4Y6WA

Crystal structure of podosopora anserina putative kinesin light chain nearly identical tpr-like repeats
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
211
structure length
211
Chain Sequence
MEHPSRLRSQHELARRYQQNGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQRQEAQELLEQVRAIQAKTQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NaB(AB)3ACb - light chain TPR-like repeats
publication title A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Unknown function
total genus 97
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4y6wA00
3SF4A 3TG5A 5EX3A 2ONDA 3KS2A 1P5QA 4AIFA 5G05C 4AM9A 4XI9A 4GCNA 2XCCA 4YVOA 1IYGA 2LSVA 4G2VA 3CKBA 4WUYA 3GYZA 5JJ7A 3Q49B 5DIZA 4AY5A 4RG9A 1FCHA 5A6CA 3QWPA 2FI7A 2YQ8A 3U4TA 3GW4A 2R5SA 2VGXB 3ZHEB 5FZQA 2PQRA 3MEKA 3RO2A 4I2WA 2VGYA 1KLXA 1TJCA 5AYWD 5EKQD 2Q7FA 4GYOA 2KATA 3K9IA 3ZHEA 4UQZA 5G04C 2DBAA 1ELRA 5KJMA 4GZ5A 3O48A 3ZN3A 5BW8C 3ASGA 4CDRA 3UQ3A 5JJTA 1HZ4A 2GW1A 2C2LA 4GYWA 5FTPA 5ARGA 4BTAA 4WNFA 4U0UA 5KJKA 5KJLA 2HO1A 3S7DA 2V5FA 2UWJG 3FWVA 2FEZA 4G23A 1KT1A 3S7FA 3Q15A 4XIFA 4G24A 3OXGA 2BUGA 4JHRA 4B94A 3U3WA 5LCWC 4GA1A 2J9QA 3Q4AB 2UY1B 3LYAA 5A7DB 4JA9A 4APOA 2VQ2A 2PZIA 4N5CA 4W9RA 1YA0A 3QDNA 1ELWA 2KC7A 4I9EA 4BT9A 1Y8MA 1PC2A 3QWWA 4GCOA 4I17A 3OXLA 3RO3A 3CV0A 4IN3B 5FJYA 2WQHA 2VYIA 3TGOA 4GA2A 2FBNA 3PDNA 4U0SA 5JJ6A 1WM5A 5FZRA 2Y4UA 2KCVA 1E96B 5FT9A 1QQEA 4I2ZA 2KCLA 1KT0A 4JL0A 5BT1A 2JLBA 2C0MA 3R9AB 4WNGA 3VTXA 4A1SA 3MA5A 4HOSA 3URZA 2I6HA 2OOEA 4UQYA 4I9CA 4RG6A 2QFCA 3RU0A 4GZ3A 2YHCA 3UUXA 4N3CA 2FF4A 1NA0A 4UI9J 4CGWA 3UPVA 3ZFWA 2L6JA 4J8EA 1HXIA 2XGSA 3OXFA 5ARFA 5D0QD 4JA7A 2C0LA 2PQNA 4NRHB 4KYOB 4HORA 1W3BA 5M72A 2KCKA 4HOTA 3QOUA 1WAO1 4O6FA 3N71A 1XNFA 2VSNA 2HYZA 3WXXA 3HYMB 3Q47B 3PE3A 2IFUA 4G26A 4UI9K 3FP3A 3EDTB 3CKCA 4KBQA 2E2EA 4U07A 2P58C 5KJNA 4J0UA 1A17A 3GZ1A 5FZSA 3CVNA 3RJVA 4N2QA 5HQ8A 3JYSA 3LPZA 4WNEA 5G05J 5CHEE 4G1TA 3LKUA 5HI7A 3S7BA 3AS4A 3ASFA 3CVLA 4GPKA 4WNDA 4CGVA 2HR2A 4YVQC 3E4BA 3CVQA 5C1DA 1ZBPA 1QZ2A 3MV3B 3ZGQA 3CK8A 3BEEA 4J8DA 2XEVA 3IEGA 3ASDA 4H7XA 1NA3A 4AY6A 4N3BA 4XI0A 3S7JA 4N2SA 5G04J 4GA0A 3MKRA 3CK9A 2XCBA 4U04A 2XGMA 4N39A 3Q5MA 3QWVA 3ULQA 3TG4A 2VGXA 1IHGA 3CVPA 3QKYA 4U0ZA 3AS8A 4BT8A 2LNIA 5EX0A 3AS5A 3LY9A 2XGOA 1NZNA 1ZU2A 3VTYA 4UI9C 2IF4A 3RIBA 5CCLA 4G25A 4KXKB 2XPIA 2VSYA 2LSUA 4Y6CA 5LCWJ 4ME2A 3NF1A 4I1AA 2NC9A 3LCAA 3GZ2A 1HH8A 2AVPA 3RKVA 2Y4TA 5CCMA 3KAEA 4H7YA 4HOUA 3ASHA 2FO7A 3TAXA 3CEQA 5D0OD 4BWRA 4EQFA 4BTBA 3ZPJA 4HOQA 4LEUA 2MHKA 4YNDA 2PL2A 3SZ7A 3FFLA 2WPVA 4N3AA 4F3VA 3ESKA 4GZ6A 4J8FA 3PE4A 5BNWA 1OUVA 4GYYA 3MV2B 3CK7A 2UY1A 3KD7A 4UQXA 4NQ0A 5DBKA 3LY8A 4Y6WA 3LY7A 1B89A 4ABNA
chains in the Genus database with same CATH superfamily
3UKUG 4N5QA 4K5BA 3SBTB 1S70B 5B1BE 1YYHA 1MYOA 2KZTB 3KS2A 1P5QA 5LP0A 2L0TB 4TUMA 5G05C 1Q2ZA 2IY0C 2WXPA 4FJZA 2OEWA 1IYGA 3SO8A 1JCQA 2ETBA 5IY5E 3G2VA 5JJ7A 4GTSA 5DIZA 3JUIA 3CHMA 4HLEA 4I6EA 2EIKE 2VGXB 5FZQA 3DSTA 3R7QA 2VTBB 2VGYA 1DCQA 4J8YA 5EN5D 5EKQD 2A5EA 2Q7FA 2DCPA 5LOZA 3EUVA 1KZPA 2OEVA 3CVVA 3Q7FA 4UQZA 3D9HA 4HFGA 5FQ8A 5JA4D 3SFZA 1K8KG 4AOFA 4AV7A 4O60A 4JVSA 2X38A 4PH4B 3CVXA 4EBAA 4WWOA 4HRLA 4U0UA 5J08A 1TNBA 3QJZA 2QZAA 4GTTA 3UM2A 3CQGB 2FEZA 3FTXA 1N4PA 4XIFA 4G24A 4B89A 4J8SA 3FTUA 3U3WA 5KCMA 1K1AA 3T5VA 1A5EA 1DNPA 3Q4AB 1X5BA 3E32A 3ULEG 4JA9A 1AWCB 2P9LG 3ISMC 4ACKA 5T8IA 1MX2A 3AG2E 4W9RA 1H6PA 3C3OA 3TWTA 3QWWA 4GCOA 4CDMA 3ZW3A 3RO3A 2VYIA 4B93B 3TGOA 3W9FA 1WM5A 2Y4UA 1E96B 1E8ZA 2NSZA 2DVWA 2Y69E 5ENNA 2NYJA 4WWPA 3FUIA 2AXZA 5FIOA 2LAIA 3RRMB 4JL0A 4XZ4A 2JLBA 1BLXB 2C0MA 3O4ZA 4MS6A 4FADA 3CHRA 3VTXA 4U96D 2A4ZA 1TR4A 3C3QA 4HNAD 2X6FA 2I6HA 2QFCA 1ZB1A 3UKRG 3HXBA 4GZ3A 1MJ0A 3ZEFA 1S63A 3CQCB 3ZFWA 4GB9A 4F6RD 2WXRA 1HS6A 2LAHA 4J8EA 5C2YA 4QQIA 3LJ3A 3GZSA 2YINA 2RG8A 3MX3A 4M3OA 2C0LA 2RD0A 3AJIA 3ZRHA 3FEYA 3ZUVB 1U2VG 4KYOB 1W3BA 5M72A 4HOTA 2WXFA 3QOUA 3ASNE 3QK0A 5JHAA 3N71A 2R05A 2ETCA 3PRZA 3UM1A 3BQOA 2WVIA 4L2LA 4G26A 4LERA 4A63B 2PM6A 3UXGA 4C48B 2CFZA 5KJNA 3SGHA 5FQ4A 1A17A 3TXMA 3CVNA 2OVFA 2XS1A 5ENQD 3RAUA 1QYMA 3SFXA 2J4BA 1Z3YA 3SHFA 3ZIMA 2NXPA 1H2VC 2ZGGA 3S7BA 3FTVA 4PS7A 4FP7A 4U8HA 2HR2A 3D9OA 4YDOA 2MRIA 4C9BB 3PREA 4F1SA 2KBXA 2FO1E 2BTDA 1NA3A 4L9PA 2IU1A 3ULYA 3S7JA 3VLDA 3W9GA 4N2SA 4GA0A 2R03A 2V4HC 2ILRA 3C98A 2XCBA 2R17C 2X6KA 1HFAA 2ETAA 4N39A 4UWGA 1N4SA 5FQ6A 3ML8A 3ABKE 1N9AA 3UI2A 2F0YA 1FT1A 4BSXA 3R7RA 2IF4A 5CCLA 3UINC 