1D9SA

Tumor suppressor p15(ink4b) structure by comparative modeling and nmr data
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
136
structure length
136
Chain Sequence
GSPGIHMLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 4 INHIBITOR B
publication title Tumor suppressor INK4: comparisons of conformational properties between p16(INK4A) and p18(INK4C).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 25
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1999-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1d9sA00
1YMPA 3AAAC 3W9GA 1N0QA 3HRAA 4U8YD 4G8LA 5JA4D 1N11A 1MX2A 4J8YA 3V31A 1BI7B 3KEAA 4QFVA 2V4HC 3DEOA 4F1PA 5BXUA 2DZNA 5EIDA 2NYJA 3W9FA 3V2OA 4K5CA 2Y0BG 3B95A 3Q9UC 4JB8P 4N5QA 5FIOA 4HB5A 4HQDA 4HBDA 3TWSA 5FINA 3TWVA 5D66A 1YCSB 2L6BA 2QC9A 4DX2A 1TR4A 2XEEA 1DCQA 3SO8A 3EHRA 3TWWA 5AQ9A 5EN5D 4OAUC 5ENPD 3J5PA 1G3NB 4U95D 3T9KA 5CBNA 1AWCB 2Y1LE 2HE0A 2RFAA 4ZHBA 2QYJA 3EHQA 4GPMA 3JXIA 1UOHA 4OAVB 4A63B 1IHBA 1OY3D 4GMRA 1MJ0A 5HRYA 4ZFHA 2XZDG 3ZNGA 5ITZF 5CEDB 4DUIA 1SVXA 4UUCA 1K3ZD 4O1PA 1SW6A 4CYMD 4HI8A 2ETCA 2XEHA 3AJIA 5AN8A 1BLXB 2F8XK 3V79K 5KNGA 4HLLA 4YDWA 3HG0D 3T8KA 5AAOA 2AJAA 3ZUVB 2F37A 4LSZE 4B93B 5ENOD 4U96D 2BKGA 2ETAA 3V2XA 4BERA 1OT8A 4BESA 4BSZB 3D9HA 5AARA 4O1OA 2JABA 4DX5D 3NBNB 1WG0A 1QYMA 2ZGDA 4C48B 2PNNA 3TWTA 2J8SD 5CBOA 2ETBA 1MX4A 2B0OE 3DEPA 5HKPA 1DC2A 5ENTD 2BKKB 5KBAA 1AP7A 4NIKA 5ENQD 4QQIA 4BETA 2DZOA 1BU9A 4DX7D 4RLYA 1YYHA 2P2CP 3IXEA 5AQBA 4HNAD 4K5AB 2DWZA 1D9SA 3B7BA 3UTMA 3TWXA 2KBXA 5KWDA 4HRLA 2DVWA 3TWUA 1NFIE 4BEPA 4DX1A 3Q9NC 5ENRD 4HI9A 4O60A 4U8VD 4TUMA 1N0RA 5HS0A 4DRXE 4F6RD 5CERB 2FO1E 1BI8B 1K1AA 2VGEA 2V5QC 3F6QA 1S70B 1WDYA 5ENSD 4K5BA 2RFMA 4LG6A 5BXOA 4YDYA 4DX6D 5EYLA 1IXVA 3NOCD 4HRMB 5CEAA 1IKND 3ZU7B 4Z68A 3V30A 5AQ7A 4G8KA 4HRNA 3JUEA 4LNUD 1MYOA 5CECB 3J5QB 2KXPC 3ZKJA 2XZTG 5AQAA 2ZGGA 2XENA 3C5RA 3EU9A 3UXGA 5EYPF 2F8YA 3NOGD 5EILA 1BD8A 3TWRA 1MX6A 5EIBE 1K1BA 3JXJA 2MYOA 3LJNA 3UI2A 5KNHD 4CZ2D 2A5EA 5JMND 3TWQA 4ATZD 4J7WA 1A5EA
chains in the Genus database with same CATH superfamily
3TG4A 1N0QA 5KJNA 4E6HA 4A55A 3KEAA 4TXPA 4N39A 3W9FA 3Q9UC 3CEQA 4EBAA 3DSXA 3TWVA 3BU8A 3NZSA 3B7RL 4IYPA 4GZ5A 3HXDA 1WAO1 1QQEA 2L0IA 5JHAA 1K3ZD 4O1PA 3CKCA 3OXGA 4I1OB 2PQNA 1H2TC 1QNFA 4KZCA 1LTXA 3DSUA 4C0EA 4EECA 4TUUA 2CG2A 3GZSA 3FUDA 2EINE 2JABA 2WXGA 2AXUA 4FHKA 3G2SA 2R5SA 4FP7A 4GMLA 1E8WA 3I3NA 1JCSA 1Z5SC 3FU0A 3P2BA 3DXMG 3TWUA 2UWJG 1FT2A 2VGEA 3G2VA 5DBKA 1UJKA 2AXVA 3GZ2A 4AM9A 2YQ8A 4KXKB 2V8SE 5CECB 1MYOA 4ACKA 2KXPC 4K03A 5EILA 4PDXA 1ZB1A 4I9CA 3LJNA 2XS8A 3SD5A 4AOFA 3TWQA 1KT1A 1H6PA 4OVVA 2DYRE 3CK9A 5EIDA 2IY0C 3C3RA 1UG3A 1H6KA 1D8EA 1YCSB 5CCMA 1OCRE 2YHCA 2VGXA 3T9KA 3HHMA 2XEVA 4RG6A 3LVRE 4P29A 1MJ0A 2IO3C 3ZNGA 4G24A 5CRUA 3TL5A 4I2ZA 4AP2A 3P1UA 2AXZA 1A17A 3ZVVA 3VTXA 3CV0A 3QARA 5ENNA 4G1TA 3TXMA 5AJLA 3CHRA 2BKKB 1XGWA 3UUXA 3HXEA 2LXLA 2GRRB 4L23A 1OCCE 4HORA 1HG2A 5EYLA 2A5UA 4L2YA 3BUAA 4E85A 2LSUA 1RZ4A 5ARFA 5LOZA 3RRNB 4FLHA 4WNDA 4A1GA 1MX6A 1K1BA 3PEUB 5JA4D 1MX2A 3JQ0A 1N52A 2OVBA 4HB5A 4UWFA 1PY1A 3APFA 2XS1A 3ZYKA 1SQMA 2X6JA 3FEYA 3Q47B 5AJDA 4J8FA 5BV1A 3TXNA 3CHQA 4JZYA 4OAVB 2IEJA 3LY9A 4W9RA 2E2EA 2MHKA 3SGHA 2ETCA 1MQSA 1DNPA 4PS7A 3V79K 3ZHEB 2R02A 3HG0D 3UT7A 4PH4B 3SFYA 2UY1B 5AARA 3TWTA 3L17A 1AP7A 2R03A 3MKRA 2DZOA 1QBQA 2L6JA 2XHEA 3ABME 4HS2A 3B13A 4I1AA 5CERB 3ML9A 2GRNB 3CQCB 4N2SA 3FU6A 2GGFA 2LSVA 4GMJA 3R7QA 2RFMA 1TNOA 3MX3A 5G55A 4YDYA 3C3OA 4UWHA 1N4SA 4BX8A 3Q15A 5CEAA 5AYWD 4EZLA 1HE8A 1EPUA 5AQAA 3RU0A 5JJ6A 1Y8MA 2CHWA 3FTZA 4CGWA 1KPSB 4CZ2D 1N54A 4YVQC 5M72A 1OXJA 3MZLB 3Q4AB 3Q5MA 3CHMA 5FZQA 3CHSA 3JCKC 2HM8A 4J8DA 4ANXA 5D66A 4M7CA 4DX2A 1TR4A 3NZUA 3QWVA 5CHEE 3B7TA 2EIKE 