1D9SA

Tumor suppressor p15(ink4b) structure by comparative modeling and nmr data
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
136
structure length
136
Chain Sequence
GSPGIHMLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CYCLIN-DEPENDENT KINASE 4 INHIBITOR B
publication title Tumor suppressor INK4: comparisons of conformational properties between p16(INK4A) and p18(INK4C).
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1999-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1d9sA00
2V5QC 2XEEA 3J5PA 4HBDA 4HI8A 1DC2A 4U8YD 3TWXA 5CBNA 5EYLA 2ETBA 4LNUD 1QYMA 3SO8A 4J7WA 3AJIA 5EILA 1IKND 4YDWA 3ZNGA 2BKKB 2RFAA 5CERB 5AQAA 4O1PA 5ENOD 2ETCA 4HLLA 4ZHBA 2F8YA 4F1PA 1MX4A 3W9GA 2ZGDA 1N0QA 4HQDA 5FIOA 5HS0A 4JB8P 3AAAC 3B7BA 3Q9UC 2ZGGA 5CEDB 2Y1LE 2V4HC 4CZ2D 2B0OE 4J8YA 5ENRD 1UOHA 2BKGA 2XZDG 3TWQA 4NIKA 4U95D 5AARA 3V2OA 4U96D 1K1AA 5AQ9A 4OAUC 3UTMA 4HI9A 5KBAA 2PNNA 2RFMA 5EIBE 5ENQD 1YCSB 4U8VD 1AP7A 4BSZB 3EHRA 4HNAD 3V31A 5FINA 4OAVB 1K1BA 1S70B 2P2CP 3F6QA 5KNHD 1WDYA 5AN8A 1MYOA 1SW6A 4HRMB 1NFIE 1SVXA 4GPMA 3UI2A 4YDYA 2DZOA 4HRNA 5JA4D 3JXJA 4ATZD 1IXVA 5ENTD 4BESA 3TWWA 2VGEA 5CECB 4O1OA 4LG6A 4QFVA 3V30A 3NBNB 5EYPF 4A63B 5ITZF 3C5RA 4K5AB 1BI7B 4DX7D 5BXUA 3TWRA 3DEPA 2F8XK 3EHQA 4ZFHA 4GMRA 4DX1A 4QQIA 3TWUA 1IHBA 1K3ZD 3ZKJA 4B93B 4DX5D 2A5EA 2QC9A 1N0RA 1YMPA 4O60A 3D9HA 4HRLA 5KWDA 2QYJA 4HB5A 1YYHA 2HE0A 4UUCA 3JUEA 5D66A 5HKPA 5BXOA 2NYJA 5CBOA 1MX2A 1MJ0A 3B95A 3EU9A 3ZUVB 4Z68A 1MX6A 3JXIA 4DX6D 3HG0D 1AWCB 3NOCD 4RLYA 3TWVA 3W9FA 4BETA 2F37A 5JMND 5AAOA 2ETAA 1N11A 5KNGA 4C48B 5CEAA 1WG0A 4BEPA 4DX2A 5AQ7A 3DEOA 3HRAA 4F6RD 2DVWA 2DZNA 3Q9NC 1OY3D 4DRXE 4CYMD 2L6BA 3T8KA 4G8LA 4LSZE 2KXPC 3LJNA 2Y0BG 2J8SD 2XZTG 3IXEA 3KEAA 3J5QB 4K5CA 1BD8A 3V2XA 5EIDA 3TWSA 4BERA 3TWTA 1BI8B 3T9KA 4TUMA 4G8KA 2XENA 4K5BA 3ZU7B 5AQBA 1BU9A 3UXGA 3V79K 1DCQA 2KBXA 5ENSD 5ENPD 1BLXB 1A5EA 1G3NB 2FO1E 1D9SA 2DWZA 2AJAA 2XEHA 2MYOA 5EN5D 1TR4A 3NOGD 4DUIA 1OT8A 4N5QA 5HRYA 2JABA
chains in the Genus database with same CATH superfamily
1H2VC 4G24A 5E76A 5CERB 2WQ6A 3FU0A 3ASFA 2ETCA 2IY0C 3ML9A 1TEZA 5J90A 4BWRA 1H0AA 2Y1LE 3CK8A 4ANXA 2XZDG 2F0YA 4FA6A 3UT8A 5KJNA 2V8SE 2PQNA 1NFIE 3IHYA 2E2EA 4I9CA 4OVUA 3LCAA 2VGEA 2YQ8A 4PDXA 4UQYA 5EYPF 2J4DA 3HIZA 1BI7B 3D9JA 5BXUA 4ANUA 3AG3E 1TN7A 1HH8A 2IU1A 4G23A 3D9HA 4KMOA 4HLEA 3P1UA 1JPLA 4U0ZA 3FH7A 5D66A 3ASDA 3R7QA 3WXXA 3IHVA 3VLFA 4TXPA 2AXUA 2XGSA 4RLYA 3U3WA 3LPZA 4J8SA 1W3BA 4J8EA 2IO3C 2GRRB 4IN3B 3QC1A 2IQCA 4BX9A 2AW6A 2XGMA 3AS4A 3DSVA 3OXFA 3CVXA 2OV8A 3EHNA 2X6IA 4N2SA 3UX4A 4AIFA 5T8IA 3NZSA 4TXQA 1Z5SC 1A5EA 3L9TA 5IY5E 3C98A 3SD5A 4UQXA 2AXVA 4KBQA 3UM3A 3ZN3A 4C0MA 4MRUA 4BTBA 5FIOA 3Q4AB 3KEZA 5CEDB 2QY7A 2XGOA 3C3QA 3TWQA 2IOLA 3URZA 1FCHA 1E8WA 4U63A 3SNXA 2XQ0A 4X8QA 3CSTA 3RKVA 1AP7A 2OOEA 3HXCA 3FHEA 2J49A 1KT1A 4YDYA 3FULA 4GTRA 4QFVA 3WG7E 3PZDA 2X6FA 4KT6B 1UJJA 3FP3A 4ZFHA 2UWJG 3ZYLA 2P9SG 1UG3A 2GW1A 5AIJA 1HG5A 3UM2A 4RQIA 5CBOA 2PQRA 4KVOA 3JXIA 2YHEA 1IQRA 2KC7A 4CGVA 3PEUB 3CVWA 2MHKA 3HDXA 1TNBA 3HRAA 3RSEG 3FH5A 1ELRA 3CVLA 3DRAA 4AOFA 1INZA 4A3VA 3DSSA 4GYOA 4JHKA 3BEEA 5FQ7A 4J6IA 1OWOA 1S64A 2BEDA 3PZ3A 1H6KA 4R7LA 5KJMA 4JVSA 4AP2A 4RG6A 4I6EA 2VYIA 4N3AA 2MYOA 3QAQA 5KCMA 1WM5A 3KAEA 1TJFA 4HS2A 3QDNA 4UI9C 1IKND 4N3BA 5AQAA 3L17A 2ZGDA 4K0RA 3G2TA 4CCAA 4UWHA 4I2WA 1V54E 3DPDA 4A1GA 5EKQD 1XNFA 2VJ8A 2X6JA 3Q78A 3SFXA 4FJYA 1FPPA 3CK9A 2J9QA 4U8VD 2VTBA 2IOSA 4ANVA 3AG1E 4K5AB 1SA4A 3LY8A 3CV0A 2KM4A 4DX1A 3AG2E 1D8DA 1P5QA 3EIJA 3S7BA 1TJCA 3B95A 3CQGB 2R59A 1TN8A 1FVFA 4FULA 2WXJA 4URKA 4IRUA 3NB2A 5LOZA 3KSQA 1QZ2A 2EQXA 2B6CA 4HOQA 1OWLA 4E6HA 1NI1A 5JJTA 3FTUA 2DZNA 1OY3D 4GMJA 3ML8A 5AJLA 4K03A 4PS7A 3IXEA 3KEAA 4UQZA 