1D9SA

Tumor suppressor p15(ink4b) structure by comparative modeling and nmr data
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
136
structure length
136
Chain Sequence
GSPGIHMLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumor suppressor INK4: comparisons of conformational properties between p16(INK4A) and p18(INK4C).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords CYCLIN-DEPENDENT KINASE 4 INHIBITOR B
total genus 25
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1999-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1d9sA00
1YYHA 5ENPD 5CBOA 5EYPF 4QQIA 4HNAD 4LG6A 1IHBA 1MX6A 2QC9A 1YMPA 3TWRA 2HE0A 3EU9A 4CYMD 3V79K 1D9SA 4RLYA 4ZHBA 5EIDA 5CBNA 4LSZE 4UUCA 2B0OE 1BLXB 2DVWA 5FINA 4HI8A 4ATZD 3D9HA 2A5EA 1WDYA 1S70B 5AQ7A 3TWSA 2XEEA 4K5AB 4Z68A 4ZFHA 2ETCA 1N0QA 2XEHA 3B7BA 4O1OA 3SO8A 4O60A 1MJ0A 5KBAA 2J8SD 4K5CA 4N5QA 5EN5D 3JXJA 1AWCB 1NFIE 4K5BA 3HG0D 1BI8B 2V5QC 2JABA 3Q9NC 4HI9A 5ENTD 2DZOA 5BXUA 5ITZF 1OT8A 4C48B 1A5EA 4DX1A 3TWVA 4J8YA 3ZU7B 3NBNB 4JB8P 4U8VD 4U96D 4DX6D 4HRMB 3TWXA 4DX2A 4DX5D 1BI7B 3NOGD 5AN8A 4HRNA 2ZGDA 4GMRA 4BETA 3J5QB 5AQ9A 5ENRD 5JMND 1BU9A 3TWUA 3T8KA 2L6BA 3W9GA 3ZUVB 2F8YA 3EHRA 5KWDA 3B95A 4QFVA 4BSZB 4DRXE 2V4HC 3C5RA 4HBDA 3TWWA 4GPMA 1MX2A 1MX4A 4OAVB 4J7WA 2AJAA 4YDYA 4HLLA 3J5PA 3KEAA 3LJNA 5CEAA 1N11A 1AP7A 3JXIA 5HKPA 5AQAA 3V30A 1YCSB 2XENA 4B93B 3W9FA 5AAOA 5JA4D 1OY3D 2MYOA 5HS0A 3AJIA 3V2XA 4HB5A 3EHQA 3V2OA 2KBXA 1QYMA 4F6RD 2F37A 1N0RA 3TWQA 1K1AA 1SVXA 4DX7D 5BXOA 3UTMA 1K1BA 2XZDG 4NIKA 2DWZA 3HRAA 3DEOA 5CERB 5FIOA 2FO1E 2RFAA 1UOHA 5HRYA 2ZGGA 5KNHD 2ETBA 2Y1LE 3ZNGA 4BERA 1K3ZD 3AAAC 4HQDA 5EYLA 1SW6A 3F6QA 1TR4A 3UXGA 2NYJA 5EIBE 2BKKB 4G8KA 3UI2A 5KNGA 1IXVA 2DZNA 3NOCD 2KXPC 3T9KA 5ENSD 5AARA 2BKGA 2VGEA 5ENQD 5CECB 1IKND 4HRLA 5AQBA 5EILA 5ENOD 1DCQA 2QYJA 2RFMA 4G8LA 4BESA 2P2CP 1BD8A 3DEPA 4U8YD 1G3NB 2Y0BG 3TWTA 3V31A 4DUIA 1DC2A 1WG0A 3Q9UC 4U95D 5D66A 2XZTG 4OAUC 4LNUD 4BEPA 5CEDB 4TUMA 3ZKJA 2PNNA 4F1PA 3JUEA 3IXEA 4CZ2D 4A63B 4O1PA 2ETAA 4YDWA 2F8XK 1MYOA
chains in the Genus database with same CATH superfamily
1HG2A 1NA3A 1FPPA 2IF4A 3CVXA 1EYHA 4UQYA 3S2AA 1N4PA 4FULA 3X2QE 4A1SA 4N3BA 4ANWA 3DRAA 3D9PA 1KZPA 3MZLB 4YVQC 3UUXA 4N2SA 4HI9A 3ASNE 1IQRA 5AJLA 3KD7A 4F1SA 5ENNA 4I1AA 4L23A 3TWXA 3NOGD 3ABME 3EHRA 4DRXE 3KEZA 2V4HC 3C5RA 3ZEFA 4OAVB 3KSLA 2QFCA 5CEAA 2V4LA 5JA4D 5HS0A 3V2XA 2KBXA 2MOWA 3AG3E 2XZDG 3QB2A 2VSXE 4APOA 4FP7A 3B7SA 3UMVA 4GPKA 4GTTA 3UI2A 2CHZA 3T9KA 2Y4TA 2ZXWE 4G8LA 2VTBB 3URZA 3WXXA 2PQRA 1OWMA 5D66A 3Q75A 4OAUC 4FC8A 5KCMA 3VTYA 2R02A 3RRNB 2WXKA 4OVVA 1SZ9A 3SHFA 4LG6A 3LCAA 3EU9A 5E76A 3V79K 4RLYA 5KJMA 4KZ0A 2DVWA 2HO1A 3SFXA 4ME2A 3SNXA 4Z68A 1D8EA 4I2ZA 4PUCA 5ANLA 3LDZA 4K5BA 1BI8B 2I1JA 4Q69A 1QQEA 1H2TC 3U64A 4UWKA 3CHMA 3QC1A 3VLDA 3T8KA 4XKCA 1H6PA 5ANRA 4P29A 2IJGX 4I2WA 4U7EB 1IYGA 4TRQA 4JHRA 2HR2A 1EF1C 1PY1A 1UN8A 3UT7A 4RSYA 2RG8A 3EIJA 4YDEA 1QYMA 3FUJA 3ZVVA 4WAFA 2KCLA 2XQ0A 4DX7D 5BXOA 4NIKA 2EILE 4C0MA 5HRYA 3FY4A 2YHCA 3FU3A 3FTWA 4I17A 3HXCA 2AW6A 3EIQC 3Q49B 4I43A 3CKCA 1KT1A 5DIZA 2RFMA 5EX0A 3RU0A 1WG0A 3Q9UC 1XGWA 3ZKJA 4DK5A 5G05C 2GRLA 3QWWA 2I2OA 1JPLA 1YYHA 4ILIA 4JHJA 3P2BA 4ZHBA 3BU8A 4Q96A 4ATZD 4GCNA 1TNYA 4ZFHA 2XEHA 3B13A 4EHMA 4O60A 3MEKA 2Y3AA 3QKYA 5LCWC 1AWCB 4U63A 3DSUA 1A5EA 5HQ8A 4U8VD 5JJTA 2XPYA 2XPIA 4BETA 3L82A 4ILGA 4FLHA 4GZDA 3FEYA 4IULA 2AXVA 3CEQA 4GA1A 1YA0A 2I9CA 3ZYQA 2FI7A 3CVYA 1B89A 3RRMB 5BV0A 4BWRA 1TJFA 4GTSA 5J08A 5AAOA 1OY3D 1FCHA 4AY6A 4Q94A 4CGWA 2OCCE 3DXMG 3D9JA 3CSFA 3L6AA 4HLEA 4XI0A 1ZB1A 4BX9A 2GRMA 3Q15A 4OVUA 3PZ3A 2VSNA 2C0MA 5EIBE 3ASFA 2H6IA 4U04A 4URKA 3L54A 5EILA 3GYZA 1HG5A 1BD8A 1TN7A 2P2CP 3DSVA 4J8EA 4AVXA 4JZYA 4TXPA 4I1OB 3I4RB 