1PC2A

Solution structure of human mitochondria fission protein fis1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords mitochondria fission protein
publication title The Solution Structure of Human Mitochondria Fission Protein Fis1 Reveals a Novel TPR-like Helix Bundle
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1pc2A00
4BT8A 5AYWD 5KJKA 2R5SA 3ZGQA 2C0LA 2VGXB 5CCMA 3RO3A 3ASDA 3GZ2A 4N2QA 3ZHEA 5DBKA 1IYGA 3ZPJA 4GYOA 1KT0A 3GZ1A 4WUYA 5FZQA 5M72A 2KCKA 1Y8MA 3ASGA 5HI7A 5KJNA 4U0ZA 5JJ6A 2HO1A 4GYYA 4I2WA 3MV3B 2BUGA 4KXKB 5EX0A 5KJLA 4UI9J 5ARFA 4UQZA 2YQ8A 3Q49B 1PC2A 3ZN3A 5G04C 3VTXA 1ZBPA 3SF4A 1HXIA 1QQEA 5EKQD 2YHCA 3PE4A 2Y4UA 2PQRA 3Q47B 4RG6A 2KATA 4H7XA 3RKVA 4AM9A 3CK7A 2FEZA 3MV2B 4EQFA 3ESKA 4N2SA 4UQYA 2KC7A 2Q7FA 5FT9A 3CVLA 4GZ3A 4J8DA 4HOQA 2Y4TA 3CVPA 5JJTA 5FZRA 4JHRA 3R9AB 3S7JA 3GYZA 3ASHA 3QWPA 3CK8A 2XCCA 4ABNA 4I2ZA 4KBQA 5A7DB 2PQNA 3CV0A 3MA5A 3QWWA 4BTAA 5CCLA 3KS2A 3PE3A 4HORA 2PL2A 4G1TA 4B94A 3S7BA 2VGYA 2E2EA 4GZ5A 4J8EA 2ONDA 4GYWA 2XEVA 4I9EA 2FF4A 4BTBA 5CHEE 4Y6CA 2HR2A 2VSYA 1OUVA 5BT1A 2UWJG 2XGOA 2LSVA 4NRHB 3UPVA 3LKUA 3N71A 4AIFA 4BT9A 3IEGA 4GCOA 4A1SA 2FI7A 3U3WA 5G04J 2C0MA 3QOUA 3URZA 2WQHA 2VYIA 4G2VA 3AS5A 2NC9A 2PZIA 4GA2A 3S7FA 2L6JA 4J0UA 4APOA 4GA1A 4U0UA 2KCVA 4JA7A 2C2LA 3QDNA 3ZHEB 3HYMB 1NZNA 2XCBA 4N5CA 3TGOA 3RU0A 1W3BA 3QWVA 2DBAA 4KYOB 2AVPA 4GPKA 4N3BA 4HOUA 4XIFA 3KD7A 4I17A 4U07A 2LNIA 2IFUA 1HZ4A 2GW1A 2XPIA 3OXGA 4I1AA 1ELWA 3UQ3A 3CKCA 3OXLA 3FFLA 4UQXA 3QKYA 3OXFA 5FJYA 4G24A 1ZU2A 3AS8A 5FTPA 3JYSA 1ELRA 2UY1A 2XGMA 4YVQC 2WPVA 1YA0A 1E96B 3RO2A 4N39A 5DIZA 2VGXA 2FBNA 1P5QA 2VSNA 3LY9A 3LYAA 2OOEA 3Q4AB 5D0OD 4U04A 4F3VA 4I9CA 3O48A 2VQ2A 3TG5A 3GW4A 2IF4A 2HYZA 5BW8C 4NQ0A 3ULQA 4CGVA 4GZ6A 1QZ2A 5KJMA 1NA3A 4W9RA 4HOTA 3VTYA 3TG4A 4XI0A 5D0QD 4HOSA 1FCHA 3E4BA 5FZSA 4LEUA 2QFCA 4GA0A 3CKBA 4YNDA 3NF1A 3RIBA 5LCWC 4N3AA 1B89A 4IN3B 5JJ7A 3CK9A 3CVQA 4J8FA 1KLXA 1TJCA 5BNWA 4JL0A 4G26A 4GCNA 3RJVA 1WM5A 4AY5A 1NA0A 4JA9A 3TAXA 3K9IA 4BWRA 4WNFA 1IHGA 2P58C 4WNGA 3LCAA 5C1DA 3S7DA 4WNDA 3UUXA 2FO7A 3LY7A 2KCLA 2I6HA 3ASFA 3LY8A 2XGSA 4O6FA 4CGWA 4AY6A 5A6CA 1XNFA 5HQ8A 3MEKA 4U0SA 3CEQA 3Q15A 3BEEA 3MKRA 4UI9C 4H7YA 5ARGA 4XI9A 4Y6WA 4CDRA 2JLBA 2LSUA 4G23A 4YVOA 3SZ7A 3FP3A 1WAO1 2V5FA 5G05J 3KAEA 3ZFWA 1KT1A 4G25A 2J9QA 1A17A 5EX3A 4UI9K 4ME2A 4WNEA 3CVNA 3U4TA 4RG9A 3WXXA 3EDTB 1HH8A 3AS4A 5G05C 2MHKA 3Q5MA 4N3CA 5LCWJ 3PDNA 3FWVA 2UY1B 3LPZA
chains in the Genus database with same CATH superfamily
4BT8A 1D8EA 3CR3A 1YCSB 3L22A 2ZIRA 2VGXB 1LD7A 4GZCA 2VTBA 1QBQA 4TXPA 4LNGA 5EYLA 3GZ1A 1UG3A 3MX3A 1Y8MA 5KCMA 2OVFA 4JD2G 5CMYA 5JJ6A 4HS2A 1H6KA 4Z68A 4R7LA 1WY6A 2P9PG 4TXRA 4F1PA 1AP7A 2R05A 3SFYA 1X81A 3TXNA 3HXBA 4XKCA 4HRLA 1ZBPA 2L6BA 3SF4A 3UKUG 1QQEA 1IXVA 5CBNA 5JMND 2YHCA 2X6IA 1RW2A 2HM8A 1S64A 4LSZE 4RG6A 1MQSA 4H7XA 4CT4A 4E6HA 4AM9A 2FEZA 3DPYA 2VGEA 2JEKA 5FWQA 3ZXSA 2J4DA 3CVLA 3TWSA 3FTSA 4J8DA 4HOQA 3UINC 2DWZA 3L54A 1AWCB 3DWLG 2XENA 5FZRA 1OWNA 1N4RA 2DVWA 3AG1E 2OV8A 4MRUA 4E85A 2Y1LE 4I6JA 2ETCA 2XCCA 4ABNA 4G11A 4KBQA 3DSWA 2EIME 3SD5A 1V55E 3DSUA 5CCLA 5JHAA 5EILA 3D3MA 5CEAA 4CCAA 2LXMA 3UIPC 3AG3E 3QNKA 1DVPA 2XEVA 1L5JA 3D9OA 4BTBA 2B6CA 4LG6A 5CRUA 5ANRA 1E7UA 4CDNA 3L17A 3SFXA 4DK5A 1O5MA 4HXIA 3IHYA 2XGOA 1FVHA 3IBEA 4M7CA 3FUKA 3PUJA 3D9IA 3CHMA 3I5PA 1JWFA 3EHRA 3JQ0A 2EILE 4AIFA 4JW1A 5AARA 4L23A 3ZYQA 5G04J 3URZA 4UWHA 3L08A 3CVXA 3UMVA 3E32A 3ZEFA 1U2VG 3W9GA 4J0UA 1HE8A 2KCVA 2C2LA 2H6GA 2FULA 4WAFA 3FTXA 3QDNA 4V3IA 2XEEA 3L6AA 1UN8A 4K0RA 5EYPF 3UM2A 3DSVA 4JVSA 4KYOB 1KZPA 4B93B 1SZ9A 3L82A 2AVPA 4GTOA 4J7WA 4GPKA 4FLHA 4N3BA 4IRUA 5FQ6A 4AOFA 4EZKA 2F0YA 3LJNA 3OTNA 4QQIA 4EPZA 3G2WA 2DIWA 2X3MA 5FQ4A 5CRVA 4ANWA 2KM4A 1YYHA 4UQXA 3DSTA 4Q96A 4FP7A 5FTPA 1ELRA 5ITZF 4YVQC 1NI1A 1YA0A 3V31A 3ASOE 4U63A 4DX6D 5DIZA 1MZCA 4A63B 2FBNA 3EUVA 3SQVA 3L9TA 2OOEA 3Q4AB 2VJ8A 4F3VA 1X5BA 3O48A 2QC9A 4HQDA 1UN9A 2IF4A 5BW8C 4NQ0A 4ATZD 3KEAA 3W9FA 1ELKA 1QZ2A 5CMWA 3VTYA 4TV3A 4HFGA 2ZISA 3TG4A 3R7QA 5D0QD 4M3OA 2VSXE 1IQRA 3D9JA 3UXGA 3ESLA 3RIBA 4CZ2D 2MOWA 1B89A 3TJPA 3R7RA 5JJ7A 5AJDA 2XS1A 5FIOA 4JL0A 2WMOA 3DPDA 2MRIA 3SGHA 1N54A 3TXMA 5KNGA 4ILHB 3MJWA 4UWFA 5T4YA 4C0MA 4JA9A 3K9IA 4L9PA 4LNBA 4C9BB 4JHJA 3LCAA 3ZW3A 4WNDA 3UUXA 3E37A 3EU5A 2XGSA 1TJFA 2QY7A 4RVBA 3PS6A 4CGWA 3APDA 5AQBA 1XNFA 4PS8A 3MEKA 4U0SA 1FT1A 1N4QA 3MKRA 4G8LA 3RK6A 2BKGA 4XI9A 4CDRA 2JLBA 3PZ3A 2J07A 2R02A 2LSUA 1TNYA 3DSSA 2MYOA 3SI5A 2RKKA 2WXFA 1H2VC 5G05J 4FJYA 3ZFWA 3NZSA 5IY5E 2J9QA 3LEWA 2VSOE 1S70B 5EX3A 2I1KA 4UI9K 2EIJE 2F8XK 5BV0A 4L7TA 2WM9A 3QAQA 4U7EB 3JUIA 1NP7A 3ZYKA 4GPMA 4DLOA 1FVFA 3FTZA 2YNQA 3CSFA 4GMLA 5BXOA 3Q9UC 1TN6A 2XZDG 4HRNA 5CERB 5B1AE 3JCKC 4JEUA 3DXMG 1FT2A 2R5SA 5KJKA 2WXJA 4HBDA 3ZIMA 2WB2A 2C0LA 4GTPA 4U8YD 3TWXA 1MX6A 5CCMA 2YHEA 4WWPA 3JXJA 3RAUA 2DYRE 4BEPA 3D9MA 4FULA 4GYOA 1KT0A 1O1RA 1OCCE 3Q7FA 1N52A 3ZKJA 5EIBE 3P1UA 5FZQA 1N95A 4B8CB 2P9NG 3CVUA 3SBSA 1K8KG 3FUIA 5LP0A 4DPRA 1NFIE 2KBXA 4GYYA 1Z6TA 2BUGA 4UUCA 2WXNA 3T5VA 2WQ7A 1DNPA 3EIQC 4PS3A 3ZN3A 3DXKG 5LX8A 5G04C 1HX8A 4UWLA 3U64A 5EKQD 3CHQA 1JUQA 2P9KG 3PE4A 2Y4UA 2KATA 3LS8A 5EDSA 4JPSA 1JWGA 3RKVA 3CK7A 4N2SA 2KC7A 1E8ZA 3QB2A 2IOLA 2CG3A 3FUMA 4O1PA 2WXQA 2PM6A 4LERA 1HU3A 4HRMB 