4Y6WA

Crystal structure of podosopora anserina putative kinesin light chain nearly identical tpr-like repeats
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
211
structure length
211
Chain Sequence
MEHPSRLRSQHELARRYQQNGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQRQEAQELLEQVRAIQAKTQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords NaB(AB)3ACb - light chain TPR-like repeats
publication title A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins.
pubmed doi rcsb
source organism Podospora anserina
total genus 97
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4y6wA00
2XCCA 4HOTA 4JL0A 3SZ7A 4G23A 4JA9A 5BT1A 3RO3A 1TJCA 3MEKA 3FWVA 4G26A 1E96B 3EDTB 2FBNA 1PC2A 4I1AA 2LSVA 5C1DA 4N3BA 4LEUA 2YQ8A 4GA1A 2PQRA 4HORA 5FJYA 2KCKA 3CEQA 2XPIA 3LCAA 5G04C 3LKUA 4ABNA 2XEVA 3Q15A 4CGWA 5CHEE 3KD7A 2MHKA 5FTPA 3ULQA 3PE3A 5D0OD 4XI9A 2VYIA 3OXLA 4UI9C 4CGVA 4J8DA 4UI9J 4NRHB 3O48A 3RIBA 3URZA 3ZFWA 3CVLA 3E4BA 4GZ5A 2VSNA 5A6CA 4G2VA 3GW4A 3ESKA 3UUXA 4J0UA 1XNFA 3JYSA 3SF4A 4XIFA 3RO2A 3ZHEA 5EX0A 4UI9K 5BNWA 4GZ6A 3LPZA 3AS4A 5FZRA 4WNEA 3CK8A 2NC9A 3Q4AB 3S7FA 2Q7FA 5AYWD 4W9RA 2R5SA 2V5FA 4BT9A 2WPVA 4UQXA 4KYOB 3TAXA 4HOSA 2HYZA 4HOUA 2XGMA 2ONDA 2IF4A 4GYYA 5EX3A 3ZN3A 1NZNA 1ELWA 1ZBPA 4GCOA 3Q49B 1Y8MA 4GPKA 2VQ2A 4AM9A 5M72A 1YA0A 4WNGA 3MA5A 3VTYA 3S7JA 3AS8A 1ELRA 3RU0A 4YVOA 4WNFA 2LSUA 3ZGQA 5DIZA 3GZ2A 4GCNA 1A17A 5KJNA 4HOQA 5G05J 2HR2A 3ASGA 3PE4A 2QFCA 4I9EA 3QWWA 4WNDA 2XGOA 3CK9A 5FT9A 4I9CA 2J9QA 5JJ7A 2KATA 5LCWC 3ZHEB 2FEZA 3TG5A 5HI7A 3S7BA 5LCWJ 4EQFA 3CKBA 1HH8A 4N2SA 2IFUA 4UQZA 1IHGA 2C0MA 3QDNA 3GZ1A 4KXKB 5KJLA 4I17A 3FFLA 4UQYA 2WQHA 1KLXA 3LY8A 3CVNA 4Y6WA 2PQNA 4N3CA 1HXIA 5KJKA 2UWJG 4I2WA 4Y6CA 3KS2A 2AVPA 3HYMB 3AS5A 4AY5A 4N39A 5ARGA 4RG9A 1NA0A 4O6FA 3OXFA 1IYGA 2VGXB 2P58C 4KBQA 4YVQC 5FZSA 3BEEA 1ZU2A 3RJVA 2GW1A 3LYAA 3CV0A 3ASHA 3QKYA 3IEGA 3CVPA 3ZPJA 2BUGA 4H7YA 2Y4UA 5CCMA 4AIFA 3RKVA 4N3AA 4N2QA 2KC7A 5G05C 2OOEA 5DBKA 4APOA 1QQEA 3UPVA 4GA0A 2FO7A 4N5CA 3ASDA 3QWPA 2VGXA 3FP3A 3CVQA 3CKCA 2C2LA 2VSYA 2KCVA 3OXGA 5A7DB 4A1SA 3ASFA 4U0ZA 4J8FA 4G24A 3MV2B 2JLBA 3Q47B 2HO1A 2Y4TA 5FZQA 4XI0A 3K9IA 4AY6A 1OUVA 4NQ0A 2L6JA 4JA7A 5G04J 3QWVA 4J8EA 4I2ZA 4GA2A 5EKQD 3U4TA 1NA3A 4IN3B 4BT8A 1QZ2A 4YNDA 3Q5MA 2XGSA 4BTBA 4BWRA 5HQ8A 1WAO1 2KCLA 2VGYA 2FF4A 3NF1A 5JJTA 3S7DA 3TGOA 3LY7A 3WXXA 4GYWA 4WUYA 2UY1B 3KAEA 4GZ3A 4JHRA 2LNIA 4U04A 3N71A 3MKRA 3PDNA 5JJ6A 4BTAA 1B89A 4CDRA 2E2EA 1P5QA 1FCHA 4ME2A 1KT0A 4U07A 2PZIA 4GYOA 5D0QD 5KJMA 3UQ3A 3U3WA 2XCBA 5ARFA 3QOUA 4H7XA 2FI7A 5CCLA 4U0SA 1HZ4A 3MV3B 3LY9A 2UY1A 4G25A 3CK7A 1W3BA 4F3VA 3R9AB 2I6HA 2YHCA 5BW8C 2DBAA 4RG6A 3TG4A 2PL2A 4G1TA 3GYZA 1WM5A 2C0LA 4U0UA 1KT1A 3VTXA 4B94A
chains in the Genus database with same CATH superfamily
2ZISA 4GTRA 4HOTA 3FULA 4JL0A 3SZ7A 4LNUD 1TJCA 5ENSD 3MEKA 4DUIA 2H6HA 4EZKA 4GTTA 2ZGDA 3SFYA 2J49A 4MRUA 3TWUA 2V4LA 3AU5A 3IXEA 4UWLA 4AJWA 4OAUC 3L9TA 3ML9A 4GA1A 4DJAA 3FUHA 3LCAA 3B7TA 2ETBA 4HRNA 3T8KA 3BG1B 2V0PA 3MKQB 4MKTA 5FTPA 3ULQA 4UUCA 3PE3A 3C3RA 4XI9A 3CHQA 1TN7A 3OXLA 5CEAA 3FTUA 4HXIA 3CHMA 2R59A 4NRHB 4BX9A 2P9UG 3KSLA 4GPMA 2X6JA 4BETA 3D9MA 2NSZA 2CHWA 2GRRB 4APFA 3CHOA 3GW4A 4XKBA 3ESKA 1H2TC 4J0UA 1XNFA 3JYSA 3SY2A 3SF4A 3CR3A 4JB8P 2R05A 3FUDA 4DX7D 4URKA 1TN8A 1WY6A 4WNEA 3CK8A 2NC9A 3X2QE 4W9RA 2XEEA 2R5SA 2V5FA 4I6GA 1MX6A 2WPVA 3DPDA 4KYOB 3TAXA 2IF4A 1FT2A 4MLPA 1Z3XA 2WQ7A 1E8YA 3FUIA 3LDZA 1ELWA 5JMND 2VJ8A 1Y8MA 4GPKA 1NI1A 3TWWA 1JWGA 1O1SA 3BU8A 4WNGA 4YDYA 4JZYA 2XHEA 1ELRA 4E85A 4WNFA 1BLXB 3ML8A 3PS6A 3ZGQA 3ISMC 2IEJA 2WXQA 3CVUA 3E30A 3FU5A 4YDEA 5KNGA 3PE4A 3HHMA 1K3ZD 4GTPA 5BV1A 2ILRA 1O1TA 2PNNA 3FHEA 3CK9A 3FU6A 4I9CA 2RFAA 3R7QA 5FWQA 3PREA 3CVWA 3S7BA 4FHKA 2P9LG 3ABME 2Y1LE 2R17C 2R02A 2IFUA 2GROB 3QDNA 4GZDA 2VSXE 1Z6TA 3FFLA 4ANVA 2CG2A 3D9HA 1S70B 1TNBA 2J4BA 4PH4B 2J07A 3G2SA 3FUFA 3VLDA 2XQ0A 1JCSA 2P9NG 3UTMA 3FU3A 2BKKB 4N3CA 1HXIA 4ATZD 3IHVA 5AQAA 2UWJG 4EBAA 4I2WA 3KS2A 1K1BA 2WXIA 1DC2A 4HS2A 1E8ZA 1TR4A 4L7TA 1TNOA 4N39A 2L0TB 1D8EA 4O6FA 1TEZA 3TWSA 2P58C 5FZSA 3UIPC 1ZU2A 3HRAA 3KSQA 4ATGA 4P29A 3FH5A 4F53A 5LP0A 2HE0A 2KBXA 5ENNA 3ZYKA 3ZPJA 3PZ4A 3FTXA 1N54A 1LD8A 2BEDA 3L13A 3D9LA 4CCAA 2OCCE 3APCA 5BUZA 3R9MA 1Y6IA 4YDWA 4MBGA 1HF8A 4PUCA 2WB2A 2OOEA 3SI5A 3D9IA 1MJ0A 1BPOA 4FA6A 4Q69A 3T8MA 5LOZA 3L17A 3FP3A 3PNLB 3U64A 4BERA 3C72A 3PEVB 1H6KA 3FDHA 3QJZA 3UINC 3ZXPA 3FUEA 4B93B 2IJGX 3MV2B 2HO1A 3ZIMA 3K9IA 4ACKA 3AG1E 1N4RA 4HBDA 1XGWA 2OV8A 2XZDG 1D9SA 4EHMA 5A23A 4BT8A 4RVBA 1U3CA 1WAO1 3NAWA 3Q7FA 4GTVA 2ZIRA 3NF1A 3S7DA 2RFMA 5CECB 1V54E 5B1AE 4HRLA 3KAEA 4GZ3A 2BTDA 3N71A 5BXOA 2P9IG 5KCMA 3CHRA 3ESLA 4F1SA 2LAIA 3DXMG 4GU5A 3CVYA 2FULA 2E2EA 4L9PA 1AP7A 1FCHA 2XS8A 3ZRHA 5FQ6A 5KJMA 3IBEA 3LJNA 3FTVA 2XCBA 5ARFA 1H0AA 4J8SA 2GRNB 3E34A 3NOGD 1MX4A 4U0SA 1UOHA 3CK7A 1UJKA 2X6KA 5EIBE 1RW2A 3I5PA 4LNGA 5ENOD 4DX6D 2C0LA 2XENA 4F7AA 4B94A 2XCCA 3C98A 4G8KA 2AWIA 4G23A 2GRLA 4AEZC 2AW6A 3FWVA 4G26A 4K5BA 2P9SG 3RAUA 4TXRA 2YINA 5ENPD 3AJIA 4I1AA 4M7CA 2LSVA 4LEUA 4HLLA 5FJYA 4E6HA 2EIME 4C48B 2LO6A 3LKUA 3L6AA 4ABNA 4CEMA 3SBSA 5CHEE 3Q9UC 4ZFHA 5T3RA 5EIDA 5G2NA 2IOSA 2VSOE 2B0OE 4UI9C 4UI9J 4R7LA 3RIBA 3URZA 1BI7B 3S2AA 2OVBA 2GRPB 1E7UA 5AQBA 2WXFA 4JVSA 3B13A 1SW6A 3UM0A 3E4BA 2WXPA 5D66A 1BI8B 3OAWA 