A 1WDYA 3CVUA 1TNOA 3SHFA 3LCAA 5A23A 2L0IA 4UWGA 5LP0A 3V2OA 2OEWA 4BWRA 1H2UA 3D9KA 3LDZA 4RQIA 4N3BA 5KCMA 2BF0X 3E32A 3UM1A 4HNAD 3QAQA 2UWJG 1D8EA 4KT6B 3PE3A 5BNWA 2DYRE 2XPZA 5ENQD 5T3RA 1OCZE 1P5QA 4WAFA 3JQ0A 3LY9A 2OCCE 4M7CA 3R9AB 4ATGA 4JW1A 3Q73A 1JUQA 3AU5A 5JMND 4KZ0A 5G05J 3DSUA 1H19A 3FU6A 3MA5A 3UIOC 1UN9A 3S2AA 3K9IA 4LERA 1LD7A 5CEDB 3BUAA 3Q49B 3L22A 1X81A 3Q9UC 4BTAA 4RG6A 3VLEA 3EHMA 3I5PA 1OWMA 3WXXA 4CGWA 1JCQA 3PEVB 2CG3A 4I1MA 2QFCA 4YDWA 3AG3E 3CV0A 1K3ZD 1HFAA 4O1OA 3T9KA 3QDNA 1BD8A 5ARFA 2EILE 3AJIA 3C3RA 4U04A 4J8EA 1SVXA 5ANRA 3T8MA 2CG2A 3CSTA 4B89A 2AVPA 3TL5A 5T8IA 1E8XA 2R02A 3Q78A 4I1OB 3ZYLA 2GROB 5BXUA 2KM4A 3EUVA 3CLJA 4GA1A 2VGXB 3Q79A 4ILIA 1E96B 3LKUA 4DI4A 3KS2A 2WXNA 4NRHB 4CEMA 4Q94A 3FUKA 2WXRA 5HRYA 5AN8A 3ULQA 4DX7D 3EIJA 3ONLA 3U64A 3Q5MA 4F6RD 3FH8A 4WNFA 3Q15A 3Q75A 3RKVA 3UM2A 4C0MA 5T4YA 2XPIA 3AS5A 4CZ2D 4FHKA 4HORA 4GTOA 4WUYA 5B3SE 4KVOA 5FQ6A 2WXLA 4F7AA 2J08A 2VSOE 4EZLA 1EPUA 5B1BE 2LAHA 4GTVA 3MCXA 5ENOD 4GU5A 1L5JA 1JCRA 3MKRA 2I1KA 3ML8A 3Q7AA 5EN5D 2VYIA 1LD8A 2X3MA 3CIAA 1HXIA 4APOA 2DVWA 3LEWA 3F6QA 3NZUA 4F1SA 3O4ZA 1EYHA 2Y1LE 4MRUA 3FTVA 4YDYA 3AS8A 3B7UX 5FTPA 3E33A 1PAQA 3SY2A 4GTPA 3LS8A 1TNZA 2BUGA 4OYSA 3CQGB 2RG8A 5FJYA 3ZYKA 4Z68A 4O1PA 2XRZA 4BTBA 5C1DA 3SI5A 3BEEA 1KPSB 4U96D 4KBQA 1S0PA 1OY3D 4P29A 3HVEA 4NQ0A 1SQMA 3G2WA 3Q9NC 5AQBA 1AP7A 2GRNB 3ZXPA 2FO7A 4A1GA 2Y69E 5CBNA 4I9EA 3UUXA 4B94A 3LPZA 2QYUA 3DXKG 3NF1A 4L2LA 4JL0A 3IHVA 3SFZA 1QNFA 4XKCA 4ACKA 3PH0C 2EQXA 2AW6A 3S7BA 4MKTA 3G2TA 2R5SA 3W9FA 3PZ3A 1GW6A 4MS6A 3HXBA 4EBAG 1MX2A 5CMYA 2L0TB 3DSWA 3E4BA 4JEUA 4CRWA 4AIFA 5A7DB 4N39A 4NIKA 4DX5D 4OVVA 5BV0A 4C0EA 4ABNA 3IBEA 2XCCA 3RU0A 2F0YA 3N71A 5G2NA 3TAXA 4ACLA 4LCTA 1HS6A 3FDHA 3CVXA 3UMVA 5KWDA 3IXEA 3NOGD 3CK9A 4QQIA 3PZ2A 4BESA 5FINA 5AAOA 3BU8A 2CHWA 4LG6A 1MHQA 3TXNA 1RW2A 1EF1C 3R7QA 3UXGA 2B6CA 3B7SA 3D9JA 4HS2A 3DWLG 4I6JA 2VSYA 3MKQA 1XGWA 5D2MC 2DBAA 3G2SA 4JB8P 4TXQA 3FY4A 4HRMB 3RAUA 2IONA 2FBNA 4L7TA 3EHQA 2V0PA 4XI0A 2WM9A 4UWFA 4RLYA 1SZ9A 3D9HA 3G2VA 3NZSA 2KCVA 3LXUX 2WQ6A 3C5RA 4GTRA 4G2VA 3SGHA 4UQYA 4OAUC 4A3VA 4I2ZA 4O6FA 1FCHA 3SD5A 4IYPA 3JCKC 3FUNA 1TJCA 4XI9A 5E76A 3FUDA 5EX0A 1N4RA 1TNUA 1HG5A 4FLHA 4N2SA 2WQ7A 1FT2A 2P9UG 5FT9A 5KNGA 1D8DA 5CCMA 1JWFA 3W9GA 2WQHA 4BETA 2WXFA 5AQAA 4G1TA 4IRUA 4CDRA 5BUZA 4LEUA 1E8ZA 5J08A 1OWOA 1WAO1 3ISMC 1RZ4A 4PS8A 3I3NA 1IHBA 2NSZA 3ZFWA 4J7WA 3CKCA 1MZCA 3FTUA 3HXDA 1N0QA 3MV2B 4CCAA 3PZ1A 2GW1A 4UI9C 2BTDA 4D10C 2NYJA 3PUKA 3IKOB 2ILRA 4DX6D 3UM3A 2NXPA 5DBKA 2VSXE 3LY8A 4NURA 4KYOB 3CSFA 1G3NB 3KEAA 4U95D 2F8YA 4C48B 2LSUA 4C9BB 4I1AA 5BT1A 1BLXB 2I2OA 3PNLB 3X2QE 2IJGX 1N11A 4LSZE 3EU5A 2X6IA 5CMWA 3CVWA 4FLBA 2XCBA 4EZJA 1U2VG 5AQ9A 1YA0A 3CQCB 1IQRA 3U66A 4L1BA 4GAAA 5LCWC 4HQDA 2WVIA 3FTXA 4KZCA 1TN8A 3PEUB 1HF8A 3R9MA 2PQRA 3RJVA 1OWNA 2WXGA 5EILA 1H6KA 3HXEA 4RG9A 3OTNA 4HI8A 3U3WA 3PVLA 1KLXA 4AVXA 4FC8A 5ENTD 3B13A 5EDSA 3PUJA 2R05A 4DJAA 2OOEA 1MX4A 3FP3A 4WWNA 5FQ8A 1DCEA 4I6GA 4WNDA 2ETCA 4DI3A 1E7UA 1YCSB 4Q69A 4K5BA 2RKKA 3T8KA 1TNYA 4BSZB 3FEXA 3OXGA 2H6IA 3PE4A 3SO8A 2R2LA 3B7RL 1SA4A 4I17A 4JA9A 2P9LG 5HQ8A 1KT1A 2ETBA 2IO2C 4GTSA 1EDUA 4HRLA 4HLLA 1OWLA 3RO3A 4FJZA 3FU3A 3CHRA 3QOUA 4AY5A 5KJNA 3FUMA 1QBQA 4I6EA 5CRVA 3TWVA 3RSEG 2V5QC 2KZTB 3S7DA 3NBNB 5JJTA 2Q7FA 1HZ4A 2NC9A 2EINE 2RD0A 2FO1E 3D9IA 1N94A 2X6KA 4HRNA 2P9PG 2PL2A 3LYAA 1TYQG 3PZ4A 3UPVA 5ANLA 1OWPA 3IEGA 2VQ2A 3TWRA 4LNUD 4LUNU 4JHJA 4WWOA 4BERA 1IQUA 4FADA 3QB2A 3TWWA 2Y4UA 4CT4A 2I1JA 2X38A 4GTMA 3BQOA 5LX8A 3AG2E 2V4LA 4CDMA 3APFA 4A1SA 2MYOA 5J90A 4DPRA 3QKYA 3DSXA 3L17A 3URZA 3VTYA 3U9WA 3HIZA 4Y6WA 4ANVA 2WXKA 4B0ZA 4GYWA 3LJ3A 3D9PA 4GZDA 4J8DA 4AM9A 1Z5SC 3QNKA 3ULYA 1E8WA 4U0ZA 3C98A 2P9KG 4AEZC 4YNDA 2XS8A 4J0UA 1E7VA 1NA0A 2XZTG 4TUMA 4HOQA 1Z3YA 5CERB 4WWPA 3FTYA 4HLEA 5G04J 2F37A 1O1SA 4EBAA 3PRZA 4GCOA 1N4PA 3ZPJA 2PM6A 4I9CA 3P1UA 3V2XA 2L9BA 4U07A 3MJWA 1TN7A 4XIFA 3CVVA 4DRXE 3ONKA 3T5XA 4MBGA 2ZGDA 3JUEA 2V8SE 3CVQA 2IFUA 4N5QA 3TWXA 3DSTA 3J5PA 4M3OA 1OCCE 4NACA 1OXJA 2IO3C 2HM8A 5ENNA 5HI7A 1H6PA 4E6HA 4K5AB 4PUCA 1B89A 2XGMA 3R7RA 1Y6IA 3O48A 3E30A 1FT1A 2GRPB 2L6JA 4BT8A 2R03A 2X6HA 2YINA 5B1AE 1ZU2A 4ANUA 2RFMA 4GPMA 4OVUA 5JJ6A 3NQPA 1NL4A 3UT7A 4HI9A 1TR4A 2EIME 3ASGA 2JABA 1WG0A 3ZHEB 4L9PA 5JHBA 3FFLA 4U0UA 1BPOA 4GZ5A 5BV1A 3CVNA 2UY1B 1A17A 1UG3A 3ZRHA 4GA2A 2FF4A 3V30A 4DLOA 2F8XK 4AXHA 4UQXA 3FWVA 3CHSA 3FULA 4TXPA 3V31A 4AY6A 1BI8B 5LOZA 3U4TA 2X6FA 2KZTA 3HDXA 1BU9A 3MZLB 1HX8A 3FU5A 4H7YA 4UI9J 2Y3AA 2HYZA 5E75A 1O5MA 1MX6A 3MYVA 2FI7A 4LNGA 3FTZA 1NZNA 2VGXA
