1D9SA

Tumor suppressor p15(ink4b) structure by comparative modeling and nmr data
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
136
structure length
136
Chain Sequence
GSPGIHMLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumor suppressor INK4: comparisons of conformational properties between p16(INK4A) and p18(INK4C).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords CYCLIN-DEPENDENT KINASE 4 INHIBITOR B
total genus 25
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1999-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1d9sA00
4CYMD 2F37A 3B95A 3ZU7B 4B93B 3TWXA 1MJ0A 5AAOA 3T9KA 4O60A 5KNGA 4F1PA 2F8XK 1N0QA 2XEHA 4YDYA 4RLYA 1N11A 4ZHBA 1BI7B 2AJAA 1MX4A 2NYJA 2DVWA 3SO8A 3DEPA 3UTMA 4HRLA 5AQAA 5D66A 3D9HA 4U8YD 4BERA 4HB5A 5ENRD 4DRXE 3JXIA 2XEEA 4OAVB 2XENA 4HBDA 4QQIA 4ATZD 2V5QC 4G8KA 2VGEA 2BKGA 4A63B 4BETA 3AAAC 5EIDA 1MX6A 4HI8A 4GPMA 5EILA 3HRAA 5BXOA 3IXEA 3J5QB 1A5EA 5EN5D 3TWTA 4LSZE 5EYPF 2RFAA 4HI9A 1WDYA 4NIKA 1YMPA 1K1BA 3EHRA 4U96D 4U95D 5AN8A 5FIOA 4TUMA 5ENSD 3UXGA 2KXPC 5CERB 4G8LA 5KBAA 2XZDG 1MYOA 1AP7A 4DX5D 4HRMB 4LG6A 1OY3D 3W9FA 3LJNA 4BESA 2RFMA 2L6BA 4HRNA 3TWWA 3TWUA 5CBNA 4DX6D 1BLXB 2PNNA 3F6QA 3C5RA 3ZUVB 2ETCA 4K5BA 4N5QA 5FINA 1NFIE 5KNHD 2BKKB 4YDWA 2DWZA 2ETAA 4JB8P 1IHBA 2A5EA 3V79K 3HG0D 5HS0A 3V30A 3EU9A 5BXUA 2Y1LE 4CZ2D 3NBNB 1K3ZD 4K5AB 4LNUD 3EHQA 2HE0A 5ENQD 5CBOA 5ENOD 1BI8B 5JMND 4J8YA 1TR4A 1IXVA 3AJIA 4U8VD 2Y0BG 5AQ7A 3J5PA 3UI2A 5EIBE 5AQ9A 5ENPD 4HQDA 5ENTD 3V2XA 3TWSA 1SW6A 4J7WA 2ETBA 4F6RD 2F8YA 1YYHA 3TWVA 5JA4D 4OAUC 3ZKJA 4GMRA 1D9SA 5CEDB 3NOCD 2KBXA 3T8KA 4BSZB 1QYMA 4DX7D 1BU9A 2JABA 4HNAD 1WG0A 2DZNA 4BEPA 2DZOA 3Q9UC 5CECB 2V4HC 5ITZF 1N0RA 4C48B 3W9GA 5CEAA 3ZNGA 4QFVA 3JXJA 1DCQA 2J8SD 4ZFHA 1DC2A 3NOGD 3V2OA 2QC9A 2MYOA 5KWDA 2P2CP 5EYLA 2QYJA 2XZTG 3KEAA 4Z68A 1OT8A 4O1PA 3TWQA 4DX1A 5AARA 3Q9NC 1G3NB 4DX2A 1AWCB 1S70B 2ZGGA 2B0OE 4HLLA 3TWRA 2ZGDA 4K5CA 3V31A 3DEOA 4DUIA 2FO1E 1SVXA 1MX2A 1BD8A 3B7BA 4O1OA 3JUEA 5AQBA 4UUCA 5HRYA 1K1AA 1IKND 1UOHA 5HKPA 1YCSB
chains in the Genus database with same CATH superfamily
4UQYA 3LY7A 4UQZA 1E90A 3FFLA 3UKRG 2GRRB 4DI4A 3E34A 2FF4A 2GROB 3CQCB 1JPLA 3ONKA 2XPZA 3ZIMA 3TXNA 4D10C 3HRAA 2PQRA 4FJZA 3ABLE 3IEGA 3QC1A 3EHRA 5FIOA 4CT0A 3FTZA 4HRMB 5IY5E 1QBQA 3FUJA 3GW4A 4F53A 1N4SA 3AS4A 2FULA 1ELKA 3L82A 3NBNB 3B7SA 3ZYQA 2WM9A 2XS1A 5JMND 2L9BA 4APOA 1X81A 3CEQA 3URZA 4YDEA 2ETBA 2XGMA 5ENNA 3G2VA 2Q7FA 2FI7A 2C0LA 5KCMA 5AIJA 5CEAA 5DBKA 4ZFHA 3CVXA 1H2UA 1SA4A 1S63A 3UIOC 2QFCA 5BNWA 1UJJA 3HXCA 3ZXSA 3CK8A 1K1AA 5AQBA 3MV2B 3P2BA 2F8XK 4RLYA 3ZPJA 4F7AA 5ARGA 4EECA 4G26A 2H6FA 5JJ7A 5EIDA 5CMWA 3L16A 3P1UA 3WXXA 3UQ3A 3EU5A 4U96D 3FH8A 3U4TA 1D8DA 3SY2A 3ASOE 1FCHA 2GRPB 4N3CA 4GTVA 1RZ4A 2GRNB 2XCCA 1KT1A 4PDXA 3CKBA 2XEVA 4K5BA 3GZ1A 3OXGA 1PAQA 3UT8A 2P9PG 5ENOD 1TN8A 2V8SE 4WUYA 2GW1A 4ATGA 2R02A 1SW6A 4KZ0A 4GMLA 5JA4D 2LSUA 5LP0A 4U0UA 4BSZB 4JPSA 3VLFA 4GTTA 4HNAD 3FTVA 3ZRHA 4I6EA 1OXJA 4E6HA 1TEZA 1E7UA 3D9IA 2IO3C 1DCQA 3U9WA 5LCWJ 4LNGA 1W3BA 2WB2A 4K5CA 2WXOA 3FWVA 1KZPA 1MZCA 4HOQA 5BT1A 3IHVA 1MJ0A 1TNOA 3CK9A 4TXQA 3KEZA 2WVIA 3PUKA 4H7XA 2LXMA 2EIKE 5ENRD 3O48A 1N4PA 2B6CA 4BX8A 4C9BB 2VGEA 4BETA 2IF4A 5J08A 2PL2A 3UKUG 2DCPA 4HI9A 3PVLA 1RW2A 4AEZC 2FO7A 2E0IA 1H2TC 3SZ7A 3RAUA 4GZDA 4GCNA 3RJVA 3AG1E 3C5RA 1OWOA 3FP3A 2WXHA 2P9NG 5CBOA 2EQXA 3E32A 1IXVA 4BSXA 2NXPA 3LYAA 4N5CA 5C2YA 4LNBA 3DSTA 1U2VG 3TWVA 3PE4A 3PNTB 3T8KA 4ILHB 2JABA 1NI1A 2DZNA 4G25A 4JXTA 3W9GA 3ZNGA 4FU3A 2VJ8A 2LNIA 4O1PA 2P9KG 4C0MA 3ML9A 1ELRA 1QNFA 3DEOA 1OCOE 1IYGA 5KJNA 5BW8C 2MHKA 3TXMA 4J8FA 2OOEA 1UOHA 3ASGA 3HDXA 1YA0A 2AJAA 3LDZA 3TL5A 3LY9A 3KD7A 4K03A 2NSZA 4C0EA 5JHBA 3ASNE 2VGXA 1PC2A 4L9PA 2IY0C 