4G25A 1RZ4A 2P9SG 4GZDA 2IOSA 2XEHA 4HBDA 1N0QA 2XRYA 4G8LA 3GZ2A 1H0AA 4HVBA 4K5CA 4OVUA 3D9MA 1Y6IA 3ASHA 4G11A 4LNBA 4BTBA 3AU4A 3DPYA 4LEUA 3BUAA 1BU9A 4AXHA 4YNDA 2IONA 3SY2A 2VJ8A 2P2CP 4DJAA 2AXUA 4F3VA 2A5UA 3L16A 4RVBA 2VSOE 3UT4A 4GYYA 4UWHA 5AJDA 3MZLB 3Q73A 2UY1A 2GRMA 1OT8A 3Q78A 1DVPA 5DBKA 2WQ6A 3FTWA 5CRUA 3HXDA 4U8YD 3SI5A 1MX4A 3LY7A 4YDYA 4JB8P 3OAWA 2F8YA 3SF4A 3CGHA 3TG5A 4CYMD 2CHWA 4AIFA 5H7PA 2WMOA 1HF8A 3FU6A 1OY3D 3UM3A 5CECB 2XCCA 4YVOA 3I4RB 3CKBA 4WUYA 3Q49B 4JC8A 5CRVA 4RG9A 3QWPA 3JXJA 2FI7A 2GGFA 2YQ8A 3APCA 4HXIA 2DZNA 4ZFHA 3CIAA 1X81A 3LVRE 3AG4E 2CHZA 2VTBA 2DBAA 4O1PA 1UG3A 3FUKA 3PZ2A 4RLYA 3E30A 5BW8C 2I9CA 3SFYA 2XRZA 1E7UA 3UQ3A 3KSLA 2C2LA 5ARGA 4BTAA 5KJKA 3FUNA 3S7DA 2PM7A 2J8SD 4LRZA 2V5FA 2GRLA 1JCRA 2QYJA 4HLLA 3OXGA 2DYRE 4E6HA 4I6JA 2LUHA 1TN6A 1S64A 4I1MA 3CVWA 3T8KA 3PUKA 2UY1B 3MJWA 4APOA 3DSVA 1FPPA 5BXUA 3LDZA 2IEJA 5HS0A 1ELWA 2KC7A 4AP2A 3NB2A 3D9LA 3D9PA 3U64A 4BT9A 1Y8MA 1HO8A 1PC2A 3B7BA 3F6QA 4DLOA 4I17A 3TWUA 5EIBE 2P9NG 5ENPD 3FUDA 2X6JA 2WXQA 2FBNA 2ZGDA 3PDNA 2H6FA 5JJ6A 3TWVA 2KCVA 5FT9A 1QQEA 4BX9A 5AN8A 1O1TA 4LUNU 2IO3C 1KZOA 3EU9A 4JZYA 3L82A 3DSXA 3UIPC 3P2BA 5ENRD 4FC8A 5BT1A 3FH7A 2R2LA 2EILE 1JWGA 3HDXA 1OWLA 2JABA 3TWWA 2MOWA 2HE0A 2EIME 5ITZF 2CFUA 2OOEA 3UT7A 4RG6A 1MX6A 4IYPA 5KNGA 2V8SE 3ZYKA 2V4LA 4GPMA 1NA0A 1UW4B 1FT2A 4CGWA 1HE8A 3CVYA 4EPZA 3HG0D 1OWNA 2B6CA 2GRQB 4HRNA 3OXFA 4ATGA 1VDYA 2R02A 3BG0B 1JCSA 3B7UX 1OWPA 1UOHA 4HORA 1E90A 2LXMA 1WAO1 1H2TC 4XE0A 2V5QC 4FA6A 1TNOA 3Q47B 3PE3A 4F53A 4UI9K 4ACLA 3CSTA 3HIZA 3CKCA 2AWIA 3TWSA 2E2EA 4U07A 4DRXE 2YHEA 2MYOA 1U3CA 4UWLA 4GMLA 3RJVA 3C3RA 2VGEA 5ENSD 2IO2C 4ILHB 4Q94A 1NFIE 2CG2A 5HQ8A 4HI8A 3EJNA 5AQ9A 4GTOA 1N0RA 3ZVVA 4F1PA 5CHEE 4U8VD 3APFA 3LKUA 3DEPA 5D2MC 2PNNA 4CT4A 1BPOA 3LS8A 3CVLA 3D9KA 1OWOA 3QARA 3TWXA 4I1OB 1IQUA 3SNXA 4DPRA 2OCCE 1SW6A 3S2AA 1QZ2A 3MV3B 3EIQC 3AAAC 3CLJA 3ZYMA 2ZISA 4H7XA 3KEAA 4ILGA 2WXGA 5G04J 4JD2G 3AG1E 3MKRA 2XPZA 1NP7A 4U04A 3B95A 2BKKB 1EPUA 3RRUA 2KM4A 1L5JA 1O1RA 1E8WA 2F37A 3JUEA 3IBEA 3B13A 3DEOA 3CVPA 4U0ZA 4ANUA 3AS5A 1N94A 3VTYA 1OXJA 3J5PA 3RIBA 4PS3A 4TUUA 2X3MA 1XGWA 2VSYA 5EDSA 2LSUA 3ONKA 4Y6CA 3UTMA 2E0IA 5D66A 4I1AA 3LCAA 3T5XA 2AVPA 1HG5A 2Y4TA 4JEHA 5CCMA 4H7YA 3SD5A 4HOUA 1NL4A 3NAWA 2YNQA 4BWRA 4EQFA 1KPSB 4BEPA 3MKQA 4A3VA 5EYLA 3SZ7A 2OV8A 4CT0A 3FFLA 1HU3A 4FLHA 4X8QA 2V0PA 5LX8A 4N3AA 3V31A 4J8FA 2QYUA 4M7CA 3PNLB 3PE4A 5BNWA 1SA5A 3MV2B 2WM9A 1JPLA 4JW1A 1V54E 4UQXA 2DIWA 1SA4A 4NQ0A 4BFRA 3LY8A 4DX2A 3PNTB 5BXOA 5LFAA 4L2YA 1YCSB 4KZCA 2ONDA 5ENOD 3ZYQA 4V3IA 4D10C 3HVEA 4XI9A 1LD8A 4DX7D 4PS8A 3I3NA 2LSVA 3G2UA 2DWZA 3R9MA 2P9PG 5AARA 3GYZA 3Q9NC 4AY5A 1FCHA 3U4TA 1SVXA 3PZ4A 3ZHEB 2PQRA 3BU8A 2I1KA 2CG3A 3MEKA 3RO2A 3QC1A 4DX6D 4GYOA 2P9KG 2X6IA 4CEMA 5G04C 2WXKA 1ELRA 3DPDA 3UT8A 4GZ5A 3CHQA 5BV1A 4Q96A 1TNYA 4MRUA 2WB2A 3E34A 5JJTA 2J09A 2GW1A 3FU5A 4GYWA 4LSZE 4B8CB 5KJLA 3MKQB 3FUMA 2HO1A 3FWVA 3JCKC 3VLFA 3ZKJA 1YMPA 3S7FA 5T4YA 3EHRA 1JUQA 5AAOA 4G8KA 4JHRA 1IQRA 4A1GA 1Z6TA 5AJLA 2QC9A 3L54A 4GA1A 4K0RA 3C72A 1UJKA 5EIDA 3EU5A 4FHKA 3CHSA 4U95D 3LYAA 4B0ZA 5FINA 2VQ2A 4XX5A 2PZIA 4OVVA 4N5CA 4FJYA 1YA0A 3QDNA 1TNZA 4JXTA 2EIJE 3HVEB 4ATZD 4BX8A 4J6IA 3ZYLA 1IKND 3TJPA 3CV0A 4IN3B 2WQHA 4Z68A 4GA2A 3B7RL 3BG1B 5KNHD 3L08A 5FZRA 1MHQA 5CMYA 5CBOA 3NBNB 2DZOA 2XENA 2ZIRA 3FTSA 1OCRE 1H19A 4I2ZA 5CERB 2GROB 3E37A 1KT0A 5EILA 3R9AB 3FU0A 4UWFA 4WNGA 3SQVA 2RFMA 3MA5A 5KWDA 4U63A 5JHBA 4OAVB 5AIJA 3URZA 2L6BA 3PEUB 3FHEA 4I9CA 5ANRA 3TL5A 3FUFA 2WXIA 3RU0A 2YHCA 4N3CA 5E75A 4DI4A 2FF4A 4UI9J 2H6IA 4GMRA 1E8XA 2XEEA 3PUJA 1N54A 4YDEA 1H2UA 3ML9A 1HXIA 3PVLA 4A55A 2XGSA 1HG2A 1FVFA 4WWNA 5ARFA 3CR3A 3APDA 5D0QD 5ANLA 3CVUA 2PQNA 1QBQA 4DX1A 1K1BA 3JQ0A 3FUHA 4GMJA 1HX8A 4C0EA 4TRQA 1XNFA 2AXVA 2J49A 2F8XK 4AVXA 4EZKA 2IFUA 3KEZA 3EDTB 3L17A 4HRMB 3NOCD 4E85A 1ELKA 2BKGA 4J0UA 1EYHA 4TXRA 3DXKG 4HB5A 3L13A 3Q9UC 4BESA 4EBAG 4ILIA 4U7EB 1N95A 4G1TA 2AJAA 5G55A 5KBAA 3MGBA 2X6HA 5HI7A 2L9BA 3AS4A 3V2XA 4URKA 1UN8A 2WXNA 4WNDA 1BI7B 4CGVA 2LXLA 5ENTD 3QAQA 3FU3A 2Y1LE 4YVQC 3TWQA 3E4BA 5CMWA 3UX4A 3CVQA 5BUZA 1ZBPA 3ABME 3T9KA 1TN8A 2L0IA 3ZGQA 3L6AA 4J8DA 4LNUD 4ANVA 3EHNA 2XEVA 4ZHBA 1EF1C 3ONLA 4GTVA 5CEDB 3ASDA 3PZDA 3MYVA 4KT6B 4AY6A 2GRNB 4N3BA 4XI0A 3DRAA 4RSYA 4QFVA 4PUCA 3LXUX 3CK9A 4WAFA 1WG0A 2XGMA 5G2NA 2I1JA 3QWVA 2J07A 3TG4A 3DSUA 4J7WA 4R7LA 3ASOE 1MZCA 5EX0A 3PS6A 2XGOA 1NZNA 1N52A 