1PC2A

Solution structure of human mitochondria fission protein fis1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of Human Mitochondria Fission Protein Fis1 Reveals a Novel TPR-like Helix Bundle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords mitochondria fission protein
total genus 40
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1pc2A00
4HORA 4GYYA 3PE4A 4ABNA 4G26A 4I9EA 3QKYA 5HQ8A 2L6JA 2HYZA 3CKCA 4RG9A 1PC2A 4U0ZA 5FJYA 5FZRA 1WM5A 4F3VA 3AS5A 1NA3A 1ELWA 4N3BA 3Q4AB 3MV3B 4KYOB 5G04C 3RO3A 3SZ7A 4CGWA 4H7XA 3ASHA 3VTXA 4BTBA 2XPIA 2KCKA 3CKBA 3FWVA 4N3AA 5EX0A 3Q47B 5FZQA 2NC9A 3O48A 5D0QD 2FEZA 5M72A 1P5QA 4GYWA 3U3WA 2KATA 2PL2A 3OXGA 4BT8A 2XGMA 4G25A 4XI0A 5D0OD 3PE3A 5DIZA 3ZFWA 5KJNA 4BWRA 2LNIA 1B89A 4KXKB 5G05C 4JL0A 1NZNA 2E2EA 3ASGA 5BW8C 4CGVA 4JA9A 5C1DA 4I1AA 4U0UA 2AVPA 2Q7FA 1ZU2A 1TJCA 2XEVA 3CK8A 3MA5A 2HR2A 3NF1A 4GA2A 2XCCA 4GCOA 4NRHB 2UY1A 4N5CA 4RG6A 2VSNA 4G2VA 5LCWC 4WNFA 4J8DA 3U4TA 3HYMB 3CVQA 5BNWA 5A7DB 5CCMA 1QZ2A 3TAXA 2VGYA 3OXLA 5JJ6A 2PZIA 4U07A 4HOSA 3GZ1A 4NQ0A 3KD7A 2P58C 4YVQC 1HZ4A 2LSUA 1HXIA 3ZPJA 1QQEA 4G1TA 4ME2A 3UPVA 1ELRA 2KC7A 2Y4TA 5ARFA 1XNFA 3QWWA 3TGOA 2BUGA 3E4BA 4XI9A 3TG5A 1Y8MA 2IF4A 4JHRA 5FTPA 4BTAA 3FP3A 1W3BA 5BT1A 4GZ5A 4WNGA 4I2WA 2WPVA 2XGSA 3FFLA 3LPZA 1KLXA 1KT0A 3MV2B 3ZHEA 1KT1A 2UWJG 2V5FA 1YA0A 1E96B 5EKQD 2VGXA 4UQZA 5KJMA 5KJKA 3S7DA 4WNEA 2VQ2A 3LCAA 4N3CA 4YNDA 4YVOA 5CHEE 3GYZA 1A17A 2LSVA 2I6HA 2YQ8A 3GZ2A 3RU0A 3URZA 5G04J 5KJLA 3UQ3A 2KCVA 3R9AB 5A6CA 3ZGQA 1OUVA 5CCLA 4GA1A 2VGXB 3VTYA 3ZN3A 4HOQA 2FI7A 3LKUA 5HI7A 2R5SA 2OOEA 3Q5MA 3EDTB 3PDNA 4H7YA 4A1SA 4EQFA 5LCWJ 4KBQA 4WUYA 3UUXA 4I9CA 3WXXA 5AYWD 4N2SA 3QDNA 3N71A 2JLBA 1NA0A 3KS2A 4BT9A 2IFUA 3AS8A 3ULQA 5ARGA 3S7FA 2XGOA 3LY8A 4LEUA 3QWVA 4O6FA 4AY5A 4GCNA 3CV0A 3RIBA 4HOTA 3CVLA 3SF4A 3MEKA 4XIFA 3RO2A 4UI9K 3IEGA 4W9RA 4CDRA 4WNDA 2C2LA 3AS4A 4GYOA 3LYAA 4B94A 1IYGA 2J9QA 4J8FA 2HO1A 4AIFA 2GW1A 4U04A 4J0UA 4IN3B 3LY7A 4UQXA 2WQHA 4I17A 1ZBPA 4N2QA 2Y4UA 3QWPA 3ZHEB 1HH8A 2FF4A 2KCLA 4Y6CA 5JJTA 3MKRA 4UI9J 4AM9A 2C0LA 3TG4A 3ASDA 3RJVA 4GA0A 2XCBA 4Y6WA 2PQRA 2VYIA 2C0MA 3OXFA 3QOUA 4G23A 1WAO1 3RKVA 5FZSA 3K9IA 2DBAA 3ASFA 3KAEA 4U0SA 5JJ7A 1IHGA 4JA7A 2FO7A 2UY1B 3CK7A 3S7BA 5G05J 3S7JA 4AY6A 5DBKA 3CK9A 3ESKA 5EX3A 4I2ZA 3LY9A 4G24A 2MHKA 3CVPA 1FCHA 3CEQA 3JYSA 3Q15A 4HOUA 4J8EA 3Q49B 5FT9A 3CVNA 4GZ3A 2QFCA 2YHCA 4UI9C 4GPKA 2FBNA 2ONDA 3BEEA 2VSYA 4GZ6A 4UQYA 4APOA 3GW4A 4N39A 2PQNA
chains in the Genus database with same CATH superfamily
4CDNA 5IY5E 3KEAA 5CERB 4U0ZA 4A55A 1ELWA 4N3BA 1MHQA 4GMRA 4H7XA 1MX4A 1LD8A 3CLJA 5D0OD 3FUEA 3ABME 1K1BA 4A63B 2CFUA 3ZXPA 4BX8A 3VLEA 2P9UG 4PS8A 4WNFA 4I43A 3FTUA 2J08A 3DWLG 3E37A 5JJ6A 3UKUG 4YDWA 3FU0A 3UPVA 3CVVA 4FULA 1JUQA 2I1KA 4XI9A 2F8XK 4L2YA 2JEKA 1D8EA 4UQZA 3CIAA 1A17A 5AIJA 4GZCA 5A6CA 4JZYA 3VTYA 4HOQA 3Q5MA 2WVIA 2EIKE 4HFGA 3RK6A 5D2MC 3MKQB 4AJWA 2XEHA 4XIFA 4TXQA 1HO8A 4HI9A 2LXLA 3ZRHA 2X6FA 3QWPA 3B13A 5CEAA 4KZ0A 4PS3A 5JHBA 3NBNB 2C0MA 4B8AA 3K9IA 5J90A 2V4LA 2RD0A 5G05J 2R02A 1K3ZD 5AARA 2YHCA 2H6HA 4HORA 2Y3AA 3DSTA 3O4ZA 1N4RA 3RO3A 3C3OA 3PUKA 4Q69A 5D0QD 2DIWA 2P2CP 4TXPA 3FTYA 5DIZA 5G05C 3ASGA 4PH4B 5C1DA 4GCOA 4RG6A 1HX8A 3HYMB 3UX4A 3R7RA 1Z6TA 4G8KA 1RW2A 1W3BA 1OY3D 2WPVA 3LPZA 1HF8A 4B8CB 3U64A 4EECA 3TXMA 3LS8A 3HXDA 5G04J 2A5UA 3T8MA 5LX8A 1OUVA 1DVPA 5LCWJ 1OWNA 4BT9A 5ENPD 4YDEA 4ACKA 2YHEA 2XPZA 1TN6A 1OWPA 1U2VG 2GW1A 2GRQB 4IN3B 3DEPA 1JCSA 1NFIE 4JC8A 4UI9J 3PZ1A 4G23A 4FC8A 4GAAA 2BKGA 3SFYA 5EIBE 2A5EA 2R17C 1EYHA 4I6JA 1Q2ZA 5HKPA 3S7BA 3RRMB 1SVXA 4HNAD 1X81A 1AWCB 4I1OB 1BI7B 3Q49B 2Y0BG 4GPKA 3TWUA 2I1JA 4ABNA 4JD2G 3SNXA 5FJYA 4DX6D 5G04C 4BSZB 5CEDB 3D9LA 4YDYA 4UWLA 3EU9A 2L0IA 1B89A 2R05A 4O60A 5ENOD 4CGVA 4JA9A 4HXIA 3AJIA 4U8YD 5A7DB 4FU3A 5HS0A 3ZXSA 4EHMA 2ETBA 2LSUA 3ZPJA 2NSZA 4G1TA 5LOZA 1ELRA 3EHRA 3C98A 3G2SA 4E6HA 2J4BA 4F6RD 3SBSA 2WXKA 2JABA 3LCAA 1E8XA 2M63A 3RU0A 3SD5A 4CZ2D 1ELKA 5KJLA 4M3OA 3G2WA 4BEPA 1TNYA 5CMYA 3UKRG 2L0TB 3EU5A 4I9CA 2DCPA 4GTVA 5LP0A 1NA0A 3ULQA 1MX6A 4GCNA 1Z3YA 5ENTD 3LDZA 2A4ZA 3PZ2A 2AJAA 3C5RA 2Y4UA 5JA4D 4AV7A 3R7QA 3IBEA 2GRRB 3FU3A 2XENA 5BUZA 3C3RA 1WAO1 3PZDA 3JXIA 2XPYA 5FZSA 5CBOA 3FTZA 3RAUA 3S7JA 4HS2A 3QC1A 4AY6A 2EIME 3ESKA 4UWGA 2VSYA 3HXEA 4G26A 1TEZA 4TRQA 4F3VA 3L17A 4FHKA 3KSLA 2IEJA 4GTSA 5M72A 4JHKA 4RVBA 2KATA 4BSXA 3ZIMA 5CMWA 3CSFA 2DZOA 4U0UA 4ZFHA 1N94A 5JMND 1PY1A 4APFA 3V79K 4KZCA 1TNOA 2R03A 4F1SA 3ABKE 3UIPC 3L08A 1IQRA 2FULA 4I2WA 3ZHEA 3TJPA 2XQ0A 2XS1A 3S7DA 2ZIRA 4J6IA 2LSVA 4HRMB 3URZA 5LFAA 5ENQD 5B3SE 5KNHD 2VGXB 2LUHA 5EILA 1HFAA 2FI7A 4ANUA 3PH0C 4PDXA 2PM7A 3EHMA 1S0PA 3EUVA 3SQVA 5E75A 2WXJA 4DX2A 2OEVA 1E7VA 2P9SG 4NURA 3TWRA 3CV0A 3RIBA 3CVLA 1OWMA 1UW4B 3RO2A 3DPDA 4AIFA 1UG3A 2P9KG 3ONLA 5T8IA 4N2QA 2KCLA 4C48B 3TG4A 2XEEA 5H7PA 4FJZA 3L82A 5EN5D 3CQCB 4J8EA 3JYSA 5FT9A 3HIZA 3ZYQA 3D9MA 4KVOA 1S64A 3D9HA 3S2AA 4GMJA 2H6FA 3HXCA 2QZAA 5FWQA 2OVBA 3ASHA 4L1BA 2FEZA 3U3WA 2KZTA 2E2EA 2LAIA 4DJAA 1S70B 4HB5A 4GA2A 4JPSA 3D9JA 1HU3A 3FTVA 4HQDA 2J4DA 4YDOA 4DX7D 1OT8A 3KD7A 4A3VA 1TR4A 3D9OA 3QWWA 4UWKA 3PVLA 4WNGA 1TNZA 5FQ7A 1YA0A 3I5PA 5KJKA 3DBSA 4G8LA 2MRIA 3MKQA 4ATGA 3MYVA 1SA4A 4PUCA 3PDNA 1G3NB 2QYJA 4MRUA 1H6PA 1D8DA 3SO8A 4C0MA 4HRNA 