5HRYA 3EIJA 4CT0A 5EX0A 3G2WA 4UI9K 1TYQG 2H6FA 4LG6A 4XX5A 3UX4A 5CMWA 3Q4AB 3JUEA 2Q7FA 4HOSA 4HOUA 2XGMA 2ONDA 4I1MA 5CERB 1K1AA 3ZN3A 2R2LA 4FU3A 1OWOA 4Z68A 3D9PA 3LS8A 3ZXSA 1ZBPA 4GCOA 3Q49B 3CIAA 2V5QC 2VQ2A 4AVXA 3HXBA 3ASOE 3CHSA 3B95A 5M72A 1YA0A 4LSZE 3AG3E 2E0IA 1FVFA 3HXFA 2IONA 1MX2A 3GZ2A 1A17A 2AXUA 2I1JA 4NACA 5G05J 3ASGA 2CG3A 4JC8A 1LD7A 2XRZA 2QC9A 1E8WA 2IY0C 3LJ3A 5FT9A 3L82A 2WXOA 5FIOA 1SQMA 1OCOE 5ANRA 3TG5A 1E7VA 4ILIA 1HH8A 4HNAD 2C0MA 3L08A 3V2OA 2Y69E 1Z5SC 1H2VC 3Q9NC 3NBNB 3QK0A 3WG7E 3PZDA 1N95A 3D9JA 4PS7A 4AP2A 4KZ0A 2Y3AA 3ZEFA 3RRMB 3CVNA 2DZNA 2PQNA 1MQSA 4F1PA 3SD5A 1GW6A 4FC8A 4DRXE 2CHXA 1H6PA 1TJFA 3AS5A 1PAQA 5AQ9A 4J8YA 3OXFA 4GTQA 2VGXB 4KBQA 1H6OA 3ZUVB 3FUMA 3BEEA 5T8IA 3CV0A 3EHQA 4BESA 3HXCA 2P9KG 4BY6A 2QYJA 4U8VD 2M63A 2P9PG 5BV0A 2P2CP 3SBTB 5AN8A 4C0MA 2LXLA 1NP7A 5AENA 4PS8A 3SO8A 5KNHD 2Y4UA 3IV0A 4BSXA 3MJWA 3BQOA 4N3AA 3UKUG 1DCQA 3DSVA 3ZNGA 3JQ0A 4FADA 5LFAA 4ILHB 1E90A 2VGXA 2KZTA 1N52A 2EINE 2X3MA 2C2LA 4GZCA 2VSYA 3JUIA 3RSEG 1HG2A 4KVOA 3MYVA 4JHKA 4A1GA 1RZ4A 1OXJA 4G24A 2OVFA 3DSWA 4RSYA 1H2UA 1N94A 3F6QA 2Y4TA 4IULA 3DSUA 1OUVA 4NQ0A 2L6JA 2DZOA 4EPZA 5G04J 2QZAA 4GA2A 3CSTA 1NA3A 3PUKA 1QZ2A 2A5EA 4ILGA 4BTBA 4A63B 2VGYA 3DRAA 5JJTA 2IOLA 3TGOA 1L5JA 4DX5D 2EILE 2QY7A 2LNIA 5C2YA 3TXMA 1S63A 3TJPA 4PS3A 1UN9A 5FQ8A 3U9WA 5JJ6A 4BTAA 4CDRA 1VDYA 1P5QA 3TWRA 1KT0A 2PZIA 3U66A 2VTBA 4JD2G 4A3TA 1MYOA 3QOUA 4XEIG 2L9BA 2FI7A 3RK6A 4CT4A 3CLJA 1KZOA 4K0RA 4WAFA 4UWFA 2RG8A 4EBAG 1HZ4A 1WG0A 3MV3B 1X81A 2PM6A 1BU9A 4G25A 1O5MA 5CBNA 3B7RL 2HM8A 2F37A 2I6HA 4MS6A 5BW8C 3PZ2A 2PL2A 3GZSA 3GYZA 5AJDA 3V31A 1N4SA 3LXUX 3VTXA 1KT1A 2DVWA 2ZU6B 2XEHA 1OCCE 3MCXA 4JA9A 5BT1A 4FLHA 3TWTA 2EIKE 2PM7A 3JXJA 1E96B 3KEZA 2EQXA 2B6CA 3C5RA 3SFZA 1IKND 1QYMA 4N3BA 3SNXA 3CSFA 3V30A 2V4HC 3CQGB 3HXEA 1DVPA 2XPIA 3B7SA 3QB2A 4L2YA 1OWLA 5CMYA 3T5VA 2XEVA 2DYRE 1LF8A 3D9OA 3ZYMA 2LUHA 2MHKA 3CVVA 3AAAC 3I4RB 4K03A 3ZYQA 4I6JA 4HB5A 3O48A 3ZFWA 1PY1A 2V8SE 3D3MA 3LEWA 4HVBA 2RD0A 4U8YD 3DEPA 4GZ5A 4LRZA 4G2VA 4U8HA 2VGEA 2WVIA 4OVUA 2NXPA 3UUXA 3QAQA 3ZHEA 2BF0X 5B3SE 5BNWA 3AS4A 3LVRE 4B0ZA 5EDSA 3J5PA 3AU4A 1FPPA 3FTYA 1N11A 2X38A 3S7FA 5AYWD 4DX2A 4BX8A 5AQ7A 3UMVA 4BT9A 2J08A 4I6EA 4ZHBA 3UT4A 2ETCA 3NQPA 1S0PA 1DNPA 3HG0D 1INZA 2J4DA 5CBOA 3HIZA 4IRUA 4I1OB 4TXPA 1JCRA 3S7JA 2R03A 3RU0A 4YVOA 3SFXA 3EU9A 4EZJA 1ZB1A 2WQ6A 4GCNA 4TV3A 4TRQA 4L1BA 3D9NA 2HR2A 5ITZF 4KT6B 3DWLG 2DWZA 1EDUA 5AJLA 4QQIA 4I9EA 4FHJA 3CHPA 4AXHA 4WWOA 4K5AB 2IO3C 2GGFA 2J9QA 5JJ7A 1MZCA 2YHEA 2FEZA 4J6IA 3T5XA 2F8YA 4ACLA 4TUUA 2H6IA 3L54A 4A3VA 2YNQA 4EQFA 3CKBA 3TWVA 4GMRA 1IHGA 1UW4B 3MGBA 5HKPA 4Q94A 3FTWA 3LVQE 3AG4E 2CFUA 2WMOA 3GZ1A 3SQVA 4FLBA 3TXNA 5KJLA 1BD8A 1UN8A 5CRVA 3UXGA 4HLEA 1KLXA 3LY8A 4G8LA 2XPYA 3W9FA 1EPUA 4Y6WA 3FEXA 5EYPF 3UM3A 3CVXA 5KJKA 2IQCA 1JPLA 3FUJA 4Y6CA 5AARA 2WXRA 2AVPA 1Z3YA 4GMJA 4GTMA 3HYMB 2ZXWE 1KZPA 4RG9A 4JPSA 1NA0A 1IYGA 4AV7A 1D8DA 4WWPA 3PVLA 3I3NA 3RJVA 2GW1A 3LYAA 1YYHA 3ASHA 3QKYA 4PDXA 4KMOA 3QC1A 3ONLA 4U63A 1UJJA 4DX1A 4L23A 2KXPC 5CCMA 3RRUA 1SA5A 3C3OA 4WWNA 3RKVA 4N2QA 1EF1C 5G05C 2WXGA 2X6FA 2I9CA 2WXHA 1QQEA 4APOA 3C3QA 3DSSA 3UPVA 4GA0A 1JWFA 5E76A 2WXMA 1N4PA 4N5CA 3UM2A 3ASDA 4U96D 4IYPA 2EIJE 1FT1A 3QWPA 4J7WA 2L0IA 4LUNU 3OXGA 3NB2A 4FP7A 4JEHA 3ASFA 4KVMA 4U0ZA 3FTZA 4CYMD 2JLBA 4DI3A 5FZQA 3Q75A 4AY6A 4HI8A 4DK5A 3PRZA 3QWVA 5EKQD 4G11A 4IN3B 2XPZA 3B7UX 3Q5MA 2IU1A 5ENTD 4C9BB 2XGSA 2ZGGA 5HQ8A 1IQUA 4I43A 3D9KA 4JW1A 2KCLA 3B7BA 3W9GA 3G2TA 5D2MC 3ABLE 3WXXA 4WUYA 3E32A 1E8XA 4U04A 5T4YA 3MKRA 5BPPA 4RQIA 3UIOC 3PDNA 1S64A 4HFGA 1B89A 3OTNA 3MZLB 3G2UA 4ME2A 4HQDA 3FUKA 4GYOA 2A4ZA 3VLEA 2KZTB 2MOWA 2XZTG 3MX3A 2OEWA 4GAAA 3MKQA 2RKKA 4ANXA 3IKOB 3EU5A 4H7XA 4DLQA 5ANLA 5AAOA 4FJZA 3KEAA 5EN5D 1N9AA 2LAHA 1W3BA 3ONKA 1Q2ZA 3NZSA 2XRYA 4CZ2D 1A5EA 2YHCA 1X5BA 1O1RA 2DBAA 4GB9A 1SA4A 3PH0C 4U0UA 2I2OA 3L16A 2WXJA 3HXDA 3QARA 3PZ1A 1NL4A 3HVEB 3RO3A 1U2VG 5EILA 3EDTB 4BFRA 1H19A 2FBNA 1PC2A 3UT8A 4GTOA 1G3NB 3ZYLA 3JCKC 3I4GA 5C1DA 3TL5A 4XE0A 2YQ8A 5J90A 4OVVA 2PQRA 3CQCB 4HORA 2KCKA 5J08A 3CEQA 4FULA 2VTBB 5G04C 3DXKG 3PNTB 1N0RA 1HE8A 3DBSA 4JXTA 4K5CA 3Q15A 4CGWA 1YCSB 3ZVVA 3KD7A 4V3IA 2DCPA 3EIQC 5D0OD 3BG0B 2VYIA 4CGVA 3HVEA 4J8DA 1IHBA 5H7PA 2WXNA 4B89A 3DEOA 1FVHA 1QBQA 4OYSA 3CVLA 3EHMA 4QFVA 2VSNA 5G55A 3UKRG 5A6CA 3UM1A 2WXKA 4F6RD 1HFAA 2MYOA 4XIFA 3RO2A 3FEYA 1IXVA 4GZ6A 2DYSE 3DSTA 3LPZA 3PUJA 4DI4A 5JHBA 3FU0A 3SHFA 5FZRA 2CFZA 3ENEA 4O1PA 1HX8A 4UQXA 4HI9A 2HYZA 3Q73A 3JQ1A 4GYYA 5EX3A 1SZAA 2NYJA 5JA4D 1NZNA 3APDA 1NFIE 3IHYA 4L2LA 3E33A 2Y0BG 3E37A 2IO2C 4AM9A 4A55A 4GMLA 3MA5A 3VTYA 3P2BA 4CRWA 4FJYA 3AS8A 1LTXA 2I1KA 4B8AA 2LSUA 2WM9A 5JHAA 1OCZE 1JUQA 5DIZA 5KJNA 4HOQA 2XS1A 3EJNA 4CDNA 2MRIA 2QFCA 4CDMA 2BKGA 3QWWA 1IQRA 4WNDA 5AIJA 2XGOA 3J5QB 2KATA 4EZLA 5LCWC 4TXQA 3ZHEB 5HI7A 2J09A 5LCWJ 4XKCA 2F8XK 2WMNA 1OCRE 4N2SA 4UQZA 4N5QA 3BUAA 2JABA 2X6HA 4AOFA 1TN6A 3TWXA 3ULEG 2OEVA 1OWNA 4LERA 4KXKB 4I17A 4UWKA 4NURA 3SGHA 4UQYA 2WQHA 4LNBA 1SVXA 3EUVA 4C0EA 5CEDB 4LCTA 3P1UA 1EYHA 1UG3A 2CHZA 2GRMA 1YMPA 2GRQB 4KZCA 4AY5A 5ARGA 4XZ4A 1HG5A 1MHQA 4UWHA 1U3DA 1OT8A 3QNKA 4YVQC 3ABKE 1HU3A 4NIKA 5ENRD 1ELKA 4YDOA 3IEGA 2AXVA 5EYLA 3CVPA 4ANUA 2KM4A 3CGHA 2BUGA 5FINA 3ZU7B 2F0YA 4H7YA 3HDXA 1SZ9A 3VLFA 4AIFA 