1ZU2A 3IXEA 4UI9C 3C5RA 3LEWA 3DXMG 4DUIA 4KXKB 2XPIA 4EZJA 4FLBA 2WXOA 3AG3E 5LCWJ 3DWLG 1N4QA 3G2SA 4ME2A 3NF1A 2B0OE 4GTMA 1QNFA 3ZU7B 3FH8A 3RKVA 3JXIA 4TV3A 3KAEA 3QNKA 1WY6A 2R59A 4KVOA 3TAXA 3FULA 3I4GA 2J4DA 3U66A 1O1SA 3ZPJA 4BY6A 2MHKA 3D9IA 3D3MA 3HHMA 2PL2A 5A23A 4L23A 2ZXWE 4FHJA 3IHYA 2XZTG 4DI3A 2P9UG 2M63A 1OUVA 5AENA 3CK7A 3KD7A 4HS2A 4OYSA 3T8MA 4MLPA 4Y6WA 1B89A 4K03A 4A3TA 4MBGA 4BETA 5EX3A 3CHOA 4CRWA 4GU5A 4GZCA 2HM8A 4AM9A 4GCNA 4B8AA 1UN9A 3FEXA 2ZU6B 4G2VA 2VSXE 5CBNA 4AEZC 4XKBA 3FY4A 5A6CA 4BSZB 1FVHA 1WDYA 3GW4A 2R5SA 1TN7A 2IOLA 3PH0C 1OWMA 3U9WA 3RRNB 4I2WA 3FUJA 2XZDG 1KLXA 4GTRA 1TJCA 5AYWD 4YDWA 3NZSA 1O5MA 2KATA 3K9IA 3ZHEA 3CSFA 2WXLA 2IJGX 2BEDA 4P29A 5KJMA 3CHPA 1U3DA 2RFAA 4DK5A 3O48A 1BD8A 3ZN3A 3DSSA 4IRUA 4LCTA 3ASGA 4CDRA 4KMOA 2Y0BG 3IHVA 3ZXPA 1Z3XA 3HRAA 1SQMA 1HZ4A 5FTPA 4HI9A 3Q79A 3TXNA 4WNFA 2UWJG 3X2QE 1PAQA 4G23A 1KT1A 1PY1A 5BPPA 3Q15A 3FTZA 4KZ0A 2BUGA 2BF0X 2XS8A 1D8DA 2WQ7A 5J90A 4B94A 5LCWC 1DCEA 3PZ1A 4KVMA 2J9QA 5HRYA 2WXMA 1TJFA 5A7DB 1K3ZD 3DBSA 1TYQG 3EHQA 3Q75A 4GAAA 5HKPA 4GTQA 4I9EA 1NI1A 2FULA 1INZA 4Q69A 2GRPB 4FU3A 3OXLA 1D9SA 5E76A 3IV0A 3ZNGA 5FJYA 4JPSA 3QB2A 3EIJA 1EDUA 1E8YA 4U0SA 3HXFA 1D8EA 3HXEA 1G3NB 4XEIG 5FQ7A 1TEZA 1N4RA 5AQ7A 4CCAA 4EZLA 1OCZE 2KCLA 3UIOC 4RQIA 3ESLA 2JEKA 3D9JA 5CEAA 4CDNA 4A1SA 4HOSA 5JMND 1LTXA 3OTNA 4UQYA 3L22A 2J08A 3UUXA 3ABLE 3UPVA 4GTPA 2P9IG 4JEUA 2OVBA 2GRRB 2L6JA 3FUEA 3D9NA 1LF8A 4JHKA 1IXVA 4I43A 3L9TA 3HXCA 4JA7A 3FTYA 3KSQA 4NRHB 3NQPA 4OAUC 3Q7AA 2KCKA 3NOGD 4UWKA 3EHMA 3LJNA 2RKKA 2XPYA 4O6FA 2VSNA 2HYZA 5B3SE 3WXXA 4EHMA 3HYMB 2XHEA 4APFA 3B7SA 3G2WA 3FP3A 5EYPF 4KBQA 3VLEA 2P58C 3I5PA 4NACA 3GZ1A 2KXPC 1N11A 5FZSA 2IQCA 4FULA 3RK6A 4N2QA 3JYSA 3V30A 3LPZA 3TWRA 5BV0A 4WNEA 5G05J 1OCOE 4PDXA 2WXHA 1E7VA 2AW6A 2Y3AA 3ASFA 3J5QB 4GPKA 2XQ0A 3P1UA 5T3RA 4O1OA 3UMVA 4CZ2D 5C1DA 2KZTA 1SZAA 3ENEA 3FDHA 3CK8A 1GW6A 3BEEA 3PEVB 3JQ1A 1TNUA 4K5AB 3IEGA 4UUCA 3V79K 1RW2A 2DYSE 5FWQA 5B1AE 3DSWA 4IULA 5AQBA 4ANWA 1AP7A 4MKTA 3FH5A 1UJJA 4L1BA 4I6GA 4LNGA 4BERA 4XKCA 4F7AA 2CHXA 3ZXSA 3Q5MA 3ULQA 4ANXA 4AJWA 2VGXA 1IHBA 3LVQE 1IHGA 3IKOB 3QKYA 4BT8A 3AS8A 2LNIA 4LG6A 3LY9A 2H6GA 3B7TA 5AQAA 3E33A 4EECA 3RSEG 3V2OA 1SZ9A 1S0PA 3NZUA 2NC9A 3SBSA 1HH8A 2QY7A 4DX5D 1DC2A 1V55E 2WMNA 2EINE 4HQDA 2H6HA 1JWFA 1H6KA 1Z5SC 2I2OA 2EQXA 1H6OA 2FO7A 1BI8B 1LD7A 4TXQA 3CEQA 5D0OD 3UM0A 3G2TA 4HOQA 1MQSA 4TXPA 3PZ3A 2WPVA 4JHJA 3ESKA 4GZ6A 4NURA 1OCCE 4C0MA 2WXJA 4L7TA 3AU5A 3WG7E 4DLQA 2LO6A 3MCXA 4NIKA 4ABNA
chains in the Genus database with same CATH topology
3SF4A 4L2YA 3CGHA 3SBTB 3TG5A 4KZCA 2KZTB 5EX3A 2ONDA 3KS2A 3CHOA 4CRWA 3ZYQA 2CHWA 4V3IA 1P5QA 4GU5A 4AIFA 4D10C 5LP0A 2L0TB 2WMOA 1HF8A 3HVEA 4GZCA 2HM8A 5G05C 4AM9A 3FU6A 4GCNA 4XI9A 4B8AA 2XCCA 4PS8A 1UN9A 2WXPA 3I3NA 4YVOA 4FJZA 3I4RB 5LFAA 1IYGA 2LSVA 3FEXA 3G2UA 2ZU6B 4G2VA 2VSXE 3CKBA 3G2VA 4WUYA 3GYZA 5JJ7A 4AEZC 3Q49B 3JUIA 4JC8A 5DIZA 4XKBA 4AY5A 3FY4A 4RG9A 1FCHA 3CHMA 3QWPA 5A6CA 4HLEA 2FI7A 2GGFA 2YQ8A 1FVHA 3U4TA 3APCA 2R5SA 3GW4A 4I6EA 2IOLA 3PH0C 2VGXB 4HXIA 1OWMA 3U9WA 3ZHEB 5FZQA 3RRNB 2PQRA 2I1KA 2CG3A 3MEKA 3RO2A 4I2WA 3R7QA 2VTBB 3CIAA 2VGYA 3FUJA 3QC1A 1KLXA 1TJCA 5AYWD 3NZSA 5EKQD 3LVRE 2Q7FA 4GYOA 2DCPA 2KATA 5LOZA 3K9IA 3ZHEA 2X6IA 3CSFA 3CVVA 2WXLA 2CHZA 2IJGX 2VTBA 4UQZA 5G04C 4CEMA 2DBAA 2WXKA 1ELRA 4HFGA 4P29A 3DPDA 5FQ8A 3UT8A 5KJMA 4GZ5A 1UG3A 3CHQA 3CHPA 5BV1A 3FUKA 4Q96A 1U3DA 3SFZA 4DK5A 3O48A 3ZN3A 4MRUA 2WB2A 5BW8C 4IRUA 4LCTA 3ASGA 2I9CA 4AOFA 4AV7A 4CDRA 4JVSA 4KMOA 2XRZA 1E7UA 3IHVA 3UQ3A 1Z3XA 2X38A 4PH4B 5JJTA 2J09A 1SQMA 1HZ4A 2GW1A 3FU5A 2C2LA 4GYWA 5FTPA 4WWOA 5ARGA 4EBAA 3CVXA 4BTAA 4B8CB 3TXNA 4WNFA 4U0UA 5KJKA 5KJLA 3MKQB 3FUMA 2HO1A 5J08A 3FUNA 3QJZA 3S7DA 2PM7A 4LRZA 2V5FA 2UWJG 2GRLA 3FWVA 3JCKC 3CQGB 2FEZA 3FTXA 3VLFA 1PAQA 4G23A 1KT1A 1PY1A 3S7FA 5BPPA 3Q15A 4XIFA 4G24A 5T4YA 4B89A 4J8SA 1JUQA 3FTZA 3FTUA 3OXGA 4KZ0A 2BUGA 2BF0X 4JHRA 4E6HA 2WQ7A 4I6JA 1IQRA 5J90A 4B94A 3U3WA 4A1GA 1Z6TA 5LCWC 5KCMA 3T5VA 4I1MA 5AJLA 1DNPA 3CVWA 3L54A 3PUKA 4GA1A 4K0RA 4KVMA 2J9QA 3Q4AB 2WXMA 2UY1B 1UJKA 1X5BA 4FHKA 3CHSA 1TJFA 3MJWA 3LYAA 5A7DB 4B0ZA 4JA9A 4APOA 3DBSA 2VQ2A 4XX5A 2PZIA 4OVVA 4ACKA 5T8IA 4N5CA 3LDZA 4FJYA 4GAAA 4W9RA 1YA0A 3QDNA 1ELWA 2KC7A 4I9EA 4AP2A 3D9LA 3D9PA 3U64A 2FULA 4JXTA 4BT9A 1INZA 1Y8MA 1HO8A 1PC2A 4DLOA 3QWWA 4Q69A 3HVEB 4GCOA 4CDMA 4BX8A 4J6IA 4FU3A 4I17A 3OXLA 3ZYLA 3ZW3A 5E76A 3IV0A 