4JHRA 5ENSD 2J4BA 1D9SA 1O1SA 3FUNA 5EN5D 3ASHA 2M63A 3CK8A 1TNZA 4DX7D 4FC8A 5AQ7A 4I2ZA 3BG0B 1A5EA 3QWWA 3ZYLA 4UWGA 2RG8A 4IYPA 3PE3A 3CHRA 4HORA 2BEDA 2PL2A 4G1TA 4B94A 3UIOC 4J8EA 1N4PA 1D8DA 4GYWA 3Q9NC 4I9EA 2FF4A 4GTSA 4BX9A 1N94A 2ZU6B 1N9AA 5D2MC 5HS0A 3TL5A 4JB8P 2DZOA 2XPYA 2WXHA 2KXPC 2WXKA 3DEOA 3LDZA 3LKUA 2IU1A 3IEGA 2Y3AA 4MKTA 1DCEA 3U3WA 1SA5A 5ENRD 1S0PA 2WQHA 3F6QA 1TYQG 2VYIA 3V30A 4L2LA 4G2VA 3AS5A 3VLDA 4URKA 2KZTA 4GMJA 4JA7A 3DEPA 3NQPA 3KEZA 3ZHEB 1NZNA 4MBGA 2XCBA 3RU0A 1DCQA 4GB9A 3QWVA 1BU9A 2L0IA 3C3RA 1OT8A 4BFRA 2DCPA 3HVEB 2CFUA 4GTMA 3MKQA 3V2OA 4I17A 2IFUA 5AQ9A 3B7RL 4AV7A 1IQUA 2XPIA 3QK0A 1MYOA 3AAAC 4I1AA 3UQ3A 3OXLA 2IQCA 3UI2A 4I6GA 4I43A 1EF1C 1UW4B 1OCRE 3AS8A 1OCOE 4I1MA 3EHMA 2UY1A 3RRNB 3J5PA 1JCRA 3LJ3A 2A5UA 3ZVVA 3ABKE 4N39A 3FTVA 2VGXA 1QNFA 1P5QA 2XQ0A 2QYUA 2VSNA 4GZDA 5D0OD 1Z5SC 2VQ2A 4A1GA 1E8WA 1SZAA 2HYZA 1FPPA 3DSXA 5BUZA 1V54E 3IKOB 4J8YA 4GZ6A 3FHEA 1PAQA 4HI9A 1MJ0A 3VLFA 4KZCA 1UJKA 5ENTD 2V5QC 1FCHA 1LTXA 3QC1A 3NF1A 4IN3B 1E8XA 3CK9A 2AW6A 3CVQA 4J8FA 3T9KA 5BNWA 3V79K 4U96D 3OAWA 3PNLB 2X6JA 1OWLA 3C98A 1WM5A 5E76A 3ML8A 1DC2A 2X6KA 3NOCD 4TXQA 4Q94A 3ULEG 2EINE 2ZGDA 3B7BA 3C5RA 1IHGA 4WNGA 3CVYA 3UM0A 3FUJA 2J49A 4RLYA 4CEMA 4BSXA 2FO7A 2R59A 1U3DA 1H6PA 2X6HA 5AIJA 2CHWA 4DX2A 4PUCA 1K3ZD 1ZB1A 3ULYA 3CEQA 2XZTG 3CVWA 3Q78A 1BLXB 3IV0A 5ANLA 4G23A 3FDHA 3FUFA 1WAO1 2V5FA 3FTWA 2I1JA 5A23A 1A17A 3L16A 4FJZA 4I6EA 3TWRA 4YDEA 5AN8A 2PM7A 4WNEA 2XS8A 3CVNA 3U4TA 4RG9A 3CLJA 3QARA 3WXXA 3PNTB 2ILRA 3AS4A 5E75A 1OWMA 3JXIA 3Q5MA 3KSQA 4N3CA 3O4ZA 4TRQA 2H6HA 3MYVA 3UM3A 5AYWD 4XX5A 3ZXPA 1K1BA 3ZGQA 4CYMD 3RO3A 4K03A 3ASNE 1IYGA 1TR4A 3C3QA 3ZPJA 1HFAA 3I3NA 4WUYA 1UJJA 3D9HA 1XGWA 1OWOA 2KCKA 3B7TA 5KNHD 1U3CA 2EQXA 4ANVA 1EYHA 4BX8A 4FU3A 5HI7A 5KJNA 4U0ZA 3UT7A 2HO1A 4ILIA 1YMPA 5H7PA 4UQZA 1PC2A 3P2BA 3VLEA 2ETBA 2X38A 3PUKA 3D9LA 2IO3C 2GGFA 1TEZA 1EPUA 3UT8A 1JCQA 3WG7E 3GZSA 3I4GA 1E90A 1TNOA 2V8SE 3SNXA 1E7VA 2LXLA 2RD0A 3MV2B 4JEHA 4EQFA 4AVXA 4NACA 2Q7FA 2DYSE 3L13A 4GZ3A 3AU5A 4XEIG 2P9IG 2LO6A 3CVPA 3FUEA 4OVUA 3AU4A 2LUHA 4ACLA 1TN7A 3B95A 3GYZA 3QWPA 2J08A 5A7DB 2L9BA 4KT6B 3MA5A 1MX4A 1MX2A 3KS2A 2P2CP 3CGHA 3S7BA 2VGYA 4GTVA 2QZAA 3ENEA 4PDXA 3E34A 3JUEA 5T8IA 3PZ2A 5CHEE 3ISMC 3FUDA 2WMNA 4XZ4A 4Y6CA 2HR2A 3SY2A 2VSYA 3FH8A 1BPOA 1OUVA 3FEYA 3UX4A 2GRMA 5CECB 2LSVA 2V4HC 2RFMA 3N71A 4FHKA 4BT9A 3I4RB 4GCOA 2H6IA 4LRZA 2FI7A 1BD8A 2C0MA 3TWWA 3HXEA 5CBOA 3HXCA 4X8QA 1S63A 4GA2A 5KWDA 3S7FA 1INZA 3IXEA 4L2YA 5BV1A 2VTBB 3RSEG 3HYMB 4APFA 3G2VA 2WQ6A 3D9NA 4K5AB 4O60A 4N5CA 2XPZA 3ZYMA 1W3BA 1Q2ZA 2H6FA 2AXZA 2DBAA 2OEWA 3SFZA 3HHMA 5ENPD 4TUMA 4EECA 3NB2A 4YDOA 2WXGA 3PRZA 3AG2E 4DLQA 1BI7B 4D10C 2AWIA 3ONLA 3X2QE 4U07A 3J5QB 4J8SA 4HB5A 1HZ4A 5BPPA 3TWVA 1ELWA 1H2TC 4O1OA 3FFLA 2P9LG 3QKYA 3OXFA 2YINA 2P9UG 1NL4A 3CVVA 4KVMA 4G24A 1ZU2A 3FU6A 3JYSA 2V0PA 2XGMA 3FTYA 1E96B 5EIDA 2WXPA 1SW6A 3U66A 5JHBA 3EJNA 3LY9A 3ABLE 4U04A 1H6OA 3FULA 3TG5A 4L1BA 2WXRA 2WXLA 4GU5A 5AAOA 5KJMA 3BG1B 1NA3A 4W9RA 4HOTA 3T8KA 3TWQA 4FLBA 5J90A 4XI0A 2E0IA 3FU5A 3FH7A 3PZ4A 1E8YA 4BY6A 4WWOA 4HOSA 4F53A 5FZSA 2QFCA 4DJAA 5BXUA 3NZUA 4UWKA 4YNDA 2CHZA 4GMRA 1KLXA 3SHFA 1HF8A 4K5CA 4G26A 3QJZA 1VDYA 3RJVA 4AY5A 3CQCB 2CG2A 1NA0A 4F6RD 3TAXA 4KMOA 1HG5A 2P58C 3CHOA 3JQ1A 3HXDA 2PNNA 3ZUVB 1TNBA 4B0ZA 2KCLA 2ETAA 3LVRE 5KBAA 4BERA 2IEJA 4YDYA 1H2UA 4F1SA 3FU3A 4AY6A 2GRPB 3CHPA 4ILGA 4OAVB 3FU0A 3Q15A 4CT0A 4GTRA 5D66A 4AEZC 4CRWA 1BI8B 5ARGA 3B7UX 3AJIA 3BQOA 1N11A 2WXIA 4OAUC 4YVOA 3E33A 4A3TA 4ZFHA 4B89A 3V2XA 1H0AA 1KT1A 4LCTA 4G25A 2B0OE 5AQAA 2Y69E 1TNUA 4AXHA 2IY0C 4GTTA 2GROB 4GAAA 4A3VA 4DI3A 5G2NA 2R03A 5ENQD 2L0TB 5G05C 3U9WA 4PS7A 1KZOA 2MHKA 3EU9A 3SO8A 3FUHA 5LCWJ 3TWUA 4J6IA 3FH5A 3PEVB 1OXJA 3UM1A 5CEDB 4HLEA 2XEHA 4FHJA 1HG2A 1KPSB 3ASDA 3GZ2A 1TN8A 4N2QA 3ZHEA 5DBKA 3NBNB 1JPLA 5HRYA 3Q79A 3HRAA 5M72A 3CHSA 2R17C 4RSYA 3CSTA 1PY1A 1WG0A 3DRAA 3APCA 2I2OA 3ASGA 2P9SG 3BUAA 3HVEA 3IHVA 5JA4D 4NIKA 1OY3D 4I2WA 3MV3B 4KXKB 5EX0A 4LUNU 4BSZB 5KJLA 4UI9J 5ARFA 2YQ8A 2HE0A 2DZNA 3Q49B 4QFVA 3RRUA 2BKKB 1O1TA 3UKRG 2CFZA 3VTXA 2OEVA 4KVOA 3UTMA 1HXIA 1K1AA 4C48B 1LD8A 2PQRA 3Q47B 5FQ7A 3LVQE 3ZRHA 4WWNA 3ESKA 1LF8A 4UQYA 5FT9A 4LNUD 3HXFA 3CQGB 4C0EA 1Y6IA 2Y4TA 3APFA 2I9CA 3Q75A 3D9PA 5JJTA 2IOSA 3FY4A 3R9AB 3S7JA 2BTDA 4ZHBA 3G2SA 2IO2C 2PQNA 3CV0A 1N4SA 3B7SA 4NURA 3SBTB 4BTAA 2IJGX 3ONKA 2E2EA 4GZ5A 3MGBA 2WXMA 2ONDA 2X6FA 1N0QA 4U95D 2OVBA 2LAIA 3R9MA 4EZJA 4ACKA 5BT1A 2UWJG 3S2AA 4AP2A 4HNAD 4NRHB 2V4LA 3UPVA 3T5XA 3PVLA 4I1OB 2CHXA 4A1SA 2JABA 3QOUA 5B3SE 2ZXWE 4HI8A 2OCCE 4G8KA 2GRLA 1OWPA 3PH0C 4JXTA 2NC9A 2PZIA 2QYJA 3PREA 4EHMA 4DI4A 1UOHA 2L6JA 4APOA 3HG0D 5LFAA 4GA1A 4U0UA 4U8HA 1JCSA 1Z3YA 4F7AA 4FADA 3ABME 3EHQA 3EHNA 4DX1A 3C72A 3T8MA 2GRQB 4JC8A 3TGOA 3MCXA 2XHEA 4FA6A 2IONA 1SVXA 3HIZA 4HOUA 4GTQA 1HO8A 3G2TA 2ZGGA 4XIFA 1N0RA 3EIJA 3KD7A 5B1BE 2LNIA 1SQMA 4XE0A 2XRZA 2GW1A 5T3RA 3FTUA 3OXGA 4A55A 3HDXA 3CKCA 3BU8A 5FJYA 3TWTA 3PEUB 5G55A 4DX5D 1Z3XA 1QYMA 2WPVA 5AJLA 5ENOD 1IKND 4N5QA 3KSLA 3RO2A 2AXVA 2WXOA 3PZDA 5HKPA 3LYAA 2NXPA 3DBSA 4OVVA 4OYSA 4I9CA 5ENNA 1OCZE 4EZLA 3GW4A 1GW6A 2A5EA 2A4ZA 3ULQA 4CGVA 3UT4A 4EBAA 5FQ8A 4YDWA 3C3OA 5FINA 2AXUA 3PZ1A 3E4BA 3LXUX 4LEUA 4GA0A 3CKBA 3FEXA 5J08A 4HLLA 5LCWC 4N3AA 2FO1E 2WVIA 1RZ4A 1TJCA 2RFAA 4EBAG 1EDUA 4GCNA 3ML9A 4P29A 4PH4B 4MLPA 4BESA 4RQIA 2LAHA 1H19A 1HS6A 3AG4E 4BWRA 4WNFA 4IULA 4K5BA 5C2YA 3Q7AA 5C1DA 2GRNB 3ZU7B 2F37A 3S7DA 4AJWA 5AENA 1WDYA 3LY7A 2I6HA 4BETA 3ASFA 3LY8A 4O6FA 2KZTB 5A6CA 5HQ8A 3BEEA 3E30A 4UI9C 4Q69A 5LOZA 2NYJA 4H7YA 4JHKA 4Y6WA 4B8AA 4U8VD 1G3NB 2J8SD 3SZ7A 3FP3A 3G2UA 3NAWA 1SA4A 3KAEA 3NOGD 3RRMB 2Y0BG 4ANUA 3MZLB 3CIAA 1IHBA 4ATGA 2J09A 4JZYA 4HVBA 4ME2A 2AJAA 3MKQB 2NSZA 3ZNGA 3EDTB 1HH8A 3Q73A 2BF0X 1MHQA 2F8YA 4DUIA 4MS6A 4CDMA 2GRRB 4DRXE 2EIKE 4XKBA 2XRYA 4ANXA 2R2LA 3B13A 3PDNA 4TUUA 3FWVA 2UY1B 3LPZA 4KZ0A 3D9KA