3Q79A 4O60A 3V2XA 2JEKA 2KC7A 4OAVB 5DBKA 4D10C 2WXLA 4UWGA 3TWQA 2FO7A 5KWDA 1N4QA 4U95D 1HS6A 3EHNA 3UI2A 4DLOA 3CVQA 3R7RA 3T9KA 3CKCA 2A5UA 2KCVA 5ENQD 5A7DB 3FY4A 3APFA 4O1OA 3NOCD 3Q78A 4A1SA 4GTSA 4J8FA 4RLYA 5LX8A 3Q47B 3PEUB 3ASNE 4XI0A 2QYUA 3DSXA 3NZUA 4HRMB 3FH7A 4U7EB 3FUNA 3O4ZA 3ZW3A 4JA7A 3UT7A 3FTSA 2L6BA 3JXIA 4J8EA 4I2ZA 4DPRA 2LXMA 3U4TA 4YNDA 1OY3D 4BWRA 1AWCB 3FH8A 2FF4A 1N0QA 1QNFA 3AG2E 5FQ4A 4ANWA 1OWPA 3LY7A 1TNZA 4Q96A 2AXZA 4GYWA 2UY1B 4JHRA 5BXUA 5B1BE 1TNUA 5E75A 3G2VA 4EECA 4X8QA 1OWMA 2DIWA 4BEPA 4U07A 5FQ7A 5D0QD 3DPYA 2ETAA 3L22A 1K8KG 1V55E 3UQ3A 2J8SD 3U3WA 4M3OA 1WDYA 1HO8A 3Q7AA 4TUMA 5CRUA 3RRNB 4B8CB 2X6IA 3PZ3A 5CCLA 1DCEA 4BSZB 3LY9A 2UY1A 5IY5E 2AJAA 5HS0A 4JEUA 3V79K 4F3VA 1KPSB 3R9AB 1TNYA 2H6GA 4JHJA 4RG6A 3TG4A 2FO1E 4G1TA 1WM5A 3ULYA 1JCQA 3ZKJA 5KBAA 3EHRA
chains in the Genus database with same CATH topology
3QARA 2XCCA 3C98A 4HOTA 3FULA 4JL0A 2AWIA 3SZ7A 3MCXA 4G23A 2GRLA 4JA9A 4AEZC 5BT1A 3HVEB 4FLHA 3RO3A 1TJCA 3MEKA 2AW6A 3FWVA 4G26A 4EZKA 2YINA 2PM7A 3KEZA 1E96B 3EDTB 4BFRA 1H19A 2FBNA 1PC2A 2EQXA 2J49A 3UT8A 3SFZA 3JCKC 3ZYLA 4MRUA 4I1AA 3I4GA 2LSVA 2V4LA 5C1DA 3AU5A 4LEUA 4N3BA 4XE0A 3TL5A 2YQ8A 3SNXA 4UWLA 4AJWA 5J90A 3CSFA 4OVVA 3ML9A 4GA1A 2PQRA 3CQCB 4HORA 3CQGB 4DJAA 1DVPA 3FUHA 5FJYA 2KCKA 5J08A 3CEQA 2XPIA 3LCAA 4FULA 4E6HA 3B7SA 3QB2A 2LO6A 5G04C 2VTBB 3PNTB 3LKUA 3B7TA 4L2YA 3L6AA 1HE8A 4ABNA 3BG1B 3DBSA 1OWLA 4JXTA 3SBSA 4CEMA 5CMYA 3T5VA 2XEVA 1LF8A 3Q15A 4CGWA 5CHEE 3D9OA 2V0PA 3ZYMA 3ZVVA 3MKQB 3KD7A 5T3RA 4MKTA 5G2NA 2MHKA 3CVVA 5FTPA 2IOSA 4V3IA 3ULQA 2DCPA 3PE3A 2VSOE 3EIQC 5D0OD 4XI9A 3CHQA 3BG0B 2VYIA 3OXLA 3I4RB 4UI9C 4CGVA 3HVEA 4J8DA 4K03A 3FTUA 4HXIA 3CHMA 3ZYQA 2R59A 4I6JA 4UI9J 2WXNA 4NRHB 4BX9A 4B89A 4R7LA 3O48A 3RIBA 3URZA 3ZFWA 1FVHA 3S2AA 2OVBA 1PY1A 2V8SE 4OYSA 2X6JA 3D3MA 3LEWA 4HVBA 3D9MA 2RD0A 2NSZA 3CVLA 1E7UA 2CHWA 2WXFA 3EHMA 4JVSA 3B13A 4QFVA 4APFA 3CHOA 3E4BA 4GZ5A 4LRZA 2VSNA 5G55A 5A6CA 4G2VA 4U8HA 2WXPA 3GW4A 4XKBA 2WXKA 2WVIA 3ESKA 4OVUA 2NXPA 3OAWA 3UUXA 1H2TC 4J0UA 3EIJA 1XNFA 3QAQA 1HFAA 3JYSA 3SF4A 4XIFA 3RO2A 2BF0X 3CR3A 3ZHEA 5EX0A 4CT0A 3G2WA 3FEYA 3FUDA 4UI9K 5BNWA 4GZ6A 3LPZA 4DI4A 3PUJA 5JHBA 3AS4A 3LVRE 4B0ZA 5EDSA 3FU0A 3SHFA 3AU4A 5FZRA 1WY6A 4URKA 2CFZA 4XX5A 3ENEA 4WNEA 3CK8A 2NC9A 3UX4A 3FTYA 5CMWA 2X38A 3Q4AB 3S7FA 2Q7FA 5AYWD 4W9RA 2R5SA 4BX8A 2V5FA 4I6GA 3UMVA 4BT9A 1HX8A 2WPVA 2J08A 3DPDA 4I6EA 4KYOB 4UQXA 3TAXA 3UT4A 4HOSA 2HYZA 4HOUA 2XGMA 2ONDA 2IF4A 3JQ1A 4GYYA 4I1MA 5EX3A 1SZAA 4MLPA 3ZN3A 1NZNA 4FU3A 3APDA 1OWOA 3NQPA 1S0PA 1Z3XA 3D9PA 1DNPA 3LS8A 2WQ7A 1E8YA 3FUIA 3LDZA 1ELWA 3IHYA 4L2LA 1ZBPA 2VJ8A 3Q49B 4GCOA 1Y8MA 3ZXSA 1INZA 2J4DA 4GPKA 1JWGA 3CIAA 2VQ2A 4AVXA 3HIZA 3CHSA 4IRUA 4AM9A 5M72A 1YA0A 4I1OB 4WNGA 4A55A 4GMLA 4JZYA 3MA5A 2E0IA 3P2BA 3VTYA 4CRWA 4FJYA 3S7JA 3AS8A 1FVFA 1ELRA 2XHEA 4E85A 3RU0A 4YVOA 2I1KA 2IONA 4B8AA 4WNFA 3ML8A 2LSUA 3PS6A 3ZGQA 4EZJA 2WM9A 5JHAA 2WQ6A 1JUQA 5DIZA 3GZ2A 4GCNA 1A17A 2AXUA 2WXQA 5KJNA 2I1JA 4TV3A 3CVUA 3FU5A 4HOQA 4L1BA 3D9NA 4NACA 4TRQA 5G05J 2HR2A 3EJNA 3ASGA 2CG3A 4JC8A 4KT6B 4CDNA 3PE4A 2MRIA 2XRZA 2QFCA 3HHMA 4CDMA 1EDUA 5AJLA 4I9EA 5BV1A 1E8WA 2ILRA 4FHJA 3CHPA 3QWWA 4AXHA 1IQRA 4WNDA 5AIJA 3FHEA 4WWOA 2XGOA 3LJ3A 3CK9A 5FT9A 3FU6A 4I9CA 2WXOA 2GGFA 1SQMA 3R7QA 5FWQA 2J9QA 5JJ7A 2YHEA 2KATA 3PREA 4EZLA 3CVWA 5LCWC 3ZHEB 2FEZA 5ANRA 3TG5A 5HI7A 3S7BA 4J6IA 2J09A 3T5XA 4ACLA 5LCWJ 1E7VA 4FHKA 4TUUA 3L54A 4A3VA 2YNQA 4EQFA 4ILIA 3CKBA 4XKCA 2WMNA 1HH8A 2R17C 4N2SA 2IFUA 4UQZA 1IHGA 1UW4B 3MGBA 2C0MA 3QDNA 3L08A 4GZDA 4Q94A 3FTWA 2VSXE 2X6HA 3LVQE 4AOFA 2CFUA 1H2VC 2WMOA 3GZ1A 1Z6TA 1OWNA 4FLBA 3QK0A 4LERA 3TXNA 4KXKB 5KJLA 4I17A 3PZDA 4UWKA 4NURA 3FFLA 3SGHA 4UQYA 3D9JA 2WQHA 2CG2A 1UN8A 4PS7A 4ANVA 4HLEA 4C0EA 4AP2A 2J4BA 4KZ0A 2Y3AA 4LCTA 1KLXA 2J07A 3LY8A 3G2SA 4PH4B 3FUFA 3VLDA 3ZEFA 3RRMB 2XQ0A 2XPYA 3CVNA 1EPUA 4Y6WA 3FEXA 3P1UA 2PQNA 3FU3A 1EYHA 1UG3A 2CHZA 2GRMA 4N3CA 1HXIA 3CVXA 5KJKA 3IHVA 1MQSA 2IQCA 3SD5A 1GW6A 2UWJG 4EBAA 4I2WA 1JPLA 3FUJA 4FC8A 4KZCA 3KS2A 4Y6CA 2WXIA 2WXRA 2CHXA 4HS2A 2AVPA 1Z3YA 4GMJA 1E8ZA 1TJFA 3HYMB 3AS5A 4AY5A 1PAQA 4L7TA 4N39A 5ARGA 4XZ4A 1HG5A 1MHQA 2L0TB 4RG9A 4JPSA 1NA0A 4UWHA 4O6FA 3OXFA 1U3DA 1IYGA 3QNKA 1TEZA 2VGXB 2P58C 4KBQA 4AV7A 4WWPA 4YVQC 5FZSA 3FUMA 3PVLA 3BEEA 1ZU2A 1HU3A 3I3NA 3RJVA 4ATGA 5T8IA 4P29A 2GW1A 3LYAA 3CV0A 1ELKA 3FH5A 4F53A 5LP0A 3ASHA 3QKYA 3IEGA 2AXVA 4PDXA 4KMOA 3CVPA 5ENNA 3ZYKA 3ZPJA 4ANUA 4BY6A 2KM4A 3QC1A 3CGHA 2BUGA 3ONLA 2M63A 5BV0A 3FTXA 3SBTB 4U63A 1N54A 1UJJA 4C0MA 1NP7A 4L23A 3L13A 3D9LA 4H7YA 4PS8A 3HDXA 4CCAA 5AENA 2Y4UA 1SZ9A 3APCA 3IV0A 5CCMA 5BUZA 1Y6IA 3RRUA 3VLFA 4AIFA 4WWNA 3RKVA 4BSXA 2JEKA 3MJWA 1HF8A 1EF1C 4N3AA 4N2QA 2KC7A 4PUCA 5G05C 2WXGA 2WB2A 2X6FA 2OOEA 5DBKA 3SI5A 3D9IA 4D10C 2I9CA 2WXLA 4UWGA 2WXHA 1QQEA 4APOA 3UPVA 1BPOA 4GA0A 1JWFA 5E76A 3JQ0A 2FO7A 2WXMA 4N5CA 4FADA 3ASDA 4Q69A 4FA6A 5LFAA 3T8MA 4IYPA 4ILHB 1HS6A 5LOZA 1E90A 3QWPA 3L17A 2VGXA 3FP3A 3EHNA 2KZTA 4DLOA 3CVQA 3PNLB 1N52A 2L0IA 3U64A 2X3MA 3R7RA 3CKCA 2A5UA 2C2LA 4GZCA 2VSYA 4LUNU 2KCVA 3OXGA 3JUIA 5A7DB 1HG2A 3FY4A 4KVOA 3APFA 3MYVA 4JHKA 4FP7A 3PEVB 4A1SA 4A1GA 1H6KA 3FDHA 4JEHA 3QJZA 3ASFA 3FUEA 4KVMA 4U0ZA 4J8FA 2IJGX 3FTZA 4G24A 3MV2B 5LX8A 2OVFA 2JLBA 3Q47B 4DI3A 3PEUB 4RSYA 1H2UA 