chains in the Genus database with same CATH topology
4RG6A 3MV2B 3VLEA 3EHMA 3CKBA 2VSNA 3I5PA 1OWMA 4CCAA 3EIQC 3Q47B 3WXXA 4CGWA 3FUEA 2GW1A 4UI9C 3L54A 2BTDA 4D10C 3PEVB 2CG3A 3PUKA 3IKOB 2ILRA 4I1MA 5FZSA 2QFCA 2NXPA 5DBKA 2VSXE 3CV0A 4JHKA 4PS3A 1HU3A 1H0AA 4MLPA 5ARGA 1HFAA 3LY8A 4CT0A 2J9QA 3QDNA 5BPPA 3D9NA 4NURA 4KYOB 3CSFA 4URKA 5ARFA 4UQZA 5FZRA 1ELKA 1ZBPA 4WNGA 3S7FA 2PQNA 2CFUA 1QQEA 5G55A 4N3AA 4G25A 1PY1A 4U04A 2GGFA 4J8EA 2LSUA 4C9BB 2LSVA 4I1AA 5ANRA 3EJNA 5BT1A 3T8MA 2I2OA 2CG2A 4LRZA 2KC7A 3PNLB 3RIBA 3IHYA 3SZ7A 3CSTA 3I4GA 1X5BA 2IJGX 4ILHB 1IHGA 4B89A 4RVBA 2XQ0A 2IOLA 4HOUA 5LCWJ 2AVPA 5KJMA 3VTXA 3TL5A 5T8IA 2FULA 1E8XA 2X6IA 3GZ2A 5CMWA 4I1OB 3SF4A 1UJJA 3ZYLA 2A5UA 3ENEA 3CVWA 2XPYA 4FLBA 2XCBA 4EZJA 2KM4A 3CHQA 1ELWA 1YA0A 3OAWA 4GZ3A 3CLJA 3FUJA 4U0SA 4GA1A 3CQCB 2VGXB 1HO8A 1IQRA 1JWGA 3U66A 4L1BA 2E0IA 4GAAA 3JQ1A 4ILIA 3RRUA 1E96B 5LCWC 4AP2A 3LKUA 4DI4A 2C0MA 2WVIA 3KS2A 1INZA 3FTXA 2WXNA 4KZCA 4NRHB 3RRNB 4E85A 4J8FA 3SNXA 4BT9A 3PEUB 4Q94A 4CEMA 3TG5A 3FUKA 1HF8A 2PQRA 2WXRA 2PM7A 3FTSA 3TGOA 2WXIA 3PREA 3ULQA 3RJVA 1OWNA 2WXGA 3EIJA 3ONLA 5CHEE 3U64A 2JEKA 3Q5MA 1H6KA 3FH8A 4UWKA 4WNFA 1DVPA 2WXJA 3Q15A 3RKVA 3KAEA 1QZ2A 2C2LA 4RG9A 5T4YA 4C0MA 4F3VA 4UWLA 3OTNA 1HE8A 2WXQA 2XPIA 2WXOA 3AS5A 4FHKA 4HORA 3U3WA 3MGBA 3UT8A 2XGOA 1FVHA 3GYZA 4WUYA 3PVLA 1ELRA 4KVOA 1KLXA 5FQ6A 4AVXA 4FC8A 2WXLA 3AS4A 2YNQA 3ASHA 5FZQA 3B13A 5LFAA 4F7AA 5EDSA 2J08A 3FHEA 4N2QA 2VSOE 2YHEA 1EPUA 3PUJA 4FHJA 4DJAA 4EZLA 2DCPA 2OOEA 3FP3A 2LAHA 4WWNA 5FQ8A 1N54A 2IF4A 3MCXA 4L23A 4I6GA 3D9MA 1TJFA 2VTBB 4GU5A 4WNDA 3HYMB 3QWWA 4DI3A 1L5JA 3MKRA 3PDNA 1E7UA 3CHMA 5AIJA 4YVOA 3L16A 2I1KA 3ML8A 4Q69A 2HR2A 1U3DA 3FEXA 3OXGA 2VYIA 3ZYMA 3AU4A 2X3MA 3CIAA 1HXIA 4APOA 3PE4A 3LEWA 4H7XA 3RRMB 4BSXA 4PS7A 3NZUA 1PC2A 3B7RL 4G26A 4F1SA 3O4ZA 2IU1A 4I17A 4JA9A 1EYHA 3FH5A 3GZSA 3UT4A 4BX9A 2VJ8A 5HQ8A 4TV3A 1OUVA 4MRUA 3G2UA 3FTVA 3ZYQA 5G04C 1KT1A 3BG0B 1EDUA 3AS8A 3B7UX 5FTPA 2HO1A 3KD7A 1PAQA 1H2VC 1OWLA 3LS8A 2QY7A 4FJZA 4JEHA 3FU3A 2LNIA 5AJDA 3RO3A 2BUGA 2WMNA 3CHRA 3QOUA 3TG4A 4OYSA 4AY5A 3CQGB 4KMOA 5KJNA 1E8YA 4FJYA 3VLFA 3FUMA 4J6IA 4N5CA 2RG8A 4I6EA 5FJYA 3ZIMA 3PZDA 3ZYKA 4CGVA 3ZXSA 2PZIA 1N52A 4WNEA 4EPZA 3GZ1A 2KZTB 3QARA 3S7DA 3TXMA 5JJTA 2FEZA 1HG2A 1HZ4A 2NC9A 2Q7FA 5KJLA 2ONDA 2RD0A 2XRZA 3FTWA 3CK7A 1NA3A 3CVPA 2I6HA 2UY1A 3D9IA 4YVQC 3LY7A 2WXMA 4BTBA 4JA7A 2X6KA 1JPLA 4BX8A 2XRYA 1MQSA 5C1DA 2X6JA 5AJLA 2PL2A 3LYAA 3SI5A 3D3MA 3FUIA 4KVMA 3UPVA 1OWPA 3BEEA 2OVBA 3FUHA 5ANLA 4K0RA 3IEGA 5FQ4A 4BY6A 3JYSA 3OXLA 4PH4B 3VLDA 1WM5A 2VQ2A 5FQ7A 4LUNU 4KBQA 1S0PA 4JHJA 4WWOA 3ZN3A 4P29A 4EECA 3HVEA 1IQUA 2YHCA 3ML9A 4FADA 4APFA 4NQ0A 1SQMA 3G2WA 3QB2A 4JXTA 1VDYA 2Y4UA 1UW4B 4ME2A 4CT4A 2I1JA 2X38A 4IULA 5LX8A 3UX4A 1Z6TA 2GRLA 3FEYA 4EZKA 2V4LA 4GCNA 3QJZA 4G23A 4CDMA 4QFVA 3T5VA 3APFA 4GPKA 2FO7A 4IN3B 4A1GA 4A1SA 5J90A 4UWHA 2YQ8A 4F53A 3UQ3A 4A3TA 4HXIA 4DPRA 4I9EA 3QKYA 2OV8A 2XEVA 3L17A 3UUXA 3URZA 4GB9A 4B94A 3LPZA 3RK6A 4DK5A 3VTYA 4HVBA 3U9WA 3HIZA 4A55A 3NF1A 5D0OD 4Y6WA 4B8AA 4BFRA 4ANVA 1IYGA 2WXKA 4L2LA 4ANWA 3QWVA 2CHZA 3IHVA 4JL0A 1TEZA 4B0ZA 3SFZA 1QNFA 2AXUA 4XKCA 4GYWA 4ACKA 4AOFA 2CHXA 3PH0C 3D9OA 3LJ3A 3D9PA 2EQXA 4KXKB 4ANXA 4GZDA 4JHRA 2AW6A 4W9RA 4J8DA 3I4RB 4AM9A 3S7BA 3CGHA 4GZCA 3MEKA 3QNKA 4MKTA 3G2TA 5BW8C 2R5SA 2WB2A 1E8WA 3RO2A 4TUUA 1GW6A 5AYWD 3IV0A 4MS6A 4U0ZA 5D0QD 4EBAG 2M63A 3C98A 5CCLA 2IQCA 4AEZC 1H2TC 2J07A 2A4ZA 4YNDA 4J0UA 5EKQD 1E7VA 3OXFA 5CMYA 1NA0A 2L0TB 4Y6CA 4UI9K 2LO6A 3HVEB 4HOQA 3E4BA 4JEUA 4CRWA 3D9LA 3APCA 1Z3YA 2XHEA 4XX5A 2WPVA 3LVRE 4WWPA 4I2WA 5EX3A 3FTYA 