3ULYA 4FULA 4G8LA 3APFA 3S7FA 4WNGA 3I3NA 3TWUA 4DX6D 2KCKA 2OEWA 4N5QA 3HG0D 5BXUA 5FTPA 4KT6B 1N54A 3FUDA 4LNUD 5ENQD 1B89A 1NL4A 1TR4A 4MS6A 2KZTB 4ILGA 1UN9A 3LVQE 3NAWA 2VQ2A 3MA5A 4FA6A 3BG0B 1HFAA 1BU9A 3PE3A 5G55A 5CECB 3G2UA 4UWKA 2ZISA 1EYHA 3MJWA 2BF0X 4GPKA 5EDSA 1MHQA 5KWDA 4V3IA 4DX2A 5FQ4A 1S64A 3SGHA 2IU1A 1H6PA 4HLLA 4DLQA 3CVWA 2YINA 5T4YA 3EIQC 3MCXA 4PH4B 3CV0A 3UTMA 5HKPA 3L13A 3D9NA 4LUNU 3UM3A 2CG3A 4B93B 4UI9K 3IHYA 5AAOA 3B7UX 1U3DA 2WMNA 4A1GA 3D9HA 2EILE 2WQ6A 5FZQA 1SQMA 3L17A 4JVSA 1FT2A 1HF8A 3ZHEA 3IKOB 2R17C 4N2SA 2XQ0A 4U95D 3UXGA 4FHKA 4KVOA 3ZN3A 4L2YA 3RO3A 3W9FA 3JUIA 1P5QA 3SI5A 2IQCA 4JHRA 5A23A 3V79K 3FTUA 2VYIA 4GTRA 3CHPA 4ANXA 3RRNB 4HOTA 3FEYA 3ZYLA 4AP2A 4G23A 5G05C 3RRUA 1O1TA 1YYHA 4BX9A 2L6JA 3VTYA 1NA3A 3HXFA 5CEDB 1ZU2A 2YHCA 2A5UA 4XX5A 1Q2ZA 2X6KA 1TJFA 4I6GA 5ITZF 3VLDA 3DSVA 1KT0A 4GTOA 3RSEG 4Q69A 2R59A 3L54A 3UMVA 1UW4B 4Q94A 4UWFA 1LD8A 1O5MA 3QARA 5FZRA 4CEMA 4O1OA 3L9TA 3SBTB 4U0SA 3BU8A 5CRUA 3LVRE 3EJNA 3QDNA 1MX4A 3ZEFA 4B8CB 2XHEA 3C3OA 3SO8A 4GCOA 4TV3A 3VLEA 5ARFA 1NP7A 4H7YA 4I17A 3ULQA 3SBSA 4MKTA 2LSVA 2R05A 1UJKA 3DSSA 1BPOA 3E37A 4JC8A 1KPSB 3Q73A 4LCTA 4JD2G 5AYWD 4N2QA 4GA1A 3TAXA 4CGVA 4JA7A 3I5PA 5EX3A 4URKA 3AU5A 3Q7FA 3KS2A 3NZUA 5KJKA 3ONLA 4J8YA 1X5BA 5AQ7A 1Z3YA 1ELWA 3DRAA 5T3RA 2IO2C 2I1KA 1HZ4A 2HO1A 4ME2A 4LERA 4EPZA 4U04A 5FQ6A 4JW1A 4BTBA 1NZNA 2QC9A 2OVFA 3EUVA 4FLHA 1OT8A 5G04C 2UWJG 4XI9A 2ZGGA 3FUFA 4L23A 2EINE 4CDNA 2P58C 2KZTA 3CK7A 4G2VA 4JA9A 3O4ZA 1IKND 1TN7A 4O6FA 3D9MA 3MV3B 4F1PA 3C98A 3PRZA 1JWGA 3MKQA 1HS6A 1WAO1 1XNFA 4PUCA 2J4BA 1JCRA 3AAAC 5BXOA 3TG4A 1HX8A 5ENSD 4GZ5A 4IN3B 1A17A 3JCKC 3I4RB 3TWWA 1U3CA 5FQ8A 2XGSA 2VSYA 3DPDA 5FINA 5J90A 3HIZA 1BI8B 4WNFA 3AJIA 3PEVB 3FULA 4HQDA 2AVPA 4XIFA 3FUNA 4FP7A 1INZA 2WXRA 2OEVA 3NOCD 1PY1A 2L0TB 5D2MC 4DX7D 1KLXA 4TXPA 3PS6A 3U64A 2J8SD 4GZCA 2JEKA 3OXFA 3LKUA 3NB2A 4U8HA 3S7JA 4I1MA 4HORA 4F1SA 2XZTG 1V55E 4XE0A 3Q9NC 1Y6IA 2WXMA 1HG2A 3LS8A 5AJDA 2B0OE 1WY6A 2RD0A 3U3WA 4HOUA 3ZXPA 1LD7A 5CCLA 3K9IA 1Y8MA 1LTXA 4UI9J 4EQFA 4NQ0A 3UM1A 1BI7B 4PS3A 4ANVA 3RO2A 4IYPA 4HB5A 3FU5A 3OAWA 4HBDA 3KSQA 3AG4E 4U0ZA 4GTSA 4R7LA 1IQUA 2YNQA 1E8ZA 5EYPF 2J08A 1OWMA 2AXVA 1OUVA 3DXMG 5FJYA 1JUQA 3CVUA 1MYOA 3ENEA 4LG6A 1OY3D 2ZXWE 1HH8A 2ZIRA 4RG6A 3D9JA 3FTYA 4CRWA 1TNBA 2CFZA 3R9AB 2CHZA 2H6HA 2PNNA 2OCCE 1NFIE 4KZCA 4CZ2D 4K5AB 5FWQA 3EHQA 2HE0A 1FVFA 3TWSA 3FY4A 2XGOA 3GYZA 2GRMA 3FH5A 2KBXA 3QNKA 2WQ7A 4I2ZA 1KZOA 4YVOA 4Y6WA 5B1BE 1E7VA 4QFVA 3NQPA 3UIPC 2PQNA 4HS2A 4YVQC 5B3SE 4CCAA 2QYJA 3QWWA 5FZSA 1XGWA 1OCCE 3FHEA 4L7TA 3PZ2A 1HE8A 2GRQB 2LAHA 3TJPA 2LXLA 3L6AA 2R03A 2F37A 3N71A 4B94A 2RKKA 5HQ8A 1N0QA 2Y4TA 2XEHA 4YDYA 4ABNA 3SHFA 3ZGQA 3PH0C 2NYJA 1TN6A 2P9LG 3HVEA 4HRLA 4CGWA 2AXZA 1TNUA 3JXIA 4A63B 1MX6A 3KSLA 1NA0A 3BQOA 3DXKG 1OCZE 2R2LA 5E75A 4XKBA 4BT9A 4GAAA 4GYWA 2HYZA 4GYOA 3NZSA 3SFZA 2QY7A 4HRNA 2VSNA 5CBNA 2IOSA 3MEKA 3ZUVB 2VSXE 3MYVA 2BKKB 4YDWA 2DWZA 1WM5A 3CSTA 5FT9A 3QOUA 1EDUA 2PZIA 5JJ6A 2Y0BG 3CVYA 3CR3A 5ENTD 4JL0A 1N52A 4J7WA 4I6JA 1TYQG 4OAUC 5A6CA 2VGXB 2I6HA 3SQVA 2OVBA 2P9SG 1N0RA 4ACKA 4NURA 4G24A 4UWHA 1IHGA 1ZBPA 4J8SA 2P2CP 3S2AA 4DX1A 2DYRE 4WNDA 3T8MA 3LEWA 2CHWA 4UI9C 1VDYA 5D0QD 4DPRA 2V0PA 5JJTA 4RVBA 4J0UA 3B7BA 3U66A 3PZDA 2XRZA 3FU3A 1E96B 4K0RA 4CYMD 4BY6A 3PNLB 4U07A 4AOFA 3Q78A 2XEEA 3EDTB 4JHKA 2QZAA 4G8KA 2BKGA 3FTXA 3SD5A 2ZU6B 1K1BA 2P9UG 3DWLG 2J07A 3JYSA 2I2OA 1DVPA 3KAEA 3QWVA 3D3MA 4UQXA 3R7RA 2Y3AA 1FVHA 1N4RA 5G2NA 1OWNA 2M63A 2ETAA 5G05J 4A55A 3EU9A 2KATA 1K3ZD 3ESKA 4J8DA 3QAQA 4L1BA 2EIJE 2A4ZA 3PZ3A 1DCEA 2X6JA 3QJZA 3T5XA 4N39A 5H7PA 1QYMA 1MQSA 4PS8A 4KBQA 1WG0A 2DZOA 3CVPA 5D0OD 3OTNA 4C48B 3JXJA 5ANRA 1DC2A 3S7BA 1H2VC 3ZYKA 4OVVA 4NACA 4Z68A 