3RO3A 3TJPA 3CV0A 4IN3B 5FJYA 4JPSA 3QB2A 2WQHA 3EIJA 2VYIA 3FUDA 2X6JA 2WXQA 1EDUA 3TGOA 1E8YA 4GA2A 2FBNA 3B7RL 3PDNA 4U0SA 3BG1B 1WM5A 5JJ6A 3L08A 5FZRA 1MHQA 2Y4UA 5CMYA 2KCVA 1E96B 1E8ZA 2NSZA 5FT9A 1QQEA 4BX9A 4LUNU 5FQ7A 1TEZA 4JZYA 3FTSA 1H19A 4I2ZA 5ENNA 4CCAA 4WWPA 4EZLA 3FUIA 2KCLA 2AXZA 3P2BA 4FC8A 2LAIA 3RRMB 1KT0A 4JL0A 5BT1A 3ESLA 3FH7A 4XZ4A 2JLBA 2JEKA 2C0MA 3O4ZA 3R9AB 4MS6A 3FU0A 4FADA 3D9JA 4UWFA 3CHRA 4WNGA 1JWGA 3VTXA 3HDXA 4CDNA 1OWLA 4A1SA 3MA5A 2A4ZA 4HOSA 2MOWA 4U63A 5JHBA 5AIJA 3URZA 2X6FA 2I6HA 2CFUA 2OOEA 3OTNA 4UQYA 3L22A 3FHEA 3PEUB 4I9CA 3UT7A 4RG6A 5ANRA 4IYPA 2QFCA 3TL5A 3FUFA 2J08A 2V8SE 3ZYKA 2WXIA 3RU0A 2V4LA 2YHCA 4GZ3A 3UUXA 4N3CA 5E75A 4DI4A 2FF4A 1NA0A 1UW4B 4UI9J 3ZEFA 3CQCB 4CGWA 3UPVA 1HE8A 1E8XA 4GB9A 3ZFWA 3PUJA 1N54A 3CVYA 4JEUA 2OVBA 4EPZA 2L6JA 2WXRA 3FUEA 1H2UA 1HS6A 1OWNA 2LAHA 3D9NA 4J8EA 1LF8A 5C2YA 3ML9A 3LJ3A 1HXIA 3GZSA 3PVLA 4A55A 2XGSA 1HG2A 1FVFA 2YINA 4JHKA 4WWNA 3OXFA 5ARFA 4I43A 3CR3A 3APDA 5D0QD 5ANLA 3CVUA 2RG8A 3MX3A 4JA7A 4ATGA 3FTYA 2C0LA 2RD0A 4M3OA 1VDYA 2PQNA 3BG0B 3ZRHA 3B7UX 3FEYA 1OWPA 4NRHB 4KYOB 3NQPA 4HORA 3JQ0A 1W3BA 5M72A 2KCKA 2WXFA 3FUHA 4GMJA 4HOTA 3QOUA 1E90A 3QK0A 1HX8A 4UWKA 4C0EA 3EHMA 4TRQA 1WAO1 2XPYA 4O6FA 1H2TC 5JHAA 3N71A 1XNFA 2VSNA 2HYZA 3WXXA 3PRZA 4XE0A 2AXVA 2J49A 4FA6A 3HYMB 3Q47B 2WVIA 4L2LA 2XHEA 4AVXA 4EZKA 3PE3A 2IFUA 4APFA 4G26A 3B7SA 4F53A 3KEZA 3G2WA 4UI9K 4LERA 3FP3A 3EDTB 4ACLA 3CSTA 3HIZA 3CKCA 2AWIA 4KBQA 2E2EA 2PM6A 3L17A 3VLEA 4U07A 2CFZA 2P58C 5KJNA 2YHEA 3I5PA 3SGHA 5FQ4A 1U3CA 4E85A 1ELKA 1A17A 4J0UA 3GZ1A 4NACA 4UWLA 5FZSA 1EYHA 3TXMA 4GMLA 3CVNA 2IQCA 3RJVA 2OVFA 4FULA 3RK6A 4ILHB 4Q94A 4N2QA 2CG2A 3L13A 5HQ8A 3EJNA 3JYSA 4EBAG 3LPZA 5BV0A 4WNEA 4ILIA 5G05J 3ZVVA 5CHEE 2J4BA 4PDXA 4G1TA 3APFA 5G55A 1Z3YA 3SHFA 3ZIMA 3LKUA 2NXPA 3MGBA 2X6HA 5HI7A 2WXHA 1H2VC 1E7VA 3S7BA 1BPOA 4CT4A 3FTVA 2L9BA 3AS4A 2AW6A 4FP7A 4PS7A 4U8HA 4URKA 2Y3AA 3LS8A 1UN8A 2WXNA 3ASFA 3CVLA 4GPKA 3D9KA 1OWOA 2XQ0A 3QARA 4WNDA 4CGVA 4I1OB 2HR2A 3D9OA 1IQUA 3QAQA 3SNXA 3FU3A 3P1UA 4DPRA 2MRIA 4C9BB 3PREA 4YVQC 4F1SA 3E4BA 5CMWA 5T3RA 3UX4A 3CVQA 3UMVA 5C1DA 3S2AA 5BUZA 1ZBPA 1QZ2A 3MV3B 2KZTA 3EIQC 1SZAA 2L0IA 3ENEA 3FDHA 3L6AA 3CK8A 3ZGQA 1GW6A 3BEEA 3PEVB 4J8DA 3EHNA 2XEVA 3JQ1A 4ANVA 3CLJA 3IEGA 1EF1C 3ONLA 3ZYMA 2BTDA 3ASDA 3PZDA 4H7XA 5FWQA 3MYVA 1NA3A 4KT6B 4AY6A 4N3BA 4ILGA 2IU1A 2WXGA 4IULA 4XI0A 3S7JA 3VLDA 4RSYA 4ANWA 4N2SA 4QFVA 5G04J 4MKTA 3FH5A 4PUCA 4GA0A 3MKRA 1UJJA 3LXUX 2XPZA 4L1BA 3CK9A 4WAFA 2ILRA 1NP7A 3C98A 2XCBA 4I6GA 4U04A 4XKCA 1EPUA 2R17C 3RRUA 4F7AA 2KM4A 1L5JA 2CHXA 2XGMA 2X6KA 1E8WA 5G2NA 3ZXSA 1HFAA 4N39A 3Q5MA 2I1JA 3QWVA 2J07A 4UWGA 3ULQA 4ANXA 4AJWA 3TG4A 2VGXA 3IBEA 3B13A 3LVQE 5FQ6A 1IHGA 4R7LA 3ML8A 3IKOB 3CVPA 3QKYA 4U0ZA 3AS8A 4BT8A 2LNIA 4ANUA 5EX0A 3AS5A 3LY9A 2XGOA 3PS6A 1NZNA 4BSXA 1N52A 1ZU2A 3R7RA 4UI9C 3VTYA 2IF4A 3RIBA 4PS3A 5CCLA 4TUUA 3LEWA 2X3MA 3B7TA 4G25A 4KXKB 2XPIA 4EZJA 1XGWA 4FLBA 2VSYA 4EECA 5EDSA 2LSUA 2WXOA 2IOSA 3ONKA 4GZDA 4Y6CA 5LCWJ 4ABNA 2E0IA 3G2SA 1SZ9A 4ME2A 3NF1A 1S0PA 3NZUA 4I1AA 2NC9A 3LCAA 3SBSA 2XRYA 1QNFA 3GZ2A 3T5XA 1H0AA 1HH8A 1HG5A 2AVPA 2QY7A 3FH8A 2Y4TA 3RKVA 4HVBA 2WMNA 4JEHA 4TV3A 5CCMA 3KAEA 3QNKA 4OVUA 4H7YA 1WY6A 3D9MA 3SD5A 1JWFA 1H6KA 1Y6IA 2I2OA 2EQXA 4HOUA 2R59A 3ASHA 2FO7A 4KVOA 3TAXA 4G11A 3FULA 3I4GA 3CEQA 2J4DA 5D0OD 2YNQA 4BWRA 4EQFA 3U66A 4BTBA 3AU4A 3G2TA 3ZPJA 4HOQA 3MKQA 4BY6A 4LEUA 1MQSA 2MHKA 4YNDA 3D9IA 3D3MA 3HHMA 2IONA 2PL2A 2OV8A 3SZ7A 4A3VA 4AXHA 4CT0A 5A23A 3FFLA 1HU3A 4FLHA 2VJ8A 4L23A 2V0PA 2WPVA 4FHJA 4N3AA 4DJAA 5LX8A 4JHJA 2AXUA 3IHYA 4F3VA 3ESKA 2A5UA 4DI3A 4GZ6A 3L16A 4NURA 4J8FA 4RVBA 2M63A 2VSOE 4C0MA 2WXJA 3PNLB 3UT4A 3PE4A 5BNWA 1OUVA 4GYYA 4UWHA 3MV2B 3MZLB 4L7TA 3CK7A 5AJDA 5AENA 2WM9A 1JPLA 2UY1A 3AU5A 4JW1A 2GRMA 3KD7A 4UQXA 2DIWA 4HS2A 1DVPA 4NQ0A 4OYSA 5DBKA 4DLQA 4BFRA 2WQ6A 2LO6A 3LY8A 3FTWA 3MCXA 3T8MA 4MLPA 3PNTB 4Y6WA 3SI5A 3LY7A 1B89A 4K03A 4A3TA 3OAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SF4 A;  3TG5 A;  5EX3 A;  2OND A;  3KS2 A;  1P5Q A;  4AIF A;  5G05 C;  4AM9 A;  4XI9 A;  4GCN A;  2XCC A;  4YVO A;  1IYG A;  2LSV A;  4G2V A;  3CKB A;  4WUY A;  3GYZ A;  5JJ7 A;  3Q49 B;  5DIZ A;  4AY5 A;  4RG9 A;  1FCH A;  5A6C A;  3QWP A;  2FI7 A;  2YQ8 A;  3U4T A;  3GW4 A;  2R5S A;  2VGX B;  3ZHE B;  5FZQ A;  2PQR A;  3MEK A;  3RO2 A;  4I2W A;  2VGY A;  1KLX A;  1TJC A;  5AYW D;  5EKQ D;  