2FO7A 2XRYA 3SQVA 5HQ8A 2J09A 3J5PA 2NC9A 1V54E 1U3CA 4MRUA 2J07A 2WQHA 4DUIA 3UQ3A 4CYMD 2H6HA 2XGMA 2EQXA 1BLXB 3MEKA 5KNGA 3OTNA 2VSOE 5AENA 2OV8A 2C2LA 4ANUA 4U96D 4UWGA 2ETAA 3QKYA 3ZPJA 2WXMA 4C48B 2PNNA 5E76A 3PRZA 3OAWA 4HOSA 3L6AA 5AQBA 3ZIMA 3QDNA 4K5AB 3CVWA 5ANLA 4XI0A 3JUIA 5BNWA 2ZXWE 4WNEA 3D9JA 4TUMA 4F6RD 4I6GA 3RK6A 4L1BA 1MZCA 3R7RA 2OVFA 3D9IA 4AJWA 3G2TA 4G25A 4U0SA 3U64A 2P9SG 3E32A 3OXFA 4C9BB 2IOSA 5ARGA 2ZGGA 3VLEA 3T8MA 4RQIA 3D9OA 4DLOA 1HU3A 4JL0A 3JXJA 4WWOA 2H6GA 3BQOA 2WXJA 4FHJA 2R2LA 5KJLA 3AG3E 2P58C 4QFVA 4UWLA 3V2OA 3ASGA 4GU5A 3RRUA 2V0PA 2XEEA 3CSTA 3QAQA 4FJYA 5KCMA 2ZIRA 3APDA 3ASOE 4JPSA 2HE0A 3D9PA 2WQ7A 4RVBA 4RG9A 2OCCE 1OY3D 4ZFHA 2FBNA 3Q7AA 3WXXA 2EIME 4XKBA 2WMOA 3DSWA 4O1OA 2ZGDA 5FWQA 1JUQA 2NSZA 2JEKA 1TJCA 3DEPA 3PNLB 2B0OE 5HKPA 5T8IA 2XPZA 3FUEA 4DX7D 5BUZA 3AS4A 1U2VG 2RD0A 4JHKA 5KWDA 3CVUA 1NFIE 2XGSA 3ZYQA 4Y6CA 1BI8B 2CHZA 2IJGX 4NURA 2P9PG 3UKRG 3ZHEA 4J6IA 3FUJA 3L82A 1E8ZA 2UY1A 3KSQA 2VGYA 4GCNA 3TWRA 2A5EA 3ASNE 3ULEG 4AEZC 2QYUA 1A5EA 4G23A 4FC8A 4J8YA 3PZ1A 3VLDA 5BW8C 2NYJA 1H19A 4JB8P 3UM1A 4U7EB 3TWSA 2H6IA 2L6BA 2X3MA 1TJFA 4CDRA 3HXBA 1UOHA 3IBEA 3AG4E 2R59A 2WVIA 2LAHA 2WMNA 4KVOA 2OEWA 2FEZA 3U66A 3AS5A 3FUMA 2AWIA 4X8QA 2IONA 1HZ4A 1Z3YA 3CQGB 4FULA 3CHPA 4XX5A 4B93B 4GAAA 2LNIA 3EHNA 4GTVA 4DX5D 1E8YA 4AY5A 3VTYA 3IXEA 3IV0A 3UTMA 3Q73A 3MV3B 4HFGA 2J4BA 4U07A 2KATA 1P5QA 3S7DA 4JA9A 3UT8A 3HDXA 3DPDA 3JUEA 4LNUD 2C0MA 3EU9A 5EYPF 4URKA 2VQ2A 3LCAA 3Q49B 3CSFA 3SZ7A 2J49A 3PZ4A 3ZN3A 2IF4A 1HG5A 4NACA 2E0IA 1OWMA 2Y0BG 1O5MA 2ONDA 4N5QA 4YDOA 3LDZA 4BSXA 4DPRA 1E96B 4U63A 4XEIG 1TN7A 2RKKA 2L0TB 5BPPA 4O6FA 5G04J 4ABNA 3EUVA 1SW6A 3D9LA 3SNXA 4F53A 3SI5A 2VTBB 1TN8A 3RSEG 5C2YA 4DI3A 4GZ6A 1B89A 3CVXA 4WNGA 3CVVA 1OWLA 4A1SA 3TWXA 4B94A 4U0UA 2LUHA 4CRWA 3Q9NC 4HI9A 3I5PA 4N3BA 2P9KG 1IXVA 4Y6WA 4GZCA 3PS6A 3ABLE 1KZOA 2XZTG 2XENA 2VSXE 4I9EA 4IULA 4A3VA 2NXPA 1BD8A 4JHRA 2MYOA 1L5JA 1E90A 2P9UG 3HXFA 5JMND 1FT1A 2BTDA 1INZA 3HRAA 2QZAA 3FUFA 3FUIA 3EU5A 5T4YA 1S64A 3GW4A 5EDSA 4LRZA 5AIJA 3SY2A 3UT4A 5AQ9A 2YHEA 3SFXA 1OWOA 3WG7E 5ENPD 4GCOA 5CBNA 4YDEA 4FU3A 3Q7FA 4MBGA 3E34A 5DIZA 3TAXA 1NL4A 5JJ7A 4JEUA 3X2QE 2F8XK 3E4BA 3I4RB 1JWGA 3SBSA 4L7TA 3NBNB 3DSSA 3LVQE 2LXMA 5JJTA 3LY7A 3UINC 3SF4A 4BTAA 2X6IA 1OCOE 3RO2A 4FA6A 4DLQA 2WM9A 4Q69A 3R9AB 3HYMB 3FH7A 5G05J 4JXTA 4FJZA 3E37A 4JHJA 1HFAA 2YNQA 5D0QD 4UQZA 2OEVA 1HO8A 3QOUA 3NOGD 4AY6A 2Y4UA 2OOEA 2WXLA 5LP0A 4XZ4A 3MV2B 3RAUA 4MS6A 3SBTB 3ESKA 4Q96A 5D0OD 2DZNA 4JW1A 5G04C 4KMOA 4XKCA 4A3TA 1ELKA 4NQ0A 3CGHA 3EHRA 3TWWA 1N95A 1Z3XA 3CVNA 4CDNA 3FFLA 5LCWJ 3MCXA 2RFAA 2QYJA 2Y3AA 3DPYA 2VSYA 3FHEA 1SVXA 4AXHA 2WXFA 2X6HA 2R05A 1D8DA 2IFUA 1LF8A 3FWVA 2JLBA 3K9IA 2Y4TA 3Q79A 4BERA 3ULQA 4BESA 4BSZB 3ESLA 4CGVA 2WXRA 2LAIA 3FP3A 4EQFA 2IQCA 4CT0A 2I2OA 1UN8A 5ENQD 2GRLA 2BF0X 2J08A 3EIQC 4F1SA 1IHGA 4ILHB 4O60A 4U8VD 4OVUA 2WPVA 3GZ1A 4GYWA 3B7SA 1WDYA 4ILGA 4K5BA 3ZFWA 5J90A 3ZW3A 5H7PA 5CRVA 2EIJE 1E7UA 2HYZA 3C3QA 1X81A 4I1MA 3FULA 2VTBA 1H2UA 4EPZA 5CMYA 1V55E 5A23A 3C72A 1TNZA 3G2WA 4N3CA 1ZBPA 1FVFA 1U3DA 3KSLA 4XIFA 4J7WA 1O1TA 4G8LA 1N11A 4ANWA 3DRAA 3QB2A 2GRPB 2GW1A 3KS2A 2X38A 5B1AE 4ACLA 2QC9A 5CCLA 3PVLA 2DYSE 3LPZA 4OAUC 2KCLA 4GYOA 4ZHBA 2DBAA 3QWWA 5FZRA 2XPIA 3CHOA 3KD7A 3U3WA 3TGOA 3ISMC 2WXNA 4WWNA 5AN8A 3ASFA 3FDHA 5AAOA 3FTXA 4U0ZA 4UWKA 4EZKA 4GTSA 4BWRA 4BFRA 2BKGA 1O1RA 3D9HA 2WXIA 2P9LG 2ETBA 1DC2A 5ENTD 5FQ4A 1YYHA 3PE3A 3S7JA 3ULYA 4GYYA 3PREA 3L9TA 2KBXA 5FTPA 4DX1A 2PZIA 1LD8A 5KJMA 4V3IA 4NRHB 3EJNA 3L08A 3HVEB 1TNUA 2F0YA 4GZ3A 3QK0A 4OYSA 5EX3A 2P9IG 5J08A 4JC8A 5B1BE 2J4DA 2I1JA 4ANVA 5G2NA 3DSTA 3ZXPA 2V4LA 3CVYA 1Z6TA 3NB2A 3L22A 4BTBA 1QZ2A 3AAAC 4DI4A 3W9GA 3E33A 4F1PA 3QJZA 