1PC2A

Solution structure of human mitochondria fission protein fis1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mitochondria fission protein
publication title The Solution Structure of Human Mitochondria Fission Protein Fis1 Reveals a Novel TPR-like Helix Bundle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 40
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1pc2A00
3ZHEB 3CV0A 4XI9A 1ZBPA 3S7JA 4IN3B 3SZ7A 4EQFA 3CEQA 3MKRA 3Q47B 2PQRA 4BT9A 2L6JA 1KT1A 4WNGA 1P5QA 5G04C 4I1AA 4I2WA 5FJYA 1PC2A 3OXGA 5G05J 3LKUA 3PE4A 4XI0A 2LSUA 4AM9A 3CK9A 3HYMB 3CVQA 2PQNA 2LNIA 4F3VA 4HOSA 1QZ2A 4G24A 4WUYA 4G26A 3N71A 1HXIA 4N2SA 4G2VA 4ME2A 4I9EA 3URZA 4BTAA 2FI7A 1YA0A 3ASFA 4GCOA 3FWVA 4I2ZA 3RU0A 5JJTA 4U0ZA 4UQZA 1HZ4A 4GZ3A 3FFLA 1ZU2A 5LCWC 1XNFA 2C0LA 2DBAA 3AS5A 4WNEA 3QWVA 2WQHA 2KCVA 3Q15A 5FZSA 2IF4A 5FZRA 2ONDA 3Q4AB 2HO1A 3U4TA 2R5SA 2UWJG 3CK8A 5CCMA 5HQ8A 4JHRA 3S7BA 3O48A 1IYGA 2VQ2A 5ARFA 5KJKA 5DIZA 4N3BA 4BTBA 5BW8C 4A1SA 3PDNA 2FF4A 4UI9K 4KYOB 3E4BA 2VYIA 4U04A 3ASGA 3LY7A 4APOA 4GYYA 3S7DA 4GPKA 4WNFA 4YVOA 4O6FA 4U0SA 4WNDA 2Y4UA 3LY8A 4B94A 4GA1A 4NQ0A 4GYWA 4HOUA 4NRHB 3U3WA 2Y4TA 5M72A 1NA0A 1HH8A 2PZIA 2V5FA 2XGSA 5DBKA 3MA5A 5FTPA 5ARGA 4JA9A 5JJ6A 4CGVA 4AY6A 4N2QA 5KJLA 3CKBA 2P58C 2PL2A 5CCLA 4J8FA 4U07A 3UPVA 3LPZA 2KCKA 4G23A 3MV3B 5EX3A 2J9QA 1WM5A 4HOQA 4CGWA 3TG5A 3GW4A 4CDRA 3VTYA 1FCHA 2KCLA 3ZFWA 4UI9J 3ZN3A 4ABNA 4U0UA 3K9IA 4GZ5A 3BEEA 2FEZA 4HORA 3RKVA 3CVNA 2XEVA 3ASHA 2C0MA 4LEUA 3KAEA 4GA0A 3AS8A 5G05C 3ESKA 4N39A 3CKCA 3TGOA 2GW1A 4BWRA 3QKYA 5A6CA 5JJ7A 3Q5MA 2FO7A 4AY5A 3GZ2A 3R9AB 4N5CA 4GYOA 2VGYA 1ELWA 4GCNA 1OUVA 1W3BA 2JLBA 3ULQA 5EX0A 2HR2A 3MV2B 4BT8A 3AS4A 5G04J 2BUGA 4Y6CA 4I17A 4J8EA 4GA2A 2VSYA 3TG4A 4Y6WA 5D0OD 3RIBA 4H7YA 3PE3A 3QDNA 3OXLA 4RG9A 4KBQA 3FP3A 2VGXA 4H7XA 4RG6A 2HYZA 2MHKA 3EDTB 4J8DA 5C1DA 2LSVA 4XIFA 4UQYA 1TJCA 1A17A 3JYSA 1NA3A 2OOEA 5A7DB 4AIFA 2VSNA 2VGXB 5LCWJ 3CVPA 3GZ1A 3UQ3A 3WXXA 1E96B 2XCCA 3LCAA 3GYZA 5HI7A 5D0QD 2XGMA 3UUXA 4YVQC 4HOTA 3ASDA 4N3CA 3RJVA 3TAXA 3LYAA 4J0UA 3ZGQA 4W9RA 4I9CA 2AVPA 2C2LA 3QWPA 2YQ8A 1Y8MA 1NZNA 4G1TA 1IHGA 4JA7A 3RO2A 5KJNA 4G25A 5BNWA 2KATA 2NC9A 1QQEA 1B89A 3ZPJA 3IEGA 2XPIA 2I6HA 3KD7A 4UQXA 5FT9A 5KJMA 1WAO1 5CHEE 4GZ6A 3KS2A 3CVLA 5AYWD 2IFUA 3LY9A 3SF4A 3CK7A 3Q49B 2XCBA 3OXFA 4YNDA 2XGOA 1ELRA 2QFCA 4UI9C 2FBNA 3RO3A 4N3AA 2E2EA 2UY1A 2KC7A 3MEKA 4KXKB 3S7FA 5BT1A 5FZQA 1KT0A 5EKQD 3ZHEA 2YHCA 3QWWA 2Q7FA 1KLXA 2UY1B 2WPVA 4JL0A 3VTXA 3QOUA 3NF1A
chains in the Genus database with same CATH superfamily
1UJKA 3ESLA 3HXFA 2BKGA 3U64A 2IY0C 4KVOA 3SFZA 3CEQA 2I9CA 4P29A 4UWHA 1Z3XA 4BT9A 1SA4A 4XE0A 2LXMA 1OWLA 2X6KA 4LG6A 3FTUA 5B1BE 1PY1A 3B7BA 4LERA 4FULA 3FU5A 2V0PA 3FH7A 3LVQE 5CERB 3HYMB 3CVQA 3DBSA 2P9KG 4EZJA 3V30A 1IQRA 5AN8A 4G26A 2LAHA 4DRXE 3GZSA 3N71A 2GRNB 3CGHA 5FQ6A 4JEUA 3JXJA 3URZA 3HHMA 3SY2A 3ASFA 1EYHA 3RU0A 3L22A 4XKBA 4GZ3A 3FFLA 2YINA 4F53A 3D9OA 4F1SA 3SO8A 1E8WA 3PNLB 4WNEA 2ZGGA 5LOZA 2BF0X 3E33A 4Q96A 2KCVA 5CEAA 1NL4A 3SFYA 5FZRA 3T5XA 4RQIA 1E8ZA 2I1KA 2UWJG 3S7BA 4HLEA 1BPOA 1H19A 4DPRA 2ZXWE 4JB8P 5BV0A 3E30A 4HS2A 4K0RA 3PZ3A 1N95A 1OCZE 3DXMG 3IXEA 3UT8A 4A55A 1JUQA 3CSTA 3FUFA 1JCSA 3ASGA 4C48B 4APOA 3PVLA 1YCSB 1EDUA 3ZNGA 2MYOA 4YVOA 4O6FA 1U2VG 1A5EA 4DX7D 4GA1A 4NQ0A 1G3NB 2P9IG 3FEXA 4HOUA 1FVHA 2Y4TA 3V2XA 3VLFA 4J6IA 3ONKA 3TL5A 2PZIA 2V5FA 5T8IA 3UM1A 4WWOA 2PM6A 4DJAA 3MA5A 5FTPA 5ARGA 4LNUD 4CDMA 2AW6A 5JJ6A 3W9FA 3FUHA 4N2QA 1OWPA 1OWMA 5KJLA 2JABA 3DSWA 5H7PA 3ENEA 2QZAA 4U07A 2F0YA 3SD5A 3LPZA 2R05A 3MV3B 3EIJA 5FINA 2GGFA 3RRUA 2J9QA 5HRYA 1K3ZD 1HFAA 2OVBA 1N4SA 4KT6B 2CG2A 5EDSA 2WVIA 3D9HA 3ZFWA 4HVBA 3EU5A 4GTMA 3NAWA 5AENA 3B7TA 3BEEA 3RKVA 3MKQB 5KWDA 1MJ0A 4GU5A 3PZDA 4XKCA 3ASOE 4JZYA 3BG1B 4GMLA 4UWKA 3ZYQA 2R17C 5BV1A 4DUIA 4GTVA 3AS8A 2IJGX 3CKCA 4A1GA 4DX6D 2B0OE 4AOFA 3DSXA 3QKYA 5JJ7A 3HXEA 2FO7A 2Y3AA 3IBEA 4I43A 4WWPA 3R9AB 4N5CA 3D9LA 4OVUA 4GCNA 4AV7A 4GTPA 5AIJA 2P9UG 3MV2B 1MX2A 4UUCA 4BT8A 1UG3A 4L2LA 4Y6CA 3PZ1A 2ILRA 1OWOA 2WXPA 4J8EA 4GTOA 4ANWA 1DNPA 2XEHA 1MX6A 3RIBA 3PE3A 3QDNA 4WWNA 4EPZA 2J49A 4KBQA 2H6GA 1OY3D 3B7UX 3KEZA 4RVBA 4CZ2D 4F7AA 3D9JA 2V8SE 3KSQA 5G55A 3EDTB 4J8DA 2VGEA 2LAIA 3HRAA 4M7CA 4N5QA 2LUHA 3ULYA 1HG2A 1NA3A 4NIKA 3PNTB 2AXVA 5ENRD 3CVWA 1FPPA 4AIFA 3DSUA 3MYVA 3Q78A 3TJPA 2VSNA 2VGXB 3C3RA 4D10C 3DSVA 3IV0A 4AJWA 2XCCA 1N52A 2XRYA 1BLXB 3UTMA 1QNFA 3AU5A 5D0QD 1TEZA 4HOTA 2KM4A 3CLJA 4PUCA 3FH5A 2V4LA 3ZGQA 4HBDA 2AVPA 4UWGA 2YQ8A 1H2TC 4G1TA 2WQ6A 3ML9A 3G2UA 3FU6A 2NC9A 3ZPJA 3FTYA 5EIDA 2XPIA 1NFIE 2I6HA 1WY6A 5FT9A 2RFAA 2CHWA 3UMVA 5CHEE 4DX2A 2WXQA 3KS2A 2RG8A 4CT4A 3QAQA 5AYWD 3Q9UC 3B95A 4TUUA 4GTTA 1SZAA 3NOCD 1ELRA 3CHPA 3SHFA 1N0RA 3JQ1A 1HX8A 5EKQD 3ZHEA 3Q7AA 3CVUA 3L9TA 1N94A 2UY1B 2ETCA 1H0AA 4CRWA 1H6OA 3NF1A 3D9PA 3TWWA 5AJDA 2X6FA 3W9GA 1Z3YA 4JD2G 4MS6A 4FLBA 2DYSE 3RRMB 4EQFA 3FHEA 3RSEG 3EHNA 4PH4B 4DX1A 3CVVA 1H2UA 5EN5D 1TJFA 3RAUA 2RKKA 3CR3A 1P5QA 4NURA 4I2WA 3ZEFA 2GRLA 5J08A 1PC2A 2L6BA 3BUAA 5G05J 5KBAA 3PE4A 2DVWA 4XI0A 2LSUA 4B89A 2R02A 1N11A 2PQNA 5CMYA 3JCKC 3UM2A 5ENTD 3CVXA 2CFZA 4QFVA 3TWXA 4WUYA 3I4RB 3HXCA 4ME2A 2XS8A 2WXHA 3LVRE 4I2ZA 5JJTA 4U0ZA 5ITZF 1HZ4A 3FUEA 4FC8A 2DZOA 2J08A 1XNFA 2CHXA 1FT1A 1KPSB 4K03A 5BPPA 3HVEB 