2UWJG 2ZU6B 3AG2E 3JUEA 2P9IG 2WVIA 4RG6A 4N2QA 3FTVA 3UKUG 4I9CA 2LAHA 3G2UA 1BLXB 4DI3A 4FHKA 4HI8A 1JUQA 1OCCE 1S70B 2J07A 3GW4A 3LYAA 3DWLG 4GZ5A 5KBAA 3PE4A 1NFIE 2VSOE 3NZSA 5CCLA 3TWVA 4DX2A 4B0ZA 4GMRA 2P9UG 3CVWA 2EIME 2DCPA 4DJAA 4BSZB 5A6CA 3OTNA 4GPMA 5HI7A 2XHEA 1NI1A 2AJAA 5LX8A 3KEAA 5FWQA 1WY6A 3ONLA 4ABNA 4G25A 4MLPA 4DLOA 3TWQA 1K1AA 1OWOA 4AJWA 3CK9A 2IU1A 3DEOA 3SD5A 5FIOA 4BERA 2V8SE 3FUNA 4EECA 4G8KA 4BX8A 3Q7FA 5CECB 2IQCA 1V54E 2QYUA 4FADA 3CHQA 3DEPA 4LNBA 2E0IA 3ZYKA 1KPSB 4IN3B 4U95D 4IRUA 4BEPA 1N94A 2C0LA 2AVPA 1MHQA 1TNBA 4DPRA 2J4DA 3TWRA 4JVSA 4KXKB 4ACLA 4UUCA 3PZ2A 3NB2A 3TL5A 1N0QA 1MJ0A 4PS8A 2R03A 2BUGA 4M7CA 4U0ZA 2PQNA 3P1UA 2FULA 4DX5D 3ZXSA 1E90A 4GZ3A 3BG0B 2I6HA 3LJ3A 3GZ2A 4JPSA 3TWUA 2L6BA 1H6KA 2CHXA 3Q79A 3TWWA 1HE8A 4KVOA 1HS6A 2IY0C 4K03A 4JHKA 4A1GA 1YCSB 3W9FA 1LTXA 1TJCA 5AJDA 3ZHEB 3NQPA 1N95A 3V2OA 3QARA 3R9AB 1TNZA 1N0RA 4TXQA 1SVXA 3ULYA 2WB2A 1O1TA 1K1BA 2GRRB 4LUNU 2GGFA 3RAUA 2IO3C 5FT9A 3KSQA 2FO1E 5BT1A 1MZCA 5KJKA 4IYPA 4AXHA 3FUHA 3RKVA 4HQDA 5EYLA 1SW6A 5D0OD 3E30A 3C72A 4KMOA 2PM7A 1V55E 3MYVA 4I1MA 1SZAA 1UJKA 1E8XA 3BUAA 4BTAA 3QAQA 4BTBA 2CHWA 2LXLA 4E85A 4AEZC 2PZIA 1O1SA 3UIPC 3MKRA 1HF8A 1O5MA 4YNDA 2OV8A 1D9SA 5CBNA 3SZ7A 3C3OA 2GRQB 1UG3A 4XX5A 2NXPA 3LEWA 2X6IA 4N5QA 2VYIA 4WWNA 1OT8A 4J8YA 5G04C 1EDUA 5BPPA 5CCMA 4GA0A 1NZNA 2F8YA 1HU3A 4XZ4A 3PEVB 3CHOA 4WNEA 1HO8A 4KVMA 3IKOB 1UN9A 3S7FA 2LSUA 3QWVA 3Q73A 1FT1A 3LY9A 4NRHB 3SGHA 3PE3A 3CV0A 3HHMA 2PM6A 3UIOC 4GYOA 3FDHA 3DPYA 4APFA 3NZUA 1ELKA 5T3RA 3EJNA 4GTVA 2OEWA 3Q7AA 2WQHA 1U3CA 5B3SE 5AQBA 3L9TA 4AM9A 2XGOA 3FP3A 2GRNB 3U4TA 2AWIA 3MKQA 2P9KG 4MS6A 4F1PA 5B1BE 2X6HA 2X6FA 3ESLA 2J09A 4WNDA 2UY1A 1Z3XA 4GMLA 3IEGA 2KZTA 4I9EA 2RD0A 4G24A 2B0OE 1LD8A 1Z6TA 3QJZA 3DSSA 1FT2A 4UQXA 3ZN3A 1PC2A 2WQ6A 3FH7A 2WMOA 4J0UA 5M72A 4O1OA 5FZSA 3OXGA 3IV0A 4H7YA 1Y6IA 3FUDA 4OYSA 5ITZF 3APDA 3MJWA 3HYMB 3QWPA 3UT8A 1W3BA 2H6GA 3RRUA 2EQXA 4WWPA 2BTDA 3ZIMA 3FUIA 2H6HA 2EIKE 4EBAA 3J5PA 2CFZA 3EU5A 3JXIA 1QNFA 3QDNA 2LNIA 5BNWA 1JCQA 2RFAA 1L5JA 3HXBA 4G26A 3LVRE 5KNGA 2WXPA 2DZNA 3ULEG 5ENSD 5ENOD 3ZHEA 4HOQA 2B6CA 2X38A 4HORA 2L0IA 4AY5A 3AS5A 4CDNA 1TEZA 4FU3A 4GB9A 2ETAA 4YDWA 1MYOA 4GZCA 5ENPD 4Y6CA 4X8QA 5FQ8A 2HE0A 5A23A 2JLBA 4GTRA 3PDNA 2A5EA 3TWSA 4ACKA 3UX4A 3B7BA 5E75A 4FJYA 4GMJA 4GTOA 4GA2A 1ZU2A 2WXMA 5JMND 3ZUVB 5LOZA 3CVNA 4GTQA 3LKUA 1Z3YA 4L2YA 3L08A 5LCWJ 3HIZA 1P5QA 3CIAA 4XE0A 2M63A 5C2YA 5A7DB 3DSWA 3FU6A 2P9LG 2A4ZA 3PUJA 2NYJA 2BKKB 1N4SA 3UM0A 4YVOA 5AARA 5ENQD 2BF0X 4U8YD 3CVVA 3TWTA 4DUIA 2R05A 4F3VA 4EZLA 4R7LA 4XI9A 4BY6A 4JL0A 2F8XK 1WM5A 3PNTB 3AS8A 1YMPA 3OXLA 4UWHA 1QZ2A 1N9AA 4B8AA 1UJJA 2IOLA 4XKBA 4TUUA 2VQ2A 3MX3A 3IHVA 4HS2A 2KCVA 3R9MA 4U96D 4DX6D 4K0RA 2PL2A 3CVUA 4B89A 2DYRE 4WUYA 4EPZA 1EPUA 3AS4A 1KZOA 3LJNA 5HKPA 3V30A 4B93B 2LXMA 3CVLA 4CDMA 4ANUA 2MYOA 3UQ3A 4LCTA 3DSTA 4PDXA 2F37A 4DLQA 2EIJE 2WXGA 3ZNGA 5KNHD 1INZA 4C0EA 4XEIG 3UKRG 3TAXA 3TGOA 4HVBA 3EHMA 3E4BA 3PS6A 1H6OA 1IKND 5CHEE 3ZYLA 2GROB 5JJ6A 4L2LA 1HXIA 3MA5A 1E8ZA 5C1DA 3HDXA 2PNNA 3I5PA 3RO2A 1XNFA 3FUMA 3JYSA 2L9BA 1HH8A 2AXZA 2LSVA 1N4QA 2E2EA 2V0PA 2J49A 1TNOA 3D9HA 1UW4B 5LP0A 4JEUA 1S64A 3G2VA 1OCRE 2KM4A 2QZAA 2NC9A 3G2TA 3CLJA 4GCOA 2JABA 4LEUA 1E8WA 4FA6A 3ZYMA 4GTPA 3FUFA 3JCKC 5AN8A 3FUEA 1KLXA 4JW1A 5KWDA 3VTXA 3SI5A 4RVBA 5AENA 1MX2A 4ILHB 3SF4A 4AP2A 3ABKE 4N3CA 3AJIA 3R7QA 4J8DA 4HB5A 1H0AA 4EZJA 5KJNA 2IOSA 4C9BB 5J90A 1LF8A 3D9OA 4G11A 5B1AE 3RO3A 1NP7A 5T4YA 1TR4A 2YINA 1U3DA 4G1TA 3EUVA 5IY5E 1OWPA 3FU5A 3PEUB 3ONKA 1G3NB 5LFAA 3T8MA 2IONA 3LS8A 3RK6A 1TYQG 5G55A 4JC8A 1NL4A 4RG9A 4W9RA 5KJLA 3E37A 4BSXA 4HOSA 3ASHA 4N5CA 5CBOA 4HXIA 5FZRA 1S0PA 3LVQE 4A3VA 5CMWA 2XS8A 3VLEA 1TNUA 3ZFWA 1DVPA 5ENTD 