4AIFA 4HLEA 1E90A 1U3CA 2DIWA 2KCKA 4GMLA 4N39A 5G04J 5A7DB 3HHMA 2MRIA 4OVVA 5BV0A 4C0EA 4ABNA 1UN8A 4ILGA 3IBEA 2V5FA 2XCCA 3RU0A 1KT0A 3N71A 4RSYA 3JUIA 5G2NA 3TAXA 4ACLA 2R17C 4LCTA 4EBAA 1HS6A 2E2EA 3FDHA 3PRZA 2KCLA 4GCOA 3B7TA 3CVLA 2J4BA 1FVFA 3Q4AB 3DBSA 4XZ4A 1WY6A 3ZPJA 2PM6A 5JHAA 3TJPA 4G24A 3P1UA 4I9CA 4GZ6A 3CVXA 3UMVA 3PS6A 1XNFA 2AXZA 3CK9A 3S7JA 4GYYA 3CR3A 3ZW3A 2L9BA 2IOSA 4V3IA 5M72A 3GW4A 4U07A 5A6CA 3FU0A 3MJWA 4XIFA 3CVVA 3ONKA 3LVQE 2KATA 2ZU6B 3T5XA 3ZEFA 3L6AA 2CHWA 2V8SE 3CVQA 3SBTB 2IFUA 2R59A 3EDTB 2MOWA 4J8SA 3ZGQA 4U63A 4EQFA 4FP7A 4M3OA 4FA6A 1MHQA 5KJKA 3ZHEA 4NACA 2P58C 3TXNA 1LF8A 3APDA 3ESKA 4XE0A 1EF1C 4R7LA 2HM8A 3QWPA 2VGYA 5ENNA 3R7QA 1Z3XA 1DNPA 3B7SA 3D9JA 4HS2A 5HI7A 4B8CB 4I6JA 2AWIA 2VSYA 3PNTB 2WXPA 3MKQA 4E6HA 4G11A 1XGWA 4HFGA 4PUCA 1B89A 2XGMA 4HOTA 2GRMA 2DBAA 4JVSA 3G2SA 3P2BA 3CEQA 5FWQA 3R7RA 1Y6IA 3MX3A 4XKBA 3ESLA 3O48A 2J09A 3FY4A 4FULA 2IONA 4FU3A 4DLQA 1UJKA 3L08A 2FBNA 2WXHA 4L7TA 2L6JA 4BT8A 2J49A 1NP7A 2I9CA 2V0PA 4XI0A 2X6HA 2WM9A 2YINA 3CVYA 1ZU2A 4JPSA 4ANUA 4UWFA 3ASFA 5AENA 4PDXA 2WMOA 3BG1B 4GYOA 1SZ9A 3G2VA 5JJ7A 3FUFA 3NZSA 2KCVA 4OVUA 3EHNA 3LXUX 3QK0A 3L13A 5JJ6A 3ASDA 4N3CA 2WQ6A 3QC1A 2OVFA 4CDNA 2CFZA 4G2VA 2VTBA 3SGHA 3NQPA 4UQYA 4AV7A 3UT7A 2LAIA 4Q96A 3CVUA 3SHFA 4A3VA 4I2ZA 3LCAA 4O6FA 5A23A 5C2YA 2L0IA 4UWGA 3ASGA 5LP0A 4I43A 3ZHEB 4BWRA 1H2UA 5JHBA 3FFLA 1FCHA 3D9KA 4GMJA 2Y4TA 4U0UA 4U8HA 3SD5A 1BPOA 3LDZA 4GZ5A 4IYPA 3JCKC 3FUNA 3CHOA 5BV1A 1TJCA 3CVNA 4XI9A 5E76A 2UY1B 4N3BA 3FUDA 5KCMA 1A17A 2BF0X 4AJWA 5EX0A 1UG3A 3MKQB 3ZRHA 4GA2A 2FF4A 3QAQA 2C0LA 1HG5A 2UWJG 4FLHA 4DLOA 4KT6B 4N2SA 4AXHA 4UQXA 3PE3A 5BNWA 2WQ7A 1Y8MA 2XPZA 4GA0A 4JZYA 5T3RA 3FWVA 1P5QA 1W3BA 3CHSA 4WAFA 1HH8A 3JQ0A 3LY9A 4JC8A 5FT9A 3MV3B 5CCMA 4L2YA 1JWFA 3FULA 3R9AB 2MHKA 4ATGA 2WQHA 1SZAA 3ZVVA 4JW1A 3DPDA 2WXFA 1JUQA 3AU5A 4AY6A 4KZ0A 5G05J 4G1TA 3CK8A 3CHPA 4IRUA 4CDRA 5LOZA 5BUZA 3U4TA 2X6FA 2KZTA 3HDXA 2JLBA 4LEUA 3FU6A 1E8ZA 1H19A 3MA5A 3FH7A 3MZLB 1OWOA 5J08A 1HX8A 1UN9A 1WAO1 3FU5A 2AXVA 4H7YA 3S2AA 4PS8A 4UI9J 2Y3AA 2HYZA 3I3NA 3K9IA 5E75A 4LERA 2NSZA 5DIZA 3ZFWA 3CKCA 3MYVA 3Q49B 2XGSA 3SBSA 3L22A 2FI7A 5G05C 4BTAA 4K03A 3FTUA 4HOSA 2J4DA 3FTZA 3KEZA 1NZNA 2VGXA 4TRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2T C;  2ZU6 B;  2KZT A;  4LUN U;  1H6K A;  4JHJ A;  3RK6 A;  3EIQ C;  3L6A A;  2IU1 A;  1N54 A;  2GGF A;  1N52 A;  4C9B B;  2KZT B;  5ANR A;  4B8A A;  2ION A;  2I2O A;  4CRW A;  1UW4 B;  4CT4 A;  4IUL A;  2NSZ A;  2VSX E;  4B89 A;  4JHK A;  1HU3 A;  2IOL A;  1PAQ A;  2HM8 A;  1H2U A;  3FEY A;  1H2V C;  4GML A;  4CEM A;  4GMJ A;  4B8C B;  2FUL A;  2IOS A;  3D3M A;  3FEX A;  2VSO E;  1UG3 A;  2RG8 A;  3EIJ A;  3JUI A; 
#chains in the Genus database with same CATH topology
 2VSN A;  3Q47 B;  2HE0 A;  3FUE A;  4OAV B;  3HXC A;  3L54 A;  1S64 A;  1MJ0 A;  2DWZ A;  4PS3 A;  1HU3 A;  4MLP A;  3DSS A;  4ZHB A;  2GRR B;  4CT0 A;  2J9Q A;  5BPP A;  3D9N A;  1JCS A;  4URK A;  1KZP A;  3DEO A;  5FZR A;  1ELK A;  2OEV A;  1ZBP A;  2PQN A;  2CFU A;  3EHR A;  1QQE A;  2IEJ A;  1PY1 A;  2GGF A;  4LRZ A;  2KC7 A;  3RIB A;  3IHY A;  3I4G A;  4ILH B;  4HOU A;  5LCW J;  3ASN E;  5ENR D;  3VTX A;  5KJM A;  3NOC D;  3GZ2 A;  3EU9 A;  2A5U A;  3ENE A;  3OAW A;  4GZ3 A;  1JWG A;  1LTX A;  3JQ1 A;  3RRU A;  3C72 A;  5KBA A;  1INZ A;  4E85 A;  4J8F A;  5EID A;  2PM7 A;  3ULE G;  5CHE E;  4O60 A;  2JEK A;  4UWK A;  4A63 B;  1DVP A;  2C2L A;  2WXQ A;  2V4H C;  3DSV A;  3GYZ A;  1N95 A;  2DZO A;  3AS4 A;  2YNQ A;  2XEE A;  3FHE A;  4N2Q A;  2YHE A;  2BKG A;  2AJA A;  1N54 A;  1O1R A;  1TJF A;  2VTB B;  3HYM B;  3QWW A;  3PDN A;  2BED A;  1N0R A;  3CHM A;  2HR2 A;  2LXM A;  5ENP D;  3RRM B;  4PS7 A;  2ZGG A;  3FH5 A;  3GZS A;  3UT4 A;  2VJ8 A;  3DPY A;  1OUV A;  3HXF A;  5AAR A;  3ZYQ A;  2J8S D;  2QY7 A;  2P9N G;  4JEH A;  2LNI A;  1S70 B;  2KXP C;  4FJY A;  1NI1 A;  4YDE A;  4J6I A;  3ABL E;  3ZIM A;  4CGV A;  4F1P A;  3TXM A;  2FEZ A;  1HG2 A;  1SW6 A;  3FTW A;  3CK7 A;  1NA3 A;  2L6B A;  2I6H A;  2UY1 A;  3CVP A;  3LY7 A;  4BX8 