3C3QA 1Z6TA 5FZSA 2IF4A 1BU9A 3U4TA 2GRMA 4LSZE 1D8EA 3O48A 2I1JA 1IYGA 2JEKA 4DLQA 3UIPC 5KJKA 5DIZA 1DCQA 2BTDA 2EQXA 3FUNA 5BW8C 3PDNA 1WDYA 4U04A 2VYIA 3LY7A 1UOHA 3UI2A 4GAAA 3P2BA 2A4ZA 4U96D 3SGHA 4GTSA 5T4YA 3UT7A 5LP0A 1RW2A 4U0SA 4WNDA 3QC1A 5E76A 2XHEA 2QYUA 3AG2E 1KZPA 1HH8A 4JPSA 1OCRE 5ENQD 5G2NA 4APFA 4ATZD 3KSLA 4CGVA 4HRNA 3SQVA 5CCLA 3I5PA 2VTBA 4OAUC 2DYRE 3NB2A 4CDNA 4A63B 4GB9A 3TG5A 4ZFHA 2H6HA 4FHKA 3VLDA 3APFA 4MKTA 2IQCA 2RFMA 3K9IA 3T8KA 3R9MA 4O60A 4DX5D 4CCAA 1E90A 1O5MA 2FEZA 2L0IA 2KZTB 1KZOA 2V5QC 2XEVA 3ASNE 4UWFA 3S2AA 3KAEA 3HXDA 2EILE 2XENA 3EHRA 5G05C 2DIWA 4N39A 1IXVA 2IONA 4BWRA 2DCPA 3ML8A 3DWLG 4AEZC 3AJIA 1TNOA 4XEIG 4B0ZA 3G2WA 3GZ2A 2J4BA 3R7QA 2L9BA 1ELWA 1OUVA 2JLBA 4HNAD 5FWQA 2KXPC 2WB2A 3NZSA 4E6HA 5B3SE 5FQ8A 3TWRA 3LJ3A 4I17A 4GA2A 2VSYA 4Y6WA 1UN9A 5D0OD 3FTZA 4J8YA 4DLOA 3MX3A 3TWUA 3C3OA 3ABLE 2P9NG 4JVSA 4BSZB 2XQ0A 3ZYLA 5C1DA 2LSVA 5HS0A 2X6HA 1TJCA 5A7DB 3CHMA 3JQ0A 4L1BA 4U8VD 2ZU6B 5LCWJ 1Y6IA 2CHZA 2WXJA 3D9KA 1D8DA 1MYOA 2OEWA 3UQ3A 1X5BA 2KBXA 2B6CA 3LCAA 4HRMB 3IKOB 3GYZA 1OCOE 2XPZA 5LFAA 3L13A 2XGMA 4A3VA 1S0PA 2Y69E 1E7VA 2ZISA 3RK6A 3CQCB 4N3CA 3U9WA 4LUNU 1AP7A 3L82A 4NACA 3TAXA 3LYAA 4DK5A 4J0UA 5KNHD 4W9RA 4JHJA 2IEJA 3PS6A 4R7LA 3F6QA 3QWPA 3CHRA 3ULEG 4BERA 2L0TB 3DPDA 4JA7A 4GZDA 2ZIRA 1RZ4A 5BNWA 2KATA 1SQMA 2ETAA 1B89A 1O1RA 4UQXA 4EBAG 1HO8A 1WAO1 1E7UA 2AXUA 4GZ6A 3ZYKA 2IFUA 1FT2A 3EIQC 4OAVB 3Q49B 3PRZA 3OAWA 2FBNA 1L5JA 1DCEA 3D9NA 2IO3C 4GTQA 3MEKA 3MGBA 2IO2C 5ANRA 4EHMA 5FZQA 2IOLA 3T9KA 1YYHA 4MLPA 3V31A 4Q94A 2Q7FA 4U7EB 1H2VC 5C2YA 5AJLA 1SA5A 1N54A 1PAQA 2WXOA 4L23A 4JL0A 4KZCA 1JPLA 1TNBA 3QOUA 1N4QA 2H6FA 3CV0A 3PZ4A 2WMNA 4FU3A 3ZKJA 3CQGB 4JW1A 1UN8A 1ZBPA 5JHAA 2CG3A 2PM7A 3MKRA 2L6JA 3FUJA 4LCTA 3FTVA 4WNGA 4I1AA 1V54E 5FJYA 2QC9A 4AM9A 3OTNA 1INZA 3MZLB 2ETBA 3PEVB 2LNIA 4M3OA 4F3VA 4HOSA 2HM8A 3MCXA 2Y1LE 1H6KA 2OCCE 4CYMD 4G2VA 4I9EA 4BTAA 4PS3A 1UW4B 3P1UA 3FTSA 1FVFA 1ZU2A 1ELKA 5LCWC 2MRIA 2J8SD 3AS5A 4B93B 4HRLA 2X38A 2WQHA 1MHQA 2WXGA 1ZB1A 4PDXA 3DEPA 2ONDA 1IQUA 3Q4AB 1D9SA 4PS7A 5D2MC 4HXIA 4Z68A 3CK8A 3FUDA 5HQ8A 4JHRA 2F37A 3CVYA 2VQ2A 5ARFA 4HB5A 4PS8A 4JXTA 4J7WA 3D9IA 1TN7A 3TWSA 2LO6A 4N3BA 3FY4A 4ATGA 2YNQA 4YDYA 4KYOB 3E4BA 2GRPB 3HIZA 4C0MA 3Q73A 4GPKA 2Y0BG 4WNFA 3T8MA 4G11A 2Y4UA 4L2YA 2MOWA 1QBQA 4GYWA 1TNUA 1EF1C 3FUKA 4AVXA 5BUZA 5JA4D 1Z5SC 1NA0A 2P9LG 4JHKA 5DBKA 1S64A 4OVVA 1SVXA 5EYLA 4AY6A 3ZXSA 3BU8A 2OVFA 3E34A 3CIAA 2GROB 4J8FA 3UPVA 2KCKA 4G23A 3G2VA 3HXBA 2GRQB 1WM5A 3AU4A 3I4GA 1O1SA 4I1MA 3LDZA 1XGWA 3PH0C 2WXLA 5CRVA 4XX5A 3GW4A 3MKQA 1FCHA 2KCLA 2QY7A 1HS6A 4UI9J 4URKA 3L08A 2A5EA 3EUVA 3TWQA 2F8XK 3C72A 4GZ5A 4ANUA 4ILIA 5JHBA 3DSTA 4HORA 3FTXA 1IKND 2YHEA 3CVNA 1MZCA 2VJ8A 2AWIA 2C0MA 3DRAA 3J5QB 3CHQA 2GW1A 1X81A 3TXMA 3ZW3A 4BESA 5LX8A 4TUMA 3KEAA 4ILGA 2X6JA 5ANLA 5EYPF 4GYOA 1JWFA 2FULA 1W3BA 4FA6A 4RSYA 5ENOD 2EIJE 2HR2A 5CRUA 2R03A 2EINE 1MQSA 2HE0A 5G04J 2LXLA 3V2OA 3IHYA 2J09A 3E32A 4FADA 3ZUVB 3TXNA 1UJJA 3SBTB 2WXFA 3LJNA 3OXLA 4YDEA 4RG9A 4TV3A 3FP3A 4LNBA 4L7TA 4K5BA 3AG3E 2VGXA 4H7XA 3ZVVA 4RG6A 3J5PA 2VSXE 3FULA 4L9PA 3TWVA 4UQYA 4I1OB 1BI8B 1S63A 1A17A 2OOEA 3L6AA 4ACLA 3UKRG 3PREA 4HI8A 1HF8A 4UWLA 3CVPA 1K1BA 1U3CA 1LF8A 3G2TA 3SI5A 2BEDA 1E8YA 4J8SA 4B8AA 3APCA 5CECB 3FUIA 3JXIA 1MX4A 3FU3A 5AQBA 1OT8A 3O4ZA 4Q69A 4KVMA 3SBSA 3BG0B 2C2LA 5KCMA 4LRZA 1Y8MA 1NZNA 3QJZA 3QB2A 3Q7FA 1IHGA 3RO2A 5KJNA 2NXPA 3HG0D 4AXHA 3DEOA 1TNYA 5D66A 4BSXA 4FHJA 5FIOA 4X8QA 4F1PA 1QYMA 5EIBE 5AQ7A 1DVPA 3KD7A 2GRRB 3PUKA 3APDA 2NSZA 4RLYA 5ENPD 4O1OA 4BX8A 3FEYA 3D9MA 3SF4A 3CK7A 4YNDA 1TN6A 5CBOA 1DC2A 4UI9C 4HFGA 4QQIA 1K1AA 4OYSA 1LD7A 2UY1A 2R59A 3CSFA 2KC7A 2WXNA 3B7SA 3S7FA 5BT1A 4U95D 3UIOC 4IYPA 3ABKE 1KLXA 3FH8A 4GZCA 1K8KG 3UT4A 4CT0A 5A23A 3NQPA 4TXRA 3ZHEB 3NBNB 1OXJA 5E75A 2A5UA 4XI9A 2WXKA 2XEEA 2WXIA 2XS1A 3S7JA 3HDXA 4IN3B 4AP2A 4GTRA 3SZ7A 4TRQA 2IOSA 3Q47B 2PQRA 3QNKA 4I6GA 3EU9A 1KT1A 5G04C 3OXGA 3LKUA 3E37A 4EZLA 3B13A 1U3DA 4MRUA 3CK9A 3LS8A 5AQAA 4KZ0A 4FJYA 1QZ2A 2OEVA 3U66A 4G24A 5EILA 4HI9A 1JWGA 1Q2ZA 5AQ9A 3ZXPA 1HXIA 4N2SA 4U8YD 4G8LA 2FI7A 3HVEA 5KNGA 1YA0A 4GCOA 3FWVA 4TXPA 2CFUA 1LTXA 4UQZA 3V79K 1TNZA 3ZU7B 2OV8A 2XZDG 3L16A 3Q75A 5CMWA 3CHOA 2C0LA 2DBAA 3TWTA 3QWVA 2I2OA 3Q15A 3BQOA 3UXGA 3ABME 2HO1A 3ISMC 2R5SA 3AG1E 5CCMA 2EIME 4GPMA 5AAOA 3C5RA 2QYJA 3NOGD 2V4HC 3L54A 3RRNB 2WXRA 4BTBA 3ONLA 4A1SA 2FF4A 4UI9K 4WAFA 1HG5A 4I6JA 2ZGDA 4ZHBA 4GYYA 1YMPA 4C9BB 2E0IA 3MJWA 5JMND 2H6IA 3S7DA 1IHBA 5ENSD 2P2CP 3LY8A 4B94A 2WQ7A 4NRHB 3JUIA 3U3WA 4F6RD 3PUJA 4BEPA 4O1PA 5M72A 1TN8A 1JCQA 3FTWA 4DI3A 4EECA 2FO1E 2XGSA 3LXUX 4K5AB 4JA9A 4TXQA 3CKBA 3D3MA 3R7RA 4FJZA 2P58C 2PL2A 1TYQG 1LD8A 2AJAA 4BFRA 5EX3A 1HE8A 3WG7E 3QARA 4HOQA 4CGWA 2XRZA 3PZ2A 4GMJA 4U63A 2KZTA 2VTBB 4CDRA 4FLHA 3VTYA 3AAAC 3ZN3A 3CHSA 4ABNA 4U0UA 4MBGA 1OCCE 3UKUG 4GMRA 4XZ4A 1OWNA 3ASHA 5AARA 3ZYMA 3I3NA 1V55E 4LEUA 1JCRA 3L17A 4GA0A 4BY6A 2P9SG 1AWCB 4A3TA 1VDYA 3ESKA 3TGOA 4KMOA 4JC8A 1BI7B 2XPYA 3T5VA 1N9AA 4V3IA 2DWZA 5A6CA 3Q5MA 2P9PG 5FQ4A 4AY5A 2WMOA 2VGYA 4CEMA 3UM0A 2AXZA 3ULQA 5EX0A 3VLEA 3UINC 1NP7A 4B8CB 4YDOA 3DXKG 4HQDA 3AS4A 2F8YA 2BUGA 1N0QA 5CBNA 4IRUA 1O1TA 3TG4A 3Q9NC 2VSOE 3X2QE 4H7YA 3B7RL 2NYJA 3LEWA 5FQ7A 3C98A 2PNNA 4U8HA 1GW6A 3NZUA 4E85A 2BKKB 1SZ9A 2HYZA 2MHKA 2R2LA 4XIFA 5BXUA 5J90A 3JYSA 5B1AE 3UM3A 2J4DA 4BX9A 1BD8A 4ACKA 3IHVA 1N4RA 3QK0A 4EBAA 3GZ1A 4YDWA 3WXXA 1E96B 5HKPA 3ZIMA 3DSSA 3EHMA 4ANXA 5HI7A 3JUEA 3UUXA 4YVQC 1SW6A 4LNGA 3ASDA 3EJNA 2EIKE 5CEDB 4I6EA 1E8XA 3RJVA 1WG0A 3FUMA 4I9CA 5ENNA 1TR4A 2WXMA 3PEUB 2J07A 4HLLA 2DZNA 4FP7A 4G25A 1QQEA 4IULA 2WM9A 3IEGA 2X6IA 2X3MA 1N4PA 4G8KA 5KJMA 2XZTG 5BXOA 1HU3A 3CVLA 3LY9A 3EHQA 4JEHA 4ANVA 2XCBA 3OXFA 2XGOA 4ILHB 3FDHA 4DI4A 1S70B 2QFCA 3DPYA 5IY5E 1H6PA 4C0EA 3RO3A 4N3AA 2E2EA 3Q79A 3UX4A 2IU1A 4EZKA 4KXKB 3ZRHA 3G2SA 1KT0A 4K5CA 1NI1A 2YHCA 1EPUA 2M63A 3FU0A 3QWWA 3SFXA 2WPVA 5T3RA 3AG4E 3VTXA 3SNXA 4BETA 2RD0A