4GZ3A 4GZCA 4TUMA 4L2LA 2IF4A 2WXOA 4GZ6A 3UMVA 4XKCA 2L9BA 3MCXA 4HFGA 4YDEA 4HXIA 2FULA 1HFAA 3ZGQA 3ZNGA 3ASNE 4XIFA 1LTXA 4JZYA 3ABLE 2GGFA 1A17A 2BTDA 4GYWA 4KXKB 1X5BA 5AENA 4IULA 2CG3A 1RZ4A 4U0UA 4OAUC 3HVEB 1YCSB 4BSZB 2P2CP 4N5CA 5AN8A 1MYOA 4WWOA 3DBSA 3FTWA 1NL4A 3CEQA 4I1OB 4MLPA 5ITZF 2F8XK 5M72A 1RW2A 1EPUA 4BX8A 3ZVVA 4I43A 3MA5A 4PS3A 3ULYA 1MJ0A 3TG5A 4O6FA 3MKQB 3NOCD 4L7TA 1Z3XA 3O48A 5KNGA 1ELWA 4XI0A 4DX2A 4APOA 4J0UA 4B89A 3FTSA 2WMOA 5C1DA 2WXQA 1E8YA 4JEUA 3Q15A 3EDTB 3R9MA 5B1BE 2KBXA 3L6AA 1D9SA 4BT9A 4KZCA 3ULQA 1OCOE 1H6OA 4DUIA 2WPVA 2WXGA 2UY1A 4HBDA 1DC2A 5EYLA 4DK5A 4RSYA 1KT0A 1QYMA 3FU6A 5CMWA 4YDWA 4F1SA 2R02A 3U9WA 5ANLA 2LSVA 4EQFA 2GROB 2OVFA 4GTQA 2V4HC 4CZ2D 2CHWA 4J8YA 1EDUA 3CVYA 3ZHEA 4EECA 3CHSA 3QJZA 5EIBE 2I2OA 3SQVA 3Q7AA 2VQ2A 5FINA 4HOTA 5ENTD 4AEZC 1H6PA 3DPYA 3UUXA 5C2YA 4LRZA 3TWRA 4DX7D 3ZIMA 3UINC 3VTXA 3PNTB 1B89A 3U64A 4HB5A 3GZ2A 3RK6A 4EBAG 3APFA 4GTVA 1DNPA 4JHRA 3MJWA 3FUKA 1NZNA 2GRPB 2ETAA 4GCOA 1N4RA 5EX3A 4MBGA 4NURA 2DCPA 5BV0A 2I9CA 2VGYA 3MV3B 3HHMA 2IONA 3UKRG 1NA0A 4XE0A 1JCQA 5AQBA 2J08A 3DWLG 5ENPD 2FO1E 3MKRA 5ENNA 2VGXB 4FLBA 1U3CA 3LY9A 4ANWA 2BKKB 1Z6TA 4F7AA 4BSXA 2LXMA 3B7BA 1JWGA 1S0PA 2BKGA 3L22A 3E34A 4U96D 1MHQA 2ZISA 1PC2A 4ACLA 3QWWA 3C3RA 4C0EA 4GPMA 4BESA 3TWWA 4U8HA 3FU3A 2H6GA 4G11A 3CHOA 1N0RA 5LP0A 2EIKE 1JUQA 1L5JA 3JUEA 5HKPA 1MX2A 3CVVA 2L0TB 2Y4UA 2Q7FA 3EHMA 3LVRE 1ZU2A 3JQ0A 1UN8A 3T8KA 1X81A 2P9KG 2J8SD 4Q94A 3UT7A 2WVIA 2Y3AA 3T5VA 5A6CA 3B13A 5D2MC 3T8MA 3V79K 3GW4A 3FUIA 4JHJA 2LSUA 2QZAA 3PEVB 2LO6A 3N71A 4AM9A 5HRYA 3AU4A 3J5PA 3CVNA 4I6GA 5BUZA 5ENOD 2F8YA 4G25A 1N0QA 5HS0A 1TNYA 2GRMA 4CT0A 3ZYQA 4AXHA 4NIKA 2WQ7A 2WXKA 4N2QA 4HORA 3I5PA 3CGHA 2VTBB 5KBAA 2HO1A 2VGXA 5FJYA 4L2YA 2JLBA 1H2UA 1IXVA 4A55A 2CFZA 1SQMA 4GMRA 3SBTB 2R2LA 2P9PG 1YMPA 5KWDA 3TXNA 5BT1A 3EU9A 1FVHA 1OCRE 4N3CA 4I1AA 3HG0D 3ISMC 1AWCB 2OEWA 5FZRA 4C48B 1QNFA 1H2TC 3SGHA 3S2AA 3D9KA 1GW6A 4NACA 2FBNA 2NSZA 4XI9A 3DXMG 4K5CA 1BD8A 4TV3A 3QWPA 1BI8B 3T9KA 5CCMA 1DCQA 1BLXB 2WXLA 1TNUA 2R17C 2DWZA 4RVBA 4JA7A 4Y6CA 4HI8A 3R9AB 2NXPA 3MV2B 3FUJA 3AJIA 1H19A 3ZPJA 1MX4A 4GYYA 5KJKA 1EYHA 4ILHB 3SF4A 3PZ2A 2C0MA 3FTYA 3JCKC 3CQCB 1DCEA 3UTMA 3FUNA 4FLHA 3APCA 3F6QA 4ME2A 4HRNA 3TGOA 4O1OA 4DI4A 4A63B 3PRZA 2A5EA 2EILE 4MS6A 4U07A 1HO8A 2QYJA 1OWNA 2XRZA 4Z68A 4PH4B 3SFZA 1Y6IA 4Y6WA 3BG1B 4CT4A 4JD2G 5CEAA 3TG4A 5AQ7A 2LAHA 3DSUA 2DYSE 2GRLA 2OEVA 2FEZA 2XCBA 3LJNA 2Y0BG 4AY5A 3DXKG 1Y8MA 1HZ4A 3GYZA 3CKCA 2IFUA 4LEUA 5G55A 2UY1B 5FTPA 1HU3A 5FZSA 5BNWA 2XPYA 2CFUA 2XEEA 3FUDA 3TWXA 5DIZA 2ETBA 3ASOE 4J7WA 4G26A 4J8FA 3PS6A 3LY7A 2VSNA 3LS8A 3D9OA 4HQDA 4JB8P 2LAIA 3B7SA 3ZHEB 3MGBA 2B0OE 3U66A 3FTVA 3VLDA 3NAWA 4JXTA 2P58C 2JEKA 1PY1A 4WNEA 3RU0A 4WNDA 2MRIA 3FTZA 4N39A 3DSWA 3ONLA 4ATZD 4RG9A 3PE4A 2WB2A 3I3NA 3V30A 2WXPA 3I4RB 1HS6A 3EHQA 1ZB1A 1IHBA 4DX5D 3TAXA 4O60A 3TL5A 4GPKA 3D9NA 3SFYA 2PZIA 3CK7A 1MX6A 2H6HA 4XX5A 3Q7FA 2F37A 2V0PA 4AVXA 1WG0A 2WQHA 1PAQA 4AV7A 4PUCA 5JHBA 3P2BA 3MYVA 3OTNA 5EIDA 3TWSA 2OVBA 2PM6A 1YA0A 3E32A 3FH8A 3RRMB 4A1SA 1OXJA 3UPVA 1OCZE 3CSFA 3T5XA 4HOUA 3MEKA 3SO8A 4UWGA 2RFAA 3CVPA 3BUAA 4H7YA 3CIAA 4WUYA 2RD0A 3W9GA 3GZ1A 1N52A 4ABNA 3DSTA 3C3OA 3ZFWA 3G2VA 5LCWJ 4GB9A 1E8ZA 3PDNA 2FI7A 4L9PA 5AQ9A 4HI9A 4UWLA 2RFMA 2AXZA 5D0QD 3ZXSA 1K1BA 1WY6A 4M3OA 3FTXA 3ESKA 3FUFA 3PNLB 4FADA 1E7VA 4LCTA 4QQIA 4EPZA 3ZKJA 4B93B 2LUHA 2V5FA 3R7RA 2WXHA 4HRLA 4CDNA 3LDZA 2AVPA 4WNFA 1E90A 3TWVA 5JMND 3QK0A 3LYAA 1S63A 3HXDA 3UM0A 5J08A 4JPSA 2GRQB 1KPSB 3PE3A 4APFA 2HYZA 4GTMA 4LSZE 4TUUA 3FDHA 3GZSA 2XZTG 4BERA 5HQ8A 4OYSA 3ZU7B 5JHAA 5FQ6A 4LNGA 3RRNB 2R03A 3QB2A 2AJAA 1TYQG 5A7DB 4JL0A 2XPZA 5G05J 3VLEA 3FUHA 3CHQA 4ZHBA 4XEIG 1MZCA 1E7UA 