3Q15A 3DSXA 2WXIA 1G3NB 2WXQA 2VSOE 3C3RA 1SVXA 2AWIA 2WXNA 3JQ0A 3MKQB 1H0AA 4BTAA 4ANUA 3B95A 4AXHA 4NRHB 3T9KA 5FQ7A 1N11A 3CKCA 5AQAA 1N95A 2HR2A 4XZ4A 4CT4A 4HI8A 3ASFA 1EPUA 3Q5MA 1YMPA 4TUMA 3PZ1A 2MOWA 4I1OB 5KBAA 2LAIA 3CHSA 3UM2A 2XPIA 3SFXA 5CMYA 3LJ3A 4RSYA 3UT4A 4FLBA 3D9LA 3CGHA 2DIWA 3X2QE 4HOSA 5ANLA 4G1TA 3J5PA 4MLPA 4M3OA 1Z5SC 4A3VA 3V2XA 3HVEB 2C0MA 2F8YA 4DLOA 1H6OA 3CSFA 3FDHA 2WXGA 1QZ2A 2BTDA 4E85A 4ANWA 3QKYA 2V4HC 3PUJA 4HFGA 1FT1A 3HXEA 2MYOA 2Y4UA 4AJWA 5EYLA 4GZ6A 3KEAA 5T8IA 1S70B 4EZLA 1JCQA 4I1AA 3Q75A 2WXFA 4GTQA 3D9PA 3AS8A 4GTPA 3ZU7B 4X8QA 1D8EA 5KNGA 1HU3A 3BEEA 1IQRA 5DIZA 4M7CA 2XENA 3C3QA 4A1SA 4F3VA 4I9EA 1Z6TA 3UINC 3MZLB 1V54E 3J5QB 4I2WA 5EN5D 4RG9A 2J49A 4AVXA 3IBEA 1H6KA 4U7EB 5AN8A 1O1RA 2J4DA 2J9QA 2VGYA 4FC8A 2KM4A 2L6BA 4L2LA 5BV0A 3ZYMA 1Z3XA 4DJAA 3AG3E 1FPPA 1IHBA 5HS0A 3L08A 3EIJA 4MBGA 4AY5A 3FTSA 3HHMA 1N9AA 3BUAA 1SZ9A 1HO8A 4B0ZA 3VTXA 1OWPA 3Q7AA 4BWRA 2KCVA 3RK6A 3LXUX 2WXKA 4TXRA 2I9CA 2P9IG 3UX4A 3FUMA 3MKRA 2WXJA 3APDA 2VTBA 1JWFA 1AWCB 4GA2A 3ABKE 3G2TA 3PEUB 2BUGA 5KJLA 2IEJA 1YCSB 3ASHA 4JEHA 3TWXA 4O60A 2WXPA 3ASDA 5BPPA 2DVWA 2I1JA 4U8YD 4LRZA 5E76A 5M72A 4OYSA 2V5QC 4IULA 5B1AE 3UT7A 3AS5A 2RFAA 1E8WA 1UN8A 1WDYA 4WWOA 2KXPC 3D9OA 4BFRA 2YHEA 4I9CA 2XZDG 2L0IA 4BESA 3LJNA 2RFMA 2J09A 2CFUA 2ETCA 4ACLA 2R5SA 4JB8P 4EBAA 2ONDA 3LPZA 4GMJA 3QB2A 4PS7A 2CG2A 5CCMA 3B13A 5CRVA 2KC7A 2LO6A 1N94A 1ZB1A 3MGBA 4JHJA 1SA5A 1QQEA 4MRUA 3ZKJA 1K8KG 1D9SA 3CIAA 3CLJA 4EHMA 2IOLA 4BEPA 4U63A 3BG1B 4FHJA 4KXKB 5LOZA 3OXLA 2X6IA 3WG7E 1E8XA 2X38A 3E30A 3TG5A 2EIME 4ILIA 2X6FA 4RQIA 4GU5A 3FEXA 4KVMA 1BD8A 3B7RL 2OV8A 4UUCA 3LCAA 2PM6A 4CDRA 2X3MA 4ZHBA 3I4GA 4OVUA 3Q4AB 4BERA 4B8AA 4DRXE 4OAVB 3Q47B 3CVNA 4ATZD 3ZFWA 3CVVA 5EILA 1A5EA 2AW6A 3FTWA 4LSZE 3ULEG 5EKQD 4APFA 2YQ8A 3CHRA 4WWPA 1AP7A 2GRLA 2IJGX 3FU6A 5BUZA 3DSWA 2XS8A 1BLXB 1JCSA 3FUKA 3F6QA 2C2LA 4Y6CA 2ILRA 4HXIA 2VTBB 4A3TA 2A5EA 3QWPA 1E8YA 3UUXA 2NC9A 4I43A 5EIBE 4XKCA 5AQ9A 5ENPD 3LY8A 3FUHA 1SZAA 3CQGB 4N3BA 5C1DA 3Q49B 5A7DB 1OCRE 4GMRA 3DPYA 3NOGD 3V2OA 3FU0A 5G04J 5AENA 1HXIA 2UY1A 3R7QA 2PM7A 3TWQA 3ZHEB 4HVBA 3Q79A 3V31A 3IV0A 4DUIA 2HM8A 4J6IA 5HRYA 1GW6A 3D9KA 4WNEA 2V4LA 3ML8A 3ESLA 2QYUA 3DBSA 4FADA 1UG3A 3B7TA 2FBNA 3DEPA 3MX3A 5CHEE 5EX0A 3SF4A 3R9MA 4Q96A 4YNDA 4GPMA 3APCA 1O1SA 3IXEA 2IONA 3QK0A 3TWTA 3FH7A 4NIKA 5CERB 4GB9A 3L22A 3CHQA 4DX5D 3EHMA 3T5VA 5BV1A 2XCBA 4IRUA 4KYOB 4N3AA 1TJCA 3AU4A 4XI0A 3V30A 4P29A 4GZ3A 2Y1LE 4AV7A 4U8VD 4AIFA 3HXBA 4G11A 4UWLA 3GZ2A 2Y69E 1HG5A 2H6IA 3JQ1A 3RRMB 4EBAG 4UWGA 4GYYA 2E2EA 2RG8A 5AJLA 3CVQA 3RKVA 5LCWC 3SNXA 3C72A 2X6HA 4EZJA 2AXUA 3PZ4A 2JLBA 2UY1B 3DSUA 5AARA 4XEIG 1LF8A 3S7DA 3TWRA 4FJYA 1L5JA 4W9RA 4YDOA 2V5FA 2LUHA 1H19A 1S0PA 4AM9A 3PDNA 3NF1A 2F0YA 3RU0A 4AY6A 4JEUA 5D66A 1N4QA 3E33A 4GA0A 4QQIA 2FEZA 3SFYA 3ABME 2GGFA 5JHAA 4B89A 3G2SA 4TRQA 3E4BA 3ISMC 3ZVVA 4J8EA 3CVLA 3ZW3A 2XRYA 3FUIA 3UPVA 3G2WA 4WAFA 5KNHD 2WPVA 1DNPA 4BT8A 4EZKA 2DBAA 3AG2E 2WQHA 3CHOA 4GTMA 3UM0A 2DYSE 2H6GA 5LX8A 5LFAA 3UI2A 4DK5A 3TGOA 3RIBA 4LEUA 2MRIA 4TUUA 4CDMA 4F6RD 2WMOA 5KJMA 2IFUA 1TNYA 4DI3A 3Q9UC 4JZYA 2CHXA 2KCLA 3HYMB 3CHMA 1TNZA 4WWNA 1OWLA 3EHNA 2BEDA 1EF1C 5HI7A 2ZGDA 4KMOA 3HXDA 2WXLA 2FO1E 1MX2A 4HLEA 3FUEA 3JUEA 3GZSA 2XPYA 3PREA
chains in the Genus database with same CATH topology