A;  1MQS A;  4HBD A;  5H7P A;  3FUI A;  4KVM A;  3L82 A;  1BI7 B;  2OVB A;  3FUH A;  5FQ4 A;  4BY6 A;  5BXO A;  2EIK E;  3JYS A;  3OXL A;  3VLD A;  1WM5 A;  5FQ7 A;  3ZN3 A;  2YHC A;  3ML9 A;  1VDY A;  4DX2 A;  1UW4 B;  4IUL A;  3UX4 A;  2ZIR A;  4EZK A;  3QJZ A;  4G23 A;  4IN3 B;  4UWH A;  4F53 A;  3UQ3 A;  2OV8 A;  2ETA A;  5AQ7 A;  4DK5 A;  4HVB A;  4A55 A;  5D0O D;  4B8A A;  1IYG A;  4ANW A;  2CHZ A;  1TEZ A;  2AXU A;  2CHX A;  4ANX A;  2Y0B G;  4KXK B;  4JHR A;  4W9R A;  3I4R B;  3ABK E;  3CGH A;  4GZC A;  3MEK A;  3JXI A;  5BW8 C;  5ENS D;  2WB2 A;  3RO2 A;  4TUU A;  1H6O A;  5AYW D;  3IV0 A;  5D0Q D;  5CCL A;  2M63 A;  2IQC A;  2A4Z A;  3OXF A;  1K1B A;  3HVE B;  3DXM G;  3D9L A;  4B93 B;  2XHE A;  1QYM A;  1S63 A;  3AG1 E;  3TWQ A;  2WPV A;  4I2W A;  5EX3 A;  3NAW A;  1E90 A;  4G8L A;  2DIW A;  2KCK A;  2MRI A;  2BKK B;  4ILG A;  2KBX A;  2V5F A;  2XEH A;  2E2E A;  2KCL A;  3V79 K;  2EIJ E;  2J4B A;  3DBS A;  4XZ4 A;  3PS6 A;  1XNF A;  2AXZ A;  2GRQ B;  4GMR A;  3GW4 A;  2QYJ A;  3ZEF A;  3SBT B;  3EDT B;  4J8S A;  4U63 A;  5KJK A;  2P58 C;  1Z3X A;  1DNP A;  2RFA A;  4B8C B;  2AWI A;  3E37 A;  2DYS E;  2WXP A;  3ABM E;  4JD2 G;  2IY0 C;  4HFG A;  4HOT A;  2GRM A;  5ITZ F;  4K5C A;  4XKB A;  3ESL A;  2QC9 A;  4DLQ A;  3L08 A;  2WXH A;  4X8Q A;  3C3Q A;  5EYL A;  2LUH A;  3CVY A;  1MYO A;  4GYO A;  3FUF A;  1TNB A;  3QK0 A;  3ASD A;  2OVF A;  4XEI G;  4CDN A;  2CFZ A;  2VTB A;  2H6F A;  5FIO A;  1SA5 A;  5KNH D;  2LAI A;  2VGE A;  5C2Y A;  2PNN A;  3KSQ A;  4I43 A;  4U8Y D;  4GMJ A;  4U8H A;  2Y4T A;  3CHO A;  3TWS A;  4AJW A;  3MKQ B;  3SFY A;  2C0L A;  1YMP A;  1OCR E;  5D66 A;  1YYH A;  1O1T A;  1Y8M A;  4JZY A;  4GA0 A;  1W3B A;  1HH8 A;  4JC8 A;  3MV3 B;  4L2Y A;  2MHK A;  1SZA A;  3ZVV A;  3DPD A;  1K8K G;  5CRU A;  3CK8 A;  3CHP A;  1D9S A;  1OT8 A;  2JLB A;  3FH7 A;  2P9S G;  2P2C P;  2AXV A;  5DIZ A;  4ATZ D;  3HRA A;  2XGS A;  3SBS A;  5G05 C;  4K03 A;  3UIP C;  4HOS A;  2J4D A;  3KEZ A;  4TRQ A;  3CKB A;  3EIQ C;  1NFI E;  3C3O A;  3TWT A;  5FZS A;  4JHK A;  1H0A A;  3AAA C;  3ZUV B;  5ARG A;  3UIN C;  1FPP A;  4UQZ A;  4WNG A;  3S7F A;  5G55 A;  4N3A A;  3UKU G;  4G25 A;  5CEC B;  5HKP A;  2LSV A;  3EJN A;  3SZ7 A;  1X5B A;  1IHG A;  4RVB A;  2XQ0 A;  2IOL A;  2FUL A;  3SF4 A;  1UJJ A;  2XPY A;  3CHQ A;  1ELW A;  4U0S A;  3FUJ A;  4CYM D;  1HO8 A;  2E0I A;  4AP2 A;  2C0M A;  3RRN B;  3SNX A;  4BT9 A;  3TG5 A;  3FTS A;  3TGO A;  2WXI A;  3PRE A;  2WXJ A;  3KAE A;  1QZ2 A;  4F3V A;  4UWL A;  5CBO A;  1HE8 A;  2WXO A;  1N9A A;  3MGB A;  3UT8 A;  2XGO A;  1FVH A;  1ELR A;  2A5E A;  2XEN A;  3ASH A;  2ZXW E;  1A5E A;  2H6H A;  5FZQ A;  5CEA A;  5LFA A;  4UUC A;  4FHJ A;  4ZFH A;  2DCP A;  1KZO A;  2IF4 A;  2DZN A;  4L23 A;  3D9M A;  1N4Q A;  3ASO E;  5AIJ A;  2B0O E;  4YVO A;  3L16 A;  5IY5 E;  1U3D A;  3DRA A;  3ZYM A;  3AU4 A;  3AG4 E;  4H7X A;  4BSX A;  1PC2 A;  4G26 A;  1IXV A;  2IU1 A;  4BX9 A;  4TV3 A;  3G2U A;  5G04 C;  3BG0 B;  2HO1 A;  4LNB A;  3KD7 A;  5HS0 A;  1H2V C;  5AJD A;  5EIB E;  2WMN A;  3TG4 A;  4KMO A;  3UTM A;  1E8Y A;  3VLF A;  4N5C A;  3PZD A;  3ZXS A;  2PZI A;  4U7E B;  1N52 A;  4WNE A;  4EPZ A;  3GZ1 A;  3QAR A;  1V54 E;  5KJL A;  2OND A;  4GTQ A;  4YVQ C;  2WXM A;  4JA7 A;  1JPL A;  2XRY A;  5AJL A;  2X6J A;  1TN6 A;  3D3M A;  3L9T A;  4K0R A;  4PH4 B;  3ZNG A;  4EEC A;  1Q2Z A;  2LXL A;  3Q7F A;  4APF A;  4JXT A;  4ME2 A;  1DC2 A;  1Z6T A;  3LJN A;  2GRL A;  1AWC B;  3FEY A;  4GCN A;  3T5V A;  4QFV A;  4GPK A;  3NB2 A;  2YQ8 A;  3UM0 A;  4A3T A;  4HXI A;  4EHM A;  2XEV A;  4GB9 A;  1OCO E;  3RK6 A;  4BFR A;  5EYP F;  3QWV A;  4AOF A;  3D9O A;  3UKR G;  4TXR A;  1DCQ A;  4DX1 A;  1N4S A;  1H2T C;  1IKN D;  2J07 A;  5EKQ D;  4Y6C A;  4UI9 K;  2LO6 A;  2XZD G;  3APC A;  4XX5 A;  3LVR E;  4GTT A;  3DEP A;  3JXJ A;  1U3C A;  4GML A;  3HHM A;  3ZKJ A;  2P9I G;  1UN8 A;  3ZU7 B;  1UOH A;  3UI2 A;  1KT0 A;  4RSY A;  3JUI A;  2R17 C;  3B95 A;  3B7B A;  4BEP A;  3B7T A;  3CVL A;  1FVF A;  3Q4A B;  1ZB1 A;  1WY6 A;  5JHA A;  3TJP A;  4G24 A;  4GZ6 A;  