chains in the Genus database with same CATH topology
1UJKA 3ESLA 3D9PA 3NQPA 3ZHEB 3CV0A 5AJDA 5E75A 2A5UA 2WMNA 4FU3A 4XI9A 2WXKA 2X6FA 3CQGB 3U64A 1Z3YA 4JW1A 1UN8A 2WXIA 1ZBPA 4KVOA 3S7JA 4MS6A 4FLBA 5JHAA 3HDXA 4IN3B 4AP2A 2CG3A 3SFZA 3RRMB 3SZ7A 4TRQA 4EQFA 2PM7A 2IOSA 3CEQA 3FHEA 2I9CA 3MKRA 2PQRA 3Q47B 3QNKA 4P29A 4UWHA 1Z3XA 3EHNA 4BT9A 4PH4B 4XE0A 3CVVA 1H2UA 1OWLA 2X6KA 4I6GA 2L6JA 3FUJA 4LCTA 3FTVA 1TJFA 1KT1A 3CR3A 1P5QA 4WNGA 5G04C 3FTUA 4NURA 4I1AA 4I2WA 2GRLA 3ZEFA 5J08A 1PY1A 4LERA 1PC2A 5FJYA 4FULA 3OXGA 5G05J 3LKUA 3FU5A 2V0PA 3FH7A 3LVQE 3PE4A 4XI0A 2LSUA 4B89A 4EZLA 4AM9A 3B13A 1U3DA 4MRUA 3CK9A 3HYMB 3OTNA 3CVQA 3DBSA 1INZA 3MZLB 3LS8A 5CMYA 2PQNA 3PEVB 2LNIA 4M3OA 3JCKC 4EZJA 4KZ0A 4F3VA 4HOSA 4FJYA 2HM8A 1IQRA 1QZ2A 3MCXA 3CVXA 2CFZA 4QFVA 4G24A 3U66A 4WUYA 3I4RB 1JWGA 4G26A 2LAHA 3GZSA 1H6KA 3N71A 1HXIA 3CGHA 4N2SA 5FQ6A 4G2VA 4JEUA 4ME2A 4I9EA 3URZA 3HHMA 4BTAA 2FI7A 3HVEA 2WXHA 1YA0A 3ASFA 3LVRE 4GCOA 1EYHA 3FWVA 4PS3A 4I2ZA 3RU0A 5JJTA 2CFUA 4U0ZA 1HZ4A 4UQZA 3L22A 1UW4B 4XKBA 3P1UA 3FUEA 3FFLA 3FTSA 2YINA 4FC8A 4GZ3A 1FVFA 1ZU2A 1ELKA 2J08A 2OV8A 2MRIA 1XNFA 3L16A 2CHXA 4F53A 5CMWA 5LCWC 3CHOA 2C0LA 2DBAA 3AS5A 1E8WA 3D9OA 3PNLB 4WNEA 4F1SA 5LOZA 3QWVA 4K03A 2BF0X 5BPPA 2X38A 2I2OA 2WQHA 4Q96A 1MHQA 2KCVA 3HVEB 2WXGA 3Q15A 1Z6TA 5FZSA 4PDXA 2IF4A 5FZRA 3T5XA 2ONDA 1IQUA 3Q4AB 2HO1A 4PS7A 3U4TA 2GRMA 4HXIA 1E8ZA 2I1KA 2R5SA 2UWJG 3CK8A 3FUDA 5CCMA 5HQ8A 4JHRA 3S7BA 3O48A 2I1JA 4HLEA 3CVYA 1BPOA 1H19A 2VQ2A 4DPRA 5ARFA 1IYGA 2JEKA 4PS8A 4JXTA 3D9IA 4DLQA 5BV0A 4HS2A 5KJKA 5DIZA 3L54A 4K0RA 2LO6A 3RRNB 2WXRA 4N3BA 2BTDA 2EQXA 3FUNA 4BTBA 5BW8C 3UT8A 4A55A 3ONLA 3FY4A 3PDNA 4A1SA 4ATGA 2FF4A 1JUQA 4UI9K 4WAFA 2YNQA 1HG5A 3CSTA 4KYOB 3E4BA 2VYIA 3FUFA 4I6JA 4U04A 3ASGA 3LY7A 3PVLA 4APOA 3HIZA 1EDUA 4GYYA 4C0MA 4C9BB 4GAAA 3P2BA 2E0IA 3MJWA 2A4ZA 3SGHA 5T4YA 3UT7A 5LP0A 3S7DA 4GPKA 4WNFA 3T8MA 4YVOA 4O6FA 4U0SA 4WNDA 4G11A 2Y4UA 3LY8A 3QC1A 5E76A 4GA1A 4L2YA 4NQ0A 4B94A 2WQ7A 2XHEA 3FEXA 2MOWA 4GYWA 4HOUA 4NRHB 3JUIA 3U3WA 1EF1C 3FUKA 1FVHA 2Y4TA 4AVXA 3PUJA 5BUZA 5M72A 1NA0A 3VLFA 3FTWA 1HH8A 4J6IA 4DI3A 4EECA 4JPSA 3ONKA 3TL5A 2PZIA 2V5FA 2XGSA 4JHKA 5T8IA 5DBKA 4WWOA 5G2NA 2PM6A 4DJAA 3MA5A 5FTPA 5ARGA 3LXUX 4JA9A 4APFA 4CDMA 2AW6A 4OVVA 5JJ6A 4CGVA 3FUHA 4AY6A 4N2QA 1OWPA 1OWMA 3ZXSA 5KJLA 3CKBA 2OVFA 3D3MA 3R7RA 4FJZA 2P58C 3CIAA 2PL2A 3ENEA 5CCLA 4J8FA 4U07A 3UPVA 3I5PA 3SD5A 3LPZA 4BFRA 2KCKA 4G23A 2VTBA 3MV3B 3EIJA 5EX3A 1HE8A 3G2VA 4CDNA 2GGFA 3QARA 3RRUA 2J9QA 1WM5A 3AU4A 3I4GA 4GB9A 4HOQA 4I1MA 3LDZA 1XGWA 3PH0C 1HFAA 2OVBA 2WXLA 4CGWA 2XRZA 3TG5A 4XX5A 4GMJA 4U63A 4FHKA 3GW4A 2KZTA 4KT6B 3VLDA 3MKQA 2CG2A 5EDSA 2VTBB 4CDRA 4FLHA 3VTYA 1FCHA 2WVIA 2KCLA 2QY7A 1HS6A 3ZFWA 4UI9J 4HVBA 4URKA 3APFA 4MKTA 2IQCA 3CHSA 3ZN3A 4ABNA 3L08A 4U0UA 3K9IA 5AENA 4GZ5A 3B7TA 4ANUA 4ILIA 4CCAA 5JHBA 1E90A 3BEEA 2FEZA 2L0IA 4HORA 3FTXA 2KZTB 3RKVA 3MKQB 2YHEA 3CVNA 2XEVA 4GU5A 4XZ4A 3PZDA 4UWFA 1OWNA 4XKCA 3S2AA 3ASHA 4JZYA 3ZYMA 3BG1B 3I3NA 2VJ8A 4GMLA 4UWKA 2AWIA 2C0MA 2R17C 3ZYQA 4LEUA 3KAEA 5BV1A 3L17A 4GA0A 4BY6A 3CHQA 4A3TA 1VDYA 3AS8A 5G05C 2DIWA 3ESKA 2IJGX 3CKCA 4N39A 4A1GA 3TGOA 4KMOA 2GW1A 2IONA 2DCPA 4JC8A 4BWRA 4AOFA 2XPYA 3TXMA 3ZW3A 3T5VA 4V3IA 5LX8A 3ML8A 3QKYA 4AEZC 5A6CA 4ILGA 5JJ7A 2X6JA 3Q5MA 2FO7A 5ANLA 5FQ4A 4AY5A 2Y3AA 4B0ZA 3IBEA 4I43A 2WMOA 3G2WA 3GZ2A 4WWPA 2J4BA 3R9AB 4N5CA 3R7QA 4GYOA 1JWFA 2VGYA 2FULA 2L9BA 1ELWA 3D9LA 4GCNA 4OVUA 1OUVA 4CEMA 1W3BA 2AXZA 2JLBA 3ULQA 4FA6A 4RSYA 4AV7A 5EX0A 3VLEA 2HR2A 5AIJA 1NP7A 5FWQA 3MV2B 4B8CB 2WB2A 3NZSA 4BT8A 3AS4A 1MQSA 1UG3A 4E6HA 5FQ8A 5G04J 4L2LA 2BUGA 3IHYA 4Y6CA 2ILRA 1OWOA 3LJ3A 4I17A 2WXPA 4J8EA 4IRUA 4ANWA 2J09A 4GA2A 2VSYA 3TG4A 2VSOE 4FADA 4Y6WA 1UN9A 5D0OD 3FTZA 3TXNA 1DNPA 1UJJA 4DLOA 3SBTB 3RIBA 4H7YA 3PE3A 3QDNA 2WXFA 4WWNA 3B7RL 3OXLA 4EPZA 2J49A 3LEWA 3MX3A 4KBQA 4RG9A 5FQ7A 4TV3A 3B7UX 3C98A 3FP3A 4U8HA 4L7TA 3KEZA 4RVBA 1GW6A 4JVSA 3NZUA 4F7AA 4E85A 2VGXA 2V8SE 2XQ0A 3D9JA 4H7XA 3ZYLA 3ZVVA 1SZ9A 2HYZA 4RG6A 5G55A 2MHKA 2VSXE 3EDTB 4J8DA 3FULA 5C1DA 2LSVA 4XIFA 4UQYA 2LAIA 4I1OB 2X6HA 1TJCA 1HG2A 5J90A 1A17A 3JYSA 1NA3A 2OOEA 3L6AA 3PNTB 5A7DB 2AXVA 3CHMA 3JQ0A 4ACLA 3CVWA 4AIFA 4L1BA 3MYVA 2J4DA 3TJPA 3PREA 2VSNA 2ZU6B 4BX9A 2VGXB 1HF8A 4UWLA 5LCWJ 1Y6IA 2CHZA 2WXJA 3CVPA 4ACKA 3D9KA 3IHVA 4D10C 1U3CA 3QK0A 4EBAA 3IV0A 4AJWA 3GZ1A 3UQ3A 3WXXA 1X5BA 1E96B 1LF8A 2XCCA 1N52A 2XRYA 3G2TA 3SI5A 3LCAA 3IKOB 3ZIMA 1QNFA 3EHMA 4ANXA 1E8YA 3GYZA 5HI7A 4J8SA 2XPZA 4B8AA 3AU5A 5D0QD 5LFAA 3APCA 3L13A 2XGMA 3UUXA 4A3VA 1S0PA 4YVQC 1TEZA 4HOTA 3ASDA 1E7VA 3FUIA 