4CYMD 2F37A 3B95A 3ZU7B 4B93B 3TWXA 1MJ0A 5AAOA 3T9KA 4O60A 5KNGA 4F1PA 2F8XK 1N0QA 2XEHA 4YDYA 4RLYA 1N11A 4ZHBA 1BI7B 2AJAA 1MX4A 2NYJA 2DVWA 3SO8A 3DEPA 3UTMA 4HRLA 5AQAA 5D66A 3D9HA 4U8YD 4BERA 4HB5A 5ENRD 4DRXE 3JXIA 2XEEA 4OAVB 2XENA 4HBDA 4QQIA 4ATZD 2V5QC 4G8KA 2VGEA 2BKGA 4A63B 4BETA 3AAAC 5EIDA 1MX6A 4HI8A 4GPMA 5EILA 3HRAA 5BXOA 3IXEA 3J5QB 1A5EA 5EN5D 3TWTA 4LSZE 5EYPF 2RFAA 4HI9A 1WDYA 4NIKA 1YMPA 1K1BA 3EHRA 4U96D 4U95D 5AN8A 5FIOA 4TUMA 5ENSD 3UXGA 2KXPC 5CERB 4G8LA 5KBAA 2XZDG 1MYOA 1AP7A 4DX5D 4HRMB 4LG6A 1OY3D 3W9FA 3LJNA 4BESA 2RFMA 2L6BA 4HRNA 3TWWA 3TWUA 5CBNA 4DX6D 1BLXB 2PNNA 3F6QA 3C5RA 3ZUVB 2ETCA 4K5BA 4N5QA 5FINA 1NFIE 5KNHD 2BKKB 4YDWA 2DWZA 2ETAA 4JB8P 1IHBA 2A5EA 3V79K 3HG0D 5HS0A 3V30A 3EU9A 5BXUA 2Y1LE 4CZ2D 3NBNB 1K3ZD 4K5AB 4LNUD 3EHQA 2HE0A 5ENQD 5CBOA 5ENOD 1BI8B 5JMND 4J8YA 1TR4A 1IXVA 3AJIA 4U8VD 2Y0BG 5AQ7A 3J5PA 3UI2A 5EIBE 5AQ9A 5ENPD 4HQDA 5ENTD 3V2XA 3TWSA 1SW6A 4J7WA 2ETBA 4F6RD 2F8YA 1YYHA 3TWVA 5JA4D 4OAUC 3ZKJA 4GMRA 1D9SA 5CEDB 3NOCD 2KBXA 3T8KA 4BSZB 1QYMA 4DX7D 1BU9A 2JABA 4HNAD 1WG0A 2DZNA 4BEPA 2DZOA 3Q9UC 5CECB 2V4HC 5ITZF 1N0RA 4C48B 3W9GA 5CEAA 3ZNGA 4QFVA 3JXJA 1DCQA 2J8SD 4ZFHA 1DC2A 3NOGD 3V2OA 2QC9A 2MYOA 5KWDA 2P2CP 5EYLA 2QYJA 2XZTG 3KEAA 4Z68A 1OT8A 4O1PA 3TWQA 4DX1A 5AARA 3Q9NC 1G3NB 4DX2A 1AWCB 1S70B 2ZGGA 2B0OE 4HLLA 3TWRA 2ZGDA 4K5CA 3V31A 3DEOA 4DUIA 2FO1E 1SVXA 1MX2A 1BD8A 3B7BA 4O1OA 3JUEA 5AQBA 4UUCA 5HRYA 1K1AA 1IKND 1UOHA 5HKPA 1YCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYM D;  2F37 A;  3B95 A;  3ZU7 B;  4B93 B;  3TWX A;  1MJ0 A;  5AAO A;  3T9K A;  4O60 A;  5KNG A;  4F1P A;  2F8X K;  1N0Q A;  2XEH A;  4YDY A;  4RLY A;  1N11 A;  4ZHB A;  1BI7 B;  2AJA A;  1MX4 A;  2NYJ A;  2DVW A;  3SO8 A;  3DEP A;  3UTM A;  4HRL A;  5AQA A;  5D66 A;  3D9H A;  4U8Y D;  4BER A;  4HB5 A;  5ENR D;  4DRX E;  3JXI A;  2XEE A;  4OAV B;  2XEN A;  4HBD A;  4QQI A;  4ATZ D;  2V5Q C;  4G8K A;  2VGE A;  2BKG A;  4A63 B;  4BET A;  3AAA C;  5EID A;  1MX6 A;  4HI8 A;  4GPM A;  5EIL A;  3HRA A;  5BXO A;  3IXE A;  3J5Q B;  1A5E A;  5EN5 D;  3TWT A;  4LSZ E;  5EYP F;  2RFA A;  4HI9 A;  1WDY A;  4NIK A;  1YMP A;  1K1B A;  3EHR A;  4U96 D;  4U95 D;  5AN8 A;  5FIO A;  4TUM A;  5ENS D;  3UXG A;  2KXP C;  5CER B;  4G8L A;  5KBA A;  2XZD G;  1MYO A;  1AP7 A;  4DX5 D;  4HRM B;  4LG6 A;  1OY3 D;  3W9F A;  3LJN A;  4BES A;  2RFM A;  2L6B A;  4HRN A;  3TWW A;  3TWU A;  5CBN A;  4DX6 D;  1BLX B;  2PNN A;  3F6Q A;  3C5R A;  3ZUV B;  2ETC A;  4K5B A;  4N5Q A;  5FIN A;  1NFI E;  5KNH D;  2BKK B;  4YDW A;  2DWZ A;  2ETA A;  4JB8 P;  1IHB A;  2A5E A;  3V79 K;  3HG0 D;  5HS0 A;  3V30 A;  3EU9 A;  5BXU A;  2Y1L E;  4CZ2 D;  3NBN B;  1K3Z D;  4K5A B;  4LNU D;  3EHQ A;  2HE0 A;  5ENQ D;  5CBO A;  5ENO D;  1BI8 B;  5JMN D;  4J8Y A;  1TR4 A;  1IXV A;  3AJI A;  4U8V D;  2Y0B G;  5AQ7 A;  3J5P A;  3UI2 A;  5EIB E;  5AQ9 A;  5ENP D;  4HQD A;  5ENT D;  3V2X A;  3TWS A;  1SW6 A;  4J7W A;  2ETB A;  4F6R D;  2F8Y A;  1YYH A;  3TWV A;  5JA4 D;  4OAU C;  3ZKJ A;  4GMR A;  1D9S A;  5CED B;  3NOC D;  2KBX A;  3T8K A;  4BSZ B;  1QYM A;  4DX7 D;  1BU9 A;  2JAB A;  4HNA D;  1WG0 A;  2DZN A;  4BEP A;  2DZO A;  3Q9U C;  5CEC B;  2V4H C;  5ITZ F;  1N0R A;  4C48 B;  3W9G A;  5CEA A;  3ZNG A;  4QFV A;  3JXJ A;  1DCQ A;  2J8S D;  4ZFH A;  1DC2 A;  3NOG D;  3V2O A;  2QC9 A;  2MYO A;  5KWD A;  2P2C P;  5EYL A;  2QYJ A;  2XZT G;  3KEA A;  4Z68 A;  1OT8 A;  4O1P A;  3TWQ A;  4DX1 A;  5AAR A;  3Q9N C;  1G3N B;  4DX2 A;  1AWC B;  1S70 B;  2ZGG A;  2B0O E;  4HLL A;  3TWR A;  2ZGD A;  4K5C A;  3V31 A;  3DEO A;  4DUI A;  2FO1 E;  1SVX A;  1MX2 A;  1BD8 A;  3B7B A;  4O1O A;  3JUE A;  5AQB A;  4UUC A;  5HRY A;  1K1A A;  1IKN D;  1UOH A;  5HKP A;  1YCS B; 
#chains in the Genus database with same CATH topology