3S7J A;  1V55 E;  2H6G A;  4GYY A;  3CR3 A;  4HB5 A;  3ZW3 A;  3E34 A;  2IOS A;  4V3I A;  5M72 A;  5A6C A;  3FU0 A;  3SFX A;  3LVQ E;  2KAT A;  2ZU6 B;  3KSL A;  3L6A A;  2R59 A;  3WG7 E;  2MOW A;  3ZGQ A;  4EQF A;  4FP7 A;  4FA6 A;  3ZHE A;  1LF8 A;  3APD A;  3ESK A;  4XE0 A;  4DUI A;  4R7L A;  3QWP A;  2VGY A;  3HG0 D;  5JA4 D;  4YDO A;  3PNT B;  4G11 A;  1K1A A;  3J5Q B;  4JVS A;  3P2B A;  3CEQ A;  5FWQ A;  4J8Y A;  3MX3 A;  2J09 A;  4FUL A;  4FU3 A;  1UJK A;  3TWU A;  2J49 A;  1NP7 A;  2I9C A;  2ZIS A;  4JPS A;  3ASF A;  5AEN A;  4PDX A;  2WMO A;  3BG1 B;  5JJ7 A;  3EHN A;  4G8K A;  3L13 A;  2QZA A;  4N3C A;  3QC1 A;  4U8V D;  2XS1 A;  3SQV A;  4AV7 A;  4Q96 A;  1WDY A;  3CVU A;  1TNO A;  3SHF A;  3LCA A;  5A23 A;  2L0I A;  4UWG A;  5LP0 A;  3V2O A;  2OEW A;  4BWR A;  1H2U A;  3D9K A;  3LDZ A;  4RQI A;  4N3B A;  5KCM A;  2BF0 X;  3E32 A;  3UM1 A;  4HNA D;  3QAQ A;  2UWJ G;  1D8E A;  4KT6 B;  3PE3 A;  5BNW A;  2DYR E;  2XPZ A;  5ENQ D;  5T3R A;  1OCZ E;  1P5Q A;  4WAF A;  3JQ0 A;  3LY9 A;  2OCC E;  4M7C A;  3R9A B;  4ATG A;  4JW1 A;  3Q73 A;  1JUQ A;  3AU5 A;  5JMN D;  4KZ0 A;  5G05 J;  3DSU A;  1H19 A;  3FU6 A;  3MA5 A;  3UIO C;  1UN9 A;  3S2A A;  3K9I A;  4LER A;  1LD7 A;  5CED B;  3BUA A;  3Q49 B;  3L22 A;  1X81 A;  3Q9U C;  4BTA A;  4RG6 A;  3VLE A;  3EHM A;  3I5P A;  1OWM A;  3WXX A;  4CGW A;  1JCQ A;  3PEV B;  2CG3 A;  4I1M A;  2QFC A;  4YDW A;  3AG3 E;  3CV0 A;  1K3Z D;  1HFA A;  4O1O A;  3T9K A;  3QDN A;  1BD8 A;  5ARF A;  2EIL E;  3AJI A;  3C3R A;  4U04 A;  4J8E A;  1SVX A;  5ANR A;  3T8M A;  2CG2 A;  3CST A;  4B89 A;  2AVP A;  3TL5 A;  5T8I A;  1E8X A;  2R02 A;  3Q78 A;  4I1O B;  3ZYL A;  2GRO B;  5BXU A;  2KM4 A;  3EUV A;  3CLJ A;  4GA1 A;  2VGX B;  3Q79 A;  4ILI A;  1E96 B;  3LKU A;  4DI4 A;  3KS2 A;  2WXN A;  4NRH B;  4CEM A;  4Q94 A;  3FUK A;  2WXR A;  5HRY A;  5AN8 A;  3ULQ A;  4DX7 D;  3EIJ A;  3ONL A;  3U64 A;  3Q5M A;  4F6R D;  3FH8 A;  4WNF A;  3Q15 A;  3Q75 A;  3RKV A;  3UM2 A;  4C0M A;  5T4Y A;  2XPI A;  3AS5 A;  4CZ2 D;  4FHK A;  4HOR A;  4GTO A;  4WUY A;  5B3S E;  4KVO A;  5FQ6 A;  2WXL A;  4F7A A;  2J08 A;  2VSO E;  4EZL A;  1EPU A;  5B1B E;  2LAH A;  4GTV A;  3MCX A;  5ENO D;  4GU5 A;  1L5J A;  1JCR A;  3MKR A;  2I1K A;  3ML8 A;  3Q7A A;  5EN5 D;  2VYI A;  1LD8 A;  2X3M A;  3CIA A;  1HXI A;  4APO A;  2DVW A;  3LEW A;  3F6Q A;  3NZU A;  4F1S A;  3O4Z A;  1EYH A;  2Y1L E;  4MRU A;  3FTV A;  4YDY A;  3AS8 A;  3B7U X;  5FTP A;  3E33 A;  1PAQ A;  3SY2 A;  4GTP A;  3LS8 A;  1TNZ A;  2BUG A;  4OYS A;  3CQG B;  2RG8 A;  5FJY A;  3ZYK A;  4Z68 A;  4O1P A;  2XRZ A;  4BTB A;  5C1D A;  3SI5 A;  3BEE A;  1KPS B;  4U96 D;  4KBQ A;  1S0P A;  1OY3 D;  4P29 A;  3HVE A;  4NQ0 A;  1SQM A;  3G2W A;  3Q9N C;  5AQB A;  1AP7 A;  2GRN B;  3ZXP A;  2FO7 A;  4A1G A;  2Y69 E;  5CBN A;  4I9E A;  3UUX A;  4B94 A;  3LPZ A;  2QYU A;  3DXK G;  3NF1 A;  4L2L A;  4JL0 A;  3IHV A;  3SFZ A;  1QNF A;  4XKC A;  4ACK A;  3PH0 C;  2EQX A;  2AW6 A;  3S7B A;  4MKT A;  3G2T A;  2R5S A;  3W9F A;  3PZ3 A;  1GW6 A;  4MS6 A;  3HXB A;  4EBA G;  1MX2 A;  5CMY A;  2L0T B;  3DSW A;  3E4B A;  4JEU A;  4CRW A;  4AIF A;  5A7D B;  4N39 A;  4NIK A;  4DX5 D;  4OVV A;  5BV0 A;  4C0E A;  4ABN A;  3IBE A;  2XCC A;  3RU0 A;  2F0Y A;  3N71 A;  5G2N A;  3TAX A;  4ACL A;  4LCT A;  1HS6 A;  3FDH A;  3CVX A;  3UMV A;  5KWD A;  3IXE A;  3NOG D;  3CK9 A;  4QQI A;  3PZ2 A;  4BES A;  5FIN A;  5AAO A;  3BU8 A;  2CHW A;  4LG6 A;  1MHQ A;  3TXN A;  1RW2 A;  1EF1 C;  3R7Q A;  3UXG A;  2B6C A;  3B7S A;  3D9J A;  4HS2 A;  3DWL G;  4I6J A;  2VSY A;  3MKQ A;  1XGW A;  5D2M C;  2DBA A;  3G2S A;  4JB8 P;  4TXQ A;  3FY4 A;  4HRM B;  3RAU A;  2ION A;  2FBN A;  4L7T A;  3EHQ A;  2V0P A;  4XI0 A;  2WM9 A;  4UWF A;  4RLY A;  1SZ9 A;  3D9H A;  3G2V A;  3NZS A;  2KCV A;  3LXU X;  2WQ6 A;  3C5R A;  4GTR A;  4G2V A;  3SGH A;  4UQY A;  4OAU C;  4A3V A;  4I2Z A;  4O6F A;  1FCH A;  3SD5 A;  4IYP A;  3JCK C;  3FUN A;  1TJC A;  4XI9 A;  5E76 A;  3FUD A;  5EX0 A;  1N4R A;  1TNU A;  1HG5 A;  4FLH A;  4N2S A;  2WQ7 A;  1FT2 A;  2P9U G;  5FT9 A;  5KNG