2KM4A 3EJNA 3RK6A 3CQCB 4N3CA 3CLJA 4PUCA 4LUNU 3U9WA 3FH5A 3FU3A 4I6EA 4NACA 1E8XA 3O4ZA 3RJVA 3TAXA 3LYAA 2V4LA 4DK5A 4Q69A 4J0UA 4KVMA 3ZGQA 3FUMA 4W9RA 3SBSA 4I9CA 3BG0B 4JHJA 3PS6A 5ENNA 2AVPA 4R7LA 2C2LA 5KCMA 4UWGA 3QWPA 2YQ8A 3CHRA 4LRZA 1Y8MA 1NZNA 1H2TC 4G1TA 2L0TB 3QJZA 2WXMA 3QB2A 1IHGA 3DPDA 3PEUB 4JA7A 3RO2A 2J07A 3ML9A 4GZDA 2NXPA 3G2UA 3FU6A 5KJNA 2WQ6A 4AXHA 4FP7A 4G25A 4BSXA 2KATA 5BNWA 2NC9A 1SQMA 1QQEA 4FHJA 4IULA 2WM9A 1B89A 3ZPJA 3FTYA 3IEGA 2X6IA 2XPIA 1DVPA 2X3MA 2I6HA 3KD7A 1WY6A 4UQXA 5FT9A 4EBAG 2CHWA 3APDA 3PUKA 3UMVA 5KJMA 2NSZA 1HO8A 1WAO1 5CHEE 1E7UA 2AXUA 2WXQA 3KS2A 4GZ6A 1HU3A 3ZYKA 2RG8A 3CVLA 4BX8A 4CT4A 3QAQA 5AYWD 2IFUA 3LY9A 3EIQC 3FEYA 3D9MA 4JEHA 4TUUA 3SF4A 4ANVA 3CK7A 3Q49B 2XCBA 3OXFA 1SZAA 3OAWA 2XGOA 3PRZA 4ILHB 4YNDA 1ELRA 3FDHA 4DI4A 2QFCA 4UI9C 4C0EA 2FBNA 1L5JA 3CHPA 4HFGA 3D9NA 3RO3A 4OYSA 4N3AA 2E2EA 2UY1A 2R59A 3UX4A 3CSFA 2KC7A 3MEKA 2IU1A 2WXNA 3MGBA 3B7SA 5ANRA 4EZKA 4KXKB 3ZRHA 3S7FA 5BT1A 3SHFA 3G2SA 5FZQA 3JQ1A 1KT0A 1HX8A 2IOLA 5EKQD 3ZHEA 4MLPA 3CVUA 2YHCA 1EPUA 2M63A 3FU0A 2Q7FA 3QWWA 4IYPA 4Q94A 1KLXA 1H2VC 5C2YA 2UY1B 3FH8A 4GZCA 5AJLA 3UT4A 1N54A 4CT0A 1PAQA 1H0AA 2WXOA 2WPVA 4L23A 5T3RA 4JL0A 4KZCA 3VTXA 1JPLA 3SNXA 4CRWA 3QOUA 3NF1A 2RD0A 5A23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZHE B;  3CV0 A;  4XI9 A;  1ZBP A;  3S7J A;  4IN3 B;  3SZ7 A;  4EQF A;  3CEQ A;  3MKR A;  3Q47 B;  2PQR A;  4BT9 A;  2L6J A;  1KT1 A;  4WNG A;  1P5Q A;  5G04 C;  4I1A A;  4I2W A;  5FJY A;  1PC2 A;  3OXG A;  5G05 J;  3LKU A;  3PE4 A;  4XI0 A;  2LSU A;  4AM9 A;  3CK9 A;  3HYM B;  3CVQ A;  2PQN A;  2LNI A;  4F3V A;  4HOS A;  1QZ2 A;  4G24 A;  4WUY A;  4G26 A;  3N71 A;  1HXI A;  4N2S A;  4G2V A;  4ME2 A;  4I9E A;  3URZ A;  4BTA A;  2FI7 A;  1YA0 A;  3ASF A;  4GCO A;  3FWV A;  4I2Z A;  3RU0 A;  5JJT A;  4U0Z A;  4UQZ A;  1HZ4 A;  4GZ3 A;  3FFL A;  1ZU2 A;  5LCW C;  1XNF A;  2C0L A;  2DBA A;  3AS5 A;  4WNE A;  3QWV A;  2WQH A;  2KCV A;  3Q15 A;  5FZS A;  2IF4 A;  5FZR A;  2OND A;  3Q4A B;  2HO1 A;  3U4T A;  2R5S A;  2UWJ G;  3CK8 A;  5CCM A;  5HQ8 A;  4JHR A;  3S7B A;  3O48 A;  1IYG A;  2VQ2 A;  5ARF A;  5KJK A;  5DIZ A;  4N3B A;  4BTB A;  5BW8 C;  4A1S A;  3PDN A;  2FF4 A;  4UI9 K;  4KYO B;  3E4B A;  2VYI A;  4U04 A;  3ASG A;  3LY7 A;  4APO A;  4GYY A;  3S7D A;  4GPK A;  4WNF A;  4YVO A;  4O6F A;  4U0S A;  4WND A;  2Y4U A;  3LY8 A;  4B94 A;  4GA1 A;  4NQ0 A;  4GYW A;  4HOU A;  4NRH B;  3U3W A;  2Y4T A;  5M72 A;  1NA0 A;  1HH8 A;  2PZI A;  2V5F A;  2XGS A;  5DBK A;  3MA5 A;  5FTP A;  5ARG A;  4JA9 A;  5JJ6 A;  4CGV A;  4AY6 A;  4N2Q A;  5KJL A;  3CKB A;  2P58 C;  2PL2 A;  5CCL A;  4J8F A;  4U07 A;  3UPV A;  3LPZ A;  2KCK A;  4G23 A;  3MV3 B;  5EX3 A;  2J9Q A;  1WM5 A;  4HOQ A;  4CGW A;  3TG5 A;  3GW4 A;  4CDR A;  3VTY A;  1FCH A;  2KCL A;  3ZFW A;  4UI9 J;  3ZN3 A;  4ABN A;  4U0U A;  3K9I A;  4GZ5 A;  3BEE A;  2FEZ A;  4HOR A;  3RKV A;  3CVN A;  2XEV A;  3ASH A;  2C0M A;  4LEU A;  3KAE A;  4GA0 A;  3AS8 A;  5G05 C;  3ESK A;  4N39 A;  3CKC A;  3TGO A;  2GW1 A;  4BWR A;  3QKY A;  5A6C A;  5JJ7 A;  3Q5M A;  2FO7 A;  4AY5 A;  3GZ2 A;  3R9A B;  4N5C A;  4GYO A;  2VGY A;  1ELW A;  4GCN A;  1OUV A;  1W3B A;  2JLB A;  3ULQ A;  5EX0 A;  2HR2 A;  3MV2 B;  4BT8 A;  3AS4 A;  5G04 J;  2BUG A;  4Y6C A;  4I17 A;  4J8E A;  4GA2 A;  2VSY A;  3TG4 A;  4Y6W A;  5D0O D;  3RIB A;  4H7Y A;  3PE3 A;  3QDN A;  3OXL A;  4RG9 A;  4KBQ A;  3FP3 A;  2VGX A;  4H7X A;  4RG6 A;  2HYZ A;  2MHK A;  3EDT B;  4J8D A;  5C1D A;  2LSV A;  4XIF A;  4UQY A;  1TJC A;  1A17 A;  3JYS A;  1NA3 A;  2OOE A;  5A7D B;  4AIF A;  2VSN A;  2VGX B;  5LCW J;  3CVP A;  3GZ1 A;  3UQ3 A;  3WXX A;  1E96 B;  2XCC A;  3LCA A;  3GYZ A;  5HI7 A;  5D0Q D;  2XGM A;  3UUX A;  4YVQ C;  4HOT A;  3ASD A;  4N3C A;  3RJV A;  3TAX A;  3LYA A;  4J0U A;  3ZGQ A;  4W9R A;  4I9C A;  2AVP A;  2C2L A;  3QWP A;  2YQ8 A;  1Y8M A;  1NZN A;  4G1T A;  1IHG A;  4JA7 A;  3RO2 A;  5KJN A;  4G25 A;  5BNW A;  2KAT A;  2NC9 A;  1QQE A;  1B89 A;  3ZPJ A;  3IEG A;  2XPI A;  2I6H A;  3KD7 A;  4UQX A;  5FT9 A;  5KJM A;  1WAO 1;  5CHE E;  4GZ6 A;  3KS2 A;  3CVL A;  5AYW D;  2IFU A;  3LY9 A;  3SF4 A;  3CK7 A;  3Q49 B;  2XCB A;  3OXF A;  4YND A;  2XGO A;  1ELR A;  2QFC A;  4UI9 C;  2FBN A;  3RO3 A;  4N3A A;  2E2E A;  2UY1 A;  2KC7 A;  3MEK A;  4KXK B;  3S7F A;  5BT1 A;  5FZQ A;  1KT0 A;  5EKQ D;  3ZHE A;  2YHC A;  3QWW A;  2Q7F A;  1KLX A;  2UY1 B;  2WPV A;  4JL0 A;  3VTX A;  3QOU A;  3NF1 A; 
#chains in the Genus database with same CATH topology
