1D9SA

Tumor suppressor p15(ink4b) structure by comparative modeling and nmr data
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
136
structure length
136
Chain Sequence
b'GSPGIHMLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 4 INHIBITOR B
publication title Tumor suppressor INK4: comparisons of conformational properties between p16(INK4A) and p18(INK4C).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 25
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1999-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1d9sA00
5ENOD 5BXOA 3TWUA 2XZTG 5KWDA 5AQBA 4HRLA 3TWSA 4DX2A 5AARA 2DWZA 3TWQA 2F8XK 4HI9A 4BEPA 1OT8A 4HI8A 4ATZD 2ZGGA 4DX5D 1N0QA 4YDWA 5EYPF 3UXGA 1OY3D 4BETA 2RFAA 3HRAA 2FO1E 1YMPA 1WDYA 5HRYA 3B7BA 4DX6D 2XZDG 3Q9NC 3W9GA 2DVWA 2NYJA 4U95D 5FINA 4G8KA 3JXJA 3KEAA 4ZHBA 4HLLA 4O1OA 5EN5D 5AN8A 5JMND 1A5EA 1BI8B 1MYOA 2JABA 2DZNA 5AAOA 5KBAA 2PNNA 3DEOA 5ENQD 2BKKB 3T8KA 4UUCA 5KNHD 5ENRD 4QFVA 1MX4A 3UI2A 3J5QB 2P2CP 1QYMA 1DC2A 1DCQA 1AP7A 4OAUC 4BERA 3IXEA 4HRMB 1G3NB 4U8YD 3TWTA 5EIBE 5AQ7A 2KXPC 4HQDA 1MX6A 1D9SA 1TR4A 4HB5A 5CECB 5HS0A 4BSZB 3NBNB 3C5RA 3TWVA 1K3ZD 4U8VD 3UTMA 3V31A 4HNAD 4O60A 3HG0D 4Z68A 2Y1LE 2XEHA 3D9HA 4HRNA 3TWWA 4YDYA 5AQ9A 1AWCB 4DUIA 5CBOA 1WG0A 2XENA 3JUEA 4O1PA 4GMRA 4DRXE 4F1PA 1SVXA 4K5CA 2QYJA 3EHQA 1S70B 5HKPA 4DX1A 3Q9UC 5EYLA 2J8SD 2B0OE 5CBNA 1BU9A 5FIOA 3LJNA 2ETAA 2Y0BG 1NFIE 3DEPA 2VGEA 4TUMA 5ENTD 2QC9A 5KNGA 1K1AA 2HE0A 4NIKA 1IXVA 4CYMD 1SW6A 3EU9A 3NOGD 2V4HC 4CZ2D 5JA4D 5ITZF 1N11A 3V79K 4ZFHA 4K5AB 5AQAA 3TWXA 2DZOA 1MX2A 3EHRA 5BXUA 3ZUVB 3J5PA 5CEAA 2XEEA 2MYOA 4J8YA 2BKGA 3T9KA 1IHBA 1BI7B 2AJAA 1K1BA 4GPMA 2A5EA 3ZKJA 3V30A 1YCSB 3V2XA 3ZU7B 5CERB 2RFMA 3V2OA 4G8LA 3TWRA 3NOCD 4RLYA 2KBXA 4U96D 4K5BA 5ENPD 1UOHA 4LSZE 3SO8A 2V5QC 1BD8A 2L6BA 2F37A 3W9FA 4B93B 4OAVB 3ZNGA 5EIDA 4A63B 3AJIA 1BLXB 2ETCA 4LNUD 5EILA 3B95A 3JXIA 4N5QA 4QQIA 5ENSD 4BESA 4HBDA 2ZGDA 1MJ0A 1YYHA 1IKND 4JB8P 4LG6A 5D66A 4C48B 1N0RA 5CEDB 4J7WA 3F6QA 4DX7D 3AAAC 2F8YA 4F6RD 2ETBA
chains in the Genus database with same CATH superfamily
5AQBA 2B6CA 1TNBA 3KSLA 3BQOA 2ZGGA 4PDXA 1IQUA 1WDYA 3ASDA 4DI4A 4E85A 5ARGA 3SFXA 4GTVA 3PE4A 2P9NG 5EN5D 2AW6A 3URZA 4UI9K 2JABA 2OCCE 3ZFWA 2WQHA 2OV8A 4GCNA 1O1TA 5FWQA 1DC2A 1AP7A 3N71A 3FU5A 4I1MA 5JHAA 4UQZA 4KT6B 2F0YA 1N4QA 4Z68A 1KT1A 3S7BA 3EHMA 5HKPA 1OWOA 1U3DA 1BU9A 5FIOA 4APOA 1JCQA 2QC9A 2IQCA 1TNOA 4U0SA 5KJLA 2WQ7A 2XGOA 1MX2A 5C2YA 5D0QD 3PNTB 2LNIA 3AG1E 3V2OA 3QARA 1SZ9A 5G05J 4TXRA 5JJ7A 4GTQA 1A17A 2QZAA 3U9WA 1BD8A 1NL4A 3FUNA 4ANVA 3UM1A 5JJ6A 1OWPA 2V5FA 4ILGA 2PZIA 1NP7A 3DPDA 4GZDA 5AENA 2I1JA 4XKCA 2X3MA 1O1SA 5ENOD 1YA0A 5A7DB 3D9IA 4GYYA 3TG5A 4BEPA 4J8SA 2LSUA 1S64A 4BFRA 1OWNA 1N0QA 2RFAA 2Q7FA 1YMPA 5HRYA 1TN8A 3KAEA 2BEDA 4JD2G 3ISMC 3LKUA 4G8KA 3G2SA 5HQ8A 5KBAA 3D9MA 3S7DA 4NQ0A 3D9JA 3FTVA 5ENRD 3UQ3A 3MGBA 5KJNA 3FUIA 3FDHA 1O5MA 1UJKA 4KYOB 3QAQA 4ACKA 3FUEA 3Q7FA 3JUIA 1EF1C 1HS6A 4YDOA 4ILIA 1N4SA 3HXDA 3ZYKA 3ABME 3RO3A 1UW4B 2IF4A 2FEZA 4O6FA 3DXKG 5KJKA 3KD7A 1SA4A 2PL2A 2WMOA 4B89A 2XEEA 3NZSA 4J8YA 3R9MA 3SGHA 5BV0A 3DWLG 3D9PA 5B1AE 3PZDA 4BSXA 1GW6A 3MYVA 2XGSA 4B8CB 2XPIA 3RKVA 4C0EA 3L13A 3QB2A 3CIAA 4N3CA 2F8YA 2VQ2A 2OEVA 2DWZA 2WPVA 1TEZA 3UM3A 1OCCE 1H6KA 3RRUA 2IJGX 3QK0A 1LTXA 4W9RA 2P2CP 3VTYA 3Q75A 3UIPC 2WXKA 4BERA 1JWGA 3D3MA 2X38A 1HG5A 3QNKA 5CECB 3RAUA 3OXGA 2OOEA 3FU6A 3TWWA 4YDYA 3LEWA 3FFLA 5CBOA 5LCWJ 2WXPA 3GZ2A 3EIJA 3Q15A 4HOUA 3RSEG 4DX1A 3CLJA 1Z5SC 5CCLA 2B0OE 5B1BE 2YNQA 3FUJA 3LJNA 1NFIE 4TXQA 1IXVA 2V4HC 1N11A 1Z3XA 4K5AB 1E7UA 2DZOA 2L9BA 2WXMA 4U07A 4FP7A 2GRNB 4Y6CA 4B93B 4A55A 4FLBA 4GZ6A 4XEIG 4MBGA 3QKYA 4FHKA 4LG6A 3UT7A 5CRUA 1Y6IA 4U0ZA 5LCWC 3Q79A 4L23A 3ZYMA 3OAWA 