1PC2A

Solution structure of human mitochondria fission protein fis1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
b'MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mitochondria fission protein
publication title The Solution Structure of Human Mitochondria Fission Protein Fis1 Reveals a Novel TPR-like Helix Bundle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 40
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1pc2A00
4AY6A 2FBNA 1HXIA 4U07A 1W3BA 4N39A 2XEVA 4RG6A 5ARFA 3ZHEB 2GW1A 4G24A 4BTAA 2LSUA 3RO2A 3ZFWA 1QZ2A 3MEKA 4XI0A 2I6HA 3SZ7A 3QKYA 4U0SA 5CHEE 3ZGQA 2FEZA 3OXFA 2VQ2A 4UQYA 4KXKB 4JL0A 4UI9K 5D0OD 2V5FA 3CK7A 1HZ4A 3ASGA 3U3WA 3CVNA 5DBKA 2MHKA 4KYOB 4GZ6A 2XGOA 3MA5A 3R9AB 3RKVA 3ULQA 3O48A 5FZQA 1A17A 4N3CA 5JJTA 3GW4A 2VGXB 3PE4A 5EX3A 4UQXA 2NC9A 4GA1A 3WXXA 1WAO1 3Q49B 4HOSA 2L6JA 3ESKA 3LY8A 4H7YA 4H7XA 4BT9A 3CVLA 1KT1A 3CVPA 3AS5A 1KT0A 3JYSA 1ZU2A 2FI7A 5ARGA 4JA7A 4N3AA 3VTXA 4HOUA 5A7DB 4GA2A 2PQRA 3QWVA 3MKRA 5CCLA 3QOUA 2KCLA 2PZIA 2C0LA 2HO1A 2IFUA 3LY9A 1B89A 4J8DA 3K9IA 3BEEA 5G04J 1IYGA 4U0ZA 4A1SA 2HYZA 3MV3B 4WNGA 1NA0A 3MV2B 1IHGA 2VSYA 3CK9A 2YQ8A 5M72A 4AM9A 1ELWA 4GYOA 2OOEA 2HR2A 2Y4UA 3KD7A 2XCCA 3CKCA 5D0QD 3S7DA 4GPKA 4KBQA 4N3BA 5G05J 2XGMA 4BT8A 2KCVA 3LY7A 5HQ8A 2XCBA 5KJMA 4EQFA 4YNDA 3GZ1A 4WUYA 4G26A 5KJKA 4BWRA 5FTPA 3ZN3A 1XNFA 5A6CA 4BTBA 4N5CA 3LYAA 4G23A 5G04C 2AVPA 4U0UA 3RU0A 4G1TA 4UQZA 4GA0A 5EKQD 4I17A 3QWPA 3TG4A 2PQNA 1KLXA 4I1AA 3ZPJA 4Y6WA 5BT1A 4JHRA 4LEUA 1NZNA 1ELRA 4WNDA 5DIZA 4I9CA 3CK8A 3UPVA 5G05C 3UQ3A 5FZSA 4XIFA 3PDNA 1ZBPA 4N2QA 3LPZA 3TAXA 2LSVA 5KJNA 3LCAA 2DBAA 3Q47B 2ONDA 5C1DA 3PE3A 4Y6CA 3RO3A 2UY1A 1PC2A 1QQEA 3IEGA 3CKBA 3CV0A 2Q7FA 3FFLA 2JLBA 4J0UA 4YVOA 3OXGA 4GYWA 2J9QA 3HYMB 4IN3B 1WM5A 2YHCA 4I2ZA 2IF4A 2VGYA 3KAEA 3FWVA 2WQHA 4ABNA 4CDRA 3E4BA 4AY5A 1NA3A 3SF4A 3EDTB 2VGXA 4F3VA 3UUXA 3AS8A 4GYYA 1Y8MA 4W9RA 2C2LA 4NRHB 2BUGA 3ASFA 5JJ7A 3URZA 5HI7A 2FO7A 5BW8C 4GZ3A 3N71A 4RG9A 3AS4A 2E2EA 3TG5A 2KATA 3TGOA 3CEQA 3QWWA 2Y4TA 3KS2A 2P58C 4GCNA 4WNFA 3RJVA 4UI9J 4G25A 3S7FA 4XI9A 5CCMA 4N2SA 4AIFA 3QDNA 1OUVA 4APOA 2UWJG 5FT9A 1P5QA 4YVQC 2WPVA 4J8EA 2VSNA 4HOTA 1HH8A 5LCWJ 4G2VA 4NQ0A 2UY1B 2VYIA 1FCHA 3ZHEA 3S7BA 2R5SA 3LKUA 2C0MA 2PL2A 2QFCA 4I2WA 2KCKA 4UI9C 3FP3A 4ME2A 1YA0A 3GZ2A 5FJYA 3ASHA 3GYZA 3U4TA 1TJCA 4HORA 3Q4AB 3NF1A 1E96B 5AYWD 5JJ6A 3RIBA 4WNEA 5BNWA 4I9EA 3VTYA 4B94A 4JA9A 4GCOA 4O6FA 3S7JA 5LCWC 2XGSA 2KC7A 4CGWA 2LNIA 5EX0A 2XPIA 3Q15A 3Q5MA 4CGVA 5KJLA 3ASDA 2FF4A 4HOQA 3OXLA 5FZRA 4J8FA 4GZ5A 3CVQA 4U04A
chains in the Genus database with same CATH superfamily
4YDOA 4AY6A 4U07A 3KEAA 4GTRA 3P2BA 1ELKA 3E37A 3T5XA 3PRZA 2CHZA 2XEVA 3NOCD 5ARFA 1K3ZD 4IULA 1FT2A 5AQ9A 2RFMA 3OTNA 4U0SA 4FU3A 5CHEE 4ANVA 2AW6A 2X6HA 3AJIA 4XX5A 2WVIA 1UW4B 2B0OE 4TXQA 2KXPC 3FU0A 2L6BA 2CFZA 4UQYA 3FH8A 4GTOA 5D0OD 2KM4A 3FULA 4OVVA 1H0AA 3CK7A 1TNZA 1HZ4A 1O5MA 2CG3A 4OAUC 5AQBA 3QB2A 3DSSA 3G2VA 3TWSA 4PH4B 4KT6B 4B0ZA 1JWFA 3RKVA 3GZSA 3BUAA 3O48A 1RW2A 1A17A 4N3CA 1LD8A 2XRZA 2QZAA 3EUVA 2FO1E 4GA1A 1WAO1 1TN7A 3Q49B 4HS2A 2A5EA 2P9KG 4HOSA 3AG3E 3LY8A 2LAIA 2DVWA 4JB8P 3UXGA 3CVPA 3APFA 1ZU2A 3PNTB 3IXEA 4G8KA 3PEUB 2IQCA 4JA7A 4HOUA 1IKND 4DRXE 1WY6A 3QWVA 3MKRA 2ETCA 2QYJA 1N0RA 3ZYQA 2PZIA 3DSTA 2P9PG 2HO1A 3R7QA 4C0EA 1N4SA 4U0ZA 2HYZA 1SQMA 3L22A 2X6FA 2VSYA 5EN5D 3ABME 2B6CA 5M72A 3EHNA 3TWXA 3TJPA 2WQ6A 4J8SA 4MLPA 3L82A 2Y4UA 3MZLB 1X5BA 4JEUA 5FIOA 1OY3D 4KBQA 1YMPA 3ZKJA 4A3TA 1Q2ZA 1WG0A 2KCVA 5HQ8A 3PZ2A 2QYUA 1D8EA 2J4DA 2P9UG 4EQFA 4WUYA 3TWQA 2R2LA 4DUIA 4G26A 5AAOA 4Q96A 4KZ0A 5FTPA 2Y0BG 4TV3A 3D9IA 4GTQA 4N5CA 2MOWA 4AP2A 3D9KA 3SHFA 4U96D 1SVXA 2DWZA 3SFXA 2P9SG 1BPOA 1JCSA 3FUKA 4AV7A 4I17A 3TG4A 2PQNA 4I1AA 1SA4A 3LJ3A 2P9NG 4RVBA 4B8AA 3UPVA 2IONA 1N11A 4DX5D 2L0TB 4FJZA 5JHAA 2LSVA 3VLEA 2E0IA 2DZNA 3V30A 4BFRA 2LXLA 3FTVA 3PE3A 2WXIA 2A5UA 3UIOC 5ANLA 4FC8A 3BG0B 3L6AA 3Q9UC 4YVOA 2RG8A 3HXBA 2IO2C 4JZYA 3HYMB 4I2ZA 4V3IA 4DX1A 5JHBA 2XPYA 4MRUA 3FWVA 5JMND 4ABNA 2WXMA 2AXZA 1BI7B 4ACLA 3P1UA 4GYYA 2H6HA 5EDSA 4OYSA 3PVLA 5JJ7A 5HI7A 5BV1A 2WXKA 4ATGA 2V0PA 3N71A 4GZ3A 3SBTB 3ZVVA 2JABA 2EILE 2WXFA 1H2VC 4K5BA 1N52A 2GRQB 3I4GA 4DI3A 4GTMA 4U8YD 4NACA 4EECA 4HXIA 1YYHA 3QDNA 2AXUA 2XRYA 4AOFA 1EF1C 3D9HA 4GMRA 1WDYA 3BG1B 1P5QA 2XQ0A 4FJYA 2WMNA 3VLFA 3UM3A 4EZKA 1FT1A 5B1BE 2HE0A 4L7TA 3U9WA 4BESA 3HXCA 5LCWJ 2UY1B 4R7LA 4LG6A 3ZHEA 3S7BA 2R5SA 5EYPF 4DLQA 5T3RA 4L2YA 2M63A 3OAWA 3FUMA 2PL2A 4UI9C 3EJNA 3FP3A 3B7TA 1JCRA 1ZB1A 3D9NA 3KSLA 4RSYA 1FVHA 3SI5A 2IOLA 4EBAG 1JWGA 3JXIA 1Z6TA 3U4TA 3Q4AB 3NF1A 4EHMA 1N0QA 5JJ6A 4LNBA 4L1BA 1NP7A 3C98A 5BNWA 3VTYA 3V2OA 4DX2A 3PREA 3RK6A 4FP7A 3Q75A 3UKUG 2AJAA 4I6EA 5LP0A 4BX9A 2QY7A 3QJZA 3DEPA 3C3OA 3C5RA 4DX7D 5EX0A 2OEWA 5EIDA 5CERB 4J8FA 2I1KA 4ANXA 4FADA 4GTSA 3RRUA 3TWVA 4N39A 3I5PA 2L9BA 5BV0A 4LERA 3ONKA 4DK5A 4B8CB 4G24A 1TN6A 3ZYLA 1BLXB 3RO2A 1QZ2A 3ZFWA 3MKQB 2I6HA 3MX3A 4ACKA 3QKYA 4FHKA 4QFVA 2H6FA 3LS8A 1OXJA 2Y1LE 2RFAA 2VSOE 4YDWA 2OV8A 1N94A 2IEJA 4HRMB 2PM7A 2R03A 4MBGA 4UWLA 1INZA 4J8YA 3CVNA 2J07A 2VSXE 3L17A 4P29A 2MHKA 4CZ2D 4BSXA 3R9MA 3AU4A 4EZLA 3T9KA 3ULQA 2EIKE 5E75A 4RQIA 3UM0A 5FQ4A 3GW4A 2VGXB 3L54A 1D9SA 3D9MA 3UKRG 3UT7A 3WXXA 4O1PA 5EYLA 4LSZE 3ESKA 2GRMA 3ENEA 3JQ1A 4GMJA 5LFAA 