4UI9K 5BW8C 1N9AA 1LD7A 2AWIA 3B7RL 3Q79A 4BY6A 3PZ4A 3RO2A 2KZTA 3BQOA 2X3MA 5EDSA 5G2NA 3CVQA 2ZIRA 1VDYA 3Q5MA 4U7EB 3CLJA 2P9NG 4UI9J 4AJWA 2YINA 5T3RA 2GRNB 5CRVA 5D0OD 3DEPA 2P9UG 3OAWA 2A5UA 1NA3A 4NQ0A 3IKOB 3PH0C 3HXEA 2NYJA 2J09A 4ILGA 4J8DA 3E37A 3W9FA 3NF1A 1QQEA 1QBQA 4L1BA 4LUNU 4YVOA 3DEOA 1Z3YA 3QNKA 3CR3A 4F6RD 1TNZA 3UT4A 3QARA 2DVWA 3EJNA 2I1JA 4DRXE 4CYMD 5A23A 3L82A 2X6HA 1DVPA 4H7XA 1N4SA 3ZEFA 2HM8A 4OVVA 2MOWA 2XEHA 3RRUA 2I1KA 1TR4A 5FZQA 3NOGD 3X2QE 3D9PA 2V5QC 3AS5A 3VTYA 1O1RA 3ONKA 3FEYA 3S7JA 4KVMA 4I17A 5ENRD 3ESLA 2VSOE 4XZ4A 2BF0X 5BV1A 1N4PA 3E33A 3AU5A 1K1AA 2PNNA 3CKBA 5ENQD 3FY4A 3Q49B 3EU5A 1KLXA 1S70B 1IHGA 3NZUA 1SVXA 1E96B 3ASHA 2VSYA 3NBNB 3JYSA 2P9LG 3IEGA 2Y69E 1K3ZD 4M7CA 4P29A 2XRYA 5LX8A 1OUVA 3ZUVB 5JJ7A 5LCWC 5BPPA 4DPRA 3FUMA 1O1TA 4TXRA 3PZ1A 2FF4A 5FQ4A 2Y4TA 3IV0A 5KJLA 2WXNA 3G2UA 4YDOA 3D9MA 4C9BB 2KCLA 4LNBA 4HOSA 4G1TA 3D9IA 3V2XA 3CHRA 3CHMA 4FP7A 2P9IG 4CDRA 5B3SE 2ONDA 3BU8A 3OXLA 1NP7A 1KZOA 1LD8A 4XKBA 5EN5D 1JWFA 3KS2A 2R05A 4LNUD 3SBSA 4GA2A 3UIOC 4F1PA 4ILIA 3KSLA 4F3VA 4YNDA 3RJVA 1UOHA 5AARA 4MKTA 3V2OA 4GZDA 5B1AE 3EUVA 3D9LA 3EHRA 3V31A 4CDMA 5KNHD 4ACKA 3TXMA 2DIWA 3UI2A 5G05C 4E85A 4V3IA 5JA4D 2IJGX 1N94A 5CECB 3IBEA 4B0ZA 5CMYA 5G04J 4D10C 2R5SA 4DJAA 1FT2A 1MQSA 2WM9A 3AG4E 4TRQA 4DLOA 4UUCA 2WXMA 3JQ1A 2WXRA 4FU3A 4GTTA 4UWFA 4CGWA 4BETA 5FQ8A 4I2ZA 2RKKA 2CHZA 4FHJA 5ARFA 1N95A 4I1MA 3Q9NC 2CG2A 4JA9A 4EHMA 4G8LA 2KXPC 2EIME 3J5QB 1IQUA 4PS8A 3BG0B 4DI3A 2FO7A 3UXGA 3QWVA 1LF8A 4NRHB 3O4ZA 3UIPC 2DBAA 5T4YA 3L08A 2LXLA 2EINE 3LXUX 1OT8A 4N5QA 3LVQE 1V55E 1U2VG 3ENEA 5CBNA 3B7TA 3PUKA 4FJZA 4CEMA 3FUEA 3S7FA 4WWNA 4YVQC 2WXFA 1ELKA 4HLLA 3QKYA 5H7PA 4EZKA 3RO3A 3B7UX 1HG2A 4JC8A 4U95D 2HR2A 4B94A 4ATGA 4L23A 3G2WA 4GTPA 4HNAD 4OAVB 5AYWD 1SW6A 4HRMB 4LERA 3JUIA 3JXJA 2DYRE 5CRUA 3LJ3A 4GZ5A 2XEVA 3ZW3A 3ZYMA 2ZXWE 2C2LA 2XS1A 1FT1A 2QFCA 1OWMA 4I9EA 5CHEE 4W9RA 3E4BA 3FWVA 4JEHA 3UM1A 3Q75A 4BT8A 1N11A 1SA5A 3CVUA 3L13A 1U3DA 3ASGA 1JCSA 3I4GA 3S7DA 4GCNA 1D8EA 3FU5A 2ZU6B 4F53A 3TWTA 4U04A 2X6KA 4G2VA 5FT9A 3Q47B 1G3NB 2BUGA 5HI7A 3DSXA 2IO2C 4GMLA 2JABA 3FEXA 4U8YD 2NC9A 3HXFA 1UJKA 2KATA 2PM7A 4WNGA 1KZPA 2KCKA 3AAAC 2EIJE 3UKUG 3Q9UC 2YHCA 3L54A 1HE8A 2L6JA 2X38A 4CRWA 2KZTB 4WWPA 3SZ7A 3PREA 3ABME 4KZ0A 4Q69A 3ZXPA 2C0LA 3CHPA 2XS8A 3APDA 2DZOA 2V4LA 2WXIA 2CHXA 5ARGA 5AJDA 3NQPA 3C5RA 4DLQA 3RAUA 3TWUA 2OCCE 4GTSA 4Q96A 1YYHA 2HE0A 3L16A 1UW4B 5BXOA 3RIBA 3ZYKA 4KYOB 4B8CB 2L0IA 4DX6D 1HF8A 4GA1A 3PUJA 1Q2ZA 4I6JA 5AAOA 3HYMB 2J07A 5ANRA 5E75A 4BEPA 3AS8A 1XGWA 4GAAA 2KCVA 3Q73A 3G2SA 3PVLA 4EZJA 2H6IA 4HVBA 5G04C 3U4TA 1EF1C 5FWQA 3UQ3A 1OCCE 5ENSD 4BTAA 3SI5A 1K8KG 1N54A 2H6FA 2XHEA 4A3TA 2XPIA 3HXBA 2RG8A 4GA0A 1SZAA 5EILA 4FC8A 1ZBPA 2XCCA 4O1PA 1O1SA 4U0SA 5CCLA 2QYUA 2ZGGA 5LFAA 1E8XA 3ZRHA 4UWKA 1UN9A 4IYPA 4GTOA 3K9IA 3SY2A 4FHKA 1SZ9A 1WDYA 1TNOA 1IYGA 3HVEA 2WMNA 1O5MA 3C72A 4WAFA 4LG6A 3TJPA 3ULEG 3EIQC 1WAO1 3D3MA 2QC9A 5JJ6A 4EZLA 5EX0A 2J4BA 3ABKE 2E0IA 4EBAA 4BFRA 3QOUA 3FFLA 1JCRA 2LNIA 3MZLB 3SHFA 2A4ZA 4GU5A 3MKQA 3E30A 1N4QA 3KD7A 5DBKA 2L6BA 2YNQA 2VSXE 2I6HA 1BPOA 3OXGA 3LKUA 1HXIA 1TN6A 4JW1A 4AY6A 4G8KA 2XENA 4K5BA 1BU9A 2IEJA 3MX3A 2ILRA 1OWPA 2PL2A 2M63A 3LEWA 1HX8A 4B8AA
chains in the Genus database with same CATH topology