2V4HC 3ONKA 3UKUG 1UW4B 2ZU6B 1N9AA 5E75A 2VYIA 4TXQA 4HQDA 1KT0A 4HXIA 4IRUA 4HOUA 5FQ6A 1G3NB 3EIJA 2GROB 2FULA 5EX0A 5ITZF 4CEMA 1SA5A 3PEVB 4UUCA 3SFZA 1LD7A 4RSYA 3FTUA 4IN3B 3RIBA 1H0AA 4HLLA 3IEGA 3ZGQA 1H2VC 2AJAA 2WXQA 1RW2A 4BX9A 3AG2E 4ATGA 4GTQA 3ZRHA 2CFZA 3MGBA 4B8AA 5KJKA 2P2CP 4KYOB 2PQRA 2R17C 1JCQA 4JVSA 4G26A 4BEPA 5ENRD 5HS0A 3UMVA 2V5QC 5HI7A 4UI9J 2AW6A 3O48A 4GTOA 5JHBA 5FZSA 2BUGA 4MKTA 3ABKE 3C5RA 4GB9A 3UXGA 3E30A 3HXCA 2CHXA 1NI1A 4I2WA 4Q94A 1TYQG 4JEHA 1OWNA 4FLBA 2Q7FA 4JD2G 1TNYA 4LERA 3UIOC 2M63A 1HX8A 3B95A 2CFUA 2ZISA 4UQYA 4MLPA 1GW6A 4LUNU 1E7VA 2Y1LE 2EILE 2VJ8A 3D9NA 3LYAA 4H7YA 2L9BA 3OXLA 2PM7A 2XEHA 3ZYLA 3T8KA 3FTYA 4B89A 1FCHA 2XRZA 4GZDA 1N4RA 4LSZE 1NZNA 3N71A 3RJVA 4APOA 1QYMA 3FUNA 4BY6A 1ELWA 5CBOA 3BEEA 5KBAA 3URZA 3FU5A 4BETA 3GYZA 1Q2ZA 2GRQB 3FY4A 4GA2A 3D9MA 3U4TA 4CCAA 4WWPA 1FPPA 3UPVA 4GPKA 4HRLA 2DVWA 4KZ0A 2PM6A 4H7XA 2J9QA 1VDYA 1MHQA 3FTSA 2IU1A 1TEZA 4GTTA 4DX6D 4WNFA 4Z68A 4R7LA 5AQ7A 4G8KA 4HRNA 4K0RA 1N94A 1OWPA 1Y6IA 5A7DB 2HO1A 2I6HA 3RKVA 2KM4A 5KNHD 3AU5A 2FF4A 3KEZA 4PUCA 5LX8A 4U8YD 4N3AA 3U9WA 3CVQA 1S63A 3V31A 4L2LA 4FADA 3EHMA 5FJYA 3MYVA 2MOWA 3DXKG 2C0LA 3TJPA 5FIOA 1S0PA 4HBDA 2KC7A 3S7FA 4BT8A 3PH0C 3HVEA 3FH5A 4TXRA 4AVXA 2PL2A 3EHQA 3NQPA 4A63B 1KLXA 3C98A 4LNGA 2Y69E 2X6FA 3PE4A 2WB2A 3G2UA 5ENOD 4B8CB 1OT8A 4YVOA 3LKUA 4HVBA 2WXPA 4UI9C 4GA1A 3AG1E 1WY6A 3MKQB 3PUJA 3B7UX 4AV7A 1D9SA 3B7BA 1DVPA 2IO2C 4GTRA 4DRXE 4ME2A 1HXIA 2A4ZA 3D9KA 5ENSD 4ILIA 4EBAG 3JQ1A 4YNDA 1NA3A 4I6EA 1SA4A 3Q75A 2KCVA 1IKND 3V30A 1EF1C 3J5QB 2XPYA 4XI9A 3HIZA 1JCRA 4KVMA 4CT4A 4J0UA 3DBSA 4ATZD 3BG1B 1HH8A 3LJ3A 3FU3A 4I6JA 2I9CA 3CK7A 4N2QA 1H6OA 2KCKA 4TV3A 3PZ3A 1O1SA 1TN6A 5BT1A 3CK8A 3QNKA 1AWCB 4DJAA 4KBQA 4APFA 2KZTB 3PNTB 2V5FA 5HRYA 5CEDB 5FQ7A 2MRIA 2XGOA 2WQ6A 3AJIA 3S2AA 3LY8A 4YDWA 4M3OA 3NAWA 3IKOB 1N4PA 3S7BA 1UN9A 4N5CA 3ZXSA 1HS6A 4NIKA 3UM0A 1BU9A 2WXKA 3ASDA 3QC1A 2DWZA 1K8KG 4LEUA 3APCA 1YA0A 4C0MA 4UI9K 1K1AA 4UQXA 2ILRA 1OUVA 5C1DA 5A6CA 2P9NG 3NOCD 4HRMB 1TNBA 1KZPA 4I43A 3VLFA 3CVPA 3I4GA 3ZKJA 1NA0A 4TRQA 3PZ2A 3SHFA 3ONLA 4G11A 4WUYA 4PS3A 1YMPA 3ENEA 1SZAA 1EDUA 3DWLG 3ASHA 3DEOA 2QY7A 4U04A 3RRMB 3AU4A 3AS8A 1IYGA 4K5CA 3IHYA 5IY5E 2XCBA 5FINA 5CMWA 5EN5D 4KT6B 1JWFA 3UM3A 5D2MC 2BEDA 3CKBA 2B6CA 1IQRA 3JXIA 1IHBA 4GMRA 2FI7A 2XZDG 3CIAA 4HLEA 5FQ8A 3PDNA 3FUKA 4HI8A 2XCCA 5FT9A 3PZDA 4BT9A 2XQ0A 5BV0A 3KAEA 3ZYMA 3TG5A 1WG0A 1UJJA 2DIWA 4QQIA 5T3RA 2WXOA 3QWPA 3FUHA 1BPOA 3UIPC 1N0RA 5EKQD 1JPLA 3L13A 3F6QA 1DCEA 5G05C 5BXOA 2VGXB 3IHVA 4D10C 3DSVA 5ANRA 3L54A 1PAQA 2H6FA 5B3SE 2HR2A 2F8YA 5EIBE 4GTMA 3D3MA 3LS8A 3UI2A 1IQUA 2DCPA 3ML8A 4DK5A 3MKQA 1BI7B 4F3VA 5BXUA 4EHMA 3NF1A 2WXHA 4WAFA 1X5BA 3CLJA 4LCTA 1ELRA 1DCQA 3SO8A 3BG0B 3FH8A 3MJWA 4L9PA 3T5XA 4U95D 3RO3A 1ZU2A 4HOQA 4JA7A 3JYSA 4GPMA 4GA0A 5LCWC 2AVPA 3PUKA 4B0ZA 2VSNA 3FTVA 4EZJA 3EDTB 2CG3A 1FVHA 4J8EA 1EYHA 2LO6A 3Q78A 3ZUVB 2F37A 3LXUX 3MA5A 3V2XA 1SZ9A 4GTPA 3R9MA 1HF8A 1W3BA 3FTWA 3FEXA 2J8SD 1MX4A 2X6KA 1NP7A 3ZEFA 1N4QA 4RLYA 4HNAD 4F7AA 4PS8A 3CR3A 5LFAA 4CDMA 1E8XA 4G2VA 2FO1E 2QFCA 1WM5A 2IOLA 2KZTA 1S70B 4I17A 4LG6A 3UM2A 4U8HA 3UX4A 3ZU7B 3O4ZA 4XE0A 4HOTA 3L16A 4LNBA 1XNFA 3LEWA 1PC2A 1OCZE 2GRMA 4AIFA 3T5VA 2YINA 2RG8A 4J8SA 3CVLA 2I1KA
chains in the Genus database with same CATH topology