4J8FA 3UINC 4MS6A 3ZNGA 4J8YA 3LXUX 1IQUA 4TUMA 3ENEA 3P1UA 3Q15A 5J08A 5AQAA 3SI5A 1JCRA 3QJZA 2WXHA 5B1AE 1L5JA 4GYYA 1FT2A 3B95A 3G2VA 4F1PA 5FZRA 2WXFA 1WM5A 2Y69E 4CGWA 1N4SA 3Q47B 3C3QA 5FZQA 1E8ZA 5EYLA 4K03A 1INZA 1FPPA 2KBXA 4DPRA 4N5CA 1FT1A 5LCWC 1HG5A 2WXLA 3LVQE 5AQBA 3CGHA 4K5CA 1E8YA 3E4BA 3TG5A 3EIJA 4A1GA 3FUKA 4GTQA 4K5AB 1N95A 2XZDG 3NZSA 5KJMA 3FUJA 4YVOA 3AU5A 2YNQA 5T4YA 3OTNA 1N9AA 1Y6IA 2LAHA 3RSEG 4A1SA 3D9IA 1DC2A 3DPYA 3B7UX 2WXQA 1BU9A 3NAWA 4WNDA 1TNUA 3FEXA 4GYOA 2J9QA 3BG1B 1MYOA 2X6IA 2WQHA 4CEMA 2XRYA 1V54E 4R7LA 3FTSA 3AG2E 1AP7A 5CRUA 3ZYLA 2WB2A 2QY7A 2OEWA 3LJNA 1NI1A 1OCRE 3MJWA 2DYRE 5JJ7A 2UY1B 2R59A 4I2ZA 4P29A 4HOUA 3AU4A 4UI9C 3GW4A 4MKTA 5BV1A 2L6JA 3CQGB 1LD7A 3VTXA 3GZSA 3DSWA 1P5QA 3ZU7B 1FVHA 3L13A 3PE3A 2LNIA 4KXKB 3DSUA 2VGEA 4JVSA 4HRLA 3NOGD 3D9KA 1A5EA 3TWXA 3TXNA 3LJ3A 5EIDA 5ARFA 4L7TA 3FTWA 3QARA 3R9MA 2PM6A 2WMOA 1UJJA 1PAQA 3B7SA 1UN9A 5AJDA 1KZPA 3BG0B 1HE8A 4UUCA 2J49A 4N2SA 2CFZA 4JHJA 3I4RB 3UT8A 3ZEFA 1OCCE 4AY5A 3QWVA 2VTBB 4NACA 4JEUA 3DSVA 2IU1A 4FLHA 3E34A 4BERA 4KT6B 4DX1A 5ENSD 2L9BA 2XCBA 4G11A 4DK5A 3ASFA 3LVRE 4AOFA 2R2LA 4C0EA 3PZ4A 1DCQA 1KPSB 3E30A 4G24A 3CVPA 5ENNA 4L2LA 4GZ3A 1N4PA 2FBNA 4UQYA 3UM1A 3HXFA 3ISMC 3HG0D 1NA3A 1IXVA 3P2BA 1EPUA 1N52A 3OAWA 1QNFA 4GYWA 2DWZA 4F53A 4FA6A 3W9FA 5FQ4A 2ETCA 1YCSB 2EIJE 3ULYA 3ABLE 2VSNA 1JWGA 3KEZA 1JPLA 3ONKA 5KWDA 4LERA 4L23A 4HOSA 1HXIA 2V4HC 4E85A 1Y8MA 2IF4A 3I3NA 4JHRA 2GRPB 1V55E 1KLXA 3DRAA 3T8KA 4YNDA 1VDYA 3UXGA 4QFVA 3UQ3A 2GRMA 4GTOA 4GU5A 4H7YA 3NB2A 4EPZA 3LEWA 3QDNA 4JW1A 2GRLA 3PUJA 2IFUA 4RQIA 3S7FA 4OYSA 3MEKA 5B1BE 4B94A 4RSYA 2IY0C 4UWHA 5AENA 4I17A 4XKBA 4I1MA 3W9GA 4IRUA 3MKRA 2XHEA 3ASNE 1O1RA 4ILGA 3U9WA 3CK7A 5E76A 2VTBA 2RFAA 4LG6A 4CCAA 4LNGA 1QBQA 3QKYA 3IHYA 1N0RA 1N0QA 4N3AA 1H19A 2AXZA 3DXKG 3OXGA 5KCMA 2Y1LE 5BW8C 4JB8P 1WY6A 5BXUA 2ILRA 4LSZE 3TAXA 4U07A 4WAFA 5BXOA 5ENRD 2BUGA 4BTAA 3EJNA 4LRZA 1KT0A 2XZTG 2VQ2A 5CHEE 2YQ8A 3J5PA 1K8KG 4GA1A 4CDMA 1MX2A 3EHNA 5FIOA 5ITZF 2V5QC 4EQFA 1SQMA 4ANWA 3CVUA 4HOTA 3SF4A 5AJLA 4UI9K 3G2UA 2IJGX 1HS6A 4U04A 2AXVA 1ZBPA 1KZOA 3V2XA 2FF4A 3RRUA 5JJTA 1QYMA 1TJFA 3ASDA 5G2NA 3RJVA 1WG0A 2F0YA 3HVEB 3JQ0A 3I4GA 3J5QB 3CHOA 4L9PA 3CVNA 3IKOB 3QK0A 2F8YA 2IQCA 4RG9A 2GRNB 2RFMA 4XZ4A 4KMOA 3MX3A 2MOWA 2OCCE 4BTBA 1H6OA 2XGMA 2WQ7A 2WXIA 1U3CA 1H0AA 3CK8A 3NF1A 5JHAA 2XCCA 3AAAC 4NRHB 1EDUA 3CVQA 3SFXA 2PZIA 3E32A 2J8SD 4NQ0A 3ASOE 3ZYKA 2KC7A 3FDHA 4C9BB 2B0OE 4A3TA 3T5VA 4V3IA 3L9TA 2XGSA 3QB2A 2P9IG 4K0RA 5C2YA 2IOSA 4DX5D 4GTTA 5EDSA 5FINA 3FULA 4U8HA 2OOEA 4CT0A 2RG8A 3AG3E 1HG2A 3KS2A 4DI4A 4GTPA 3BQOA 3LY8A 4HBDA 4LEUA 2KXPC 4CDRA 4W9RA 4J7WA 1SW6A 4HI8A 3Q7FA 4U8VD 3JUIA 4DI3A 4CYMD 1O1SA 1ZB1A 3PEVB 2OVFA 3KAEA 1IKND 3AG1E 4JA7A 4XE0A 4ANXA 2EILE 3CK9A 5EX3A 4OAVB 3L16A 1FCHA 2ONDA 3CHRA 1H6KA 4N39A 2V8SE 5AAOA 2HYZA 1PC2A 2H6IA 4MLPA 2ZGDA 2KCKA 2CHXA 2IOLA 2V0PA 1K1AA 2DVWA 1MZCA 2DYSE 2HR2A 2P9NG 3SY2A 4WWNA 4CT4A 3BUAA 3EHQA 4FADA 2VGYA 3GZ1A 2P58C 5EYPF 5A23A 4ILIA 2Y4TA 2IO2C 3CVYA 2OV8A 4ILHB 1KT1A 1UJKA 4GTMA 2I6HA 2B6CA 3LKUA 2AXUA 3SBTB 2CG2A 3FU5A 4O6FA 3SFZA 3BU8A 3CSTA 3JQ1A 3ZYMA 4FLBA 2XS8A 3Q7AA 1FVFA 3ML9A 1HH8A 4HLLA 4GA0A 4BESA 3QOUA 3JXJA 4Q94A 2DBAA 5CBNA 3T9KA 1O1TA 1SZAA 3FU6A 3KSQA 4LNUD 3V31A 4BETA 4UWFA 3L22A 5HQ8A 3CKCA 1O5MA 3TWTA 3FH8A 3T5XA 4FHJA 2XPIA 4RLYA 1BI8B 4I6GA 1E90A 2X6KA 4BT8A 1N54A 2CHWA 5D66A 4B0ZA 1U3DA 1TN7A 4J8SA 1OCOE 3NZUA 3Q9UC 4G2VA 4J8DA 3U4TA 4BFRA 3OXLA 4XX5A 1HZ4A 4DLQA 1XNFA 4I6EA 2J09A 3FUHA 3V30A 1DCEA 2X38A 3CHQA 3SGHA 3GZ2A 3QAQA 5ANRA 2GROB 3JUEA 3ZGQA 5ANLA 3FEYA 3RRNB 4CRWA 4KBQA 4GPMA 5FQ6A 2BTDA 3AS8A 1X5BA 4LUNU 4N5QA 4BY6A 4GB9A 1IYGA 4AP2A 3NOCD 2HO1A 4UQXA 2VSOE 1N11A 3DEOA 2C0LA 2LXMA 2ZU6B 3B7BA 2PQRA 4AEZC 3UI2A 3APCA 3LY9A 3HVEA 3BEEA 4Y6CA 2H6GA 3PE4A 4QQIA 4TV3A 4TXRA 1UN8A 5BT1A 1OCZE 2WM9A 3HRAA 4HLEA 1WDYA 2X6HA 5CRVA 4XI0A 4G25A 4EZJA 3PRZA 3UM3A 5KJNA 4JL0A 4FP7A 3PNTB 2E0IA 2AVPA 3G2TA 1TJCA 3MA5A 4X8QA 2HM8A 2QYUA 3Q78A 3TWQA 3UT4A 2VJ8A 4EBAG 5BPPA 3PREA 4ZHBA 2KZTB 1D9SA 1TNBA 3FP3A 4F7AA 3Q73A 1JCQA 4DRXE 3FFLA 2UWJG 3CHMA 2J07A 2EQXA 3GYZA 5CCLA 4OAUC 3ZN3A 4B89A 3F6QA 1Z5SC 3PZ3A 4WUYA 5ARGA 3ML8A 4PS7A 1E8WA 1E7UA 1OWOA 3ZUVB 2ZGGA 3TL5A 4K5BA 3LYAA 3L6AA 1YYHA 4J0UA 3PNLB 3LY7A 4DUIA 1DNPA 3FY4A 3UT7A 3ZHEB 3ULEG 4AXHA 3RKVA 3VLDA 5HRYA 3UTMA 2BF0X 3IV0A 3CEQA 2QFCA 4GZ6A 3UIOC 3CHSA 5CECB 3AS5A 3SZ7A 3D3MA 3CR3A 1NP7A 3O48A 2PL2A 3FUFA 3ZFWA 3CHPA 5AN8A 4BWRA 2BEDA 1LTXA 3C72A 2ZXWE 3IHVA 4AVXA 1OWLA 2LO6A 1QZ2A 5BV0A 1QQEA 3B7RL 5FTPA 4U95D 2WXMA 3MV2B 3UMVA 2WXNA 4N3CA 4LCTA 1NL4A 3Q75A 3R9AB 2AWIA 3DSSA 3VLFA 2R5SA 4JXTA 2XRZA 1S63A 4D10C 3TWWA 3X2QE 5AQ7A 5KBAA 2HE0A 2ETAA 4IULA 3DXMG 3IEGA 1BPOA 3AS4A 1BD8A 4NIKA 3FUDA 3HDXA 4WWPA 2I9CA 1LF8A 3NQPA 2YINA 4U96D 1TYQG 3OXFA 4JEHA 1JWFA 2WXOA 2X6JA 3WG7E 2MHKA 2WMNA 1UOHA 4LNBA 4O1PA 3QNKA 3TWSA 4I9EA 3CVWA 3HHMA 3Q4AB 2X3MA 3D9PA 3FWVA 3CKBA 5EX0A 3UM0A 2NC9A 4WWOA 1BLXB 4OVVA 4ATZD 3Q9NC 2NXPA 2KM4A 2P9PG 5T3RA 2I2OA 4DLOA 1ZU2A 2XEVA 2BKKB 5BNWA 5CCMA 2VSXE 1H2VC 4YVQC 4TUUA 3CVXA 1H2UA 3TGOA 3ESLA 4GZ5A 2EINE 3APFA 4Q96A 1IHBA 4OVUA 1E96B 1Z3XA 2VGXA 1MJ0A 5KNGA 1YMPA 2KCVA 4EBAA 2AW6A 5FQ8A 5HI7A 3EDTB 4U7EB 2RKKA 3UUXA 2P9LG 3D9NA 3WXXA 5AYWD 2JLBA 2NYJA 3ZW3A 3TWVA 4M7CA 1SA5A 2CHZA 2C2LA 2ZISA 1EF1C 4EZLA 3MCXA 1TN8A 3EIQC 4FJYA 2GGFA 3U66A 4Y6WA 1H2TC 3L54A 3V2OA 3SHFA 2FO7A 5DBKA 3FHEA 2QC9A 3B7TA 4BX9A 1SZ9A 4APOA 2MYOA 2PQNA 3JCKC 3MV3B 4KYOB 3ZKJA 2WXRA 4EZKA 2IO3C 4U63A 4B93B 2L6BA 1NZNA 4I1AA 4GTRA 2Q7FA 2WXPA 2UY1A 5G55A 3UM2A 3DSXA 5AQ9A 1GW6A 4ME2A 4XEIG 3PEUB 1RZ4A 3MGBA 4KVMA 3IXEA 2V5FA 5EKQD 3HXBA 4WNEA 4XKCA 2WXGA 2FO1E 1OXJA 4O1OA 2PNNA 4MBGA 3AG4E 3FUMA 4Z68A 3FH5A 2CG3A 2F37A 3ZVVA 3N71A 3E33A 3PS6A 2XGOA 3FUIA 2IONA 4ANVA 3FH7A 4HVBA 2WQ6A 4URKA 3MZLB 4GMLA 4AM9A 1MQSA 2DZNA 2VYIA 1XGWA 4GZDA 4U0SA 3FUNA 1IHGA 1N4QA 3FTXA 3Q79A 3APDA 4IYPA 4ACLA