chains in the Genus database with same CATH topology
4BT8A 3JCKC 4JEUA 5AYWD 4XX5A 5KJKA 2R5SA 3CR3A 4FHJA 2WXJA 3ZIMA 2WB2A 3L22A 1HG2A 3ZGQA 2C0LA 2VGXB 4GZCA 5CCMA 2YHEA 3RO3A 3ASDA 2VTBA 3GZ2A 4WWPA 4N2QA 4K03A 3ZHEA 5DBKA 1IYGA 3ZPJA 3D9MA 4FULA 4GYOA 1KT0A 1JPLA 3GZ1A 1HFAA 1UG3A 1N52A 3I3NA 3MX3A 4WUYA 1UJJA 3P1UA 5FZQA 5M72A 3CHSA 1XGWA 1OWOA 2KCKA 2R17C 3B7TA 1U3CA 4B8CB 4RSYA 1Y8MA 2EQXA 3CSTA 4ANVA 1EYHA 1PY1A 5KCMA 4BX8A 2OVFA 3CVUA 3APCA 3SBSA 5CMYA 2I2OA 3ASGA 3FUIA 4FU3A 5HI7A 4U0ZA 3UT7A 4DPRA 3HVEA 5JJ6A 5KJNA 2HO1A 5LP0A 4HS2A 1H6KA 3IHVA 4GYYA 4R7LA 4I2WA 1Z6TA 2BUGA 3MV3B 4ILIA 4KXKB 5EX0A 4LUNU 1WY6A 2WXNA 5KJLA 4UI9J 3T5VA 2WQ7A 5ARFA 4UQZA 2YQ8A 1DNPA 3EIQC 3Q49B 1PC2A 4QFVA 3RRUA 4PS3A 3ZN3A 5LX8A 3P2BA 3TXNA 5G04C 3VLEA 2CFZA 1HX8A 3VTXA 2X38A 4UWLA 3PUKA 4XKCA 3D9LA 4KVOA 3U64A 1ZBPA 3SF4A 1HXIA 2GGFA 1QQEA 1EPUA 5EKQD 3UT8A 1TEZA 3CHQA 1JUQA 2YHCA 2X6IA 3PE4A 2Y4UA 2HM8A 2PQRA 3Q47B 3GZSA 4RG6A 1MQSA 2KATA 3LS8A 5EDSA 4H7XA 4JPSA 5FQ7A 3I4GA 4CT4A 1JWGA 1E90A 2V8SE 4E6HA 3RKVA 3SNXA 1E7VA 3LVQE 4AM9A 3CK7A 2RD0A 3ZRHA 2FEZA 4WWNA 3MV2B 4JEHA 3ESKA 4AVXA 4EQFA 4N2SA 4NACA 1LF8A 4UQYA 2JEKA 2KC7A 2Q7FA 5FT9A 5FWQA 1E8ZA 3QB2A 3ZXSA 3CQGB 2IOLA 2J4DA 3L13A 3CVLA 4GZ3A 3AU5A 2CG3A 3FUMA 2LO6A 4C0EA 1Y6IA 3FTSA 4J8DA 4HOQA 2Y4TA 3APFA 3L54A 3CVPA 2I9CA 3FUEA 2WXQA 2PM6A 4LERA 3D9PA 1HU3A 5FZRA 4JHRA 1OWNA 5JJTA 2J4BA 4OVUA 3AU4A 2IOSA 3FY4A 2OV8A 4ACLA 3R9AB 3S7JA 4MRUA 2BTDA 3FUNA 3GYZA 4E85A 3ASHA 2M63A 3QWPA 2J08A 3G2SA 3CK8A 4I6JA 2XCCA 4FC8A 4ABNA 4I2ZA 4G11A 4KBQA 5A7DB 3BG0B 2PQNA 3CV0A 3B7SA 2L9BA 4NURA 3SBTB 4KT6B 3MA5A 3QWWA 3ZYLA 3SD5A 4UWGA 2RG8A 4IYPA 4BTAA 5CCLA 3KS2A 5JHAA 3D3MA 3CHRA 3PE3A 4HORA 2PL2A 4G1TA 4B94A 3CGHA 3S7BA 2VGYA 2IJGX 3ONKA 4CCAA 3ENEA 2E2EA 4GZ5A 3MGBA 4J8EA 2WXMA 4PDXA 2ONDA 3QNKA 4GYWA 1DVPA 2XEVA 4I9EA 1L5JA 2FF4A 5T8IA 2X6FA 3D9OA 4BTBA 5CHEE 5ANRA 1E7UA 3FUDA 4BX9A 2WMNA 2OVBA 2LAIA 2ZU6B 4XZ4A 3TL5A 4CDNA 3L17A 4Y6CA 2HR2A 4EZJA 2VSYA 2XPYA 4ACKA 2WXHA 3FH8A 1BPOA 4DK5A 4HXIA 1OUVA 3IHYA 5BT1A 2UWJG 3S2AA 4AP2A 2XGOA 1FVHA 3IBEA 3FEYA 3UX4A 2GRMA 3FUKA 2LSVA 3PUJA 2WXKA 3D9IA 3CHMA 3LDZA 4NRHB 2V4LA 1JWFA 3I5PA 3T5XA 3UPVA 3LKUA 3JQ0A 3N71A 4AIFA 4FHKA 3PVLA 4JW1A 4I1OB 4BT9A 2IU1A 3I4RB 2CHXA 3IEGA 4GCOA 2Y3AA 4A1SA 4L23A 4MKTA 4LRZA 2FI7A 3U3WA 3ZYQA 5G04J 2C0MA 3QOUA 3URZA 4UWHA 1S0PA 2WQHA 2VYIA 3L08A 2GRLA 1OWPA 4G2VA 3PH0C 4L2LA 4JXTA 3AS5A 3VLDA 2NC9A 2PZIA 4URKA 3PREA 3CVXA 3UMVA 3ZEFA 4GA2A 4DI4A 2KZTA 3S7FA 4GMJA 2L6JA 1INZA 4J0UA 4APOA 1HE8A 5LFAA 4GA1A 4U0UA 2KCVA 4U8HA 4JA7A 2C2LA 4L2YA 5BV1A 2FULA 1Z3YA 3KEZA 3NQPA 4WAFA 3FTXA 3QDNA 4V3IA 4F7AA 4FADA 3ZHEB 3EHNA 3HYMB 1NZNA 4APFA 3G2VA 3L6AA 2WQ6A 2XCBA 3D9NA 4N5CA 3T8MA 2XPZA 4JC8A 3TGOA 1UN8A 4K0RA 3RU0A 3ZYMA 1W3BA 2AXZA 4GB9A 3QWVA 2DBAA 4JVSA 3MCXA 2XHEA 4KYOB 3SFZA 4FA6A 1SZ9A 3HHMA 4EECA 2L0IA 2IONA 2AVPA 2WXGA 3PRZA 4FLHA 4N3BA 4GPKA 4BFRA 4IRUA 3HIZA 4DLQA 4HOUA 5FQ6A 4AOFA 2DCPA 3HVEB 4EZKA 2CFUA 1HO8A 3G2TA 3OTNA 2AWIA 4D10C 4EPZA 3G2WA 3MKQA 4XIFA 3ONLA 3EIJA 3KD7A 4I17A 4U07A 2DIWA 2X3MA 2LNIA 1SQMA 4J8SA 2IFUA 3B7RL 4AV7A 1HZ4A 4XE0A 1IQUA 2GW1A 2XPIA 5T3RA 5FQ4A 2XRZA 3FTUA 3QK0A 4ANWA 5BPPA 3OXGA 4A55A 3HDXA 4I1AA 1ELWA 1H2TC 3UQ3A 2KM4A 3CKCA 3OXLA 3FFLA 2IQCA 4UQXA 4I6GA 3QKYA 3OXFA 4I43A 2YINA 5FJYA 3CVVA 1EF1C 4KVMA 1UW4B 4G24A 1ZU2A 3FU6A 4FP7A 4Q96A 3PEUB 5G55A 3AS8A 5FTPA 4I1MA 3JYSA 2V0PA 3EHMA 1ELRA 2UY1A 1Z3XA 2XGMA 4YVQC 3RRNB 2WPVA 1YA0A 3LJ3A 5AJLA 3FTYA 2A5UA 1E96B 4U63A 3RO2A 3ZVVA 2AXVA 2WXPA 4N39A 5DIZA 3FTVA 2VGXA 3U66A 2WXOA 3PZDA 1QNFA 1P5QA 2FBNA 2XQ0A 5JHBA 2VSNA 3EJNA 3LY9A 4GZDA 3LYAA 2OOEA 3Q4AB 2NXPA 5D0OD 2VJ8A 3DBSA 4U04A 4F3VA 4OVVA 3FULA 4OYSA 1X5BA 4I9CA 3O48A 2VQ2A 5ENNA 4A1GA 3TG5A 1E8WA 4EZLA 1UN9A 3GW4A 2IF4A 1SZAA 2HYZA 5BW8C 4L1BA 4NQ0A 1GW6A 5BUZA 2WXRA 3IKOB 2WXLA 4GU5A 2A4ZA 3ULQA 1ELKA 4CGVA 4GZ6A 3FHEA 1QZ2A 5CMWA 5KJMA 3BG1B 1NA3A 3UT4A 4W9RA 4HOTA 1PAQA 4TV3A 3VTYA 4EBAA 4FLBA 4HFGA 5FQ8A 3TG4A 3R7QA 3VLFA 5J90A 4XI0A 2E0IA 5D0QD 3FU5A 4KZCA 1UJKA 4M3OA 3FH7A 2AXUA 1E8YA 4BY6A 4WWOA 4HOSA 1FCHA 3E4BA 2VSXE 4F53A 1IQRA 3D9JA 3LXUX 4LEUA 5FZSA 2QFCA 4DJAA 3NZUA 4UWKA 4GA0A 3CKBA 3FEXA 3QC1A 4YNDA 5J08A 3ESLA 3NF1A 3RIBA 5LCWC 4N3AA 2MOWA 1B89A 2WVIA 3TJPA 2CHZA 3R7RA 4IN3B 5JJ7A 1E8XA 3CK9A 2AW6A 3CVQA 4J8FA 5AJDA 1KLXA 1TJCA 3SHFA 5BNWA 1HF8A 4EBAG 1EDUA 4JL0A 4G26A 3OAWA 3QJZA 3PNLB 2X6JA 2WMOA 4GCNA 1VDYA 3ML9A 4P29A 3RJVA 1OWLA 3DPDA 4PH4B 3C98A 2MRIA 1WM5A 5E76A 4AY5A 3ML8A 4MLPA 3CQCB 2CG2A 1N54A 3SGHA 3TXMA 1NA0A 2X6KA 4ILHB 3MJWA 2LAHA 4UWFA 4Q94A 1H19A 1HS6A 5T4YA 4C0MA 4JA9A 3TAXA 3K9IA 