2V5QC 2XEEA 3J5PA 4HBDA 4HI8A 1DC2A 4U8YD 3TWXA 5CBNA 5EYLA 2ETBA 4LNUD 1QYMA 3SO8A 4J7WA 3AJIA 5EILA 1IKND 4YDWA 3ZNGA 2BKKB 2RFAA 5CERB 5AQAA 4O1PA 5ENOD 2ETCA 4HLLA 4ZHBA 2F8YA 4F1PA 1MX4A 3W9GA 2ZGDA 1N0QA 4HQDA 5FIOA 5HS0A 4JB8P 3AAAC 3B7BA 3Q9UC 2ZGGA 5CEDB 2Y1LE 2V4HC 4CZ2D 2B0OE 4J8YA 5ENRD 1UOHA 2BKGA 2XZDG 3TWQA 4NIKA 4U95D 5AARA 3V2OA 4U96D 1K1AA 5AQ9A 4OAUC 3UTMA 4HI9A 5KBAA 2PNNA 2RFMA 5EIBE 5ENQD 1YCSB 4U8VD 1AP7A 4BSZB 3EHRA 4HNAD 3V31A 5FINA 4OAVB 1K1BA 1S70B 2P2CP 3F6QA 5KNHD 1WDYA 5AN8A 1MYOA 1SW6A 4HRMB 1NFIE 1SVXA 4GPMA 3UI2A 4YDYA 2DZOA 4HRNA 5JA4D 3JXJA 4ATZD 1IXVA 5ENTD 4BESA 3TWWA 2VGEA 5CECB 4O1OA 4LG6A 4QFVA 3V30A 3NBNB 5EYPF 4A63B 5ITZF 3C5RA 4K5AB 1BI7B 4DX7D 5BXUA 3TWRA 3DEPA 2F8XK 3EHQA 4ZFHA 4GMRA 4DX1A 4QQIA 3TWUA 1IHBA 1K3ZD 3ZKJA 4B93B 4DX5D 2A5EA 2QC9A 1N0RA 1YMPA 4O60A 3D9HA 4HRLA 5KWDA 2QYJA 4HB5A 1YYHA 2HE0A 4UUCA 3JUEA 5D66A 5HKPA 5BXOA 2NYJA 5CBOA 1MX2A 1MJ0A 3B95A 3EU9A 3ZUVB 4Z68A 1MX6A 3JXIA 4DX6D 3HG0D 1AWCB 3NOCD 4RLYA 3TWVA 3W9FA 4BETA 2F37A 5JMND 5AAOA 2ETAA 1N11A 5KNGA 4C48B 5CEAA 1WG0A 4BEPA 4DX2A 5AQ7A 3DEOA 3HRAA 4F6RD 2DVWA 2DZNA 3Q9NC 1OY3D 4DRXE 4CYMD 2L6BA 3T8KA 4G8LA 4LSZE 2KXPC 3LJNA 2Y0BG 2J8SD 2XZTG 3IXEA 3KEAA 3J5QB 4K5CA 1BD8A 3V2XA 5EIDA 3TWSA 4BERA 3TWTA 1BI8B 3T9KA 4TUMA 4G8KA 2XENA 4K5BA 3ZU7B 5AQBA 1BU9A 3UXGA 3V79K 1DCQA 2KBXA 5ENSD 5ENPD 1BLXB 1A5EA 1G3NB 2FO1E 1D9SA 2DWZA 2AJAA 2XEHA 2MYOA 5EN5D 1TR4A 3NOGD 4DUIA 1OT8A 4N5QA 5HRYA 2JABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V5Q C;  2XEE A;  3J5P A;  4HBD A;  4HI8 A;  1DC2 A;  4U8Y D;  3TWX A;  5CBN A;  5EYL A;  2ETB A;  4LNU D;  1QYM A;  3SO8 A;  4J7W A;  3AJI A;  5EIL A;  1IKN D;  4YDW A;  3ZNG A;  2BKK B;  2RFA A;  5CER B;  5AQA A;  4O1P A;  5ENO D;  2ETC A;  4HLL A;  4ZHB A;  2F8Y A;  4F1P A;  1MX4 A;  3W9G A;  2ZGD A;  1N0Q A;  4HQD A;  5FIO A;  5HS0 A;  4JB8 P;  3AAA C;  3B7B A;  3Q9U C;  2ZGG A;  5CED B;  2Y1L E;  2V4H C;  4CZ2 D;  2B0O E;  4J8Y A;  5ENR D;  1UOH A;  2BKG A;  2XZD G;  3TWQ A;  4NIK A;  4U95 D;  5AAR A;  3V2O A;  4U96 D;  1K1A A;  5AQ9 A;  4OAU C;  3UTM A;  4HI9 A;  5KBA A;  2PNN A;  2RFM A;  5EIB E;  5ENQ D;  1YCS B;  4U8V D;  1AP7 A;  4BSZ B;  3EHR A;  4HNA D;  3V31 A;  5FIN A;  4OAV B;  1K1B A;  1S70 B;  2P2C P;  3F6Q A;  5KNH D;  1WDY A;  5AN8 A;  1MYO A;  1SW6 A;  4HRM B;  1NFI E;  1SVX A;  4GPM A;  3UI2 A;  4YDY A;  2DZO A;  4HRN A;  5JA4 D;  3JXJ A;  4ATZ D;  1IXV A;  5ENT D;  4BES A;  3TWW A;  2VGE A;  5CEC B;  4O1O A;  4LG6 A;  4QFV A;  3V30 A;  3NBN B;  5EYP F;  4A63 B;  5ITZ F;  3C5R A;  4K5A B;  1BI7 B;  4DX7 D;  5BXU A;  3TWR A;  3DEP A;  2F8X K;  3EHQ A;  4ZFH A;  4GMR A;  4DX1 A;  4QQI A;  3TWU A;  1IHB A;  1K3Z D;  3ZKJ A;  4B93 B;  4DX5 D;  2A5E A;  2QC9 A;  1N0R A;  1YMP A;  4O60 A;  3D9H A;  4HRL A;  5KWD A;  2QYJ A;  4HB5 A;  1YYH A;  2HE0 A;  4UUC A;  3JUE A;  5D66 A;  5HKP A;  5BXO A;  2NYJ A;  5CBO A;  1MX2 A;  1MJ0 A;  3B95 A;  3EU9 A;  3ZUV B;  4Z68 A;  1MX6 A;  3JXI A;  4DX6 D;  3HG0 D;  1AWC B;  3NOC D;  4RLY A;  3TWV A;  3W9F A;  4BET A;  2F37 A;  5JMN D;  5AAO A;  2ETA A;  1N11 A;  5KNG A;  4C48 B;  5CEA A;  1WG0 A;  4BEP A;  4DX2 A;  5AQ7 A;  3DEO A;  3HRA A;  4F6R D;  2DVW A;  2DZN A;  3Q9N C;  1OY3 D;  4DRX E;  4CYM D;  2L6B A;  3T8K A;  4G8L A;  4LSZ E;  2KXP C;  3LJN A;  2Y0B G;  2J8S D;  2XZT G;  3IXE A;  3KEA A;  3J5Q B;  4K5C A;  1BD8 A;  3V2X A;  5EID A;  3TWS A;  4BER A;  3TWT A;  1BI8 B;  3T9K A;  4TUM A;  4G8K A;  2XEN A;  4K5B A;  3ZU7 B;  5AQB A;  1BU9 A;  3UXG A;  3V79 K;  1DCQ A;  2KBX A;  5ENS D;  5ENP D;  1BLX B;  1A5E A;  1G3N B;  2FO1 E;  1D9S A;  2DWZ A;  2AJA A;  2XEH A;  2MYO A;  5EN5 D;  1TR4 A;  3NOG D;  4DUI A;  1OT8 A;  4N5Q A;  5HRY A;  2JAB A; 
#chains in the Genus database with same CATH topology