4BT9A 2X6KA 3DSVA 2FI7A 1TEZA 4GU5A 2KZTA 4N3AA 3TXMA 3S2AA 5G55A 5A7DB 2DZOA 2PQRA 1TNOA 1MX4A 2C0LA 3FU5A 2BEDA 4RLYA 1B89A 1UJKA 4J8DA 3BEEA 2I1JA 5G04J 3J5PA 1BU9A 2H6GA 1IHGA 2NSZA 3C3QA 4M3OA 5HRYA 3FUJA 4AVXA 3PH0C 1LTXA 2V4LA 2XZTG 4GYOA 2WXQA 3KEZA 4CT0A 4HI8A 3UM1A 3FTZA 4A1GA 5D0QD 4ANWA 4CYMD 4C0MA 3S7DA 4GPKA 2BKKB 3RRNB 2XZDG 5G05J 2R02A 5ITZF 1SA5A 3GZ1A 4UWGA 5LOZA 1JCQA 4BTBA 4AEZC 2KBXA 3HHMA 2F0YA 4U0UA 3ASNE 3RU0A 4MKTA 3MJWA 4JC8A 4JW1A 3HXDA 1H2UA 1OCRE 3V31A 5EKQD 2V4HC 3JXJA 3NZSA 3T8KA 5FINA 5J08A 4JHRA 4LEUA 3ML9A 5BUZA 1QBQA 2GROB 3LXUX 4I9CA 3J5QB 1MQSA 4LCTA 4CCAA 3ESLA 4JHKA 5FQ7A 3MKQA 4UUCA 3CHOA 4XIFA 3LPZA 3TAXA 4G8LA 2J09A 1S0PA 3TWTA 3SBSA 4KVOA 3UI2A 4FLHA 1U3CA 1JPLA 3TXNA 1FPPA 4XZ4A 2WXJA 4I6JA 4U7EB 1PC2A 1QQEA 3ABLE 4QQIA 3CV0A 1TNBA 3FFLA 2JLBA 4AJWA 2R05A 1OCOE 3PUJA 4J0UA 3B7SA 4GYWA 2J9QA 4IN3B 1H6PA 1UJJA 2IF4A 2VGYA 3KAEA 1K8KG 1TR4A 1BI8B 4GAAA 4TXPA 4HLEA 4AY5A 3UT8A 3SF4A 4APFA 3IKOB 3EDTB 2VGXA 2OCCE 2R17C 4F3VA 3V2XA 2GRPB 4NRHB 3ASFA 3PNLB 1E90A 3PEVB 4TRQA 3L9TA 3EHMA 3JUEA 2FO7A 1AWCB 5BW8C 3E33A 3PS6A 4WWPA 2YHEA 3U64A 2WXRA 3Q73A 3AS4A 1V54E 2WB2A 4PS7A 2DCPA 3E34A 1H2TC 3QWWA 1S70B 2P58C 3ZYKA 5ENRD 3RJVA 3TWWA 3SFZA 4N2SA 4L2LA 2XS1A 4APOA 2RD0A 4PDXA 1YCSB 1N4PA 2NYJA 3B7BA 3EHQA 2FULA 4J8EA 3QK0A 2GRNB 3FTSA 3PZ4A 1HH8A 2AWIA 3LVRE 1E8XA 1NFIE 5E76A 3MCXA 5EILA 4BSZB 1FCHA 4XE0A 1MJ0A 3G2UA 4HRNA 1YA0A 3GZ2A 3HVEB 5FJYA 3SQVA 3ASHA 3GYZA 1Z3YA 4F1PA 1N4RA 4F1SA 5CMYA 3RIBA 2ZU6B 5G2NA 2XEEA 1IHBA 3IBEA 5LCWC 3DXMG 3FEXA 2XGSA 4F7AA 4ILHB 4U8VD 4CGWA 3FDHA 4DPRA 4O60A 1QNFA 3B7UX 3B7RL 2IJGX 3BQOA 4EPZA 1DVPA 4CT4A 5T4YA 5CRVA 3IHYA 3Q5MA 3APDA 4CGVA 1OCCE 5B1AE 3C72A 4CEMA 4L9PA 2FF4A 4BEPA 4LUNU 4U63A 3OXLA 5FZRA 3AG4E 3CVXA 3EIJA 4CDNA 1W3BA 4EBAA 2WMOA 4BTAA 2LSUA 2I2OA 1Y6IA 3MEKA 4JHJA 3SZ7A 3EIQC 4HI9A 2LUHA 2IO3C 4GB9A 1TJFA 2BKGA 4UWHA 5AJLA 5ENTD 3SGHA 2J49A 3HDXA 2FEZA 3ZXPA 1GW6A 3CLJA 5CMWA 4GZDA 4KXKB 4JL0A 4UI9K 1OCZE 3F6QA 2V5FA 3UTMA 3G2WA 1HG5A 4D10C 3L16A 4PUCA 4I1MA 1S63A 3U3WA 2CG2A 4HVBA 3QC1A 2VJ8A 3FUNA 4KYOB 5EIBE 3E32A 4GZ6A 3R9AB 2A4ZA 5FZQA 5EX3A 4UQXA 2NC9A 4FHJA 4JPSA 4MS6A 4KZCA 3DPDA 5ENNA 2Y3AA 4H7YA 4H7XA 3V79K 1KT1A 3ZYMA 3AS5A 2X6JA 1MX2A 2IOSA 2XENA 4UWFA 5ARGA 1IQRA 1IQUA 4TUUA 3CSFA 3VTXA 4GA2A 4B89A 1O1TA 4BETA 5CCLA 5FQ8A 2P9LG 4E6HA 3JCKC 3HVEA 4GTTA 1V55E 3ULYA 2ZGGA 2Y69E 4A1SA 3MV3B 5C2YA 1NA0A 3DSXA 3FTYA 3FU6A 3CK9A 4FA6A 2YQ8A 2ZIRA 4DLOA 3JUIA 4FULA 1ELWA 3FUEA 3T5VA 2OOEA 3DPYA 2XCCA 4NIKA 3RRMB 3CHPA 2J08A 4N3BA 1UG3A 3CVVA 4BT8A 3LY7A 5KJMA 4YNDA 3C3RA 1UN8A 4A55A 3UX4A 3FEYA 4BWRA 3ZN3A 1KZPA 3QARA 1HS6A 5A6CA 3AG1E 4J7WA 3CHQA 4IRUA 5G04C 4GTVA 3D9PA 4AXHA 3MYVA 1O1SA 5HS0A 3DEOA 4G1TA 4UQZA 4GA0A 2PNNA 2WXLA 4ZFHA 5CECB 1HU3A 3QAQA 3ISMC 3ZU7B 5BT1A 3D9OA 1HF8A 4WNDA 5DIZA 4ATZD 3CVWA 2LO6A 2ILRA 3NB2A 5G05C 2EIME 5ENQD 5FZSA 3Q79A 3PDNA 1ZBPA 3ULEG 4EZJA 3X2QE 4OAVB 4O1OA 4JD2G 3CVUA 1KZOA 2DBAA 4ILGA 2ONDA 5KNHD 3IV0A 4Y6CA 1VDYA 3RO3A 2UY1A 3CKBA 5AQ7A 4KVMA 3ZXSA 5KWDA 4TXRA 5AARA 1WM5A 3L08A 4JEHA 1S64A 2WQHA 3E4BA 1NA3A 3UUXA 3AS8A 3UT4A 1Y8MA 5AENA 4W9RA 4UWKA 5AN8A 3HIZA 3EU5A 4WWNA 3TG5A 3WG7E 3TGOA 3CEQA 5ENSD 4WNFA 3MGBA 1IXVA 4G25A 1TNUA 5CCMA 1H6OA 4ILIA 3HXFA 2XEHA 2CFUA 2F37A 2IY0C 1MHQA 4HLLA 2WPVA 4F53A 2VSNA 3CSTA 3ABKE 3AAAC 4M7CA 2ETBA 5AIJA 4GTPA 5KBAA 3ZNGA 5D66A 2J4BA 1FVFA 4GZCA 3TL5A 2QFCA 3D3MA 2CHWA 4ME2A 4B93B 3APCA 3DWLG 1HX8A 3SFYA 2WXNA 5B3SE 4DI4A 4HORA 4A63B 4ANUA 1E96B 5AYWD 5CEAA 2YNQA 1SZAA 3HRAA 2WXOA 1UOHA 4Q69A 2EIJE 4JA9A 1U3DA 1UN9A 2DYSE 3S7JA 1H19A 1OWNA 4KMOA 2WXHA 2WXGA 4JVSA 3VLDA 5CBOA 2XPIA 1DCQA 4ZHBA 1TNYA 1LD7A 1PY1A 3Q15A 3SNXA 5LX8A 2VTBB 4N5QA 3KSQA 3O4ZA 1JUQA 1N95A 4X8QA 5FQ6A 3CVQA 4U04A 1BD8A 3PZ1A 3ONLA 2PM6A 3QNKA 2FBNA 4IYPA 1HXIA 1OWPA 3SY2A 2LAHA 1EDUA 1EYHA 3I3NA 1N4QA 4RG6A 3ZHEB 2GW1A 3FH7A 4XI0A 1QYMA 4HFGA 3PUKA 1KPSB 3LJNA 2MYOA 3ZGQA 4XEIG 5ENOD 3OXFA 4K03A 2VQ2A 5CRUA 5BXUA 4YDEA 3Q9NC 1HG2A 3W9GA 2R59A 2GRLA 4NURA 4U8HA 3ASGA 3B95A 4I1OB 5DBKA 4GPMA 1X81A 2IU1A 2JEKA 2XGOA 5AJDA 3AU5A 3MA5A 4WWOA 1TYQG 5JJTA 3PE4A 4HNAD 1MZCA 3FH5A 3R7RA 2RKKA 4JXTA 2BTDA 2L6JA 2V5QC 2ZISA 3LVQE 5T8IA 3FUHA 3I4RB 3NAWA 3CVLA 3NQPA 2J8SD 1KT0A 3AG2E 1K1BA 3JYSA 1G3NB 3DRAA 5KNGA 4URKA 3FTXA 3NOGD 3ZW3A 3UIPC 3TWUA 3RAUA 1NI1A 3QOUA 2KCLA 3W9FA 2NXPA 2IFUA 3LY9A 5BXOA 3K9IA 4Q94A 4LRZA 4K5AB 2L0IA 3FUDA 1IYGA 4XKBA 4WNGA 3MV2B 5KCMA 3ML8A 2LXMA 1SW6A 4C9BB 4G11A 4AM9A 3U66A 4LNGA 4FLBA 3B13A 4PS3A 5D2MC 2HR2A 3FTWA 4K0RA 3KD7A 3CKCA 2EQXA 3HXEA 1TN8A 4HBDA 2ZGDA 1HFAA 2P2CP 2XGMA 5FWQA 2XCBA 5J90A 3SO8A 1AP7A 5KJKA 1E8ZA 1U2VG 3CHSA 3ZEFA 4PS8A 4YDYA 1DC2A 1XNFA 3LYAA 2BF0X 4G23A 2AVPA 2VTBA 1EPUA 1PAQA 3JQ0A 3CGHA 5H7PA 3T8MA 2ETAA 1OWOA 4I6GA 4HB5A 3QWPA 3DBSA 3UMVA 4F6RD 3CHMA 1KLXA 3ZPJA 2GRRB 2YINA 3DXKG 5ENPD 4Y6WA 2H6IA 4BY6A 3DSWA 4CDMA 1NZNA 1ELRA 4E85A 1MX6A 2KZTB 1K1AA 2X3MA 3CK8A 4A3VA 2X38A 3NBNB 5BPPA 3UQ3A 3FHEA 1E8WA 3LEWA 4N2QA 3FTUA 3EU9A 3HG0D 3NZUA 2XHEA 5KJNA 3LCAA 3Q47B 3SD5A 5C1DA 3PZ3A 3ASOE 2VGEA 5HKPA 1E7UA 3IEGA 2Q7FA 2AXVA 3FU3A 3D9LA 4Z68A 3L13A 4OVUA 3OXGA 1MYOA 3Q7AA 1Z5SC 2YHCA 1A5EA 4GMLA 1O1RA 4CDRA 1OWLA 1Z3XA 3ZIMA 1HE8A 2EINE 1DCEA 3LDZA 1NL4A 1XGWA 1E7VA 2C2LA 2BUGA 3UM2A 2P9IG 3URZA 3DSUA 4L23A 5IY5E 4K5CA 3ZUVB 2OEVA 3BU8A 4RG9A 2F8YA 2E2EA 2WXPA 3CR3A 2KATA 4C48B 2Y4TA 3KS2A 4GCNA 2DYRE 4UI9J 3S7FA 4CRWA 4XI9A 4DX6D 2MRIA 3IHVA 4AIFA 1OUVA 2V8SE 2UWJG 5FT9A 2GGFA 3FUIA 4TUMA 1RZ4A 3RSEG 1LF8A 4YVQC 2DIWA 4HOTA 4HRLA 3ZRHA 5JA4D 5A23A 1HO8A 4G2VA 4NQ0A 4U95D 4HQDA 4BERA 2VYIA 2WQ7A 5CBNA 2XPZA 1DNPA 1D8DA 3G2SA 2I9CA 3LKUA 1OT8A 2C0MA 1N54A 1L5JA 3CHRA 4I2WA 2KCKA 4DJAA 1OWMA 1TJCA 3UINC 2XS8A 4LNUD 4XKCA 4WAFA 3TWRA 2HM8A 4I43A 3PZDA 4WNEA 3CQCB 2OVFA 2F8XK 4I9EA 2QC9A 4B94A 4GCOA 3Q7FA 3G2TA 4O6FA 3FY4A 4BX8A 5CEDB 5AQAA 4J6IA 2CHXA 2KC7A 3FUFA 3CIAA 3EHRA 3CQGB 3CVYA 2LNIA 3E30A 1SZ9A 2OVBA 1H6KA 2ZXWE 2WM9A 2X6IA 5ANRA 3D9JA 5KJLA 3ASDA 1N9AA 4HOQA 4GZ5A 1E8YA 3Q78A