3ZGQA 4C48B 2RKKA 2WXFA 4TXRA 1BI7B 4CEMA 4HRNA 5ENRD 4JA9A 3MKQB 2XCBA 3B95A 3D3MA 1RZ4A 1N54A 1SA4A 1MQSA 3HXEA 4PS7A 1BPOA 3APCA 2WMNA 3S7DA 1TN6A 3HVEB 3ULQA 4GZ6A 2XENA 3MCXA 1X81A 1HX8A 1RW2A 3O48A 2KC7A 1OUVA 5AIJA 1D8DA 4WNFA 2C2LA 3BQOA 4H7XA 1U2VG 3OAWA 2ZGGA 5CMYA 2Y1LE 3Q4AB 2Q7FA 4U0SA 3CVQA 3VLFA 3F6QA 3UXGA 3KAEA 5D2MC 2KXPC 2R5SA 2IEJA 4F7AA 5FQ7A 3SBTB 3CHPA 4HRLA 2FO7A 4BESA 3JQ0A 3SBSA 4JXTA 3QOUA 4GYWA 2L0TB 2J08A 3CK7A 2ZIRA 4L9PA 3PRZA 4E6HA 3E34A 2OVFA 3WG7E 4BFRA 3NAWA 1Z5SC 4QQIA 3G2WA 3FEXA 3DPDA 2ILRA 4LSZE 2WXLA 4KT6B 1JWGA 3D9LA 3UT4A 4B8CB 4K5CA 5EN5D 3N71A 2MHKA 2WXHA 3HG0D 2DZOA 4BT9A 3ZU7B 3AG1E 2WQ7A 4HRMB 3TXMA 4EBAG 2YNQA 1VDYA 2NSZA 2GRPB 4I6JA 5ARFA 3IBEA 3L16A 4V3IA 3MV3B 4J8SA 2X3MA 1HFAA 3EDTB 4CT0A 4L1BA 4YDOA 2CG2A 3T5XA 5AQAA 3ZPJA 3FTXA 2VJ8A 2FEZA 3FU0A 3UTMA 2VGYA 3JUIA 1OWLA 2DWZA 3ZXPA 3T5VA 4J8FA 2P9NG 4NQ0A 2JEKA 3CKBA 1K8KG 1K3ZD 2XRZA 3DXKG 3C3QA 3LY8A 3GZ1A 4HOTA 3S7BA 1JCSA 4JD2G 4UWGA 2BEDA 2YQ8A 1E7UA 4LNUD 5CEDB 4NACA 3IXEA 4AIFA 2X6KA 3K9IA 5FTPA 2J9QA 3CGHA 1JCRA 4XIFA 4CT4A 2L6JA 3FTSA 2R17C 5G05J 4FJZA 2H6FA 4I6EA 2DBAA 3JXJA 1OCZE 1E8YA 5H7PA 2V5QC 5BXUA 5EDSA 4PS3A 4M3OA 2WXJA 4JB8P 3APFA 3FFLA 3AU5A 3QNKA 5CRVA 3O4ZA 5D0QD 1BU9A 3D9NA 1GW6A 3LXUX 1IHGA 4CGVA 4NURA 3PNLB 3CHSA 3PVLA 4J6IA 2VSYA 3FH8A 4HBDA 5BV1A 1ZBPA 3FH5A 1HZ4A 4LRZA 2XCCA 1N11A 5BW8C 3C3RA 2KZTB 5T8IA 4F6RD 2R59A 3PH0C 5AYWD 2WXQA 5FJYA 4CCAA 2WXNA 5CERB 3L22A 2A5UA 3D9MA 3CSTA 3LY7A 2HM8A 3AAAC 3LPZA 2UY1B 1E7VA 3PREA 2P9PG 1TN8A 2KCKA 3ASDA 2IO2C 4GYYA 2Y0BG 3DBSA 3SFYA 3PZ1A 4KZCA 5FQ4A 4UQZA 3UM3A 2LAIA 4HOUA 4TUMA 3R7RA 4CZ2D 1DCEA 4A63B 2VTBA 3SQVA 4FLBA 1JWFA 4UWFA 5EYPF 4HNAD 2MRIA 1FVHA 2QC9A 3HVEA 1Y8MA 3L17A 3PZDA 4CYMD 3JQ1A 4N3AA 5EIDA 5G04J 2DIWA 5FINA 4ANVA 3Q5MA 3TJPA 5G2NA 2DYSE 3CVPA 1A17A 4DI4A 5JHBA 1NA0A 2XS1A 1N52A 1E96B 1H2VC 4ATGA 2V5FA 3Q9NC 2XPZA 3DSXA 4CRWA 3FULA 2QY7A 4AV7A 2XRYA 3U66A 1Q2ZA 2YHEA 3J5QB 3W9GA 1OWNA 3PZ4A 4GU5A 3CR3A 4EQFA 2LUHA 1OXJA 1LD7A 3ASOE 3PUKA 3U9WA 4U07A 4HFGA 1WAO1 3E32A 1AP7A 5ARGA 2WPVA 3OXFA 2IFUA 2EINE 2KATA 3QK0A 4CDRA 3FTYA 2R2LA 4D10C 1S63A 3S7JA 3FTUA 3ISMC 2J4BA 3HRAA 3ASGA 3MV2B 2FF4A 4G2VA 3FUKA 3I3NA 2XGSA 1ELRA 2OVBA 1N4RA 2HYZA 1OCOE 3V31A 3TG4A 3B7UX 3G2SA 4KBQA 3I4GA 3GZSA 3B7TA 4UWLA 2VGXA 3L13A 3HXFA 3UM2A 2WXRA 3U3WA 4PH4B 3UINC 1MX6A 3D9IA 4MKTA 3CQGB 4AOFA 4L7TA 3RIBA 2WXOA 5JJ7A 4EZKA 2WXIA 2XEEA 2WM9A 3NF1A 5CRUA 2ETCA 4KYOB 3BG1B 3ZW3A 4MRUA 3RJVA 2OEVA 3ESKA 3CK8A 4U0UA 3SFZA 5JHAA 4DX1A 3NBNB 3E33A 2XEVA 1O1RA 1H2UA 4A55A 3FWVA 2ZGDA 1PAQA 4QFVA 4Y6WA 3EHNA 4JA7A 4TV3A 1MX4A 2GW1A 3CQCB 4J7WA 3FTZA 4YDYA 4HLLA 3IHYA 4BT8A 5FZQA 1IQUA 1FVFA 3EHQA 2CG3A 3ML8A 2OOEA 4LNGA 4UI9K 4MBGA 2ETBA 5EKQD 4B94A 4FHJA 4LERA 3HXDA 3ENEA 1SQMA 1IXVA 3NOCD 3SY2A 2BKGA 2ZISA 4JEHA 4I6GA 3AG4E 3ABLE 4N39A 4UI9J 2I1KA 4O1PA 3D9KA 4ANXA 1IHBA 3UM1A 2P58C 4WWOA 1ELWA 2P9SG 3C98A 3RSEG 4RQIA 1WDYA 5AQ7A 4K5AB 5DBKA 3SO8A 2Y4UA 3ML9A 2J8SD 4A3TA 5BUZA 2ONDA 3BEEA 4F53A 2X6JA 4O6FA 5AQ9A 3CHRA 3Q47B 3Q78A 2AXUA 2FBNA 3UPVA 3AU4A 2XGMA 4GTMA 1KT0A 3B7RL 5FQ6A 4G23A 3TG5A 3TXNA 3MGBA 2LO6A 3ZRHA 1DNPA 1UOHA 4UI9C 1X5BA 4WNGA 2F0YA 2CFUA 2VGEA 1DCQA 2QYJA 3KS2A 2VGXB 1DC2A 1QBQA 4U8HA 2XZTG 5EX3A 2Y69E 4GAAA 3FHEA 1SA5A 1H19A
chains in the Genus database with same CATH topology