chains in the Genus database with same CATH topology
4KVOA 3PE4A 4CDNA 3QKYA 4TV3A 3S2AA 4GMJA 1UN8A 4U0ZA 4A55A 5BT1A 1ELWA 3IHYA 4N3BA 1MHQA 5FWQA 2OVBA 2WM9A 4H7XA 3ASHA 4L1BA 3ZVVA 4N3AA 4HLEA 1H19A 2AXZA 2X6HA 2FEZA 3U3WA 3CLJA 3OXGA 4XI0A 4G25A 5D0OD 5KCMA 3PRZA 4EZJA 5KJNA 2KZTA 3FUEA 4JL0A 2E2EA 2CFUA 2LAIA 4FP7A 5BW8C 4DJAA 3PNTB 2E0IA 2AVPA 3G2TA 4GA2A 1TJCA 3MA5A 1WY6A 4BX8A 3VLEA 2ILRA 4JPSA 2HM8A 4PS8A 3D9JA 4WNFA 1HU3A 4I43A 3FTVA 3TAXA 2J4DA 3FTUA 2J08A 3UT4A 5JJ6A 4U07A 2VJ8A 3KD7A 4EBAG 5BPPA 4WAFA 4A3VA 3PREA 3FU0A 3D9OA 3UPVA 3CVVA 4FULA 3QWWA 1JUQA 2BUGA 2I1KA 4XI9A 2KZTB 4UWKA 4L2YA 2JEKA 3FP3A 4BTAA 4F7AA 3PVLA 4WNGA 3EJNA 4LRZA 3FFLA 5FQ7A 1KT0A 2UWJG 3CHMA 1YA0A 3I5PA 4UQZA 2J07A 5KJKA 2EQXA 3CIAA 3DBSA 2VQ2A 2MRIA 5CHEE 3GYZA 1A17A 3MKQA 2YQ8A 4ATGA 3MYVA 5AIJA 4GZCA 5A6CA 5CCLA 4GA1A 4JZYA 3VTYA 3ZN3A 4HOQA 4B89A 4PUCA 4CDMA 3Q5MA 3EHNA 3PDNA 4EQFA 1SQMA 2WVIA 4WUYA 4HFGA 3RK6A 4ANWA 3CVUA 4MRUA 3MKQB 5ARGA 4AJWA 3ML8A 4HOTA 4PS7A 1E8WA 3SF4A 5AJLA 1E7UA 1OWOA 4XIFA 4UI9K 3TL5A 3G2UA 3LYAA 2IJGX 4C0MA 4J8FA 1HS6A 3L6AA 1HO8A 4U04A 4J0UA 3PNLB 3LY7A 2AXVA 1ZBPA 1DNPA 4MS6A 3ZRHA 3FY4A 2X6FA 3QWPA 3UT7A 3B13A 3ZHEB 2FF4A 3RRUA 4KZ0A 4PS3A 5JJTA 5JHBA 1TJFA 3ASDA 5G2NA 3RJVA 2C0MA 3HVEB 3JQ0A 4AXHA 3LXUX 1IQUA 3RKVA 4B8AA 3K9IA 3I4GA 5J90A 2V4LA 3ENEA 3P1UA 3VLDA 2RD0A 3CHOA 5G05J 2BF0X 3IV0A 3Q15A 3CEQA 5J08A 3SI5A 3CVNA 2QFCA 2YHCA 3IKOB 3QJZA 2WXHA 4GZ6A 1L5JA 3QK0A 3CHSA 4HORA 4GYYA 2IQCA 2Y3AA 3O4ZA 3G2VA 4RG9A 5FZRA 2WXFA 1WM5A 3AS5A 4XZ4A 3RO3A 4CGWA 4KMOA 3MX3A 2MOWA 3SZ7A 3D3MA 4BTBA 3CR3A 3PUKA 4Q69A 3Q47B 5FZQA 5D0QD 1NP7A 3O48A 2DIWA 1E8ZA 2PL2A 3FUFA 2XGMA 3FTYA 3ZFWA 2WQ7A 3CHPA 5DIZA 4BWRA 5G05C 2WXIA 3ASGA 1U3CA 1H0AA 4K03A 4PH4B 5C1DA 1INZA 3CK8A 3NF1A 4DPRA 4N5CA 5JHAA 2XCCA 3IHVA 4GCOA 4NRHB 1EDUA 4RG6A 4AVXA 1HG5A 2WXLA 5LCWC 1OWLA 2LO6A 1HX8A 3HYMB 3UX4A 3CVQA 3R7RA 1QZ2A 1Z6TA 3LVQE 2PZIA 5BV0A 4NQ0A 1QQEA 3ZYKA 3CGHA 2KC7A 3FDHA 4C9BB 1E8YA 4A3TA 3E4BA 3T5VA 3TG5A 3B7RL 4V3IA 5FTPA 1W3BA 3EIJA 2WXMA 4A1GA 2WPVA 2XGSA 3LPZA 3MV2B 1HF8A 3FUKA 3QB2A 4K0RA 3UMVA 4B8CB 3U64A 3NZSA 5KJMA 3FUJA 4EECA 2WXNA 5C2YA 2IOSA 4N3CA 3TXMA 4YVOA 3LS8A 4LCTA 3AU5A 5G04J 2A5UA 2YNQA 5T4YA 3R9AB 3T8MA 5LX8A 5EDSA 1OUVA 3OTNA 2AWIA 1DVPA 1Y6IA 3FULA 4U8HA 2LAHA 3VLFA 2R5SA 2OOEA 4CT0A 4A1SA 4JXTA 2RG8A 2XRZA 5LCWJ 3D9IA 1HG2A 1OWNA 4D10C 3KS2A 4BT9A 4DI4A 3B7UX 3LY8A 4LEUA 4ACKA 2WXQA 4IULA 2YHEA 4CDRA 2XPZA 3IEGA 4W9RA 1BPOA 3FEXA 3AS4A 4WNDA 1OWPA 4GYOA 2J9QA 2GW1A 3BG1B 2X6IA 4IN3B 2WQHA 4CEMA 2XRYA 3FUDA 3HDXA 4R7LA 3FTSA 4WWPA 2I9CA 1LF8A 3NQPA 4JC8A 3JUIA 4UI9J 2YINA 4DI3A 3ZYLA 2WB2A 3OXFA 2QY7A 4G23A 4FC8A 1JWFA 4GAAA 3PEVB 2OVFA 4JEHA 2R17C 3KAEA 3MJWA 5JJ7A 1EYHA 2WXOA 4I6JA 4JA7A 2UY1B 4XE0A 3S7BA 2R59A 4ANXA 2X6JA 3CK9A 3RRMB 5EX3A 4I2ZA 2MHKA 2WMNA 1FCHA 3L16A 4HOUA 4I1OB 4P29A 3Q49B 3QNKA 4GPKA 3AU4A 4UI9C 2ONDA 3CHRA 1H6KA 3GW4A 4N39A 2I1JA 4MKTA 4ABNA 2V8SE 5BV1A 3SNXA 4I9EA 3CVWA 2L6JA 2HYZA 1PC2A 5FJYA 4MLPA 3HHMA 3Q4AB 2X3MA 5G04C 3CQGB 3D9LA 4UWLA 3VTXA 3D9PA 3FWVA 2KCKA 3CKBA 3GZSA 5EX0A 2NC9A 4WWOA 1P5QA 4OVVA 2CHXA 1FVHA 2IOLA 2V0PA 2L0IA 3L13A 3PE3A 2LNIA 1B89A 2NXPA 4KXKB 2KM4A 5T3RA 2I2OA 4JA9A 4CGVA 4HXIA 4DLOA 1ZU2A 2XEVA 2HR2A 4JVSA 4WWNA 4CT4A 3D9KA 4FADA 5BNWA 5A7DB 5CCMA 2VGYA 2VSXE 1H2VC 3TXNA 3GZ1A 4FU3A 4YVQC 2P58C 3ZXSA 5A23A 2LSUA 4ILIA 2NSZA 4G1TA 3LJ3A 5LOZA 3ZPJA 4TUUA 1ELRA 3CVXA 1H2UA 2Y4TA 5ARFA 3TGOA 3CVYA 2OV8A 4L7TA 3C98A 3G2SA 3ESLA 4E6HA 4GZ5A 3APFA 2J4BA 3FTWA 4ILHB 3QARA 1KT1A 4Q96A 3SBSA 4OVUA 1E96B 1UJKA 1Z3XA 2PM6A 2VGXA 2WMOA 1UJJA 1PAQA 2WXKA 3LCAA 1E8XA 2M63A 2I6HA 3B7SA 3RU0A 3SD5A 1ELKA 5KJLA 4M3OA 2KCVA 3G2WA 1UN9A 5CMYA 5AJDA 4EBAA 3BG0B 1HE8A 2L0TB 2AW6A 5FQ8A 3LKUA 5HI7A 3EDTB 3UUXA 2J49A 3D9NA 4I9CA 3WXXA 2DCPA 2CFZA 5AYWD 4JHJA 2AXUA 2JLBA 1NA0A 5LP0A 4N2SA 3SBTB 3I4RB 2CG2A 3ULQA 3UT8A 3ZEFA 3ZW3A 3FU5A 4AY5A 3QWVA 4O6FA 4GCNA 3SFZA 1Z3YA 2VTBB 4NACA 4JEUA 2CHZA 3CSTA 2C2LA 3LDZA 1EF1C 3JQ1A 4EZLA 3MCXA 2IU1A 2A4ZA 3ZYMA 4FLBA 4FLHA 1FVFA 3ML9A 2Y4UA 1HH8A 4KT6B 3R7QA 3IBEA 4AV7A 3EIQC 4FJYA 2GGFA 3FU3A 3U66A 2L9BA 4GA0A 2XCBA 4Y6WA 1H2TC 3QOUA 4G11A 5BUZA 3PZDA 1WAO1 4Q94A 2XPYA 5FZSA 3L54A 2DBAA 3ASFA 4DK5A 3FTZA 3LVRE 3SHFA 3S7JA 2FO7A 3QC1A 4HS2A 4AOFA 4C0EA 4AY6A 5DBKA 3ESKA 1SZAA 3FHEA 4G24A 3CVPA 3FU6A 4UWGA 5ENNA 3B7TA 4BX9A 4L2LA 4GZ3A 2FBNA 4UWFA 4UQYA 2VSYA 1SZ9A 4APOA 3L22A 2PQNA 4G26A 1TEZA 5HQ8A 4TRQA 3CKCA 3L17A 4F3VA 4FHKA 3FH8A 1NA3A 3T5XA 3JCKC 3MV3B 4KYOB 4FHJA 3P2BA 2WXRA 2XPIA 4EZKA 1EPUA 1N52A 4I6GA 3OAWA 5M72A 1QNFA 1E90A 2X6KA 4GYWA 4U63A 4JHKA 4RVBA 