2ILRA 4URKA 3JQ0A 3VLEA 5BUZA 2WMNA 3Q9NC 4J6IA 4JL0A 5FINA 2RG8A 1QZ2A 2X6KA 2QYUA 4RVBA 3ZN3A 3TAXA 3JYSA 2FBNA 5LOZA 3J5QB 3ASGA 3C72A 3BEEA 4OAUC 3HVEA 5T8IA 1L5JA 4AIFA 3ZEFA 5LP0A 1XGWA 4WUYA 3RRNB 3O4ZA 3HG0D 5G55A 1ELRA 4DUIA 2J4BA 4K5CA 4A1SA 2PQNA 3QDNA 2WXFA 1H19A 3RU0A 3IEGA 2J4DA 2H6GA 5DBKA 5AQAA 3I5PA 2BKGA 3QC1A 5ARFA 3L22A 1N54A 3HVEB 3VLFA 4HOTA 1H6OA 4EZLA 2AXZA 3NAWA 4LUNU 3ULEG 3ULQA 3KSQA 1N4RA 5EX3A 1XNFA 3CHRA 3VLDA 2J07A 2GRPB 3LCAA 3LY8A 4A3VA 1V54E 3LJ3A 2I9CA 2WXOA 2C0LA 4TUUA 2IFUA 4BY6A 4G26A 3UXGA 3UM0A 3APDA 4PH4B 3UX4A 3SBTB 3BUAA 1LD7A 4N3AA 4HLLA 1Y8MA 2XCBA 2GGFA 2NC9A 2IU1A 3AS4A 1OWMA 4XX5A 2JLBA 4GPKA 5CMWA 3ASFA 2YQ8A 4HNAD 4B0ZA 4JA9A 1OUVA 5FQ4A 1SVXA 1W3BA 3ESKA 4LCTA 2CHWA 3LS8A 4NACA 1KLXA 1KZPA 4AEZC 2WXRA 3NOGD 5FTPA 5LX8A 4YVQC 4L7TA 1E8YA 3PS6A 3SQVA 4ATGA 3G2VA 3CV0A 3FH7A 4G8LA 4RLYA 1NA3A 4MLPA 3PDNA 2KZTA 2EILE 4OVVA 2V8SE 3K9IA 1BLXB 2ETCA 4G23A 5ENSD 2WXNA 3JQ1A 3FU3A 2I6HA 3FHEA 5CEDB 3CKCA 1H2TC 4TV3A 4HVBA 3BG0B 4UWLA 4ANXA 2Y4TA 3E32A 4DX5D 1HU3A 1TNZA 1OY3D 3FUMA 3HRAA 5AJDA 3GYZA 5BPPA 3TJPA 3ASHA 3SI5A 1PY1A 3WG7E 5AIJA 2XPZA 2R59A 2H6FA 5ANLA 2KZTB 2PNNA 2CG3A 2BKKB 2YHCA 3MV2B 4QFVA 3UI2A 5KCMA 4CGWA 1DCQA 1G3NB 2AXUA 3FY4A 1UJJA 4X8QA 4CEMA 3HXFA 2VSXE 4UWHA 1JUQA 2KCKA 2WVIA 4HORA 1S63A 2PM6A 1E8ZA 2ETAA 4CGVA 2PQRA 3AG3E 3L16A 3WXXA 5G04J 4AXHA 4IULA 2WM9A 5FZRA 3ZW3A 4JA7A 3R7QA 3ZIMA 1K1BA 5CERB 3Q4AB 3UIOC 4N3BA 2BF0X 3NOCD 5BT1A 3Q5MA 1TN7A 3AS5A 2V5QC 5EILA 3OXLA 3VTXA 3CVVA 4BX9A 2VSNA 2NXPA 3UKUG 1FPPA 2FO1E 2ETBA 5KWDA 1IQRA 4H7XA 4BT9A 1RZ4A 4AJWA 1D8DA 3HDXA 4M3OA 1TYQG 4I6GA 3W9GA 1HH8A 4U95D 5G04C 2XHEA 4XI0A 3EDTB 2IOLA 3PH0C 3L17A 3FTYA 3L6AA 1JCRA 1D9SA 4U8HA 3DSVA 3C5RA 4AVXA 5ANRA 4I6EA 3EJNA 4R7LA 4AP2A 1AWCB 4CT4A 2X6FA 5G05C 4U7EB 2VGEA 2NSZA 4EBAA 4HOQA 4NURA 4JVSA 4MKTA 3UM2A 4CDRA 4DLOA 2IONA 5BXUA 2A5EA 3ZKJA 5A23A 2R03A 3DSUA 3ZU7B 4AOFA 5DIZA 4ANUA 3APFA 2P9LG 4LSZE 1INZA 3GZ1A 3EHNA 3IV0A 2DYRE 4GZ3A 1NZNA 2ZGDA 1OCZE 5D66A 4I9CA 4F3VA 4JEHA 4FA6A 4J0UA 2XQ0A 3KS2A 3TWUA 3PNLB 3SHFA 5AARA 3ULYA 3RJVA 4EECA 4HI9A 3B7RL 4J8DA 4N2SA 2WB2A 2E0IA 3U66A 4D10C 3MKRA 1MQSA 3I3NA 3LYAA 1LF8A 1FCHA 5IY5E 1U3CA 4N2QA 3C3RA 4FU3A 4EZJA 2GRLA 1TR4A 4PS7A 4I9EA 1K3ZD 3BU8A 4MRUA 5M72A 2LXMA 4V3IA 4F1PA 2Y4UA 3Q49B 5CMYA 3Q9UC 3P2BA 4ILHB 2Y0BG 2DYSE 3JCKC 5EX0A 4CDNA 2WXQA 3SNXA 5JA4D 4CZ2D 3PUJA 4FJZA 1LD8A 4GB9A 3CHPA 4LERA 1N9AA 1RW2A 4U63A 4WNEA 3GZSA 4JXTA 3DXMG 3UUXA 4M7CA 4CT0A 4CCAA 3TL5A 3E33A 2IO2C 4I1OB 1MJ0A 1ELWA 3DSXA 3S7JA 2XZTG 5FZSA 4UWFA 1OCRE 4HXIA 1SA5A 4G1TA 1TJFA 3LPZA 1QBQA 5EYPF 4GAAA 3EU5A 4JZYA 1N4PA 2FF4A 5EDSA 2NYJA 3PZ2A 4EHMA 4ZHBA 2P9IG 3IHVA 4TXPA 2DZNA 5FJYA 4ME2A 5HI7A 1QYMA 4JW1A 1MHQA 3U3WA 3TWTA 4HRMB 4U8YD 5EIBE 1HXIA 2Y3AA 3PUKA 4U04A 3ZYLA 1P5QA 1X5BA 3FUHA 3TWVA 4UQXA 3V31A 2VSOE 2Y1LE 1FVHA 3L82A 1O1RA 3CVQA 4DJAA 2ZISA 1KZOA 3FULA 2FULA 4AY5A 4C9BB 5EYLA 2C2LA 5CBNA 4DK5A 2P9SG 3DEPA 4NIKA 4ANWA 4AY6A 2LAIA 4CYMD 4B8AA 4ACLA 3CSTA 5CRVA 3QOUA 4PUCA 3EHRA 2J09A 3ZUVB 5CEAA 4GMJA 1PC2A 1Z6TA 4KZCA 1BI7B 4EZKA 1H6PA 2UWJG 4J8EA 1FT1A 3LDZA 2HYZA 3FWVA 4JHJA 1BPOA 3OTNA 5KJMA 3ZNGA 5LFAA 2M63A 3PVLA 1D8EA 5C1DA 4KXKB 1WY6A 3C98A 4LNBA 4YVOA 4GTPA 4WWOA 2R17C 4YDWA 5ENNA 1WM5A 1MZCA 3C3OA 4MS6A 1BI8B 2AVPA 3T8KA 4FADA 3I4GA 1MX4A 4FLHA 3CVNA 4G24A 3OXFA 2KCVA 2KXPC 1E8WA 3MCXA 3DRAA 3IKOB 4JEUA 3Q73A 3MZLB 1FT2A 3ZPJA 4HOSA 2E2EA 3AG2E 3C3QA 3D9KA 3CQGB 1UG3A 1WG0A 2XENA 3JUEA 4O1PA 1S70B 2C0MA 3Q47B 3FUDA 3FP3A 3T8MA 4IRUA 1Q2ZA 3CVLA 3FUKA 3ESLA 3V79K 5BNWA 3SFYA 3TWXA 3D9NA 3CKBA 1JCSA 3RRMB 1HFAA 2CFZA 4LRZA 2H6IA 5ENPD 4BTBA 3FTSA 5EIDA 1Z3YA 3ZXSA 4WNFA 4N5QA 4BESA 4NRHB 3UT4A 2I1KA 2LAHA 3F6QA 3AAAC 3ZXPA 2RKKA 3FTUA 