chains in the Genus database with same CATH topology
4AY6A 2FBNA 4IYPA 1HXIA 3RRUA 4CDNA 1OWPA 4U07A 1W3BA 4EBAA 3P2BA 1ELKA 2LAHA 4N39A 3I5PA 3T5XA 1EDUA 2L9BA 2WMOA 3PRZA 1EYHA 5BV0A 3I3NA 2CHZA 2XEVA 4LERA 4RG6A 3ONKA 4DK5A 5ARFA 3ZHEB 4IULA 4B8CB 2GW1A 4G24A 4BTAA 2LSUA 3ZYLA 2I2OA 3RO2A 3ZFWA 1QZ2A 3FH7A 1Y6IA 3MEKA 3MKQB 4JHJA 4XI0A 2I6HA 3EIQC 3MX3A 4HFGA 3SZ7A 4ACKA 3QKYA 3OTNA 3PUKA 4FHKA 4GB9A 4U0SA 1TJFA 4FU3A 4QFVA 4UWHA 5AJLA 5CHEE 3LS8A 3ZGQA 4ANVA 2AW6A 3SGHA 2J49A 2X6HA 4XX5A 2WVIA 1UW4B 3HDXA 2FEZA 3OXFA 4K03A 2VQ2A 3FU0A 2CFZA 2VSOE 2OV8A 1GW6A 4UQYA 3FH8A 3CLJA 5CMWA 4GZDA 4KXKB 4JL0A 4UI9K 5D0OD 2KM4A 3FULA 4OVVA 1HG2A 1H0AA 2V5FA 3CK7A 2PM7A 1HZ4A 2R59A 2GRLA 3G2WA 1HG5A 4D10C 2CG3A 3L16A 4NURA 4U8HA 4PUCA 4I1MA 4UWLA 3QB2A 3ASGA 3U3WA 1INZA 2CG2A 3CVNA 4HVBA 2J07A 3G2VA 2VSXE 3L17A 4I1OB 5DBKA 4P29A 3QC1A 2VJ8A 2MHKA 4PH4B 3FUNA 4KYOB 4KT6B 4BSXA 4B0ZA 1JWFA 4GZ6A 2IU1A 2JEKA 3AU4A 2XGOA 5AJDA 4EZLA 3AU5A 3MA5A 3R9AB 3RKVA 3ULQA 3GZSA 2A4ZA 3O48A 4WWOA 5E75A 5FZQA 1A17A 4N3CA 2XRZA 5FQ4A 5JJTA 3GW4A 2VGXB 3L54A 3PE4A 5EX3A 4UQXA 3D9MA 2NC9A 4FHJA 4GA1A 3FH5A 3R7RA 3UT7A 4JXTA 1WAO1 3Q49B 3WXXA 4JPSA 4MS6A 4KZCA 4HS2A 3DPDA 5ENNA 2BTDA 4HOSA 2L6JA 3ESKA 2GRMA 3ENEA 3JQ1A 4GMJA 5LFAA 3LY8A 2Y3AA 4H7YA 3LVQE 2LAIA 4H7XA 4BT9A 5T8IA 3FUHA 3I4RB 3CVLA 3NQPA 1KT1A 2X6KA 3ZYMA 3CVPA 3AS5A 2X6JA 1KT0A 2IOSA 3APFA 3JYSA 4UWFA 1ZU2A 2FI7A 5ARGA 1TEZA 3PNTB 1IQRA 4GU5A 2KZTA 3PEUB 1IQUA 4URKA 2IQCA 4TUUA 4JA7A 4N3AA 3S2AA 3TXMA 3FTXA 3CSFA 5G55A 3VTXA 4HOUA 5A7DB 4GA2A 3ZW3A 2PQRA 4B89A 1WY6A 3QWVA 3MKRA 5CCLA 3QOUA 5FQ8A 2KCLA 4E6HA 2NXPA 3ZYQA 2PZIA 2C0LA 2HO1A 3FU5A 3R7QA 2IFUA 3LY9A 3JCKC 4C0EA 1B89A 1UJKA 4J8DA 3HVEA 3K9IA 4Q94A 3BEEA 4LRZA 2I1JA 5G04J 2L0IA 3FUDA 1IYGA 4U0ZA 4XKBA 2HYZA 3MV3B 1SQMA 4WNGA 5C2YA 4A1SA 1NA0A 3MV2B 1IHGA 3FTYA 3L22A 2NSZA 5KCMA 2X6FA 3ML8A 4M3OA 3FU6A 2VSYA 3CK9A 4FA6A 2YQ8A 4C9BB 3FUJA 5M72A 4G11A 3JUIA 4DLOA 4AM9A 4AVXA 3EHNA 3PH0C 3U66A 4FULA 3TJPA 4FLBA 1ELWA 2V4LA 3B13A 3FUEA 3T5VA 4GYOA 2WQ6A 4PS3A 2OOEA 2WXQA 3KEZA 4J8SA 2HR2A 2Y4UA 4MLPA 4CT0A 3FTWA 4K0RA 3KD7A 2XCCA 3FTZA 3MZLB 3CKCA 5D0QD 4A1GA 4ANWA 2EQXA 1X5BA 4C0MA 3S7DA 3RRMB 3CHPA 4GPKA 4JEUA 2J08A 1HFAA 4KBQA 3RRNB 4N3BA 1UG3A 5G05J 2XGMA 3CVVA 4A3TA 4BT8A 2KCVA 5FWQA 3LY7A 5HQ8A 2XCBA 5KJMA 4EQFA 2J4DA 4YNDA 5J90A 3GZ1A 4WUYA 1UN8A 4G26A 5KJKA 1E8ZA 4Q96A 3FEYA 3CHSA 4UWGA 3UX4A 3ZEFA 4KZ0A 5FTPA 4A55A 4BWRA 4PS8A 5LOZA 3ZN3A 4TV3A 1XNFA 3QARA 1HS6A 3D9IA 5A6CA 4BTBA 4N5CA 2MOWA 4AEZC 3LYAA 2BF0X 3CHQA 4IRUA 4AP2A 4G23A 5G04C 3HHMA 2AVPA 4U0UA 3D9PA 3D9KA 3RU0A 2VTBA 1EPUA 1PAQA 3SHFA 4AXHA 3MYVA 3JQ0A 3CGHA 4MKTA 3MJWA 3T8MA 4G1TA 4UQZA 4JC8A 4JW1A 4GA0A 1H2UA 1OWOA 4I6GA 5EKQD 1BPOA 3FUKA 4AV7A 4I17A 3QWPA 3DBSA 2WXLA 3UMVA 1HU3A 3CHMA 2PQNA 1KLXA 3TG4A 4I1AA 3NZSA 3ZPJA 3QAQA 2YINA 3LJ3A 4Y6WA 5BT1A 4BY6A 4CDMA 3D9OA 5J08A 4JHRA 4LEUA 1NZNA 1ELRA 4E85A 3ML9A 5BUZA 1HF8A 4RVBA 4WNDA 3LXUX 2KZTB 5DIZA 4B8AA 4I9CA 3CVWA 2LO6A 2ILRA 2X3MA 3CK8A 3UPVA 1MQSA 4A3VA 2X38A 4LCTA 5G05C 5BPPA 2IONA 3UQ3A 3ESLA 4JHKA 4CCAA 3FHEA 5FQ7A 3MKQA 1E8WA 3CHOA 5FZSA 4XIFA 3LEWA 3PDNA 1ZBPA 2L0TB 4FJZA 5JHAA 4N2QA 3FTUA 3LPZA 3TAXA 2LSVA 2J09A 3VLEA 4EZJA 2E0IA 1S0PA 3SBSA 3NZUA 2XHEA 5KJNA 4BFRA 4KVOA 4FLHA 3LCAA 3CVUA 1U3CA 1JPLA 2DBAA 3TXNA 3Q47B 4ILGA 4XZ4A 3SD5A 2ONDA 2WXJA 5C1DA 3IV0A 3FTVA 3PE3A 4Y6CA 1VDYA 2WXIA 3RO3A 2UY1A 2A5UA 4I6JA 1PC2A 1E7UA 1QQEA 3IEGA 3CKBA 3CV0A 2Q7FA 2AXVA 3FFLA 2JLBA 4KVMA 3FU3A 3D9LA 5ANLA 3ZXSA 4FC8A 3L13A 4AJWA 3PUJA 4J0UA 3BG0B 3L6AA 3B7SA 4OVUA 4YVOA 3OXGA 2RG8A 4GYWA 2J9QA 4JZYA 3HYMB 4IN3B 1WM5A 2YHCA 4I2ZA 4V3IA 3L08A 1UJJA 4JEHA 2IF4A 5JHBA 2VGYA 3KAEA 2XPYA 4MRUA 4GMLA 3FWVA 4GAAA 2WQHA 4ABNA 4CDRA 4HLEA 3E4BA 2WXMA 4AY5A 1OWLA 1Z3XA 3ZIMA 2AXZA 1HE8A 3UT8A 1NA3A 3SF4A 4APFA 3IKOB 3EDTB 2VGXA 2R17C 4ACLA 4F3VA 3LDZA 3P1UA 3UUXA 3AS8A 4GYYA 1Y8MA 3UT4A 4W9RA 5AENA 5EDSA 4UWKA 1XGWA 1E7VA 2C2LA 4NRHB 4OYSA 2BUGA 3HIZA 3ASFA 3PNLB 1E90A 3PEVB 3PVLA 4TRQA 3EHMA 5JJ7A 3URZA 5HI7A 5BV1A 2FO7A 2WXKA 4L23A 5BW8C 4ATGA 2V0PA 3N71A 4GZ3A 3SBTB 4WWNA 3PS6A 4WWPA 3ZVVA 2YHEA 4RG9A 3U64A 2WXRA 3AS4A 2WB2A 2E2EA 3TG5A 2WXPA 4PS7A 3CR3A 2KATA 2DCPA 3TGOA 2WXFA 1H2TC 1H2VC 3CEQA 3QWWA 2Y4TA 3KS2A 2P58C 1N52A 4GCNA 3I4GA 4DI3A 4WNFA 3MGBA 3ZYKA 4NACA 3RJVA 4UI9J 4EECA 4G25A 3S7FA 4CRWA 4XI9A 5CCMA 2MRIA 3SFZA 4HXIA 4ILIA 4N2SA 3IHVA 4AIFA 3QDNA 4L2LA 1OUVA 2AXUA 2V8SE 4APOA 2UWJG 2XRYA 5FT9A 4AOFA 2GGFA 3FUIA 1EF1C 2RD0A 2CFUA 1P5QA 3BG1B 4PDXA 2XQ0A 1MHQA 4FJYA 1LF8A 4YVQC 2WMNA 3VLFA 2WPVA 