4KMOA 4BWRA 4WNFA 1IHGA 4IULA 1HG5A 4C9BB 5C2YA 2P58C 3CHOA 3JQ1A 4WNGA 4JHJA 3LCAA 3CVYA 5C1DA 3FUJA 2J49A 4CEMA 3ZW3A 3S7DA 4WNDA 3UUXA 4AJWA 4BSXA 5AENA 4B0ZA 2FO7A 2R59A 1U3DA 3LY7A 2KCLA 2X6HA 5AIJA 2CHWA 2I6HA 3LVRE 3ASFA 3LY8A 2XGSA 4O6FA 4PUCA 1TJFA 2QY7A 4RVBA 1H2UA 3PS6A 4F1SA 3FU3A 4CGWA 4AY6A 3CHPA 2KZTB 3APDA 1XNFA 4ILGA 5A6CA 5HQ8A 4PS8A 3MEKA 4U0SA 3CEQA 3FU0A 3Q15A 3BEEA 4CT0A 3MKRA 4UI9C 4Q69A 4AEZC 3CVWA 5LOZA 4CRWA 4H7YA 4JHKA 5ARGA 3B7UX 3RK6A 4XI9A 4Y6WA 4CDRA 2JLBA 4B8AA 2WXIA 3IV0A 2J07A 5ANLA 2LSUA 4G23A 4YVOA 3SZ7A 3FDHA 3FUFA 4A3TA 3SI5A 3FP3A 1WAO1 2WXFA 3G2UA 1H2VC 2V5FA 5G05J 4B89A 3FTWA 4FJYA 3KAEA 3ZFWA 1H0AA 1KT1A 3NZSA 3RRMB 4LCTA 2I1JA 4G25A 4ANUA 3MZLB 5A23A 2VTBB 3CIAA 2J9QA 1A17A 3L16A 3LEWA 2VSOE 4FJZA 5EX3A 4I6EA 2I1KA 2J09A 4ATGA 4AXHA 4JZYA 4UI9K 4HVBA 4ME2A 2PM7A 3MKQB 4GAAA 4WNEA 5BV0A 4L7TA 4A3VA 3CVNA 3U4TA 4RG9A 3CLJA 4DI3A 3QARA 5G2NA 3WXXA 2NSZA 3PNTB 3EDTB 2WM9A 1HH8A 3QAQA 2ILRA 3AS4A 1NP7A 3JUIA 2BF0X 2L0TB 1MHQA 3ZYKA 4DLOA 5E75A 1FVFA 5G05C 3U9WA 1OWMA 4PS7A 4MS6A 4CDMA 3FTZA 2MHKA 2YNQA 3Q5MA 4XKBA 2XRYA 3CSFA 4GMLA 4ANXA 4N3CA 3FUHA 5LCWJ 3O4ZA 4J6IA 3B13A 3FH5A 3PEVB 3PDNA 4TUUA 3FWVA 4TRQA 2UY1B 3MYVA 3LPZA 4HLEA 4KZ0A 3D9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT8 A;  5AYW D;  5KJK A;  2R5S A;  3ZGQ A;  2C0L A;  2VGX B;  5CCM A;  3RO3 A;  3ASD A;  3GZ2 A;  4N2Q A;  3ZHE A;  5DBK A;  1IYG A;  3ZPJ A;  4GYO A;  1KT0 A;  3GZ1 A;  4WUY A;  5FZQ A;  5M72 A;  2KCK A;  1Y8M A;  3ASG A;  5HI7 A;  5KJN A;  4U0Z A;  5JJ6 A;  2HO1 A;  4GYY A;  4I2W A;  3MV3 B;  2BUG A;  4KXK B;  5EX0 A;  5KJL A;  4UI9 J;  5ARF A;  4UQZ A;  2YQ8 A;  3Q49 B;  1PC2 A;  3ZN3 A;  5G04 C;  3VTX A;  1ZBP A;  3SF4 A;  1HXI A;  1QQE A;  5EKQ D;  2YHC A;  3PE4 A;  2Y4U A;  2PQR A;  3Q47 B;  4RG6 A;  2KAT A;  4H7X A;  3RKV A;  4AM9 A;  3CK7 A;  2FEZ A;  3MV2 B;  4EQF A;  3ESK A;  4N2S A;  4UQY A;  2KC7 A;  2Q7F A;  5FT9 A;  3CVL A;  4GZ3 A;  4J8D A;  4HOQ A;  2Y4T A;  3CVP A;  5JJT A;  5FZR A;  4JHR A;  3R9A B;  3S7J A;  3GYZ A;  3ASH A;  3QWP A;  3CK8 A;  2XCC A;  4ABN A;  4I2Z A;  4KBQ A;  5A7D B;  2PQN A;  3CV0 A;  3MA5 A;  3QWW A;  4BTA A;  5CCL A;  3KS2 A;  3PE3 A;  4HOR A;  2PL2 A;  4G1T A;  4B94 A;  3S7B A;  2VGY A;  2E2E A;  4GZ5 A;  4J8E A;  2OND A;  4GYW A;  2XEV A;  4I9E A;  2FF4 A;  4BTB A;  5CHE E;  4Y6C A;  2HR2 A;  2VSY A;  1OUV A;  5BT1 A;  2UWJ G;  2XGO A;  2LSV A;  4NRH B;  3UPV A;  3LKU A;  3N71 A;  4AIF A;  4BT9 A;  3IEG A;  4GCO A;  4A1S A;  2FI7 A;  3U3W A;  5G04 J;  2C0M A;  3QOU A;  3URZ A;  2WQH A;  2VYI A;  4G2V A;  3AS5 A;  2NC9 A;  2PZI A;  4GA2 A;  3S7F A;  2L6J A;  4J0U A;  4APO A;  4GA1 A;  4U0U A;  2KCV A;  4JA7 A;  2C2L A;  3QDN A;  3ZHE B;  3HYM B;  1NZN A;  2XCB A;  4N5C A;  3TGO A;  3RU0 A;  1W3B A;  3QWV A;  2DBA A;  4KYO B;  2AVP A;  4GPK A;  4N3B A;  4HOU A;  4XIF A;  3KD7 A;  4I17 A;  4U07 A;  2LNI A;  2IFU A;  1HZ4 A;  2GW1 A;  2XPI A;  3OXG A;  4I1A A;  1ELW A;  3UQ3 A;  3CKC A;  3OXL A;  3FFL A;  4UQX A;  3QKY A;  3OXF A;  5FJY A;  4G24 A;  1ZU2 A;  3AS8 A;  5FTP A;  3JYS A;  1ELR A;  2UY1 A;  2XGM A;  4YVQ C;  2WPV A;  1YA0 A;  1E96 B;  3RO2 A;  4N39 A;  5DIZ A;  2VGX A;  2FBN A;  1P5Q A;  2VSN A;  3LY9 A;  3LYA A;  2OOE A;  3Q4A B;  5D0O D;  4U04 A;  4F3V A;  4I9C A;  3O48 A;  2VQ2 A;  3TG5 A;  3GW4 A;  2IF4 A;  2HYZ A;  5BW8 C;  4NQ0 A;  3ULQ A;  4CGV A;  4GZ6 A;  1QZ2 A;  5KJM A;  1NA3 A;  4W9R A;  4HOT A;  3VTY A;  3TG4 A;  4XI0 A;  5D0Q D;  4HOS A;  1FCH A;  3E4B A;  5FZS A;  4LEU A;  2QFC A;  4GA0 A;  3CKB A;  4YND A;  3NF1 A;  3RIB A;  5LCW C;  4N3A A;  1B89 A;  4IN3 B;  5JJ7 A;  3CK9 A;  3CVQ A;  4J8F A;  1KLX A;  1TJC A;  5BNW A;  4JL0 A;  4G26 A;  4GCN A;  3RJV A;  1WM5 A;  4AY5 A;  1NA0 A;  4JA9 A;  3TAX A;  3K9I A;  4BWR A;  4WNF A;  1IHG A;  2P58 C;  4WNG A;  3LCA A;  5C1D A;  3S7D A;  4WND A;  3UUX A;  2FO7 A;  3LY7 A;  2KCL A;  2I6H A;  3ASF A;  3LY8 A;  2XGS A;  4O6F A;  4CGW A;  4AY6 A;  5A6C A;  1XNF A;  5HQ8 A;  3MEK A;  4U0S A;  3CEQ A;  3Q15 A;  3BEE A;  3MKR A;  4UI9 C;  4H7Y A;  5ARG A;  4XI9 A;  4Y6W A;  4CDR A;  2JLB A;  2LSU A;  4G23 A;  4YVO A;  3SZ7 A;  3FP3 A;  1WAO 1;  2V5F A;  5G05 J;  3KAE A;  3ZFW A;  1KT1 A;  4G25 A;  2J9Q A;  1A17 A;  5EX3 A;  4UI9 K;  4ME2 A;  4WNE A;  3CVN A;  3U4T A;  4RG9 A;  3WXX A;  3EDT B;  1HH8 A;  3AS4 A;  5G05 C;  2MHK A;  3Q5M A;  4N3C A;  5LCW J;  3PDN A;  3FWV A;  2UY1 B;  3LPZ A; 
#chains in the Genus database with same CATH topology