A;  1D8D A;  5CCM A;  1JWF A;  3W9G A;  2WQH A;  4BET A;  2WXF A;  5AQA A;  4G1T A;  4IRU A;  4CDR A;  5BUZ A;  4LEU A;  1E8Z A;  5J08 A;  1OWO A;  1WAO 1;  3ISM C;  1RZ4 A;  4PS8 A;  3I3N A;  1IHB A;  2NSZ A;  3ZFW A;  4J7W A;  3CKC A;  1MZC A;  3FTU A;  3HXD A;  1N0Q A;  3MV2 B;  4CCA A;  3PZ1 A;  2GW1 A;  4UI9 C;  2BTD A;  4D10 C;  2NYJ A;  3PUK A;  3IKO B;  2ILR A;  4DX6 D;  3UM3 A;  2NXP A;  5DBK A;  2VSX E;  3LY8 A;  4NUR A;  4KYO B;  3CSF A;  1G3N B;  3KEA A;  4U95 D;  2F8Y A;  4C48 B;  2LSU A;  4C9B B;  4I1A A;  5BT1 A;  1BLX B;  2I2O A;  3PNL B;  3X2Q E;  2IJG X;  1N11 A;  4LSZ E;  3EU5 A;  2X6I A;  5CMW A;  3CVW A;  4FLB A;  2XCB A;  4EZJ A;  1U2V G;  5AQ9 A;  1YA0 A;  3CQC B;  1IQR A;  3U66 A;  4L1B A;  4GAA A;  5LCW C;  4HQD A;  2WVI A;  3FTX A;  4KZC A;  1TN8 A;  3PEU B;  1HF8 A;  3R9M A;  2PQR A;  3RJV A;  1OWN A;  2WXG A;  5EIL A;  1H6K A;  3HXE A;  4RG9 A;  3OTN A;  4HI8 A;  3U3W A;  3PVL A;  1KLX A;  4AVX A;  4FC8 A;  5ENT D;  3B13 A;  5EDS A;  3PUJ A;  2R05 A;  4DJA A;  2OOE A;  1MX4 A;  3FP3 A;  4WWN A;  5FQ8 A;  1DCE A;  4I6G A;  4WND A;  2ETC A;  4DI3 A;  1E7U A;  1YCS B;  4Q69 A;  4K5B A;  2RKK A;  3T8K A;  1TNY A;  4BSZ B;  3FEX A;  3OXG A;  2H6I A;  3PE4 A;  3SO8 A;  2R2L A;  3B7R L;  1SA4 A;  4I17 A;  4JA9 A;  2P9L G;  5HQ8 A;  1KT1 A;  2ETB A;  2IO2 C;  4GTS A;  1EDU A;  4HRL A;  4HLL A;  1OWL A;  3RO3 A;  4FJZ A;  3FU3 A;  3CHR A;  3QOU A;  4AY5 A;  5KJN A;  3FUM A;  1QBQ A;  4I6E A;  5CRV A;  3TWV A;  3RSE G;  2V5Q C;  2KZT B;  3S7D A;  3NBN B;  5JJT A;  2Q7F A;  1HZ4 A;  2NC9 A;  2EIN E;  2RD0 A;  2FO1 E;  3D9I A;  1N94 A;  2X6K A;  4HRN A;  2P9P G;  2PL2 A;  3LYA A;  1TYQ G;  3PZ4 A;  3UPV A;  5ANL A;  1OWP A;  3IEG A;  2VQ2 A;  3TWR A;  4LNU D;  4LUN U;  4JHJ A;  4WWO A;  4BER A;  1IQU A;  4FAD A;  3QB2 A;  3TWW A;  2Y4U A;  4CT4 A;  2I1J A;  2X38 A;  4GTM A;  3BQO A;  5LX8 A;  3AG2 E;  2V4L A;  4CDM A;  3APF A;  4A1S A;  2MYO A;  5J90 A;  4DPR A;  3QKY A;  3DSX A;  3L17 A;  3URZ A;  3VTY A;  3U9W A;  3HIZ A;  4Y6W A;  4ANV A;  2WXK A;  4B0Z A;  4GYW A;  3LJ3 A;  3D9P A;  4GZD A;  4J8D A;  4AM9 A;  1Z5S C;  3QNK A;  3ULY A;  1E8W A;  4U0Z A;  3C98 A;  2P9K G;  4AEZ C;  4YND A;  2XS8 A;  4J0U A;  1E7V A;  1NA0 A;  2XZT G;  4TUM A;  4HOQ A;  1Z3Y A;  5CER B;  4WWP A;  3FTY A;  4HLE A;  5G04 J;  2F37 A;  1O1S A;  4EBA A;  3PRZ A;  4GCO A;  1N4P A;  3ZPJ A;  2PM6 A;  4I9C A;  3P1U A;  3V2X A;  2L9B A;  4U07 A;  3MJW A;  1TN7 A;  4XIF A;  3CVV A;  4DRX E;  3ONK A;  3T5X A;  4MBG A;  2ZGD A;  3JUE A;  2V8S E;  3CVQ A;  2IFU A;  4N5Q A;  3TWX A;  3DST A;  3J5P A;  4M3O A;  1OCC E;  4NAC A;  1OXJ A;  2IO3 C;  2HM8 A;  5ENN A;  5HI7 A;  1H6P A;  4E6H A;  4K5A B;  4PUC A;  1B89 A;  2XGM A;  3R7R A;  1Y6I A;  3O48 A;  3E30 A;  1FT1 A;  2GRP B;  2L6J A;  4BT8 A;  2R03 A;  2X6H A;  2YIN A;  5B1A E;  1ZU2 A;  4ANU A;  2RFM A;  4GPM A;  4OVU A;  5JJ6 A;  3NQP A;  1NL4 A;  3UT7 A;  4HI9 A;  1TR4 A;  2EIM E;  3ASG A;  2JAB A;  1WG0 A;  3ZHE B;  4L9P A;  5JHB A;  3FFL A;  4U0U A;  1BPO A;  4GZ5 A;  5BV1 A;  3CVN A;  2UY1 B;  1A17 A;  1UG3 A;  3ZRH A;  4GA2 A;  2FF4 A;  3V30 A;  4DLO A;  2F8X K;  4AXH A;  4UQX A;  3FWV A;  3CHS A;  3FUL A;  4TXP A;  3V31 A;  4AY6 A;  1BI8 B;  5LOZ A;  3U4T A;  2X6F A;  2KZT A;  3HDX A;  1BU9 A;  3MZL B;  1HX8 A;  3FU5 A;  4H7Y A;  4UI9 J;  2Y3A A;  2HYZ A;  5E75 A;  1O5M A;  1MX6 A;  3MYV A;  2FI7 A;  4LNG A;  3FTZ A;  1NZN A;  2VGX A; 
#chains in the Genus database with same CATH homology