2Y69E 1DNPA 4GYOA 4GZ5A 3LVQE 2RD0A 4BETA 4K0RA 3PZ4A 4DX6D 3FUFA 4AM9A 2XRYA 1VDYA 3LXUX 5FT9A 3E4BA 1HF8A 5AN8A 5JMND 3ZVVA 2VJ8A 1QQEA 2KC7A 4GMLA 1UN8A 3DSWA 2I2OA 5AQ7A 2CG2A 3B13A 2V4LA 3LY9A 3E30A 1JWFA 3UTMA 5JJTA 2H6HA 3L08A 3PEVB 1H2UA 3UINC 1K8KG 3ZYQA 2XS1A 2QYJA 2GW1A 1E8XA 4A3TA 5EKQD 3G2TA 4DLQA 4AV7A 1SW6A 2VGXA 1KPSB 2XEVA 1PAQA 3UT8A 1TNYA 5T4YA 3CQCB 2AXVA 1IHBA 3TXMA 3FU0A 4I2ZA 2EINE 3CEQA 4GTSA 1UOHA 2L6JA 3SO8A 4KBQA 2F37A 4P29A 3SFZA 3W9FA 3SBSA 4G11A 3HHMA 1IKND 3SY2A 1NA0A 3I4RB 5BXOA 2WXGA 4UI9J 3CVUA 3TWSA 2VGXB 1OT8A 2WXIA 5J08A 3PREA 2AWIA 4B94A 4UWGA 2BTDA 1UN9A 3SF4A 5FQ6A 2X6HA 4IYPA 4F53A 3G2WA 3PZ3A 3FTXA 3BG1B 3B7TA 5ENQD 3AS8A 5KNHD 5D0OD 4PS8A 3IXEA 3X2QE 1HZ4A 4FULA 3E37A 5HS0A 1JPLA 1KT0A 4HFGA 2XGMA 3MV3B 1E90A 3CVXA 4I6JA 3ZHEA 4EQFA 4HRNA 4BTAA 3EIQC 4G2VA 5FQ7A 2FI7A 2WXJA 1OCOE 4BX8A 3MX3A 4UI9C 4KVMA 4UWKA 3ONLA 5T3RA 4F7AA 2DIWA 2ZIRA 2J08A 4ZFHA 4FJYA 4XIFA 4XI9A 2XPYA 1DCEA 4GYWA 2KATA 4GTTA 4I17A 5AYWD 3B7UX 3MJWA 4GCOA 1YCSB 3V2XA 4BWRA 2RFMA 4GZCA 1FVFA 3B7SA 1EDUA 3U4TA 3Q78A 3ZHEB 1HE8A 3L54A 2LO6A 4N5CA 4BT8A 4ABNA 2XCCA 4N39A 2L0IA 3DBSA 3CK9A 4DI3A 2PM7A 3ZRHA 2EQXA 5CHEE 2XZDG 3IBEA 2DVWA 5CCMA 3PE3A 4OVUA 2HM8A 3CVWA 2P9UG 3QWVA 2VTBA 3QWWA 2EIME 4L1BA 4HS2A 3CHQA 3ONKA 4EBAG 3DSTA 4Q69A 3FTZA 2ZXWE 4WNDA 1DVPA 4RSYA 3NBNB 3U64A 2JEKA 3NQPA 4O60A 2FO7A 4JC8A 4PS3A 3UPVA 1TN6A 1ZB1A 3EHQA 4KZ0A 2IY0C 1OXJA 3G2UA 1QNFA 2HE0A 1ZBPA 5KNGA 4XZ4A 3EU9A 3HYMB 4E6HA 3NZUA 1N95A 2VSYA 4U0UA 2HO1A 3CHOA 3FEXA 3CR3A 2MYOA 4LEUA 2VTBB 3D9LA 2X6JA 4JPSA 3P1UA 1N94A 4L9PA 4HLEA 1E96B 2KBXA 3R7RA 2MRIA 2IO3C 4L2LA 4APFA 3AU4A 1IHGA 5JHBA 2XS8A 4L2YA 3D9OA 2V0PA 2L0TB 4IN3B 1N0RA 1E7VA 4J7WA 1TJCA 4DX7D 3RO2A 3SZ7A 1S0PA 4RG6A 4F1SA 2BUGA 3NF1A 4DX2A 3TWQA 2F8XK 3UKRG 3TXNA 2J9QA 3ABLE 5BV1A 2LSVA 3AU5A 4K03A 4I1AA 3T5VA 3DPYA 3IHYA 2GRQB 4O1OA 3S7FA 5AAOA 3DEOA 1N52A 3T5XA 3UMVA 2R5SA 3FH5A 1H2VC 4HQDA 4A1GA 3D9HA 5AQ9A 4WAFA 2X6IA 3KEZA 3ABKE 2MHKA 3AG4E 4XE0A 4JHKA 2A5UA 4GTMA 1V55E 4EPZA 4J8FA 3QWPA 4UQYA 3E34A 3CHSA 4CDMA 2CFUA 3V30A 5E75A 2J49A 1ZU2A 3CVYA 2QFCA 4DPRA 4K5BA 4Q94A 2MOWA 2L6BA 4OAVB 2GROB 3AJIA 1B89A 3B95A 4QQIA 4JB8P 3PZ1A 4C48B 5J90A 3ZGQA 2R05A 4YNDA 3PRZA 3CSFA 2KCLA 4HRLA 2KM4A 3PEUB 1X81A 3EUVA 3B7BA 3L9TA 3MEKA 3FH8A 3O48A 1A5EA 3S2AA 1U2VG 4GTOA 4WWNA 2LUHA 1TNUA 2WXLA 1HG2A 5G2NA 1MX6A 3DSSA 4HB5A 2R02A 3FEYA 3QJZA 3ASNE 1OWLA 4GA2A 1EYHA 4DRXE 5ENTD 1K1AA 4CRWA 3CHMA 4I43A 4JHRA 4GTRA 2OVFA 3CK7A 5ITZF 2P58C 3ENEA 3LY7A 2P9KG 3J5PA 1ELKA 3T9KA 3MKQA 2OVBA 2IEJA 2A4ZA 5H7PA 3R9AB 1EPUA 3LVRE 3RK6A 4GA1A 2VGYA 4A63B 2GRRB 2XRZA 3MA5A 4KMOA 3GW4A 2GRMA 5FQ8A 3JXIA 2R2LA 2VYIA 4YDEA 5D2MC 4WWPA 4HI8A 4ATZD 2UY1A 3FTWA 1NI1A 2YINA 3TGOA 3MKQB 4RG9A 4Q96A 3JXJA 3KEAA 1HO8A 3CVPA 1MYOA 2ONDA 3CGHA 3CK8A 4UUCA 2EIKE 2OEWA 3NB2A 4TRQA 4XKBA 1SQMA 4WNGA 4GU5A 3ML9A 5AJLA 5A6CA 5E76A 2HR2A 4BSZB 2YHEA 4U8VD 4FHJA 2XEHA 2WQ6A 2ZU6B 4Y6WA 5FZQA 3TG4A 4FC8A 2UY1B 4GMRA 2P9PG 2J8SD 1WAO1 4OYSA 4TUMA 2CHXA 3HIZA 2WXHA 3Q7AA 2LXLA 4RQIA 3RIBA 3SD5A 4H7YA 3HXCA 4KVOA 5B3SE 2QY7A 2AJAA 4I2WA 4GPMA 2EIJE 3APCA 2CHZA 4GA0A 3TWRA 3ASOE 1SZAA 5BW8C 1IYGA 4U96D 3ML8A 1HX8A 4G25A 4LNUD 2DBAA 3HXEA 2IOSA 4HBDA 1YYHA 2DCPA 3HXBA 4LNGA 4C0MA 1H0AA 4F6RD
chains in the Genus database with same CATH topology