1YMPA 3AAAC 3W9GA 1N0QA 3HRAA 4U8YD 4G8LA 5JA4D 1N11A 1MX2A 4J8YA 3V31A 1BI7B 3KEAA 4QFVA 2V4HC 3DEOA 4F1PA 5BXUA 2DZNA 5EIDA 2NYJA 3W9FA 3V2OA 4K5CA 2Y0BG 3B95A 3Q9UC 4JB8P 4N5QA 5FIOA 4HB5A 4HQDA 4HBDA 3TWSA 5FINA 3TWVA 5D66A 1YCSB 2L6BA 2QC9A 4DX2A 1TR4A 2XEEA 1DCQA 3SO8A 3EHRA 3TWWA 5AQ9A 5EN5D 4OAUC 5ENPD 3J5PA 1G3NB 4U95D 3T9KA 5CBNA 1AWCB 2Y1LE 2HE0A 2RFAA 4ZHBA 2QYJA 3EHQA 4GPMA 3JXIA 1UOHA 4OAVB 4A63B 1IHBA 1OY3D 4GMRA 1MJ0A 5HRYA 4ZFHA 2XZDG 3ZNGA 5ITZF 5CEDB 4DUIA 1SVXA 4UUCA 1K3ZD 4O1PA 1SW6A 4CYMD 4HI8A 2ETCA 2XEHA 3AJIA 5AN8A 1BLXB 2F8XK 3V79K 5KNGA 4HLLA 4YDWA 3HG0D 3T8KA 5AAOA 2AJAA 3ZUVB 2F37A 4LSZE 4B93B 5ENOD 4U96D 2BKGA 2ETAA 3V2XA 4BERA 1OT8A 4BESA 4BSZB 3D9HA 5AARA 4O1OA 2JABA 4DX5D 3NBNB 1WG0A 1QYMA 2ZGDA 4C48B 2PNNA 3TWTA 2J8SD 5CBOA 2ETBA 1MX4A 2B0OE 3DEPA 5HKPA 1DC2A 5ENTD 2BKKB 5KBAA 1AP7A 4NIKA 5ENQD 4QQIA 4BETA 2DZOA 1BU9A 4DX7D 4RLYA 1YYHA 2P2CP 3IXEA 5AQBA 4HNAD 4K5AB 2DWZA 1D9SA 3B7BA 3UTMA 3TWXA 2KBXA 5KWDA 4HRLA 2DVWA 3TWUA 1NFIE 4BEPA 4DX1A 3Q9NC 5ENRD 4HI9A 4O60A 4U8VD 4TUMA 1N0RA 5HS0A 4DRXE 4F6RD 5CERB 2FO1E 1BI8B 1K1AA 2VGEA 2V5QC 3F6QA 1S70B 1WDYA 5ENSD 4K5BA 2RFMA 4LG6A 5BXOA 4YDYA 4DX6D 5EYLA 1IXVA 3NOCD 4HRMB 5CEAA 1IKND 3ZU7B 4Z68A 3V30A 5AQ7A 4G8KA 4HRNA 3JUEA 4LNUD 1MYOA 5CECB 3J5QB 2KXPC 3ZKJA 2XZTG 5AQAA 2ZGGA 2XENA 3C5RA 3EU9A 3UXGA 5EYPF 2F8YA 3NOGD 5EILA 1BD8A 3TWRA 1MX6A 5EIBE 1K1BA 3JXJA 2MYOA 3LJNA 3UI2A 5KNHD 4CZ2D 2A5EA 5JMND 3TWQA 4ATZD 4J7WA 1A5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YMP A;  3AAA C;  3W9G A;  1N0Q A;  3HRA A;  4U8Y D;  4G8L A;  5JA4 D;  1N11 A;  1MX2 A;  4J8Y A;  3V31 A;  1BI7 B;  3KEA A;  4QFV A;  2V4H C;  3DEO A;  4F1P A;  5BXU A;  2DZN A;  5EID A;  2NYJ A;  3W9F A;  3V2O A;  4K5C A;  2Y0B G;  3B95 A;  3Q9U C;  4JB8 P;  4N5Q A;  5FIO A;  4HB5 A;  4HQD A;  4HBD A;  3TWS A;  5FIN A;  3TWV A;  5D66 A;  1YCS B;  2L6B A;  2QC9 A;  4DX2 A;  1TR4 A;  2XEE A;  1DCQ A;  3SO8 A;  3EHR A;  3TWW A;  5AQ9 A;  5EN5 D;  4OAU C;  5ENP D;  3J5P A;  1G3N B;  4U95 D;  3T9K A;  5CBN A;  1AWC B;  2Y1L E;  2HE0 A;  2RFA A;  4ZHB A;  2QYJ A;  3EHQ A;  4GPM A;  3JXI A;  1UOH A;  4OAV B;  4A63 B;  1IHB A;  1OY3 D;  4GMR A;  1MJ0 A;  5HRY A;  4ZFH A;  2XZD G;  3ZNG A;  5ITZ F;  5CED B;  4DUI A;  1SVX A;  4UUC A;  1K3Z D;  4O1P A;  1SW6 A;  4CYM D;  4HI8 A;  2ETC A;  2XEH A;  3AJI A;  5AN8 A;  1BLX B;  2F8X K;  3V79 K;  5KNG A;  4HLL A;  4YDW A;  3HG0 D;  3T8K A;  5AAO A;  2AJA A;  3ZUV B;  2F37 A;  4LSZ E;  4B93 B;  5ENO D;  4U96 D;  2BKG A;  2ETA A;  3V2X A;  4BER A;  1OT8 A;  4BES A;  4BSZ B;  3D9H A;  5AAR A;  4O1O A;  2JAB A;  4DX5 D;  3NBN B;  1WG0 A;  1QYM A;  2ZGD A;  4C48 B;  2PNN A;  3TWT A;  2J8S D;  5CBO A;  2ETB A;  1MX4 A;  2B0O E;  3DEP A;  5HKP A;  1DC2 A;  5ENT D;  2BKK B;  5KBA A;  1AP7 A;  4NIK A;  5ENQ D;  4QQI A;  4BET A;  2DZO A;  1BU9 A;  4DX7 D;  4RLY A;  1YYH A;  2P2C P;  3IXE A;  5AQB A;  4HNA D;  4K5A B;  2DWZ A;  1D9S A;  3B7B A;  3UTM A;  3TWX A;  2KBX A;  5KWD A;  4HRL A;  2DVW A;  3TWU A;  1NFI E;  4BEP A;  4DX1 A;  3Q9N C;  5ENR D;  4HI9 A;  4O60 A;  4U8V D;  4TUM A;  1N0R A;  5HS0 A;  4DRX E;  4F6R D;  5CER B;  2FO1 E;  1BI8 B;  1K1A A;  2VGE A;  2V5Q C;  3F6Q A;  1S70 B;  1WDY A;  5ENS D;  4K5B A;  2RFM A;  4LG6 A;  5BXO A;  4YDY A;  4DX6 D;  5EYL A;  1IXV A;  3NOC D;  4HRM B;  5CEA A;  1IKN D;  3ZU7 B;  4Z68 A;  3V30 A;  5AQ7 A;  4G8K A;  4HRN A;  3JUE A;  4LNU D;  1MYO A;  5CEC B;  3J5Q B;  2KXP C;  3ZKJ A;  2XZT G;  5AQA A;  2ZGG A;  2XEN A;  3C5R A;  3EU9 A;  3UXG A;  5EYP F;  2F8Y A;  3NOG D;  5EIL A;  1BD8 A;  3TWR A;  1MX6 A;  5EIB E;  1K1B A;  3JXJ A;  2MYO A;  3LJN A;  3UI2 A;  5KNH D;  4CZ2 D;  2A5E A;  5JMN D;  3TWQ A;  4ATZ D;  4J7W A;  1A5E A; 
#chains in the Genus database with same CATH topology