 4BT8 A;  1D8E A;  3CR3 A;  1YCS B;  3L22 A;  2ZIR A;  2VGX B;  1LD7 A;  4GZC A;  2VTB A;  1QBQ A;  4TXP A;  4LNG A;  5EYL A;  3GZ1 A;  1UG3 A;  3MX3 A;  1Y8M A;  5KCM A;  2OVF A;  4JD2 G;  5CMY A;  5JJ6 A;  4HS2 A;  1H6K A;  4Z68 A;  4R7L A;  1WY6 A;  2P9P G;  4TXR A;  4F1P A;  1AP7 A;  2R05 A;  3SFY A;  1X81 A;  3TXN A;  3HXB A;  4XKC A;  4HRL A;  1ZBP A;  2L6B A;  3SF4 A;  3UKU G;  1QQE A;  1IXV A;  5CBN A;  5JMN D;  2YHC A;  2X6I A;  1RW2 A;  2HM8 A;  1S64 A;  4LSZ E;  4RG6 A;  1MQS A;  4H7X A;  4CT4 A;  4E6H A;  4AM9 A;  2FEZ A;  3DPY A;  2VGE A;  2JEK A;  5FWQ A;  3ZXS A;  2J4D A;  3CVL A;  3TWS A;  3FTS A;  4J8D A;  4HOQ A;  3UIN C;  2DWZ A;  3L54 A;  1AWC B;  3DWL G;  2XEN A;  5FZR A;  1OWN A;  1N4R A;  2DVW A;  3AG1 E;  2OV8 A;  4MRU A;  4E85 A;  2Y1L E;  4I6J A;  2ETC A;  2XCC A;  4ABN A;  4G11 A;  4KBQ A;  3DSW A;  2EIM E;  3SD5 A;  1V55 E;  3DSU A;  5CCL A;  5JHA A;  5EIL A;  3D3M A;  5CEA A;  4CCA A;  2LXM A;  3UIP C;  3AG3 E;  3QNK A;  1DVP A;  2XEV A;  1L5J A;  3D9O A;  4BTB A;  2B6C A;  4LG6 A;  5CRU A;  5ANR A;  1E7U A;  4CDN A;  3L17 A;  3SFX A;  4DK5 A;  1O5M A;  4HXI A;  3IHY A;  2XGO A;  1FVH A;  3IBE A;  4M7C A;  3FUK A;  3PUJ A;  3D9I A;  3CHM A;  3I5P A;  1JWF A;  3EHR A;  3JQ0 A;  2EIL E;  4AIF A;  4JW1 A;  5AAR A;  4L23 A;  3ZYQ A;  5G04 J;  3URZ A;  4UWH A;  3L08 A;  3CVX A;  3UMV A;  3E32 A;  3ZEF A;  1U2V G;  3W9G A;  4J0U A;  1HE8 A;  2KCV A;  2C2L A;  2H6G A;  2FUL A;  4WAF A;  3FTX A;  3QDN A;  4V3I A;  2XEE A;  3L6A A;  1UN8 A;  4K0R A;  5EYP F;  3UM2 A;  3DSV A;  4JVS A;  4KYO B;  1KZP A;  4B93 B;  1SZ9 A;  3L82 A;  2AVP A;  4GTO A;  4J7W A;  4GPK A;  4FLH A;  4N3B A;  4IRU A;  5FQ6 A;  4AOF A;  4EZK A;  2F0Y A;  3LJN A;  3OTN A;  4QQI A;  4EPZ A;  3G2W A;  2DIW A;  2X3M A;  5FQ4 A;  5CRV A;  4ANW A;  2KM4 A;  1YYH A;  4UQX A;  3DST A;  4Q96 A;  4FP7 A;  5FTP A;  1ELR A;  5ITZ F;  4YVQ C;  1NI1 A;  1YA0 A;  3V31 A;  3ASO E;  4U63 A;  4DX6 D;  5DIZ A;  1MZC A;  4A63 B;  2FBN A;  3EUV A;  3SQV A;  3L9T A;  2OOE A;  3Q4A B;  2VJ8 A;  4F3V A;  1X5B A;  3O48 A;  2QC9 A;  4HQD A;  1UN9 A;  2IF4 A;  5BW8 C;  4NQ0 A;  4ATZ D;  3KEA A;  3W9F A;  1ELK A;  1QZ2 A;  5CMW A;  3VTY A;  4TV3 A;  4HFG A;  2ZIS A;  3TG4 A;  3R7Q A;  5D0Q D;  4M3O A;  2VSX E;  1IQR A;  3D9J A;  3UXG A;  3ESL A;  3RIB A;  4CZ2 D;  2MOW A;  1B89 A;  3TJP A;  3R7R A;  5JJ7 A;  5AJD A;  2XS1 A;  5FIO A;  4JL0 A;  2WMO A;  3DPD A;  2MRI A;  3SGH A;  1N54 A;  3TXM A;  5KNG A;  4ILH B;  3MJW A;  4UWF A;  5T4Y A;  4C0M A;  4JA9 A;  3K9I A;  4L9P A;  4LNB A;  4C9B B;  4JHJ A;  3LCA A;  3ZW3 A;  4WND A;  3UUX A;  3E37 A;  3EU5 A;  2XGS A;  1TJF A;  2QY7 A;  4RVB A;  3PS6 A;  4CGW A;  3APD A;  5AQB A;  1XNF A;  4PS8 A;  3MEK A;  4U0S A;  1FT1 A;  1N4Q A;  3MKR A;  4G8L A;  3RK6 A;  2BKG A;  4XI9 A;  4CDR A;  2JLB A;  3PZ3 A;  2J07 A;  2R02 A;  2LSU A;  1TNY A;  3DSS A;  2MYO A;  3SI5 A;  2RKK A;  2WXF A;  1H2V C;  5G05 J;  4FJY A;  3ZFW A;  3NZS A;  5IY5 E;  2J9Q A;  3LEW A;  2VSO E;  1S70 B;  5EX3 A;  2I1K A;  4UI9 K;  2EIJ E;  2F8X K;  5BV0 A;  4L7T A;  2WM9 A;  3QAQ A;  4U7E B;  3JUI A;  1NP7 A;  3ZYK A;  4GPM A;  4DLO A;  1FVF A;  3FTZ A;  2YNQ A;  3CSF A;  4GML A;  5BXO A;  3Q9U C;  1TN6 A;  2XZD G;  4HRN A;  5CER B;  5B1A E;  3JCK C;  4JEU A;  3DXM G;  1FT2 A;  2R5S A;  5KJK A;  2WXJ A;  4HBD A;  3ZIM A;  2WB2 A;  2C0L A;  4GTP A;  4U8Y D;  3TWX A;  1MX6 A;  5CCM A;  2YHE A;  4WWP A;  3JXJ A;  3RAU A;  2DYR E;  4BEP A;  3D9M A;  4FUL A;  4GYO A;  1KT0 A;  1O1R A;  1OCC E;  3Q7F A;  1N52 A;  3ZKJ A;  5EIB E;  3P1U A;  5FZQ A;  1N95 A;  4B8C B;  2P9N G;  3CVU A;  3SBS A;  1K8K G;  3FUI A;  5LP0 A;  4DPR A;  1NFI E;  2KBX A;  4GYY A;  1Z6T A;  2BUG A;  4UUC A;  2WXN A;  3T5V A;  2WQ7 A;  1DNP A;  3EIQ C;  4PS3 A;  3ZN3 A;  3DXK G;  5LX8 A;  5G04 C;  1HX8 A;  4UWL A;  3U64 A;  5EKQ D;  3CHQ A;  1JUQ A;  2P9K G;  3PE4 A;  2Y4U A;  2KAT A;  3LS8 A;  5EDS A;  4JPS A;  1JWG A;  3RKV A;  3CK7 A;  4N2S A;  2KC7 A;  1E8Z A;  3QB2 A;  2IOL A;  2CG3 A;  3FUM A;  4O1P A;  2WXQ A;  2PM6 A;  4LER A;  1HU3 A;  4HRM B;  4JHR A;  5ENS D;  2J4B A;  1D9S A;  1O1S A;  3FUN A;  5EN5 D;  3ASH A;  2M63 A;  3CK8 A;  1TNZ A;  4DX7 D;  4FC8 A;  5AQ7 A;  4I2Z A;  3BG0 B;  1A5E A;  3QWW A;  3ZYL A;  4UWG A;  2RG8 A;  4IYP A;  3PE3 A;  3CHR A;  4HOR A;  2BED A;  2PL2 A;  4G1T A;  4B94 A;  3UIO C;  4J8E A;  1N4P A;  1D8D A;  4GYW A;  3Q9N C;  4I9E A;  2FF4 A;  4GTS A;  4BX9 A;  1N94 A;  2ZU6 B;  1N9A A;  5D2M C;  5HS0 A;  3TL5 A;  4JB8 P;  2DZO A;  2XPY A;  2WXH A;  2KXP C;  2WXK A;  3DEO A;  3LDZ A;  3LKU A;  2IU1 A;  3IEG A;  2Y3A A;  4MKT A;  1DCE A;  3U3W A;  1SA5 A;  5ENR D;  1S0P A;  2WQH A;  3F6Q A;  1TYQ G;  2VYI A;  3V30 A;  4L2L A;  4G2V A;  3AS5 A;  3VLD A;  4URK A;  2KZT A;  4GMJ A;  4JA7 A;  3DEP A;  3NQP A;  3KEZ A;  3ZHE B;  1NZN A;  4MBG A;  2XCB A;  3RU0 A;  1DCQ A;  4GB9 A;  3QWV A;  1BU9 A;  2L0I A;  3C3R A;  1OT8 A;  4BFR A;  2DCP A;  3HVE B;  2CFU A;  4GTM A;  3MKQ A;  3V2O A;  4I17 A;  2IFU A;  5AQ9 A;  3B7R L;  4AV7 A;  1IQU A;  2XPI A;  3QK0 A;  1MYO A;  3AAA C;  4I1A A;  3UQ3 A;  3OXL A;  2IQC A;  3UI2 A;  4I6G A;  4I43 A;  1EF1 C;  1UW4 B;  1OCR E;  3AS8 A;  1OCO E;  4I1M A;  3EHM A;  2UY1 A;  3RRN B;  3J5P A;  1JCR A;  3LJ3 A;  2A5U A;  3ZVV A;  3ABK E;  4N39 A;  3FTV A;  2VGX A;  1QNF A;  1P5Q A;  2XQ0 A;  2QYU A;  2VSN A;  4GZD A;  5D0O D;  1Z5S C;  2VQ2 A;  4A1G A;  1E8W A;  1SZA A;  2HYZ A;  1FPP A;  3DSX A;  5BUZ A;  1V54 E;  3IKO B;  4J8Y A;  4GZ6 A;  3FHE A;  1PAQ A;  4HI9 A;  1MJ0 A;  3VLF A;  4KZC A;  1UJK A;  5ENT D;  2V5Q C;  1FCH A;  1LTX A;  3QC1 A;  3NF1 A;  4IN3 B;  1E8X A;  3CK9 A;  2AW6 A;  3CVQ A;  4J8F A;  3T9K A;  5BNW A;  3V79 K;  4U96 D;  3OAW A;  3PNL B;  2X6J A;  1OWL A;  3C98 A;  1WM5 A;  5E76 A;  3ML8 A;  1DC2 A;  2X6K A;  3NOC D;  4TXQ A;  4Q94 A;  3ULE G;  2EIN E;  2ZGD A;  3B7B A;  3C5R A;  1IHG A;  4WNG A;  3CVY A;  3UM0 A;  3FUJ A;  2J49 A;  4RLY A;  4CEM A;  4BSX A;  2FO7 