5ENOD 5BXOA 3TWUA 2XZTG 5KWDA 5AQBA 4HRLA 3TWSA 4DX2A 5AARA 2DWZA 3TWQA 2F8XK 4HI9A 4BEPA 1OT8A 4HI8A 4ATZD 2ZGGA 4DX5D 1N0QA 4YDWA 5EYPF 3UXGA 1OY3D 4BETA 2RFAA 3HRAA 2FO1E 1YMPA 1WDYA 5HRYA 3B7BA 4DX6D 2XZDG 3Q9NC 3W9GA 2DVWA 2NYJA 4U95D 5FINA 4G8KA 3JXJA 3KEAA 4ZHBA 4HLLA 4O1OA 5EN5D 5AN8A 5JMND 1A5EA 1BI8B 1MYOA 2JABA 2DZNA 5AAOA 5KBAA 2PNNA 3DEOA 5ENQD 2BKKB 3T8KA 4UUCA 5KNHD 5ENRD 4QFVA 1MX4A 3UI2A 3J5QB 2P2CP 1QYMA 1DC2A 1DCQA 1AP7A 4OAUC 4BERA 3IXEA 4HRMB 1G3NB 4U8YD 3TWTA 5EIBE 5AQ7A 2KXPC 4HQDA 1MX6A 1D9SA 1TR4A 4HB5A 5CECB 5HS0A 4BSZB 3NBNB 3C5RA 3TWVA 1K3ZD 4U8VD 3UTMA 3V31A 4HNAD 4O60A 3HG0D 4Z68A 2Y1LE 2XEHA 3D9HA 4HRNA 3TWWA 4YDYA 5AQ9A 1AWCB 4DUIA 5CBOA 1WG0A 2XENA 3JUEA 4O1PA 4GMRA 4DRXE 4F1PA 1SVXA 4K5CA 2QYJA 3EHQA 1S70B 5HKPA 4DX1A 3Q9UC 5EYLA 2J8SD 2B0OE 5CBNA 1BU9A 5FIOA 3LJNA 2ETAA 2Y0BG 1NFIE 3DEPA 2VGEA 4TUMA 5ENTD 2QC9A 5KNGA 1K1AA 2HE0A 4NIKA 1IXVA 4CYMD 1SW6A 3EU9A 3NOGD 2V4HC 4CZ2D 5JA4D 5ITZF 1N11A 3V79K 4ZFHA 4K5AB 5AQAA 3TWXA 2DZOA 1MX2A 3EHRA 5BXUA 3ZUVB 3J5PA 5CEAA 2XEEA 2MYOA 4J8YA 2BKGA 3T9KA 1IHBA 1BI7B 2AJAA 1K1BA 4GPMA 2A5EA 3ZKJA 3V30A 1YCSB 3V2XA 3ZU7B 5CERB 2RFMA 3V2OA 4G8LA 3TWRA 3NOCD 4RLYA 2KBXA 4U96D 4K5BA 5ENPD 1UOHA 4LSZE 3SO8A 2V5QC 1BD8A 2L6BA 2F37A 3W9FA 4B93B 4OAVB 3ZNGA 5EIDA 4A63B 3AJIA 1BLXB 2ETCA 4LNUD 5EILA 3B95A 3JXIA 4N5QA 4QQIA 5ENSD 4BESA 4HBDA 2ZGDA 1MJ0A 1YYHA 1IKND 4JB8P 4LG6A 5D66A 4C48B 1N0RA 5CEDB 4J7WA 3F6QA 4DX7D 3AAAC 2F8YA 4F6RD 2ETBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENO D;  5BXO A;  3TWU A;  2XZT G;  5KWD A;  5AQB A;  4HRL A;  3TWS A;  4DX2 A;  5AAR A;  2DWZ A;  3TWQ A;  2F8X K;  4HI9 A;  4BEP A;  1OT8 A;  4HI8 A;  4ATZ D;  2ZGG A;  4DX5 D;  1N0Q A;  4YDW A;  5EYP F;  3UXG A;  1OY3 D;  4BET A;  2RFA A;  3HRA A;  2FO1 E;  1YMP A;  1WDY A;  5HRY A;  3B7B A;  4DX6 D;  2XZD G;  3Q9N C;  3W9G A;  2DVW A;  2NYJ A;  4U95 D;  5FIN A;  4G8K A;  3JXJ A;  3KEA A;  4ZHB A;  4HLL A;  4O1O A;  5EN5 D;  5AN8 A;  5JMN D;  1A5E A;  1BI8 B;  1MYO A;  2JAB A;  2DZN A;  5AAO A;  5KBA A;  2PNN A;  3DEO A;  5ENQ D;  2BKK B;  3T8K A;  4UUC A;  5KNH D;  5ENR D;  4QFV A;  1MX4 A;  3UI2 A;  3J5Q B;  2P2C P;  1QYM A;  1DC2 A;  1DCQ A;  1AP7 A;  4OAU C;  4BER A;  3IXE A;  4HRM B;  1G3N B;  4U8Y D;  3TWT A;  5EIB E;  5AQ7 A;  2KXP C;  4HQD A;  1MX6 A;  1D9S A;  1TR4 A;  4HB5 A;  5CEC B;  5HS0 A;  4BSZ B;  3NBN B;  3C5R A;  3TWV A;  1K3Z D;  4U8V D;  3UTM A;  3V31 A;  4HNA D;  4O60 A;  3HG0 D;  4Z68 A;  2Y1L E;  2XEH A;  3D9H A;  4HRN A;  3TWW A;  4YDY A;  5AQ9 A;  1AWC B;  4DUI A;  5CBO A;  1WG0 A;  2XEN A;  3JUE A;  4O1P A;  4GMR A;  4DRX E;  4F1P A;  1SVX A;  4K5C A;  2QYJ A;  3EHQ A;  1S70 B;  5HKP A;  4DX1 A;  3Q9U C;  5EYL A;  2J8S D;  2B0O E;  5CBN A;  1BU9 A;  5FIO A;  3LJN A;  2ETA A;  2Y0B G;  1NFI E;  3DEP A;  2VGE A;  4TUM A;  5ENT D;  2QC9 A;  5KNG A;  1K1A A;  2HE0 A;  4NIK A;  1IXV A;  4CYM D;  1SW6 A;  3EU9 A;  3NOG D;  2V4H C;  4CZ2 D;  5JA4 D;  5ITZ F;  1N11 A;  3V79 K;  4ZFH A;  4K5A B;  5AQA A;  3TWX A;  2DZO A;  1MX2 A;  3EHR A;  5BXU A;  3ZUV B;  3J5P A;  5CEA A;  2XEE A;  2MYO A;  4J8Y A;  2BKG A;  3T9K A;  1IHB A;  1BI7 B;  2AJA A;  1K1B A;  4GPM A;  2A5E A;  3ZKJ A;  3V30 A;  1YCS B;  3V2X A;  3ZU7 B;  5CER B;  2RFM A;  3V2O A;  4G8L A;  3TWR A;  3NOC D;  4RLY A;  2KBX A;  4U96 D;  4K5B A;  5ENP D;  1UOH A;  4LSZ E;  3SO8 A;  2V5Q C;  1BD8 A;  2L6B A;  2F37 A;  3W9F A;  4B93 B;  4OAV B;  3ZNG A;  5EID A;  4A63 B;  3AJI A;  1BLX B;  2ETC A;  4LNU D;  5EIL A;  3B95 A;  3JXI A;  4N5Q A;  4QQI A;  5ENS D;  4BES A;  4HBD A;  2ZGD A;  1MJ0 A;  1YYH A;  1IKN D;  4JB8 P;  4LG6 A;  5D66 A;  4C48 B;  1N0R A;  5CED B;  4J7W A;  3F6Q A;  4DX7 D;  3AAA C;  2F8Y A;  4F6R D;  2ETB A; 
#chains in the Genus database with same CATH topology