2Q7F A;  4GYO A;  2KAT A;  3K9I A;  3ZHE A;  4UQZ A;  5G04 C;  2DBA A;  1ELR A;  5KJM A;  4GZ5 A;  3O48 A;  3ZN3 A;  5BW8 C;  3ASG A;  4CDR A;  3UQ3 A;  5JJT A;  1HZ4 A;  2GW1 A;  2C2L A;  4GYW A;  5FTP A;  5ARG A;  4BTA A;  4WNF A;  4U0U A;  5KJK A;  5KJL A;  2HO1 A;  3S7D A;  2V5F A;  2UWJ G;  3FWV A;  2FEZ A;  4G23 A;  1KT1 A;  3S7F A;  3Q15 A;  4XIF A;  4G24 A;  3OXG A;  2BUG A;  4JHR A;  4B94 A;  3U3W A;  5LCW C;  4GA1 A;  2J9Q A;  3Q4A B;  2UY1 B;  3LYA A;  5A7D B;  4JA9 A;  4APO A;  2VQ2 A;  2PZI A;  4N5C A;  4W9R A;  1YA0 A;  3QDN A;  1ELW A;  2KC7 A;  4I9E A;  4BT9 A;  1Y8M A;  1PC2 A;  3QWW A;  4GCO A;  4I17 A;  3OXL A;  3RO3 A;  3CV0 A;  4IN3 B;  5FJY A;  2WQH A;  2VYI A;  3TGO A;  4GA2 A;  2FBN A;  3PDN A;  4U0S A;  5JJ6 A;  1WM5 A;  5FZR A;  2Y4U A;  2KCV A;  1E96 B;  5FT9 A;  1QQE A;  4I2Z A;  2KCL A;  1KT0 A;  4JL0 A;  5BT1 A;  2JLB A;  2C0M A;  3R9A B;  4WNG A;  3VTX A;  4A1S A;  3MA5 A;  4HOS A;  3URZ A;  2I6H A;  2OOE A;  4UQY A;  4I9C A;  4RG6 A;  2QFC A;  3RU0 A;  4GZ3 A;  2YHC A;  3UUX A;  4N3C A;  2FF4 A;  1NA0 A;  4UI9 J;  4CGW A;  3UPV A;  3ZFW A;  2L6J A;  4J8E A;  1HXI A;  2XGS A;  3OXF A;  5ARF A;  5D0Q D;  4JA7 A;  2C0L A;  2PQN A;  4NRH B;  4KYO B;  4HOR A;  1W3B A;  5M72 A;  2KCK A;  4HOT A;  3QOU A;  1WAO 1;  4O6F A;  3N71 A;  1XNF A;  2VSN A;  2HYZ A;  3WXX A;  3HYM B;  3Q47 B;  3PE3 A;  2IFU A;  4G26 A;  4UI9 K;  3FP3 A;  3EDT B;  3CKC A;  4KBQ A;  2E2E A;  4U07 A;  2P58 C;  5KJN A;  4J0U A;  1A17 A;  3GZ1 A;  5FZS A;  3CVN A;  3RJV A;  4N2Q A;  5HQ8 A;  3JYS A;  3LPZ A;  4WNE A;  5G05 J;  5CHE E;  4G1T A;  3LKU A;  5HI7 A;  3S7B A;  3AS4 A;  3ASF A;  3CVL A;  4GPK A;  4WND A;  4CGV A;  2HR2 A;  4YVQ C;  3E4B A;  3CVQ A;  5C1D A;  1ZBP A;  1QZ2 A;  3MV3 B;  3ZGQ A;  3CK8 A;  3BEE A;  4J8D A;  2XEV A;  3IEG A;  3ASD A;  4H7X A;  1NA3 A;  4AY6 A;  4N3B A;  4XI0 A;  3S7J A;  4N2S A;  5G04 J;  4GA0 A;  3MKR A;  3CK9 A;  2XCB A;  4U04 A;  2XGM A;  4N39 A;  3Q5M A;  3QWV A;  3ULQ A;  3TG4 A;  2VGX A;  1IHG A;  3CVP A;  3QKY A;  4U0Z A;  3AS8 A;  4BT8 A;  2LNI A;  5EX0 A;  3AS5 A;  3LY9 A;  2XGO A;  1NZN A;  1ZU2 A;  3VTY A;  4UI9 C;  2IF4 A;  3RIB A;  5CCL A;  4G25 A;  4KXK B;  2XPI A;  2VSY A;  2LSU A;  4Y6C A;  5LCW J;  4ME2 A;  3NF1 A;  4I1A A;  2NC9 A;  3LCA A;  3GZ2 A;  1HH8 A;  2AVP A;  3RKV A;  2Y4T A;  5CCM A;  3KAE A;  4H7Y A;  4HOU A;  3ASH A;  2FO7 A;  3TAX A;  3CEQ A;  5D0O D;  4BWR A;  4EQF A;  4BTB A;  3ZPJ A;  4HOQ A;  4LEU A;  2MHK A;  4YND A;  2PL2 A;  3SZ7 A;  3FFL A;  2WPV A;  4N3A A;  4F3V A;  3ESK A;  4GZ6 A;  4J8F A;  3PE4 A;  5BNW A;  1OUV A;  4GYY A;  3MV2 B;  3CK7 A;  2UY1 A;  3KD7 A;  4UQX A;  4NQ0 A;  5DBK A;  3LY8 A;  4Y6W A;  3LY7 A;  1B89 A;  4ABN A; 
#chains in the Genus database with same CATH topology
 3UKU G;  4N5Q A;  4K5B A;  3SBT B;  1S70 B;  5B1B E;  1YYH A;  1MYO A;  2KZT B;  3KS2 A;  1P5Q A;  5LP0 A;  2L0T B;  4TUM A;  5G05 C;  1Q2Z A;  2IY0 C;  2WXP A;  4FJZ A;  2OEW A;  1IYG A;  3SO8 A;  1JCQ A;  2ETB A;  5IY5 E;  3G2V A;  5JJ7 A;  4GTS A;  5DIZ A;  3JUI A;  3CHM A;  4HLE A;  4I6E A;  2EIK E;  2VGX B;  5FZQ A;  3DST A;  3R7Q A;  2VTB B;  2VGY A;  1DCQ A;  4J8Y A;  5EN5 D;  5EKQ D;  2A5E A;  2Q7F A;  2DCP A;  5LOZ A;  3EUV A;  1KZP A;  2OEV A;  3CVV A;  3Q7F A;  4UQZ A;  3D9H A;  4HFG A;  5FQ8 A;  5JA4 D;  3SFZ A;  1K8K G;  4AOF A;  4AV7 A;  4O60 A;  4JVS A;  2X38 A;  4PH4 B;  3CVX A;  4EBA A;  4WWO A;  4HRL A;  4U0U A;  5J08 A;  1TNB A;  3QJZ A;  2QZA A;  4GTT A;  3UM2 A;  3CQG B;  2FEZ A;  3FTX A;  1N4P A;  4XIF A;  4G24 A;  4B89 A;  4J8S A;  3FTU A;  3U3W A;  5KCM A;  1K1A A;  3T5V A;  1A5E A;  1DNP A;  3Q4A B;  1X5B A;  3E32 A;  3ULE G;  4JA9 A;  1AWC B;  2P9L G;  3ISM C;  4ACK A;  5T8I A;  1MX2 A;  3AG2 E;  4W9R A;  1H6P A;  3C3O A;  3TWT A;  3QWW A;  4GCO A;  4CDM A;  3ZW3 A;  3RO3 A;  2VYI A;  4B93 B;  3TGO A;  3W9F A;  1WM5 A;  2Y4U A;  1E96 B;  1E8Z A;  2NSZ A;  2DVW A;  2Y69 E;  5ENN A;  2NYJ A;  4WWP A;  3FUI A;  2AXZ A;  5FIO A;  2LAI A;  3RRM B;  4JL0 A;  4XZ4 A;  2JLB A;  1BLX B;  2C0M A;  3O4Z A;  4MS6 A;  4FAD A;  3CHR A;  3VTX A;  4U96 D;  2A4Z A;  1TR4 A;  3C3Q A;  4HNA D;  2X6F A;  2I6H A;  2QFC A;  1ZB1 A;  3UKR G;  3HXB A;  4GZ3 A;  1MJ0 A;  3ZEF A;  1S63 A;  3CQC B;  3ZFW A;  4GB9 A;  4F6R D;  2WXR A;  1HS6 A;  2LAH A;  4J8E A;  5C2Y A;  4QQI A;  3LJ3 A;  3GZS A;  2YIN A;  2RG8 A;  3MX3 A;  4M3O A;  2C0L