 4UQY A;  3LY7 A;  4UQZ A;  1E90 A;  3FFL A;  3UKR G;  2GRR B;  4DI4 A;  3E34 A;  2FF4 A;  2GRO B;  3CQC B;  1JPL A;  3ONK A;  2XPZ A;  3ZIM A;  3TXN A;  4D10 C;  3HRA A;  2PQR A;  4FJZ A;  3ABL E;  3IEG A;  3QC1 A;  3EHR A;  5FIO A;  4CT0 A;  3FTZ A;  4HRM B;  5IY5 E;  1QBQ A;  3FUJ A;  3GW4 A;  4F53 A;  1N4S A;  3AS4 A;  2FUL A;  1ELK A;  3L82 A;  3NBN B;  3B7S A;  3ZYQ A;  2WM9 A;  2XS1 A;  5JMN D;  2L9B A;  4APO A;  1X81 A;  3CEQ A;  3URZ A;  4YDE A;  2ETB A;  2XGM A;  5ENN A;  3G2V A;  2Q7F A;  2FI7 A;  2C0L A;  5KCM A;  5AIJ A;  5CEA A;  5DBK A;  4ZFH A;  3CVX A;  1H2U A;  1SA4 A;  1S63 A;  3UIO C;  2QFC A;  5BNW A;  1UJJ A;  3HXC A;  3ZXS A;  3CK8 A;  1K1A A;  5AQB A;  3MV2 B;  3P2B A;  2F8X K;  4RLY A;  3ZPJ A;  4F7A A;  5ARG A;  4EEC A;  4G26 A;  2H6F A;  5JJ7 A;  5EID A;  5CMW A;  3L16 A;  3P1U A;  3WXX A;  3UQ3 A;  3EU5 A;  4U96 D;  3FH8 A;  3U4T A;  1D8D A;  3SY2 A;  3ASO E;  1FCH A;  2GRP B;  4N3C A;  4GTV A;  1RZ4 A;  2GRN B;  2XCC A;  1KT1 A;  4PDX A;  3CKB A;  2XEV A;  4K5B A;  3GZ1 A;  3OXG A;  1PAQ A;  3UT8 A;  2P9P G;  5ENO D;  1TN8 A;  2V8S E;  4WUY A;  2GW1 A;  4ATG A;  2R02 A;  1SW6 A;  4KZ0 A;  4GML A;  5JA4 D;  2LSU A;  5LP0 A;  4U0U A;  4BSZ B;  4JPS A;  3VLF A;  4GTT A;  4HNA D;  3FTV A;  3ZRH A;  4I6E A;  1OXJ A;  4E6H A;  1TEZ A;  1E7U A;  3D9I A;  2IO3 C;  1DCQ A;  3U9W A;  5LCW J;  4LNG A;  1W3B A;  2WB2 A;  4K5C A;  2WXO A;  3FWV A;  1KZP A;  1MZC A;  4HOQ A;  5BT1 A;  3IHV A;  1MJ0 A;  1TNO A;  3CK9 A;  4TXQ A;  3KEZ A;  2WVI A;  3PUK A;  4H7X A;  2LXM A;  2EIK E;  5ENR D;  3O48 A;  1N4P A;  2B6C A;  4BX8 A;  4C9B B;  2VGE A;  4BET A;  2IF4 A;  5J08 A;  2PL2 A;  3UKU G;  2DCP A;  4HI9 A;  3PVL A;  1RW2 A;  4AEZ C;  2FO7 A;  2E0I A;  1H2T C;  3SZ7 A;  3RAU A;  4GZD A;  4GCN A;  3RJV A;  3AG1 E;  3C5R A;  1OWO A;  3FP3 A;  2WXH A;  2P9N G;  5CBO A;  2EQX A;  3E32 A;  1IXV A;  4BSX A;  2NXP A;  3LYA A;  4N5C A;  5C2Y A;  4LNB A;  3DST A;  1U2V G;  3TWV A;  3PE4 A;  3PNT B;  3T8K A;  4ILH B;  2JAB A;  1NI1 A;  2DZN A;  4G25 A;  4JXT A;  3W9G A;  3ZNG A;  4FU3 A;  2VJ8 A;  2LNI A;  4O1P A;  2P9K G;  4C0M A;  3ML9 A;  1ELR A;  1QNF A;  3DEO A;  1OCO E;  1IYG A;  5KJN A;  5BW8 C;  2MHK A;  3TXM A;  4J8F A;  2OOE A;  1UOH A;  3ASG A;  3HDX A;  1YA0 A;  2AJA A;  3LDZ A;  3TL5 A;  3LY9 A;  3KD7 A;  4K03 A;  2NSZ A;  4C0E A;  5JHB A;  3ASN E;  2VGX A;  1PC2 A;  4L9P A;  2IY0 C;  3ULY A;  4FUL A;  4G8L A;  3APF A;  3S7F A;  4WNG A;  3I3N A;  3TWU A;  4DX6 D;  2KCK A;  2OEW A;  4N5Q A;  3HG0 D;  5BXU A;  5FTP A;  4KT6 B;  1N54 A;  3FUD A;  4LNU D;  5ENQ D;  1B89 A;  1NL4 A;  1TR4 A;  4MS6 A;  2KZT B;  4ILG A;  1UN9 A;  3LVQ E;  3NAW A;  2VQ2 A;  3MA5 A;  4FA6 A;  3BG0 B;  1HFA A;  1BU9 A;  3PE3 A;  5G55 A;  5CEC B;  3G2U A;  4UWK A;  2ZIS A;  1EYH A;  3MJW A;  2BF0 X;  4GPK A;  5EDS A;  1MHQ A;  5KWD A;  4V3I A;  4DX2 A;  5FQ4 A;  1S64 A;  3SGH A;  2IU1 A;  1H6P A;  4HLL A;  4DLQ A;  3CVW A;  2YIN A;  5T4Y A;  3EIQ C;  3MCX A;  4PH4 B;  3CV0 A;  3UTM A;  5HKP A;  3L13 A;  3D9N A;  4LUN U;  3UM3 A;  2CG3 A;  4B93 B;  4UI9 K;  3IHY A;  5AAO A;  3B7U X;  1U3D A;  2WMN A;  4A1G A;  3D9H A;  2EIL E;  2WQ6 A;  5FZQ A;  1SQM A;  3L17 A;  4JVS A;  1FT2 A;  1HF8 A;  3ZHE A;  3IKO B;  2R17 C;  4N2S A;  2XQ0 A;  4U95 D;  3UXG A;  4FHK A;  4KVO A;  3ZN3 A;  4L2Y A;  3RO3 A;  3W9F A;  3JUI A;  1P5Q A;  3SI5 A;  2IQC A;  4JHR A;  5A23 A;  3V79 K;  3FTU A;  2VYI A;  4GTR A;  3CHP A;  4ANX A;  3RRN B;  4HOT A;  3FEY A;  3ZYL A;  4AP2 A;  4G23 A;  5G05 C;  3RRU A;  1O1T A;  1YYH A;  4BX9 A;  2L6J A;  3VTY A;  1NA3 A;  3HXF A;  5CED B;  1ZU2 A;  2YHC A;  2A5U A;  4XX5 A;  1Q2Z A;  2X6K A;  1TJF A;  4I6G A;  5ITZ F;  3VLD A;  3DSV A;  1KT0 A;  4GTO A;  3RSE G;  4Q69 A;  2R59 A;  3L54 A;  3UMV A;  1UW4 B;  4Q94 A;  4UWF A;  1LD8 A;  1O5M A;  3QAR A;  5FZR A;  4CEM A;  4O1O A;  3L9T A;  3SBT B;  4U0S A;  3BU8 A;  5CRU A;  3LVR E;  3EJN A;  3QDN A;  1MX4 A;  3ZEF A;  4B8C B;  2XHE A;  3C3O A;  3SO8 A;  4GCO A;  4TV3 A;  3VLE A;  5ARF A;  1NP7 A;  4H7Y A;  4I17 