A;  2R59 A;  1U3D A;  1H6P A;  2X6H A;  5AIJ A;  2CHW A;  4DX2 A;  4PUC A;  1K3Z D;  1ZB1 A;  3ULY A;  3CEQ A;  2XZT G;  3CVW A;  3Q78 A;  1BLX B;  3IV0 A;  5ANL A;  4G23 A;  3FDH A;  3FUF A;  1WAO 1;  2V5F A;  3FTW A;  2I1J A;  5A23 A;  1A17 A;  3L16 A;  4FJZ A;  4I6E A;  3TWR A;  4YDE A;  5AN8 A;  2PM7 A;  4WNE A;  2XS8 A;  3CVN A;  3U4T A;  4RG9 A;  3CLJ A;  3QAR A;  3WXX A;  3PNT B;  2ILR A;  3AS4 A;  5E75 A;  1OWM A;  3JXI A;  3Q5M A;  3KSQ A;  4N3C A;  3O4Z A;  4TRQ A;  2H6H A;  3MYV A;  3UM3 A;  5AYW D;  4XX5 A;  3ZXP A;  1K1B A;  3ZGQ A;  4CYM D;  3RO3 A;  4K03 A;  3ASN E;  1IYG A;  1TR4 A;  3C3Q A;  3ZPJ A;  1HFA A;  3I3N A;  4WUY A;  1UJJ A;  3D9H A;  1XGW A;  1OWO A;  2KCK A;  3B7T A;  5KNH D;  1U3C A;  2EQX A;  4ANV A;  1EYH A;  4BX8 A;  4FU3 A;  5HI7 A;  5KJN A;  4U0Z A;  3UT7 A;  2HO1 A;  4ILI A;  1YMP A;  5H7P A;  4UQZ A;  1PC2 A;  3P2B A;  3VLE A;  2ETB A;  2X38 A;  3PUK A;  3D9L A;  2IO3 C;  2GGF A;  1TEZ A;  1EPU A;  3UT8 A;  1JCQ A;  3WG7 E;  3GZS A;  3I4G A;  1E90 A;  1TNO A;  2V8S E;  3SNX A;  1E7V A;  2LXL A;  2RD0 A;  3MV2 B;  4JEH A;  4EQF A;  4AVX A;  4NAC A;  2Q7F A;  2DYS E;  3L13 A;  4GZ3 A;  3AU5 A;  4XEI G;  2P9I G;  2LO6 A;  3CVP A;  3FUE A;  4OVU A;  3AU4 A;  2LUH A;  4ACL A;  1TN7 A;  3B95 A;  3GYZ A;  3QWP A;  2J08 A;  5A7D B;  2L9B A;  4KT6 B;  3MA5 A;  1MX4 A;  1MX2 A;  3KS2 A;  2P2C P;  3CGH A;  3S7B A;  2VGY A;  4GTV A;  2QZA A;  3ENE A;  4PDX A;  3E34 A;  3JUE A;  5T8I A;  3PZ2 A;  5CHE E;  3ISM C;  3FUD A;  2WMN A;  4XZ4 A;  4Y6C A;  2HR2 A;  3SY2 A;  2VSY A;  3FH8 A;  1BPO A;  1OUV A;  3FEY A;  3UX4 A;  2GRM A;  5CEC B;  2LSV A;  2V4H C;  2RFM A;  3N71 A;  4FHK A;  4BT9 A;  3I4R B;  4GCO A;  2H6I A;  4LRZ A;  2FI7 A;  1BD8 A;  2C0M A;  3TWW A;  3HXE A;  5CBO A;  3HXC A;  4X8Q A;  1S63 A;  4GA2 A;  5KWD A;  3S7F A;  1INZ A;  3IXE A;  4L2Y A;  5BV1 A;  2VTB B;  3RSE G;  3HYM B;  4APF A;  3G2V A;  2WQ6 A;  3D9N A;  4K5A B;  4O60 A;  4N5C A;  2XPZ A;  3ZYM A;  1W3B A;  1Q2Z A;  2H6F A;  2AXZ A;  2DBA A;  2OEW A;  3SFZ A;  3HHM A;  5ENP D;  4TUM A;  4EEC A;  3NB2 A;  4YDO A;  2WXG A;  3PRZ A;  3AG2 E;  4DLQ A;  1BI7 B;  4D10 C;  2AWI A;  3ONL A;  3X2Q E;  4U07 A;  3J5Q B;  4J8S A;  4HB5 A;  1HZ4 A;  5BPP A;  3TWV A;  1ELW A;  1H2T C;  4O1O A;  3FFL A;  2P9L G;  3QKY A;  3OXF A;  2YIN A;  2P9U G;  1NL4 A;  3CVV A;  4KVM A;  4G24 A;  1ZU2 A;  3FU6 A;  3JYS A;  2V0P A;  2XGM A;  3FTY A;  1E96 B;  5EID A;  2WXP A;  1SW6 A;  3U66 A;  5JHB A;  3EJN A;  3LY9 A;  3ABL E;  4U04 A;  1H6O A;  3FUL A;  3TG5 A;  4L1B A;  2WXR A;  2WXL A;  4GU5 A;  5AAO A;  5KJM A;  3BG1 B;  1NA3 A;  4W9R A;  4HOT A;  3T8K A;  3TWQ A;  4FLB A;  5J90 A;  4XI0 A;  2E0I A;  3FU5 A;  3FH7 A;  3PZ4 A;  1E8Y A;  4BY6 A;  4WWO A;  4HOS A;  4F53 A;  5FZS A;  2QFC A;  4DJA A;  5BXU A;  3NZU A;  4UWK A;  4YND A;  2CHZ A;  4GMR A;  1KLX A;  3SHF A;  1HF8 A;  4K5C A;  4G26 A;  3QJZ A;  1VDY A;  3RJV A;  4AY5 A;  3CQC B;  2CG2 A;  1NA0 A;  4F6R D;  3TAX A;  4KMO A;  1HG5 A;  2P58 C;  3CHO A;  3JQ1 A;  3HXD A;  2PNN A;  3ZUV B;  1TNB A;  4B0Z A;  2KCL A;  2ETA A;  3LVR E;  5KBA A;  4BER A;  2IEJ A;  4YDY A;  1H2U A;  4F1S A;  3FU3 A;  4AY6 A;  2GRP B;  3CHP A;  4ILG A;  4OAV B;  3FU0 A;  3Q15 A;  4CT0 A;  4GTR A;  5D66 A;  4AEZ C;  4CRW A;  1BI8 B;  5ARG A;  3B7U X;  3AJI A;  3BQO A;  1N11 A;  2WXI A;  4OAU C;  4YVO A;  3E33 A;  4A3T A;  4ZFH A;  4B89 A;  3V2X A;  1H0A A;  1KT1 A;  4LCT A;  4G25 A;  2B0O E;  5AQA A;  2Y69 E;  1TNU A;  4AXH A;  2IY0 C;  4GTT A;  2GRO B;  4GAA A;  4A3V A;  4DI3 A;  5G2N A;  2R03 A;  5ENQ D;  2L0T B;  5G05 C;  3U9W A;  4PS7 A;  1KZO A;  2MHK A;  3EU9 A;  3SO8 A;  3FUH A;  5LCW J;  3TWU A;  4J6I A;  3FH5 A;  3PEV B;  1OXJ A;  3UM1 A;  5CED B;  4HLE A;  2XEH A;  4FHJ A;  1HG2 A;  1KPS B;  3ASD A;  3GZ2 A;  1TN8 A;  4N2Q A;  3ZHE A;  5DBK A;  3NBN B;  1JPL A;  5HRY A;  3Q79 A;  3HRA A;  5M72 A;  3CHS A;  2R17 C;  4RSY A;  3CST A;  1PY1 A;  1WG0 A;  3DRA A;  3APC A;  2I2O A;  3ASG A;  2P9S G;  3BUA A;  3HVE A;  3IHV A;  5JA4 D;  4NIK A;  1OY3 D;  4I2W A;  3MV3 B;  4KXK B;  5EX0 A;  4LUN U;  4BSZ B;  5KJL A;  4UI9 J;  5ARF A;  2YQ8 A;  2HE0 A;  2DZN A;  3Q49 B;  4QFV A;  3RRU A;  2BKK B;  1O1T A;  3UKR G;  2CFZ A;  3VTX A;  2OEV A;  4KVO A;  3UTM A;  1HXI A;  1K1A A;  4C48 B;  1LD8 A;  2PQR A;  3Q47 B;  5FQ7 A;  3LVQ E;  3ZRH A;  4WWN A;  3ESK A;  1LF8 A;  4UQY A;  5FT9 A;  4LNU D;  3HXF A;  3CQG B;  4C0E A;  1Y6I A;  2Y4T A;  3APF A;  2I9C A;  3Q75 A;  3D9P A;  5JJT A;  2IOS A;  3FY4 A;  3R9A B;  3S7J A;  2BTD A;  4ZHB A;  3G2S A;  2IO2 C;  2PQN A;  3CV0 A;  1N4S A;  3B7S A;  4NUR A;  3SBT B;  4BTA A;  2IJG X;  3ONK A;  2E2E A;  4GZ5 A;  3MGB A;  2WXM A;  2OND A;  2X6F A;  1N0Q A;  4U95 D;  2OVB A;  2LAI A;  3R9M A;  4EZJ A;  4ACK A;  5BT1 A;  2UWJ G;  3S2A A;  4AP2 A;  4HNA D;  4NRH B;  2V4L A;  3UPV A;  3T5X A;  3PVL A;  4I1O B;  2CHX A;  4A1S A;  2JAB A;  3QOU A;  5B3S E;  2ZXW E;  4HI8 A;  2OCC E;  4G8K A;  2GRL A;  1OWP A;  3PH0 C;  4JXT A;  2NC9 A;  2PZI A;  2QYJ A;  3PRE A;  4EHM A;  4DI4 A;  1UOH A;  2L6J A;  4APO A;  3HG0 D;  5LFA A;  4GA1 A;  4U0U A;  4U8H A;  1JCS A;  1Z3Y A;  4F7A A;  4FAD A;  3ABM E;  3EHQ A;  3EHN A;  4DX1 A;  3C72 A;  3T8M A;  2GRQ B;  4JC8 A;  3TGO A;  3MCX A;  2XHE A;  4FA6 A;  2ION A;  1SVX A;  3HIZ A;  4HOU A;  4GTQ A;  1HO8 A;  3G2T A;  2ZGG A;  4XIF A;  1N0R A;  3EIJ A;  3KD7 A;  5B1B E;  2LNI A;  1SQM A;  4XE0 A;  2XRZ A;  2GW1 A;  5T3R A;  3FTU A;  3OXG A;  4A55 A;  3HDX A;  3CKC A;  3BU8 A;  5FJY A;  3TWT A;  3PEU B;  5G55 A;  4DX5 D;  1Z3X A;  1QYM A;  2WPV A;  5AJL A;  5ENO D;  1IKN D;  4N5Q A;  3KSL A;  3RO2 A;  2AXV A;  2WXO A;  3PZD A;  5HKP A;  3LYA A;  2NXP A;  3DBS A;  4OVV A;  4OYS A;  4I9C A;  5ENN A;  1OCZ E;  4EZL A;  3GW4 A;  1GW6 A;  2A5E A;  2A4Z A;  3ULQ A;  4CGV A;  3UT4 A;  4EBA A;  5FQ8 A;  4YDW A;  3C3O A;  5FIN A;  2AXU A;  3PZ1 A;  3E4B A;  3LXU X;  4LEU A;  4GA0 A;  3CKB A;  3FEX A;  5J08 A;  4HLL A;  5LCW C;  4N3A A;  2FO1 E;  2WVI A;  1RZ4 A;  1TJC A;  2RFA A;  4EBA G;  1EDU A;  4GCN A;  3ML9 A;  4P29 A;  4PH4 B;  4MLP A;  4BES A;  4RQI A;  2LAH A;  1H19 A;  1HS6 A;  3AG4 E;  4BWR A;  4WNF A;  4IUL A;  4K5B A;  5C2Y A;  3Q7A A;  5C1D A;  2GRN B;  3ZU7 B;  2F37 A;  3S7D A;  4AJW A;  5AEN A;  1WDY A;  3LY7 A;  2I6H A;  4BET A;  3ASF A;  3LY8 A;  4O6F A;  2KZT B;  5A6C A;  5HQ8 A;  3BEE A;  3E30 A;  4UI9 C;  4Q69 A;  5LOZ A;  2NYJ A;  4H7Y A;  4JHK A;  4Y6W A;  4B8A A;  4U8V D;  1G3N B;  2J8S D;  3SZ7 A;  3FP3 A;  3G2U A;  3NAW A;  1SA4 A;  3KAE A;  3NOG D;  3RRM B;  2Y0B G;  4ANU A;  3MZL B;  3CIA A;  1IHB A;  4ATG A;  2J09 A;  4JZY A;  4HVB A;  4ME2 A;  2AJA A;  3MKQ B;  2NSZ A;  3ZNG A;  3EDT B;  1HH8 A;  3Q73 A;  2BF0 X;  1MHQ A;  2F8Y A;  4DUI A;  4MS6 A;  4CDM A;  2GRR B;  4DRX E;  2EIK E;  4XKB A;  2XRY A;  4ANX A;  2R2L A;  3B13 A;  3PDN A;  4TUU A;  3FWV A;  2UY1 B;  3LPZ A;  4KZ0 A;  3D9K A; 
#chains in the Genus database with same CATH homology
 4BT8 A;  3JCK C;  4JEU A;  5AYW D;  4XX5 A;  5KJK A;  2R5S A;  3CR3 A;  4FHJ A;  2WXJ A;  3ZIM A;  2WB2 A;  3L22 A;  1HG2 A;  3ZGQ A;  2C0L A;  2VGX B;  4GZC A;  5CCM A;  2YHE A;  3RO3 A;  3ASD A;  2VTB A;  3GZ2 A;  4WWP A;  4N2Q A;  4K03 A;  3ZHE A;  5DBK A;  1IYG A;  3ZPJ A;  3D9M A;  4FUL A;  4GYO A;  1KT0 A;  1JPL A;  3GZ1 A;  1HFA A;  1UG3 A;  1N52 A;  3I3N A;  3MX3 A;  4WUY A;  1UJJ A;  3P1U A;  5FZQ A;  5M72 A;  3CHS A;  1XGW A;  1OWO A;  2KCK A;  2R17 C;  3B7T A;  1U3C A;  4B8C B;  4RSY A;  1Y8M A;  2EQX A;  3CST A;  4ANV A;  1EYH A;  1PY1 A;  5KCM A;  4BX8 A;  2OVF A;  3CVU A;  3APC A;  3SBS A;  5CMY A;  2I2O A;  3ASG A;  3FUI A;  4FU3 A;  5HI7 A;  4U0Z A;  3UT7 A;  4DPR A;  3HVE A;  5JJ6 A;  5KJN A;  2HO1 A;  5LP0 A;  4HS2 A;  1H6K A;  3IHV A;  4GYY A;  4R7L A;  4I2W A;  1Z6T A;  2BUG A;  3MV3 B;  4ILI A;  4KXK B;  5EX0 A;  4LUN U;  1WY6 A;  2WXN A;  5KJL A;  4UI9 J;  3T5V A;  2WQ7 A;  5ARF A;  4UQZ A;  2YQ8 A;  1DNP A;  3EIQ C;  3Q49 B;  1PC2 A;  4QFV A;  3RRU A;  4PS3 A;  3ZN3 A;  5LX8 A;  3P2B A;  3TXN A;  5G04 C;  3VLE A;  2CFZ A;  1HX8 A;  3VTX A;  2X38 A;  4UWL A;  3PUK A;  4XKC A;  3D9L A;  4KVO A;  3U64 A;  1ZBP A;  3SF4 A;  1HXI A;  2GGF A;  1QQE A;  1EPU A;  5EKQ D;  3UT8 A;  1TEZ A;  3CHQ A;  1JUQ A;  2YHC A;  2X6I A;  3PE4 A;  2Y4U A;  2HM8 A;  2PQR A;  3Q47 B;  3GZS A;  4RG6 A;  1MQS A;  2KAT A;  3LS8 A;  5EDS A;  4H7X A;  4JPS A;  5FQ7 A;  3I4G A;  4CT4 A;  1JWG A;  1E90 A;  2V8S E;  4E6H A;  3RKV A;  3SNX A;  1E7V A;  3LVQ E;  4AM9 A;  3CK7 A;  2RD0 A;  3ZRH A;  2FEZ A;  4WWN A;  3MV2 B;  4JEH A;  3ESK A;  4AVX A;  4EQF A;  4N2S A;  4NAC A;  1LF8 A;  4UQY A;  2JEK A;  2KC7 A;  2Q7F A;  5FT9 A;  5FWQ A;  1E8Z A;  3QB2 A;  3ZXS A;  3CQG B;  2IOL A;  2J4D A;  3L13 A;  3CVL A;  4GZ3 A;  3AU5 A;  2CG3 A;  3FUM A;  2LO6 A;  4C0E A;  1Y6I A;  3FTS A;  4J8D A;  4HOQ A;  2Y4T A;  3APF A;  3L54 A;  3CVP A;  2I9C A;  3FUE A;  2WXQ A;  2PM6 A;  4LER A;  3D9P A;  1HU3 A;  5FZR A;  4JHR A;  1OWN A;  5JJT A;  2J4B A;  4OVU A;  3AU4 A;  2IOS A;  3FY4 A;  2OV8 A;  4ACL A;  3R9A B;  3S7J A;  4MRU A;  2BTD A;  3FUN A;  3GYZ A;  4E85 A;  3ASH A;  2M63 A;  3QWP A;  2J08 A;  3G2S A;  3CK8 A;  4I6J A;  2XCC A;  4FC8 A;  4ABN A;  4I2Z A;  4G11 A;  4KBQ A;  5A7D B;  3BG0 B;  2PQN A;  3CV0 A;  3B7S A;  2L9B A;  4NUR A;  3SBT B;  4KT6 B;  3MA5 A;  3QWW A;  3ZYL A;  3SD5 A;  4UWG A;  2RG8 A;  4IYP A;  4BTA A;  5CCL A;  3KS2 A;  5JHA A;  3D3M A;  3CHR A;  3PE3 A;  4HOR A;  2PL2 A;  4G1T A;  4B94 A;  3CGH A;  3S7B A;  2VGY A;  2IJG X;  3ONK A;  4CCA A;  3ENE A;  2E2E A;  4GZ5 A;  3MGB A;  4J8E A;  2WXM A;  4PDX A;  2OND A;  3QNK A;  4GYW A;  1DVP A;  2XEV A;  4I9E A;  1L5J A;  2FF4 A;  5T8I A;  2X6F A;  3D9O A;  4BTB A;  5CHE E;  5ANR A;  1E7U A;  3FUD A;  4BX9 A;  2WMN A;  2OVB A;  2LAI A;  2ZU6 B;  4XZ4 A;  3TL5 A;  4CDN A;  3L17 A;  4Y6C A;  2HR2 A;  4EZJ A;  2VSY A;  2XPY A;  4ACK A;  2WXH A;  3FH8 A;  1BPO A;  4DK5 A;  4HXI A;  1OUV A;  3IHY A;  5BT1 A;  2UWJ G;  3S2A A;  4AP2 A;  2XGO A;  1FVH A;  3IBE A;  3FEY A;  3UX4 A;  2GRM A;  3FUK A;  2LSV A;  3PUJ A;  2WXK A;  3D9I A;  3CHM A;  3LDZ A;  4NRH B;  2V4L A;  1JWF A;  3I5P A;  3T5X A;  3UPV A;  3LKU A;  3JQ0 A;  3N71 A;  4AIF A;  4FHK A;  3PVL A;  4JW1 A;  4I1O B;  4BT9 A;  2IU1 A;  3I4R B;  2CHX A;  3IEG A;  4GCO A;  2Y3A A;  4A1S A;  4L23 A;  4MKT A;  4LRZ A;  2FI7 A;  3U3W A;  3ZYQ A;  5G04 J;  2C0M A;  3QOU A;  3URZ A;  4UWH A;  1S0P A;  2WQH A;  2VYI A;  3L08 A;  2GRL