2KATA 4BT8A 4BSXA 4F53A 4FA6A 3ZIMA 1N54A 2CHWA 4B0ZA 5FQ4A 1U3DA 1NZNA 5CMWA 3CSFA 4I1AA 4U0UA 2Q7FA 4J8SA 2WXPA 2UY1A 2VSNA 1PY1A 1JWGA 3NZUA 4G2VA 3KEZA 4J8DA 1JPLA 5G55A 3U4TA 4APFA 4BFRA 3ONKA 4KZCA 3OXLA 4LERA 4XX5A 4L23A 4HOSA 4F1SA 1HZ4A 1GW6A 1HXIA 4ME2A 3L08A 4DLQA 1XNFA 4E85A 3PEUB 1Y8MA 2IF4A 3I3NA 1IQRA 4JHRA 4I6EA 2J09A 3FUHA 2FULA 3MGBA 4I2WA 3ZHEA 4KVMA 1KLXA 2X38A 2V5FA 3TJPA 3CHQA 5EKQD 2XQ0A 3S7DA 4WNEA 4YNDA 3SGHA 4J6IA 1VDYA 2LSVA 2WXGA 3GZ2A 4XKCA 3URZA 5LFAA 3QAQA 5ANRA 4QFVA 3UQ3A 3ZGQA 2GRMA 5ANLA 2VGXB 3FEYA 1HFAA 2FI7A 4GU5A 3RRNB 4CRWA 3FUMA 4H7YA 4ANUA 3PH0C 4EPZA 4KBQA 4PDXA 5FQ6A 3FH5A 3LEWA 2CG3A 2PM7A 3N71A 3QDNA 2BTDA 3EHMA 1S0PA 2GRLA 3PUJA 2IFUA 2WXJA 3AS8A 3PS6A 4JW1A 5E75A 1E7VA 3S7FA 4OYSA 2XGOA 4NURA 1X5BA 3CV0A 4LUNU 3RIBA 3CVLA 1OWMA 3MEKA 1UW4B 3RO2A 3FUIA 4BY6A 3DPDA 4GB9A 4RSYA 4B94A 4AP2A 2IONA 4AIFA 1IYGA 1UG3A 2HO1A 4ANVA 3FH7A 4HVBA 2WQ6A 4UQXA 4UWHA 5AENA 2VSOE 4URKA 4I17A 4XKBA 3ONLA 5T8IA 4N2QA 3MZLB 4GMLA 4I1MA 2KCLA 4IRUA 1MQSA 3MKRA 4AM9A 2C0LA 2XHEA 2ZU6B 3TG4A 2PQRA 2VYIA 1XGWA 4ILGA 4GZDA 4U0SA 4FJZA 4AEZC 3FUNA 1IHGA 3U9WA 3CK7A 3APCA 3CQCB 3FTXA 3LY9A 4J8EA 3JYSA 5E76A 3APDA 5FT9A 4IYPA 3HIZA 2VTBA 3ZYQA 3HVEA 3BEEA 4Y6CA 4ACLA 4CCAA 3D9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HOR A;  4GYY A;  3PE4 A;  4ABN A;  4G26 A;  4I9E A;  3QKY A;  5HQ8 A;  2L6J A;  2HYZ A;  3CKC A;  4RG9 A;  1PC2 A;  4U0Z A;  5FJY A;  5FZR A;  1WM5 A;  4F3V A;  3AS5 A;  1NA3 A;  1ELW A;  4N3B A;  3Q4A B;  3MV3 B;  4KYO B;  5G04 C;  3RO3 A;  3SZ7 A;  4CGW A;  4H7X A;  3ASH A;  3VTX A;  4BTB A;  2XPI A;  2KCK A;  3CKB A;  3FWV A;  4N3A A;  5EX0 A;  3Q47 B;  5FZQ A;  2NC9 A;  3O48 A;  5D0Q D;  2FEZ A;  5M72 A;  1P5Q A;  4GYW A;  3U3W A;  2KAT A;  2PL2 A;  3OXG A;  4BT8 A;  2XGM A;  4G25 A;  4XI0 A;  5D0O D;  3PE3 A;  5DIZ A;  3ZFW A;  5KJN A;  4BWR A;  2LNI A;  1B89 A;  4KXK B;  5G05 C;  4JL0 A;  1NZN A;  2E2E A;  3ASG A;  5BW8 C;  4CGV A;  4JA9 A;  5C1D A;  4I1A A;  4U0U A;  2AVP A;  2Q7F A;  1ZU2 A;  1TJC A;  2XEV A;  3CK8 A;  3MA5 A;  2HR2 A;  3NF1 A;  4GA2 A;  2XCC A;  4GCO A;  4NRH B;  2UY1 A;  4N5C A;  4RG6 A;  2VSN A;  4G2V A;  5LCW C;  4WNF A;  4J8D A;  3U4T A;  3HYM B;  3CVQ A;  5BNW A;  5A7D B;  5CCM A;  1QZ2 A;  3TAX A;  2VGY A;  3OXL A;  5JJ6 A;  2PZI A;  4U07 A;  4HOS A;  3GZ1 A;  4NQ0 A;  3KD7 A;  2P58 C;  4YVQ C;  1HZ4 A;  2LSU A;  1HXI A;  3ZPJ A;  1QQE A;  4G1T A;  4ME2 A;  3UPV A;  1ELR A;  2KC7 A;  2Y4T A;  5ARF A;  1XNF A;  3QWW A;  3TGO A;  2BUG A;  3E4B A;  4XI9 A;  3TG5 A;  1Y8M A;  2IF4 A;  4JHR A;  5FTP A;  4BTA A;  3FP3 A;  1W3B A;  5BT1 A;  4GZ5 A;  4WNG A;  4I2W A;  2WPV A;  2XGS A;  3FFL A;  3LPZ A;  1KLX A;  1KT0 A;  3MV2 B;  3ZHE A;  1KT1 A;  2UWJ G;  2V5F A;  1YA0 A;  1E96 B;  5EKQ D;  2VGX A;  4UQZ A;  5KJM A;  5KJK A;  3S7D A;  4WNE A;  2VQ2 A;  3LCA A;  4N3C A;  4YND A;  4YVO A;  5CHE E;  3GYZ A;  1A17 A;  2LSV A;  2I6H A;  2YQ8 A;  3GZ2 A;  3RU0 A;  3URZ A;  5G04 J;  5KJL A;  3UQ3 A;  2KCV A;  3R9A B;  5A6C A;  3ZGQ A;  1OUV A;  5CCL A;  4GA1 A;  2VGX B;  3VTY A;  3ZN3 A;  4HOQ A;  2FI7 A;  3LKU A;  5HI7 A;  2R5S A;  2OOE A;  3Q5M A;  3EDT B;  3PDN A;  4H7Y A;  4A1S A;  4EQF A;  5LCW J;  4KBQ A;  4WUY A;  3UUX A;  4I9C A;  3WXX A;  5AYW D;  4N2S A;  3QDN A;  3N71 A;  2JLB A;  1NA0 A;  3KS2 A;  4BT9 A;  2IFU A;  3AS8 A;  3ULQ A;  5ARG A;  3S7F A;  2XGO A;  3LY8 A;  4LEU A;  3QWV A;  4O6F A;  4AY5 A;  4GCN A;  3CV0 A;  3RIB A;  4HOT A;  3CVL A;  3SF4 A;  3MEK A;  4XIF A;  3RO2 A;  4UI9 K;  3IEG A;  4W9R A;  4CDR A;  4WND A;  2C2L A;  3AS4 A;  4GYO A;  3LYA A;  4B94 A;  1IYG A;  2J9Q A;  4J8F A;  2HO1 A;  4AIF A;  2GW1 A;  4U04 A;  4J0U A;  4IN3 B;  3LY7 A;  4UQX A;  2WQH A;  4I17 A;  1ZBP A;  4N2Q A;  2Y4U A;  3QWP A;  3ZHE B;  1HH8 A;  2FF4 A;  2KCL A;  4Y6C A;  5JJT A;  3MKR A;  4UI9 J;  4AM9 A;  2C0L A;  3TG4 A;  3ASD A;  3RJV A;  4GA0 A;  2XCB A;  4Y6W A;  2PQR A;  2VYI A;  2C0M A;  3OXF A;  3QOU A;  4G23 A;  1WAO 1;  3RKV A;  5FZS A;  3K9I A;  2DBA A;  3ASF A;  3KAE A;  4U0S A;  5JJ7 A;  1IHG A;  4JA7 A;  2FO7 A;  2UY1 B;  3CK7 A;  3S7B A;  5G05 J;  3S7J A;  4AY6 A;  5DBK A;  3CK9 A;  3ESK A;  5EX3 A;  4I2Z A;  3LY9 A;  4G24 A;  2MHK A;  3CVP A;  1FCH A;  3CEQ A;  3JYS A;  3Q15 A;  4HOU A;  4J8E A;  3Q49 B;  5FT9 A;  3CVN A;  4GZ3 A;  2QFC A;  2YHC A;  4UI9 C;  4GPK A;  2FBN A;  2OND A;  3BEE A;  2VSY A;  4GZ6 A;  4UQY A;  4APO A;  3GW4 A;  4N39 A;  2PQN A; 
#chains in the Genus database with same CATH topology