1YYHA 5ENPD 5CBOA 5EYPF 4QQIA 4HNAD 4LG6A 1IHBA 1MX6A 2QC9A 1YMPA 3TWRA 2HE0A 3EU9A 4CYMD 3V79K 1D9SA 4RLYA 4ZHBA 5EIDA 5CBNA 4LSZE 4UUCA 2B0OE 1BLXB 2DVWA 5FINA 4HI8A 4ATZD 3D9HA 2A5EA 1WDYA 1S70B 5AQ7A 3TWSA 2XEEA 4K5AB 4Z68A 4ZFHA 2ETCA 1N0QA 2XEHA 3B7BA 4O1OA 3SO8A 4O60A 1MJ0A 5KBAA 2J8SD 4K5CA 4N5QA 5EN5D 3JXJA 1AWCB 1NFIE 4K5BA 3HG0D 1BI8B 2V5QC 2JABA 3Q9NC 4HI9A 5ENTD 2DZOA 5BXUA 5ITZF 1OT8A 4C48B 1A5EA 4DX1A 3TWVA 4J8YA 3ZU7B 3NBNB 4JB8P 4U8VD 4U96D 4DX6D 4HRMB 3TWXA 4DX2A 4DX5D 1BI7B 3NOGD 5AN8A 4HRNA 2ZGDA 4GMRA 4BETA 3J5QB 5AQ9A 5ENRD 5JMND 1BU9A 3TWUA 3T8KA 2L6BA 3W9GA 3ZUVB 2F8YA 3EHRA 5KWDA 3B95A 4QFVA 4BSZB 4DRXE 2V4HC 3C5RA 4HBDA 3TWWA 4GPMA 1MX2A 1MX4A 4OAVB 4J7WA 2AJAA 4YDYA 4HLLA 3J5PA 3KEAA 3LJNA 5CEAA 1N11A 1AP7A 3JXIA 5HKPA 5AQAA 3V30A 1YCSB 2XENA 4B93B 3W9FA 5AAOA 5JA4D 1OY3D 2MYOA 5HS0A 3AJIA 3V2XA 4HB5A 3EHQA 3V2OA 2KBXA 1QYMA 4F6RD 2F37A 1N0RA 3TWQA 1K1AA 1SVXA 4DX7D 5BXOA 3UTMA 1K1BA 2XZDG 4NIKA 2DWZA 3HRAA 3DEOA 5CERB 5FIOA 2FO1E 2RFAA 1UOHA 5HRYA 2ZGGA 5KNHD 2ETBA 2Y1LE 3ZNGA 4BERA 1K3ZD 3AAAC 4HQDA 5EYLA 1SW6A 3F6QA 1TR4A 3UXGA 2NYJA 5EIBE 2BKKB 4G8KA 3UI2A 5KNGA 1IXVA 2DZNA 3NOCD 2KXPC 3T9KA 5ENSD 5AARA 2BKGA 2VGEA 5ENQD 5CECB 1IKND 4HRLA 5AQBA 5EILA 5ENOD 1DCQA 2QYJA 2RFMA 4G8LA 4BESA 2P2CP 1BD8A 3DEPA 4U8YD 1G3NB 2Y0BG 3TWTA 3V31A 4DUIA 1DC2A 1WG0A 3Q9UC 4U95D 5D66A 2XZTG 4OAUC 4LNUD 4BEPA 5CEDB 4TUMA 3ZKJA 2PNNA 4F1PA 3JUEA 3IXEA 4CZ2D 4A63B 4O1PA 2ETAA 4YDWA 2F8XK 1MYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYH A;  5ENP D;  5CBO A;  5EYP F;  4QQI A;  4HNA D;  4LG6 A;  1IHB A;  1MX6 A;  2QC9 A;  1YMP A;  3TWR A;  2HE0 A;  3EU9 A;  4CYM D;  3V79 K;  1D9S A;  4RLY A;  4ZHB A;  5EID A;  5CBN A;  4LSZ E;  4UUC A;  2B0O E;  1BLX B;  2DVW A;  5FIN A;  4HI8 A;  4ATZ D;  3D9H A;  2A5E A;  1WDY A;  1S70 B;  5AQ7 A;  3TWS A;  2XEE A;  4K5A B;  4Z68 A;  4ZFH A;  2ETC A;  1N0Q A;  2XEH A;  3B7B A;  4O1O A;  3SO8 A;  4O60 A;  1MJ0 A;  5KBA A;  2J8S D;  4K5C A;  4N5Q A;  5EN5 D;  3JXJ A;  1AWC B;  1NFI E;  4K5B A;  3HG0 D;  1BI8 B;  2V5Q C;  2JAB A;  3Q9N C;  4HI9 A;  5ENT D;  2DZO A;  5BXU A;  5ITZ F;  1OT8 A;  4C48 B;  1A5E A;  4DX1 A;  3TWV A;  4J8Y A;  3ZU7 B;  3NBN B;  4JB8 P;  4U8V D;  4U96 D;  4DX6 D;  4HRM B;  3TWX A;  4DX2 A;  4DX5 D;  1BI7 B;  3NOG D;  5AN8 A;  4HRN A;  2ZGD A;  4GMR A;  4BET A;  3J5Q B;  5AQ9 A;  5ENR D;  5JMN D;  1BU9 A;  3TWU A;  3T8K A;  2L6B A;  3W9G A;  3ZUV B;  2F8Y A;  3EHR A;  5KWD A;  3B95 A;  4QFV A;  4BSZ B;  4DRX E;  2V4H C;  3C5R A;  4HBD A;  3TWW A;  4GPM A;  1MX2 A;  1MX4 A;  4OAV B;  4J7W A;  2AJA A;  4YDY A;  4HLL A;  3J5P A;  3KEA A;  3LJN A;  5CEA A;  1N11 A;  1AP7 A;  3JXI A;  5HKP A;  5AQA A;  3V30 A;  1YCS B;  2XEN A;  4B93 B;  3W9F A;  5AAO A;  5JA4 D;  1OY3 D;  2MYO A;  5HS0 A;  3AJI A;  3V2X A;  4HB5 A;  3EHQ A;  3V2O A;  2KBX A;  1QYM A;  4F6R D;  2F37 A;  1N0R A;  3TWQ A;  1K1A A;  1SVX A;  4DX7 D;  5BXO A;  3UTM A;  1K1B A;  2XZD G;  4NIK A;  2DWZ A;  3HRA A;  3DEO A;  5CER B;  5FIO A;  2FO1 E;  2RFA A;  1UOH A;  5HRY A;  2ZGG A;  5KNH D;  2ETB A;  2Y1L E;  3ZNG A;  4BER A;  1K3Z D;  3AAA C;  4HQD A;  5EYL A;  1SW6 A;  3F6Q A;  1TR4 A;  3UXG A;  2NYJ A;  5EIB E;  2BKK B;  4G8K A;  3UI2 A;  5KNG A;  1IXV A;  2DZN A;  3NOC D;  2KXP C;  3T9K A;  5ENS D;  5AAR A;  2BKG A;  2VGE A;  5ENQ D;  5CEC B;  1IKN D;  4HRL A;  5AQB A;  5EIL A;  5ENO D;  1DCQ A;  2QYJ A;  2RFM A;  4G8L A;  4BES A;  2P2C P;  1BD8 A;  3DEP A;  4U8Y D;  1G3N B;  2Y0B G;  3TWT A;  3V31 A;  4DUI A;  1DC2 A;  1WG0 A;  3Q9U C;  4U95 D;  5D66 A;  2XZT G;  4OAU C;  4LNU D;  4BEP A;  5CED B;  4TUM A;  3ZKJ A;  2PNN A;  4F1P A;  3JUE A;  3IXE A;  4CZ2 D;  4A63 B;  4O1P A;  2ETA A;  4YDW A;  2F8X K;  1MYO A; 
#chains in the Genus database with same CATH topology