2HO1A 2Y4TA 3ZIMA 4XI0A 5FZQA 3K9IA 4IULA 4ACKA 3NZUA 3FH7A 4AY6A 3FUNA 1OUVA 3O4ZA 4NQ0A 3ZW3A 2L6JA 4JA7A 3UT7A 1XGWA 3FTSA 4EPZA 2OV8A 4DK5A 5G04J 3PRZA 3QWVA 4J8EA 4I2ZA 4GA2A 5EKQD 4DPRA 3CSTA 4G11A 3U4TA 1NA3A 4IN3B 5A23A 2XPZA 3B7UX 3PUKA 4BT8A 1QZ2A 4YNDA 3Q5MA 2IU1A 4C9BB 2XGSA 4ILGA 4RVBA 4BTBA 4BWRA 1IQUA 4I43A 3FH8A 1U3CA 3D9KA 1WAO1 5HQ8A 2KCLA 2VGYA 4JW1A 2FF4A 1QNFA 5FQ4A 4ANWA 3G2TA 3NF1A 5JJTA 3S7DA 2IOLA 3TGOA 1OWPA 1L5JA 3LY7A 4Q96A 2AXZA 3WXXA 4GYWA 4WUYA 2UY1B 3KAEA 4GZ3A 4JHRA 2QY7A 2LNIA 5C2YA 1E8XA 2BTDA 3TXMA 4U04A 3TJPA 4PS3A 5T4YA 3N71A 3MKRA 5BPPA 5KCMA 1UN9A 3CHRA 3ESLA 3PDNA 5FQ8A 4F1SA 2LAIA 5E75A 3U9WA 5JJ6A 3G2VA 4GU5A 3CVYA 4EECA 4BTAA 1OWMA 2FULA 1B89A 2DIWA 3OTNA 4HFGA 1VDYA 2E2EA 3MZLB 4CDRA 1P5QA 3G2UA 1FCHA 4ME2A 1KT0A 3ZRHA 4U07A 2PZIA 3FUKA 4GYOA 5FQ7A 3U66A 2A4ZA 3VLEA 5D0QD 2KZTB 2VTBA 5FQ6A 5KJMA 3L22A 3UQ3A 2MOWA 3MX3A 3IBEA 3U3WA 3FTVA 2XCBA 5ARFA 4A3TA 4GAAA 3QOUA 4M3OA 3MKQA 4ANXA 1H0AA 4J8SA 3IKOB 1HO8A 4H7XA 2L9BA 2FI7A 4DLQA 3RK6A 5ANLA 3RRNB 4B8CB 2X6IA 3CLJA 4CT4A 4K0RA 4WAFA 4UWFA 5CCLA 2RG8A 4U0SA 4EBAG 1HZ4A 3MV3B 4FJZA 2PM6A 3LY9A 2UY1A 4G25A 3CK7A 3B7RL 2LAHA 1W3BA 2HM8A 3ONKA 4JEUA 4F3VA 1UJKA 3R9AB 2I6HA 2XRYA 2X6KA 3NZSA 4MS6A 2YHCA 5BW8C 1X5BA 2DBAA 4JHJA 3I5PA 4GB9A 4RG6A 3TG4A 2PL2A 3PH0C 4G1TA 3GZSA 3GYZA 5AJDA 1WM5A 3LXUX 2C0LA 4U0UA 1KT1A 3VTXA 2I2OA 3L16A 2WXJA 4F7AA 4B94A 2ZU6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCC A;  4HOT A;  4JL0 A;  3SZ7 A;  4G23 A;  4JA9 A;  5BT1 A;  3RO3 A;  1TJC A;  3MEK A;  3FWV A;  4G26 A;  1E96 B;  3EDT B;  2FBN A;  1PC2 A;  4I1A A;  2LSV A;  5C1D A;  4N3B A;  4LEU A;  2YQ8 A;  4GA1 A;  2PQR A;  4HOR A;  5FJY A;  2KCK A;  3CEQ A;  2XPI A;  3LCA A;  5G04 C;  3LKU A;  4ABN A;  2XEV A;  3Q15 A;  4CGW A;  5CHE E;  3KD7 A;  2MHK A;  5FTP A;  3ULQ A;  3PE3 A;  5D0O D;  4XI9 A;  2VYI A;  3OXL A;  4UI9 C;  4CGV A;  4J8D A;  4UI9 J;  4NRH B;  3O48 A;  3RIB A;  3URZ A;  3ZFW A;  3CVL A;  3E4B A;  4GZ5 A;  2VSN A;  5A6C A;  4G2V A;  3GW4 A;  3ESK A;  3UUX A;  4J0U A;  1XNF A;  3JYS A;  3SF4 A;  4XIF A;  3RO2 A;  3ZHE A;  5EX0 A;  4UI9 K;  5BNW A;  4GZ6 A;  3LPZ A;  3AS4 A;  5FZR A;  4WNE A;  3CK8 A;  2NC9 A;  3Q4A B;  3S7F A;  2Q7F A;  5AYW D;  4W9R A;  2R5S A;  2V5F A;  4BT9 A;  2WPV A;  4UQX A;  4KYO B;  3TAX A;  4HOS A;  2HYZ A;  4HOU A;  2XGM A;  2OND A;  2IF4 A;  4GYY A;  5EX3 A;  3ZN3 A;  1NZN A;  1ELW A;  1ZBP A;  4GCO A;  3Q49 B;  1Y8M A;  4GPK A;  2VQ2 A;  4AM9 A;  5M72 A;  1YA0 A;  4WNG A;  3MA5 A;  3VTY A;  3S7J A;  3AS8 A;  1ELR A;  3RU0 A;  4YVO A;  4WNF A;  2LSU A;  3ZGQ A;  5DIZ A;  3GZ2 A;  4GCN A;  1A17 A;  5KJN A;  4HOQ A;  5G05 J;  2HR2 A;  3ASG A;  3PE4 A;  2QFC A;  4I9E A;  3QWW A;  4WND A;  2XGO A;  3CK9 A;  5FT9 A;  4I9C A;  2J9Q A;  5JJ7 A;  2KAT A;  5LCW C;  3ZHE B;  2FEZ A;  3TG5 A;  5HI7 A;  3S7B A;  5LCW J;  4EQF A;  3CKB A;  1HH8 A;  4N2S A;  2IFU A;  4UQZ A;  1IHG A;  2C0M A;  3QDN A;  3GZ1 A;  4KXK B;  5KJL A;  4I17 A;  3FFL A;  4UQY A;  2WQH A;  1KLX A;  3LY8 A;  3CVN A;  4Y6W A;  2PQN A;  4N3C A;  1HXI A;  5KJK A;  2UWJ G;  4I2W A;  4Y6C A;  3KS2 A;  2AVP A;  3HYM B;  3AS5 A;  4AY5 A;  4N39 A;  5ARG A;  4RG9 A;  1NA0 A;  4O6F A;  3OXF A;  1IYG A;  2VGX B;  2P58 C;  4KBQ A;  4YVQ C;  5FZS A;  3BEE A;  1ZU2 A;  3RJV A;  2GW1 A;  3LYA A;  3CV0 A;  3ASH A;  3QKY A;  3IEG A;  3CVP A;  3ZPJ A;  2BUG A;  4H7Y A;  2Y4U A;  5CCM A;  4AIF A;  3RKV A;  4N3A A;  4N2Q A;  2KC7 A;  5G05 C;  2OOE A;  5DBK A;  4APO A;  1QQE A;  3UPV A;  4GA0 A;  2FO7 A;  4N5C A;  3ASD A;  3QWP A;  2VGX A;  3FP3 A;  3CVQ A;  3CKC A;  2C2L A;  2VSY A;  2KCV A;  3OXG A;  5A7D B;  4A1S A;  3ASF A;  4U0Z A;  4J8F A;  4G24 A;  3MV2 B;  2JLB A;  3Q47 B;  2HO1 A;  2Y4T A;  5FZQ A;  4XI0 A;  3K9I A;  4AY6 A;  1OUV A;  4NQ0 A;  2L6J A;  4JA7 A;  5G04 J;  3QWV A;  4J8E A;  4I2Z A;  4GA2 A;  5EKQ D;  3U4T A;  1NA3 A;  4IN3 B;  4BT8 A;  1QZ2 A;  4YND A;  3Q5M A;  2XGS A;  4BTB A;  4BWR A;  5HQ8 A;  1WAO 1;  2KCL A;  2VGY A;  2FF4 A;  3NF1 A;  5JJT A;  3S7D A;  3TGO A;  3LY7 A;  3WXX A;  4GYW A;  4WUY A;  2UY1 B;  3KAE A;  4GZ3 A;  4JHR A;  2LNI A;  4U04 A;  3N71 A;  3MKR A;  3PDN A;  5JJ6 A;  4BTA A;  1B89 A;  4CDR A;  2E2E A;  1P5Q A;  1FCH A;  4ME2 A;  1KT0 A;  4U07 A;  2PZI A;  4GYO A;  5D0Q D;  5KJM A;  3UQ3 A;  3U3W A;  2XCB A;  5ARF A;  3QOU A;  4H7X A;  2FI7 A;  5CCL A;  4U0S A;  1HZ4 A;  3MV3 B;  3LY9 A;  2UY1 A;  4G25 A;  3CK7 A;  1W3B A;  4F3V A;  3R9A B;  2I6H A;  2YHC A;  5BW8 C;  2DBA A;  4RG6 A;  3TG4 A;  2PL2 A;  4G1T A;  3GYZ A;  1WM5 A;  2C0L A;  4U0U A;  1KT1 A;  3VTX A;  4B94 A; 
#chains in the Genus database with same CATH topology