 5AQB A;  2B6C A;  1TNB A;  3KSL A;  3BQO A;  2ZGG A;  4PDX A;  1IQU A;  1WDY A;  3ASD A;  4DI4 A;  4E85 A;  5ARG A;  3SFX A;  4GTV A;  3PE4 A;  2P9N G;  5EN5 D;  2AW6 A;  3URZ A;  4UI9 K;  2JAB A;  2OCC E;  3ZFW A;  2WQH A;  2OV8 A;  4GCN A;  1O1T A;  5FWQ A;  1DC2 A;  1AP7 A;  3N71 A;  3FU5 A;  4I1M A;  5JHA A;  4UQZ A;  4KT6 B;  2F0Y A;  1N4Q A;  4Z68 A;  1KT1 A;  3S7B A;  3EHM A;  5HKP A;  1OWO A;  1U3D A;  1BU9 A;  5FIO A;  4APO A;  1JCQ A;  2QC9 A;  2IQC A;  1TNO A;  4U0S A;  5KJL A;  2WQ7 A;  2XGO A;  1MX2 A;  5C2Y A;  5D0Q D;  3PNT B;  2LNI A;  3AG1 E;  3V2O A;  3QAR A;  1SZ9 A;  5G05 J;  4TXR A;  5JJ7 A;  4GTQ A;  1A17 A;  2QZA A;  3U9W A;  1BD8 A;  1NL4 A;  3FUN A;  4ANV A;  3UM1 A;  5JJ6 A;  1OWP A;  2V5F A;  4ILG A;  2PZI A;  1NP7 A;  3DPD A;  4GZD A;  5AEN A;  2I1J A;  4XKC A;  2X3M A;  1O1S A;  5ENO D;  1YA0 A;  5A7D B;  3D9I A;  4GYY A;  3TG5 A;  4BEP A;  4J8S A;  2LSU A;  1S64 A;  4BFR A;  1OWN A;  1N0Q A;  2RFA A;  2Q7F A;  1YMP A;  5HRY A;  1TN8 A;  3KAE A;  2BED A;  4JD2 G;  3ISM C;  3LKU A;  4G8K A;  3G2S A;  5HQ8 A;  5KBA A;  3D9M A;  3S7D A;  4NQ0 A;  3D9J A;  3FTV A;  5ENR D;  3UQ3 A;  3MGB A;  5KJN A;  3FUI A;  3FDH A;  1O5M A;  1UJK A;  4KYO B;  3QAQ A;  4ACK A;  3FUE A;  3Q7F A;  3JUI A;  1EF1 C;  1HS6 A;  4YDO A;  4ILI A;  1N4S A;  3HXD A;  3ZYK A;  3ABM E;  3RO3 A;  1UW4 B;  2IF4 A;  2FEZ A;  4O6F A;  3DXK G;  5KJK A;  3KD7 A;  1SA4 A;  2PL2 A;  2WMO A;  4B89 A;  2XEE A;  3NZS A;  4J8Y A;  3R9M A;  3SGH A;  5BV0 A;  3DWL G;  3D9P A;  5B1A E;  3PZD A;  4BSX A;  1GW6 A;  3MYV A;  2XGS A;  4B8C B;  2XPI A;  3RKV A;  4C0E A;  3L13 A;  3QB2 A;  3CIA A;  4N3C A;  2F8Y A;  2VQ2 A;  2OEV A;  2DWZ A;  2WPV A;  1TEZ A;  3UM3 A;  1OCC E;  1H6K A;  3RRU A;  2IJG X;  3QK0 A;  1LTX A;  4W9R A;  2P2C P;  3VTY A;  3Q75 A;  3UIP C;  2WXK A;  4BER A;  1JWG A;  3D3M A;  2X38 A;  1HG5 A;  3QNK A;  5CEC B;  3RAU A;  3OXG A;  2OOE A;  3FU6 A;  3TWW A;  4YDY A;  3LEW A;  3FFL A;  5CBO A;  5LCW J;  2WXP A;  3GZ2 A;  3EIJ A;  3Q15 A;  4HOU A;  3RSE G;  4DX1 A;  3CLJ A;  1Z5S C;  5CCL A;  2B0O E;  5B1B E;  2YNQ A;  3FUJ A;  3LJN A;  1NFI E;  4TXQ A;  1IXV A;  2V4H C;  1N11 A;  1Z3X A;  4K5A B;  1E7U A;  2DZO A;  2L9B A;  2WXM A;  4U07 A;  4FP7 A;  2GRN B;  4Y6C A;  4B93 B;  4A55 A;  4FLB A;  4GZ6 A;  4XEI G;  4MBG A;  3QKY A;  4FHK A;  4LG6 A;  3UT7 A;  5CRU A;  1Y6I A;  4U0Z A;  5LCW C;  3Q79 A;  4L23 A;  3ZYM A;  3OAW A;  2ILR A;  4URK A;  3JQ0 A;  3VLE A;  5BUZ A;  2WMN A;  3Q9N C;  4J6I A;  4JL0 A;  5FIN A;  2RG8 A;  1QZ2 A;  2X6K A;  2QYU A;  4RVB A;  3ZN3 A;  3TAX A;  3JYS A;  2FBN A;  5LOZ A;  3J5Q B;  3ASG A;  3C72 A;  3BEE A;  4OAU C;  3HVE A;  5T8I A;  1L5J A;  4AIF A;  3ZEF A;  5LP0 A;  1XGW A;  4WUY A;  3RRN B;  3O4Z A;  3HG0 D;  5G55 A;  1ELR A;  4DUI A;  2J4B A;  4K5C A;  4A1S A;  2PQN A;  3QDN A;  2WXF A;  1H19 A;  3RU0 A;  3IEG A;  2J4D A;  2H6G A;  5DBK A;  5AQA A;  3I5P A;  2BKG A;  3QC1 A;  5ARF A;  3L22 A;  1N54 A;  3HVE B;  3VLF A;  4HOT A;  1H6O A;  4EZL A;  2AXZ A;  3NAW A;  4LUN U;  3ULE G;  3ULQ A;  3KSQ A;  1N4R A;  5EX3 A;  1XNF A;  3CHR A;  3VLD A;  2J07 A;  2GRP B;  3LCA A;  3LY8 A;  4A3V A;  1V54 E;  3LJ3 A;  2I9C A;  2WXO A;  2C0L A;  4TUU A;  2IFU A;  4BY6 A;  4G26 A;  3UXG A;  3UM0 A;  3APD A;  4PH4 B;  3UX4 A;  3SBT B;  3BUA A;  1LD7 A;  4N3A A;  4HLL A;  1Y8M A;  2XCB A;  2GGF A;  2NC9 A;  2IU1 A;  3AS4 A;  1OWM A;  4XX5 A;  2JLB A;  4GPK A;  5CMW A;  3ASF A;  2YQ8 A;  4HNA D;  4B0Z A;  4JA9 A;  1OUV A;  5FQ4 A;  1SVX A;  1W3B A;  3ESK A;  4LCT A;  2CHW A;  3LS8 A;  4NAC A;  1KLX A;  1KZP A;  4AEZ C;  2WXR A;  3NOG D;  5FTP A;  5LX8 A;  4YVQ C;  4L7T A;  1E8Y A;  3PS6 A;  3SQV A;  4ATG A;  3G2V A;  3CV0 A;  3FH7 A;  4G8L A;  4RLY A;  1NA3 A;  4MLP A;  3PDN A;  2KZT A;  2EIL E;  4OVV A;  2V8S E;  3K9I A;  1BLX B;  2ETC A;  4G23 A;  5ENS D;  2WXN A;  3JQ1 A;  3FU3 A;  2I6H A;  3FHE A;  5CED B;  3CKC A;  1H2T C;  4TV3 A;  4HVB A;  3BG0 B;  4UWL A;  4ANX A;  2Y4T A;  3E32 A;  4DX5 D;  1HU3 A;  1TNZ A;  1OY3 D;  3FUM A;  3HRA A;  5AJD