 1HG2 A;  1NA3 A;  1FPP A;  2IF4 A;  3CVX A;  1EYH A;  4UQY A;  3S2A A;  1N4P A;  4FUL A;  3X2Q E;  4A1S A;  4N3B A;  4ANW A;  3DRA A;  3D9P A;  1KZP A;  3MZL B;  4YVQ C;  3UUX A;  4N2S A;  4HI9 A;  3ASN E;  1IQR A;  5AJL A;  3KD7 A;  4F1S A;  5ENN A;  4I1A A;  4L23 A;  3TWX A;  3NOG D;  3ABM E;  3EHR A;  4DRX E;  3KEZ A;  2V4H C;  3C5R A;  3ZEF A;  4OAV B;  3KSL A;  2QFC A;  5CEA A;  2V4L A;  5JA4 D;  5HS0 A;  3V2X A;  2KBX A;  2MOW A;  3AG3 E;  2XZD G;  3QB2 A;  2VSX E;  4APO A;  4FP7 A;  3B7S A;  3UMV A;  4GPK A;  4GTT A;  3UI2 A;  2CHZ A;  3T9K A;  2Y4T A;  2ZXW E;  4G8L A;  2VTB B;  3URZ A;  3WXX A;  2PQR A;  1OWM A;  5D66 A;  3Q75 A;  4OAU C;  4FC8 A;  5KCM A;  3VTY A;  2R02 A;  3RRN B;  2WXK A;  4OVV A;  1SZ9 A;  3SHF A;  4LG6 A;  3LCA A;  3EU9 A;  5E76 A;  3V79 K;  4RLY A;  5KJM A;  4KZ0 A;  2DVW A;  2HO1 A;  3SFX A;  4ME2 A;  3SNX A;  4Z68 A;  1D8E A;  4I2Z A;  4PUC A;  5ANL A;  3LDZ A;  4K5B A;  1BI8 B;  2I1J A;  4Q69 A;  1QQE A;  1H2T C;  3U64 A;  4UWK A;  3CHM A;  3QC1 A;  3VLD A;  3T8K A;  4XKC A;  1H6P A;  5ANR A;  4P29 A;  2IJG X;  4I2W A;  4U7E B;  1IYG A;  4TRQ A;  4JHR A;  2HR2 A;  1EF1 C;  1PY1 A;  1UN8 A;  3UT7 A;  4RSY A;  2RG8 A;  3EIJ A;  4YDE A;  1QYM A;  3FUJ A;  3ZVV A;  4WAF A;  2KCL A;  2XQ0 A;  4DX7 D;  5BXO A;  4NIK A;  2EIL E;  4C0M A;  5HRY A;  3FY4 A;  2YHC A;  3FU3 A;  3FTW A;  4I17 A;  3HXC A;  2AW6 A;  3EIQ C;  3Q49 B;  4I43 A;  3CKC A;  1KT1 A;  5DIZ A;  2RFM A;  5EX0 A;  3RU0 A;  1WG0 A;  3Q9U C;  1XGW A;  3ZKJ A;  4DK5 A;  5G05 C;  2GRL A;  3QWW A;  2I2O A;  1JPL A;  1YYH A;  4ILI A;  4JHJ A;  3P2B A;  4ZHB A;  3BU8 A;  4Q96 A;  4ATZ D;  4GCN A;  1TNY A;  4ZFH A;  2XEH A;  3B13 A;  4EHM A;  4O60 A;  3MEK A;  2Y3A A;  3QKY A;  5LCW C;  1AWC B;  4U63 A;  3DSU A;  1A5E A;  5HQ8 A;  4U8V D;  5JJT A;  2XPY A;  2XPI A;  4BET A;  3L82 A;  4ILG A;  4FLH A;  4GZD A;  3FEY A;  4IUL A;  2AXV A;  3CEQ A;  4GA1 A;  1YA0 A;  2I9C A;  3ZYQ A;  2FI7 A;  3CVY A;  1B89 A;  3RRM B;  5BV0 A;  4BWR A;  1TJF A;  4GTS A;  5J08 A;  5AAO A;  1OY3 D;  1FCH A;  4AY6 A;  4Q94 A;  4CGW A;  2OCC E;  3DXM G;  3D9J A;  3CSF A;  3L6A A;  4HLE A;  4XI0 A;  1ZB1 A;  4BX9 A;  2GRM A;  3Q15 A;  4OVU A;  3PZ3 A;  2VSN A;  2C0M A;  5EIB E;  3ASF A;  2H6I A;  4U04 A;  4URK A;  3L54 A;  5EIL A;  3GYZ A;  1HG5 A;  1BD8 A;  1TN7 A;  2P2C P;  3DSV A;  4J8E A;  4AVX A;  4JZY A;  4TXP A;  4I1O B;  3I4R B;  2UWJ G;  2ZU6 B;  3AG2 E;  3JUE A;  2P9I G;  2WVI A;  4RG6 A;  4N2Q A;  3FTV A;  3UKU G;  4I9C A;  2LAH A;  3G2U A;  1BLX B;  4DI3 A;  4FHK A;  4HI8 A;  1JUQ A;  1OCC E;  1S70 B;  2J07 A;  3GW4 A;  3LYA A;  3DWL G;  4GZ5 A;  5KBA A;  3PE4 A;  1NFI E;  2VSO E;  3NZS A;  5CCL A;  3TWV A;  4DX2 A;  4B0Z A;  4GMR A;  2P9U G;  3CVW A;  2EIM E;  2DCP A;  4DJA A;  4BSZ B;  5A6C A;  3OTN A;  4GPM A;  5HI7 A;  2XHE A;  1NI1 A;  2AJA A;  5LX8 A;  3KEA A;  5FWQ A;  1WY6 A;  3ONL A;  4ABN A;  4G25 A;  4MLP A;  4DLO A;  3TWQ A;  1K1A A;  1OWO A;  4AJW A;  3CK9 A;  2IU1 A;  3DEO A;  3SD5 A;  5FIO A;  4BER A;  2V8S E;  3FUN A;  4EEC A;  4G8K A;  4BX8 A;  3Q7F A;  5CEC B;  2IQC A;  1V54 E;  2QYU A;  4FAD A;  3CHQ A;  3DEP A;  4LNB A;  2E0I A;  3ZYK A;  1KPS B;  4IN3 B;  4U95 D;  4IRU A;  4BEP A;  1N94 A;  2C0L A;  2AVP A;  1MHQ A;  1TNB A;  4DPR A;  2J4D A;  3TWR A;  4JVS A;  4KXK B;  4ACL A;  4UUC A;  3PZ2 A;  3NB2 A;  3TL5 A;  1N0Q A;  1MJ0 A;  4PS8 A;  2R03 A;  2BUG A;  4M7C A;  4U0Z A;  2PQN A;  3P1U A;  2FUL A;  4DX5 D;  3ZXS A;  1E90 A;  4GZ3 A;  3BG0 B;  2I6H A;  3LJ3 A;  3GZ2 A;  4JPS A;  3TWU A;  2L6B A;  1H6K A;  2CHX A;  3Q79 A;  3TWW A;  1HE8 A;  4KVO A;  1HS6 A;  2IY0 C;  4K03 A;  4JHK A;  4A1G A;  1YCS B;  3W9F A;  1LTX A;  1TJC A;  5AJD A;  3ZHE B;  3NQP A;  1N95 A;  3V2O A;  3QAR A;  3R9A B;  1TNZ A;  1N0R A;  4TXQ A;  1SVX A;  3ULY A;  2WB2 A;  1O1T A;  1K1B A;  2GRR B;  4LUN U;  2GGF A;  3RAU A;  2IO3 C;  5FT9 A;  3KSQ A;  2FO1 E;  5BT1 A;  1MZC A;  5KJK A;  4IYP A;  4AXH A;  3FUH A;  3RKV A;  4HQD A;  5EYL A;  1SW6 A;  5D0O D;  3E30 A;  3C72 A;  4KMO A;  2PM7 