 2ZIS A;  4GTR A;  4HOT A;  3FUL A;  4JL0 A;  3SZ7 A;  4LNU D;  1TJC A;  5ENS D;  3MEK A;  4DUI A;  2H6H A;  4EZK A;  4GTT A;  2ZGD A;  3SFY A;  2J49 A;  4MRU A;  3TWU A;  2V4L A;  3AU5 A;  3IXE A;  4UWL A;  4AJW A;  4OAU C;  3L9T A;  3ML9 A;  4GA1 A;  4DJA A;  3FUH A;  3LCA A;  3B7T A;  2ETB A;  4HRN A;  3T8K A;  3BG1 B;  2V0P A;  3MKQ B;  4MKT A;  5FTP A;  3ULQ A;  4UUC A;  3PE3 A;  3C3R A;  4XI9 A;  3CHQ A;  1TN7 A;  3OXL A;  5CEA A;  3FTU A;  4HXI A;  3CHM A;  2R59 A;  4NRH B;  4BX9 A;  2P9U G;  3KSL A;  4GPM A;  2X6J A;  4BET A;  3D9M A;  2NSZ A;  2CHW A;  2GRR B;  4APF A;  3CHO A;  3GW4 A;  4XKB A;  3ESK A;  1H2T C;  4J0U A;  1XNF A;  3JYS A;  3SY2 A;  3SF4 A;  3CR3 A;  4JB8 P;  2R05 A;  3FUD A;  4DX7 D;  4URK A;  1TN8 A;  1WY6 A;  4WNE A;  3CK8 A;  2NC9 A;  3X2Q E;  4W9R A;  2XEE A;  2R5S A;  2V5F A;  4I6G A;  1MX6 A;  2WPV A;  3DPD A;  4KYO B;  3TAX A;  2IF4 A;  1FT2 A;  4MLP A;  1Z3X A;  2WQ7 A;  1E8Y A;  3FUI A;  3LDZ A;  1ELW A;  5JMN D;  2VJ8 A;  1Y8M A;  4GPK A;  1NI1 A;  3TWW A;  1JWG A;  1O1S A;  3BU8 A;  4WNG A;  4YDY A;  4JZY A;  2XHE A;  1ELR A;  4E85 A;  4WNF A;  1BLX B;  3ML8 A;  3PS6 A;  3ZGQ A;  3ISM C;  2IEJ A;  2WXQ A;  3CVU A;  3E30 A;  3FU5 A;  4YDE A;  5KNG A;  3PE4 A;  3HHM A;  1K3Z D;  4GTP A;  5BV1 A;  2ILR A;  1O1T A;  2PNN A;  3FHE A;  3CK9 A;  3FU6 A;  4I9C A;  2RFA A;  3R7Q A;  5FWQ A;  3PRE A;  3CVW A;  3S7B A;  4FHK A;  2P9L G;  3ABM E;  2Y1L E;  2R17 C;  2R02 A;  2IFU A;  2GRO B;  3QDN A;  4GZD A;  2VSX E;  1Z6T A;  3FFL A;  4ANV A;  2CG2 A;  3D9H A;  1S70 B;  1TNB A;  2J4B A;  4PH4 B;  2J07 A;  3G2S A;  3FUF A;  3VLD A;  2XQ0 A;  1JCS A;  2P9N G;  3UTM A;  3FU3 A;  2BKK B;  4N3C A;  1HXI A;  4ATZ D;  3IHV A;  5AQA A;  2UWJ G;  4EBA A;  4I2W A;  3KS2 A;  1K1B A;  2WXI A;  1DC2 A;  4HS2 A;  1E8Z A;  1TR4 A;  4L7T A;  1TNO A;  4N39 A;  2L0T B;  1D8E A;  4O6F A;  1TEZ A;  3TWS A;  2P58 C;  5FZS A;  3UIP C;  1ZU2 A;  3HRA A;  3KSQ A;  4ATG A;  4P29 A;  3FH5 A;  4F53 A;  5LP0 A;  2HE0 A;  2KBX A;  5ENN A;  3ZYK A;  3ZPJ A;  3PZ4 A;  3FTX A;  1N54 A;  1LD8 A;  2BED A;  3L13 A;  3D9L A;  4CCA A;  2OCC E;  3APC A;  5BUZ A;  3R9M A;  1Y6I A;  4YDW A;  4MBG A;  1HF8 A;  4PUC A;  2WB2 A;  2OOE A;  3SI5 A;  3D9I A;  1MJ0 A;  1BPO A;  4FA6 A;  4Q69 A;  3T8M A;  5LOZ A;  3L17 A;  3FP3 A;  3PNL B;  3U64 A;  4BER A;  3C72 A;  3PEV B;  1H6K A;  3FDH A;  3QJZ A;  3UIN C;  3ZXP A;  3FUE A;  4B93 B;  2IJG X;  3MV2 B;  2HO1 A;  3ZIM A;  3K9I A;  4ACK A;  3AG1 E;  1N4R A;  4HBD A;  1XGW A;  2OV8 A;  2XZD G;  1D9S A;  4EHM A;  5A23 A;  4BT8 A;  4RVB A;  1U3C A;  1WAO 1;  3NAW A;  3Q7F A;  4GTV A;  2ZIR A;  3NF1 A;  3S7D A;  2RFM A;  5CEC B;  1V54 E;  5B1A E;  4HRL A;  3KAE A;  4GZ3 A;  2BTD A;  3N71 A;  5BXO A;  2P9I G;  5KCM A;  3CHR A;  3ESL A;  4F1S A;  2LAI A;  3DXM G;  4GU5 A;  3CVY A;  2FUL A;  2E2E A;  4L9P A;  1AP7 A;  1FCH A;  2XS8 A;  3ZRH A;  5FQ6 A;  5KJM A;  3IBE A;  3LJN A;  3FTV A;  2XCB A;  5ARF A;  1H0A A;  4J8S A;  2GRN B;  3E34 A;  3NOG D;  1MX4 A;  4U0S A;  1UOH A;  3CK7 A;  1UJK A;  2X6K A;  5EIB E;  1RW2 A;  3I5P A;  4LNG A;  5ENO D;  4DX6 D;  2C0L A;  2XEN A;  4F7A A;  4B94 A;  2XCC A;  3C98 A;  4G8K A;  2AWI A;  4G23 A;  2GRL A;  4AEZ C;  2AW6 A;  3FWV A;  4G26 A;  4K5B A;  2P9S G;  3RAU A;  4TXR A;  2YIN A;  5ENP D;  3AJI A;  4I1A A;  4M7C A;  2LSV A;  4LEU A;  4HLL A;  5FJY A;  4E6H A;  2EIM E;  4C48 B;  2LO6 A;  3LKU A;  3L6A A;  4ABN A;  4CEM A;  3SBS A;  5CHE E;  3Q9U C;  4ZFH A;  5T3R A;  5EID A;  5G2N A;  2IOS A;  2VSO E;  2B0O E;  4UI9 C;  4UI9 J;  4R7L A;  3RIB A;  3URZ A;  1BI7 B;  3S2A A;  2OVB A;  2GRP B;  1E7U A;  5AQB A;  2WXF A;  4JVS A;  3B13 A;  1SW6 A;  3UM0 A;  3E4B A;  2WXP A;  5D66 A;  1BI8 B;  3OAW A;  5HRY A;  3EIJ A;  4CT0 A;  5EX0 A;  3G2W A;  4UI9 K;  1TYQ G;  2H6F A;  4LG6 A;  4XX5 A;  3UX4 A;  5CMW A;  3Q4A B;  3JUE A;  2Q7F A;  4HOS A;  4HOU A;  2XGM A;  2OND A;  4I1M A;  5CER B;  1K1A A;  3ZN3 A;  2R2L A;  4FU3 A;  1OWO A;  4Z68 A;  3D9P A;  3LS8 A;  3ZXS A;  1ZBP A;  4GCO A;  3Q49 B;  3CIA A;  2V5Q C;  2VQ2 A;  4AVX A;  3HXB A;  3ASO E;  3CHS A;  3B95 A;  5M72 A;  1YA0 A;  4LSZ E;  3AG3 E;  2E0I A;  1FVF A;  3HXF A;  2ION A;  1MX2 A;  3GZ2 A;  1A17 A;  2AXU A;  2I1J A;  4NAC A;  5G05 J;  3ASG A;  2CG3 A;  4JC8 A;  1LD7 A;  2XRZ A;  2QC9 A;  1E8W A;  2IY0 C;  3LJ3 A;  5FT9 A;  3L82 A;  2WXO A;  5FIO A;  1SQM A;  1OCO E;  5ANR A;  3TG5 A;  1E7V A;  4ILI A;  1HH8 A;  4HNA D;  2C0M A;  3L08 A;  3V2O A;  2Y69 E;  1Z5S C;  1H2V C;  3Q9N C;  3NBN B;  3QK0 A;  3WG7 E;  3PZD A;  1N95 A;  3D9J A;  4PS7 A;  4AP2 A;  4KZ0 A;  2Y3A A;  3ZEF A;  3RRM B;  3CVN A;  2DZN A;  2PQN A;  1MQS A;  4F1P A;  3SD5 A;  1GW6 A;  4FC8 A;  4DRX E;  2CHX A;  1H6P A;  1TJF A;  3AS5 A;  1PAQ A;  5AQ9 A;  4J8Y A;  3OXF A;  4GTQ A;  2VGX B;  4KBQ A;  1H6O A;  3ZUV B;  3FUM A;  3BEE A;  5T8I A;  3CV0 A;  3EHQ A;  4BES A;  3HXC A;  2P9K G;  4BY6 A;  2QYJ A;  4U8V D;  2M63 A;  2P9P G;  5BV0 A;  2P2C P;  3SBT B;  5AN8 A;  4C0M A;  2LXL A;  1NP7 A;  5AEN A;  4PS8 A;  3SO8 A;  5KNH D;  2Y4U A;  3IV0 A;  4BSX A;  3MJW A;  3BQO A;  4N3A A;  3UKU G;  1DCQ A;  3DSV A;  3ZNG A;  3JQ0 A;  4FAD A;  5LFA A;  4ILH B;  1E90 A;  2VGX A;  2KZT A;  1N52 A;  2EIN E;  2X3M A;  2C2L A;  4GZC A;  2VSY A;  3JUI A;  3RSE G;  1HG2 A;  4KVO A;  3MYV A;  4JHK A;  4A1G A;  1RZ4 A;  1OXJ A;  4G24 A;  2OVF A;  3DSW A;  4RSY A;  1H2U A;  1N94 A;  3F6Q A;  2Y4T A;  4IUL A;  3DSU A;  1OUV A;  4NQ0 A;  2L6J A;  2DZO A;  4EPZ A;  5G04 J;  2QZA A;  4GA2 A;  3CST A;  1NA3 A;  3PUK A;  1QZ2 A;  2A5E A;  4ILG A;  4BTB A;  4A63 B;  2VGY A;  3DRA A;  5JJT A;  2IOL A;  3TGO A;  1L5J A;  4DX5 D;  2EIL E;  2QY7 A;  2LNI A;  5C2Y A;  3TXM A;  1S63 A;  3TJP A;  4PS3 A;  1UN9 A;  5FQ8 A;  3U9W A;  5JJ6 A;  4BTA A;  4CDR A;  1VDY A;  1P5Q A;  3TWR A;  1KT0 A;  2PZI A;  3U66 A;  2VTB A;  4JD2 G;  4A3T A;  1MYO A;  3QOU A;  4XEI G;  2L9B A;  2FI7 A;  3RK6 A;  4CT4 A;  3CLJ A;  1KZO A;  4K0R A;  4WAF A;  4UWF A;  2RG8 A;  4EBA G;  1HZ4 A;  1WG0 A;  3MV3 B;  1X81 A;  2PM6 A;  1BU9 A;  4G25 A;  1O5M A;  5CBN A;  3B7R L;  2HM8 A;  2F37 A;  2I6H A;  4MS6 A;  5BW8 C;  3PZ2 A;  2PL2 A;  3GZS A;  3GYZ A;  5AJD A;  3V31 A;  1N4S A;  3LXU X;  3VTX A;  1KT1 A;  2DVW A;  2ZU6 B;  2XEH A;  1OCC E;  3MCX A;  4JA9 A;  5BT1 A;  4FLH A;  3TWT A;  2EIK E;  2PM7 A;  3JXJ A;  1E96 B;  3KEZ A;  2EQX A;  2B6C A;  3C5R A;  3SFZ A;  1IKN D;  1QYM A;  4N3B A;  3SNX A;  3CSF A;  3V30 A;  2V4H C;  3CQG B;  3HXE A;  1DVP A;  2XPI A;  3B7S A;  3QB2 A;  4L2Y A;  1OWL A;  5CMY A;  3T5V A;  2XEV A;  2DYR E;  1LF8 A;  3D9O A;  3ZYM A;  2LUH A;  2MHK A;  3CVV A;  3AAA C;  3I4R B;  4K03 A;  3ZYQ A;  4I6J A;  4HB5 A;  3O48 A;  3ZFW A;  1PY1 A;  2V8S E;  3D3M A;  3LEW A;  4HVB A;  2RD0 A;  4U8Y D;  3DEP A;  4GZ5 A;  4LRZ A;  4G2V A;  4U8H A;  2VGE A;  2WVI A;  4OVU A;  2NXP A;  3UUX A;  3QAQ A;  3ZHE A;  2BF0 X;  5B3S E;  5BNW A;  3AS4 A;  3LVR E;  4B0Z A;  5EDS A;  3J5P A;  3AU4 A;  1FPP A;  3FTY A;  1N11 A;  2X38 A;  3S7F A;  5AYW D;  4DX2 A;  4BX8 A;  5AQ7 A;  3UMV A;  4BT9 A;  2J08 A;  4I6E A;  4ZHB A;  3UT4 A;  2ETC A;  3NQP A;  1S0P A;  1DNP A;  3HG0 D;  1INZ A;  2J4D A;  5CBO A;  3HIZ A;  4IRU A;  4I1O B;  4TXP A;  1JCR A;  3S7J A;  2R03 A;  3RU0 A;  4YVO A;  3SFX A;  3EU9 A;  4EZJ A;  1ZB1 A;  2WQ6 A;  4GCN A;  4TV3 A;  4TRQ A;  4L1B A;  3D9N A;  2HR2 A;  5ITZ F;  4KT6 B;  3DWL G;  2DWZ A;  1EDU A;  5AJL A;  4QQI A;  4I9E A;  4FHJ A;  3CHP A;  4AXH A;  4WWO A;  4K5A B;  2IO3 C;  2GGF A;  2J9Q A;  5JJ7 A;  1MZC A;  2YHE A;  2FEZ A;  4J6I A;  3T5X A;  2F8Y A;  4ACL A;  4TUU A;  2H6I A;  3L54 A;  4A3V A;  2YNQ A;  4EQF A;  3CKB A;  3TWV A;  4GMR A;  1IHG A;  1UW4 B;  3MGB A;  5HKP A;  4Q94 A;  3FTW A;  3LVQ E;  3AG4 E;  2CFU A;  2WMO A;  3GZ1 A;  3SQV A;  4FLB A;  3TXN A;  5KJL A;  1BD8 A;  1UN8 A;  5CRV A;  3UXG A;  4HLE A;  1KLX A;  3LY8 A;  4G8L A;  2XPY A;  3W9F A;  1EPU A;  4Y6W A;  3FEX A;  5EYP F;  3UM3 A;  3CVX A;  5KJK A;  2IQC A;  1JPL A;  3FUJ A;  4Y6C A;  5AAR A;  2WXR A;  2AVP A;  1Z3Y A;  4GMJ A;  4GTM A;  3HYM B;  2ZXW E;  1KZP A;  4RG9 A;  4JPS A;  1NA0 A;  1IYG A;  4AV7 A;  1D8D A;  4WWP A;  3PVL A;  3I3N A;  3RJV A;  2GW1 A;  3LYA A;  1YYH A;  3ASH A;  3QKY A;  4PDX A;  4KMO A;  3QC1 A;  3ONL A;  4U63 A;  1UJJ A;  4DX1 A;  4L23 A;  2KXP C;  5CCM A;  3RRU A;  1SA5 A;  3C3O A;  4WWN A;  3RKV A;  4N2Q A;  1EF1 C;  5G05 C;  2WXG A;  2X6F A;  2I9C A;  2WXH A;  1QQE A;  4APO A;  3C3Q A;  3DSS A;  3UPV A;  4GA0 A;  1JWF A;  5E76 A;  2WXM A;  1N4P A;  4N5C A;  3UM2 A;  3ASD A;  4U96 D;  4IYP A;  2EIJ E;  1FT1 A;  3QWP A;  4J7W A;  2L0I A;  4LUN U;  3OXG A;  3NB2 A;  4FP7 A;  4JEH A;  3ASF A;  4KVM A;  4U0Z A;  3FTZ A;  4CYM D;  2JLB A;  4DI3 A;  5FZQ A;  3Q75 A;  4AY6 A;  4HI8 A;  4DK5 A;  3PRZ A;  3QWV A;  5EKQ D;  4G11 A;  4IN3 B;  2XPZ A;  3B7U X;  3Q5M A;  2IU1 A;  5ENT D;  4C9B B;  2XGS A;  2ZGG A;  5HQ8 A;  1IQU A;  4I43 A;  3D9K A;  4JW1 A;  2KCL A;  3B7B A;  3W9G A;  3G2T A;  5D2M C;  3ABL E;  3WXX A;  4WUY A;  3E32 A;  1E8X A;  4U04 A;  5T4Y A;  3MKR A;  5BPP A;  4RQI A;  3UIO C;  3PDN A;  1S64 A;  4HFG A;  1B89 A;  3OTN A;  3MZL B;  3G2U A;  4ME2 A;  4HQD A;  3FUK A;  4GYO A;  2A4Z A;  3VLE A;  2KZT B;  2MOW A;  2XZT G;  3MX3 A;  2OEW A;  4GAA A;  3MKQ A;  2RKK A;  4ANX A;  3IKO B;  3EU5 A;  4H7X A;  4DLQ A;  5ANL A;  5AAO A;  4FJZ A;  3KEA A;  5EN5 D;  1N9A A;  2LAH A;  1W3B A;  3ONK A;  1Q2Z A;  3NZS A;  2XRY A;  4CZ2 D;  1A5E A;  2YHC A;  1X5B A;  1O1R A;  2DBA A;  4GB9 A;  1SA4 A;  3PH0 C;  4U0U A;  2I2O A;  3L16 A;  2WXJ A;  3HXD A;  3QAR A;  3PZ1 A;  1NL4 A;  3HVE B;  3RO3 A;  1U2V G;  5EIL A;  3EDT B;  4BFR A;  1H19 A;  2FBN A;  1PC2 A;  3UT8 A;  4GTO A;  1G3N B;  3ZYL A;  3JCK C;  3I4G A;  5C1D A;  3TL5 A;  4XE0 A;  2YQ8 A;  5J90 A;  4OVV A;  2PQR A;  3CQC B;  4HOR A;  2KCK A;  5J08 A;  3CEQ A;  4FUL A;  2VTB B;  5G04 C;  3DXK G;  3PNT B;  1N0R A;  1HE8 A;  3DBS A;  4JXT A;  4K5C A;  3Q15 A;  4CGW A;  1YCS B;  3ZVV A;  3KD7 A;  4V3I A;  2DCP A;  3EIQ C;  5D0O D;  3BG0 B;  2VYI A;  4CGV A;  3HVE A;  4J8D A;  1IHB A;  5H7P A;  2WXN A;  4B89 A;  3DEO A;  1FVH A;  1QBQ A;  4OYS A;  3CVL A;  3EHM A;  4QFV A;  2VSN A;  5G55 A;  3UKR G;  5A6C A;  3UM1 A;  2WXK A;  4F6R D;  1HFA A;  2MYO A;  4XIF A;  3RO2 A;  3FEY A;  1IXV A;  4GZ6 A;  2DYS E;  3DST A;  3LPZ A;  3PUJ A;  4DI4 A;  5JHB A;  3FU0 A;  3SHF A;  5FZR A;  2CFZ A;  3ENE A;  4O1P A;  1HX8 A;  4UQX A;  4HI9 A;  2HYZ A;  3Q73 A;  3JQ1 A;  4GYY A;  5EX3 A;  1SZA A;  2NYJ A;  5JA4 D;  1NZN A;  3APD A;  1NFI E;  3IHY A;  4L2L A;  3E33 A;  2Y0B G;  3E37 A;  2IO2 C;  4AM9 A;  4A55 A;  4GML A;  3MA5 A;  3VTY A;  3P2B A;  4CRW A;  4FJY A;  3AS8 A;  1LTX A;  2I1K A;  4B8A A;  2LSU A;  2WM9 A;  5JHA A;  1OCZ E;  1JUQ A;  5DIZ A;  5KJN A;  4HOQ A;  2XS1 A;  3EJN A;  4CDN A;  2MRI A;  2QFC A;  4CDM A;  2BKG A;  3QWW A;  1IQR A;  4WND A;  5AIJ A;  2XGO A;  3J5Q B;  2KAT A;  4EZL A;  5LCW C;  4TXQ A;  3ZHE B;  5HI7 A;  2J09 A;  5LCW J;  4XKC A;  2F8X K;  2WMN A;  1OCR E;  4N2S A;  4UQZ A;  4N5Q A;  3BUA A;  2JAB A;  2X6H A;  4AOF A;  1TN6 A;  3TWX A;  3ULE G;  2OEV A;  1OWN A;  4LER A;  