A;  3GYZ A;  5BPP A;  3TJP A;  3ASH A;  3SI5 A;  1PY1 A;  3WG7 E;  5AIJ A;  2XPZ A;  2R59 A;  2H6F A;  5ANL A;  2KZT B;  2PNN A;  2CG3 A;  2BKK B;  2YHC A;  3MV2 B;  4QFV A;  3UI2 A;  5KCM A;  4CGW A;  1DCQ A;  1G3N B;  2AXU A;  3FY4 A;  1UJJ A;  4X8Q A;  4CEM A;  3HXF A;  2VSX E;  4UWH A;  1JUQ A;  2KCK A;  2WVI A;  4HOR A;  1S63 A;  2PM6 A;  1E8Z A;  2ETA A;  4CGV A;  2PQR A;  3AG3 E;  3L16 A;  3WXX A;  5G04 J;  4AXH A;  4IUL A;  2WM9 A;  5FZR A;  3ZW3 A;  4JA7 A;  3R7Q A;  3ZIM A;  1K1B A;  5CER B;  3Q4A B;  3UIO C;  4N3B A;  2BF0 X;  3NOC D;  5BT1 A;  3Q5M A;  1TN7 A;  3AS5 A;  2V5Q C;  5EIL A;  3OXL A;  3VTX A;  3CVV A;  4BX9 A;  2VSN A;  2NXP A;  3UKU G;  1FPP A;  2FO1 E;  2ETB A;  5KWD A;  1IQR A;  4H7X A;  4BT9 A;  1RZ4 A;  4AJW A;  1D8D A;  3HDX A;  4M3O A;  1TYQ G;  4I6G A;  3W9G A;  1HH8 A;  4U95 D;  5G04 C;  2XHE A;  4XI0 A;  3EDT B;  2IOL A;  3PH0 C;  3L17 A;  3FTY A;  3L6A A;  1JCR A;  1D9S A;  4U8H A;  3DSV A;  3C5R A;  4AVX A;  5ANR A;  4I6E A;  3EJN A;  4R7L A;  4AP2 A;  1AWC B;  4CT4 A;  2X6F A;  5G05 C;  4U7E B;  2VGE A;  2NSZ A;  4EBA A;  4HOQ A;  4NUR A;  4JVS A;  4MKT A;  3UM2 A;  4CDR A;  4DLO A;  2ION A;  5BXU A;  2A5E A;  3ZKJ A;  5A23 A;  2R03 A;  3DSU A;  3ZU7 B;  4AOF A;  5DIZ A;  4ANU A;  3APF A;  2P9L G;  4LSZ E;  1INZ A;  3GZ1 A;  3EHN A;  3IV0 A;  2DYR E;  4GZ3 A;  1NZN A;  2ZGD A;  1OCZ E;  5D66 A;  4I9C A;  4F3V A;  4JEH A;  4FA6 A;  4J0U A;  2XQ0 A;  3KS2 A;  3TWU A;  3PNL B;  3SHF A;  5AAR A;  3ULY A;  3RJV A;  4EEC A;  4HI9 A;  3B7R L;  4J8D A;  4N2S A;  2WB2 A;  2E0I A;  3U66 A;  4D10 C;  3MKR A;  1MQS A;  3I3N A;  3LYA A;  1LF8 A;  1FCH A;  5IY5 E;  1U3C A;  4N2Q A;  3C3R A;  4FU3 A;  4EZJ A;  2GRL A;  1TR4 A;  4PS7 A;  4I9E A;  1K3Z D;  3BU8 A;  4MRU A;  5M72 A;  2LXM A;  4V3I A;  4F1P A;  2Y4U A;  3Q49 B;  5CMY A;  3Q9U C;  3P2B A;  4ILH B;  2Y0B G;  2DYS E;  3JCK C;  5EX0 A;  4CDN A;  2WXQ A;  3SNX A;  5JA4 D;  4CZ2 D;  3PUJ A;  4FJZ A;  1LD8 A;  4GB9 A;  3CHP A;  4LER A;  1N9A A;  1RW2 A;  4U63 A;  4WNE A;  3GZS A;  4JXT A;  3DXM G;  3UUX A;  4M7C A;  4CT0 A;  4CCA A;  3TL5 A;  3E33 A;  2IO2 C;  4I1O B;  1MJ0 A;  1ELW A;  3DSX A;  3S7J A;  2XZT G;  5FZS A;  4UWF A;  1OCR E;  4HXI A;  1SA5 A;  4G1T A;  1TJF A;  3LPZ A;  1QBQ A;  5EYP F;  4GAA A;  3EU5 A;  4JZY A;  1N4P A;  2FF4 A;  5EDS A;  2NYJ A;  3PZ2 A;  4EHM A;  4ZHB A;  2P9I G;  3IHV A;  4TXP A;  2DZN A;  5FJY A;  4ME2 A;  5HI7 A;  1QYM A;  4JW1 A;  1MHQ A;  3U3W A;  3TWT A;  4HRM B;  4U8Y D;  5EIB E;  1HXI A;  2Y3A A;  3PUK A;  4U04 A;  3ZYL A;  1P5Q A;  1X5B A;  3FUH A;  3TWV A;  4UQX A;  3V31 A;  2VSO E;  2Y1L E;  1FVH A;  3L82 A;  1O1R A;  3CVQ A;  4DJA A;  2ZIS A;  1KZO A;  3FUL A;  2FUL A;  4AY5 A;  4C9B B;  5EYL A;  2C2L A;  5CBN A;  4DK5 A;  2P9S G;  3DEP A;  4NIK A;  4ANW A;  4AY6 A;  2LAI A;  4CYM D;  4B8A A;  4ACL A;  3CST A;  5CRV A;  3QOU A;  4PUC A;  3EHR A;  2J09 A;  3ZUV B;  5CEA A;  4GMJ A;  1PC2 A;  1Z6T A;  4KZC A;  1BI7 B;  4EZK A;  1H6P A;  2UWJ G;  4J8E A;  1FT1 A;  3LDZ A;  2HYZ A;  3FWV A;  4JHJ A;  1BPO A;  3OTN A;  5KJM A;  3ZNG A;  5LFA A;  2M63 A;  3PVL A;  1D8E A;  5C1D A;  4KXK B;  1WY6 A;  3C98 A;  4LNB A;  4YVO A;  4GTP A;  4WWO A;  2R17 C;  4YDW A;  5ENN A;  1WM5 A;  1MZC A;  3C3O A;  4MS6 A;  1BI8 B;  2AVP A;  3T8K A;  4FAD A;  3I4G A;  1MX4 A;  4FLH A;  3CVN A;  4G24 A;  3OXF A;  2KCV A;  2KXP C;  1E8W A;  3MCX A;  3DRA A;  3IKO B;  4JEU A;  3Q73 A;  3MZL B;  1FT2 A;  3ZPJ A;  4HOS A;  2E2E A;  3AG2 E;  3C3Q A;  3D9K A;  3CQG B;  1UG3 A;  1WG0 A;  2XEN A;  3JUE A;  4O1P A;  1S70 B;  2C0M A;  3Q47 B;  3FUD A;  3FP3 A;  3T8M A;  4IRU A;  1Q2Z A;  3CVL A;  3FUK A;  3ESL A;  3V79 K;  5BNW A;  3SFY A;  3TWX A;  