A;  2RD0 A;  3AJI A;  3ZRH A;  3FEY A;  3ZUV B;  1U2V G;  4KYO B;  1W3B A;  5M72 A;  4HOT A;  2WXF A;  3QOU A;  3ASN E;  3QK0 A;  5JHA A;  3N71 A;  2R05 A;  2ETC A;  3PRZ A;  3UM1 A;  3BQO A;  2WVI A;  4L2L A;  4G26 A;  4LER A;  4A63 B;  2PM6 A;  3UXG A;  4C48 B;  2CFZ A;  5KJN A;  3SGH A;  5FQ4 A;  1A17 A;  3TXM A;  3CVN A;  2OVF A;  2XS1 A;  5ENQ D;  3RAU A;  1QYM A;  3SFX A;  2J4B A;  1Z3Y A;  3SHF A;  3ZIM A;  2NXP A;  1H2V C;  2ZGG A;  3S7B A;  3FTV A;  4PS7 A;  4FP7 A;  4U8H A;  2HR2 A;  3D9O A;  4YDO A;  2MRI A;  4C9B B;  3PRE A;  4F1S A;  2KBX A;  2FO1 E;  2BTD A;  1NA3 A;  4L9P A;  2IU1 A;  3ULY A;  3S7J A;  3VLD A;  3W9G A;  4N2S A;  4GA0 A;  2R03 A;  2V4H C;  2ILR A;  3C98 A;  2XCB A;  2R17 C;  2X6K A;  1HFA A;  2ETA A;  4N39 A;  4UWG A;  1N4S A;  5FQ6 A;  3ML8 A;  3ABK E;  1N9A A;  3UI2 A;  2F0Y A;  1FT1 A;  4BSX A;  3R7R A;  2IF4 A;  5CCL A;  3UIN C;  4G25 A;  1RZ4 A;  2P9S G;  4GZD A;  2IOS A;  2XEH A;  4HBD A;  1N0Q A;  2XRY A;  4G8L A;  3GZ2 A;  1H0A A;  4HVB A;  4K5C A;  4OVU A;  3D9M A;  1Y6I A;  3ASH A;  4G11 A;  4LNB A;  4BTB A;  3AU4 A;  3DPY A;  4LEU A;  3BUA A;  1BU9 A;  4AXH A;  4YND A;  2ION A;  3SY2 A;  2VJ8 A;  2P2C P;  4DJA A;  2AXU A;  4F3V A;  2A5U A;  3L16 A;  4RVB A;  2VSO E;  3UT4 A;  4GYY A;  4UWH A;  5AJD A;  3MZL B;  3Q73 A;  2UY1 A;  2GRM A;  1OT8 A;  3Q78 A;  1DVP A;  5DBK A;  2WQ6 A;  3FTW A;  5CRU A;  3HXD A;  4U8Y D;  3SI5 A;  1MX4 A;  3LY7 A;  4YDY A;  4JB8 P;  3OAW A;  2F8Y A;  3SF4 A;  3CGH A;  3TG5 A;  4CYM D;  2CHW A;  4AIF A;  5H7P A;  2WMO A;  1HF8 A;  3FU6 A;  1OY3 D;  3UM3 A;  5CEC B;  2XCC A;  4YVO A;  3I4R B;  3CKB A;  4WUY A;  3Q49 B;  4JC8 A;  5CRV A;  4RG9 A;  3QWP A;  3JXJ A;  2FI7 A;  2GGF A;  2YQ8 A;  3APC A;  4HXI A;  2DZN A;  4ZFH A;  3CIA A;  1X81 A;  3LVR E;  3AG4 E;  2CHZ A;  2VTB A;  2DBA A;  4O1P A;  1UG3 A;  3FUK A;  3PZ2 A;  4RLY A;  3E30 A;  5BW8 C;  2I9C A;  3SFY A;  2XRZ A;  1E7U A;  3UQ3 A;  3KSL A;  2C2L A;  5ARG A;  4BTA A;  5KJK A;  3FUN A;  3S7D A;  2PM7 A;  2J8S D;  4LRZ A;  2V5F A;  2GRL A;  1JCR A;  2QYJ A;  4HLL A;  3OXG A;  2DYR E;  4E6H A;  4I6J A;  2LUH A;  1TN6 A;  1S64 A;  4I1M A;  3CVW A;  3T8K A;  3PUK A;  2UY1 B;  3MJW A;  4APO A;  3DSV A;  1FPP A;  5BXU A;  3LDZ A;  2IEJ A;  5HS0 A;  1ELW A;  2KC7 A;  4AP2 A;  3NB2 A;  3D9L A;  3D9P A;  3U64 A;  4BT9 A;  1Y8M A;  1HO8 A;  1PC2 A;  3B7B A;  3F6Q A;  4DLO A;  4I17 A;  3TWU A;  5EIB E;  2P9N G;  5ENP D;  3FUD A;  2X6J A;  2WXQ A;  2FBN A;  2ZGD A;  3PDN A;  2H6F A;  5JJ6 A;  3TWV A;  2KCV A;  5FT9 A;  1QQE A;  4BX9 A;  5AN8 A;  1O1T A;  4LUN U;  2IO3 C;  1KZO A;  3EU9 A;  4JZY A;  3L82 A;  3DSX A;  3UIP C;  3P2B A;  5ENR D;  4FC8 A;  5BT1 A;  3FH7 A;  2R2L A;  2EIL E;  1JWG A;  3HDX A;  1OWL A;  2JAB A;  3TWW A;  2MOW A;  2HE0 A;  2EIM E;  5ITZ F;  2CFU A;  2OOE A;  3UT7 A;  4RG6 A;  1MX6 A;  4IYP A;  5KNG A;  2V8S E;  3ZYK A;  2V4L A;  4GPM A;  1NA0 A;  1UW4 B;  1FT2 A;  4CGW A;  1HE8 A;  3CVY A;  4EPZ A;  3HG0 D;  1OWN A;  2B6C A;  2GRQ B;  4HRN A;  3OXF A;  4ATG A;  1VDY A;  2R02 A;  3BG0 B;  1JCS A;  3B7U X;  1OWP A;  1UOH A;  4HOR A;  1E90 A;  2LXM A;  1WAO 1;  1H2T C;  4XE0 A;  2V5Q C;  4FA6 A;  1TNO A;  3Q47 B;  3PE3 A;  4F53 A;  4UI9 K;  4ACL A;  3CST A;  3HIZ A;  3CKC A;  2AWI A;  3TWS A;  2E2E A;  4U07 A;  4DRX E;  2YHE A;  2MYO A;  1U3C A;  4UWL A;  4GML A;  3RJV A;  3C3R A;  2VGE A;  5ENS D;  2IO2 C;  4ILH B;  4Q94 A;  1NFI E;  2CG2 A;  5HQ8 A;  4HI8 A;  3EJN A;  5AQ9 A;  4GTO A;  1N0R A;  3ZVV A;  4F1P A;  5CHE E;  4U8V D;  3APF A;  3LKU A;  3DEP A;  5D2M C;  2PNN A;  4CT4 A;  1BPO A;  3LS8 A;  3CVL A;  3D9K A;  1OWO A;  3QAR A;  3TWX A;  4I1O B;  1IQU A;  3SNX A;  4DPR A;  2OCC E;  1SW6 A;  3S2A A;  1QZ2 A;  3MV3 B;  3EIQ C;  3AAA C;  3CLJ A;  3ZYM A;  2ZIS A;  4H7X A;  3KEA A;  4ILG A;  2WXG A;  5G04 J;  4JD2 G;  3AG1 E;  3MKR A;  2XPZ A;  1NP7 A;  4U04 A;  3B95 A;  2BKK B;  1EPU A;  3RRU A;  2KM4 A;  1L5J A;  1O1R A;  1E8W A;  2F37 A;  3JUE A;  3IBE A;  3B13 A;  3DEO A;  3CVP A;  4U0Z A;  4ANU A;  3AS5 A;  1N94 A;  3VTY A;  1OXJ A;  3J5P A;  3RIB A;  4PS3 A;  4TUU A;  2X3M A;  1XGW A;  2VSY A;  5EDS A;  2LSU A;  3ONK A;  4Y6C A;  3UTM A;  2E0I A;  5D66 A;  4I1A A;  3LCA A;  3T5X A;  2AVP A;  1HG5 A;  2Y4T A;  4JEH A;  5CCM A;  4H7Y A;  3SD5 A;  4HOU A;  1NL4 A;  3NAW A;  2YNQ A;  4BWR A;  4EQF A;  1KPS B;  4BEP A;  3MKQ A;  4A3V A;  5EYL A;  3SZ7 