 4RG6 A;  3MV2 B;  3VLE A;  3EHM A;  3CKB A;  2VSN A;  3I5P A;  1OWM A;  4CCA A;  3EIQ C;  3Q47 B;  3WXX A;  4CGW A;  3FUE A;  2GW1 A;  4UI9 C;  3L54 A;  2BTD A;  4D10 C;  3PEV B;  2CG3 A;  3PUK A;  3IKO B;  2ILR A;  4I1M A;  5FZS A;  2QFC A;  2NXP A;  5DBK A;  2VSX E;  3CV0 A;  4JHK A;  4PS3 A;  1HU3 A;  1H0A A;  4MLP A;  5ARG A;  1HFA A;  3LY8 A;  4CT0 A;  2J9Q A;  3QDN A;  5BPP A;  3D9N A;  4NUR A;  4KYO B;  3CSF A;  4URK A;  5ARF A;  4UQZ A;  5FZR A;  1ELK A;  1ZBP A;  4WNG A;  3S7F A;  2PQN A;  2CFU A;  1QQE A;  5G55 A;  4N3A A;  4G25 A;  1PY1 A;  4U04 A;  2GGF A;  4J8E A;  2LSU A;  4C9B B;  2LSV A;  4I1A A;  5ANR A;  3EJN A;  5BT1 A;  3T8M A;  2I2O A;  2CG2 A;  4LRZ A;  2KC7 A;  3PNL B;  3RIB A;  3IHY A;  3SZ7 A;  3CST A;  3I4G A;  1X5B A;  2IJG X;  4ILH B;  1IHG A;  4B89 A;  4RVB A;  2XQ0 A;  2IOL A;  4HOU A;  5LCW J;  2AVP A;  5KJM A;  3VTX A;  3TL5 A;  5T8I A;  2FUL A;  1E8X A;  2X6I A;  3GZ2 A;  5CMW A;  4I1O B;  3SF4 A;  1UJJ A;  3ZYL A;  2A5U A;  3ENE A;  3CVW A;  2XPY A;  4FLB A;  2XCB A;  4EZJ A;  2KM4 A;  3CHQ A;  1ELW A;  1YA0 A;  3OAW A;  4GZ3 A;  3CLJ A;  3FUJ A;  4U0S A;  4GA1 A;  3CQC B;  2VGX B;  1HO8 A;  1IQR A;  1JWG A;  3U66 A;  4L1B A;  2E0I A;  4GAA A;  3JQ1 A;  4ILI A;  3RRU A;  1E96 B;  5LCW C;  4AP2 A;  3LKU A;  4DI4 A;  2C0M A;  2WVI A;  3KS2 A;  1INZ A;  3FTX A;  2WXN A;  4KZC A;  4NRH B;  3RRN B;  4E85 A;  4J8F A;  3SNX A;  4BT9 A;  3PEU B;  4Q94 A;  4CEM A;  3TG5 A;  3FUK A;  1HF8 A;  2PQR A;  2WXR A;  2PM7 A;  3FTS A;  3TGO A;  2WXI A;  3PRE A;  3ULQ A;  3RJV A;  1OWN A;  2WXG A;  3EIJ A;  3ONL A;  5CHE E;  3U64 A;  2JEK A;  3Q5M A;  1H6K A;  3FH8 A;  4UWK A;  4WNF A;  1DVP A;  2WXJ A;  3Q15 A;  3RKV A;  3KAE A;  1QZ2 A;  2C2L A;  4RG9 A;  5T4Y A;  4C0M A;  4F3V A;  4UWL A;  3OTN A;  1HE8 A;  2WXQ A;  2XPI A;  2WXO A;  3AS5 A;  4FHK A;  4HOR A;  3U3W A;  3MGB A;  3UT8 A;  2XGO A;  1FVH A;  3GYZ A;  4WUY A;  3PVL A;  1ELR A;  4KVO A;  1KLX A;  5FQ6 A;  4AVX A;  4FC8 A;  2WXL A;  3AS4 A;  2YNQ A;  3ASH A;  5FZQ A;  3B13 A;  5LFA A;  4F7A A;  5EDS A;  2J08 A;  3FHE A;  4N2Q A;  2VSO E;  2YHE A;  1EPU A;  3PUJ A;  4FHJ A;  4DJA A;  4EZL A;  2DCP A;  2OOE A;  3FP3 A;  2LAH A;  4WWN A;  5FQ8 A;  1N54 A;  2IF4 A;  3MCX A;  4L23 A;  4I6G A;  3D9M A;  1TJF A;  2VTB B;  4GU5 A;  4WND A;  3HYM B;  3QWW A;  4DI3 A;  1L5J A;  3MKR A;  3PDN A;  1E7U A;  3CHM A;  5AIJ A;  4YVO A;  3L16 A;  2I1K A;  3ML8 A;  4Q69 A;  2HR2 A;  1U3D A;  3FEX A;  3OXG A;  2VYI A;  3ZYM A;  3AU4 A;  2X3M A;  3CIA A;  1HXI A;  4APO A;  3PE4 A;  3LEW A;  4H7X A;  3RRM B;  4BSX A;  4PS7 A;  3NZU A;  1PC2 A;  3B7R L;  4G26 A;  4F1S A;  3O4Z A;  2IU1 A;  4I17 A;  4JA9 A;  1EYH A;  3FH5 A;  3GZS A;  3UT4 A;  4BX9 A;  2VJ8 A;  5HQ8 A;  4TV3 A;  1OUV A;  4MRU A;  3G2U A;  3FTV A;  3ZYQ A;  5G04 C;  1KT1 A;  3BG0 B;  1EDU A;  3AS8 A;  3B7U X;  5FTP A;  2HO1 A;  3KD7 A;  1PAQ A;  1H2V C;  1OWL A;  3LS8 A;  2QY7 A;  4FJZ A;  4JEH A;  3FU3 A;  2LNI A;  5AJD A;  3RO3 A;  2BUG A;  2WMN A;  3CHR A;  3QOU A;  3TG4 A;  4OYS A;  4AY5 A;  3CQG B;  4KMO A;  5KJN A;  1E8Y A;  4FJY A;  3VLF A;  3FUM A;  4J6I A;  4N5C A;  2RG8 A;  4I6E A;  5FJY A;  3ZIM A;  3PZD A;  3ZYK A;  4CGV A;  3ZXS A;  2PZI A;  1N52 A;  4WNE A;  4EPZ A;  3GZ1 A;  2KZT B;  3QAR A;  3S7D A;  3TXM A;  5JJT A;  2FEZ A;  1HG2 A;  1HZ4 A;  2NC9 A;  2Q7F A;  5KJL A;  2OND A;  2RD0 A;  2XRZ A;  3FTW A;  3CK7 A;  1NA3 A;  3CVP A;  2I6H A;  2UY1 A;  3D9I A;  4YVQ C;  3LY7 A;  2WXM A;  4BTB A;  4JA7 A;  2X6K A;  1JPL A;  4BX8 A;  2XRY A;  1MQS A;  5C1D A;  2X6J A;  5AJL A;  2PL2 A;  3LYA A;  3SI5 A;  3D3M A;  3FUI A;  4KVM A;  3UPV A;  1OWP A;  3BEE A;  2OVB A;  3FUH A;  5ANL A;  4K0R A;  3IEG A;  5FQ4 A;  4BY6 A;  3JYS A;  3OXL A;  4PH4 B;  3VLD A;  1WM5 A;  2VQ2 A;  5FQ7 A;  4LUN U;  4KBQ A;  1S0P A;  4JHJ A;  4WWO A;  3ZN3 A;  4P29 A;  4EEC A;  3HVE A;  1IQU A;  2YHC A;  3ML9 A;  4FAD A;  4APF A;  4NQ0 A;  1SQM A;  3G2W A;  3QB2 A;  4JXT A;  1VDY A;  2Y4U A;  1UW4 B;  4ME2 A;  4CT4 A;  2I1J A;  2X38 A;  4IUL A;  5LX8 A;  3UX4 A;  1Z6T A;  2GRL A;  3FEY A;  4EZK A;  2V4L A;  4GCN A;  3QJZ A;  4G23 A;  4CDM A;  4QFV A;  3T5V A;  3APF A;  4GPK A;  2FO7 A;  4IN3 B;  4A1G A;  4A1S A;  5J90 A;  4UWH A;  2YQ8 A;  4F53 A;  3UQ3 A;  4A3T A;  4HXI A;  4DPR A;  4I9E A;  3QKY A;  2OV8 A;  2XEV A;  3L17 A;  3UUX A;  3URZ A;  4GB9 A;  4B94 A;  3LPZ A;  3RK6 A;  4DK5 A;  3VTY A;  4HVB A;  3U9W A;  3HIZ A;  4A55 A;  3NF1 A;  5D0O D;  4Y6W A;  4B8A A;  4BFR A;  4ANV A;  1IYG A;  2WXK A;  4L2L A;  4ANW A;  3QWV A;  2CHZ A;  3IHV A;  4JL0 A;  1TEZ A;  4B0Z A;  3SFZ A;  1QNF A;  2AXU A;  4XKC A;  4GYW A;  