 4CDN A;  5IY5 E;  3KEA A;  5CER B;  4U0Z A;  4A55 A;  1ELW A;  4N3B A;  1MHQ A;  4GMR A;  4H7X A;  1MX4 A;  1LD8 A;  3CLJ A;  5D0O D;  3FUE A;  3ABM E;  1K1B A;  4A63 B;  2CFU A;  3ZXP A;  4BX8 A;  3VLE A;  2P9U G;  4PS8 A;  4WNF A;  4I43 A;  3FTU A;  2J08 A;  3DWL G;  3E37 A;  5JJ6 A;  3UKU G;  4YDW A;  3FU0 A;  3UPV A;  3CVV A;  4FUL A;  1JUQ A;  2I1K A;  4XI9 A;  2F8X K;  4L2Y A;  2JEK A;  1D8E A;  4UQZ A;  3CIA A;  1A17 A;  5AIJ A;  4GZC A;  5A6C A;  4JZY A;  3VTY A;  4HOQ A;  3Q5M A;  2WVI A;  2EIK E;  4HFG A;  3RK6 A;  5D2M C;  3MKQ B;  4AJW A;  2XEH A;  4XIF A;  4TXQ A;  1HO8 A;  4HI9 A;  2LXL A;  3ZRH A;  2X6F A;  3QWP A;  3B13 A;  5CEA A;  4KZ0 A;  4PS3 A;  5JHB A;  3NBN B;  2C0M A;  4B8A A;  3K9I A;  5J90 A;  2V4L A;  2RD0 A;  5G05 J;  2R02 A;  1K3Z D;  5AAR A;  2YHC A;  2H6H A;  4HOR A;  2Y3A A;  3DST A;  3O4Z A;  1N4R A;  3RO3 A;  3C3O A;  3PUK A;  4Q69 A;  5D0Q D;  2DIW A;  2P2C P;  4TXP A;  3FTY A;  5DIZ A;  5G05 C;  3ASG A;  4PH4 B;  5C1D A;  4GCO A;  4RG6 A;  1HX8 A;  3HYM B;  3UX4 A;  3R7R A;  1Z6T A;  4G8K A;  1RW2 A;  1W3B A;  1OY3 D;  2WPV A;  3LPZ A;  1HF8 A;  4B8C B;  3U64 A;  4EEC A;  3TXM A;  3LS8 A;  3HXD A;  5G04 J;  2A5U A;  3T8M A;  5LX8 A;  1OUV A;  1DVP A;  5LCW J;  1OWN A;  4BT9 A;  5ENP D;  4YDE A;  4ACK A;  2YHE A;  2XPZ A;  1TN6 A;  1OWP A;  1U2V G;  2GW1 A;  2GRQ B;  4IN3 B;  3DEP A;  1JCS A;  1NFI E;  4JC8 A;  4UI9 J;  3PZ1 A;  4G23 A;  4FC8 A;  4GAA A;  2BKG A;  3SFY A;  5EIB E;  2A5E A;  2R17 C;  1EYH A;  4I6J A;  1Q2Z A;  5HKP A;  3S7B A;  3RRM B;  1SVX A;  4HNA D;  1X81 A;  1AWC B;  4I1O B;  1BI7 B;  3Q49 B;  2Y0B G;  4GPK A;  3TWU A;  2I1J A;  4ABN A;  4JD2 G;  3SNX A;  5FJY A;  4DX6 D;  5G04 C;  4BSZ B;  5CED B;  3D9L A;  4YDY A;  4UWL A;  3EU9 A;  2L0I A;  1B89 A;  2R05 A;  4O60 A;  5ENO D;  4CGV A;  4JA9 A;  4HXI A;  3AJI A;  4U8Y D;  5A7D B;  4FU3 A;  5HS0 A;  3ZXS A;  4EHM A;  2ETB A;  2LSU A;  3ZPJ A;  2NSZ A;  4G1T A;  5LOZ A;  1ELR A;  3EHR A;  3C98 A;  3G2S A;  4E6H A;  2J4B A;  4F6R D;  3SBS A;  2WXK A;  2JAB A;  3LCA A;  1E8X A;  2M63 A;  3RU0 A;  3SD5 A;  4CZ2 D;  1ELK A;  5KJL A;  4M3O A;  3G2W A;  4BEP A;  1TNY A;  5CMY A;  3UKR G;  2L0T B;  3EU5 A;  4I9C A;  2DCP A;  4GTV A;  5LP0 A;  1NA0 A;  3ULQ A;  1MX6 A;  4GCN A;  1Z3Y A;  5ENT D;  3LDZ A;  2A4Z A;  3PZ2 A;  2AJA A;  3C5R A;  2Y4U A;  5JA4 D;  4AV7 A;  3R7Q A;  3IBE A;  2GRR B;  3FU3 A;  2XEN A;  5BUZ A;  3C3R A;  1WAO 1;  3PZD A;  3JXI A;  2XPY A;  5FZS A;  5CBO A;  3FTZ A;  3RAU A;  3S7J A;  4HS2 A;  3QC1 A;  4AY6 A;  2EIM E;  3ESK A;  4UWG A;  2VSY A;  3HXE A;  4G26 A;  1TEZ A;  4TRQ A;  4F3V A;  3L17 A;  4FHK A;  3KSL A;  2IEJ A;  4GTS A;  5M72 A;  4JHK A;  4RVB A;  2KAT A;  4BSX A;  3ZIM A;  5CMW A;  3CSF A;  2DZO A;  4U0U A;  4ZFH A;  1N94 A;  5JMN D;  1PY1 A;  4APF A;  3V79 K;  4KZC A;  1TNO A;  2R03 A;  4F1S A;  3ABK E;  3UIP C;  3L08 A;  1IQR A;  2FUL A;  4I2W A;  3ZHE A;  3TJP A;  2XQ0 A;  2XS1 A;  3S7D A;  2ZIR A;  4J6I A;  2LSV A;  4HRM B;  3URZ A;  5LFA A;  5ENQ D;  5B3S E;  5KNH D;  2VGX B;  2LUH A;  5EIL A;  1HFA A;  2FI7 A;  4ANU A;  3PH0 C;  4PDX A;  2PM7 A;  3EHM A;  1S0P A;  3EUV A;  3SQV A;  5E75 A;  2WXJ A;  4DX2 A;  2OEV A;  1E7V A;  2P9S G;  4NUR A;  3TWR A;  3CV0 A;  3RIB A;  3CVL A;  1OWM A;  1UW4 B;  3RO2 A;  3DPD A;  4AIF A;  1UG3 A;  2P9K G;  3ONL A;  5T8I A;  4N2Q A;  2KCL A;  4C48 B;  3TG4 A;  2XEE A;  5H7P A;  4FJZ A;  3L82 A;  5EN5 D;  3CQC B;  4J8E A;  3JYS A;  5FT9 A;  3HIZ A;  3ZYQ A;  3D9M A;  4KVO A;  1S64 A;  3D9H A;  3S2A A;  4GMJ A;  2H6F A;  3HXC A;  2QZA A;  5FWQ A;  2OVB A;  3ASH A;  4L1B A;  2FEZ A;  3U3W A;  2KZT A;  2E2E A;  2LAI A;  4DJA A;  1S70 B;  4HB5 A;  4GA2 A;  4JPS A;  3D9J A;  1HU3 A;  3FTV A;  4HQD A;  2J4D A;  4YDO A;  4DX7 D;  1OT8 A;  3KD7 A;  4A3V A;  1TR4 A;  3D9O A;  3QWW A;  4UWK A;  3PVL A;  4WNG A;  1TNZ A;  5FQ7 A;  1YA0 A;  3I5P A;  5KJK A;  3DBS A;  4G8L A;  2MRI A;  3MKQ A;  4ATG A;  3MYV A;  1SA4 A;  4PUC A;  3PDN A;  1G3N B;  2QYJ A;  4MRU A;  1H6P A;  1D8D A;  3SO8 A;  4C0M A;  4HRN A;  4J8F A;  3UIN C;  4MS6 A;  3ZNG A;  4J8Y A;  3LXU X;  1IQU A;  4TUM A;  3ENE A;  3P1U A;  3Q15 A;  5J08 A;  5AQA A;  3SI5 A;  1JCR A;  3QJZ A;  2WXH A;  5B1A E;  1L5J A;  4GYY A;  1FT2 A;  3B95 A;  3G2V A;  4F1P A;  5FZR A;  2WXF A;  1WM5 A;  2Y69 E;  4CGW A;  1N4S A;  3Q47 B;  3C3Q A;  5FZQ A;  1E8Z A;  5EYL A;  4K03 A;  1INZ A;  1FPP A;  2KBX A;  4DPR A;  4N5C A;  1FT1 A;  5LCW C;  1HG5 A;  2WXL A;  3LVQ E;  5AQB A;  3CGH A;  4K5C A;  1E8Y A;  3E4B A;  3TG5 A;  3EIJ A;  4A1G A;  3FUK A;  4GTQ A;  4K5A B;  1N95 A;  2XZD G;  3NZS A;  5KJM A;  3FUJ A;  4YVO A;  3AU5 A;  2YNQ A;  5T4Y A;  3OTN A;  1N9A A;  1Y6I A;  2LAH A;  3RSE G;  4A1S A;  3D9I A;  1DC2 A;  3DPY A;  3B7U X;  2WXQ A;  1BU9 A;  3NAW A;  4WND A;  1TNU A;  3FEX A;  4GYO A;  2J9Q A;  3BG1 B;  1MYO A;  2X6I A;  2WQH A;  4CEM A;  2XRY A;  1V54 E;  4R7L A;  3FTS A;  3AG2 E;  1AP7 A;  5CRU A;  3ZYL A;  2WB2 A;  2QY7 A;  2OEW A;  3LJN A;  1NI1 A;  1OCR E;  3MJW A;  2DYR E;  5JJ7 A;  2UY1 B;  2R59 A;  4I2Z A;  4P29 A;  4HOU A;  3AU4 A;  4UI9 C;  3GW4 A;  4MKT A;  5BV1 A;  2L6J A;  3CQG B;  1LD7 A;  3VTX A;  3GZS A;  3DSW A;  1P5Q A;  3ZU7 B;  1FVH A;  3L13 A;  3PE3 A;  2LNI A;  4KXK B;  3DSU A;  2VGE A;  4JVS A;  4HRL A;  3NOG D;  3D9K A;  1A5E A;  3TWX A;  3TXN A;  3LJ3 A;  5EID A;  5ARF A;  4L7T A;  3FTW A;  3QAR A;  3R9M A;  2PM6 A;  2WMO A;  1UJJ A;  1PAQ A;  3B7S A;  1UN9 A;  5AJD A;  1KZP A;  3BG0 B;  1HE8 A;  4UUC A;  2J49 A;  4N2S A;  2CFZ A;  4JHJ A;  3I4R B;  3UT8 A;  3ZEF A;  1OCC E;  4AY5 A;  3QWV A;  2VTB B;  4NAC A;  4JEU A;  3DSV A;  2IU1 A;  4FLH A;  3E34 A;  4BER A;  4KT6 B;  4DX1 A;  5ENS D;  2L9B A;  2XCB A;  4G11 A;  4DK5 A;  3ASF A;  3LVR E;  4AOF A;  2R2L A;  4C0E A;  3PZ4 A;  1DCQ A;  1KPS B;  3E30 A;  4G24 A;  3CVP A;  5ENN A;  4L2L A;  4GZ3 A;  1N4P A;  2FBN A;  4UQY A;  3UM1 A;  3HXF A;  3ISM C;  3HG0 D;  1NA3 A;  1IXV A;  3P2B A;  1EPU A;  1N52 A;  3OAW A;  1QNF A;  4GYW A;  2DWZ A;  4F53 A;  4FA6 A;  3W9F A;  5FQ4 A;  2ETC A;  1YCS B;  2EIJ E;  3ULY A;  3ABL E;  2VSN A;  1JWG A;  3KEZ A;  1JPL A;  3ONK A;  5KWD A;  4LER A;  4L23 A;  4HOS A;  1HXI A;  2V4H C;  4E85 A;  1Y8M A;  2IF4 A;  3I3N A;  4JHR A;  2GRP B;  1V55 E;  1KLX A;  3DRA A;  3T8K A;  4YND A;  1VDY A;  3UXG A;  4QFV A;  3UQ3 A;  2GRM A;  4GTO A;  4GU5 A;  4H7Y A;  3NB2 A;  4EPZ A;  3LEW A;  3QDN A;  4JW1 A;  2GRL A;  3PUJ A;  2IFU A;  4RQI A;  3S7F A;  4OYS A;  3MEK A;  5B1B E;  4B94 A;  4RSY A;  2IY0 C;  4UWH A;  5AEN A;  4I17 A;  4XKB A;  4I1M A;  3W9G A;  4IRU A;  3MKR A;  2XHE A;  3ASN E;  1O1R A;  4ILG A;  3U9W A;  3CK7 A;  5E76 A;  2VTB A;  2RFA A;  4LG6 A;  4CCA A;  4LNG A;  1QBQ A;  3QKY A;  3IHY A;  1N0R A;  1N0Q A;  4N3A A;  1H19 A;  2AXZ A;  3DXK G;  3OXG A;  5KCM A;  2Y1L E;  5BW8 C;  4JB8 P;  1WY6 A;  5BXU A;  2ILR A;  4LSZ E;  3TAX A;  4U07 A;  4WAF A;  5BXO A;  5ENR D;  2BUG A;  4BTA A;  3EJN A;  4LRZ A;  1KT0 A;  2XZT G;  2VQ2 A;  5CHE E;  2YQ8 A;  3J5P A;  1K8K G;  4GA1 A;  4CDM A;  1MX2 A;  3EHN A;  5FIO A;  5ITZ F;  2V5Q C;  4EQF A;  1SQM A;  4ANW A;  3CVU A;  4HOT A;  3SF4 A;  5AJL A;  4UI9 K;  3G2U A;  2IJG X;  1HS6 A;  4U04 A;  2AXV A;  1ZBP A;  1KZO A;  3V2X A;  2FF4 A;  3RRU A;  5JJT A;  1QYM A;  1TJF A;  3ASD A;  5G2N A;  3RJV A;  1WG0 A;  2F0Y A;  3HVE B;  3JQ0 A;  3I4G A;  3J5Q B;  3CHO A;  4L9P A;  3CVN A;  3IKO B;  3QK0 A;  2F8Y A;  2IQC A;  4RG9 A;  2GRN B;  2RFM A;  4XZ4 A;  4KMO A;  3MX3 A;  2MOW A;  2OCC E;  4BTB A;  1H6O A;  2XGM A;  2WQ7 A;  2WXI A;  1U3C A;  1H0A A;  3CK8 A;  3NF1 A;  5JHA A;  2XCC A;  3AAA C;  4NRH B;  1EDU A;  3CVQ A;  3SFX A;  2PZI A;  3E32 A;  2J8S D;  4NQ0 A;  3ASO E;  3ZYK A;  2KC7 A;  3FDH A;  4C9B B;  2B0O E;  4A3T A;  3T5V A;  4V3I A;  3L9T A;  2XGS A;  3QB2 A;  2P9I G;  4K0R A;  5C2Y A;  2IOS A;  4DX5 D;  4GTT A;  5EDS A;  5FIN A;  3FUL A;  4U8H A;  2OOE A;  4CT0 A;  2RG8 A;  3AG3 E;  1HG2 A;  3KS2 A;  4DI4 A;  4GTP A;  3BQO A;  3LY8 A;  4HBD A;  4LEU A;  2KXP C;  4CDR A;  4W9R A;  4J7W A;  1SW6 A;  4HI8 A;  3Q7F A;  4U8V D;  3JUI A;  4DI3 A;  4CYM D;  1O1S A;  1ZB1 A;  3PEV B;  2OVF A;  3KAE A;  1IKN D;  3AG1 E;  4JA7 A;  4XE0 A;  4ANX A;  2EIL E;  3CK9 A;  5EX3 A;  4OAV B;  3L16 A;  1FCH A;  2OND A;  3CHR A;  1H6K A;  4N39 A;  2V8S E;  5AAO A;  2HYZ A;  1PC2 A;  2H6I A;  4MLP A;  2ZGD A;  2KCK A;  2CHX A;  2IOL A;  2V0P A;  1K1A A;  2DVW A;  1MZC A;  2DYS E;  2HR2 A;  2P9N G;  3SY2 A;  4WWN A;  4CT4 A;  3BUA A;  3EHQ A;  4FAD A;  2VGY A;  3GZ1 A;  2P58 C;  5EYP F;  5A23 A;  4ILI A;  2Y4T A;  2IO2 C;  3CVY A;  2OV8 A;  4ILH B;  1KT1 A;  1UJK A;  4GTM A;  2I6H A;  2B6C A;  3LKU A;  2AXU A;  3SBT B;  2CG2 A;  3FU5 A;  4O6F A;  3SFZ A;  3BU8 A;  3CST A;  3JQ1 A;  3ZYM A;  4FLB A;  2XS8 A;  3Q7A A;  1FVF A;  3ML9 A;  1HH8 A;  4HLL A;  4GA0 A;  4BES A;  3QOU A;  3JXJ A;  4Q94 A;  2DBA A;  5CBN A;  3T9K A;  1O1T A;  1SZA A;  3FU6 A;  3KSQ A;  4LNU D;  3V31 A;  4BET A;  4UWF A;  3L22 A;  5HQ8 A;  3CKC A;  1O5M A;  3TWT A;  3FH8 A;  3T5X A;  4FHJ A;  2XPI A;  4RLY A;  1BI8 B;  4I6G A;  1E90 A;  2X6K A;  4BT8 A;  1N54 A;  2CHW A;  5D66 A;  4B0Z A;  1U3D A;  1TN7 A;  4J8S A;  1OCO E;  3NZU A;  3Q9U C;  4G2V A;  4J8D A;  3U4T A;  4BFR A;  3OXL A;  4XX5 A;  1HZ4 A;  4DLQ A;  1XNF A;  4I6E A;  2J09 A;  3FUH A;  3V30 A;  1DCE A;  2X38 A;  3CHQ A;  3SGH A;  3GZ2 A;  3QAQ A;  5ANR A;  2GRO B;  3JUE A;  3ZGQ A;  5ANL A;  3FEY A;  3RRN B;  4CRW A;  4KBQ A;  4GPM A;  5FQ6 A;  2BTD A;  3AS8 A;  1X5B A;  4LUN U;  4N5Q A;  4BY6 A;  4GB9 A;  1IYG A;  4AP2 A;  3NOC D;  2HO1 A;  4UQX A;  2VSO E;  1N11 A;  3DEO A;  2C0L A;  2LXM A;  2ZU6 B;  3B7B A;  2PQR A;  4AEZ C;  3UI2 A;  3APC A;  3LY9 A;  3HVE A;  3BEE A;  4Y6C A;  2H6G A;  3PE4 A;  4QQI A;  4TV3 A;  4TXR A;  1UN8 A;  5BT1 A;  1OCZ E;  2WM9 A;  3HRA A;  4HLE A;  1WDY A;  2X6H A;  5CRV A;  4XI0 A;  4G25 A;  4EZJ A;  3PRZ A;  3UM3 A;  5KJN A;  4JL0 A;  4FP7 A;  3PNT B;  2E0I A;  2AVP A;  3G2T A;  1TJC A;  3MA5 A;  4X8Q A;  2HM8 A;  2QYU A;  3Q78 A;  3TWQ A;  3UT4 A;  2VJ8 A;  4EBA G;  5BPP A;  3PRE A;  4ZHB A;  2KZT B;  1D9S A;  1TNB A;  3FP3 A;  4F7A A;  3Q73 A;  1JCQ A;  4DRX E;  3FFL A;  2UWJ G;  3CHM A;  2J07 A;  2EQX A;  3GYZ A;  5CCL A;  4OAU C;  3ZN3 A;  4B89 A;  3F6Q A;  1Z5S C;  3PZ3 A;  4WUY A;  5ARG A;  3ML8 A;  4PS7 A;  1E8W A;  1E7U A;  1OWO A;  3ZUV B;  2ZGG A;  3TL5 A;  4K5B A;  3LYA A;  3L6A A;  1YYH A;  4J0U A;  3PNL B;  3LY7 A;  4DUI A;  1DNP A;  3FY4 A;  3UT7 A;  3ZHE B;  3ULE G;  4AXH A;  3RKV A;  3VLD A;  5HRY A;  3UTM A;  2BF0 X;  3IV0 A;  3CEQ A;  2QFC A;  4GZ6 A;  3UIO C;  3CHS A;  5CEC B;  3AS5 A;  3SZ7 A;  3D3M A;  3CR3 A;  1NP7 A;  3O48 A;  2PL2 A;  3FUF A;  3ZFW A;  3CHP A;  5AN8 A;  4BWR A;  2BED A;  1LTX A;  3C72 A;  2ZXW E;  3IHV A;  4AVX A;  1OWL A;  2LO6 A;  1QZ2 A;  5BV0 A;  1QQE A;  3B7R L;  5FTP A;  4U95 D;  2WXM A;  3MV2 B;  3UMV A;  2WXN A;  4N3C A;  4LCT A;  1NL4 A;  3Q75 A;  3R9A B;  2AWI A;  3DSS A;  3VLF A;  2R5S A;  4JXT A;  2XRZ A;  1S63 A;  4D10 C;  3TWW A;  3X2Q E;  5AQ7 A;  5KBA A;  2HE0 A;  2ETA A;  4IUL A;  3DXM G;  3IEG A;  1BPO A;  3AS4 A;  1BD8 A;  4NIK A;  3FUD A;  3HDX A;  4WWP A;  2I9C A;  1LF8 A;  3NQP