 3TG4 A;  1N0Q A;  5KJN A;  4E6H A;  4A55 A;  3KEA A;  4TXP A;  4N39 A;  3W9F A;  3Q9U C;  3CEQ A;  4EBA A;  3DSX A;  3TWV A;  3BU8 A;  3NZS A;  3B7R L;  4IYP A;  4GZ5 A;  3HXD A;  1WAO 1;  1QQE A;  2L0I A;  5JHA A;  1K3Z D;  4O1P A;  3CKC A;  3OXG A;  4I1O B;  2PQN A;  1H2T C;  1QNF A;  4KZC A;  1LTX A;  3DSU A;  4C0E A;  4EEC A;  4TUU A;  2CG2 A;  3GZS A;  3FUD A;  2EIN E;  2JAB A;  2WXG A;  2AXU A;  4FHK A;  3G2S A;  2R5S A;  4FP7 A;  4GML A;  1E8W A;  3I3N A;  1JCS A;  1Z5S C;  3FU0 A;  3P2B A;  3DXM G;  3TWU A;  2UWJ G;  1FT2 A;  2VGE A;  3G2V A;  5DBK A;  1UJK A;  2AXV A;  3GZ2 A;  4AM9 A;  2YQ8 A;  4KXK B;  2V8S E;  5CEC B;  1MYO A;  4ACK A;  2KXP C;  4K03 A;  5EIL A;  4PDX A;  1ZB1 A;  4I9C A;  3LJN A;  2XS8 A;  3SD5 A;  4AOF A;  3TWQ A;  1KT1 A;  1H6P A;  4OVV A;  2DYR E;  3CK9 A;  5EID A;  2IY0 C;  3C3R A;  1UG3 A;  1H6K A;  1D8E A;  1YCS B;  5CCM A;  1OCR E;  2YHC A;  2VGX A;  3T9K A;  3HHM A;  2XEV A;  4RG6 A;  3LVR E;  4P29 A;  1MJ0 A;  2IO3 C;  3ZNG A;  4G24 A;  5CRU A;  3TL5 A;  4I2Z A;  4AP2 A;  3P1U A;  2AXZ A;  1A17 A;  3ZVV A;  3VTX A;  3CV0 A;  3QAR A;  5ENN A;  4G1T A;  3TXM A;  5AJL A;  3CHR A;  2BKK B;  1XGW A;  3UUX A;  3HXE A;  2LXL A;  2GRR B;  4L23 A;  1OCC E;  4HOR A;  1HG2 A;  5EYL A;  2A5U A;  4L2Y A;  3BUA A;  4E85 A;  2LSU A;  1RZ4 A;  5ARF A;  5LOZ A;  3RRN B;  4FLH A;  4WND A;  4A1G A;  1MX6 A;  1K1B A;  3PEU B;  5JA4 D;  1MX2 A;  3JQ0 A;  1N52 A;  2OVB A;  4HB5 A;  4UWF A;  1PY1 A;  3APF A;  2XS1 A;  3ZYK A;  1SQM A;  2X6J A;  3FEY A;  3Q47 B;  5AJD A;  4J8F A;  5BV1 A;  3TXN A;  3CHQ A;  4JZY A;  4OAV B;  2IEJ A;  3LY9 A;  4W9R A;  2E2E A;  2MHK A;  3SGH A;  2ETC A;  1MQS A;  1DNP A;  4PS7 A;  3V79 K;  3ZHE B;  2R02 A;  3HG0 D;  3UT7 A;  4PH4 B;  3SFY A;  2UY1 B;  5AAR A;  3TWT A;  3L17 A;  1AP7 A;  2R03 A;  3MKR A;  2DZO A;  1QBQ A;  2L6J A;  2XHE A;  3ABM E;  4HS2 A;  3B13 A;  4I1A A;  5CER B;  3ML9 A;  2GRN B;  3CQC B;  4N2S A;  3FU6 A;  2GGF A;  2LSV A;  4GMJ A;  3R7Q A;  2RFM A;  1TNO A;  3MX3 A;  5G55 A;  4YDY A;  3C3O A;  4UWH A;  1N4S A;  4BX8 A;  3Q15 A;  5CEA A;  5AYW D;  4EZL A;  1HE8 A;  1EPU A;  5AQA A;  3RU0 A;  5JJ6 A;  1Y8M A;  2CHW A;  3FTZ A;  4CGW A;  1KPS B;  4CZ2 D;  1N54 A;  4YVQ C;  5M72 A;  1OXJ A;  3MZL B;  3Q4A B;  3Q5M A;  3CHM A;  5FZQ A;  3CHS A;  3JCK C;  2HM8 A;  4J8D A;  4ANX A;  5D66 A;  4M7C A;  4DX2 A;  1TR4 A;  3NZU A;  3QWV A;  5CHE E;  3B7T A;  2EIK E;  2FO7 A;  2XRY A;  3SQV A;  5HQ8 A;  2J09 A;  3J5P A;  2NC9 A;  1V54 E;  1U3C A;  4MRU A;  2J07 A;  2WQH A;  4DUI A;  3UQ3 A;  4CYM D;  2H6H A;  2XGM A;  2EQX A;  1BLX B;  3MEK A;  5KNG A;  3OTN A;  2VSO E;  5AEN A;  2OV8 A;  2C2L A;  4ANU A;  4U96 D;  4UWG A;  2ETA A;  3QKY A;  3ZPJ A;  2WXM A;  4C48 B;  2PNN A;  5E76 A;  3PRZ A;  3OAW A;  4HOS A;  3L6A A;  5AQB A;  3ZIM A;  3QDN A;  4K5A B;  3CVW A;  5ANL A;  4XI0 A;  3JUI A;  5BNW A;  2ZXW E;  4WNE A;  3D9J A;  4TUM A;  4F6R D;  4I6G A;  3RK6 A;  4L1B A;  1MZC A;  3R7R A;  2OVF A;  3D9I A;  4AJW A;  3G2T A;  4G25 A;  4U0S A;  3U64 A;  2P9S G;  3E32 A;  3OXF A;  4C9B B;  2IOS A;  5ARG A;  2ZGG A;  3VLE A;  3T8M A;  4RQI A;  3D9O A;  4DLO A;  1HU3 A;  4JL0 A;  3JXJ A;  4WWO A;  2H6G A;  3BQO A;  2WXJ A;  4FHJ A;  2R2L A;  5KJL A;  3AG3 E;  2P58 C;  4QFV A;  4UWL A;  3V2O A;  3ASG A;  4GU5 A;  3RRU A;  2V0P A;  2XEE A;  3CST A;  3QAQ A;  4FJY A;  5KCM A;  2ZIR A;  3APD A;  3ASO E;  4JPS A;  2HE0 A;  3D9P A;  2WQ7 A;  4RVB A;  4RG9 A;  2OCC E;  1OY3 D;  4ZFH A;  2FBN A;  3Q7A A;  3WXX A;  2EIM E;  4XKB A;  2WMO A;  3DSW A;  4O1O A;  2ZGD A;  5FWQ A;  1JUQ A;  2NSZ A;  2JEK A;  1TJC A;  3DEP A;  3PNL B;  2B0O E;  5HKP A;  5T8I A;  2XPZ A;  3FUE A;  4DX7 D;  5BUZ A;  3AS4 A;  1U2V G;  2RD0 A;  4JHK A;  5KWD A;  3CVU A;  1NFI E;  2XGS A;  3ZYQ A;  4Y6C A;  1BI8 B;  2CHZ A;  2IJG X;  4NUR A;  2P9P G;  3UKR G;  3ZHE A;  4J6I A;  3FUJ A;  3L82 A;  1E8Z A;  2UY1 A;  3KSQ A;  2VGY A;  4GCN A;  3TWR A;  2A5E A;  3ASN E;  3ULE G;  4AEZ C;  2QYU A;  1A5E A;  4G23 A;  4FC8 A;  4J8Y A;  3PZ1 A;  3VLD A;  5BW8 