4KXK B;  4I17 A;  4UWK A;  4NUR A;  3SGH A;  4UQY A;  2WQH A;  4LNB A;  1SVX A;  3EUV A;  4C0E A;  5CED B;  4LCT A;  3P1U A;  1EYH A;  1UG3 A;  2CHZ A;  2GRM A;  1YMP A;  2GRQ B;  4KZC A;  4AY5 A;  5ARG A;  4XZ4 A;  1HG5 A;  1MHQ A;  4UWH A;  1U3D A;  1OT8 A;  3QNK A;  4YVQ C;  3ABK E;  1HU3 A;  4NIK A;  5ENR D;  1ELK A;  4YDO A;  3IEG A;  2AXV A;  5EYL A;  3CVP A;  4ANU A;  2KM4 A;  3CGH A;  2BUG A;  5FIN A;  3ZU7 B;  2F0Y A;  4H7Y A;  3HDX A;  1SZ9 A;  3VLF A;  4AIF A;  3Q79 A;  4O60 A;  3V2X A;  2JEK A;  2KC7 A;  4OAV B;  5DBK A;  4D10 C;  2WXL A;  4UWG A;  3TWQ A;  2FO7 A;  5KWD A;  1N4Q A;  4U95 D;  1HS6 A;  3EHN A;  3UI2 A;  4DLO A;  3CVQ A;  3R7R A;  3T9K A;  3CKC A;  2A5U A;  2KCV A;  5ENQ D;  5A7D B;  3FY4 A;  3APF A;  4O1O A;  3NOC D;  3Q78 A;  4A1S A;  4GTS A;  4J8F A;  4RLY A;  5LX8 A;  3Q47 B;  3PEU B;  3ASN E;  4XI0 A;  2QYU A;  3DSX A;  3NZU A;  4HRM B;  3FH7 A;  4U7E B;  3FUN A;  3O4Z A;  3ZW3 A;  4JA7 A;  3UT7 A;  3FTS A;  2L6B A;  3JXI A;  4J8E A;  4I2Z A;  4DPR A;  2LXM A;  3U4T A;  4YND A;  1OY3 D;  4BWR A;  1AWC B;  3FH8 A;  2FF4 A;  1N0Q A;  1QNF A;  3AG2 E;  5FQ4 A;  4ANW A;  1OWP A;  3LY7 A;  1TNZ A;  4Q96 A;  2AXZ A;  4GYW A;  2UY1 B;  4JHR A;  5BXU A;  5B1B E;  1TNU A;  5E75 A;  3G2V A;  4EEC A;  4X8Q A;  1OWM A;  2DIW A;  4BEP A;  4U07 A;  5FQ7 A;  5D0Q D;  3DPY A;  2ETA A;  3L22 A;  1K8K G;  1V55 E;  3UQ3 A;  2J8S D;  3U3W A;  4M3O A;  1WDY A;  1HO8 A;  3Q7A A;  4TUM A;  5CRU A;  3RRN B;  4B8C B;  2X6I A;  3PZ3 A;  5CCL A;  1DCE A;  4BSZ B;  3LY9 A;  2UY1 A;  5IY5 E;  2AJA A;  5HS0 A;  4JEU A;  3V79 K;  4F3V A;  1KPS B;  3R9A B;  1TNY A;  2H6G A;  4JHJ A;  4RG6 A;  3TG4 A;  2FO1 E;  4G1T A;  1WM5 A;  3ULY A;  1JCQ A;  3ZKJ A;  5KBA A;  3EHR A; 
#chains in the Genus database with same CATH homology
 3QAR A;  2XCC A;  3C98 A;  4HOT A;  3FUL A;  4JL0 A;  2AWI A;  3SZ7 A;  3MCX A;  4G23 A;  2GRL A;  4JA9 A;  4AEZ C;  5BT1 A;  3HVE B;  4FLH A;  3RO3 A;  1TJC A;  3MEK A;  2AW6 A;  3FWV A;  4G26 A;  4EZK A;  2YIN A;  2PM7 A;  3KEZ A;  1E96 B;  3EDT B;  4BFR A;  1H19 A;  2FBN A;  1PC2 A;  2EQX A;  2J49 A;  3UT8 A;  3SFZ A;  3JCK C;  3ZYL A;  4MRU A;  4I1A A;  3I4G A;  2LSV A;  2V4L A;  5C1D A;  3AU5 A;  4LEU A;  4N3B A;  4XE0 A;  3TL5 A;  2YQ8 A;  3SNX A;  4UWL A;  4AJW A;  5J90 A;  3CSF A;  4OVV A;  3ML9 A;  4GA1 A;  2PQR A;  3CQC B;  4HOR A;  3CQG B;  4DJA A;  1DVP A;  3FUH A;  5FJY A;  2KCK A;  5J08 A;  3CEQ A;  2XPI A;  3LCA A;  4FUL A;  4E6H A;  3B7S A;  3QB2 A;  2LO6 A;  5G04 C;  2VTB B;  3PNT B;  3LKU A;  3B7T A;  4L2Y A;  3L6A A;  1HE8 A;  4ABN A;  3BG1 B;  3DBS A;  1OWL A;  4JXT A;  3SBS A;  4CEM A;  5CMY A;  3T5V A;  2XEV A;  1LF8 A;  3Q15 A;  4CGW A;  5CHE E;  3D9O A;  2V0P A;  3ZYM A;  3ZVV A;  3MKQ B;  3KD7 A;  5T3R A;  4MKT A;  5G2N A;  2MHK A;  3CVV A;  5FTP A;  2IOS A;  4V3I A;  3ULQ A;  2DCP A;  3PE3 A;  2VSO E;  3EIQ C;  5D0O D;  4XI9 A;  3CHQ A;  3BG0 B;  2VYI A;  3OXL A;  3I4R B;  4UI9 C;  4CGV A;  3HVE A;  4J8D A;  4K03 A;  3FTU A;  4HXI A;  3CHM A;  3ZYQ A;  2R59 A;  4I6J A;  4UI9 J;  2WXN A;  4NRH B;  4BX9 A;  4B89 A;  4R7L A;  3O48 A;  3RIB A;  3URZ A;  3ZFW A;  1FVH A;  3S2A A;  2OVB A;  1PY1 A;  2V8S E;  4OYS A;  2X6J A;  3D3M A;  3LEW A;  4HVB A;  3D9M A;  2RD0 A;  2NSZ A;  3CVL A;  1E7U A;  2CHW A;  2WXF A;  3EHM A;  4JVS A;  3B13 A;  4QFV A;  4APF A;  3CHO A;  3E4B A;  4GZ5 A;  4LRZ A;  2VSN A;  5G55 A;  5A6C A;  4G2V A;  4U8H A;  2WXP A;  3GW4 A;  4XKB A;  2WXK A;  2WVI A;  3ESK A;  4OVU A;  2NXP A;  3OAW A;  3UUX A;  1H2T C;  4J0U A;  3EIJ A;  1XNF A;  3QAQ A;  1HFA A;  3JYS A;  3SF4 A;  4XIF A;  3RO2 A;  2BF0 X;  3CR3 A;  3ZHE A;  5EX0 A;  4CT0 A;  3G2W A;  3FEY A;  3FUD A;  4UI9 K;  5BNW A;  4GZ6 A;  3LPZ A;  4DI4 A;  3PUJ A;  5JHB A;  3AS4 A;  3LVR E;  4B0Z A;  5EDS A;  3FU0 A;  3SHF A;  3AU4 A;  5FZR A;  1WY6 A;  4URK A;  2CFZ A;  4XX5 A;  3ENE A;  4WNE A;  3CK8 A;  2NC9 A;  3UX4 A;  3FTY A;  5CMW A;  2X38 A;  3Q4A B;  3S7F A;  2Q7F A;  5AYW D;  4W9R A;  2R5S A;  4BX8 A;  2V5F A;  4I6G A;  3UMV A;  4BT9 A;  1HX8 A;  2WPV A;  2J08 A;  3DPD A;  4I6E A;  4KYO B;  4UQX A;  3TAX A;  3UT4 A;  4HOS A;  2HYZ A;  4HOU A;  2XGM A;  2OND A;  2IF4 A;  3JQ1 A;  4GYY A;  4I1M A;  5EX3 A;  1SZA A;  4MLP A;  3ZN3 A;  1NZN A;  4FU3 A;  3APD A;  1OWO A;  3NQP A;  1S0P A;  1Z3X A;  3D9P A;  1DNP A;  3LS8 A;  2WQ7 A;  1E8Y A;  3FUI A;  3LDZ A;  1ELW A;  3IHY A;  4L2L A;  1ZBP A;  2VJ8 A;  3Q49 B;  4GCO A;  1Y8M A;  3ZXS A;  1INZ A;  2J4D A;  4GPK A;  1JWG A;  3CIA A;  2VQ2 A;  4AVX A;  3HIZ A;  3CHS A;  4IRU A;  4AM9 A;  5M72 A;  1YA0 A;  4I1O B;  4WNG A;  4A55 A;  4GML A;  4JZY A;  3MA5 A;  2E0I A;  3P2B A;  3VTY A;  4CRW A;  4FJY A;  3S7J A;  3AS8 A;  1FVF A;  1ELR A;  2XHE A;  4E85 A;  3RU0 A;  4YVO A;  2I1K A;  2ION A;  4B8A A;  4WNF A;  3ML8 A;  2LSU A;  3PS6 A;  3ZGQ A;  4EZJ A;  2WM9 A;  5JHA A;  2WQ6 A;  1JUQ A;  5DIZ A;  3GZ2 A;  4GCN A;  1A17 A;  2AXU A;  2WXQ A;  5KJN A;  2I1J A;  4TV3 A;  3CVU A;  3FU5 A;  4HOQ A;  4L1B A;  3D9N A;  4NAC A;  4TRQ A;  5G05 J;  2HR2 A;  3EJN A;  3ASG A;  2CG3 A;  4JC8 A;  4KT6 B;  4CDN A;  3PE4 A;  2MRI A;  2XRZ A;  2QFC A;  3HHM A;  4CDM A;  1EDU A;  5AJL A;  4I9E A;  5BV1 A;  1E8W A;  2ILR A;  4FHJ A;  3CHP A;  3QWW A;  4AXH A;  1IQR A;  