A;  2YIN A;  4U96 D;  1TYQ G;  3OXF A;  4JEH A;  1JWF A;  2WXO A;  2X6J A;  3WG7 E;  2MHK A;  2WMN A;  1UOH A;  4LNB A;  4O1P A;  3QNK A;  3TWS A;  4I9E A;  3CVW A;  3HHM A;  3Q4A B;  2X3M A;  3D9P A;  3FWV A;  3CKB A;  5EX0 A;  3UM0 A;  2NC9 A;  4WWO A;  1BLX B;  4OVV A;  4ATZ D;  3Q9N C;  2NXP A;  2KM4 A;  2P9P G;  5T3R A;  2I2O A;  4DLO A;  1ZU2 A;  2XEV A;  2BKK B;  5BNW A;  5CCM A;  2VSX E;  1H2V C;  4YVQ C;  4TUU A;  3CVX A;  1H2U A;  3TGO A;  3ESL A;  4GZ5 A;  2EIN E;  3APF A;  4Q96 A;  1IHB A;  4OVU A;  1E96 B;  1Z3X A;  2VGX A;  1MJ0 A;  5KNG A;  1YMP A;  2KCV A;  4EBA A;  2AW6 A;  5FQ8 A;  5HI7 A;  3EDT B;  4U7E B;  2RKK A;  3UUX A;  2P9L G;  3D9N A;  3WXX A;  5AYW D;  2JLB A;  2NYJ A;  3ZW3 A;  3TWV A;  4M7C A;  1SA5 A;  2CHZ A;  2C2L A;  2ZIS A;  1EF1 C;  4EZL A;  3MCX A;  1TN8 A;  3EIQ C;  4FJY A;  2GGF A;  3U66 A;  4Y6W A;  1H2T C;  3L54 A;  3V2O A;  3SHF A;  2FO7 A;  5DBK A;  3FHE A;  2QC9 A;  3B7T A;  4BX9 A;  1SZ9 A;  4APO A;  2MYO A;  2PQN A;  3JCK C;  3MV3 B;  4KYO B;  3ZKJ A;  2WXR A;  4EZK A;  2IO3 C;  4U63 A;  4B93 B;  2L6B A;  1NZN A;  4I1A A;  4GTR A;  2Q7F A;  2WXP A;  2UY1 A;  5G55 A;  3UM2 A;  3DSX A;  5AQ9 A;  1GW6 A;  4ME2 A;  4XEI G;  3PEU B;  1RZ4 A;  3MGB A;  4KVM A;  3IXE A;  2V5F A;  5EKQ D;  3HXB A;  4WNE A;  4XKC A;  2WXG A;  2FO1 E;  1OXJ A;  4O1O A;  2PNN A;  4MBG A;  3AG4 E;  3FUM A;  4Z68 A;  3FH5 A;  2CG3 A;  2F37 A;  3ZVV A;  3N71 A;  3E33 A;  3PS6 A;  2XGO A;  3FUI A;  2ION A;  4ANV A;  3FH7 A;  4HVB A;  2WQ6 A;  4URK A;  3MZL B;  4GML A;  4AM9 A;  1MQS A;  2DZN A;  2VYI A;  1XGW A;  4GZD A;  4U0S A;  3FUN A;  1IHG A;  1N4Q A;  3FTX A;  3Q79 A;  3APD A;  4IYP A;  4ACL A; 
#chains in the Genus database with same CATH homology
 4KVO A;  3PE4 A;  4CDN A;  3QKY A;  4TV3 A;  3S2A A;  4GMJ A;  1UN8 A;  4U0Z A;  4A55 A;  5BT1 A;  1ELW A;  3IHY A;  4N3B A;  1MHQ A;  5FWQ A;  2OVB A;  2WM9 A;  4H7X A;  3ASH A;  4L1B A;  3ZVV A;  4N3A A;  4HLE A;  1H19 A;  2AXZ A;  2X6H A;  2FEZ A;  3U3W A;  3CLJ A;  3OXG A;  4XI0 A;  4G25 A;  5D0O D;  5KCM A;  3PRZ A;  4EZJ A;  5KJN A;  2KZT A;  3FUE A;  4JL0 A;  2E2E A;  2CFU A;  2LAI A;  4FP7 A;  5BW8 C;  4DJA A;  3PNT B;  2E0I A;  2AVP A;  3G2T A;  4GA2 A;  1TJC A;  3MA5 A;  1WY6 A;  4BX8 A;  3VLE A;  2ILR A;  4JPS A;  2HM8 A;  4PS8 A;  3D9J A;  4WNF A;  1HU3 A;  4I43 A;  3FTV A;  3TAX A;  2J4D A;  3FTU A;  2J08 A;  3UT4 A;  5JJ6 A;  4U07 A;  2VJ8 A;  3KD7 A;  4EBA G;  5BPP A;  4WAF A;  4A3V A;  3PRE A;  3FU0 A;  3D9O A;  3UPV A;  3CVV A;  4FUL A;  3QWW A;  1JUQ A;  2BUG A;  2I1K A;  4XI9 A;  2KZT B;  4UWK A;  4L2Y A;  2JEK A;  3FP3 A;  4BTA A;  4F7A A;  3PVL A;  4WNG A;  3EJN A;  4LRZ A;  3FFL A;  5FQ7 A;  1KT0 A;  2UWJ G;  3CHM A;  1YA0 A;  3I5P A;  4UQZ A;  2J07 A;  5KJK A;  2EQX A;  3CIA A;  3DBS A;  2VQ2 A;  2MRI A;  5CHE E;  3GYZ A;  1A17 A;  3MKQ A;  2YQ8 A;  4ATG A;  3MYV A;  5AIJ A;  4GZC A;  5A6C A;  5CCL A;  4GA1 A;  4JZY A;  3VTY A;  3ZN3 A;  4HOQ A;  4B89 A;  4PUC A;  4CDM A;  3Q5M A;  3EHN A;  3PDN A;  4EQF A;  1SQM A;  2WVI A;  4WUY A;  4HFG A;  3RK6 A;  4ANW A;  3CVU A;  4MRU A;  3MKQ B;  5ARG A;  4AJW A;  3ML8 A;  4HOT A;  4PS7 A;  1E8W A;  3SF4 A;  5AJL A;  1E7U A;  1OWO A;  4XIF A;  4UI9 K;  3TL5 A;  3G2U A;  3LYA A;  2IJG X;  4C0M A;  4J8F A;  1HS6 A;  3L6A A;  1HO8 A;  4U04 A;  4J0U A;  3PNL B;  3LY7 A;  2AXV A;  1ZBP A;  1DNP A;  4MS6 A;  3ZRH A;  3FY4 A;  2X6F A;  3QWP A;  3UT7 A;  3B13 A;  3ZHE B;  2FF4 A;  3RRU A;  4KZ0 A;  4PS3 A;  5JJT A;  5JHB A;  1TJF A;  3ASD A;  5G2N A;  3RJV A;  2C0M A;  3HVE B;  3JQ0 A;  4AXH A;  3LXU X;  1IQU A;  3RKV A;  4B8A A;  3K9I A;  3I4G A;  5J90 A;  2V4L A;  3ENE A;  3P1U A;  3VLD A;  2RD0 A;  3CHO A;  5G05 J;  2BF0 X;  3IV0 A;  3Q15 A;  3CEQ A;  5J08 A;  3SI5 A;  3CVN A;  2QFC A;  2YHC A;  3IKO B;  3QJZ A;  2WXH A;  4GZ6 A;  1L5J A;  3QK0 A;  3CHS A;  4HOR A;  4GYY A;  2IQC A;  2Y3A A;  3O4Z A;  3G2V A;  4RG9 A;  5FZR A;  2WXF A;  1WM5 A;  3AS5 A;  4XZ4 A;  3RO3 A;  4CGW A;  4KMO A;  3MX3 A;  2MOW A;  3SZ7 A;  3D3M A;  4BTB A;  3CR3 A;  3PUK A;  4Q69 A;  3Q47 B;  5FZQ A;  5D0Q D;  1NP7 A;  3O48 A;  2DIW A;  1E8Z A;  2PL2 A;  3FUF A;  2XGM A;  3FTY A;  3ZFW A;  2WQ7 A;  3CHP A;  5DIZ A;  4BWR A;  5G05 C;  2WXI A;  3ASG A;  1U3C A;  1H0A A;  4K03 A;  4PH4 B;  5C1D A;  1INZ A;  3CK8 A;  3NF1 A;  4DPR A;  4N5C A;  5JHA A;  2XCC A;  3IHV A;  4GCO A;  4NRH B;  1EDU A;  4RG6 A;  4AVX A;  1HG5 A;  2WXL A;  5LCW C;  1OWL A;  2LO6 A;  1HX8 A;  3HYM B;  3UX4 A;  3CVQ A;  3R7R A;  1QZ2 A;  1Z6T A;  3LVQ E;  2PZI A;  5BV0 A;  4NQ0 A;  1QQE A;  3ZYK A;  3CGH A;  2KC7 A;  3FDH A;  4C9B B;  1E8Y A;  4A3T A;  3E4B A;  3T5V A;  3TG5 A;  3B7R L;  4V3I A;  5FTP A;  1W3B A;  3EIJ A;  2WXM A;  4A1G A;  2WPV A;  2XGS A;  3LPZ A;  3MV2 B;  1HF8 A;  3FUK A;  3QB2 A;  4K0R A;  3UMV A;  4B8C B;  3U64 A;  3NZS A;  5KJM A;  3FUJ A;  4EEC A;  2WXN A;  5C2Y A;  2IOS A;  4N3C A;  3TXM A;  4YVO A;  3LS8 A;  4LCT A;  3AU5 A;  5G04 J;  2A5U A;  2YNQ A;  5T4Y A;  3R9A B;  3T8M A;  5LX8 A;  5EDS A;  1OUV A;  3OTN A;  2AWI A;  1DVP A;  1Y6I A;  3FUL A;  4U8H A;  2LAH A;  3VLF A;  2R5S A;  2OOE A;  4CT0 A;  4A1S A;  4JXT A;  2RG8 A;  2XRZ A;  5LCW J;  3D9I A;  1HG2 A;  1OWN A;  4D10 C;  3KS2 A;  