C;  2NYJ A;  1H19 A;  4JB8 P;  3UM1 A;  4U7E B;  3TWS A;  2H6I A;  2L6B A;  2X3M A;  1TJF A;  4CDR A;  3HXB A;  1UOH A;  3IBE A;  3AG4 E;  2R59 A;  2WVI A;  2LAH A;  2WMN A;  4KVO A;  2OEW A;  2FEZ A;  3U66 A;  3AS5 A;  3FUM A;  2AWI A;  4X8Q A;  2ION A;  1HZ4 A;  1Z3Y A;  3CQG B;  4FUL A;  3CHP A;  4XX5 A;  4B93 B;  4GAA A;  2LNI A;  3EHN A;  4GTV A;  4DX5 D;  1E8Y A;  4AY5 A;  3VTY A;  3IXE A;  3IV0 A;  3UTM A;  3Q73 A;  3MV3 B;  4HFG A;  2J4B A;  4U07 A;  2KAT A;  1P5Q A;  3S7D A;  4JA9 A;  3UT8 A;  3HDX A;  3DPD A;  3JUE A;  4LNU D;  2C0M A;  3EU9 A;  5EYP F;  4URK A;  2VQ2 A;  3LCA A;  3Q49 B;  3CSF A;  3SZ7 A;  2J49 A;  3PZ4 A;  3ZN3 A;  2IF4 A;  1HG5 A;  4NAC A;  2E0I A;  1OWM A;  2Y0B G;  1O5M A;  2OND A;  4N5Q A;  4YDO A;  3LDZ A;  4BSX A;  4DPR A;  1E96 B;  4U63 A;  4XEI G;  1TN7 A;  2RKK A;  2L0T B;  5BPP A;  4O6F A;  5G04 J;  4ABN A;  3EUV A;  1SW6 A;  3D9L A;  3SNX A;  4F53 A;  3SI5 A;  2VTB B;  1TN8 A;  3RSE G;  5C2Y A;  4DI3 A;  4GZ6 A;  1B89 A;  3CVX A;  4WNG A;  3CVV A;  1OWL A;  4A1S A;  3TWX A;  4B94 A;  4U0U A;  2LUH A;  4CRW A;  3Q9N C;  4HI9 A;  3I5P A;  4N3B A;  2P9K G;  1IXV A;  4Y6W A;  4GZC A;  3PS6 A;  3ABL E;  1KZO A;  2XZT G;  2XEN A;  2VSX E;  4I9E A;  4IUL A;  4A3V A;  2NXP A;  1BD8 A;  4JHR A;  2MYO A;  1L5J A;  1E90 A;  2P9U G;  3HXF A;  5JMN D;  1FT1 A;  2BTD A;  1INZ A;  3HRA A;  2QZA A;  3FUF A;  3FUI A;  3EU5 A;  5T4Y A;  1S64 A;  3GW4 A;  5EDS A;  4LRZ A;  5AIJ A;  3SY2 A;  3UT4 A;  5AQ9 A;  2YHE A;  3SFX A;  1OWO A;  3WG7 E;  5ENP D;  4GCO A;  5CBN A;  4YDE A;  4FU3 A;  3Q7F A;  4MBG A;  3E34 A;  5DIZ A;  3TAX A;  1NL4 A;  5JJ7 A;  4JEU A;  3X2Q E;  2F8X K;  3E4B A;  3I4R B;  1JWG A;  3SBS A;  4L7T A;  3NBN B;  3DSS A;  3LVQ E;  2LXM A;  5JJT A;  3LY7 A;  3UIN C;  3SF4 A;  4BTA A;  2X6I A;  1OCO E;  3RO2 A;  4FA6 A;  4DLQ A;  2WM9 A;  4Q69 A;  3R9A B;  3HYM B;  3FH7 A;  5G05 J;  4JXT A;  4FJZ A;  3E37 A;  4JHJ A;  1HFA A;  2YNQ A;  5D0Q D;  4UQZ A;  2OEV A;  1HO8 A;  3QOU A;  3NOG D;  4AY6 A;  2Y4U A;  2OOE A;  2WXL A;  5LP0 A;  4XZ4 A;  3MV2 B;  3RAU A;  4MS6 A;  3SBT B;  3ESK A;  4Q96 A;  5D0O D;  2DZN A;  4JW1 A;  5G04 C;  4KMO A;  4XKC A;  4A3T A;  1ELK A;  4NQ0 A;  3CGH A;  3EHR A;  3TWW A;  1N95 A;  1Z3X A;  3CVN A;  4CDN A;  3FFL A;  5LCW J;  3MCX A;  2RFA A;  2QYJ A;  2Y3A A;  3DPY A;  2VSY A;  3FHE A;  1SVX A;  4AXH A;  2WXF A;  2X6H A;  2R05 A;  1D8D A;  2IFU A;  1LF8 A;  3FWV A;  2JLB A;  3K9I A;  2Y4T A;  3Q79 A;  4BER A;  3ULQ A;  4BES A;  4BSZ B;  3ESL A;  4CGV A;  2WXR A;  2LAI A;  3FP3 A;  4EQF A;  2IQC A;  4CT0 A;  2I2O A;  1UN8 A;  5ENQ D;  2GRL A;  2BF0 X;  2J08 A;  3EIQ C;  4F1S A;  1IHG A;  4ILH B;  4O60 A;  4U8V D;  4OVU A;  2WPV A;  3GZ1 A;  4GYW A;  3B7S A;  1WDY A;  4ILG A;  4K5B A;  3ZFW A;  5J90 A;  3ZW3 A;  5H7P A;  5CRV A;  2EIJ E;  1E7U A;  2HYZ A;  3C3Q A;  1X81 A;  4I1M A;  3FUL A;  2VTB A;  1H2U A;  4EPZ A;  5CMY A;  1V55 E;  5A23 A;  3C72 A;  1TNZ A;  3G2W A;  4N3C A;  1ZBP A;  1FVF A;  1U3D A;  3KSL A;  4XIF A;  4J7W A;  1O1T A;  4G8L A;  1N11 A;  4ANW A;  3DRA A;  3QB2 A;  2GRP B;  2GW1 A;  3KS2 A;  2X38 A;  5B1A E;  4ACL A;  2QC9 A;  5CCL A;  3PVL A;  2DYS E;  3LPZ A;  4OAU C;  2KCL A;  4GYO A;  4ZHB A;  2DBA A;  3QWW A;  5FZR A;  2XPI A;  3CHO A;  3KD7 A;  3U3W A;  3TGO A;  3ISM C;  2WXN A;  4WWN A;  5AN8 A;  3ASF A;  3FDH A;  5AAO A;  3FTX A;  4U0Z A;  4UWK A;  4EZK A;  4GTS A;  4BWR A;  4BFR A;  2BKG A;  1O1R A;  3D9H A;  2WXI A;  2P9L G;  2ETB A;  1DC2 A;  5ENT D;  5FQ4 A;  1YYH A;  3PE3 A;  3S7J A;  3ULY A;  4GYY A;  3PRE A;  3L9T A;  2KBX A;  5FTP A;  4DX1 A;  2PZI A;  1LD8 A;  5KJM A;  4V3I A;  4NRH B;  3EJN A;  3L08 A;  3HVE B;  1TNU A;  2F0Y A;  4GZ3 A;  