4EZKA 2DIWA 2FULA 4J8EA 4F53A 3QK0A 2VSNA 3CSTA 4HOTA 3FTSA 4L7TA 3ZRHA 1HH8A 3U9WA 2AWIA 3LVRE 1E8XA 5A23A 1HO8A 4G2VA 4NQ0A 5E76A 5LCWJ 2UY1B 3MCXA 4R7LA 2VYIA 5AIJA 2WQ7A 2XPZA 1FCHA 1DNPA 3ZHEA 3S7BA 2R5SA 3G2SA 4XE0A 2I9CA 4DLQA 3LKUA 2J4BA 5T3RA 2C0MA 4L2YA 1FVFA 2M63A 1N54A 1L5JA 3FUMA 3OAWA 4GZCA 3G2UA 3TL5A 2PL2A 3CHRA 2QFCA 3EJNA 2KCKA 3D3MA 3FP3A 2CHWA 3B7TA 4I2WA 4ME2A 4UI9C 4DJAA 1YA0A 3APCA 3GZ2A 3HVEB 3D9NA 5FJYA 4RSYA 1FVHA 3SI5A 2IOLA 1OWMA 4EBAG 1JWGA 1HX8A 3ASHA 1Z6TA 1Z3YA 3GYZA 3U4TA 2WXNA 1TJCA 4DI4A 4HORA 4XKCA 4WAFA 3Q4AB 4F1SA 4ANUA 2HM8A 3NF1A 1E96B 5AYWD 4I43A 5JJ6A 2YNQA 3PZDA 5CMYA 3RIBA 1SZAA 4L1BA 2ZU6B 4WNEA 1NP7A 3CQCB 3C98A 2OVFA 5BNWA 4I9EA 3VTYA 4B94A 2WXOA 4Q69A 3PREA 4JA9A 4GCOA 5G2NA 3G2TA 4O6FA 1U3DA 1UN9A 3FY4A 3RK6A 4BX8A 3IBEA 3S7JA 1H19A 5LCWC 4FP7A 3FEXA 4J6IA 1OWNA 2CHXA 2XGSA 4F7AA 2KC7A 4ILHB 4KMOA 2WXHA 2WXGA 3FUFA 4JVSA 3CIAA 4I6EA 4CGWA 4BX9A 5LP0A 3FDHA 3VLDA 2QY7A 4DPRA 3QJZA 1QNFA 3B7UX 3B7RL 3CQGB 3CVYA 2LNIA 5EX0A 2XPIA 2IJGX 4EPZA 1DVPA 4CT4A 5T4YA 1SZ9A 2OVBA 1PY1A 1H6KA 3Q15A 3IHYA 3SNXA 3Q5MA 3APDA 4CGVA 2WM9A 2X6IA 5ANRA 5LX8A 2VTBB 4CEMA 3D9JA 5KJLA 3ASDA 2FF4A 4HOQA 4LUNU 4U63A 3OXLA 5FZRA 4J8FA 3O4ZA 1JUQA 4GZ5A 3CVXA 5FQ6A 2I1KA 1E8YA 3EIJA 3CVQA 4U04A 4ANXA 4FADA 3ONLA 2PM6A 3QNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AY6 A;  2FBN A;  1HXI A;  4U07 A;  1W3B A;  4N39 A;  2XEV A;  4RG6 A;  5ARF A;  3ZHE B;  2GW1 A;  4G24 A;  4BTA A;  2LSU A;  3RO2 A;  3ZFW A;  1QZ2 A;  3MEK A;  4XI0 A;  2I6H A;  3SZ7 A;  3QKY A;  4U0S A;  5CHE E;  3ZGQ A;  2FEZ A;  3OXF A;  2VQ2 A;  4UQY A;  4KXK B;  4JL0 A;  4UI9 K;  5D0O D;  2V5F A;  3CK7 A;  1HZ4 A;  3ASG A;  3U3W A;  3CVN A;  5DBK A;  2MHK A;  4KYO B;  4GZ6 A;  2XGO A;  3MA5 A;  3R9A B;  3RKV A;  3ULQ A;  3O48 A;  5FZQ A;  1A17 A;  4N3C A;  5JJT A;  3GW4 A;  2VGX B;  3PE4 A;  5EX3 A;  4UQX A;  2NC9 A;  4GA1 A;  3WXX A;  1WAO 1;  3Q49 B;  4HOS A;  2L6J A;  3ESK A;  3LY8 A;  4H7Y A;  4H7X A;  4BT9 A;  3CVL A;  1KT1 A;  3CVP A;  3AS5 A;  1KT0 A;  3JYS A;  1ZU2 A;  2FI7 A;  5ARG A;  4JA7 A;  4N3A A;  3VTX A;  4HOU A;  5A7D B;  4GA2 A;  2PQR A;  3QWV A;  3MKR A;  5CCL A;  3QOU A;  2KCL A;  2PZI A;  2C0L A;  2HO1 A;  2IFU A;  3LY9 A;  1B89 A;  4J8D A;  3K9I A;  3BEE A;  5G04 J;  1IYG A;  4U0Z A;  4A1S A;  2HYZ A;  3MV3 B;  4WNG A;  1NA0 A;  3MV2 B;  1IHG A;  2VSY A;  3CK9 A;  2YQ8 A;  5M72 A;  4AM9 A;  1ELW A;  4GYO A;  2OOE A;  2HR2 A;  2Y4U A;  3KD7 A;  2XCC A;  3CKC A;  5D0Q D;  3S7D A;  4GPK A;  4KBQ A;  4N3B A;  5G05 J;  2XGM A;  4BT8 A;  2KCV A;  3LY7 A;  5HQ8 A;  2XCB A;  5KJM A;  4EQF A;  4YND A;  3GZ1 A;  4WUY A;  4G26 A;  5KJK A;  4BWR A;  5FTP A;  3ZN3 A;  1XNF A;  5A6C A;  4BTB A;  4N5C A;  3LYA A;  4G23 A;  5G04 C;  2AVP A;  4U0U A;  3RU0 A;  4G1T A;  4UQZ A;  4GA0 A;  5EKQ D;  4I17 A;  3QWP A;  3TG4 A;  2PQN A;  1KLX A;  4I1A A;  3ZPJ A;  4Y6W A;  5BT1 A;  4JHR A;  4LEU A;  1NZN A;  1ELR A;  4WND A;  5DIZ A;  4I9C A;  3CK8 A;  3UPV A;  5G05 C;  3UQ3 A;  5FZS A;  4XIF A;  3PDN A;  1ZBP A;  4N2Q A;  3LPZ A;  3TAX A;  2LSV A;  5KJN A;  3LCA A;  2DBA A;  3Q47 B;  2OND A;  5C1D A;  3PE3 A;  4Y6C A;  3RO3 A;  2UY1 A;  1PC2 A;  1QQE A;  3IEG A;  3CKB A;  3CV0 A;  2Q7F A;  3FFL A;  2JLB A;  4J0U A;  4YVO A;  3OXG A;  4GYW A;  2J9Q A;  3HYM B;  4IN3 B;  1WM5 A;  2YHC A;  4I2Z A;  2IF4 A;  2VGY A;  3KAE A;  3FWV A;  2WQH A;  4ABN A;  4CDR A;  3E4B A;  4AY5 A;  1NA3 A;  3SF4 A;  3EDT B;  2VGX A;  4F3V A;  3UUX A;  3AS8 A;  4GYY A;  1Y8M A;  4W9R A;  2C2L A;  4NRH B;  2BUG A;  3ASF A;  5JJ7 A;  3URZ A;  5HI7 A;  2FO7 A;  5BW8 C;  4GZ3 A;  3N71 A;  4RG9 A;  3AS4 A;  2E2E A;  3TG5 A;  2KAT A;  3TGO A;  3CEQ A;  3QWW A;  2Y4T A;  3KS2 A;  2P58 C;  4GCN A;  4WNF A;  3RJV A;  4UI9 J;  4G25 A;  3S7F A;  4XI9 A;  5CCM A;  4N2S A;  4AIF A;  3QDN A;  1OUV A;  4APO A;  2UWJ G;  5FT9 A;  1P5Q A;  4YVQ C;  2WPV A;  4J8E A;  2VSN A;  4HOT A;  1HH8 A;  5LCW J;  4G2V A;  4NQ0 A;  2UY1 B;  2VYI A;  1FCH A;  3ZHE A;  3S7B A;  2R5S A;  3LKU A;  2C0M A;  2PL2 A;  2QFC A;  4I2W A;  2KCK A;  4UI9 C;  3FP3 A;  4ME2 A;  1YA0 A;  3GZ2 A;  5FJY A;  3ASH A;  3GYZ A;  3U4T A;  1TJC A;  4HOR A;  3Q4A B;  3NF1 A;  1E96 B;  5AYW D;  5JJ6 A;  3RIB A;  4WNE A;  5BNW A;  4I9E A;  3VTY A;  4B94 A;  4JA9 A;  4GCO A;  4O6F A;  3S7J A;  5LCW C;  2XGS A;  2KC7 A;  4CGW A;  2LNI A;  5EX0 A;  2XPI A;  3Q15 A;  3Q5M A;  4CGV A;  5KJL A;  3ASD A;  2FF4 A;  4HOQ A;  3OXL A;  5FZR A;  4J8F A;  4GZ5 A;  3CVQ A;  4U04 A; 
#chains in the Genus database with same CATH topology