4BT9 A;  4DI4 A;  3B7U X;  3LY8 A;  4LEU A;  4ACK A;  2WXQ A;  4IUL A;  2YHE A;  4CDR A;  2XPZ A;  3IEG A;  4W9R A;  1BPO A;  3FEX A;  3AS4 A;  4WND A;  1OWP A;  4GYO A;  2J9Q A;  2GW1 A;  3BG1 B;  2X6I A;  4IN3 B;  2WQH A;  4CEM A;  2XRY A;  3FUD A;  3HDX A;  4R7L A;  3FTS A;  4WWP A;  2I9C A;  1LF8 A;  3NQP A;  4JC8 A;  3JUI A;  4UI9 J;  2YIN A;  4DI3 A;  3ZYL A;  2WB2 A;  3OXF A;  2QY7 A;  4G23 A;  4FC8 A;  1JWF A;  4GAA A;  3PEV B;  2OVF A;  4JEH A;  2R17 C;  3KAE A;  3MJW A;  5JJ7 A;  1EYH A;  2WXO A;  4I6J A;  4JA7 A;  2UY1 B;  4XE0 A;  3S7B A;  2R59 A;  4ANX A;  2X6J A;  3CK9 A;  3RRM B;  5EX3 A;  4I2Z A;  2MHK A;  2WMN A;  1FCH A;  3L16 A;  4HOU A;  4I1O B;  4P29 A;  3Q49 B;  3QNK A;  4GPK A;  3AU4 A;  4UI9 C;  2OND A;  3CHR A;  1H6K A;  3GW4 A;  4N39 A;  2I1J A;  4MKT A;  4ABN A;  2V8S E;  5BV1 A;  3SNX A;  4I9E A;  3CVW A;  2L6J A;  2HYZ A;  1PC2 A;  5FJY A;  4MLP A;  3HHM A;  3Q4A B;  2X3M A;  5G04 C;  3CQG B;  3D9L A;  4UWL A;  3VTX A;  3D9P A;  3FWV A;  2KCK A;  3CKB A;  3GZS A;  5EX0 A;  2NC9 A;  4WWO A;  1P5Q A;  4OVV A;  2CHX A;  1FVH A;  2IOL A;  2V0P A;  2L0I A;  3L13 A;  3PE3 A;  2LNI A;  1B89 A;  2NXP A;  4KXK B;  2KM4 A;  5T3R A;  2I2O A;  4JA9 A;  4CGV A;  4HXI A;  4DLO A;  1ZU2 A;  2XEV A;  2HR2 A;  4JVS A;  4WWN A;  4CT4 A;  3D9K A;  4FAD A;  5BNW A;  5A7D B;  5CCM A;  2VGY A;  2VSX E;  1H2V C;  3TXN A;  3GZ1 A;  4FU3 A;  4YVQ C;  2P58 C;  3ZXS A;  5A23 A;  2LSU A;  4ILI A;  2NSZ A;  4G1T A;  3LJ3 A;  5LOZ A;  3ZPJ A;  4TUU A;  1ELR A;  3CVX A;  1H2U A;  2Y4T A;  5ARF A;  3TGO A;  3CVY A;  2OV8 A;  4L7T A;  3C98 A;  3G2S A;  3ESL A;  4E6H A;  4GZ5 A;  3APF A;  2J4B A;  3FTW A;  4ILH B;  3QAR A;  1KT1 A;  4Q96 A;  3SBS A;  4OVU A;  1E96 B;  1UJK A;  1Z3X A;  2PM6 A;  2VGX A;  2WMO A;  1UJJ A;  1PAQ A;  2WXK A;  3LCA A;  1E8X A;  2M63 A;  2I6H A;  3B7S A;  3RU0 A;  3SD5 A;  1ELK A;  5KJL A;  4M3O A;  2KCV A;  3G2W A;  1UN9 A;  5CMY A;  5AJD A;  4EBA A;  3BG0 B;  1HE8 A;  2L0T B;  2AW6 A;  5FQ8 A;  3LKU A;  5HI7 A;  3EDT B;  3UUX A;  2J49 A;  3D9N A;  4I9C A;  3WXX A;  2DCP A;  2CFZ A;  5AYW D;  4JHJ A;  2AXU A;  2JLB A;  1NA0 A;  5LP0 A;  4N2S A;  3SBT B;  3I4R B;  2CG2 A;  3ULQ A;  3UT8 A;  3ZEF A;  3ZW3 A;  3FU5 A;  4AY5 A;  3QWV A;  4O6F A;  4GCN A;  3SFZ A;  1Z3Y A;  2VTB B;  4NAC A;  4JEU A;  2CHZ A;  3CST A;  2C2L A;  3LDZ A;  1EF1 C;  3JQ1 A;  4EZL A;  3MCX A;  2IU1 A;  2A4Z A;  3ZYM A;  4FLB A;  4FLH A;  1FVF A;  3ML9 A;  2Y4U A;  1HH8 A;  4KT6 B;  3R7Q A;  3IBE A;  4AV7 A;  3EIQ C;  4FJY A;  2GGF A;  3FU3 A;  3U66 A;  2L9B A;  4GA0 A;  2XCB A;  4Y6W A;  1H2T C;  3QOU A;  4G11 A;  5BUZ A;  3PZD A;  1WAO 1;  4Q94 A;  2XPY A;  5FZS A;  3L54 A;  2DBA A;  3ASF A;  4DK5 A;  3FTZ A;  3LVR E;  3SHF A;  3S7J A;  2FO7 A;  3QC1 A;  4HS2 A;  4AOF A;  4C0E A;  4AY6 A;  5DBK A;  3ESK A;  1SZA A;  3FHE A;  4G24 A;  3CVP A;  3FU6 A;  4UWG A;  5ENN A;  3B7T A;  4BX9 A;  4L2L A;  4GZ3 A;  2FBN A;  4UWF A;  4UQY A;  2VSY A;  1SZ9 A;  4APO A;  3L22 A;  2PQN A;  4G26 A;  1TEZ A;  5HQ8 A;  4TRQ A;  3CKC A;  3L17 A;  4F3V A;  4FHK A;  3FH8 A;  1NA3 A;  3T5X A;  3JCK C;  3MV3 B;  4KYO B;  4FHJ A;  3P2B A;  2WXR A;  2XPI A;  4EZK A;  1EPU A;  1N52 A;  4I6G A;  3OAW A;  5M72 A;  1QNF A;  1E90 A;  2X6K A;  4GYW A;  4U63 A;  4JHK A;  4RVB A;  2KAT A;  4BT8 A;  4BSX A;  4F53 A;  4FA6 A;  3ZIM A;  1N54 A;  2CHW A;  4B0Z A;  5FQ4 A;  1U3D A;  1NZN A;  5CMW A;  3CSF A;  4I1A A;  4U0U A;  2Q7F A;  4J8S A;  2WXP A;  2UY1 A;  2VSN A;  1PY1 A;  1JWG A;  3NZU A;  4G2V A;  3KEZ A;  4J8D A;  1JPL A;  5G55 A;  3U4T A;  4APF A;  4BFR A;  3ONK A;  4KZC A;  3OXL A;  4LER A;  4XX5 A;  4L23 A;  4HOS A;  4F1S A;  1HZ4 A;  1GW6 A;  1HXI A;  4ME2 A;  3L08 A;  4DLQ A;  1XNF A;  4E85 A;  3PEU B;  1Y8M A;  2IF4 A;  3I3N A;  1IQR A;  4JHR A;  4I6E A;  2J09 A;  3FUH A;  2FUL A;  3MGB A;  4I2W A;  3ZHE A;  4KVM A;  1KLX A;  2X38 A;  2V5F A;  3TJP A;  3CHQ A;  5EKQ D;  2XQ0 A;  3S7D A;  4WNE A;  4YND A;  3SGH A;  4J6I A;  1VDY A;  2LSV A;  2WXG A;  3GZ2 A;  4XKC A;  3URZ A;  5LFA A;  3QAQ A;  5ANR A;  4QFV A;  3UQ3 A;  3ZGQ A;  2GRM A;  5ANL A;  2VGX B;  3FEY A;  1HFA A;  2FI7 A;  4GU5 A;  3RRN B;  4CRW A;  3FUM A;  4H7Y A;  4ANU A;  3PH0 C;  4EPZ A;  4KBQ A;  4PDX A;  5FQ6 A;  3FH5 A;  3LEW A;  2CG3 A;  2PM7 A;  3N71 A;  3QDN A;  2BTD A;  3EHM A;  1S0P A;  2GRL A;  3PUJ A;  2IFU A;  2WXJ A;  3AS8 A;  3PS6 A;  4JW1 A;  5E75 A;  1E7V A;  3S7F A;  4OYS A;  2XGO A;  4NUR A;  1X5B A;  3CV0 A;  4LUN U;  3RIB A;  3CVL A;  1OWM A;  3MEK A;  1UW4 B;  3RO2 A;  3FUI A;  4BY6 A;  3DPD A;  4GB9 A;  4RSY A;  4B94 A;  4AP2 A;  2ION A;  4AIF A;  1IYG A;  1UG3 A;  2HO1 A;  4ANV A;  3FH7 A;  4HVB A;  2WQ6 A;  4UQX A;  4UWH A;  5AEN A;  2VSO E;  4URK A;  4I17 A;  4XKB A;  3ONL A;  5T8I A;  4N2Q A;  3MZL B;  4GML A;  4I1M A;  2KCL A;  4IRU A;  1MQS A;  3MKR A;  4AM9 A;  2C0L A;  2XHE A;  2ZU6 B;  3TG4 A;  2PQR A;  2VYI A;  1XGW A;  4ILG A;  4GZD A;  4U0S A;  4FJZ A;  4AEZ C;  3FUN A;  1IHG A;  3U9W A;  3CK7 A;  3APC A;  3CQC B;  3FTX A;  3LY9 A;  4J8E A;  3JYS A;  5E76 A;  3APD A;  5FT9 A;  4IYP A;  3HIZ A;  2VTB A;  3ZYQ A;  3HVE A;  3BEE A;  4Y6C A;  4ACL A;  4CCA A;  3D9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...