3QK0 A;  4OYS A;  5EX3 A;  2P9I G;  5J08 A;  4JC8 A;  5B1B E;  2J4D A;  2I1J A;  4ANV A;  5G2N A;  3DST A;  3ZXP A;  2V4L A;  3CVY A;  1Z6T A;  3NB2 A;  3L22 A;  4BTB A;  1QZ2 A;  3AAA C;  4DI4 A;  3W9G A;  3E33 A;  4F1P A;  3QJZ A;  2V4H C;  3ONK A;  3UKU G;  1UW4 B;  2ZU6 B;  1N9A A;  5E75 A;  2VYI A;  4TXQ A;  4HQD A;  1KT0 A;  4HXI A;  4IRU A;  4HOU A;  5FQ6 A;  1G3N B;  3EIJ A;  2GRO B;  2FUL A;  5EX0 A;  5ITZ F;  4CEM A;  1SA5 A;  3PEV B;  4UUC A;  3SFZ A;  1LD7 A;  4RSY A;  3FTU A;  4IN3 B;  3RIB A;  1H0A A;  4HLL A;  3IEG A;  3ZGQ A;  1H2V C;  2AJA A;  2WXQ A;  1RW2 A;  4BX9 A;  3AG2 E;  4ATG A;  4GTQ A;  3ZRH A;  2CFZ A;  3MGB A;  4B8A A;  5KJK A;  2P2C P;  4KYO B;  2PQR A;  2R17 C;  1JCQ A;  4JVS A;  4G26 A;  4BEP A;  5ENR D;  5HS0 A;  3UMV A;  2V5Q C;  5HI7 A;  4UI9 J;  2AW6 A;  3O48 A;  4GTO A;  5JHB A;  5FZS A;  2BUG A;  4MKT A;  3ABK E;  3C5R A;  4GB9 A;  3UXG A;  3E30 A;  3HXC A;  2CHX A;  1NI1 A;  4I2W A;  4Q94 A;  1TYQ G;  4JEH A;  1OWN A;  4FLB A;  2Q7F A;  4JD2 G;  1TNY A;  4LER A;  3UIO C;  2M63 A;  1HX8 A;  3B95 A;  2CFU A;  2ZIS A;  4UQY A;  4MLP A;  1GW6 A;  4LUN U;  1E7V A;  2Y1L E;  2EIL E;  2VJ8 A;  3D9N A;  3LYA A;  4H7Y A;  2L9B A;  3OXL A;  2PM7 A;  2XEH A;  3ZYL A;  3T8K A;  3FTY A;  4B89 A;  1FCH A;  2XRZ A;  4GZD A;  1N4R A;  4LSZ E;  1NZN A;  3N71 A;  3RJV A;  4APO A;  1QYM A;  3FUN A;  4BY6 A;  1ELW A;  5CBO A;  3BEE A;  5KBA A;  3URZ A;  3FU5 A;  4BET A;  3GYZ A;  1Q2Z A;  2GRQ B;  3FY4 A;  4GA2 A;  3D9M A;  3U4T A;  4CCA A;  4WWP A;  1FPP A;  3UPV A;  4GPK A;  4HRL A;  2DVW A;  4KZ0 A;  2PM6 A;  4H7X A;  2J9Q A;  1VDY A;  1MHQ A;  3FTS A;  2IU1 A;  1TEZ A;  4GTT A;  4DX6 D;  4WNF A;  4Z68 A;  4R7L A;  5AQ7 A;  4G8K A;  4HRN A;  4K0R A;  1N94 A;  1OWP A;  1Y6I A;  5A7D B;  2HO1 A;  2I6H A;  3RKV A;  2KM4 A;  5KNH D;  3AU5 A;  2FF4 A;  3KEZ A;  4PUC A;  5LX8 A;  4U8Y D;  4N3A A;  3U9W A;  3CVQ A;  1S63 A;  3V31 A;  4L2L A;  4FAD A;  3EHM A;  5FJY A;  3MYV A;  2MOW A;  3DXK G;  2C0L A;  3TJP A;  5FIO A;  1S0P A;  4HBD A;  2KC7 A;  3S7F A;  4BT8 A;  3PH0 C;  3HVE A;  3FH5 A;  4TXR A;  4AVX A;  2PL2 A;  3EHQ A;  3NQP A;  4A63 B;  1KLX A;  3C98 A;  4LNG A;  2Y69 E;  2X6F A;  3PE4 A;  2WB2 A;  3G2U A;  5ENO D;  4B8C B;  1OT8 A;  4YVO A;  3LKU A;  4HVB A;  2WXP A;  4UI9 C;  4GA1 A;  3AG1 E;  1WY6 A;  3MKQ B;  3PUJ A;  3B7U X;  4AV7 A;  1D9S A;  3B7B A;  1DVP A;  2IO2 C;  4GTR A;  4DRX E;  4ME2 A;  1HXI A;  2A4Z A;  3D9K A;  5ENS D;  4ILI A;  4EBA G;  3JQ1 A;  4YND A;  1NA3 A;  4I6E A;  1SA4 A;  3Q75 A;  2KCV A;  1IKN D;  3V30 A;  1EF1 C;  3J5Q B;  2XPY A;  4XI9 A;  3HIZ A;  1JCR A;  4KVM A;  4CT4 A;  4J0U A;  3DBS A;  4ATZ D;  3BG1 B;  1HH8 A;  3LJ3 A;  3FU3 A;  4I6J A;  2I9C A;  3CK7 A;  4N2Q A;  1H6O A;  2KCK A;  4TV3 A;  3PZ3 A;  1O1S A;  1TN6 A;  5BT1 A;  3CK8 A;  3QNK A;  1AWC B;  4DJA A;  4KBQ A;  4APF A;  2KZT B;  3PNT B;  2V5F A;  5HRY A;  5CED B;  5FQ7 A;  2MRI A;  2XGO A;  2WQ6 A;  3AJI A;  3S2A A;  3LY8 A;  4YDW A;  4M3O A;  3NAW A;  3IKO B;  1N4P A;  3S7B A;  1UN9 A;  4N5C A;  3ZXS A;  1HS6 A;  4NIK A;  3UM0 A;  1BU9 A;  2WXK A;  3ASD A;  3QC1 A;  2DWZ A;  1K8K G;  4LEU A;  3APC A;  1YA0 A;  4C0M A;  4UI9 K;  1K1A A;  4UQX A;  2ILR A;  1OUV A;  5C1D A;  5A6C A;  2P9N G;  3NOC D;  4HRM B;  1TNB A;  1KZP A;  4I43 A;  3VLF A;  3CVP A;  3I4G A;  3ZKJ A;  1NA0 A;  4TRQ A;  3PZ2 A;  3SHF A;  3ONL A;  4G11 A;  4WUY A;  4PS3 A;  1YMP A;  3ENE A;  1SZA A;  1EDU A;  3DWL G;  3ASH A;  3DEO A;  2QY7 A;  4U04 A;  3RRM B;  3AU4 A;  3AS8 A;  1IYG A;  4K5C A;  3IHY A;  5IY5 E;  2XCB A;  5FIN A;  5CMW A;  5EN5 D;  4KT6 B;  1JWF A;  3UM3 A;  5D2M C;  2BED A;  3CKB A;  2B6C A;  1IQR A;  3JXI A;  1IHB A;  4GMR A;  2FI7 A;  