 4YDO A;  4AY6 A;  4U07 A;  3KEA A;  4GTR A;  3P2B A;  1ELK A;  3E37 A;  3T5X A;  3PRZ A;  2CHZ A;  2XEV A;  3NOC D;  5ARF A;  1K3Z D;  4IUL A;  1FT2 A;  5AQ9 A;  2RFM A;  3OTN A;  4U0S A;  4FU3 A;  5CHE E;  4ANV A;  2AW6 A;  2X6H A;  3AJI A;  4XX5 A;  2WVI A;  1UW4 B;  2B0O E;  4TXQ A;  2KXP C;  3FU0 A;  2L6B A;  2CFZ A;  4UQY A;  3FH8 A;  4GTO A;  5D0O D;  2KM4 A;  3FUL A;  4OVV A;  1H0A A;  3CK7 A;  1TNZ A;  1HZ4 A;  1O5M A;  2CG3 A;  4OAU C;  5AQB A;  3QB2 A;  3DSS A;  3G2V A;  3TWS A;  4PH4 B;  4KT6 B;  4B0Z A;  1JWF A;  3RKV A;  3GZS A;  3BUA A;  3O48 A;  1RW2 A;  1A17 A;  4N3C A;  1LD8 A;  2XRZ A;  2QZA A;  3EUV A;  2FO1 E;  4GA1 A;  1WAO 1;  1TN7 A;  3Q49 B;  4HS2 A;  2A5E A;  2P9K G;  4HOS A;  3AG3 E;  3LY8 A;  2LAI A;  2DVW A;  4JB8 P;  3UXG A;  3CVP A;  3APF A;  1ZU2 A;  3PNT B;  3IXE A;  4G8K A;  3PEU B;  2IQC A;  4JA7 A;  4HOU A;  1IKN D;  4DRX E;  1WY6 A;  3QWV A;  3MKR A;  2ETC A;  2QYJ A;  1N0R A;  3ZYQ A;  2PZI A;  3DST A;  2P9P G;  2HO1 A;  3R7Q A;  4C0E A;  1N4S A;  4U0Z A;  2HYZ A;  1SQM A;  3L22 A;  2X6F A;  2VSY A;  5EN5 D;  3ABM E;  2B6C A;  5M72 A;  3EHN A;  3TWX A;  3TJP A;  2WQ6 A;  4J8S A;  4MLP A;  3L82 A;  2Y4U A;  3MZL B;  1X5B A;  4JEU A;  5FIO A;  1OY3 D;  4KBQ A;  1YMP A;  3ZKJ A;  4A3T A;  1Q2Z A;  1WG0 A;  2KCV A;  5HQ8 A;  3PZ2 A;  2QYU A;  1D8E A;  2J4D A;  2P9U G;  4EQF A;  4WUY A;  3TWQ A;  2R2L A;  4DUI A;  4G26 A;  5AAO A;  4Q96 A;  4KZ0 A;  5FTP A;  2Y0B G;  4TV3 A;  3D9I A;  4GTQ A;  4N5C A;  2MOW A;  4AP2 A;  3D9K A;  3SHF A;  4U96 D;  1SVX A;  2DWZ A;  3SFX A;  2P9S G;  1BPO A;  1JCS A;  3FUK A;  4AV7 A;  4I17 A;  3TG4 A;  2PQN A;  4I1A A;  1SA4 A;  3LJ3 A;  2P9N G;  4RVB A;  4B8A A;  3UPV A;  2ION A;  1N11 A;  4DX5 D;  2L0T B;  4FJZ A;  5JHA A;  2LSV A;  3VLE A;  2E0I A;  2DZN A;  3V30 A;  4BFR A;  2LXL A;  3FTV A;  3PE3 A;  2WXI A;  2A5U A;  3UIO C;  5ANL A;  4FC8 A;  3BG0 B;  3L6A A;  3Q9U C;  4YVO A;  2RG8 A;  3HXB A;  2IO2 C;  4JZY A;  3HYM B;  4I2Z A;  4V3I A;  4DX1 A;  5JHB A;  2XPY A;  4MRU A;  3FWV A;  5JMN D;  4ABN A;  2WXM A;  2AXZ A;  1BI7 B;  4ACL A;  3P1U A;  4GYY A;  2H6H A;  5EDS A;  4OYS A;  3PVL A;  5JJ7 A;  5HI7 A;  5BV1 A;  2WXK A;  4ATG A;  2V0P A;  3N71 A;  4GZ3 A;  3SBT B;  3ZVV A;  2JAB A;  2EIL E;  2WXF A;  1H2V C;  4K5B A;  1N52 A;  2GRQ B;  3I4G A;  4DI3 A;  4GTM A;  4U8Y D;  4NAC A;  4EEC A;  4HXI A;  1YYH A;  3QDN A;  2AXU A;  2XRY A;  4AOF A;  1EF1 C;  3D9H A;  4GMR A;  1WDY A;  3BG1 B;  1P5Q A;  2XQ0 A;  4FJY A;  2WMN A;  3VLF A;  3UM3 A;  4EZK A;  1FT1 A;  5B1B E;  2HE0 A;  4L7T A;  3U9W A;  4BES A;  3HXC A;  5LCW J;  2UY1 B;  4R7L A;  4LG6 A;  3ZHE A;  3S7B A;  2R5S A;  5EYP F;  4DLQ A;  5T3R A;  4L2Y A;  2M63 A;  3OAW A;  3FUM A;  2PL2 A;  4UI9 C;  3EJN A;  3FP3 A;  3B7T A;  1JCR A;  1ZB1 A;  3D9N A;  3KSL A;  4RSY A;  1FVH A;  3SI5 A;  2IOL A;  4EBA G;  1JWG A;  3JXI A;  1Z6T A;  3U4T A;  3Q4A B;  3NF1 A;  4EHM A;  1N0Q A;  5JJ6 A;  4LNB A;  4L1B A;  1NP7 A;  3C98 A;  5BNW A;  3VTY A;  3V2O A;  4DX2 A;  3PRE A;  3RK6 A;  4FP7 A;  3Q75 A;  3UKU G;  2AJA A;  4I6E A;  5LP0 A;  4BX9 A;  2QY7 A;  3QJZ A;  3DEP A;  3C3O A;  3C5R A;  4DX7 D;  5EX0 A;  2OEW A;  5EID A;  5CER B;  4J8F A;  2I1K A;  4ANX A;  4FAD A;  4GTS A;  3RRU A;  3TWV A;  4N39 A;  3I5P A;  2L9B A;  5BV0 A;  4LER A;  3ONK A;  4DK5 A;  4B8C B;  4G24 A;  1TN6 A;  3ZYL A;  1BLX B;  3RO2 A;  1QZ2 A;  3ZFW A;  3MKQ B;  2I6H A;  3MX3 A;  4ACK A;  3QKY A;  4FHK A;  4QFV A;  2H6F A;  3LS8 A;  1OXJ A;  2Y1L E;  2RFA A;  2VSO E;  4YDW A;  2OV8 A;  1N94 A;  2IEJ A;  4HRM B;  2PM7 A;  2R03 A;  4MBG A;  4UWL A;  1INZ A;  4J8Y A;  3CVN A;  2J07 A;  2VSX E;  3L17 A;  4P29 A;  2MHK A;  4CZ2 D;  4BSX A;  3R9M A;  3AU4 A;  4EZL A;  3T9K A;  3ULQ A;  2EIK E;  5E75 A;  4RQI A;  3UM0 A;  5FQ4 A;  3GW4 A;  2VGX B;  3L54 A;  1D9S A;  3D9M A;  3UKR G;  3UT7 A;  3WXX A;  4O1P A;  5EYL A;  4LSZ E;  3ESK A;  2GRM A;  3ENE A;  3JQ1 A;  4GMJ A;  5LFA A;  4BT9 A;  2X6K A;  3DSV A;  2FI7 A;  1TEZ A;  4GU5 A;  2KZT A;  4N3A A;  3TXM A;  3S2A A;  5G55 A;  5A7D B;  2DZO A;  2PQR A;  1TNO A;  1MX4 A;  2C0L A;  3FU5 A;  2BED A;  4RLY A;  1B89 A;  1UJK A;  4J8D A;  3BEE A;  2I1J A;  5G04 J;  3J5P A;  1BU9 A;  2H6G A;  1IHG A;  2NSZ A;  3C3Q A;  4M3O A;  5HRY A;  3FUJ A;  4AVX A;  3PH0 C;  1LTX A;  2V4L A;  2XZT G;  4GYO A;  2WXQ A;  3KEZ A;  4CT0 A;  4HI8 A;  3UM1 A;  3FTZ A;  4A1G A;  5D0Q D;  4ANW A;  4CYM D;  4C0M A;  3S7D A;  4GPK A;  2BKK B;  3RRN B;  2XZD G;  5G05 J;  2R02 A;  5ITZ F;  1SA5 A;  3GZ1 A;  4UWG A;  5LOZ A;  1JCQ A;  4BTB A;  4AEZ C;  2KBX A;  3HHM A;  2F0Y A;  4U0U A;  3ASN E;  3RU0 A;  4MKT A;  3MJW A;  4JC8 A;  4JW1 A;  3HXD A;  1H2U A;  1OCR E;  3V31 A;  5EKQ D;  2V4H C;  3JXJ A;  3NZS A;  3T8K A;  5FIN A;  5J08 A;  4JHR A;  4LEU A;  3ML9 A;  5BUZ A;  1QBQ A;  2GRO B;  3LXU X;  4I9C A;  3J5Q B;  1MQS A;  4LCT A;  4CCA A;  3ESL A;  4JHK A;  5FQ7 A;  3MKQ A;  4UUC A;  3CHO A;  4XIF A;  3LPZ A;  3TAX A;  4G8L A;  2J09 A;  1S0P A;  3TWT A;  3SBS A;  4KVO A;  3UI2 A;  4FLH A;  1U3C A;  1JPL A;  3TXN A;  1FPP A;  4XZ4 A;  2WXJ A;  4I6J A;  4U7E B;  1PC2 A;  1QQE A;  3ABL E;  4QQI A;  3CV0 A;  1TNB A;  3FFL A;  2JLB A;  4AJW A;  2R05 A;  1OCO E;  3PUJ A;  4J0U A;  3B7S A;  4GYW A;  2J9Q A;  4IN3 B;  1H6P A;  1UJJ A;  2IF4 A;  2VGY A;  3KAE A;  1K8K G;  1TR4 A;  1BI8 B;  4GAA A;  4TXP A;  4HLE A;  4AY5 A;  3UT8 A;  3SF4 A;  4APF A;  3IKO B;  3EDT B;  2VGX A;  2OCC E;  2R17 C;  4F3V A;  3V2X A;  2GRP B;  4NRH B;  3ASF A;  3PNL B;  1E90 A;  3PEV B;  4TRQ A;  3L9T A;  3EHM A;  3JUE A;  2FO7 A;  1AWC B;  5BW8 C;  3E33 A;  3PS6 A;  4WWP A;  2YHE A;  3U64 A;  2WXR A;  3Q73 A;  3AS4 A;  1V54 E;  2WB2 A;  4PS7 A;  2DCP A;  3E34 A;  1H2T C;  3QWW A;  1S70 B;  2P58 C;  3ZYK A;  5ENR D;  3RJV A;  3TWW A;  3SFZ A;  4N2S A;  4L2L A;  2XS1 A;  4APO A;  2RD0 A;  4PDX A;  1YCS B;  1N4P A;  2NYJ A;  3B7B A;  3EHQ A;  2FUL A;  4J8E A;  3QK0 A;  2GRN B;  