A;  2OV8 A;  4CT0 A;  3FFL A;  1HU3 A;  4FLH A;  4X8Q A;  2V0P A;  5LX8 A;  4N3A A;  3V31 A;  4J8F A;  2QYU A;  4M7C A;  3PNL B;  3PE4 A;  5BNW A;  1SA5 A;  3MV2 B;  2WM9 A;  1JPL A;  4JW1 A;  1V54 E;  4UQX A;  2DIW A;  1SA4 A;  4NQ0 A;  4BFR A;  3LY8 A;  4DX2 A;  3PNT B;  5BXO A;  5LFA A;  4L2Y A;  1YCS B;  4KZC A;  2OND A;  5ENO D;  3ZYQ A;  4V3I A;  4D10 C;  3HVE A;  4XI9 A;  1LD8 A;  4DX7 D;  4PS8 A;  3I3N A;  2LSV A;  3G2U A;  2DWZ A;  3R9M A;  2P9P G;  5AAR A;  3GYZ A;  3Q9N C;  4AY5 A;  1FCH A;  3U4T A;  1SVX A;  3PZ4 A;  3ZHE B;  2PQR A;  3BU8 A;  2I1K A;  2CG3 A;  3MEK A;  3RO2 A;  3QC1 A;  4DX6 D;  4GYO A;  2P9K G;  2X6I A;  4CEM A;  5G04 C;  2WXK A;  1ELR A;  3DPD A;  3UT8 A;  4GZ5 A;  3CHQ A;  5BV1 A;  4Q96 A;  1TNY A;  4MRU A;  2WB2 A;  3E34 A;  5JJT A;  2J09 A;  2GW1 A;  3FU5 A;  4GYW A;  4LSZ E;  4B8C B;  5KJL A;  3MKQ B;  3FUM A;  2HO1 A;  3FWV A;  3JCK C;  3VLF A;  3ZKJ A;  1YMP A;  3S7F A;  5T4Y A;  3EHR A;  1JUQ A;  5AAO A;  4G8K A;  4JHR A;  1IQR A;  4A1G A;  1Z6T A;  5AJL A;  2QC9 A;  3L54 A;  4GA1 A;  4K0R A;  3C72 A;  1UJK A;  5EID A;  3EU5 A;  4FHK A;  3CHS A;  4U95 D;  3LYA A;  4B0Z A;  5FIN A;  2VQ2 A;  4XX5 A;  2PZI A;  4OVV A;  4N5C A;  4FJY A;  1YA0 A;  3QDN A;  1TNZ A;  4JXT A;  2EIJ E;  3HVE B;  4ATZ D;  4BX8 A;  4J6I A;  3ZYL A;  1IKN D;  3TJP A;  3CV0 A;  4IN3 B;  2WQH A;  4Z68 A;  4GA2 A;  3B7R L;  3BG1 B;  5KNH D;  3L08 A;  5FZR A;  1MHQ A;  5CMY A;  5CBO A;  3NBN B;  2DZO A;  2XEN A;  2ZIR A;  3FTS A;  1OCR E;  1H19 A;  4I2Z A;  5CER B;  2GRO B;  3E37 A;  1KT0 A;  5EIL A;  3R9A B;  3FU0 A;  4UWF A;  4WNG A;  3SQV A;  2RFM A;  3MA5 A;  5KWD A;  4U63 A;  5JHB A;  4OAV B;  5AIJ A;  3URZ A;  2L6B A;  3PEU B;  3FHE A;  4I9C A;  5ANR A;  3TL5 A;  3FUF A;  2WXI A;  3RU0 A;  2YHC A;  4N3C A;  5E75 A;  4DI4 A;  2FF4 A;  4UI9 J;  2H6I A;  4GMR A;  1E8X A;  2XEE A;  3PUJ A;  1N54 A;  4YDE A;  1H2U A;  3ML9 A;  1HXI A;  3PVL A;  4A55 A;  2XGS A;  1HG2 A;  1FVF A;  4WWN A;  5ARF A;  3CR3 A;  3APD A;  5D0Q D;  5ANL A;  3CVU A;  2PQN A;  1QBQ A;  4DX1 A;  1K1B A;  3JQ0 A;  3FUH A;  4GMJ A;  1HX8 A;  4C0E A;  4TRQ A;  1XNF A;  2AXV A;  2J49 A;  2F8X K;  4AVX A;  4EZK A;  2IFU A;  3KEZ A;  3EDT B;  3L17 A;  4HRM B;  3NOC D;  4E85 A;  1ELK A;  2BKG A;  4J0U A;  1EYH A;  4TXR A;  3DXK G;  4HB5 A;  3L13 A;  3Q9U C;  4BES A;  4EBA G;  4ILI A;  4U7E B;  1N95 A;  4G1T A;  2AJA A;  5G55 A;  5KBA A;  3MGB A;  2X6H A;  5HI7 A;  2L9B A;  3AS4 A;  3V2X A;  4URK A;  1UN8 A;  2WXN A;  4WND A;  1BI7 B;  4CGV A;  2LXL A;  5ENT D;  3QAQ A;  3FU3 A;  2Y1L E;  4YVQ C;  3TWQ A;  3E4B A;  5CMW A;  3UX4 A;  3CVQ A;  5BUZ A;  1ZBP A;  3ABM E;  3T9K A;  1TN8 A;  2L0I A;  3ZGQ A;  3L6A A;  4J8D A;  4LNU D;  4ANV A;  3EHN A;  2XEV A;  4ZHB A;  1EF1 C;  3ONL A;  4GTV A;  5CED B;  3ASD A;  3PZD A;  3MYV A;  4KT6 B;  4AY6 A;  2GRN B;  4N3B A;  4XI0 A;  3DRA A;  4RSY A;  4QFV A;  4PUC A;  3LXU X;  3CK9 A;  4WAF A;  1WG0 A;  2XGM A;  5G2N A;  2I1J A;  3QWV A;  2J07 A;  3TG4 A;  3DSU A;  4J7W A;  4R7L A;  3ASO E;  1MZC A;  5EX0 A;  3PS6 A;  2XGO A;  1NZN A;  1N52 A;  1ZU2 A;  3IXE A;  4UI9 C;  3C5R A;  3LEW A;  3DXM G;  4DUI A;  4KXK B;  2XPI A;  4EZJ A;  4FLB A;  2WXO A;  3AG3 E;  5LCW J;  3DWL G;  1N4Q A;  3G2S A;  4ME2 A;  3NF1 A;  2B0O E;  4GTM A;  1QNF A;  3ZU7 B;  3FH8 A;  3RKV A;  3JXI A;  4TV3 A;  3KAE A;  3QNK A;  1WY6 A;  2R59 A;  4KVO A;  3TAX A;  3FUL A;  3I4G A;  2J4D A;  3U66 A;  1O1S A;  3ZPJ A;  4BY6 A;  2MHK A;  3D9I A;  3D3M A;  3HHM A;  2PL2 A;  5A23 A;  4L23 A;  2ZXW E;  4FHJ A;  3IHY A;  2XZT G;  4DI3 A;  2P9U G;  2M63 A;  1OUV A;  5AEN A;  3CK7 A;  3KD7 A;  4HS2 A;  4OYS A;  3T8M A;  4MLP A;  4Y6W A;  1B89 A;  4K03 A;  4A3T A;  4MBG A;  4BET A;  5EX3 A;  3CHO A;  4CRW A;  4GU5 A;  4GZC A;  2HM8 A;  4AM9 A;  4GCN A;  4B8A A;  1UN9 A;  3FEX A;  2ZU6 B;  4G2V A;  2VSX E;  5CBN A;  4AEZ C;  4XKB A;  3FY4 A;  5A6C A;  4BSZ B;  1FVH A;  1WDY A;  3GW4 A;  2R5S A;  1TN7 A;  2IOL A;  3PH0 C;  1OWM A;  3U9W A;  3RRN B;  4I2W A;  3FUJ A;  2XZD G;  1KLX A;  4GTR A;  1TJC A;  5AYW D;  4YDW A;  3NZS A;  1O5M A;  2KAT A;  3K9I A;  3ZHE A;  3CSF A;  2WXL A;  2IJG X;  2BED A;  4P29 A;  5KJM A;  3CHP A;  1U3D A;  2RFA A;  4DK5 A;  3O48 A;  1BD8 A;  3ZN3 A;  3DSS A;  4IRU A;  4LCT A;  3ASG A;  4CDR A;  4KMO A;  2Y0B G;  3IHV A;  3ZXP A;  1Z3X A;  3HRA A;  1SQM A;  1HZ4 A;  5FTP A;  4HI9 A;  3Q79 A;  3TXN