2XZD G;  3CIA A;  4HLE A;  5FQ8 A;  3PDN A;  3FUK A;  4HI8 A;  2XCC A;  5FT9 A;  3PZD A;  4BT9 A;  2XQ0 A;  5BV0 A;  3KAE A;  3ZYM A;  3TG5 A;  1WG0 A;  1UJJ A;  2DIW A;  4QQI A;  5T3R A;  2WXO A;  3QWP A;  3FUH A;  1BPO A;  3UIP C;  1N0R A;  5EKQ D;  1JPL A;  3L13 A;  3F6Q A;  1DCE A;  5G05 C;  5BXO A;  2VGX B;  3IHV A;  4D10 C;  3DSV A;  5ANR A;  3L54 A;  1PAQ A;  2H6F A;  5B3S E;  2HR2 A;  2F8Y A;  5EIB E;  4GTM A;  3D3M A;  3LS8 A;  3UI2 A;  1IQU A;  2DCP A;  3ML8 A;  4DK5 A;  3MKQ A;  1BI7 B;  4F3V A;  5BXU A;  4EHM A;  3NF1 A;  2WXH A;  4WAF A;  1X5B A;  3CLJ A;  4LCT A;  1ELR A;  1DCQ A;  3SO8 A;  3BG0 B;  3FH8 A;  3MJW A;  4L9P A;  3T5X A;  4U95 D;  3RO3 A;  1ZU2 A;  4HOQ A;  4JA7 A;  3JYS A;  4GPM A;  4GA0 A;  5LCW C;  2AVP A;  3PUK A;  4B0Z A;  2VSN A;  3FTV A;  4EZJ A;  3EDT B;  2CG3 A;  1FVH A;  4J8E A;  1EYH A;  2LO6 A;  3Q78 A;  3ZUV B;  2F37 A;  3LXU X;  3MA5 A;  3V2X A;  1SZ9 A;  4GTP A;  3R9M A;  1HF8 A;  1W3B A;  3FTW A;  3FEX A;  2J8S D;  1MX4 A;  2X6K A;  1NP7 A;  3ZEF A;  1N4Q A;  4RLY A;  4HNA D;  4F7A A;  4PS8 A;  3CR3 A;  5LFA A;  4CDM A;  1E8X A;  4G2V A;  2FO1 E;  2QFC A;  1WM5 A;  2IOL A;  2KZT A;  1S70 B;  4I17 A;  4LG6 A;  3UM2 A;  4U8H A;  3UX4 A;  3ZU7 B;  3O4Z A;  4XE0 A;  4HOT A;  3L16 A;  4LNB A;  1XNF A;  3LEW A;  1PC2 A;  1OCZ E;  2GRM A;  4AIF A;  3T5V A;  2YIN A;  2RG8 A;  4J8S A;  3CVL A;  2I1K A; 
#chains in the Genus database with same CATH homology
 1YMP A;  3AAA C;  3W9G A;  1N0Q A;  3HRA A;  4U8Y D;  4G8L A;  5JA4 D;  1N11 A;  1MX2 A;  4J8Y A;  3V31 A;  1BI7 B;  3KEA A;  4QFV A;  2V4H C;  3DEO A;  4F1P A;  5BXU A;  2DZN A;  5EID A;  2NYJ A;  3W9F A;  3V2O A;  4K5C A;  2Y0B G;  3B95 A;  3Q9U C;  4JB8 P;  4N5Q A;  5FIO A;  4HB5 A;  4HQD A;  4HBD A;  3TWS A;  5FIN A;  3TWV A;  5D66 A;  1YCS B;  2L6B A;  2QC9 A;  4DX2 A;  1TR4 A;  2XEE A;  1DCQ A;  3SO8 A;  3EHR A;  3TWW A;  5AQ9 A;  5EN5 D;  4OAU C;  5ENP D;  3J5P A;  1G3N B;  4U95 D;  3T9K A;  5CBN A;  1AWC B;  2Y1L E;  2HE0 A;  2RFA A;  4ZHB A;  2QYJ A;  3EHQ A;  4GPM A;  3JXI A;  1UOH A;  4OAV B;  4A63 B;  1IHB A;  1OY3 D;  4GMR A;  1MJ0 A;  5HRY A;  4ZFH A;  2XZD G;  3ZNG A;  5ITZ F;  5CED B;  4DUI A;  1SVX A;  4UUC A;  1K3Z D;  4O1P A;  1SW6 A;  4CYM D;  4HI8 A;  2ETC A;  2XEH A;  3AJI A;  5AN8 A;  1BLX B;  2F8X K;  3V79 K;  5KNG A;  4HLL A;  4YDW A;  3HG0 D;  3T8K A;  5AAO A;  2AJA A;  3ZUV B;  2F37 A;  4LSZ E;  4B93 B;  5ENO D;  4U96 D;  2BKG A;  2ETA A;  3V2X A;  4BER A;  1OT8 A;  4BES A;  4BSZ B;  3D9H A;  5AAR A;  4O1O A;  2JAB A;  4DX5 D;  3NBN B;  1WG0 A;  1QYM A;  2ZGD A;  4C48 B;  2PNN A;  3TWT A;  2J8S D;  5CBO A;  2ETB A;  1MX4 A;  2B0O E;  3DEP A;  5HKP A;  1DC2 A;  5ENT D;  2BKK B;  5KBA A;  1AP7 A;  4NIK A;  5ENQ D;  4QQI A;  4BET A;  2DZO A;  1BU9 A;  4DX7 D;  4RLY A;  1YYH A;  2P2C P;  3IXE A;  5AQB A;  4HNA D;  4K5A B;  2DWZ A;  1D9S A;  3B7B A;  3UTM A;  3TWX A;  2KBX A;  5KWD A;  4HRL A;  2DVW A;  3TWU A;  1NFI E;  4BEP A;  4DX1 A;  3Q9N C;  5ENR D;  4HI9 A;  4O60 A;  4U8V D;  4TUM A;  1N0R A;  5HS0 A;  4DRX E;  4F6R D;  5CER B;  2FO1 E;  1BI8 B;  1K1A A;  2VGE A;  2V5Q C;  3F6Q A;  1S70 B;  1WDY A;  5ENS D;  4K5B A;  2RFM A;  4LG6 A;  5BXO A;  4YDY A;  4DX6 D;  5EYL A;  1IXV A;  3NOC D;  4HRM B;  5CEA A;  1IKN D;  3ZU7 B;  4Z68 A;  3V30 A;  5AQ7 A;  4G8K A;  4HRN A;  3JUE A;  4LNU D;  1MYO A;  5CEC B;  3J5Q B;  2KXP C;  3ZKJ A;  2XZT G;  5AQA A;  2ZGG A;  2XEN A;  3C5R A;  3EU9 A;  3UXG A;  5EYP F;  2F8Y A;  3NOG D;  5EIL A;  1BD8 A;  3TWR A;  1MX6 A;  5EIB E;  1K1B A;  3JXJ A;  2MYO A;  3LJN A;  3UI2 A;  5KNH D;  4CZ2 D;  2A5E A;  5JMN D;  3TWQ A;  4ATZ D;  4J7W A;  1A5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...