3D9N A;  3CKB A;  1JCS A;  3RRM B;  1HFA A;  2CFZ A;  4LRZ A;  2H6I A;  5ENP D;  4BTB A;  3FTS A;  5EID A;  1Z3Y A;  3ZXS A;  4WNF A;  4N5Q A;  4BES A;  4NRH B;  3UT4 A;  2I1K A;  2LAH A;  3F6Q A;  3AAA C;  3ZXP A;  2RKK A;  3FTU A;  2Y69 E;  1DNP A;  4GYO A;  4GZ5 A;  3LVQ E;  2RD0 A;  4BET A;  4K0R A;  3PZ4 A;  4DX6 D;  3FUF A;  4AM9 A;  2XRY A;  1VDY A;  3LXU X;  5FT9 A;  3E4B A;  1HF8 A;  5AN8 A;  5JMN D;  3ZVV A;  2VJ8 A;  1QQE A;  2KC7 A;  4GML A;  1UN8 A;  3DSW A;  2I2O A;  5AQ7 A;  2CG2 A;  3B13 A;  2V4L A;  3LY9 A;  3E30 A;  1JWF A;  3UTM A;  5JJT A;  2H6H A;  3L08 A;  3PEV B;  1H2U A;  3UIN C;  1K8K G;  3ZYQ A;  2XS1 A;  2QYJ A;  2GW1 A;  1E8X A;  4A3T A;  5EKQ D;  3G2T A;  4DLQ A;  4AV7 A;  1SW6 A;  2VGX A;  1KPS B;  2XEV A;  1PAQ A;  3UT8 A;  1TNY A;  5T4Y A;  3CQC B;  2AXV A;  1IHB A;  3TXM A;  3FU0 A;  4I2Z A;  2EIN E;  3CEQ A;  4GTS A;  1UOH A;  2L6J A;  3SO8 A;  4KBQ A;  2F37 A;  4P29 A;  3SFZ A;  3W9F A;  3SBS A;  4G11 A;  3HHM A;  1IKN D;  3SY2 A;  1NA0 A;  3I4R B;  5BXO A;  2WXG A;  4UI9 J;  3CVU A;  3TWS A;  2VGX B;  1OT8 A;  2WXI A;  5J08 A;  3PRE A;  2AWI A;  4B94 A;  4UWG A;  2BTD A;  1UN9 A;  3SF4 A;  5FQ6 A;  2X6H A;  4IYP A;  4F53 A;  3G2W A;  3PZ3 A;  3FTX A;  3BG1 B;  3B7T A;  5ENQ D;  3AS8 A;  5KNH D;  5D0O D;  4PS8 A;  3IXE A;  3X2Q E;  1HZ4 A;  4FUL A;  3E37 A;  5HS0 A;  1JPL A;  1KT0 A;  4HFG A;  2XGM A;  3MV3 B;  1E90 A;  3CVX A;  4I6J A;  3ZHE A;  4EQF A;  4HRN A;  4BTA A;  3EIQ C;  4G2V A;  5FQ7 A;  2FI7 A;  2WXJ A;  1OCO E;  4BX8 A;  3MX3 A;  4UI9 C;  4KVM A;  4UWK A;  3ONL A;  5T3R A;  4F7A A;  2DIW A;  2ZIR A;  2J08 A;  4ZFH A;  4FJY A;  4XIF A;  4XI9 A;  2XPY A;  1DCE A;  4GYW A;  2KAT A;  4GTT A;  4I17 A;  5AYW D;  3B7U X;  3MJW A;  4GCO A;  1YCS B;  3V2X A;  4BWR A;  2RFM A;  4GZC A;  1FVF A;  3B7S A;  1EDU A;  3U4T A;  3Q78 A;  3ZHE B;  1HE8 A;  3L54 A;  2LO6 A;  4N5C A;  4BT8 A;  4ABN A;  2XCC A;  4N39 A;  2L0I A;  3DBS A;  3CK9 A;  4DI3 A;  2PM7 A;  3ZRH A;  2EQX A;  5CHE E;  2XZD G;  3IBE A;  2DVW A;  5CCM A;  3PE3 A;  4OVU A;  2HM8 A;  3CVW A;  2P9U G;  3QWV A;  2VTB A;  3QWW A;  2EIM E;  4L1B A;  4HS2 A;  3CHQ A;  3ONK A;  4EBA G;  3DST A;  4Q69 A;  3FTZ A;  2ZXW E;  4WND A;  1DVP A;  4RSY A;  3NBN B;  3U64 A;  2JEK A;  3NQP A;  4O60 A;  2FO7 A;  4JC8 A;  4PS3 A;  3UPV A;  1TN6 A;  1ZB1 A;  3EHQ A;  4KZ0 A;  2IY0 C;  1OXJ A;  3G2U A;  1QNF A;  2HE0 A;  1ZBP A;  5KNG A;  4XZ4 A;  3EU9 A;  3HYM B;  4E6H A;  3NZU A;  1N95 A;  2VSY A;  4U0U A;  2HO1 A;  3CHO A;  3FEX A;  3CR3 A;  2MYO A;  4LEU A;  2VTB B;  3D9L A;  2X6J A;  4JPS A;  3P1U A;  1N94 A;  4L9P A;  4HLE A;  1E96 B;  2KBX A;  3R7R A;  2MRI A;  2IO3 C;  4L2L A;  4APF A;  3AU4 A;  1IHG A;  5JHB A;  2XS8 A;  4L2Y A;  3D9O A;  2V0P A;  2L0T B;  4IN3 B;  1N0R A;  1E7V A;  4J7W A;  1TJC A;  4DX7 D;  3RO2 A;  3SZ7 A;  1S0P A;  4RG6 A;  4F1S A;  2BUG A;  3NF1 A;  4DX2 A;  3TWQ A;  2F8X K;  3UKR G;  3TXN A;  2J9Q A;  3ABL E;  5BV1 A;  2LSV A;  3AU5 A;  4K03 A;  4I1A A;  3T5V A;  3DPY A;  3IHY A;  2GRQ B;  4O1O A;  3S7F A;  5AAO A;  3DEO A;  1N52 A;  3T5X A;  3UMV A;  2R5S A;  3FH5 A;  1H2V C;  4HQD A;  4A1G A;  3D9H A;  5AQ9 A;  4WAF A;  2X6I A;  3KEZ A;  3ABK E;  2MHK A;  3AG4 E;  4XE0 A;  4JHK A;  2A5U A;  4GTM A;  1V55 E;  4EPZ A;  4J8F A;  3QWP A;  4UQY A;  3E34 A;  3CHS A;  4CDM A;  2CFU A;  3V30 A;  5E75 A;  2J49 A;  1ZU2 A;  3CVY A;  2QFC A;  4DPR A;  4K5B A;  4Q94 A;  2MOW A;  2L6B A;  4OAV B;  2GRO B;  3AJI A;  1B89 A;  3B95 A;  4QQI A;  4JB8 P;  3PZ1 A;  4C48 B;  5J90 A;  3ZGQ A;  2R05 A;  4YND A;  3PRZ A;  3CSF A;  2KCL A;  4HRL A;  2KM4 A;  3PEU B;  1X81 A;  3EUV A;  3B7B A;  3L9T A;  3MEK A;  3FH8 A;  3O48 A;  1A5E A;  3S2A A;  1U2V G;  