3FTS A;  3PZ4 A;  1HH8 A;  2AWI A;  3LVR E;  1E8X A;  1NFI E;  5E76 A;  3MCX A;  5EIL A;  4BSZ B;  1FCH A;  4XE0 A;  1MJ0 A;  3G2U A;  4HRN A;  1YA0 A;  3GZ2 A;  3HVE B;  5FJY A;  3SQV A;  3ASH A;  3GYZ A;  1Z3Y A;  4F1P A;  1N4R A;  4F1S A;  5CMY A;  3RIB A;  2ZU6 B;  5G2N A;  2XEE A;  1IHB A;  3IBE A;  5LCW C;  3DXM G;  3FEX A;  2XGS A;  4F7A A;  4ILH B;  4U8V D;  4CGW A;  3FDH A;  4DPR A;  4O60 A;  1QNF A;  3B7U X;  3B7R L;  2IJG X;  3BQO A;  4EPZ A;  1DVP A;  4CT4 A;  5T4Y A;  5CRV A;  3IHY A;  3Q5M A;  3APD A;  4CGV A;  1OCC E;  5B1A E;  3C72 A;  4CEM A;  4L9P A;  2FF4 A;  4BEP A;  4LUN U;  4U63 A;  3OXL A;  5FZR A;  3AG4 E;  3CVX A;  3EIJ A;  4CDN A;  1W3B A;  4EBA A;  2WMO A;  4BTA A;  2LSU A;  2I2O A;  1Y6I A;  3MEK A;  4JHJ A;  3SZ7 A;  3EIQ C;  4HI9 A;  2LUH A;  2IO3 C;  4GB9 A;  1TJF A;  2BKG A;  4UWH A;  5AJL A;  5ENT D;  3SGH A;  2J49 A;  3HDX A;  2FEZ A;  3ZXP A;  1GW6 A;  3CLJ A;  5CMW A;  4GZD A;  4KXK B;  4JL0 A;  4UI9 K;  1OCZ E;  3F6Q A;  2V5F A;  3UTM A;  3G2W A;  1HG5 A;  4D10 C;  3L16 A;  4PUC A;  4I1M A;  1S63 A;  3U3W A;  2CG2 A;  4HVB A;  3QC1 A;  2VJ8 A;  3FUN A;  4KYO B;  5EIB E;  3E32 A;  4GZ6 A;  3R9A B;  2A4Z A;  5FZQ A;  5EX3 A;  4UQX A;  2NC9 A;  4FHJ A;  4JPS A;  4MS6 A;  4KZC A;  3DPD A;  5ENN A;  2Y3A A;  4H7Y A;  4H7X A;  3V79 K;  1KT1 A;  3ZYM A;  3AS5 A;  2X6J A;  1MX2 A;  2IOS A;  2XEN A;  4UWF A;  5ARG A;  1IQR A;  1IQU A;  4TUU A;  3CSF A;  3VTX A;  4GA2 A;  4B89 A;  1O1T A;  4BET A;  5CCL A;  5FQ8 A;  2P9L G;  4E6H A;  3JCK C;  3HVE A;  4GTT A;  1V55 E;  3ULY A;  2ZGG A;  2Y69 E;  4A1S A;  3MV3 B;  5C2Y A;  1NA0 A;  3DSX A;  3FTY A;  3FU6 A;  3CK9 A;  4FA6 A;  2YQ8 A;  2ZIR A;  4DLO A;  3JUI A;  4FUL A;  1ELW A;  3FUE A;  3T5V A;  2OOE A;  3DPY A;  2XCC A;  4NIK A;  3RRM B;  3CHP A;  2J08 A;  4N3B A;  1UG3 A;  3CVV A;  4BT8 A;  3LY7 A;  5KJM A;  4YND A;  3C3R A;  1UN8 A;  4A55 A;  3UX4 A;  3FEY A;  4BWR A;  3ZN3 A;  1KZP A;  3QAR A;  1HS6 A;  5A6C A;  3AG1 E;  4J7W A;  3CHQ A;  4IRU A;  5G04 C;  4GTV A;  3D9P A;  4AXH A;  3MYV A;  1O1S A;  5HS0 A;  3DEO A;  4G1T A;  4UQZ A;  4GA0 A;  2PNN A;  2WXL A;  4ZFH A;  5CEC B;  1HU3 A;  3QAQ A;  3ISM C;  3ZU7 B;  5BT1 A;  3D9O A;  1HF8 A;  4WND A;  5DIZ A;  4ATZ D;  3CVW A;  2LO6 A;  2ILR A;  3NB2 A;  5G05 C;  2EIM E;  5ENQ D;  5FZS A;  3Q79 A;  3PDN A;  1ZBP A;  3ULE G;  4EZJ A;  3X2Q E;  4OAV B;  4O1O A;  4JD2 G;  3CVU A;  1KZO A;  2DBA A;  4ILG A;  2OND A;  5KNH D;  3IV0 A;  4Y6C A;  1VDY A;  3RO3 A;  2UY1 A;  3CKB A;  5AQ7 A;  4KVM A;  3ZXS A;  5KWD A;  4TXR A;  5AAR A;  1WM5 A;  3L08 A;  4JEH A;  1S64 A;  2WQH A;  3E4B A;  1NA3 A;  3UUX A;  3AS8 A;  3UT4 A;  1Y8M A;  5AEN A;  4W9R A;  4UWK A;  5AN8 A;  3HIZ A;  3EU5 A;  4WWN A;  3TG5 A;  3WG7 E;  3TGO A;  3CEQ A;  5ENS D;  4WNF A;  3MGB A;  1IXV A;  4G25 A;  1TNU A;  5CCM A;  1H6O A;  4ILI A;  3HXF A;  2XEH A;  2CFU A;  2F37 A;  2IY0 C;  1MHQ A;  4HLL A;  2WPV A;  4F53 A;  2VSN A;  3CST A;  3ABK E;  3AAA C;  4M7C A;  2ETB A;  5AIJ A;  4GTP A;  5KBA A;  3ZNG A;  5D66 A;  2J4B A;  1FVF A;  4GZC A;  3TL5 A;  2QFC A;  3D3M A;  2CHW A;  4ME2 A;  4B93 B;  3APC A;  3DWL G;  1HX8 A;  3SFY A;  2WXN A;  5B3S E;  4DI4 A;  4HOR A;  4A63 B;  4ANU A;  1E96 B;  5AYW D;  5CEA A;  2YNQ A;  1SZA A;  3HRA A;  2WXO A;  1UOH A;  4Q69 A;  2EIJ E;  4JA9 A;  1U3D A;  1UN9 A;  2DYS E;  3S7J A;  1H19 A;  1OWN A;  4KMO A;  2WXH A;  2WXG A;  4JVS A;  3VLD A;  5CBO A;  2XPI A;  1DCQ A;  4ZHB A;  1TNY A;  1LD7 A;  1PY1 A;  3Q15 A;  3SNX A;  5LX8 A;  2VTB B;  4N5Q A;  3KSQ A;  3O4Z A;  1JUQ A;  1N95 A;  4X8Q A;  5FQ6 A;  3CVQ A;  4U04 A;  1BD8 A;  3PZ1 A;  3ONL A;  2PM6 A;  3QNK A;  2FBN A;  4IYP A;  1HXI A;  1OWP A;  3SY2 A;  2LAH A;  1EDU A;  1EYH A;  3I3N A;  1N4Q A;  4RG6 A;  3ZHE B;  2GW1 A;  3FH7 A;  4XI0 A;  1QYM A;  4HFG A;  3PUK A;  1KPS B;  3LJN A;  2MYO A;  3ZGQ A;  4XEI G;  5ENO D;  3OXF A;  4K03 A;  2VQ2 A;  5CRU A;  5BXU A;  4YDE A;  3Q9N C;  1HG2 A;  3W9G A;  2R59 A;  2GRL A;  4NUR A;  4U8H A;  3ASG A;  3B95 A;  4I1O B;  5DBK A;  4GPM A;  1X81 A;  2IU1 A;  2JEK A;  2XGO A;  5AJD A;  3AU5 A;  3MA5 A;  4WWO A;  1TYQ G;  5JJT A;  3PE4 A;  4HNA D;  1MZC A;  3FH5 A;  3R7R A;  2RKK A;  4JXT A;  2BTD A;  2L6J A;  2V5Q C;  2ZIS A;  3LVQ E;  5T8I A;  3FUH A;  3I4R B;  3NAW A;  3CVL A;  3NQP A;  2J8S D;  1KT0 A;  3AG2 E;  1K1B A;  3JYS A;  1G3N B;  3DRA A;  5KNG A;  4URK A;  3FTX A;  3NOG D;  3ZW3 A;  3UIP C;  3TWU A;  3RAU A;  1NI1 A;  3QOU A;  2KCL A;  3W9F A;  2NXP A;  2IFU A;  3LY9 A;  5BXO A;  3K9I A;  4Q94 A;  4LRZ A;  4K5A B;  2L0I A;  3FUD A;  1IYG A;  4XKB A;  4WNG A;  3MV2 B;  5KCM A;  3ML8 A;  2LXM A;  1SW6 A;  4C9B B;  4G11 A;  4AM9 A;  3U66 A;  4LNG A;  4FLB A;  3B13 A;  4PS3 A;  5D2M C;  2HR2 A;  3FTW A;  4K0R A;  3KD7 A;  3CKC A;  2EQX A;  3HXE A;  1TN8 A;  4HBD A;  2ZGD A;  1HFA A;  2P2C P;  2XGM A;  5FWQ A;  2XCB A;  5J90 A;  3SO8 A;  1AP7 A;  5KJK A;  1E8Z A;  1U2V G;  3CHS A;  3ZEF A;  4PS8 A;  4YDY A;  1DC2 A;  1XNF A;  3LYA A;  2BF0 X;  4G23 A;  2AVP A;  2VTB A;  1EPU A;  1PAQ A;  3JQ0 A;  3CGH A;  5H7P A;  3T8M A;  2ETA A;  1OWO A;  4I6G A;  4HB5 A;  3QWP A;  3DBS A;  3UMV A;  4F6R D;  3CHM A;  1KLX A;  3ZPJ A;  2GRR B;  2YIN A;  3DXK G;  5ENP D;  4Y6W A;  2H6I