 1H2V C;  4G24 A;  5E76 A;  5CER B;  2WQ6 A;  3FU0 A;  3ASF A;  2ETC A;  2IY0 C;  3ML9 A;  1TEZ A;  5J90 A;  4BWR A;  1H0A A;  2Y1L E;  3CK8 A;  4ANX A;  2XZD G;  2F0Y A;  4FA6 A;  3UT8 A;  5KJN A;  2V8S E;  2PQN A;  1NFI E;  3IHY A;  2E2E A;  4I9C A;  4OVU A;  3LCA A;  2VGE A;  2YQ8 A;  4PDX A;  4UQY A;  5EYP F;  2J4D A;  3HIZ A;  1BI7 B;  3D9J A;  5BXU A;  4ANU A;  3AG3 E;  1TN7 A;  1HH8 A;  2IU1 A;  4G23 A;  3D9H A;  4KMO A;  4HLE A;  3P1U A;  1JPL A;  4U0Z A;  3FH7 A;  5D66 A;  3ASD A;  3R7Q A;  3WXX A;  3IHV A;  3VLF A;  4TXP A;  2AXU A;  2XGS A;  4RLY A;  3U3W A;  3LPZ A;  4J8S A;  1W3B A;  4J8E A;  2IO3 C;  2GRR B;  4IN3 B;  3QC1 A;  2IQC A;  4BX9 A;  2AW6 A;  2XGM A;  3AS4 A;  3DSV A;  3OXF A;  3CVX A;  2OV8 A;  3EHN A;  2X6I A;  4N2S A;  3UX4 A;  4AIF A;  5T8I A;  3NZS A;  4TXQ A;  1Z5S C;  1A5E A;  3L9T A;  5IY5 E;  3C98 A;  3SD5 A;  4UQX A;  2AXV A;  4KBQ A;  3UM3 A;  3ZN3 A;  4C0M A;  4MRU A;  4BTB A;  5FIO A;  3Q4A B;  3KEZ A;  5CED B;  2QY7 A;  2XGO A;  3C3Q A;  3TWQ A;  2IOL A;  3URZ A;  1FCH A;  1E8W A;  4U63 A;  3SNX A;  2XQ0 A;  4X8Q A;  3CST A;  3RKV A;  1AP7 A;  2OOE A;  3HXC A;  3FHE A;  2J49 A;  1KT1 A;  4YDY A;  3FUL A;  4GTR A;  4QFV A;  3WG7 E;  3PZD A;  2X6F A;  4KT6 B;  1UJJ A;  3FP3 A;  4ZFH A;  2UWJ G;  3ZYL A;  2P9S G;  1UG3 A;  2GW1 A;  5AIJ A;  1HG5 A;  3UM2 A;  4RQI A;  5CBO A;  2PQR A;  4KVO A;  3JXI A;  2YHE A;  1IQR A;  2KC7 A;  4CGV A;  3PEU B;  3CVW A;  2MHK A;  3HDX A;  1TNB A;  3HRA A;  3RSE G;  3FH5 A;  1ELR A;  3CVL A;  3DRA A;  4AOF A;  1INZ A;  4A3V A;  3DSS A;  4GYO A;  4JHK A;  3BEE A;  5FQ7 A;  4J6I A;  1OWO A;  1S64 A;  2BED A;  3PZ3 A;  1H6K A;  4R7L A;  5KJM A;  4JVS A;  4AP2 A;  4RG6 A;  4I6E A;  2VYI A;  4N3A A;  2MYO A;  3QAQ A;  5KCM A;  1WM5 A;  3KAE A;  1TJF A;  4HS2 A;  3QDN A;  4UI9 C;  1IKN D;  4N3B A;  5AQA A;  3L17 A;  2ZGD A;  4K0R A;  3G2T A;  4CCA A;  4UWH A;  4I2W A;  1V54 E;  3DPD A;  4A1G A;  5EKQ D;  1XNF A;  2VJ8 A;  2X6J A;  3Q78 A;  3SFX A;  4FJY A;  1FPP A;  3CK9 A;  2J9Q A;  4U8V D;  2VTB A;  2IOS A;  4ANV A;  3AG1 E;  4K5A B;  1SA4 A;  3LY8 A;  3CV0 A;  2KM4 A;  4DX1 A;  3AG2 E;  1D8D A;  1P5Q A;  3EIJ A;  3S7B A;  1TJC A;  3B95 A;  3CQG B;  2R59 A;  1TN8 A;  1FVF A;  4FUL A;  2WXJ A;  4URK A;  4IRU A;  3NB2 A;  5LOZ A;  3KSQ A;  1QZ2 A;  2EQX A;  2B6C A;  4HOQ A;  1OWL A;  4E6H A;  1NI1 A;  5JJT A;  3FTU A;  2DZN A;  1OY3 D;  4GMJ A;  3ML8 A;  5AJL A;  4K03 A;  4PS7 A;  3IXE A;  3KEA A;  4UQZ A;  4GZ3 A;  4GZC A;  4TUM A;  4L2L A;  2IF4 A;  2WXO A;  4GZ6 A;  3UMV A;  4XKC A;  2L9B A;  3MCX A;  4HFG A;  4YDE A;  4HXI A;  2FUL A;  1HFA A;  3ZGQ A;  3ZNG A;  3ASN E;  4XIF A;  1LTX A;  4JZY A;  3ABL E;  2GGF A;  1A17 A;  2BTD A;  4GYW A;  4KXK B;  1X5B A;  5AEN A;  4IUL A;  2CG3 A;  1RZ4 A;  4U0U A;  4OAU C;  3HVE B;  1YCS B;  4BSZ B;  2P2C P;  4N5C A;  5AN8 A;  1MYO A;  4WWO A;  3DBS A;  3FTW A;  1NL4 A;  3CEQ A;  4I1O B;  4MLP A;  5ITZ F;  2F8X K;  5M72 A;  1RW2 A;  1EPU A;  4BX8 A;  3ZVV A;  4I43 A;  3MA5 A;  4PS3 A;  3ULY A;  1MJ0 A;  3TG5 A;  4O6F A;  3MKQ B;  3NOC D;  4L7T A;  1Z3X A;  3O48 A;  5KNG A;  1ELW A;  4XI0 A;  4DX2 A;  4APO A;  4J0U A;  4B89 A;  3FTS A;  2WMO A;  5C1D A;  2WXQ A;  1E8Y A;  4JEU A;  3Q15 A;  3EDT B;  3R9M A;  5B1B E;  2KBX A;  3L6A A;  1D9S A;  4BT9 A;  4KZC A;  3ULQ A;  1OCO E;  1H6O A;  4DUI A;  2WPV A;  2WXG A;  2UY1 A;  4HBD A;  1DC2 A;  5EYL A;  4DK5 A;  4RSY A;  1KT0 A;  1QYM A;  3FU6 A;  5CMW A;  4YDW A;  4F1S A;  2R02 A;  3U9W A;  5ANL A;  2LSV A;  4EQF A;  2GRO B;  2OVF A;  4GTQ A;  2V4H C;  4CZ2 D;  2CHW A;  4J8Y A;  1EDU A;  3CVY A;  3ZHE A;  4EEC A;  3CHS A;  3QJZ A;  5EIB E;  2I2O A;  3SQV A;  3Q7A A;  2VQ2 A;  5FIN A;  4HOT A;  5ENT D;  4AEZ C;  1H6P A;  3DPY A;  3UUX A;  5C2Y A;  4LRZ A;  3TWR A;  4DX7 D;  3ZIM A;  3UIN C;  3VTX A;  3PNT B;  1B89 A;  3U64 A;  4HB5 A;  3GZ2 A;  3RK6 A;  4EBA G;  3APF A;  4GTV A;  1DNP A;  4JHR A;  3MJW A;  3FUK A;  1NZN A;  2GRP B;  2ETA A;  4GCO A;  1N4R A;  5EX3 A;  4MBG A;  4NUR A;  2DCP A;  5BV0 A;  2I9C A;  2VGY A;  3MV3 B;  