 1UJK A;  3ESL A;  3HXF A;  2BKG A;  3U64 A;  2IY0 C;  4KVO A;  3SFZ A;  3CEQ A;  2I9C A;  4P29 A;  4UWH A;  1Z3X A;  4BT9 A;  1SA4 A;  4XE0 A;  2LXM A;  1OWL A;  2X6K A;  4LG6 A;  3FTU A;  5B1B E;  1PY1 A;  3B7B A;  4LER A;  4FUL A;  3FU5 A;  2V0P A;  3FH7 A;  3LVQ E;  5CER B;  3HYM B;  3CVQ A;  3DBS A;  2P9K G;  4EZJ A;  3V30 A;  1IQR A;  5AN8 A;  4G26 A;  2LAH A;  4DRX E;  3GZS A;  3N71 A;  2GRN B;  3CGH A;  5FQ6 A;  4JEU A;  3JXJ A;  3URZ A;  3HHM A;  3SY2 A;  3ASF A;  1EYH A;  3RU0 A;  3L22 A;  4XKB A;  4GZ3 A;  3FFL A;  2YIN A;  4F53 A;  3D9O A;  4F1S A;  3SO8 A;  1E8W A;  3PNL B;  4WNE A;  2ZGG A;  5LOZ A;  2BF0 X;  3E33 A;  4Q96 A;  2KCV A;  5CEA A;  1NL4 A;  3SFY A;  5FZR A;  3T5X A;  4RQI A;  1E8Z A;  2I1K A;  2UWJ G;  3S7B A;  4HLE A;  1BPO A;  1H19 A;  4DPR A;  2ZXW E;  4JB8 P;  5BV0 A;  3E30 A;  4HS2 A;  4K0R A;  3PZ3 A;  1N95 A;  1OCZ E;  3DXM G;  3IXE A;  3UT8 A;  4A55 A;  1JUQ A;  3CST A;  3FUF A;  1JCS A;  3ASG A;  4C48 B;  4APO A;  3PVL A;  1YCS B;  1EDU A;  3ZNG A;  2MYO A;  4YVO A;  4O6F A;  1U2V G;  1A5E A;  4DX7 D;  4GA1 A;  4NQ0 A;  1G3N B;  2P9I G;  3FEX A;  4HOU A;  1FVH A;  2Y4T A;  3V2X A;  3VLF A;  4J6I A;  3ONK A;  3TL5 A;  2PZI A;  2V5F A;  5T8I A;  3UM1 A;  4WWO A;  2PM6 A;  4DJA A;  3MA5 A;  5FTP A;  5ARG A;  4LNU D;  4CDM A;  2AW6 A;  5JJ6 A;  3W9F A;  3FUH A;  4N2Q A;  1OWP A;  1OWM A;  5KJL A;  2JAB A;  3DSW A;  5H7P A;  3ENE A;  2QZA A;  4U07 A;  2F0Y A;  3SD5 A;  3LPZ A;  2R05 A;  3MV3 B;  3EIJ A;  5FIN A;  2GGF A;  3RRU A;  2J9Q A;  5HRY A;  1K3Z D;  1HFA A;  2OVB A;  1N4S A;  4KT6 B;  2CG2 A;  5EDS A;  2WVI A;  3D9H A;  3ZFW A;  4HVB A;  3EU5 A;  4GTM A;  3NAW A;  5AEN A;  3B7T A;  3BEE A;  3RKV A;  3MKQ B;  5KWD A;  1MJ0 A;  4GU5 A;  3PZD A;  4XKC A;  3ASO E;  4JZY A;  3BG1 B;  4GML A;  4UWK A;  3ZYQ A;  2R17 C;  5BV1 A;  4DUI A;  4GTV A;  3AS8 A;  2IJG X;  3CKC A;  4A1G A;  4DX6 D;  2B0O E;  4AOF A;  3DSX A;  3QKY A;  5JJ7 A;  3HXE A;  2FO7 A;  2Y3A A;  3IBE A;  4I43 A;  4WWP A;  3R9A B;  4N5C A;  3D9L A;  4OVU A;  4GCN A;  4AV7 A;  4GTP A;  5AIJ A;  2P9U G;  3MV2 B;  1MX2 A;  4UUC A;  4BT8 A;  1UG3 A;  4L2L A;  4Y6C A;  3PZ1 A;  2ILR A;  1OWO A;  2WXP A;  4J8E A;  4GTO A;  4ANW A;  1DNP A;  2XEH A;  1MX6 A;  3RIB A;  3PE3 A;  3QDN A;  4WWN A;  4EPZ A;  2J49 A;  4KBQ A;  2H6G A;  1OY3 D;  3B7U X;  3KEZ A;  4RVB A;  4CZ2 D;  4F7A A;  3D9J A;  2V8S E;  3KSQ A;  5G55 A;  3EDT B;  4J8D A;  2VGE A;  2LAI A;  3HRA A;  4M7C A;  4N5Q A;  2LUH A;  3ULY A;  1HG2 A;  1NA3 A;  4NIK A;  3PNT B;  2AXV A;  5ENR D;  3CVW A;  1FPP A;  4AIF A;  3DSU A;  3MYV A;  3Q78 A;  3TJP A;  2VSN A;  2VGX B;  3C3R A;  4D10 C;  3DSV A;  3IV0 A;  4AJW A;  2XCC A;  1N52 A;  2XRY A;  1BLX B;  3UTM A;  1QNF A;  3AU5 A;  5D0Q D;  1TEZ A;  4HOT A;  2KM4 A;  3CLJ A;  4PUC A;  3FH5 A;  2V4L A;  3ZGQ A;  4HBD A;  2AVP A;  4UWG A;  2YQ8 A;  1H2T C;  4G1T A;  2WQ6 A;  3ML9 A;  3G2U A;  3FU6 A;  2NC9 A;  3ZPJ A;  3FTY A;  5EID A;  2XPI A;  1NFI E;  2I6H A;  1WY6 A;  5FT9 A;  2RFA A;  2CHW A;  3UMV A;  5CHE E;  4DX2 A;  2WXQ A;  3KS2 A;  2RG8 A;  4CT4 A;  3QAQ A;  5AYW D;  3Q9U C;  3B95 A;  4TUU A;  4GTT A;  1SZA A;  3NOC D;  1ELR A;  3CHP A;  3SHF A;  1N0R A;  3JQ1 A;  1HX8 A;  5EKQ D;  3ZHE A;  3Q7A A;  3CVU A;  3L9T A;  1N94 A;  2UY1 B;  2ETC A;  1H0A A;  4CRW A;  1H6O A;  3NF1 A;  3D9P A;  3TWW A;  5AJD A;  2X6F A;  3W9G A;  1Z3Y A;  4JD2 G;  4MS6 A;  4FLB A;  2DYS E;  3RRM B;  4EQF A;  3FHE A;  3RSE G;  3EHN A;  4PH4 B;  4DX1 A;  3CVV A;  1H2U A;  5EN5 D;  1TJF A;  3RAU A;  2RKK A;  3CR3 A;  1P5Q A;  4NUR A;  4I2W A;  3ZEF A;  2GRL A;  5J08 A;  1PC2 A;  2L6B A;  3BUA A;  5G05 J;  5KBA A;  3PE4 A;  2DVW A;  4XI0 A;  2LSU A;  4B89 A;  2R02 A;  1N11 A;  2PQN A;  5CMY A;  3JCK C;  3UM2 A;  5ENT D;  3CVX A;  2CFZ A;  4QFV A;  3TWX A;  4WUY A;  3I4R B;  3HXC A;  4ME2 A;  2XS8 A;  2WXH A;  3LVR E;  4I2Z A;  5JJT A;  4U0Z A;  5ITZ F;  1HZ4 A;  3FUE A;  4FC8 A;  2DZO A;  2J08 A;  1XNF A;  2CHX A;  1FT1 A;  1KPS B;  4K03 A;  5BPP A;  3HVE B;  3C3Q A;  1Z6T A;  5FZS A;  2IF4 A;  1BU9 A;  3U4T A;  2GRM A;  4LSZ E;  1D8E A;  3O48 A;  2I1J A;  1IYG A;  2JEK A;  4DLQ A;  3UIP C;  5KJK A;  5DIZ A;  1DCQ A;  2BTD A;  2EQX A;  3FUN A;  5BW8 C;  3PDN A;  1WDY A;  4U04 A;  2VYI A;  3LY7 A;  1UOH A;  3UI2 A;  4GAA A;  3P2B A;  2A4Z A;  4U96 D;  3SGH A;  4GTS A;  5T4Y A;  3UT7 A;  5LP0 A;  1RW2 A;  4U0S A;  4WND A;  3QC1 A;  5E76 A;  2XHE A;  2QYU A;  3AG2 E;  1KZP A;  1HH8 A;  4JPS A;  1OCR E;  5ENQ D;  5G2N A;  4APF A;  4ATZ D;  3KSL A;  4CGV A;  4HRN A;  3SQV A;  5CCL A;  3I5P A;  2VTB A;  4OAU C;  2DYR E;  3NB2 A;  4CDN A;  4A63 B;  4GB9 A;  3TG5 A;  4ZFH A;  2H6H A;  4FHK A;  3VLD A;  3APF A;  4MKT A;  2IQC A;  2RFM A;  3K9I A;  3T8K A;  3R9M A;  4O60 A;  4DX5 D;  4CCA A;  1E90 A;  1O5M A;  2FEZ A;  2L0I A;  2KZT B;  1KZO A;  2V5Q C;  2XEV A;  3ASN E;  4UWF A;  3S2A A;  3KAE A;  3HXD A;  2EIL E;  2XEN A;  3EHR A;  5G05 C;  2DIW A;  4N39 A;  1IXV A;  2ION A;  4BWR A;  2DCP A;  3ML8 A;  3DWL G;  4AEZ C;  3AJI A;  1TNO A;  4XEI G;  4B0Z A;  3G2W A;  3GZ2 A;  2J4B A;  3R7Q A;  2L9B A;  1ELW A;  1OUV A;  2JLB A;  4HNA D;  5FWQ A;  2KXP C;  2WB2 A;  3NZS A;  4E6H A;  5B3S E;  5FQ8 A;  3TWR A;  3LJ3 A;  4I17 A;  4GA2 A;  2VSY A;  4Y6W A;  1UN9 A;  5D0O D;  3FTZ A;  4J8Y A;  4DLO A;  3MX3 A;  3TWU A;  3C3O A;  3ABL E;  2P9N G;  4JVS A;  4BSZ B;  2XQ0 A;  3ZYL A;  5C1D A;  2LSV A;  5HS0 A;  2X6H A;  1TJC A;  5A7D B;  3CHM A;  3JQ0 A;  4L1B A;  4U8V D;  2ZU6 B;  5LCW J;  1Y6I A;  2CHZ A;  2WXJ A;  3D9K A;  1D8D A;  1MYO A;  2OEW A;  3UQ3 A;  1X5B A;  2KBX A;  2B6C A;  3LCA A;  4HRM B;  3IKO B;  3GYZ A;  1OCO E;  2XPZ A;  5LFA A;  3L13 A;  2XGM A;  4A3V A;  1S0P A;  2Y69 E;  1E7V A;  2ZIS A;  3RK6 A;  3CQC B;  4N3C A;  3U9W A;  4LUN U;  1AP7 A;  3L82 A;  4NAC A;  3TAX A;  3LYA A;  4DK5 A;  4J0U A;  5KNH D;  4W9R A;  4JHJ A;  2IEJ A;  3PS6 A;  4R7L A;  3F6Q A;  3QWP A;  3CHR A;  3ULE G;  4BER A;  