A;  1V55 E;  3MYV A;  4I1M A;  1SZA A;  1UJK A;  1E8X A;  3BUA A;  4BTA A;  3QAQ A;  4BTB A;  2CHW A;  2LXL A;  4E85 A;  4AEZ C;  2PZI A;  1O1S A;  3UIP C;  3MKR A;  1HF8 A;  1O5M A;  4YND A;  2OV8 A;  1D9S A;  5CBN A;  3SZ7 A;  3C3O A;  2GRQ B;  1UG3 A;  4XX5 A;  2NXP A;  3LEW A;  2X6I A;  4N5Q A;  2VYI A;  4WWN A;  1OT8 A;  4J8Y A;  5G04 C;  1EDU A;  5BPP A;  5CCM A;  4GA0 A;  1NZN A;  2F8Y A;  1HU3 A;  4XZ4 A;  3PEV B;  3CHO A;  4WNE A;  1HO8 A;  4KVM A;  3IKO B;  1UN9 A;  3S7F A;  2LSU A;  3QWV A;  3Q73 A;  1FT1 A;  3LY9 A;  4NRH B;  3SGH A;  3PE3 A;  3CV0 A;  3HHM A;  2PM6 A;  3UIO C;  4GYO A;  3FDH A;  3DPY A;  4APF A;  3NZU A;  1ELK A;  5T3R A;  3EJN A;  4GTV A;  2OEW A;  3Q7A A;  2WQH A;  1U3C A;  5B3S E;  5AQB A;  3L9T A;  4AM9 A;  2XGO A;  3FP3 A;  2GRN B;  3U4T A;  2AWI A;  3MKQ A;  2P9K G;  4MS6 A;  4F1P A;  5B1B E;  2X6H A;  2X6F A;  3ESL A;  2J09 A;  4WND A;  2UY1 A;  1Z3X A;  4GML A;  3IEG A;  2KZT A;  4I9E A;  2RD0 A;  4G24 A;  2B0O E;  1LD8 A;  1Z6T A;  3QJZ A;  3DSS A;  1FT2 A;  4UQX A;  3ZN3 A;  1PC2 A;  2WQ6 A;  3FH7 A;  2WMO A;  4J0U A;  5M72 A;  4O1O A;  5FZS A;  3OXG A;  3IV0 A;  4H7Y A;  1Y6I A;  3FUD A;  4OYS A;  5ITZ F;  3APD A;  3MJW A;  3HYM B;  3QWP A;  3UT8 A;  1W3B A;  2H6G A;  3RRU A;  2EQX A;  4WWP A;  2BTD A;  3ZIM A;  3FUI A;  2H6H A;  2EIK E;  4EBA A;  3J5P A;  2CFZ A;  3EU5 A;  3JXI A;  1QNF A;  3QDN A;  2LNI A;  5BNW A;  1JCQ A;  2RFA A;  1L5J A;  3HXB A;  4G26 A;  3LVR E;  5KNG A;  2WXP A;  2DZN A;  3ULE G;  5ENS D;  5ENO D;  3ZHE A;  4HOQ A;  2B6C A;  2X38 A;  4HOR A;  2L0I A;  4AY5 A;  3AS5 A;  4CDN A;  1TEZ A;  4FU3 A;  4GB9 A;  2ETA A;  4YDW A;  1MYO A;  4GZC A;  5ENP D;  4Y6C A;  4X8Q A;  5FQ8 A;  2HE0 A;  5A23 A;  2JLB A;  4GTR A;  3PDN A;  2A5E A;  3TWS A;  4ACK A;  3UX4 A;  3B7B A;  5E75 A;  4FJY A;  4GMJ A;  4GTO A;  4GA2 A;  1ZU2 A;  2WXM A;  5JMN D;  3ZUV B;  5LOZ A;  3CVN A;  4GTQ A;  3LKU A;  1Z3Y A;  4L2Y A;  3L08 A;  5LCW J;  3HIZ A;  1P5Q A;  3CIA A;  4XE0 A;  2M63 A;  5C2Y A;  5A7D B;  3DSW A;  3FU6 A;  2P9L G;  2A4Z A;  3PUJ A;  2NYJ A;  2BKK B;  1N4S A;  3UM0 A;  4YVO A;  5AAR A;  5ENQ D;  2BF0 X;  4U8Y D;  3CVV A;  3TWT A;  4DUI A;  2R05 A;  4F3V A;  4EZL A;  4R7L A;  4XI9 A;  4BY6 A;  4JL0 A;  2F8X K;  1WM5 A;  3PNT B;  3AS8 A;  1YMP A;  3OXL A;  4UWH A;  1QZ2 A;  1N9A A;  4B8A A;  1UJJ A;  2IOL A;  4XKB A;  4TUU A;  2VQ2 A;  3MX3 A;  3IHV A;  4HS2 A;  2KCV A;  3R9M A;  4U96 D;  4DX6 D;  4K0R A;  2PL2 A;  3CVU A;  4B89 A;  2DYR E;  4WUY A;  4EPZ A;  1EPU A;  3AS4 A;  1KZO A;  3LJN A;  5HKP A;  3V30 A;  4B93 B;  2LXM A;  3CVL A;  4CDM A;  4ANU A;  2MYO A;  3UQ3 A;  4LCT A;  3DST A;  4PDX A;  2F37 A;  4DLQ A;  2EIJ E;  2WXG A;  3ZNG A;  5KNH D;  1INZ A;  4C0E A;  4XEI G;  3UKR G;  3TAX A;  3TGO A;  4HVB A;  3EHM A;  3E4B A;  3PS6 A;  1H6O A;  1IKN D;  5CHE E;  3ZYL A;  2GRO B;  5JJ6 A;  4L2L A;  1HXI A;  3MA5 A;  1E8Z A;  5C1D A;  3HDX A;  2PNN A;  3I5P A;  3RO2 A;  1XNF A;  3FUM A;  3JYS A;  2L9B A;  1HH8 A;  2AXZ A;  2LSV A;  1N4Q A;  2E2E A;  2V0P A;  2J49 A;  1TNO A;  3D9H A;  1UW4 B;  5LP0 A;  4JEU A;  1S64 A;  3G2V A;  1OCR E;  2KM4 A;  2QZA A;  2NC9 A;  3G2T A;  3CLJ A;  4GCO A;  2JAB A;  4LEU A;  1E8W A;  4FA6 A;  3ZYM A;  4GTP A;  3FUF A;  3JCK C;  5AN8 A;  3FUE A;  1KLX A;  4JW1 A;  5KWD A;  3VTX A;  3SI5 A;  4RVB A;  5AEN A;  1MX2 A;  4ILH B;  3SF4 A;  4AP2 A;  3ABK E;  4N3C A;  3AJI A;  3R7Q A;  4J8D A;  4HB5 A;  1H0A A;  4EZJ A;  5KJN A;  2IOS A;  4C9B B;  5J90 A;  1LF8 A;  3D9O A;  4G11 A;  5B1A E;  3RO3 A;  1NP7 A;  5T4Y A;  1TR4 A;  2YIN A;  1U3D A;  4G1T A;  3EUV A;  5IY5 E;  1OWP A;  3FU5 A;  3PEU B;  3ONK A;  1G3N B;  5LFA A;  3T8M A;  2ION A;  3LS8 A;  3RK6 A;  1TYQ G;  5G55 A;  4JC8 A;  1NL4 A;  4RG9 A;  4W9R A;  5KJL A;  3E37 A;  4BSX A;  4HOS A;  3ASH A;  4N5C A;  5CBO A;  4HXI A;  5FZR A;  1S0P A;  3LVQ E;  4A3V A;  5CMW A;  2XS8 A;  3VLE A;  1TNU A;  3ZFW A;  1DVP A;  5ENT D;  3ZGQ A;  4C48 B;  2RKK A;  2WXF A;  4TXR A;  1BI7 B;  4CEM A;  4HRN A;  5ENR D;  4JA9 A;  3MKQ B;  2XCB A;  3B95 A;  3D3M A;  1RZ4 A;  1N54 A;  1SA4 A;  1MQS A;  3HXE A;  4PS7 A;  1BPO A;  3APC A;  2WMN A;  3S7D A;  1TN6 A;  3HVE B;  3ULQ A;  4GZ6 A;  2XEN A;  3MCX A;  1X81 A;  1HX8 A;  1RW2 A;  3O48 A;  2KC7 A;  1OUV A;  5AIJ A;  1D8D A;  4WNF A;  2C2L A;  3BQO A;  4H7X A;  1U2V G;  3OAW A;  2ZGG A;  5CMY A;  2Y1L E;  3Q4A B;  2Q7F A;  4U0S A;  3CVQ A;  3VLF A;  3F6Q A;  3UXG A;  3KAE A;  5D2M C;  2KXP C;  2R5S A;  2IEJ A;  4F7A A;  5FQ7 A;  3SBT B;  3CHP A;  4HRL A;  2FO7 A;  4BES A;  3JQ0 A;  3SBS A;  4JXT A;  3QOU A;  4GYW A;  2L0T B;  2J08 A;  3CK7 A;  2ZIR A;  4L9P A;  3PRZ A;  4E6H A;  3E34 A;  2OVF A;  3WG7 E;  4BFR A;  3NAW A;  1Z5S C;  4QQI A;  3G2W A;  3FEX A;  3DPD A;  2ILR A;  4LSZ E;  2WXL A;  4KT6 B;  1JWG A;  3D9L A;  3UT4 A;  4B8C B;  4K5C A;  5EN5 D;  3N71 A;  2MHK A;  2WXH A;  3HG0 D;  2DZO A;  4BT9 A;  3ZU7 B;  3AG1 E;  2WQ7 A;  4HRM B;  3TXM A;  4EBA G;  2YNQ A;  1VDY A;  2NSZ A;  2GRP B;  4I6J A;  5ARF A;  3IBE A;  3L16 A;  4V3I A;  3MV3 B;  4J8S A;  2X3M A;  1HFA A;  3EDT B;  4CT0 A;  4L1B A;  4YDO A;  2CG2 A;  3T5X A;  5AQA A;  3ZPJ A;  3FTX A;  2VJ8 A;  2FEZ A;  3FU0 A;  3UTM A;  2VGY A;  3JUI A;  1OWL A;  2DWZ A;  3ZXP A;  3T5V A;  4J8F A;  2P9N G;  4NQ0 A;  2JEK A;  3CKB A;  1K8K G;  1K3Z D;  2XRZ A;  3DXK G;  3C3Q A;  3LY8 A;  3GZ1 A;  4HOT A;  3S7B A;  1JCS A;  4JD2 G;  4UWG A;  2BED A;  2YQ8 A;  1E7U A;  4LNU D;  5CED B;  4NAC A;  3IXE A;  4AIF A;  2X6K A;  3K9I A;  5FTP A;  2J9Q A;  3CGH A;  1JCR A;  4XIF A;  4CT4 A;  2L6J A;  3FTS A;  2R17 C;  5G05 J;  4FJZ A;  2H6F A;  4I6E A;  2DBA A;  3JXJ A;  1OCZ E;  1E8Y A;  5H7P A;  2V5Q C;  5BXU A;  5EDS A;  4PS3 A;  4M3O A;  2WXJ A;  4JB8 P;  3APF A;  3FFL A;  3AU5 A;  3QNK A;  5CRV A;  3O4Z A;  5D0Q D;  1BU9 A;  3D9N A;  1GW6 A;  3LXU X;  1IHG A;  4CGV A;  4NUR A;  3PNL B;  3CHS A;  3PVL A;  4J6I A;  2VSY A;  3FH8 A;  4HBD A;  5BV1 A;  1ZBP A;  3FH5 A;  1HZ4 A;  4LRZ A;  2XCC A;  1N11 A;  5BW8 C;  3C3R A;  2KZT B;  5T8I A;  4F6R D;  2R59 A;  3PH0 C;  5AYW D;  2WXQ A;  5FJY A;  4CCA A;  2WXN A;  5CER B;  3L22 A;  2A5U A;  3D9M A;  3CST A;  3LY7 A;  2HM8 A;  3AAA C;  3LPZ A;  2UY1 B;  1E7V A;  3PRE A;  2P9P G;  1TN8 A;  2KCK A;  3ASD A;  2IO2 C;  4GYY A;  2Y0B G;  3DBS A;  3SFY A;  3PZ1 A;  4KZC A;  5FQ4 A;  4UQZ A;  3UM3 A;  2LAI A;  4HOU A;  4TUM A;  3R7R A;  4CZ2 D;  1DCE A;  4A63 B;  2VTB A;  3SQV A;  4FLB A;  1JWF A;  4UWF A;  5EYP F;  4HNA D;  2MRI A;  1FVH A;  2QC9 A;  3HVE A;  1Y8M A;  3L17 A;  3PZD A;  4CYM D;  3JQ1 A;  4N3A A;  5EID A;  5G04 J;  2DIW A;  5FIN A;  4ANV A;  3Q5M A;  3TJP A;  5G2N A;  2DYS E;  3CVP A;  1A17 A;  4DI4 A;  5JHB A;  1NA0 A;  2XS1 A;  1N52 A;  1E96 B;  1H2V C;  4ATG A;  2V5F A;  3Q9N C;  2XPZ A;  3DSX A;  4CRW A;  3FUL A;  2QY7 A;  4AV7 A;  2XRY A;  3U66 A;  1Q2Z A;  2YHE A;  3J5Q B;  3W9G A;  1OWN A;  3PZ4 A;  4GU5 A;  3CR3 A;  4EQF A;  2LUH A;  1OXJ A;  1LD7 A;  3ASO E;  3PUK A;  3U9W A;  4U07 A;  4HFG A;  1WAO 1;  3E32 A;  1AP7 A;  5ARG A;  2WPV A;  3OXF A;  2IFU A;  2EIN E;  2KAT A;  3QK0 A;  4CDR A;  3FTY A;  2R2L A;  4D10 C;  1S63 A;  3S7J A;  3FTU A;  3ISM C;  2J4B A;  3HRA A;  3ASG A;  3MV2 B;  2FF4 A;  4G2V A;  3FUK A;  3I3N A;  2XGS A;  1ELR A;  2OVB A;  1N4R A;  2HYZ A;  1OCO E;  3V31 A;  3TG4 A;  3B7U X;  3G2S A;  4KBQ A;  3I4G A;  3GZS A;  3B7T A;  4UWL A;  2VGX A;  3L13 A;  3HXF A;  3UM2 A;  2WXR A;  3U3W