A;  1OWP A;  4G2V A;  3PH0 C;  4L2L A;  4JXT A;  3AS5 A;  3VLD A;  2NC9 A;  2PZI A;  4URK A;  3PRE A;  3CVX A;  3UMV A;  3ZEF A;  4GA2 A;  4DI4 A;  2KZT A;  3S7F A;  4GMJ A;  2L6J A;  1INZ A;  4J0U A;  4APO A;  1HE8 A;  5LFA A;  4GA1 A;  4U0U A;  2KCV A;  4U8H A;  4JA7 A;  2C2L A;  4L2Y A;  5BV1 A;  2FUL A;  1Z3Y A;  3KEZ A;  3NQP A;  4WAF A;  3FTX A;  3QDN A;  4V3I A;  4F7A A;  4FAD A;  3ZHE B;  3EHN A;  3HYM B;  1NZN A;  4APF A;  3G2V A;  3L6A A;  2WQ6 A;  2XCB A;  3D9N A;  4N5C A;  3T8M A;  2XPZ A;  4JC8 A;  3TGO A;  1UN8 A;  4K0R A;  3RU0 A;  3ZYM A;  1W3B A;  2AXZ A;  4GB9 A;  3QWV A;  2DBA A;  4JVS A;  3MCX A;  2XHE A;  4KYO B;  3SFZ A;  4FA6 A;  1SZ9 A;  3HHM A;  4EEC A;  2L0I A;  2ION A;  2AVP A;  2WXG A;  3PRZ A;  4FLH A;  4N3B A;  4GPK A;  4BFR A;  4IRU A;  3HIZ A;  4DLQ A;  4HOU A;  5FQ6 A;  4AOF A;  2DCP A;  3HVE B;  4EZK A;  2CFU A;  1HO8 A;  3G2T A;  3OTN A;  2AWI A;  4D10 C;  4EPZ A;  3G2W A;  3MKQ A;  4XIF A;  3ONL A;  3EIJ A;  3KD7 A;  4I17 A;  4U07 A;  2DIW A;  2X3M A;  2LNI A;  1SQM A;  4J8S A;  2IFU A;  3B7R L;  4AV7 A;  1HZ4 A;  4XE0 A;  1IQU A;  2GW1 A;  2XPI A;  5T3R A;  5FQ4 A;  2XRZ A;  3FTU A;  3QK0 A;  4ANW A;  5BPP A;  3OXG A;  4A55 A;  3HDX A;  4I1A A;  1ELW A;  1H2T C;  3UQ3 A;  2KM4 A;  3CKC A;  3OXL A;  3FFL A;  2IQC A;  4UQX A;  4I6G A;  3QKY A;  3OXF A;  4I43 A;  2YIN A;  5FJY A;  3CVV A;  1EF1 C;  4KVM A;  1UW4 B;  4G24 A;  1ZU2 A;  3FU6 A;  4FP7 A;  4Q96 A;  3PEU B;  5G55 A;  3AS8 A;  5FTP A;  4I1M A;  3JYS A;  2V0P A;  3EHM A;  1ELR A;  2UY1 A;  1Z3X A;  2XGM A;  4YVQ C;  3RRN B;  2WPV A;  1YA0 A;  3LJ3 A;  5AJL A;  3FTY A;  2A5U A;  1E96 B;  4U63 A;  3RO2 A;  3ZVV A;  2AXV A;  2WXP A;  4N39 A;  5DIZ A;  3FTV A;  2VGX A;  3U66 A;  2WXO A;  3PZD A;  1QNF A;  1P5Q A;  2FBN A;  2XQ0 A;  5JHB A;  2VSN A;  3EJN A;  3LY9 A;  4GZD A;  3LYA A;  2OOE A;  3Q4A B;  2NXP A;  5D0O D;  2VJ8 A;  3DBS A;  4U04 A;  4F3V A;  4OVV A;  3FUL A;  4OYS A;  1X5B A;  4I9C A;  3O48 A;  2VQ2 A;  5ENN A;  4A1G A;  3TG5 A;  1E8W A;  4EZL A;  1UN9 A;  3GW4 A;  2IF4 A;  1SZA A;  2HYZ A;  5BW8 C;  4L1B A;  4NQ0 A;  1GW6 A;  5BUZ A;  2WXR A;  3IKO B;  2WXL A;  4GU5 A;  2A4Z A;  3ULQ A;  1ELK A;  4CGV A;  4GZ6 A;  3FHE A;  1QZ2 A;  5CMW A;  5KJM A;  3BG1 B;  1NA3 A;  3UT4 A;  4W9R A;  4HOT A;  1PAQ A;  4TV3 A;  3VTY A;  4EBA A;  4FLB A;  4HFG A;  5FQ8 A;  3TG4 A;  3R7Q A;  3VLF A;  5J90 A;  4XI0 A;  2E0I A;  5D0Q D;  3FU5 A;  4KZC A;  1UJK A;  4M3O A;  3FH7 A;  2AXU A;  1E8Y A;  4BY6 A;  4WWO A;  4HOS A;  1FCH A;  3E4B A;  2VSX E;  4F53 A;  1IQR A;  3D9J A;  3LXU X;  4LEU A;  5FZS A;  2QFC A;  4DJA A;  3NZU A;  4UWK A;  4GA0 A;  3CKB A;  3FEX A;  3QC1 A;  4YND A;  5J08 A;  3ESL A;  3NF1 A;  3RIB A;  5LCW C;  4N3A A;  2MOW A;  1B89 A;  2WVI A;  3TJP A;  2CHZ A;  3R7R A;  4IN3 B;  5JJ7 A;  1E8X A;  3CK9 A;  2AW6 A;  3CVQ A;  4J8F A;  5AJD A;  1KLX A;  1TJC A;  3SHF A;  5BNW A;  1HF8 A;  4EBA G;  1EDU A;  4JL0 A;  4G26 A;  3OAW A;  3QJZ A;  3PNL B;  2X6J A;  2WMO A;  4GCN A;  1VDY A;  3ML9 A;  4P29 A;  3RJV A;  1OWL A;  3DPD A;  4PH4 B;  3C98 A;  2MRI A;  1WM5 A;  5E76 A;  4AY5 A;  3ML8 A;  4MLP A;  3CQC B;  2CG2 A;  1N54 A;  3SGH A;  3TXM A;  1NA0 A;  2X6K A;  4ILH B;  3MJW A;  2LAH A;  4UWF A;  4Q94 A;  1H19 A;  1HS6 A;  5T4Y A;  4C0M A;  4JA9 A;  3TAX A;  3K9I A;  4KMO A;  4BWR A;  4WNF A;  1IHG A;  4IUL A;  1HG5 A;  4C9B B;  5C2Y A;  2P58 C;  3CHO A;  3JQ1 A;  4WNG A;  4JHJ A;  3LCA A;  3CVY A;  5C1D A;  3FUJ A;  2J49 A;  4CEM A;  3ZW3 A;  3S7D A;  4WND A;  3UUX A;  4AJW A;  4BSX A;  5AEN A;  4B0Z A;  2FO7 A;  2R59 A;  1U3D A;  3LY7 A;  2KCL A;  2X6H A;  5AIJ A;  2CHW A;  2I6H A;  3LVR E;  3ASF A;  3LY8 A;  2XGS A;  4O6F A;  4PUC A;  1TJF A;  2QY7 A;  4RVB A;  1H2U A;  3PS6 A;  4F1S A;  3FU3 A;  4CGW A;  4AY6 A;  3CHP A;  2KZT B;  3APD A;  1XNF A;  4ILG A;  5A6C A;  5HQ8 A;  4PS8 A;  3MEK A;  4U0S A;  3CEQ A;  3FU0 A;  3Q15 A;  3BEE A;  4CT0 A;  3MKR A;  4UI9 C;  4Q69 A;  4AEZ C;  3CVW A;  5LOZ A;  4CRW A;  4H7Y A;  4JHK A;  5ARG A;  3B7U X;  3RK6 A;  4XI9 A;  4Y6W A;  4CDR A;  2JLB A;  4B8A A;  2WXI A;  3IV0 A;  2J07 A;  5ANL A;  2LSU A;  4G23 A;  4YVO A;  3SZ7 A;  3FDH A;  3FUF A;  4A3T A;  3SI5 A;  3FP3 A;  1WAO 1;  2WXF A;  3G2U A;  1H2V C;  2V5F A;  5G05 J;  4B89 A;  3FTW A;  4FJY A;  3KAE A;  3ZFW A;  1H0A A;  1KT1 A;  3NZS A;  3RRM B;  4LCT A;  2I1J A;  4G25 A;  4ANU A;  3MZL B;  5A23 A;  2VTB B;  3CIA A;  2J9Q A;  1A17 A;  3L16 A;  3LEW A;  2VSO E;  4FJZ A;  5EX3 A;  4I6E A;  2I1K A;  2J09 A;  4ATG A;  4AXH A;  4JZY A;  4UI9 K;  4HVB A;  4ME2 A;  2PM7 A;  3MKQ B;  4GAA A;  4WNE A;  5BV0 A;  4L7T A;  4A3V A;  3CVN A;  3U4T A;  4RG9 A;  3CLJ A;  4DI3 A;  3QAR A;  5G2N A;  3WXX A;  2NSZ A;  3PNT B;  3EDT B;  2WM9 A;  1HH8 A;  3QAQ A;  2ILR A;  3AS4 A;  1NP7 A;  3JUI A;  2BF0 X;  2L0T B;  1MHQ A;  3ZYK A;  4DLO A;  5E75 A;  1FVF A;  5G05 C;  3U9W A;  1OWM A;  4PS7 A;  4MS6 A;  4CDM A;  3FTZ A;  2MHK A;  2YNQ A;  3Q5M A;  4XKB A;  2XRY A;  3CSF A;  4GML A;  4ANX A;  4N3C A;  3FUH A;  5LCW J;  3O4Z A;  4J6I A;  3B13 A;  3FH5 A;  3PEV B;  3PDN A;  4TUU A;  3FWV A;  4TRQ A;  2UY1 B;  3MYV A;  3LPZ A;  4HLE A;  4KZ0 A;  3D9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...