2L0T B;  3DPD A;  4JA7 A;  4GZD A;  2ZIR A;  1RZ4 A;  5BNW A;  2KAT A;  1SQM A;  2ETA A;  1B89 A;  1O1R A;  4UQX A;  4EBA G;  1HO8 A;  1WAO 1;  1E7U A;  2AXU A;  4GZ6 A;  3ZYK A;  2IFU A;  1FT2 A;  3EIQ C;  4OAV B;  3Q49 B;  3PRZ A;  3OAW A;  2FBN A;  1L5J A;  1DCE A;  3D9N A;  2IO3 C;  4GTQ A;  3MEK A;  3MGB A;  2IO2 C;  5ANR A;  4EHM A;  5FZQ A;  2IOL A;  3T9K A;  1YYH A;  4MLP A;  3V31 A;  4Q94 A;  2Q7F A;  4U7E B;  1H2V C;  5C2Y A;  5AJL A;  1SA5 A;  1N54 A;  1PAQ A;  2WXO A;  4L23 A;  4JL0 A;  4KZC A;  1JPL A;  1TNB A;  3QOU A;  1N4Q A;  2H6F A;  3CV0 A;  3PZ4 A;  2WMN A;  4FU3 A;  3ZKJ A;  3CQG B;  4JW1 A;  1UN8 A;  1ZBP A;  5JHA A;  2CG3 A;  2PM7 A;  3MKR A;  2L6J A;  3FUJ A;  4LCT A;  3FTV A;  4WNG A;  4I1A A;  1V54 E;  5FJY A;  2QC9 A;  4AM9 A;  3OTN A;  1INZ A;  3MZL B;  2ETB A;  3PEV B;  2LNI A;  4M3O A;  4F3V A;  4HOS A;  2HM8 A;  3MCX A;  2Y1L E;  1H6K A;  2OCC E;  4CYM D;  4G2V A;  4I9E A;  4BTA A;  4PS3 A;  1UW4 B;  3P1U A;  3FTS A;  1FVF A;  1ZU2 A;  1ELK A;  5LCW C;  2MRI A;  2J8S D;  3AS5 A;  4B93 B;  4HRL A;  2X38 A;  2WQH A;  1MHQ A;  2WXG A;  1ZB1 A;  4PDX A;  3DEP A;  2OND A;  1IQU A;  3Q4A B;  1D9S A;  4PS7 A;  5D2M C;  4HXI A;  4Z68 A;  3CK8 A;  3FUD A;  5HQ8 A;  4JHR A;  2F37 A;  3CVY A;  2VQ2 A;  5ARF A;  4HB5 A;  4PS8 A;  4JXT A;  4J7W A;  3D9I A;  1TN7 A;  3TWS A;  2LO6 A;  4N3B A;  3FY4 A;  4ATG A;  2YNQ A;  4YDY A;  4KYO B;  3E4B A;  2GRP B;  3HIZ A;  4C0M A;  3Q73 A;  4GPK A;  2Y0B G;  4WNF A;  3T8M A;  4G11 A;  2Y4U A;  4L2Y A;  2MOW A;  1QBQ A;  4GYW A;  1TNU A;  1EF1 C;  3FUK A;  4AVX A;  5BUZ A;  5JA4 D;  1Z5S C;  1NA0 A;  2P9L G;  4JHK A;  5DBK A;  1S64 A;  4OVV A;  1SVX A;  5EYL A;  4AY6 A;  3ZXS A;  3BU8 A;  2OVF A;  3E34 A;  3CIA A;  2GRO B;  4J8F A;  3UPV A;  2KCK A;  4G23 A;  3G2V A;  3HXB A;  2GRQ B;  1WM5 A;  3AU4 A;  3I4G A;  1O1S A;  4I1M A;  3LDZ A;  1XGW A;  3PH0 C;  2WXL A;  5CRV A;  4XX5 A;  3GW4 A;  3MKQ A;  1FCH A;  2KCL A;  2QY7 A;  1HS6 A;  4UI9 J;  4URK A;  3L08 A;  2A5E A;  3EUV A;  3TWQ A;  2F8X K;  3C72 A;  4GZ5 A;  4ANU A;  4ILI A;  5JHB A;  3DST A;  4HOR A;  3FTX A;  1IKN D;  2YHE A;  3CVN A;  1MZC A;  2VJ8 A;  2AWI A;  2C0M A;  3DRA A;  3J5Q B;  3CHQ A;  2GW1 A;  1X81 A;  3TXM A;  3ZW3 A;  4BES A;  5LX8 A;  4TUM A;  3KEA A;  4ILG A;  2X6J A;  5ANL A;  5EYP F;  4GYO A;  1JWF A;  2FUL A;  1W3B A;  4FA6 A;  4RSY A;  5ENO D;  2EIJ E;  2HR2 A;  5CRU A;  2R03 A;  2EIN E;  1MQS A;  2HE0 A;  5G04 J;  2LXL A;  3V2O A;  3IHY A;  2J09 A;  3E32 A;  4FAD A;  3ZUV B;  3TXN A;  1UJJ A;  3SBT B;  2WXF A;  3LJN A;  3OXL A;  4YDE A;  4RG9 A;  4TV3 A;  3FP3 A;  4LNB A;  4L7T A;  4K5B A;  3AG3 E;  2VGX A;  4H7X A;  3ZVV A;  4RG6 A;  3J5P A;  2VSX E;  3FUL A;  4L9P A;  3TWV A;  4UQY A;  4I1O B;  1BI8 B;  1S63 A;  1A17 A;  2OOE A;  3L6A A;  4ACL A;  3UKR G;  3PRE A;  4HI8 A;  1HF8 A;  4UWL A;  3CVP A;  1K1B A;  1U3C A;  1LF8 A;  3G2T A;  3SI5 A;  2BED A;  1E8Y A;  4J8S A;  4B8A A;  3APC A;  5CEC B;  3FUI A;  3JXI A;  1MX4 A;  3FU3 A;  5AQB A;  1OT8 A;  3O4Z A;  4Q69 A;  4KVM A;  3SBS A;  3BG0 B;  2C2L A;  5KCM A;  4LRZ A;  1Y8M A;  1NZN A;  3QJZ A;  3QB2 A;  3Q7F A;  1IHG A;  3RO2 A;  5KJN A;  2NXP A;  3HG0 D;  4AXH A;  3DEO A;  1TNY A;  5D66 A;  4BSX A;  4FHJ A;  5FIO A;  4X8Q A;  4F1P A;  1QYM A;  5EIB E;  5AQ7 A;  1DVP A;  3KD7 A;  2GRR B;  3PUK A;  3APD A;  2NSZ A;  4RLY A;  5ENP D;  4O1O A;  4BX8 A;  3FEY A;  3D9M A;  3SF4 A;  3CK7 A;  4YND A;  1TN6 A;  5CBO A;  1DC2 A;  4UI9 C;  4HFG A;  4QQI A;  1K1A A;  4OYS A;  1LD7 A;  2UY1 A;  2R59 A;  3CSF A;  2KC7 A;  2WXN A;  3B7S A;  3S7F A;  5BT1 A;  4U95 D;  3UIO C;  4IYP A;  3ABK E;  1KLX A;  3FH8 A;  4GZC A;  1K8K G;  3UT4 A;  4CT0 A;  5A23 A;  3NQP A;  4TXR A;  3ZHE B;  3NBN B;  1OXJ A;  5E75 A;  2A5U A;  4XI9 A;  2WXK A;  2XEE A;  2WXI A;  2XS1 A;  3S7J A;  3HDX A;  4IN3 B;  4AP2 A;  4GTR A;  3SZ7 A;  4TRQ A;  2IOS A;  3Q47 B;  2PQR A;  3QNK A;  4I6G A;  3EU9 A;  1KT1 A;  5G04 C;  3OXG A;  3LKU A;  3E37 A;  4EZL A;  3B13 A;  1U3D A;  4MRU A;  3CK9 A;  3LS8 A;  5AQA A;  4KZ0 A;  4FJY A;  1QZ2 A;  2OEV A;  3U66 A;  4G24 A;  5EIL A;  4HI9 A;  1JWG A;  1Q2Z A;  5AQ9 A;  3ZXP A;  1HXI A;  4N2S A;  4U8Y D;  4G8L A;  2FI7 A;  3HVE A;  5KNG A;  1YA0 A;  4GCO A;  3FWV A;  4TXP A;  2CFU A;  1LTX A;  4UQZ A;  3V79 K;  1TNZ A;  3ZU7 B;  2OV8 A;  2XZD G;  3L16 A;  3Q75 A;  5CMW A;  3CHO A;  2C0L A;  2DBA A;  3TWT A;  3QWV A;  2I2O A;  3Q15 A;  3BQO A;  3UXG A;  3ABM E;  2HO1 A;  3ISM C;  2R5S A;  3AG1 E;  5CCM A;  2EIM E;  4GPM A;  5AAO A;  3C5R A;  2QYJ A;  3NOG D;  2V4H C;  3L54 A;  3RRN B;  2WXR A;  4BTB A;  3ONL A;  4A1S A;  2FF4 A;  4UI9 K;  4WAF A;  1HG5 A;  4I6J A;  2ZGD A;  4ZHB A;  4GYY A;  1YMP A;  4C9B B;  2E0I A;  3MJW A;  5JMN D;  2H6I A;  3S7D A;  1IHB A;  5ENS D;  2P2C P;  3LY8 A;  4B94 A;  2WQ7 A;  4NRH B;  3JUI A;  3U3W A;  4F6R D;  3PUJ A;  4BEP A;  4O1P A;  5M72 A;  1TN8 A;  1JCQ A;  3FTW A;  4DI3 A;  4EEC A;  2FO1 E;  2XGS A;  3LXU X;  4K5A B;  4JA9 A;  4TXQ A;  3CKB A;  3D3M A;  3R7R A;  4FJZ A;  2P58 C;  2PL2 A;  1TYQ G;  1LD8 A;  2AJA A;  4BFR A;  5EX3 A;  1HE8 A;  3WG7 E;  3QAR A;  4HOQ A;  4CGW A;  2XRZ A;  3PZ2 A;  4GMJ A;  4U63 A;  2KZT A;  2VTB B;  4CDR A;  4FLH A;  3VTY A;  3AAA C;  