A;  3ULQ A;  3SBS A;  4MKT A;  2LSV A;  2R05 A;  1UJK A;  3DSS A;  1BPO A;  3E37 A;  4JC8 A;  1KPS B;  3Q73 A;  4LCT A;  4JD2 G;  5AYW D;  4N2Q A;  4GA1 A;  3TAX A;  4CGV A;  4JA7 A;  3I5P A;  5EX3 A;  4URK A;  3AU5 A;  3Q7F A;  3KS2 A;  3NZU A;  5KJK A;  3ONL A;  4J8Y A;  1X5B A;  5AQ7 A;  1Z3Y A;  1ELW A;  3DRA A;  5T3R A;  2IO2 C;  2I1K A;  1HZ4 A;  2HO1 A;  4ME2 A;  4LER A;  4EPZ A;  4U04 A;  5FQ6 A;  4JW1 A;  4BTB A;  1NZN A;  2QC9 A;  2OVF A;  3EUV A;  4FLH A;  1OT8 A;  5G04 C;  2UWJ G;  4XI9 A;  2ZGG A;  3FUF A;  4L23 A;  2EIN E;  4CDN A;  2P58 C;  2KZT A;  3CK7 A;  4G2V A;  4JA9 A;  3O4Z A;  1IKN D;  1TN7 A;  4O6F A;  3D9M A;  3MV3 B;  4F1P A;  3C98 A;  3PRZ A;  1JWG A;  3MKQ A;  1HS6 A;  1WAO 1;  1XNF A;  4PUC A;  2J4B A;  1JCR A;  3AAA C;  5BXO A;  3TG4 A;  1HX8 A;  5ENS D;  4GZ5 A;  4IN3 B;  1A17 A;  3JCK C;  3I4R B;  3TWW A;  1U3C A;  5FQ8 A;  2XGS A;  2VSY A;  3DPD A;  5FIN A;  5J90 A;  3HIZ A;  1BI8 B;  4WNF A;  3AJI A;  3PEV B;  3FUL A;  4HQD A;  2AVP A;  4XIF A;  3FUN A;  4FP7 A;  1INZ A;  2WXR A;  2OEV A;  3NOC D;  1PY1 A;  2L0T B;  5D2M C;  4DX7 D;  1KLX A;  4TXP A;  3PS6 A;  3U64 A;  2J8S D;  4GZC A;  2JEK A;  3OXF A;  3LKU A;  3NB2 A;  4U8H A;  3S7J A;  4I1M A;  4HOR A;  4F1S A;  2XZT G;  1V55 E;  4XE0 A;  3Q9N C;  1Y6I A;  2WXM A;  1HG2 A;  3LS8 A;  5AJD A;  2B0O E;  1WY6 A;  2RD0 A;  3U3W A;  4HOU A;  3ZXP A;  1LD7 A;  5CCL A;  3K9I A;  1Y8M A;  1LTX A;  4UI9 J;  4EQF A;  4NQ0 A;  3UM1 A;  1BI7 B;  4PS3 A;  4ANV A;  3RO2 A;  4IYP A;  4HB5 A;  3FU5 A;  3OAW A;  4HBD A;  3KSQ A;  3AG4 E;  4U0Z A;  4GTS A;  4R7L A;  1IQU A;  2YNQ A;  1E8Z A;  5EYP F;  2J08 A;  1OWM A;  2AXV A;  1OUV A;  3DXM G;  5FJY A;  1JUQ A;  3CVU A;  1MYO A;  3ENE A;  4LG6 A;  1OY3 D;  2ZXW E;  1HH8 A;  2ZIR A;  4RG6 A;  3D9J A;  3FTY A;  4CRW A;  1TNB A;  2CFZ A;  3R9A B;  2CHZ A;  2H6H A;  2PNN A;  2OCC E;  1NFI E;  4KZC A;  4CZ2 D;  4K5A B;  5FWQ A;  3EHQ A;  2HE0 A;  1FVF A;  3TWS A;  3FY4 A;  2XGO A;  3GYZ A;  2GRM A;  3FH5 A;  2KBX A;  3QNK A;  2WQ7 A;  4I2Z A;  1KZO A;  4YVO A;  4Y6W A;  5B1B E;  1E7V A;  4QFV A;  3NQP A;  3UIP C;  2PQN A;  4HS2 A;  4YVQ C;  5B3S E;  4CCA A;  2QYJ A;  3QWW A;  5FZS A;  1XGW A;  1OCC E;  3FHE A;  4L7T A;  3PZ2 A;  1HE8 A;  2GRQ B;  2LAH A;  3TJP A;  2LXL A;  3L6A A;  2R03 A;  2F37 A;  3N71 A;  4B94 A;  2RKK A;  5HQ8 A;  1N0Q A;  2Y4T A;  2XEH A;  4YDY A;  4ABN A;  3SHF A;  3ZGQ A;  3PH0 C;  2NYJ A;  1TN6 A;  2P9L G;  3HVE A;  4HRL A;  4CGW A;  2AXZ A;  1TNU A;  3JXI A;  4A63 B;  1MX6 A;  3KSL A;  1NA0 A;  3BQO A;  3DXK G;  1OCZ E;  2R2L A;  5E75 A;  4XKB A;  4BT9 A;  4GAA A;  4GYW A;  2HYZ A;  4GYO A;  3NZS A;  3SFZ A;  2QY7 A;  4HRN A;  2VSN A;  5CBN A;  2IOS A;  3MEK A;  3ZUV B;  2VSX E;  3MYV A;  2BKK B;  4YDW A;  2DWZ A;  1WM5 A;  3CST A;  5FT9 A;  3QOU A;  1EDU A;  2PZI A;  5JJ6 A;  2Y0B G;  3CVY A;  3CR3 A;  5ENT D;  4JL0 A;  1N52 A;  4J7W A;  4I6J A;  1TYQ G;  4OAU C;  5A6C A;  2VGX B;  2I6H A;  3SQV A;  2OVB A;  2P9S G;  1N0R A;  4ACK A;  4NUR A;  4G24 A;  4UWH A;  1IHG A;  1ZBP A;  4J8S A;  2P2C P;  3S2A A;  4DX1 A;  2DYR E;  4WND A;  3T8M A;  3LEW A;  2CHW A;  4UI9 C;  1VDY A;  5D0Q D;  4DPR A;  2V0P A;  5JJT A;  4RVB A;  4J0U A;  3B7B A;  3U66 A;  3PZD A;  2XRZ A;  3FU3 A;  1E96 B;  4K0R A;  4CYM D;  4BY6 A;  3PNL B;  4U07 A;  4AOF A;  3Q78 A;  2XEE A;  3EDT B;  4JHK A;  2QZA A;  4G8K A;  2BKG A;  3FTX A;  3SD5 A;  2ZU6 B;  1K1B A;  2P9U G;  3DWL G;  2J07 A;  3JYS A;  2I2O A;  1DVP A;  3KAE A;  3QWV A;  3D3M A;  4UQX A;  3R7R A;  2Y3A A;  1FVH A;  1N4R A;  5G2N A;  1OWN A;  2M63 A;  2ETA A;  5G05 J;  4A55 A;  3EU9 A;  2KAT A;  1K3Z D;  3ESK A;  4J8D A;  3QAQ A;  4L1B A;  2EIJ E;  2A4Z A;  3PZ3 A;  1DCE