3HHM A;  2ION A;  3UKR G;  1NA0 A;  4XE0 A;  1JCQ A;  5AQB A;  2J08 A;  3DWL G;  5ENP D;  2FO1 E;  3MKR A;  5ENN A;  2VGX B;  4FLB A;  1U3C A;  3LY9 A;  4ANW A;  2BKK B;  1Z6T A;  4F7A A;  4BSX A;  2LXM A;  3B7B A;  1JWG A;  1S0P A;  2BKG A;  3L22 A;  3E34 A;  4U96 D;  1MHQ A;  2ZIS A;  1PC2 A;  4ACL A;  3QWW A;  3C3R A;  4C0E A;  4GPM A;  4BES A;  3TWW A;  4U8H A;  3FU3 A;  2H6G A;  4G11 A;  3CHO A;  1N0R A;  5LP0 A;  2EIK E;  1JUQ A;  1L5J A;  3JUE A;  5HKP A;  1MX2 A;  3CVV A;  2L0T B;  2Y4U A;  2Q7F A;  3EHM A;  3LVR E;  1ZU2 A;  3JQ0 A;  1UN8 A;  3T8K A;  1X81 A;  2P9K G;  2J8S D;  4Q94 A;  3UT7 A;  2WVI A;  2Y3A A;  3T5V A;  5A6C A;  3B13 A;  5D2M C;  3T8M A;  3V79 K;  3GW4 A;  3FUI A;  4JHJ A;  2LSU A;  2QZA A;  3PEV B;  2LO6 A;  3N71 A;  4AM9 A;  5HRY A;  3AU4 A;  3J5P A;  3CVN A;  4I6G A;  5BUZ A;  5ENO D;  2F8Y A;  4G25 A;  1N0Q A;  5HS0 A;  1TNY A;  2GRM A;  4CT0 A;  3ZYQ A;  4AXH A;  4NIK A;  2WQ7 A;  2WXK A;  4N2Q A;  4HOR A;  3I5P A;  3CGH A;  2VTB B;  5KBA A;  2HO1 A;  2VGX A;  5FJY A;  4L2Y A;  2JLB A;  1H2U A;  1IXV A;  4A55 A;  2CFZ A;  1SQM A;  4GMR A;  3SBT B;  2R2L A;  2P9P G;  1YMP A;  5KWD A;  3TXN A;  5BT1 A;  3EU9 A;  1FVH A;  1OCR E;  4N3C A;  4I1A A;  3HG0 D;  3ISM C;  1AWC B;  2OEW A;  5FZR A;  4C48 B;  1QNF A;  1H2T C;  3SGH A;  3S2A A;  3D9K A;  1GW6 A;  4NAC A;  2FBN A;  2NSZ A;  4XI9 A;  3DXM G;  4K5C A;  1BD8 A;  4TV3 A;  3QWP A;  1BI8 B;  3T9K A;  5CCM A;  1DCQ A;  1BLX B;  2WXL A;  1TNU A;  2R17 C;  2DWZ A;  4RVB A;  4JA7 A;  4Y6C A;  4HI8 A;  3R9A B;  2NXP A;  3MV2 B;  3FUJ A;  3AJI A;  1H19 A;  3ZPJ A;  1MX4 A;  4GYY A;  5KJK A;  1EYH A;  4ILH B;  3SF4 A;  3PZ2 A;  2C0M A;  3FTY A;  3JCK C;  3CQC B;  1DCE A;  3UTM A;  3FUN A;  4FLH A;  3APC A;  3F6Q A;  4ME2 A;  4HRN A;  3TGO A;  4O1O A;  4DI4 A;  4A63 B;  3PRZ A;  2A5E A;  2EIL E;  4MS6 A;  4U07 A;  1HO8 A;  2QYJ A;  1OWN A;  2XRZ A;  4Z68 A;  4PH4 B;  3SFZ A;  1Y6I A;  4Y6W A;  3BG1 B;  4CT4 A;  4JD2 G;  5CEA A;  3TG4 A;  5AQ7 A;  2LAH A;  3DSU A;  2DYS E;  2GRL A;  2OEV A;  2FEZ A;  2XCB A;  3LJN A;  2Y0B G;  4AY5 A;  3DXK G;  1Y8M A;  1HZ4 A;  3GYZ A;  3CKC A;  2IFU A;  4LEU A;  5G55 A;  2UY1 B;  5FTP A;  1HU3 A;  5FZS A;  5BNW A;  2XPY A;  2CFU A;  2XEE A;  3FUD A;  3TWX A;  5DIZ A;  2ETB A;  3ASO E;  4J7W A;  4G26 A;  4J8F A;  3PS6 A;  3LY7 A;  2VSN A;  3LS8 A;  3D9O A;  4HQD A;  4JB8 P;  2LAI A;  3B7S A;  3ZHE B;  3MGB A;  2B0O E;  3U66 A;  3FTV A;  3VLD A;  3NAW A;  4JXT A;  2P58 C;  2JEK A;  1PY1 A;  4WNE A;  3RU0 A;  4WND A;  2MRI A;  3FTZ A;  4N39 A;  3DSW A;  3ONL A;  4ATZ D;  4RG9 A;  3PE4 A;  2WB2 A;  3I3N A;  3V30 A;  2WXP A;  3I4R B;  1HS6 A;  3EHQ A;  1ZB1 A;  1IHB A;  4DX5 D;  3TAX A;  4O60 A;  3TL5 A;  4GPK A;  3D9N A;  3SFY A;  2PZI A;  3CK7 A;  1MX6 A;  2H6H A;  4XX5 A;  3Q7F A;  2F37 A;  2V0P A;  4AVX A;  1WG0 A;  2WQH A;  1PAQ A;  4AV7 A;  4PUC A;  5JHB A;  3P2B A;  3MYV A;  3OTN A;  5EID A;  3TWS A;  2OVB A;  2PM6 A;  1YA0 A;  3E32 A;  3FH8 A;  3RRM B;  4A1S A;  1OXJ A;  3UPV A;  1OCZ E;  3CSF A;  3T5X A;  4HOU A;  3MEK A;  3SO8 A;  4UWG A;  2RFA A;  3CVP A;  3BUA A;  4H7Y A;  3CIA A;  4WUY A;  2RD0 A;  3W9G A;  3GZ1 A;  1N52 A;  4ABN A;  3DST A;  3C3O A;  3ZFW A;  3G2V A;  5LCW J;  4GB9 A;  1E8Z A;  3PDN A;  2FI7 A;  4L9P A;  5AQ9 A;  4HI9 A;  4UWL A;  2RFM A;  2AXZ A;  5D0Q D;  3ZXS A;  1K1B A;  1WY6 A;  4M3O A;  3FTX A;  3ESK A;  3FUF A;  3PNL B;  4FAD A;  1E7V A;  4LCT A;  4QQI A;  4EPZ A;  3ZKJ A;  4B93 B;  2LUH A;  2V5F A;  3R7R A;  2WXH A;  4HRL A;  4CDN A;  3LDZ A;  2AVP A;  4WNF A;  1E90 A;  3TWV A;  5JMN D;  3QK0 A;  3LYA A;  1S63 A;  3HXD A;  3UM0 A;  5J08 A;  4JPS A;  2GRQ B;  1KPS B;  3PE3 A;  4APF A;  2HYZ A;  