3ZN3 A;  3CHS A;  4ABN A;  4U0U A;  4MBG A;  1OCC E;  3UKU G;  4GMR A;  4XZ4 A;  1OWN A;  3ASH A;  5AAR A;  3ZYM A;  3I3N A;  1V55 E;  4LEU A;  1JCR A;  3L17 A;  4GA0 A;  4BY6 A;  2P9S G;  1AWC B;  4A3T A;  1VDY A;  3ESK A;  3TGO A;  4KMO A;  4JC8 A;  1BI7 B;  2XPY A;  3T5V A;  1N9A A;  4V3I A;  2DWZ A;  5A6C A;  3Q5M A;  2P9P G;  5FQ4 A;  4AY5 A;  2WMO A;  2VGY A;  4CEM A;  3UM0 A;  2AXZ A;  3ULQ A;  5EX0 A;  3VLE A;  3UIN C;  1NP7 A;  4B8C B;  4YDO A;  3DXK G;  4HQD A;  3AS4 A;  2F8Y A;  2BUG A;  1N0Q A;  5CBN A;  4IRU A;  1O1T A;  3TG4 A;  3Q9N C;  2VSO E;  3X2Q E;  4H7Y A;  3B7R L;  2NYJ A;  3LEW A;  5FQ7 A;  3C98 A;  2PNN A;  4U8H A;  1GW6 A;  3NZU A;  4E85 A;  2BKK B;  1SZ9 A;  2HYZ A;  2MHK A;  2R2L A;  4XIF A;  5BXU A;  5J90 A;  3JYS A;  5B1A E;  3UM3 A;  2J4D A;  4BX9 A;  1BD8 A;  4ACK A;  3IHV A;  1N4R A;  3QK0 A;  4EBA A;  3GZ1 A;  4YDW A;  3WXX A;  1E96 B;  5HKP A;  3ZIM A;  3DSS A;  3EHM A;  4ANX A;  5HI7 A;  3JUE A;  3UUX A;  4YVQ C;  1SW6 A;  4LNG A;  3ASD A;  3EJN A;  2EIK E;  5CED B;  4I6E A;  1E8X A;  3RJV A;  1WG0 A;  3FUM A;  4I9C A;  5ENN A;  1TR4 A;  2WXM A;  3PEU B;  2J07 A;  4HLL A;  2DZN A;  4FP7 A;  4G25 A;  1QQE A;  4IUL A;  2WM9 A;  3IEG A;  2X6I A;  2X3M A;  1N4P A;  4G8K A;  5KJM A;  2XZT G;  5BXO A;  1HU3 A;  3CVL A;  3LY9 A;  3EHQ A;  4JEH A;  4ANV A;  2XCB A;  3OXF A;  2XGO A;  4ILH B;  3FDH A;  4DI4 A;  1S70 B;  2QFC A;  3DPY A;  5IY5 E;  1H6P A;  4C0E A;  3RO3 A;  4N3A A;  2E2E A;  3Q79 A;  3UX4 A;  2IU1 A;  4EZK A;  4KXK B;  3ZRH A;  3G2S A;  1KT0 A;  4K5C A;  1NI1 A;  2YHC A;  1EPU A;  2M63 A;  3FU0 A;  3QWW A;  3SFX A;  2WPV A;  5T3R A;  3AG4 E;  3VTX A;  3SNX A;  4BET A;  2RD0 A; 
#chains in the Genus database with same CATH homology
 1UJK A;  3ESL A;  3D9P A;  3NQP A;  3ZHE B;  3CV0 A;  5AJD A;  5E75 A;  2A5U A;  2WMN A;  4FU3 A;  4XI9 A;  2WXK A;  2X6F A;  3CQG B;  3U64 A;  1Z3Y A;  4JW1 A;  1UN8 A;  2WXI A;  1ZBP A;  4KVO A;  3S7J A;  4MS6 A;  4FLB A;  5JHA A;  3HDX A;  4IN3 B;  4AP2 A;  2CG3 A;  3SFZ A;  3RRM B;  3SZ7 A;  4TRQ A;  4EQF A;  2PM7 A;  2IOS A;  3CEQ A;  3FHE A;  2I9C A;  3MKR A;  2PQR A;  3Q47 B;  3QNK A;  4P29 A;  4UWH A;  1Z3X A;  3EHN A;  4BT9 A;  4PH4 B;  4XE0 A;  3CVV A;  1H2U A;  1OWL A;  2X6K A;  4I6G A;  2L6J A;  3FUJ A;  4LCT A;  3FTV A;  1TJF A;  1KT1 A;  3CR3 A;  1P5Q A;  4WNG A;  5G04 C;  3FTU A;  4NUR A;  4I1A A;  4I2W A;  2GRL A;  3ZEF A;  5J08 A;  1PY1 A;  4LER A;  1PC2 A;  5FJY A;  4FUL A;  3OXG A;  5G05 J;  3LKU A;  3FU5 A;  2V0P A;  3FH7 A;  3LVQ E;  3PE4 A;  4XI0 A;  2LSU A;  4B89 A;  4EZL A;  4AM9 A;  3B13 A;  1U3D A;  4MRU A;  3CK9 A;  3HYM B;  3OTN A;  3CVQ A;  3DBS A;  1INZ A;  3MZL B;  3LS8 A;  5CMY A;  2PQN A;  3PEV B;  2LNI A;  4M3O A;  3JCK C;  4EZJ A;  4KZ0 A;  4F3V A;  4HOS A;  4FJY A;  2HM8 A;  1IQR A;  1QZ2 A;  3MCX A;  3CVX A;  2CFZ A;  4QFV A;  4G24 A;  3U66 A;  4WUY A;  3I4R B;  1JWG A;  4G26 A;  2LAH A;  3GZS A;  1H6K A;  3N71 A;  1HXI A;  3CGH A;  4N2S A;  5FQ6 A;  4G2V A;  4JEU A;  4ME2 A;  4I9E A;  3URZ A;  3HHM A;  4BTA A;  2FI7 A;  3HVE A;  2WXH A;  1YA0 A;  3ASF A;  3LVR E;  4GCO A;  1EYH A;  3FWV A;  4PS3 A;  4I2Z A;  3RU0 A;  5JJT A;  2CFU A;  4U0Z A;  1HZ4 A;  4UQZ A;  3L22 A;  1UW4 B;  4XKB A;  3P1U A;  3FUE A;  3FFL A;  3FTS A;  2YIN A;  4FC8 A;  4GZ3 A;  1FVF A;  1ZU2 A;  1ELK A;  2J08 A;  2OV8 A;  2MRI A;  1XNF A;  3L16 A;  2CHX A;  4F53 A;  5CMW A;  5LCW C;  3CHO A;  2C0L A;  2DBA A;  3AS5 A;  1E8W A;  3D9O A;  3PNL B;  4WNE A;  4F1S A;  5LOZ A;  3QWV A;  4K03 A;  2BF0 X;  5BPP A;  2X38 A;  2I2O A;  2WQH A;  4Q96 A;  1MHQ A;  2KCV A;  3HVE B;  2WXG A;  3Q15 A;  1Z6T A;  5FZS A;  4PDX A;  2IF4 A;  5FZR A;  3T5X A;  2OND A;  1IQU A;  3Q4A B;  2HO1 A;  4PS7 A;  3U4T A;  2GRM A;  4HXI A;  1E8Z A;  2I1K A;  2R5S A;  2UWJ G;  3CK8 A;  3FUD A;  5CCM A;  5HQ8 A;  4JHR A;  3S7B A;  3O48 A;  2I1J A;  4HLE A;  3CVY A;  1BPO A;  1H19 A;  2VQ2 A;  4DPR A;  5ARF A;  1IYG A;  2JEK A;  4PS8 A;  4JXT A;  3D9I A;  4DLQ A;  5BV0 A;  4HS2 A;  5KJK A;  5DIZ A;  3L54 A;  4K0R A;  2LO6 A;  3RRN B;  2WXR A;  4N3B A;  2BTD A;  2EQX A;  3FUN A;  4BTB A;  5BW8 C;  3UT8 A;  4A55 A;  3ONL A;  3FY4 A;  3PDN A;  4A1S A;  4ATG A;  2FF4 A;  1JUQ A;  4UI9 K;  4WAF A;  2YNQ A;  1HG5 A;  3CST A;  4KYO B;  3E4B A;  2VYI A;  3FUF A;  4I6J A;  4U04 A;  3ASG A;  3LY7 A;  3PVL A;  4APO A;  3HIZ A;  1EDU A;  4GYY A;  4C0M A;  4C9B B;  4GAA A;  3P2B A;  2E0I A;  3MJW A;  2A4Z A;  3SGH A;  5T4Y A;  3UT7 A;  5LP0 A;  3S7D A;  4GPK A;  4WNF A;  3T8M A;  4YVO A;  4O6F A;  4U0S A;  4WND A;  4G11 A;  2Y4U A;  3LY8 A;  3QC1 A;  5E76 A;  4GA1 A;  4L2Y A;  4NQ0 A;  4B94 A;  2WQ7 A;  2XHE A;  3FEX A;  2MOW A;  4GYW A;  4HOU A;  4NRH B;  3JUI A;  3U3W A;  1EF1 C;  3FUK A;  1FVH A;  2Y4T A;  4AVX A;  3PUJ A;  5BUZ A;  5M72 A;  1NA0 A;  3VLF A;  3FTW A;  1HH8 A;  4J6I A;  4DI3 A;  4EEC A;  4JPS A;  3ONK A;  3TL5 A;  2PZI A;  2V5F A;  2XGS A;  4JHK A;  5T8I A;  5DBK A;  4WWO A;  5G2N A;  2PM6 A;  4DJA A;  3MA5 A;  5FTP A;  5ARG A;  3LXU X;  4JA9 A;  4APF A;  4CDM A;  2AW6 A;  4OVV A;  5JJ6 A;  4CGV A;  3FUH A;  4AY6 A;  4N2Q A;  1OWP A;  1OWM A;  3ZXS A;  5KJL A;  3CKB A;  2OVF A;  3D3M A;  3R7R A;  4FJZ A;  2P58 C;  3CIA A;  2PL2 A;  3ENE A;  