A;  4BY6 A;  3DSW A;  4CDM A;  1NZN A;  1ELR A;  4E85 A;  1MX6 A;  2KZT B;  1K1A A;  2X3M A;  3CK8 A;  4A3V A;  2X38 A;  3NBN B;  5BPP A;  3UQ3 A;  3FHE A;  1E8W A;  3LEW A;  4N2Q A;  3FTU A;  3EU9 A;  3HG0 D;  3NZU A;  2XHE A;  5KJN A;  3LCA A;  3Q47 B;  3SD5 A;  5C1D A;  3PZ3 A;  3ASO E;  2VGE A;  5HKP A;  1E7U A;  3IEG A;  2Q7F A;  2AXV A;  3FU3 A;  3D9L A;  4Z68 A;  3L13 A;  4OVU A;  3OXG A;  1MYO A;  3Q7A A;  1Z5S C;  2YHC A;  1A5E A;  4GML A;  1O1R A;  4CDR A;  1OWL A;  1Z3X A;  3ZIM A;  1HE8 A;  2EIN E;  1DCE A;  3LDZ A;  1NL4 A;  1XGW A;  1E7V A;  2C2L A;  2BUG A;  3UM2 A;  2P9I G;  3URZ A;  3DSU A;  4L23 A;  5IY5 E;  4K5C A;  3ZUV B;  2OEV A;  3BU8 A;  4RG9 A;  2F8Y A;  2E2E A;  2WXP A;  3CR3 A;  2KAT A;  4C48 B;  2Y4T A;  3KS2 A;  4GCN A;  2DYR E;  4UI9 J;  3S7F A;  4CRW A;  4XI9 A;  4DX6 D;  2MRI A;  3IHV A;  4AIF A;  1OUV A;  2V8S E;  2UWJ G;  5FT9 A;  2GGF A;  3FUI A;  4TUM A;  1RZ4 A;  3RSE G;  1LF8 A;  4YVQ C;  2DIW A;  4HOT A;  4HRL A;  3ZRH A;  5JA4 D;  5A23 A;  1HO8 A;  4G2V A;  4NQ0 A;  4U95 D;  4HQD A;  4BER A;  2VYI A;  2WQ7 A;  5CBN A;  2XPZ A;  1DNP A;  1D8D A;  3G2S A;  2I9C A;  3LKU A;  1OT8 A;  2C0M A;  1N54 A;  1L5J A;  3CHR A;  4I2W A;  2KCK A;  4DJA A;  1OWM A;  1TJC A;  3UIN C;  2XS8 A;  4LNU D;  4XKC A;  4WAF A;  3TWR A;  2HM8 A;  4I43 A;  3PZD A;  4WNE A;  3CQC B;  2OVF A;  2F8X K;  4I9E A;  2QC9 A;  4B94 A;  4GCO A;  3Q7F A;  3G2T A;  4O6F A;  3FY4 A;  4BX8 A;  5CED B;  5AQA A;  4J6I A;  2CHX A;  2KC7 A;  3FUF A;  3CIA A;  3EHR A;  3CQG B;  3CVY A;  2LNI A;  3E30 A;  1SZ9 A;  2OVB A;  1H6K A;  2ZXW E;  2WM9 A;  2X6I A;  5ANR A;  3D9J A;  5KJL A;  3ASD A;  1N9A A;  4HOQ A;  4GZ5 A;  1E8Y A;  3Q78 A; 
#chains in the Genus database with same CATH homology
 4AY6 A;  2FBN A;  4IYP A;  1HXI A;  3RRU A;  4CDN A;  1OWP A;  4U07 A;  1W3B A;  4EBA A;  3P2B A;  1ELK A;  2LAH A;  4N39 A;  3I5P A;  3T5X A;  1EDU A;  2L9B A;  2WMO A;  3PRZ A;  1EYH A;  5BV0 A;  3I3N A;  2CHZ A;  2XEV A;  4LER A;  4RG6 A;  3ONK A;  4DK5 A;  5ARF A;  3ZHE B;  4IUL A;  4B8C B;  2GW1 A;  4G24 A;  4BTA A;  2LSU A;  3ZYL A;  2I2O A;  3RO2 A;  3ZFW A;  1QZ2 A;  3FH7 A;  1Y6I A;  3MEK A;  3MKQ B;  4JHJ A;  4XI0 A;  2I6H A;  3EIQ C;  3MX3 A;  4HFG A;  3SZ7 A;  4ACK A;  3QKY A;  3OTN A;  3PUK A;  4FHK A;  4GB9 A;  4U0S A;  1TJF A;  4FU3 A;  4QFV A;  4UWH A;  5AJL A;  5CHE E;  3LS8 A;  3ZGQ A;  4ANV A;  2AW6 A;  3SGH A;  2J49 A;  2X6H A;  4XX5 A;  2WVI A;  1UW4 B;  3HDX A;  2FEZ A;  3OXF A;  4K03 A;  2VQ2 A;  3FU0 A;  2CFZ A;  2VSO E;  2OV8 A;  1GW6 A;  4UQY A;  3FH8 A;  3CLJ A;  5CMW A;  4GZD A;  4KXK B;  4JL0 A;  4UI9 K;  5D0O D;  2KM4 A;  3FUL A;  4OVV A;  1HG2 A;  1H0A A;  2V5F A;  3CK7 A;  2PM7 A;  1HZ4 A;  2R59 A;  2GRL A;  3G2W A;  1HG5 A;  4D10 C;  2CG3 A;  3L16 A;  4NUR A;  4U8H A;  4PUC A;  4I1M A;  4UWL A;  3QB2 A;  3ASG A;  3U3W A;  1INZ A;  2CG2 A;  3CVN A;  4HVB A;  2J07 A;  3G2V A;  2VSX E;  3L17 A;  4I1O B;  5DBK A;  4P29 A;  3QC1 A;  2VJ8 A;  2MHK A;  4PH4 B;  3FUN A;  4KYO B;  4KT6 B;  4BSX A;  4B0Z A;  1JWF A;  4GZ6 A;  2IU1 A;  2JEK A;  3AU4 A;  2XGO A;  5AJD A;  4EZL A;  3AU5 A;  3MA5 A;  3R9A B;  3RKV A;  3ULQ A;  3GZS A;  2A4Z A;  3O48 A;  4WWO A;  5E75 A;  5FZQ A;  1A17 A;  4N3C A;  2XRZ A;  5FQ4 A;  5JJT A;  3GW4 A;  2VGX B;  3L54 A;  3PE4 A;  5EX3 A;  4UQX A;  3D9M A;  2NC9 A;  4FHJ A;  4GA1 A;  3FH5 A;  3R7R A;  3UT7 A;  4JXT A;  1WAO 1;  3Q49 B;  3WXX A;  4JPS A;  4MS6 A;  4KZC A;  4HS2 A;  3DPD A;  5ENN A;  2BTD A;  4HOS A;  2L6J A;  3ESK A;  2GRM A;  3ENE A;  3JQ1 A;  4GMJ A;  5LFA A;  3LY8 A;  2Y3A A;  4H7Y A;  3LVQ E;  2LAI A;  4H7X A;  4BT9 A;  5T8I A;  3FUH A;  3I4R B;  3CVL A;  3NQP A;  1KT1 A;  2X6K A;  3ZYM A;  3CVP A;  3AS5 A;  2X6J A;  1KT0 A;  2IOS A;  3APF A;  3JYS A;  4UWF A;  1ZU2 A;  2FI7 A;  5ARG A;  1TEZ A;  3PNT B;  1IQR A;  4GU5 A;  2KZT A;  3PEU B;  1IQU A;  4URK A;  2IQC A;  4TUU A;  4JA7 A;  4N3A A;  3S2A A;  3TXM A;  3FTX A;  3CSF A;  5G55 A;  3VTX A;  4HOU A;  5A7D B;  4GA2 A;  3ZW3 A;  2PQR A;  4B89 A;  1WY6 A;  3QWV A;  3MKR A;  5CCL A;  3QOU A;  5FQ8 A;  2KCL A;  4E6H A;  2NXP A;  3ZYQ A;  2PZI A;  2C0L A;  2HO1 A;  3FU5 A;  3R7Q A;  2IFU A;  3LY9 A;  3JCK C;  4C0E A;  1B89 A;  1UJK A;  4J8D A;  3HVE A;  3K9I A;  4Q94 A;  3BEE A;  4LRZ A;  2I1J A;  5G04 J;  2L0I A;  3FUD A;  1IYG A;  4U0Z A;  4XKB A;  2HYZ A;  3MV3 B;  1SQM A;  4WNG A;  5C2Y A;  4A1S A;  1NA0 A;  3MV2 B;  1IHG A;  3FTY A;  3L22 A;  2NSZ A;  5KCM A;  2X6F A;  3ML8 A;  4M3O A;  3FU6 A;  2VSY A;  3CK9 A;  4FA6 A;  2YQ8 A;  4C9B B;  3FUJ A;  5M72 A;  4G11 A;  3JUI A;  4DLO A;  4AM9 A;  4AVX A;  3EHN A;  3PH0 C;  3U66 A;  4FUL A;  3TJP A;  4FLB A;  1ELW A;  2V4L A;  3B13 A;  3FUE A;  3T5V A;  4GYO A;  2WQ6 A;  4PS3 A;  2OOE A;  2WXQ A;  3KEZ A;  4J8S A;  2HR2 A;  2Y4U A;  4MLP A;  4CT0 A;  3FTW A;  4K0R A;  3KD7 A;  2XCC A;  3FTZ A;  3MZL B;  3CKC A;  5D0Q D;  4A1G A;  4ANW A;  2EQX A;  1X5B A;  4C0M A;  3S7D A;  3RRM B;  3CHP A;  4GPK A;  4JEU A;  2J08 A;  1HFA A;  4KBQ A;  3RRN B;  4N3B A;  1UG3 A;  5G05 J;  2XGM A;  3CVV A;  4A3T A;  4BT8 A;  2KCV A;  5FWQ A;  3LY7 A;  5HQ8 A;  2XCB A;  5KJM A;  4EQF A;  2J4D A;  4YND A;  5J90 A;  3GZ1 A;  4WUY A;  1UN8 A;  4G26 A;  5KJK A;  1E8Z A;  