4GTM A;  4LSZ E;  4TUU A;  3FDH A;  3GZS A;  2XZT G;  4BER A;  5HQ8 A;  4OYS A;  3ZU7 B;  5JHA A;  5FQ6 A;  4LNG A;  3RRN B;  2R03 A;  3QB2 A;  2AJA A;  1TYQ G;  5A7D B;  4JL0 A;  2XPZ A;  5G05 J;  3VLE A;  3FUH A;  3CHQ A;  4ZHB A;  4XEI G;  1MZC A;  1E7U A;  4UI9 K;  5BW8 C;  1N9A A;  1LD7 A;  2AWI A;  3B7R L;  3Q79 A;  4BY6 A;  3PZ4 A;  3RO2 A;  2KZT A;  3BQO A;  2X3M A;  5EDS A;  5G2N A;  3CVQ A;  2ZIR A;  1VDY A;  3Q5M A;  4U7E B;  3CLJ A;  2P9N G;  4UI9 J;  4AJW A;  2YIN A;  5T3R A;  2GRN B;  5CRV A;  5D0O D;  3DEP A;  2P9U G;  3OAW A;  2A5U A;  1NA3 A;  4NQ0 A;  3IKO B;  3PH0 C;  3HXE A;  2NYJ A;  2J09 A;  4ILG A;  4J8D A;  3E37 A;  3W9F A;  3NF1 A;  1QQE A;  1QBQ A;  4L1B A;  4LUN U;  4YVO A;  3DEO A;  1Z3Y A;  3QNK A;  3CR3 A;  4F6R D;  1TNZ A;  3UT4 A;  3QAR A;  2DVW A;  3EJN A;  2I1J A;  4DRX E;  4CYM D;  5A23 A;  3L82 A;  2X6H A;  1DVP A;  4H7X A;  1N4S A;  3ZEF A;  2HM8 A;  4OVV A;  2MOW A;  2XEH A;  3RRU A;  2I1K A;  1TR4 A;  5FZQ A;  3NOG D;  3X2Q E;  3D9P A;  2V5Q C;  3AS5 A;  3VTY A;  1O1R A;  3ONK A;  3FEY A;  3S7J A;  4KVM A;  4I17 A;  5ENR D;  3ESL A;  2VSO E;  4XZ4 A;  2BF0 X;  5BV1 A;  1N4P A;  3E33 A;  3AU5 A;  1K1A A;  2PNN A;  3CKB A;  5ENQ D;  3FY4 A;  3Q49 B;  3EU5 A;  1KLX A;  1S70 B;  1IHG A;  3NZU A;  1SVX A;  1E96 B;  3ASH A;  2VSY A;  3NBN B;  3JYS A;  2P9L G;  3IEG A;  2Y69 E;  1K3Z D;  4M7C A;  4P29 A;  2XRY A;  5LX8 A;  1OUV A;  3ZUV B;  5JJ7 A;  5LCW C;  5BPP A;  4DPR A;  3FUM A;  1O1T A;  4TXR A;  3PZ1 A;  2FF4 A;  5FQ4 A;  2Y4T A;  3IV0 A;  5KJL A;  2WXN A;  3G2U A;  4YDO A;  3D9M A;  4C9B B;  2KCL A;  4LNB A;  4HOS A;  4G1T A;  3D9I A;  3V2X A;  3CHR A;  3CHM A;  4FP7 A;  2P9I G;  4CDR A;  5B3S E;  2OND A;  3BU8 A;  3OXL A;  1NP7 A;  1KZO A;  1LD8 A;  4XKB A;  5EN5 D;  1JWF A;  3KS2 A;  2R05 A;  4LNU D;  3SBS A;  4GA2 A;  3UIO C;  4F1P A;  4ILI A;  3KSL A;  4F3V A;  4YND A;  3RJV A;  1UOH A;  5AAR A;  4MKT A;  3V2O A;  4GZD A;  5B1A E;  3EUV A;  3D9L A;  3EHR A;  3V31 A;  4CDM A;  5KNH D;  4ACK A;  3TXM A;  2DIW A;  3UI2 A;  5G05 C;  4E85 A;  4V3I A;  5JA4 D;  2IJG X;  1N94 A;  5CEC B;  3IBE A;  4B0Z A;  5CMY A;  5G04 J;  4D10 C;  2R5S A;  4DJA A;  1FT2 A;  1MQS A;  2WM9 A;  3AG4 E;  4TRQ A;  4DLO A;  4UUC A;  2WXM A;  3JQ1 A;  2WXR A;  4FU3 A;  4GTT A;  4UWF A;  4CGW A;  4BET A;  5FQ8 A;  4I2Z A;  2RKK A;  2CHZ A;  4FHJ A;  5ARF A;  1N95 A;  4I1M A;  3Q9N C;  2CG2 A;  4JA9 A;  4EHM A;  4G8L A;  2KXP C;  2EIM E;  3J5Q B;  1IQU A;  4PS8 A;  3BG0 B;  4DI3 A;  2FO7 A;  3UXG A;  3QWV A;  1LF8 A;  4NRH B;  3O4Z A;  3UIP C;  2DBA A;  5T4Y A;  3L08 A;  2LXL A;  2EIN E;  3LXU X;  1OT8 A;  4N5Q A;  3LVQ E;  1V55 E;  1U2V G;  3ENE A;  5CBN A;  3B7T A;  3PUK A;  4FJZ A;  4CEM A;  3FUE A;  3S7F A;  4WWN A;  4YVQ C;  2WXF A;  1ELK A;  4HLL A;  3QKY A;  5H7P A;  4EZK A;  3RO3 A;  3B7U X;  1HG2 A;  4JC8 A;  4U95 D;  2HR2 A;  4B94 A;  4ATG A;  4L23 A;  3G2W A;  4GTP A;  4HNA D;  4OAV B;  5AYW D;  1SW6 A;  4HRM B;  4LER A;  3JUI A;  3JXJ A;  2DYR E;  5CRU A;  3LJ3 A;  4GZ5 A;  2XEV A;  3ZW3 A;  3ZYM A;  2ZXW E;  2C2L A;  2XS1 A;  1FT1 A;  2QFC A;  1OWM A;  4I9E A;  5CHE E;  4W9R A;  3E4B A;  3FWV A;  4JEH A;  3UM1 A;  3Q75 A;  4BT8 A;  1N11 A;  1SA5 A;  3CVU A;  3L13 A;  1U3D A;  3ASG A;  1JCS A;  3I4G A;  3S7D A;  4GCN A;  1D8E A;  3FU5 A;  2ZU6 B;  4F53 A;  3TWT A;  4U04 A;  2X6K A;  4G2V A;  5FT9 A;  3Q47 B;  1G3N B;  2BUG A;  5HI7 A;  3DSX A;  2IO2 C;  4GML A;  2JAB A;  3FEX A;  4U8Y D;  2NC9 A;  3HXF A;  1UJK A;  2KAT A;  2PM7 A;  4WNG A;  1KZP A;  2KCK A;  3AAA C;  2EIJ E;  3UKU G;  3Q9U C;  2YHC A;  3L54 A;  1HE8 A;  2L6J A;  2X38 A;  4CRW A;  2KZT B;  4WWP A;  3SZ7 A;  3PRE A;  3ABM E;  4KZ0 A;  4Q69 A;  3ZXP