5CCL A;  4J8F A;  4U07 A;  3UPV A;  3I5P A;  3SD5 A;  3LPZ A;  4BFR A;  2KCK A;  4G23 A;  2VTB A;  3MV3 B;  3EIJ A;  5EX3 A;  1HE8 A;  3G2V A;  4CDN A;  2GGF A;  3QAR A;  3RRU A;  2J9Q A;  1WM5 A;  3AU4 A;  3I4G A;  4GB9 A;  4HOQ A;  4I1M A;  3LDZ A;  1XGW A;  3PH0 C;  1HFA A;  2OVB A;  2WXL A;  4CGW A;  2XRZ A;  3TG5 A;  4XX5 A;  4GMJ A;  4U63 A;  4FHK A;  3GW4 A;  2KZT A;  4KT6 B;  3VLD A;  3MKQ A;  2CG2 A;  5EDS A;  2VTB B;  4CDR A;  4FLH A;  3VTY A;  1FCH A;  2WVI A;  2KCL A;  2QY7 A;  1HS6 A;  3ZFW A;  4UI9 J;  4HVB A;  4URK A;  3APF A;  4MKT A;  2IQC A;  3CHS A;  3ZN3 A;  4ABN A;  3L08 A;  4U0U A;  3K9I A;  5AEN A;  4GZ5 A;  3B7T A;  4ANU A;  4ILI A;  4CCA A;  5JHB A;  1E90 A;  3BEE A;  2FEZ A;  2L0I A;  4HOR A;  3FTX A;  2KZT B;  3RKV A;  3MKQ B;  2YHE A;  3CVN A;  2XEV A;  4GU5 A;  4XZ4 A;  3PZD A;  4UWF A;  1OWN A;  4XKC A;  3S2A A;  3ASH A;  4JZY A;  3ZYM A;  3BG1 B;  3I3N A;  2VJ8 A;  4GML A;  4UWK A;  2AWI A;  2C0M A;  2R17 C;  3ZYQ A;  4LEU A;  3KAE A;  5BV1 A;  3L17 A;  4GA0 A;  4BY6 A;  3CHQ A;  4A3T A;  1VDY A;  3AS8 A;  5G05 C;  2DIW A;  3ESK A;  2IJG X;  3CKC A;  4N39 A;  4A1G A;  3TGO A;  4KMO A;  2GW1 A;  2ION A;  2DCP A;  4JC8 A;  4BWR A;  4AOF A;  2XPY A;  3TXM A;  3ZW3 A;  3T5V A;  4V3I A;  5LX8 A;  3ML8 A;  3QKY A;  4AEZ C;  5A6C A;  4ILG A;  5JJ7 A;  2X6J A;  3Q5M A;  2FO7 A;  5ANL A;  5FQ4 A;  4AY5 A;  2Y3A A;  4B0Z A;  3IBE A;  4I43 A;  2WMO A;  3G2W A;  3GZ2 A;  4WWP A;  2J4B A;  3R9A B;  4N5C A;  3R7Q A;  4GYO A;  1JWF A;  2VGY A;  2FUL A;  2L9B A;  1ELW A;  3D9L A;  4GCN A;  4OVU A;  1OUV A;  4CEM A;  1W3B A;  2AXZ A;  2JLB A;  3ULQ A;  4FA6 A;  4RSY A;  4AV7 A;  5EX0 A;  3VLE A;  2HR2 A;  5AIJ A;  1NP7 A;  5FWQ A;  3MV2 B;  4B8C B;  2WB2 A;  3NZS A;  4BT8 A;  3AS4 A;  1MQS A;  1UG3 A;  4E6H A;  5FQ8 A;  5G04 J;  4L2L A;  2BUG A;  3IHY A;  4Y6C A;  2ILR A;  1OWO A;  3LJ3 A;  4I17 A;  2WXP A;  4J8E A;  4IRU A;  4ANW A;  2J09 A;  4GA2 A;  2VSY A;  3TG4 A;  2VSO E;  4FAD A;  4Y6W A;  1UN9 A;  5D0O D;  3FTZ A;  3TXN A;  1DNP A;  1UJJ A;  4DLO A;  3SBT B;  3RIB A;  4H7Y A;  3PE3 A;  3QDN A;  2WXF A;  4WWN A;  3B7R L;  3OXL A;  4EPZ A;  2J49 A;  3LEW A;  3MX3 A;  4KBQ A;  4RG9 A;  5FQ7 A;  4TV3 A;  3B7U X;  3C98 A;  3FP3 A;  4U8H A;  4L7T A;  3KEZ A;  4RVB A;  1GW6 A;  4JVS A;  3NZU A;  4F7A A;  4E85 A;  2VGX A;  2V8S E;  2XQ0 A;  3D9J A;  4H7X A;  3ZYL A;  3ZVV A;  1SZ9 A;  2HYZ A;  4RG6 A;  5G55 A;  2MHK A;  2VSX E;  3EDT B;  4J8D A;  3FUL A;  5C1D A;  2LSV A;  4XIF A;  4UQY A;  2LAI A;  4I1O B;  2X6H A;  1TJC A;  1HG2 A;  5J90 A;  1A17 A;  3JYS A;  1NA3 A;  2OOE A;  3L6A A;  3PNT B;  5A7D B;  2AXV A;  3CHM A;  3JQ0 A;  4ACL A;  3CVW A;  4AIF A;  4L1B A;  3MYV A;  2J4D A;  3TJP A;  3PRE A;  2VSN A;  2ZU6 B;  4BX9 A;  2VGX B;  1HF8 A;  4UWL A;  5LCW J;  1Y6I A;  2CHZ A;  2WXJ A;  3CVP A;  4ACK A;  3D9K A;  3IHV A;  4D10 C;  1U3C A;  3QK0 A;  4EBA A;  3IV0 A;  4AJW A;  3GZ1 A;  3UQ3 A;  3WXX A;  1X5B A;  1E96 B;  1LF8 A;  2XCC A;  1N52 A;  2XRY A;  3G2T A;  3SI5 A;  3LCA A;  3IKO B;  3ZIM A;  1QNF A;  3EHM A;  4ANX A;  1E8Y A;  3GYZ A;  5HI7 A;  4J8S A;  2XPZ A;  4B8A A;  3AU5 A;  5D0Q D;  5LFA A;  3APC A;  3L13 A;  2XGM A;  3UUX A;  4A3V A;  1S0P A;  4YVQ C;  1TEZ A;  4HOT A;  3ASD A;  1E7V A;  3FUI A;  2KM4 A;  3EJN A;  3RK6 A;  3CQC B;  4N3C A;  3CLJ A;  4PUC A;  4LUN U;  3U9W A;  3FH5 A;  3FU3 A;  4I6E A;  4NAC A;  1E8X A;  3O4Z A;  3RJV A;  3TAX A;  3LYA A;  2V4L A;  4DK5 A;  4Q69 A;  4J0U A;  4KVM A;  3ZGQ A;  3FUM A;  4W9R A;  3SBS A;  4I9C A;  3BG0 B;  4JHJ A;  3PS6 A;  5ENN A;  2AVP A;  4R7L A;  2C2L A;  5KCM A;  4UWG A;  3QWP A;  2YQ8 A;  3CHR A;  4LRZ A;  1Y8M A;  1NZN A;  1H2T C;  4G1T A;  2L0T B;  3QJZ A;  2WXM A;  3QB2 A;  1IHG A;  3DPD A;  3PEU B;  4JA7 A;  3RO2 A;  2J07 A;  3ML9 A;  4GZD A;  2NXP A;  3G2U A;  3FU6 A;  5KJN A;  2WQ6 A;  4AXH A;  4FP7 A;  4G25 A;  4BSX A;  2KAT A;  5BNW A;  2NC9 A;  1SQM A;  1QQE A;  4FHJ A;  4IUL A;  2WM9 A;  1B89 A;  3ZPJ A;  3FTY A;  3IEG A;  2X6I A;  2XPI A;  1DVP A;  2X3M A;  2I6H A;  3KD7 A;  1WY6 A;  4UQX A;  5FT9 A;  4EBA G;  2CHW A;  3APD A;  3PUK A;  3UMV A;  5KJM A;  2NSZ A;  1HO8 A;  1WAO 1;  5CHE E;  1E7U A;  2AXU A;  2WXQ A;  3KS2 A;  4GZ6 A;  1HU3 A;  3ZYK A;  2RG8 A;  3CVL A;  4BX8 A;  4CT4 A;  3QAQ A;  5AYW D;  2IFU A;  3LY9 A;  3EIQ C;  3FEY A;  3D9M A;  4JEH A;  4TUU A;  3SF4 A;  4ANV A;  3CK7 A;  3Q49 B;  2XCB A;  3OXF A;  1SZA A;  3OAW A;  2XGO A;  3PRZ A;  4ILH B;  4YND A;  1ELR A;  3FDH A;  4DI4 A;  2QFC A;  4UI9 C;  4C0E A;  2FBN A;  1L5J A;  3CHP A;  4HFG A;  3D9N A;  3RO3 A;  4OYS A;  4N3A A;  2E2E A;  2UY1 A;  2R59 A;  3UX4 A;  3CSF A;  2KC7 A;  3MEK A;  2IU1 A;  2WXN A;  3MGB A;  3B7S A;  5ANR A;  4EZK A;  4KXK B;  3ZRH A;  3S7F A;  5BT1 A;  3SHF A;  3G2S A;  5FZQ A;  3JQ1 A;  1KT0 A;  1HX8 A;  2IOL A;  5EKQ D;  3ZHE A;  4MLP A;  3CVU A;  2YHC A;  1EPU A;  2M63 A;  3FU0 A;  2Q7F A;  3QWW A;  4IYP A;  4Q94 A;  1KLX A;  1H2V C;  5C2Y A;  2UY1 B;  3FH8 A;  4GZC A;  5AJL A;  3UT4 A;  1N54 A;  4CT0 A;  1PAQ A;  1H0A A;  2WXO A;  2WPV A;  4L23 A;  5T3R A;  4JL0 A;  4KZC A;  3VTX A;  1JPL A;  3SNX A;  4CRW A;  3QOU A;  3NF1 A;  2RD0 A;  5A23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...