4ACK A;  4AOF A;  2CHX A;  3PH0 C;  3D9O A;  3LJ3 A;  3D9P A;  2EQX A;  4KXK B;  4ANX A;  4GZD A;  4JHR A;  2AW6 A;  4W9R A;  4J8D A;  3I4R B;  4AM9 A;  3S7B A;  3CGH A;  4GZC A;  3MEK A;  3QNK A;  4MKT A;  3G2T A;  5BW8 C;  2R5S A;  2WB2 A;  1E8W A;  3RO2 A;  4TUU A;  1GW6 A;  5AYW D;  3IV0 A;  4MS6 A;  4U0Z A;  5D0Q D;  4EBA G;  2M63 A;  3C98 A;  5CCL A;  2IQC A;  4AEZ C;  1H2T C;  2J07 A;  2A4Z A;  4YND A;  4J0U A;  5EKQ D;  1E7V A;  3OXF A;  5CMY A;  1NA0 A;  2L0T B;  4Y6C A;  4UI9 K;  2LO6 A;  3HVE B;  4HOQ A;  3E4B A;  4JEU A;  4CRW A;  3D9L A;  3APC A;  1Z3Y A;  2XHE A;  4XX5 A;  2WPV A;  3LVR E;  4WWP A;  4I2W A;  5EX3 A;  3FTY A;  4AIF A;  4HLE A;  1E90 A;  1U3C A;  2DIW A;  2KCK A;  4GML A;  4N39 A;  5G04 J;  5A7D B;  3HHM A;  2MRI A;  4OVV A;  5BV0 A;  4C0E A;  4ABN A;  1UN8 A;  4ILG A;  3IBE A;  2V5F A;  2XCC A;  3RU0 A;  1KT0 A;  3N71 A;  4RSY A;  3JUI A;  5G2N A;  3TAX A;  4ACL A;  2R17 C;  4LCT A;  4EBA A;  1HS6 A;  2E2E A;  3FDH A;  3PRZ A;  2KCL A;  4GCO A;  3B7T A;  3CVL A;  2J4B A;  1FVF A;  3Q4A B;  3DBS A;  4XZ4 A;  1WY6 A;  3ZPJ A;  2PM6 A;  5JHA A;  3TJP A;  4G24 A;  3P1U A;  4I9C A;  4GZ6 A;  3CVX A;  3UMV A;  3PS6 A;  1XNF A;  2AXZ A;  3CK9 A;  3S7J A;  4GYY A;  3CR3 A;  3ZW3 A;  2L9B A;  2IOS A;  4V3I A;  5M72 A;  3GW4 A;  4U07 A;  5A6C A;  3FU0 A;  3MJW A;  4XIF A;  3CVV A;  3ONK A;  3LVQ E;  2KAT A;  2ZU6 B;  3T5X A;  3ZEF A;  3L6A A;  2CHW A;  2V8S E;  3CVQ A;  3SBT B;  2IFU A;  2R59 A;  3EDT B;  2MOW A;  4J8S A;  3ZGQ A;  4U63 A;  4EQF A;  4FP7 A;  4M3O A;  4FA6 A;  1MHQ A;  5KJK A;  3ZHE A;  4NAC A;  2P58 C;  3TXN A;  1LF8 A;  3APD A;  3ESK A;  4XE0 A;  1EF1 C;  4R7L A;  2HM8 A;  3QWP A;  2VGY A;  5ENN A;  3R7Q A;  1Z3X A;  1DNP A;  3B7S A;  3D9J A;  4HS2 A;  5HI7 A;  4B8C B;  4I6J A;  2AWI A;  2VSY A;  3PNT B;  2WXP A;  3MKQ A;  4E6H A;  4G11 A;  1XGW A;  4HFG A;  4PUC A;  1B89 A;  2XGM A;  4HOT A;  2GRM A;  2DBA A;  4JVS A;  3G2S A;  3P2B A;  3CEQ A;  5FWQ A;  3R7R A;  1Y6I A;  3MX3 A;  4XKB A;  3ESL A;  3O48 A;  2J09 A;  3FY4 A;  4FUL A;  2ION A;  4FU3 A;  4DLQ A;  1UJK A;  3L08 A;  2FBN A;  2WXH A;  4L7T A;  2L6J A;  4BT8 A;  2J49 A;  1NP7 A;  2I9C A;  2V0P A;  4XI0 A;  2X6H A;  2WM9 A;  2YIN A;  3CVY A;  1ZU2 A;  4JPS A;  4ANU A;  4UWF A;  3ASF A;  5AEN A;  4PDX A;  2WMO A;  3BG1 B;  4GYO A;  1SZ9 A;  3G2V A;  5JJ7 A;  3FUF A;  3NZS A;  2KCV A;  4OVU A;  3EHN A;  3LXU X;  3QK0 A;  3L13 A;  5JJ6 A;  3ASD A;  4N3C A;  2WQ6 A;  3QC1 A;  2OVF A;  4CDN A;  2CFZ A;  4G2V A;  2VTB A;  3SGH A;  3NQP A;  4UQY A;  4AV7 A;  3UT7 A;  2LAI A;  4Q96 A;  3CVU A;  3SHF A;  4A3V A;  4I2Z A;  3LCA A;  4O6F A;  5A23 A;  5C2Y A;  2L0I A;  4UWG A;  3ASG A;  5LP0 A;  4I43 A;  3ZHE B;  4BWR A;  1H2U A;  5JHB A;  3FFL A;  1FCH A;  3D9K A;  4GMJ A;  2Y4T A;  4U0U A;  4U8H A;  3SD5 A;  1BPO A;  3LDZ A;  4GZ5 A;  4IYP A;  3JCK C;  3FUN A;  3CHO A;  5BV1 A;  1TJC A;  3CVN A;  4XI9 A;  5E76 A;  2UY1 B;  4N3B A;  3FUD A;  5KCM A;  1A17 A;  2BF0 X;  4AJW A;  5EX0 A;  1UG3 A;  3MKQ B;  3ZRH A;  4GA2 A;  2FF4 A;  3QAQ A;  2C0L A;  1HG5 A;  2UWJ G;  4FLH A;  4DLO A;  4KT6 B;  4N2S A;  4AXH A;  4UQX A;  3PE3 A;  5BNW A;  2WQ7 A;  1Y8M A;  2XPZ A;  4GA0 A;  4JZY A;  5T3R A;  3FWV A;  1P5Q A;  1W3B A;  3CHS A;  4WAF A;  1HH8 A;  3JQ0 A;  3LY9 A;  4JC8 A;  5FT9 A;  3MV3 B;  5CCM A;  4L2Y A;  1JWF A;  3FUL A;  3R9A B;  2MHK A;  4ATG A;  2WQH A;  1SZA A;  3ZVV A;  4JW1 A;  3DPD A;  2WXF A;  1JUQ A;  3AU5 A;  4AY6 A;  4KZ0 A;  5G05 J;  4G1T A;  3CK8 A;  3CHP A;  4IRU A;  4CDR A;  5LOZ A;  5BUZ A;  3U4T A;  2X6F A;  2KZT A;  3HDX A;  2JLB A;  4LEU A;  3FU6 A;  1E8Z A;  1H19 A;  3MA5 A;  3FH7 A;  3MZL B;  1OWO A;  5J08 A;  1HX8 A;  1UN9 A;  1WAO 1;  3FU5 A;  2AXV A;  4H7Y A;  3S2A A;  4PS8 A;  4UI9 J;  2Y3A A;  2HYZ A;  3I3N A;  3K9I A;  5E75 A;  4LER A;  2NSZ A;  5DIZ A;  3ZFW A;  3CKC A;  3MYV A;  3Q49 B;  2XGS A;  3SBS A;  3L22 A;  2FI7 A;  5G05 C;  4BTA A;  4K03 A;  3FTU A;  4HOS A;  2J4D A;  3FTZ A;  3KEZ A;  1NZN A;  2VGX A;  4TRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...