A;  2X6J A;  3QJZ A;  3T5X A;  4N39 A;  5H7P A;  1QYM A;  1MQS A;  4PS8 A;  4KBQ A;  1WG0 A;  2DZO A;  3CVP A;  5D0O D;  3OTN A;  4C48 B;  3JXJ A;  5ANR A;  1DC2 A;  3S7B A;  1H2V C;  3ZYK A;  4OVV A;  4NAC A;  4Z68 A;  3Q15 A;  3DSX A;  2WXI A;  1G3N B;  2WXQ A;  2VSO E;  3C3R A;  1SVX A;  2AWI A;  2WXN A;  3JQ0 A;  3MKQ B;  1H0A A;  4BTA A;  4ANU A;  3B95 A;  4AXH A;  4NRH B;  3T9K A;  5FQ7 A;  1N11 A;  3CKC A;  5AQA A;  1N95 A;  2HR2 A;  4XZ4 A;  4CT4 A;  4HI8 A;  3ASF A;  1EPU A;  3Q5M A;  1YMP A;  4TUM A;  3PZ1 A;  2MOW A;  4I1O B;  5KBA A;  2LAI A;  3CHS A;  3UM2 A;  2XPI A;  3SFX A;  5CMY A;  3LJ3 A;  4RSY A;  3UT4 A;  4FLB A;  3D9L A;  3CGH A;  2DIW A;  3X2Q E;  4HOS A;  5ANL A;  4G1T A;  3J5P A;  4MLP A;  4M3O A;  1Z5S C;  4A3V A;  3V2X A;  3HVE B;  2C0M A;  2F8Y A;  4DLO A;  1H6O A;  3CSF A;  3FDH A;  2WXG A;  1QZ2 A;  2BTD A;  4E85 A;  4ANW A;  3QKY A;  2V4H C;  3PUJ A;  4HFG A;  1FT1 A;  3HXE A;  2MYO A;  2Y4U A;  4AJW A;  5EYL A;  4GZ6 A;  3KEA A;  5T8I A;  1S70 B;  4EZL A;  1JCQ A;  4I1A A;  3Q75 A;  2WXF A;  4GTQ A;  3D9P A;  3AS8 A;  4GTP A;  3ZU7 B;  4X8Q A;  1D8E A;  5KNG A;  1HU3 A;  3BEE A;  1IQR A;  5DIZ A;  4M7C A;  2XEN A;  3C3Q A;  4A1S A;  4F3V A;  4I9E A;  1Z6T A;  3UIN C;  3MZL B;  1V54 E;  3J5Q B;  4I2W A;  5EN5 D;  4RG9 A;  2J49 A;  4AVX A;  3IBE A;  1H6K A;  4U7E B;  5AN8 A;  1O1R A;  2J4D A;  2J9Q A;  2VGY A;  4FC8 A;  2KM4 A;  2L6B A;  4L2L A;  5BV0 A;  3ZYM A;  1Z3X A;  4DJA A;  3AG3 E;  1FPP A;  1IHB A;  5HS0 A;  3L08 A;  3EIJ A;  4MBG A;  4AY5 A;  3FTS A;  3HHM A;  1N9A A;  3BUA A;  1SZ9 A;  1HO8 A;  4B0Z A;  3VTX A;  1OWP A;  3Q7A A;  4BWR A;  2KCV A;  3RK6 A;  3LXU X;  2WXK A;  4TXR A;  2I9C A;  2P9I G;  3UX4 A;  3FUM A;  3MKR A;  2WXJ A;  3APD A;  2VTB A;  1JWF A;  1AWC B;  4GA2 A;  3ABK E;  3G2T A;  3PEU B;  2BUG A;  5KJL A;  2IEJ A;  1YCS B;  3ASH A;  4JEH A;  3TWX A;  4O60 A;  2WXP A;  3ASD A;  5BPP A;  2DVW A;  2I1J A;  4U8Y D;  4LRZ A;  5E76 A;  5M72 A;  4OYS A;  2V5Q C;  4IUL A;  5B1A E;  3UT7 A;  3AS5 A;  2RFA A;  1E8W A;  1UN8 A;  1WDY A;  4WWO A;  2KXP C;  3D9O A;  4BFR A;  2YHE A;  4I9C A;  2XZD G;  2L0I A;  4BES A;  3LJN A;  2RFM A;  2J09 A;  2CFU A;  2ETC A;  4ACL A;  2R5S A;  4JB8 P;  4EBA A;  2OND A;  3LPZ A;  4GMJ A;  3QB2 A;  4PS7 A;  2CG2 A;  5CCM A;  3B13 A;  5CRV A;  2KC7 A;  2LO6 A;  1N94 A;  1ZB1 A;  3MGB A;  4JHJ A;  1SA5 A;  1QQE A;  4MRU A;  3ZKJ A;  1K8K G;  1D9S A;  3CIA A;  3CLJ A;  4EHM A;  2IOL A;  4BEP A;  4U63 A;  3BG1 B;  4FHJ A;  4KXK B;  5LOZ A;  3OXL A;  2X6I A;  3WG7 E;  1E8X A;  2X38 A;  3E30 A;  3TG5 A;  2EIM E;  4ILI A;  2X6F A;  4RQI A;  4GU5 A;  3FEX A;  4KVM A;  1BD8 A;  3B7R L;  2OV8 A;  4UUC A;  3LCA A;  2PM6 A;  4CDR A;  2X3M A;  4ZHB A;  3I4G A;  4OVU A;  3Q4A B;  4BER A;  4B8A A;  4DRX E;  4OAV B;  3Q47 B;  3CVN A;  4ATZ D;  3ZFW A;  3CVV A;  5EIL A;  1A5E A;  2AW6 A;  3FTW A;  4LSZ E;  3ULE G;  5EKQ D;  4APF A;  2YQ8 A;  3CHR A;  4WWP A;  1AP7 A;  2GRL A;  2IJG X;  3FU6 A;  5BUZ A;  3DSW A;  2XS8 A;  1BLX B;  1JCS A;  3FUK A;  3F6Q A;  2C2L A;  4Y6C A;  2ILR A;  4HXI A;  2VTB B;  4A3T A;  2A5E A;  3QWP A;  1E8Y A;  3UUX A;  2NC9 A;  4I43 A;  5EIB E;  4XKC A;  5AQ9 A;  5ENP D;  3LY8 A;  3FUH A;  1SZA A;  3CQG B;  4N3B A;  5C1D A;  3Q49 B;  5A7D B;  1OCR E;  4GMR A;  3DPY A;  3NOG D;  3V2O A;  3FU0 A;  5G04 J;  5AEN A;  1HXI A;  2UY1 A;  3R7Q A;  2PM7 A;  3TWQ A;  3ZHE B;  4HVB A;  3Q79 A;  3V31 A;  3IV0 A;  4DUI A;  2HM8 A;  4J6I A;  5HRY A;  1GW6 A;  3D9K A;  4WNE A;  2V4L A;  3ML8 A;  3ESL A;  2QYU A;  3DBS A;  4FAD A;  1UG3 A;  3B7T A;  2FBN A;  3DEP A;  3MX3 A;  5CHE E;  5EX0 A;  3SF4 A;  3R9M A;  4Q96 A;  4YND A;  4GPM A;  3APC A;  1O1S A;  3IXE A;  2ION