4WND A;  5AIJ A;  3FHE A;  4WWO A;  2XGO A;  3LJ3 A;  3CK9 A;  5FT9 A;  3FU6 A;  4I9C A;  2WXO A;  2GGF A;  1SQM A;  3R7Q A;  5FWQ A;  2J9Q A;  5JJ7 A;  2YHE A;  2KAT A;  3PRE A;  4EZL A;  3CVW A;  5LCW C;  3ZHE B;  2FEZ A;  5ANR A;  3TG5 A;  5HI7 A;  3S7B A;  4J6I A;  2J09 A;  3T5X A;  4ACL A;  5LCW J;  1E7V A;  4FHK A;  4TUU A;  3L54 A;  4A3V A;  2YNQ A;  4EQF A;  4ILI A;  3CKB A;  4XKC A;  2WMN A;  1HH8 A;  2R17 C;  4N2S A;  2IFU A;  4UQZ A;  1IHG A;  1UW4 B;  3MGB A;  2C0M A;  3QDN A;  3L08 A;  4GZD A;  4Q94 A;  3FTW A;  2VSX E;  2X6H A;  3LVQ E;  4AOF A;  2CFU A;  1H2V C;  2WMO A;  3GZ1 A;  1Z6T A;  1OWN A;  4FLB A;  3QK0 A;  4LER A;  3TXN A;  4KXK B;  5KJL A;  4I17 A;  3PZD A;  4UWK A;  4NUR A;  3FFL A;  3SGH A;  4UQY A;  3D9J A;  2WQH A;  2CG2 A;  1UN8 A;  4PS7 A;  4ANV A;  4HLE A;  4C0E A;  4AP2 A;  2J4B A;  4KZ0 A;  2Y3A A;  4LCT A;  1KLX A;  2J07 A;  3LY8 A;  3G2S A;  4PH4 B;  3FUF A;  3VLD A;  3ZEF A;  3RRM B;  2XQ0 A;  2XPY A;  3CVN A;  1EPU A;  4Y6W A;  3FEX A;  3P1U A;  2PQN A;  3FU3 A;  1EYH A;  1UG3 A;  2CHZ A;  2GRM A;  4N3C A;  1HXI A;  3CVX A;  5KJK A;  3IHV A;  1MQS A;  2IQC A;  3SD5 A;  1GW6 A;  2UWJ G;  4EBA A;  4I2W A;  1JPL A;  3FUJ A;  4FC8 A;  4KZC A;  3KS2 A;  4Y6C A;  2WXI A;  2WXR A;  2CHX A;  4HS2 A;  2AVP A;  1Z3Y A;  4GMJ A;  1E8Z A;  1TJF A;  3HYM B;  3AS5 A;  4AY5 A;  1PAQ A;  4L7T A;  4N39 A;  5ARG A;  4XZ4 A;  1HG5 A;  1MHQ A;  2L0T B;  4RG9 A;  4JPS A;  1NA0 A;  4UWH A;  4O6F A;  3OXF A;  1U3D A;  1IYG A;  3QNK A;  1TEZ A;  2VGX B;  2P58 C;  4KBQ A;  4AV7 A;  4WWP A;  4YVQ C;  5FZS A;  3FUM A;  3PVL A;  3BEE A;  1ZU2 A;  1HU3 A;  3I3N A;  3RJV A;  4ATG A;  5T8I A;  4P29 A;  2GW1 A;  3LYA A;  3CV0 A;  1ELK A;  3FH5 A;  4F53 A;  5LP0 A;  3ASH A;  3QKY A;  3IEG A;  2AXV A;  4PDX A;  4KMO A;  3CVP A;  5ENN A;  3ZYK A;  3ZPJ A;  4ANU A;  4BY6 A;  2KM4 A;  3QC1 A;  3CGH A;  2BUG A;  3ONL A;  2M63 A;  5BV0 A;  3FTX A;  3SBT B;  4U63 A;  1N54 A;  1UJJ A;  4C0M A;  1NP7 A;  4L23 A;  3L13 A;  3D9L A;  4H7Y A;  4PS8 A;  3HDX A;  4CCA A;  5AEN A;  2Y4U A;  1SZ9 A;  3APC A;  3IV0 A;  5CCM A;  5BUZ A;  1Y6I A;  3RRU A;  3VLF A;  4AIF A;  4WWN A;  3RKV A;  4BSX A;  2JEK A;  3MJW A;  1HF8 A;  1EF1 C;  4N3A A;  4N2Q A;  2KC7 A;  4PUC A;  5G05 C;  2WXG A;  2WB2 A;  2X6F A;  2OOE A;  5DBK A;  3SI5 A;  3D9I A;  4D10 C;  2I9C A;  2WXL A;  4UWG A;  2WXH A;  1QQE A;  4APO A;  3UPV A;  1BPO A;  4GA0 A;  1JWF A;  5E76 A;  3JQ0 A;  2FO7 A;  2WXM A;  4N5C A;  4FAD A;  3ASD A;  4Q69 A;  4FA6 A;  5LFA A;  3T8M A;  4IYP A;  4ILH B;  1HS6 A;  5LOZ A;  1E90 A;  3QWP A;  3L17 A;  2VGX A;  3FP3 A;  3EHN A;  2KZT A;  4DLO A;  3CVQ A;  3PNL B;  1N52 A;  2L0I A;  3U64 A;  2X3M A;  3R7R A;  3CKC A;  2A5U A;  2C2L A;  4GZC A;  2VSY A;  4LUN U;  2KCV A;  3OXG A;  3JUI A;  5A7D B;  1HG2 A;  3FY4 A;  4KVO A;  3APF A;  3MYV A;  4JHK A;  4FP7 A;  3PEV B;  4A1S A;  4A1G A;  1H6K A;  3FDH A;  4JEH A;  3QJZ A;  3ASF A;  3FUE A;  4KVM A;  4U0Z A;  4J8F A;  2IJG X;  3FTZ A;  4G24 A;  3MV2 B;  5LX8 A;  2OVF A;  2JLB A;  3Q47 B;  4DI3 A;  3PEU B;  4RSY A;  1H2U A;  2HO1 A;  2Y4T A;  3ZIM A;  4XI0 A;  5FZQ A;  3K9I A;  4IUL A;  4ACK A;  3NZU A;  3FH7 A;  4AY6 A;  3FUN A;  1OUV A;  3O4Z A;  4NQ0 A;  3ZW3 A;  2L6J A;  4JA7 A;  3UT7 A;  1XGW A;  3FTS A;  4EPZ A;  2OV8 A;  4DK5 A;  5G04 J;  3PRZ A;  3QWV A;  4J8E A;  4I2Z A;  4GA2 A;  5EKQ D;  4DPR A;  3CST A;  4G11 A;  3U4T A;  1NA3 A;  4IN3 B;  5A23 A;  2XPZ A;  3B7U X;  3PUK A;  4BT8 A;  1QZ2 A;  4YND A;  3Q5M A;  2IU1 A;  4C9B B;  2XGS A;  4ILG A;  4RVB A;  4BTB A;  4BWR A;  1IQU A;  4I43 A;  3FH8 A;  1U3C A;  3D9K A;  1WAO 1;  5HQ8 A;  2KCL A;  2VGY A;  4JW1 A;  2FF4 A;  1QNF A;  5FQ4 A;  4ANW A;  3G2T A;  3NF1 A;  5JJT A;  3S7D A;  2IOL A;  3TGO A;  1OWP A;  1L5J A;  3LY7 A;  4Q96 A;  2AXZ A;  3WXX A;  4GYW A;  4WUY A;  2UY1 B;  3KAE A;  4GZ3 A;  4JHR A;  2QY7 A;  2LNI A;  5C2Y A;  1E8X A;  2BTD A;  3TXM A;  4U04 A;  3TJP A;  4PS3 A;  5T4Y A;  3N71 A;  3MKR A;  5BPP A;  5KCM A;  1UN9 A;  3CHR A;  3ESL A;  3PDN A;  5FQ8 A;  4F1S A;  2LAI A;  5E75 A;  3U9W A;  5JJ6 A;  3G2V A;  4GU5 A;  3CVY A;  4EEC A;  4BTA A;  1OWM A;  2FUL A;  1B89 A;  2DIW A;  3OTN A;  4HFG A;  1VDY A;  2E2E A;  3MZL B;  4CDR A;  1P5Q A;  3G2U A;  1FCH A;  4ME2 A;  1KT0 A;  3ZRH A;  4U07 A;  2PZI A;  3FUK A;  4GYO A;  5FQ7 A;  3U66 A;  2A4Z A;  3VLE A;  5D0Q D;  2KZT B;  2VTB A;  5FQ6 A;  5KJM A;  3L22 A;  3UQ3 A;  2MOW A;  3MX3 A;  3IBE A;  3U3W A;  3FTV A;  2XCB A;  5ARF A;  4A3T A;  4GAA A;  3QOU A;  4M3O A;  3MKQ A;  4ANX A;  1H0A A;  4J8S A;  3IKO B;  1HO8 A;  4H7X A;  2L9B A;  2FI7 A;  4DLQ A;  3RK6 A;  5ANL A;  3RRN B;  4B8C B;  2X6I A;  3CLJ A;  4CT4 A;  4K0R A;  4WAF A;  4UWF A;  5CCL A;  2RG8 A;  4U0S A;  4EBA G;  1HZ4 A;  3MV3 B;  4FJZ A;  2PM6 A;  3LY9 A;  2UY1 A;  4G25 A;  3CK7 A;  3B7R L;  2LAH A;  1W3B A;  2HM8 A;  3ONK A;  4JEU A;  4F3V A;  1UJK A;  3R9A B;  2I6H A;  2XRY A;  2X6K A;  3NZS A;  4MS6 A;  2YHC A;  5BW8 C;  1X5B A;  2DBA A;  4JHJ A;  3I5P A;  4GB9 A;  4RG6 A;  3TG4 A;  2PL2 A;  3PH0 C;  4G1T A;  3GZS A;  3GYZ A;  5AJD A;  1WM5 A;  3LXU X;  2C0L A;  4U0U A;  1KT1 A;  3VTX A;  2I2O A;  3L16 A;  2WXJ A;  4F7A A;  4B94 A;  2ZU6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...