4Q96 A;  3FEY A;  3CHS A;  4UWG A;  3UX4 A;  3ZEF A;  4KZ0 A;  5FTP A;  4A55 A;  4BWR A;  4PS8 A;  5LOZ A;  3ZN3 A;  4TV3 A;  1XNF A;  3QAR A;  1HS6 A;  3D9I A;  5A6C A;  4BTB A;  4N5C A;  2MOW A;  4AEZ C;  3LYA A;  2BF0 X;  3CHQ A;  4IRU A;  4AP2 A;  4G23 A;  5G04 C;  3HHM A;  2AVP A;  4U0U A;  3D9P A;  3D9K A;  3RU0 A;  2VTB A;  1EPU A;  1PAQ A;  3SHF A;  4AXH A;  3MYV A;  3JQ0 A;  3CGH A;  4MKT A;  3MJW A;  3T8M A;  4G1T A;  4UQZ A;  4JC8 A;  4JW1 A;  4GA0 A;  1H2U A;  1OWO A;  4I6G A;  5EKQ D;  1BPO A;  3FUK A;  4AV7 A;  4I17 A;  3QWP A;  3DBS A;  2WXL A;  3UMV A;  1HU3 A;  3CHM A;  2PQN A;  1KLX A;  3TG4 A;  4I1A A;  3NZS A;  3ZPJ A;  3QAQ A;  2YIN A;  3LJ3 A;  4Y6W A;  5BT1 A;  4BY6 A;  4CDM A;  3D9O A;  5J08 A;  4JHR A;  4LEU A;  1NZN A;  1ELR A;  4E85 A;  3ML9 A;  5BUZ A;  1HF8 A;  4RVB A;  4WND A;  3LXU X;  2KZT B;  5DIZ A;  4B8A A;  4I9C A;  3CVW A;  2LO6 A;  2ILR A;  2X3M A;  3CK8 A;  3UPV A;  1MQS A;  4A3V A;  2X38 A;  4LCT A;  5G05 C;  5BPP A;  2ION A;  3UQ3 A;  3ESL A;  4JHK A;  4CCA A;  3FHE A;  5FQ7 A;  3MKQ A;  1E8W A;  3CHO A;  5FZS A;  4XIF A;  3LEW A;  3PDN A;  1ZBP A;  2L0T B;  4FJZ A;  5JHA A;  4N2Q A;  3FTU A;  3LPZ A;  3TAX A;  2LSV A;  2J09 A;  3VLE A;  4EZJ A;  2E0I A;  1S0P A;  3SBS A;  3NZU A;  2XHE A;  5KJN A;  4BFR A;  4KVO A;  4FLH A;  3LCA A;  3CVU A;  1U3C A;  1JPL A;  2DBA A;  3TXN A;  3Q47 B;  4ILG A;  4XZ4 A;  3SD5 A;  2OND A;  2WXJ A;  5C1D A;  3IV0 A;  3FTV A;  3PE3 A;  4Y6C A;  1VDY A;  2WXI A;  3RO3 A;  2UY1 A;  2A5U A;  4I6J A;  1PC2 A;  1E7U A;  1QQE A;  3IEG A;  3CKB A;  3CV0 A;  2Q7F A;  2AXV A;  3FFL A;  2JLB A;  4KVM A;  3FU3 A;  3D9L A;  5ANL A;  3ZXS A;  4FC8 A;  3L13 A;  4AJW A;  3PUJ A;  4J0U A;  3BG0 B;  3L6A A;  3B7S A;  4OVU A;  4YVO A;  3OXG A;  2RG8 A;  4GYW A;  2J9Q A;  4JZY A;  3HYM B;  4IN3 B;  1WM5 A;  2YHC A;  4I2Z A;  4V3I A;  3L08 A;  1UJJ A;  4JEH A;  2IF4 A;  5JHB A;  2VGY A;  3KAE A;  2XPY A;  4MRU A;  4GML A;  3FWV A;  4GAA A;  2WQH A;  4ABN A;  4CDR A;  4HLE A;  3E4B A;  2WXM A;  4AY5 A;  1OWL A;  1Z3X A;  3ZIM A;  2AXZ A;  1HE8 A;  3UT8 A;  1NA3 A;  3SF4 A;  4APF A;  3IKO B;  3EDT B;  2VGX A;  2R17 C;  4ACL A;  4F3V A;  3LDZ A;  3P1U A;  3UUX A;  3AS8 A;  4GYY A;  1Y8M A;  3UT4 A;  4W9R A;  5AEN A;  5EDS A;  4UWK A;  1XGW A;  1E7V A;  2C2L A;  4NRH B;  4OYS A;  2BUG A;  3HIZ A;  3ASF A;  3PNL B;  1E90 A;  3PEV B;  3PVL A;  4TRQ A;  3EHM A;  5JJ7 A;  3URZ A;  5HI7 A;  5BV1 A;  2FO7 A;  2WXK A;  4L23 A;  5BW8 C;  4ATG A;  2V0P A;  3N71 A;  4GZ3 A;  3SBT B;  4WWN A;  3PS6 A;  4WWP A;  3ZVV A;  2YHE A;  4RG9 A;  3U64 A;  2WXR A;  3AS4 A;  2WB2 A;  2E2E A;  3TG5 A;  2WXP A;  4PS7 A;  3CR3 A;  2KAT A;  2DCP A;  3TGO A;  2WXF A;  1H2T C;  1H2V C;  3CEQ A;  3QWW A;  2Y4T A;  3KS2 A;  2P58 C;  1N52 A;  4GCN A;  3I4G A;  4DI3 A;  4WNF A;  3MGB A;  3ZYK A;  4NAC A;  3RJV A;  4UI9 J;  4EEC A;  4G25 A;  3S7F A;  4CRW A;  4XI9 A;  5CCM A;  2MRI A;  3SFZ A;  4HXI A;  4ILI A;  4N2S A;  3IHV A;  4AIF A;  3QDN A;  4L2L A;  1OUV A;  2AXU A;  2V8S E;  4APO A;  2UWJ G;  2XRY A;  5FT9 A;  4AOF A;  2GGF A;  3FUI A;  1EF1 C;  2RD0 A;  2CFU A;  1P5Q A;  3BG1 B;  4PDX A;  2XQ0 A;  1MHQ A;  4FJY A;  1LF8 A;  4YVQ C;  2WMN A;  3VLF A;  2WPV A;  4EZK A;  2DIW A;  2FUL A;  4J8E A;  4F53 A;  3QK0 A;  2VSN A;  3CST A;  4HOT A;  3FTS A;  4L7T A;  3ZRH A;  1HH8 A;  3U9W A;  2AWI A;  3LVR E;  1E8X A;  5A23 A;  1HO8 A;  4G2V A;  4NQ0 A;  5E76 A;  5LCW J;  2UY1 B;  3MCX A;  4R7L A;  2VYI A;  5AIJ A;  2WQ7 A;  2XPZ A;  1FCH A;  1DNP A;  3ZHE A;  3S7B A;  2R5S A;  3G2S A;  4XE0 A;  2I9C A;  4DLQ A;  3LKU A;  2J4B A;  5T3R A;  2C0M A;  4L2Y A;  1FVF A;  2M63 A;  1N54 A;  1L5J A;  3FUM A;  3OAW A;  4GZC A;  3G2U A;  3TL5 A;  2PL2 A;  3CHR A;  2QFC A;  3EJN A;  2KCK A;  3D3M A;  3FP3 A;  2CHW A;  3B7T A;  4I2W A;  4ME2 A;  4UI9 C;  4DJA A;  1YA0 A;  3APC A;  3GZ2 A;  3HVE B;  3D9N A;  5FJY A;  4RSY A;  1FVH A;  3SI5 A;  2IOL A;  1OWM A;  4EBA G;  1JWG A;  1HX8 A;  3ASH A;  1Z6T A;  1Z3Y A;  3GYZ A;  3U4T A;  2WXN A;  1TJC A;  4DI4 A;  4HOR A;  4XKC A;  4WAF A;  3Q4A B;  4F1S A;  4ANU A;  2HM8 A;  3NF1 A;  1E96 B;  5AYW D;  4I43 A;  5JJ6 A;  2YNQ A;  3PZD A;  5CMY A;  3RIB A;  1SZA A;  4L1B A;  2ZU6 B;  4WNE A;  1NP7 A;  3CQC B;  3C98 A;  2OVF A;  5BNW A;  4I9E A;  3VTY A;  4B94 A;  2WXO A;  4Q69 A;  3PRE A;  4JA9 A;  4GCO A;  5G2N A;  3G2T A;  4O6F A;  1U3D A;  1UN9 A;  3FY4 A;  3RK6 A;  4BX8 A;  3IBE A;  3S7J A;  1H19 A;  5LCW C;  4FP7 A;  3FEX A;  4J6I A;  1OWN A;  2CHX A;  2XGS A;  4F7A A;  2KC7 A;  4ILH B;  4KMO A;  2WXH A;  2WXG A;  3FUF A;  4JVS A;  3CIA A;  4I6E A;  4CGW A;  4BX9 A;  5LP0 A;  3FDH A;  3VLD A;  2QY7 A;  4DPR A;  3QJZ A;  1QNF A;  3B7U X;  3B7R L;  3CQG B;  3CVY A;  2LNI A;  5EX0 A;  2XPI A;  2IJG X;  4EPZ A;  1DVP A;  4CT4 A;  5T4Y A;  1SZ9 A;  2OVB A;  1PY1 A;  1H6K A;  3Q15 A;  3IHY A;  3SNX A;  3Q5M A;  3APD A;  4CGV A;  2WM9 A;  2X6I A;  5ANR A;  5LX8 A;  2VTB B;  4CEM A;  3D9J A;  5KJL A;  3ASD A;  2FF4 A;  4HOQ A;  4LUN U;  4U63 A;  3OXL A;  5FZR A;  4J8F A;  3O4Z A;  1JUQ A;  4GZ5 A;  3CVX A;  5FQ6 A;  2I1K A;  1E8Y A;  3EIJ A;  3CVQ A;  4U04 A;  4ANX A;  4FAD A;  3ONL A;  2PM6 A;  3QNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...