A;  3QK0 A;  3TWT A;  3FH7 A;  4NIK A;  5CER B;  4GB9 A;  3L22 A;  3CHQ A;  4DX5 D;  3EHM A;  3T5V A;  5BV1 A;  2XCB A;  4IRU A;  4KYO B;  4N3A A;  1TJC A;  3AU4 A;  4XI0 A;  3V30 A;  4P29 A;  4GZ3 A;  2Y1L E;  4AV7 A;  4U8V D;  4AIF A;  3HXB A;  4G11 A;  4UWL A;  3GZ2 A;  2Y69 E;  1HG5 A;  2H6I A;  3JQ1 A;  3RRM B;  4EBA G;  4UWG A;  4GYY A;  2E2E A;  2RG8 A;  5AJL A;  3CVQ A;  3RKV A;  5LCW C;  3SNX A;  3C72 A;  2X6H A;  4EZJ A;  2AXU A;  3PZ4 A;  2JLB A;  2UY1 B;  3DSU A;  5AAR A;  4XEI G;  1LF8 A;  3S7D A;  3TWR A;  4FJY A;  1L5J A;  4W9R A;  4YDO A;  2V5F A;  2LUH A;  1H19 A;  1S0P A;  4AM9 A;  3PDN A;  3NF1 A;  2F0Y A;  3RU0 A;  4AY6 A;  4JEU A;  5D66 A;  1N4Q A;  3E33 A;  4GA0 A;  4QQI A;  2FEZ A;  3SFY A;  3ABM E;  2GGF A;  5JHA A;  4B89 A;  3G2S A;  4TRQ A;  3E4B A;  3ISM C;  3ZVV A;  4J8E A;  3CVL A;  3ZW3 A;  2XRY A;  3FUI A;  3UPV A;  3G2W A;  4WAF A;  5KNH D;  2WPV A;  1DNP A;  4BT8 A;  4EZK A;  2DBA A;  3AG2 E;  2WQH A;  3CHO A;  4GTM A;  3UM0 A;  2DYS E;  2H6G A;  5LX8 A;  5LFA A;  3UI2 A;  4DK5 A;  3TGO A;  3RIB A;  4LEU A;  2MRI A;  4TUU A;  4CDM A;  4F6R D;  2WMO A;  5KJM A;  2IFU A;  1TNY A;  4DI3 A;  3Q9U C;  4JZY A;  2CHX A;  2KCL A;  3HYM B;  3CHM A;  1TNZ A;  4WWN A;  1OWL A;  3EHN A;  2BED A;  1EF1 C;  5HI7 A;  2ZGD A;  4KMO A;  3HXD A;  2WXL A;  2FO1 E;  1MX2 A;  4HLE A;  3FUE A;  3JUE A;  3GZS A;  2XPY A;  3PRE A; 
#chains in the Genus database with same CATH homology
 4CYM D;  2F37 A;  3B95 A;  3ZU7 B;  4B93 B;  3TWX A;  1MJ0 A;  5AAO A;  3T9K A;  4O60 A;  5KNG A;  4F1P A;  2F8X K;  1N0Q A;  2XEH A;  4YDY A;  4RLY A;  1N11 A;  4ZHB A;  1BI7 B;  2AJA A;  1MX4 A;  2NYJ A;  2DVW A;  3SO8 A;  3DEP A;  3UTM A;  4HRL A;  5AQA A;  5D66 A;  3D9H A;  4U8Y D;  4BER A;  4HB5 A;  5ENR D;  4DRX E;  3JXI A;  2XEE A;  4OAV B;  2XEN A;  4HBD A;  4QQI A;  4ATZ D;  2V5Q C;  4G8K A;  2VGE A;  2BKG A;  4A63 B;  4BET A;  3AAA C;  5EID A;  1MX6 A;  4HI8 A;  4GPM A;  5EIL A;  3HRA A;  5BXO A;  3IXE A;  3J5Q B;  1A5E A;  5EN5 D;  3TWT A;  4LSZ E;  5EYP F;  2RFA A;  4HI9 A;  1WDY A;  4NIK A;  1YMP A;  1K1B A;  3EHR A;  4U96 D;  4U95 D;  5AN8 A;  5FIO A;  4TUM A;  5ENS D;  3UXG A;  2KXP C;  5CER B;  4G8L A;  5KBA A;  2XZD G;  1MYO A;  1AP7 A;  4DX5 D;  4HRM B;  4LG6 A;  1OY3 D;  3W9F A;  3LJN A;  4BES A;  2RFM A;  2L6B A;  4HRN A;  3TWW A;  3TWU A;  5CBN A;  4DX6 D;  1BLX B;  2PNN A;  3F6Q A;  3C5R A;  3ZUV B;  2ETC A;  4K5B A;  4N5Q A;  5FIN A;  1NFI E;  5KNH D;  2BKK B;  4YDW A;  2DWZ A;  2ETA A;  4JB8 P;  1IHB A;  2A5E A;  3V79 K;  3HG0 D;  5HS0 A;  3V30 A;  3EU9 A;  5BXU A;  2Y1L E;  4CZ2 D;  3NBN B;  1K3Z D;  4K5A B;  4LNU D;  3EHQ A;  2HE0 A;  5ENQ D;  5CBO A;  5ENO D;  1BI8 B;  5JMN D;  4J8Y A;  1TR4 A;  1IXV A;  3AJI A;  4U8V D;  2Y0B G;  5AQ7 A;  3J5P A;  3UI2 A;  5EIB E;  5AQ9 A;  5ENP D;  4HQD A;  5ENT D;  3V2X A;  3TWS A;  1SW6 A;  4J7W A;  2ETB A;  4F6R D;  2F8Y A;  1YYH A;  3TWV A;  5JA4 D;  4OAU C;  3ZKJ A;  4GMR A;  1D9S A;  5CED B;  3NOC D;  2KBX A;  3T8K A;  4BSZ B;  1QYM A;  4DX7 D;  1BU9 A;  2JAB A;  4HNA D;  1WG0 A;  2DZN A;  4BEP A;  2DZO A;  3Q9U C;  5CEC B;  2V4H C;  5ITZ F;  1N0R A;  4C48 B;  3W9G A;  5CEA A;  3ZNG A;  4QFV A;  3JXJ A;  1DCQ A;  2J8S D;  4ZFH A;  1DC2 A;  3NOG D;  3V2O A;  2QC9 A;  2MYO A;  5KWD A;  2P2C P;  5EYL A;  2QYJ A;  2XZT G;  3KEA A;  4Z68 A;  1OT8 A;  4O1P A;  3TWQ A;  4DX1 A;  5AAR A;  3Q9N C;  1G3N B;  4DX2 A;  1AWC B;  1S70 B;  2ZGG A;  2B0O E;  4HLL A;  3TWR A;  2ZGD A;  4K5C A;  3V31 A;  3DEO A;  4DUI A;  2FO1 E;  1SVX A;  1MX2 A;  1BD8 A;  3B7B A;  4O1O A;  3JUE A;  5AQB A;  4UUC A;  5HRY A;  1K1A A;  1IKN D;  1UOH A;  5HKP A;  1YCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...