4GTO A;  4WWN A;  2LUH A;  1TNU A;  2WXL A;  1HG2 A;  5G2N A;  1MX6 A;  3DSS A;  4HB5 A;  2R02 A;  3FEY A;  3QJZ A;  3ASN E;  1OWL A;  4GA2 A;  1EYH A;  4DRX E;  5ENT D;  1K1A A;  4CRW A;  3CHM A;  4I43 A;  4JHR A;  4GTR A;  2OVF A;  3CK7 A;  5ITZ F;  2P58 C;  3ENE A;  3LY7 A;  2P9K G;  3J5P A;  1ELK A;  3T9K A;  3MKQ A;  2OVB A;  2IEJ A;  2A4Z A;  5H7P A;  3R9A B;  1EPU A;  3LVR E;  3RK6 A;  4GA1 A;  2VGY A;  4A63 B;  2GRR B;  2XRZ A;  3MA5 A;  4KMO A;  3GW4 A;  2GRM A;  5FQ8 A;  3JXI A;  2R2L A;  2VYI A;  4YDE A;  5D2M C;  4WWP A;  4HI8 A;  4ATZ D;  2UY1 A;  3FTW A;  1NI1 A;  2YIN A;  3TGO A;  3MKQ B;  4RG9 A;  4Q96 A;  3JXJ A;  3KEA A;  1HO8 A;  3CVP A;  1MYO A;  2OND A;  3CGH A;  3CK8 A;  4UUC A;  2EIK E;  2OEW A;  3NB2 A;  4TRQ A;  4XKB A;  1SQM A;  4WNG A;  4GU5 A;  3ML9 A;  5AJL A;  5A6C A;  5E76 A;  2HR2 A;  4BSZ B;  2YHE A;  4U8V D;  4FHJ A;  2XEH A;  2WQ6 A;  2ZU6 B;  4Y6W A;  5FZQ A;  3TG4 A;  4FC8 A;  2UY1 B;  4GMR A;  2P9P G;  2J8S D;  1WAO 1;  4OYS A;  4TUM A;  2CHX A;  3HIZ A;  2WXH A;  3Q7A A;  2LXL A;  4RQI A;  3RIB A;  3SD5 A;  4H7Y A;  3HXC A;  4KVO A;  5B3S E;  2QY7 A;  2AJA A;  4I2W A;  4GPM A;  2EIJ E;  3APC A;  2CHZ A;  4GA0 A;  3TWR A;  3ASO E;  1SZA A;  5BW8 C;  1IYG A;  4U96 D;  3ML8 A;  1HX8 A;  4G25 A;  4LNU D;  2DBA A;  3HXE A;  2IOS A;  4HBD A;  1YYH A;  2DCP A;  3HXB A;  4LNG A;  4C0M A;  1H0A A;  4F6R D; 
#chains in the Genus database with same CATH homology
 5ENO D;  5BXO A;  3TWU A;  2XZT G;  5KWD A;  5AQB A;  4HRL A;  3TWS A;  4DX2 A;  5AAR A;  2DWZ A;  3TWQ A;  2F8X K;  4HI9 A;  4BEP A;  1OT8 A;  4HI8 A;  4ATZ D;  2ZGG A;  4DX5 D;  1N0Q A;  4YDW A;  5EYP F;  3UXG A;  1OY3 D;  4BET A;  2RFA A;  3HRA A;  2FO1 E;  1YMP A;  1WDY A;  5HRY A;  3B7B A;  4DX6 D;  2XZD G;  3Q9N C;  3W9G A;  2DVW A;  2NYJ A;  4U95 D;  5FIN A;  4G8K A;  3JXJ A;  3KEA A;  4ZHB A;  4HLL A;  4O1O A;  5EN5 D;  5AN8 A;  5JMN D;  1A5E A;  1BI8 B;  1MYO A;  2JAB A;  2DZN A;  5AAO A;  5KBA A;  2PNN A;  3DEO A;  5ENQ D;  2BKK B;  3T8K A;  4UUC A;  5KNH D;  5ENR D;  4QFV A;  1MX4 A;  3UI2 A;  3J5Q B;  2P2C P;  1QYM A;  1DC2 A;  1DCQ A;  1AP7 A;  4OAU C;  4BER A;  3IXE A;  4HRM B;  1G3N B;  4U8Y D;  3TWT A;  5EIB E;  5AQ7 A;  2KXP C;  4HQD A;  1MX6 A;  1D9S A;  1TR4 A;  4HB5 A;  5CEC B;  5HS0 A;  4BSZ B;  3NBN B;  3C5R A;  3TWV A;  1K3Z D;  4U8V D;  3UTM A;  3V31 A;  4HNA D;  4O60 A;  3HG0 D;  4Z68 A;  2Y1L E;  2XEH A;  3D9H A;  4HRN A;  3TWW A;  4YDY A;  5AQ9 A;  1AWC B;  4DUI A;  5CBO A;  1WG0 A;  2XEN A;  3JUE A;  4O1P A;  4GMR A;  4DRX E;  4F1P A;  1SVX A;  4K5C A;  2QYJ A;  3EHQ A;  1S70 B;  5HKP A;  4DX1 A;  3Q9U C;  5EYL A;  2J8S D;  2B0O E;  5CBN A;  1BU9 A;  5FIO A;  3LJN A;  2ETA A;  2Y0B G;  1NFI E;  3DEP A;  2VGE A;  4TUM A;  5ENT D;  2QC9 A;  5KNG A;  1K1A A;  2HE0 A;  4NIK A;  1IXV A;  4CYM D;  1SW6 A;  3EU9 A;  3NOG D;  2V4H C;  4CZ2 D;  5JA4 D;  5ITZ F;  1N11 A;  3V79 K;  4ZFH A;  4K5A B;  5AQA A;  3TWX A;  2DZO A;  1MX2 A;  3EHR A;  5BXU A;  3ZUV B;  3J5P A;  5CEA A;  2XEE A;  2MYO A;  4J8Y A;  2BKG A;  3T9K A;  1IHB A;  1BI7 B;  2AJA A;  1K1B A;  4GPM A;  2A5E A;  3ZKJ A;  3V30 A;  1YCS B;  3V2X A;  3ZU7 B;  5CER B;  2RFM A;  3V2O A;  4G8L A;  3TWR A;  3NOC D;  4RLY A;  2KBX A;  4U96 D;  4K5B A;  5ENP D;  1UOH A;  4LSZ E;  3SO8 A;  2V5Q C;  1BD8 A;  2L6B A;  2F37 A;  3W9F A;  4B93 B;  4OAV B;  3ZNG A;  5EID A;  4A63 B;  3AJI A;  1BLX B;  2ETC A;  4LNU D;  5EIL A;  3B95 A;  3JXI A;  4N5Q A;  4QQI A;  5ENS D;  4BES A;  4HBD A;  2ZGD A;  1MJ0 A;  1YYH A;  1IKN D;  4JB8 P;  4LG6 A;  5D66 A;  4C48 B;  1N0R A;  5CED B;  4J7W A;  3F6Q A;  4DX7 D;  3AAA C;  2F8Y A;  4F6R D;  2ETB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...