A;  2C0L A;  3CHP A;  2XS8 A;  3APD A;  2DZO A;  2V4L A;  2WXI A;  2CHX A;  5ARG A;  5AJD A;  3NQP A;  3C5R A;  4DLQ A;  3RAU A;  3TWU A;  2OCC E;  4GTS A;  4Q96 A;  1YYH A;  2HE0 A;  3L16 A;  1UW4 B;  5BXO A;  3RIB A;  3ZYK A;  4KYO B;  4B8C B;  2L0I A;  4DX6 D;  1HF8 A;  4GA1 A;  3PUJ A;  1Q2Z A;  4I6J A;  5AAO A;  3HYM B;  2J07 A;  5ANR A;  5E75 A;  4BEP A;  3AS8 A;  1XGW A;  4GAA A;  2KCV A;  3Q73 A;  3G2S A;  3PVL A;  4EZJ A;  2H6I A;  4HVB A;  5G04 C;  3U4T A;  1EF1 C;  5FWQ A;  3UQ3 A;  1OCC E;  5ENS D;  4BTA A;  3SI5 A;  1K8K G;  1N54 A;  2H6F A;  2XHE A;  4A3T A;  2XPI A;  3HXB A;  2RG8 A;  4GA0 A;  1SZA A;  5EIL A;  4FC8 A;  1ZBP A;  2XCC A;  4O1P A;  1O1S A;  4U0S A;  5CCL A;  2QYU A;  2ZGG A;  5LFA A;  1E8X A;  3ZRH A;  4UWK A;  1UN9 A;  4IYP A;  4GTO A;  3K9I A;  3SY2 A;  4FHK A;  1SZ9 A;  1WDY A;  1TNO A;  1IYG A;  3HVE A;  2WMN A;  1O5M A;  3C72 A;  4WAF A;  4LG6 A;  3TJP A;  3ULE G;  3EIQ C;  1WAO 1;  3D3M A;  2QC9 A;  5JJ6 A;  4EZL A;  5EX0 A;  2J4B A;  3ABK E;  2E0I A;  4EBA A;  4BFR A;  3QOU A;  3FFL A;  1JCR A;  2LNI A;  3MZL B;  3SHF A;  2A4Z A;  4GU5 A;  3MKQ A;  3E30 A;  1N4Q A;  3KD7 A;  5DBK A;  2L6B A;  2YNQ A;  2VSX E;  2I6H A;  1BPO A;  3OXG A;  3LKU A;  1HXI A;  1TN6 A;  4JW1 A;  4AY6 A;  4G8K A;  2XEN A;  4K5B A;  1BU9 A;  2IEJ A;  3MX3 A;  2ILR A;  1OWP A;  2PL2 A;  2M63 A;  3LEW A;  1HX8 A;  4B8A A; 
#chains in the Genus database with same CATH homology
 2V5Q C;  2XEE A;  3J5P A;  4HBD A;  4HI8 A;  1DC2 A;  4U8Y D;  3TWX A;  5CBN A;  5EYL A;  2ETB A;  4LNU D;  1QYM A;  3SO8 A;  4J7W A;  3AJI A;  5EIL A;  1IKN D;  4YDW A;  3ZNG A;  2BKK B;  2RFA A;  5CER B;  5AQA A;  4O1P A;  5ENO D;  2ETC A;  4HLL A;  4ZHB A;  2F8Y A;  4F1P A;  1MX4 A;  3W9G A;  2ZGD A;  1N0Q A;  4HQD A;  5FIO A;  5HS0 A;  4JB8 P;  3AAA C;  3B7B A;  3Q9U C;  2ZGG A;  5CED B;  2Y1L E;  2V4H C;  4CZ2 D;  2B0O E;  4J8Y A;  5ENR D;  1UOH A;  2BKG A;  2XZD G;  3TWQ A;  4NIK A;  4U95 D;  5AAR A;  3V2O A;  4U96 D;  1K1A A;  5AQ9 A;  4OAU C;  3UTM A;  4HI9 A;  5KBA A;  2PNN A;  2RFM A;  5EIB E;  5ENQ D;  1YCS B;  4U8V D;  1AP7 A;  4BSZ B;  3EHR A;  4HNA D;  3V31 A;  5FIN A;  4OAV B;  1K1B A;  1S70 B;  2P2C P;  3F6Q A;  5KNH D;  1WDY A;  5AN8 A;  1MYO A;  1SW6 A;  4HRM B;  1NFI E;  1SVX A;  4GPM A;  3UI2 A;  4YDY A;  2DZO A;  4HRN A;  5JA4 D;  3JXJ A;  4ATZ D;  1IXV A;  5ENT D;  4BES A;  3TWW A;  2VGE A;  5CEC B;  4O1O A;  4LG6 A;  4QFV A;  3V30 A;  3NBN B;  5EYP F;  4A63 B;  5ITZ F;  3C5R A;  4K5A B;  1BI7 B;  4DX7 D;  5BXU A;  3TWR A;  3DEP A;  2F8X K;  3EHQ A;  4ZFH A;  4GMR A;  4DX1 A;  4QQI A;  3TWU A;  1IHB A;  1K3Z D;  3ZKJ A;  4B93 B;  4DX5 D;  2A5E A;  2QC9 A;  1N0R A;  1YMP A;  4O60 A;  3D9H A;  4HRL A;  5KWD A;  2QYJ A;  4HB5 A;  1YYH A;  2HE0 A;  4UUC A;  3JUE A;  5D66 A;  5HKP A;  5BXO A;  2NYJ A;  5CBO A;  1MX2 A;  1MJ0 A;  3B95 A;  3EU9 A;  3ZUV B;  4Z68 A;  1MX6 A;  3JXI A;  4DX6 D;  3HG0 D;  1AWC B;  3NOC D;  4RLY A;  3TWV A;  3W9F A;  4BET A;  2F37 A;  5JMN D;  5AAO A;  2ETA A;  1N11 A;  5KNG A;  4C48 B;  5CEA A;  1WG0 A;  4BEP A;  4DX2 A;  5AQ7 A;  3DEO A;  3HRA A;  4F6R D;  2DVW A;  2DZN A;  3Q9N C;  1OY3 D;  4DRX E;  4CYM D;  2L6B A;  3T8K A;  4G8L A;  4LSZ E;  2KXP C;  3LJN A;  2Y0B G;  2J8S D;  2XZT G;  3IXE A;  3KEA A;  3J5Q B;  4K5C A;  1BD8 A;  3V2X A;  5EID A;  3TWS A;  4BER A;  3TWT A;  1BI8 B;  3T9K A;  4TUM A;  4G8K A;  2XEN A;  4K5B A;  3ZU7 B;  5AQB A;  1BU9 A;  3UXG A;  3V79 K;  1DCQ A;  2KBX A;  5ENS D;  5ENP D;  1BLX B;  1A5E A;  1G3N B;  2FO1 E;  1D9S A;  2DWZ A;  2AJA A;  2XEH A;  2MYO A;  5EN5 D;  1TR4 A;  3NOG D;  4DUI A;  1OT8 A;  4N5Q A;  5HRY A;  2JAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...