A;  4PH4 B;  3UIN C;  1MX6 A;  3D9I A;  4MKT A;  3CQG B;  4AOF A;  4L7T A;  3RIB A;  2WXO A;  5JJ7 A;  4EZK A;  2WXI A;  2XEE A;  2WM9 A;  3NF1 A;  5CRU A;  2ETC A;  4KYO B;  3BG1 B;  3ZW3 A;  4MRU A;  3RJV A;  2OEV A;  3ESK A;  3CK8 A;  4U0U A;  3SFZ A;  5JHA A;  4DX1 A;  3NBN B;  3E33 A;  2XEV A;  1O1R A;  1H2U A;  4A55 A;  3FWV A;  2ZGD A;  1PAQ A;  4QFV A;  4Y6W A;  3EHN A;  4JA7 A;  4TV3 A;  1MX4 A;  2GW1 A;  3CQC B;  4J7W A;  3FTZ A;  4YDY A;  4HLL A;  3IHY A;  4BT8 A;  5FZQ A;  1IQU A;  1FVF A;  3EHQ A;  2CG3 A;  3ML8 A;  2OOE A;  4LNG A;  4UI9 K;  4MBG A;  2ETB A;  5EKQ D;  4B94 A;  4FHJ A;  4LER A;  3HXD A;  3ENE A;  1SQM A;  1IXV A;  3NOC D;  3SY2 A;  2BKG A;  2ZIS A;  4JEH A;  4I6G A;  3AG4 E;  3ABL E;  4N39 A;  4UI9 J;  2I1K A;  4O1P A;  3D9K A;  4ANX A;  1IHB A;  3UM1 A;  2P58 C;  4WWO A;  1ELW A;  2P9S G;  3C98 A;  3RSE G;  4RQI A;  1WDY A;  5AQ7 A;  4K5A B;  5DBK A;  3SO8 A;  2Y4U A;  3ML9 A;  2J8S D;  4A3T A;  5BUZ A;  2OND A;  3BEE A;  4F53 A;  2X6J A;  4O6F A;  5AQ9 A;  3CHR A;  3Q47 B;  3Q78 A;  2AXU A;  2FBN A;  3UPV A;  3AU4 A;  2XGM A;  4GTM A;  1KT0 A;  3B7R L;  5FQ6 A;  4G23 A;  3TG5 A;  3TXN A;  3MGB A;  2LO6 A;  3ZRH A;  1DNP A;  1UOH A;  4UI9 C;  1X5B A;  4WNG A;  2F0Y A;  2CFU A;  2VGE A;  1DCQ A;  2QYJ A;  3KS2 A;  2VGX B;  1DC2 A;  1QBQ A;  4U8H A;  2XZT G;  5EX3 A;  2Y69 E;  4GAA A;  3FHE A;  1SA5 A;  1H19 A; 
#chains in the Genus database with same CATH homology
 1YYH A;  5ENP D;  5CBO A;  5EYP F;  4QQI A;  4HNA D;  4LG6 A;  1IHB A;  1MX6 A;  2QC9 A;  1YMP A;  3TWR A;  2HE0 A;  3EU9 A;  4CYM D;  3V79 K;  1D9S A;  4RLY A;  4ZHB A;  5EID A;  5CBN A;  4LSZ E;  4UUC A;  2B0O E;  1BLX B;  2DVW A;  5FIN A;  4HI8 A;  4ATZ D;  3D9H A;  2A5E A;  1WDY A;  1S70 B;  5AQ7 A;  3TWS A;  2XEE A;  4K5A B;  4Z68 A;  4ZFH A;  2ETC A;  1N0Q A;  2XEH A;  3B7B A;  4O1O A;  3SO8 A;  4O60 A;  1MJ0 A;  5KBA A;  2J8S D;  4K5C A;  4N5Q A;  5EN5 D;  3JXJ A;  1AWC B;  1NFI E;  4K5B A;  3HG0 D;  1BI8 B;  2V5Q C;  2JAB A;  3Q9N C;  4HI9 A;  5ENT D;  2DZO A;  5BXU A;  5ITZ F;  1OT8 A;  4C48 B;  1A5E A;  4DX1 A;  3TWV A;  4J8Y A;  3ZU7 B;  3NBN B;  4JB8 P;  4U8V D;  4U96 D;  4DX6 D;  4HRM B;  3TWX A;  4DX2 A;  4DX5 D;  1BI7 B;  3NOG D;  5AN8 A;  4HRN A;  2ZGD A;  4GMR A;  4BET A;  3J5Q B;  5AQ9 A;  5ENR D;  5JMN D;  1BU9 A;  3TWU A;  3T8K A;  2L6B A;  3W9G A;  3ZUV B;  2F8Y A;  3EHR A;  5KWD A;  3B95 A;  4QFV A;  4BSZ B;  4DRX E;  2V4H C;  3C5R A;  4HBD A;  3TWW A;  4GPM A;  1MX2 A;  1MX4 A;  4OAV B;  4J7W A;  2AJA A;  4YDY A;  4HLL A;  3J5P A;  3KEA A;  3LJN A;  5CEA A;  1N11 A;  1AP7 A;  3JXI A;  5HKP A;  5AQA A;  3V30 A;  1YCS B;  2XEN A;  4B93 B;  3W9F A;  5AAO A;  5JA4 D;  1OY3 D;  2MYO A;  5HS0 A;  3AJI A;  3V2X A;  4HB5 A;  3EHQ A;  3V2O A;  2KBX A;  1QYM A;  4F6R D;  2F37 A;  1N0R A;  3TWQ A;  1K1A A;  1SVX A;  4DX7 D;  5BXO A;  3UTM A;  1K1B A;  2XZD G;  4NIK A;  2DWZ A;  3HRA A;  3DEO A;  5CER B;  5FIO A;  2FO1 E;  2RFA A;  1UOH A;  5HRY A;  2ZGG A;  5KNH D;  2ETB A;  2Y1L E;  3ZNG A;  4BER A;  1K3Z D;  3AAA C;  4HQD A;  5EYL A;  1SW6 A;  3F6Q A;  1TR4 A;  3UXG A;  2NYJ A;  5EIB E;  2BKK B;  4G8K A;  3UI2 A;  5KNG A;  1IXV A;  2DZN A;  3NOC D;  2KXP C;  3T9K A;  5ENS D;  5AAR A;  2BKG A;  2VGE A;  5ENQ D;  5CEC B;  1IKN D;  4HRL A;  5AQB A;  5EIL A;  5ENO D;  1DCQ A;  2QYJ A;  2RFM A;  4G8L A;  4BES A;  2P2C P;  1BD8 A;  3DEP A;  4U8Y D;  1G3N B;  2Y0B G;  3TWT A;  3V31 A;  4DUI A;  1DC2 A;  1WG0 A;  3Q9U C;  4U95 D;  5D66 A;  2XZT G;  4OAU C;  4LNU D;  4BEP A;  5CED B;  4TUM A;  3ZKJ A;  2PNN A;  4F1P A;  3JUE A;  3IXE A;  4CZ2 D;  4A63 B;  4O1P A;  2ETA A;  4YDW A;  2F8X K;  1MYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...