A;  4WNF A;  2UWJ G;  3X2Q E;  1PAQ A;  4G23 A;  1KT1 A;  1PY1 A;  5BPP A;  3Q15 A;  3FTZ A;  4KZ0 A;  2BUG A;  2BF0 X;  2XS8 A;  1D8D A;  2WQ7 A;  5J90 A;  4B94 A;  5LCW C;  1DCE A;  3PZ1 A;  4KVM A;  2J9Q A;  5HRY A;  2WXM A;  1TJF A;  5A7D B;  1K3Z D;  3DBS A;  1TYQ G;  3EHQ A;  3Q75 A;  4GAA A;  5HKP A;  4GTQ A;  4I9E A;  1NI1 A;  2FUL A;  1INZ A;  4Q69 A;  2GRP B;  4FU3 A;  3OXL A;  1D9S A;  5E76 A;  3IV0 A;  3ZNG A;  5FJY A;  4JPS A;  3QB2 A;  3EIJ A;  1EDU A;  1E8Y A;  4U0S A;  3HXF A;  1D8E A;  3HXE A;  1G3N B;  4XEI G;  5FQ7 A;  1TEZ A;  1N4R A;  5AQ7 A;  4CCA A;  4EZL A;  1OCZ E;  2KCL A;  3UIO C;  4RQI A;  3ESL A;  2JEK A;  3D9J A;  5CEA A;  4CDN A;  4A1S A;  4HOS A;  5JMN D;  1LTX A;  3OTN A;  4UQY A;  3L22 A;  2J08 A;  3UUX A;  3ABL E;  3UPV A;  4GTP A;  2P9I G;  4JEU A;  2OVB A;  2GRR B;  2L6J A;  3FUE A;  3D9N A;  1LF8 A;  4JHK A;  1IXV A;  4I43 A;  3L9T A;  3HXC A;  4JA7 A;  3FTY A;  3KSQ A;  4NRH B;  3NQP A;  4OAU C;  3Q7A A;  2KCK A;  3NOG D;  4UWK A;  3EHM A;  3LJN A;  2RKK A;  2XPY A;  4O6F A;  2VSN A;  2HYZ A;  5B3S E;  3WXX A;  4EHM A;  3HYM B;  2XHE A;  4APF A;  3B7S A;  3G2W A;  3FP3 A;  5EYP F;  4KBQ A;  3VLE A;  2P58 C;  3I5P A;  4NAC A;  3GZ1 A;  2KXP C;  1N11 A;  5FZS A;  2IQC A;  4FUL A;  3RK6 A;  4N2Q A;  3JYS A;  3V30 A;  3LPZ A;  3TWR A;  5BV0 A;  4WNE A;  5G05 J;  1OCO E;  4PDX A;  2WXH A;  1E7V A;  2AW6 A;  2Y3A A;  3ASF A;  3J5Q B;  4GPK A;  2XQ0 A;  3P1U A;  5T3R A;  4O1O A;  3UMV A;  4CZ2 D;  5C1D A;  2KZT A;  1SZA A;  3ENE A;  3FDH A;  3CK8 A;  1GW6 A;  3BEE A;  3PEV B;  3JQ1 A;  1TNU A;  4K5A B;  3IEG A;  4UUC A;  3V79 K;  1RW2 A;  2DYS E;  5FWQ A;  5B1A E;  3DSW A;  4IUL A;  5AQB A;  4ANW A;  1AP7 A;  4MKT A;  3FH5 A;  1UJJ A;  4L1B A;  4I6G A;  4LNG A;  4BER A;  4XKC A;  4F7A A;  2CHX A;  3ZXS A;  3Q5M A;  3ULQ A;  4ANX A;  4AJW A;  2VGX A;  1IHB A;  3LVQ E;  1IHG A;  3IKO B;  3QKY A;  4BT8 A;  3AS8 A;  2LNI A;  4LG6 A;  3LY9 A;  2H6G A;  3B7T A;  5AQA A;  3E33 A;  4EEC A;  3RSE G;  3V2O A;  1SZ9 A;  1S0P A;  3NZU A;  2NC9 A;  3SBS A;  1HH8 A;  2QY7 A;  4DX5 D;  1DC2 A;  1V55 E;  2WMN A;  2EIN E;  4HQD A;  2H6H A;  1JWF A;  1H6K A;  1Z5S C;  2I2O A;  2EQX A;  1H6O A;  2FO7 A;  1BI8 B;  1LD7 A;  4TXQ A;  3CEQ A;  5D0O D;  3UM0 A;  3G2T A;  4HOQ A;  1MQS A;  4TXP A;  3PZ3 A;  2WPV A;  4JHJ A;  3ESK A;  4GZ6 A;  4NUR A;  1OCC E;  4C0M A;  2WXJ A;  4L7T A;  3AU5 A;  3WG7 E;  4DLQ A;  2LO6 A;  3MCX A;  4NIK A;  4ABN A; 
#chains in the Genus database with same CATH homology
 3SF4 A;  4L2Y A;  3CGH A;  3SBT B;  3TG5 A;  4KZC A;  2KZT B;  5EX3 A;  2OND A;  3KS2 A;  3CHO A;  4CRW A;  3ZYQ A;  2CHW A;  4V3I A;  1P5Q A;  4GU5 A;  4AIF A;  4D10 C;  5LP0 A;  2L0T B;  2WMO A;  1HF8 A;  3HVE A;  4GZC A;  2HM8 A;  5G05 C;  4AM9 A;  3FU6 A;  4GCN A;  4XI9 A;  4B8A A;  2XCC A;  4PS8 A;  1UN9 A;  2WXP A;  3I3N A;  4YVO A;  4FJZ A;  3I4R B;  5LFA A;  1IYG A;  2LSV A;  3FEX A;  3G2U A;  2ZU6 B;  4G2V A;  2VSX E;  3CKB A;  3G2V A;  4WUY A;  3GYZ A;  5JJ7 A;  4AEZ C;  3Q49 B;  3JUI A;  4JC8 A;  5DIZ A;  4XKB A;  4AY5 A;  3FY4 A;  4RG9 A;  1FCH A;  3CHM A;  3QWP A;  5A6C A;  4HLE A;  2FI7 A;  2GGF A;  2YQ8 A;  1FVH A;  3U4T A;  3APC A;  2R5S A;  3GW4 A;  4I6E A;  2IOL A;  3PH0 C;  2VGX B;  4HXI A;  1OWM A;  3U9W A;  3ZHE B;  5FZQ A;  3RRN B;  2PQR A;  2I1K A;  2CG3 A;  3MEK A;  3RO2 A;  4I2W A;  3R7Q A;  2VTB B;  3CIA A;  2VGY A;  3FUJ A;  3QC1 A;  1KLX A;  1TJC A;  5AYW D;  3NZS A;  5EKQ D;  3LVR E;  2Q7F A;  4GYO A;  2DCP A;  2KAT A;  5LOZ A;  3K9I A;  3ZHE A;  2X6I A;  3CSF A;  3CVV A;  2WXL A;  2CHZ A;  2IJG X;  2VTB A;  4UQZ A;  5G04 C;  4CEM A;  2DBA A;  2WXK A;  1ELR A;  4HFG A;  4P29 A;  3DPD A;  5FQ8 A;  3UT8 A;  5KJM A;  4GZ5 A;  1UG3 A;  3CHQ A;  3CHP A;  5BV1 A;  3FUK A;  4Q96 A;  1U3D A;  3SFZ A;  4DK5 A;  3O48 A;  3ZN3 A;  4MRU A;  2WB2 A;  5BW8 C;  4IRU A;  4LCT A;  3ASG A;  2I9C A;  4AOF A;  4AV7 A;  4CDR A;  4JVS A;  4KMO A;  2XRZ A;  1E7U A;  3IHV A;  3UQ3 A;  1Z3X A;  2X38 A;  4PH4 B;  5JJT A;  2J09 A;  1SQM A;  1HZ4 A;  2GW1 A;  3FU5 A;  2C2L A;  4GYW A;  5FTP A;  4WWO A;  5ARG A;  4EBA A;  3CVX A;  4BTA A;  4B8C B;  3TXN A;  4WNF A;  4U0U A;  5KJK A;  5KJL A;  3MKQ B;  3FUM A;  2HO1 A;  5J08 A;  3FUN A;  3QJZ A;  3S7D A;  2PM7 A;  4LRZ A;  2V5F A;  2UWJ G;  2GRL A;  3FWV A;  3JCK C;  3CQG B;  2FEZ A;  3FTX A;  3VLF A;  1PAQ A;  4G23 A;  1KT1 A;  1PY1 A;  3S7F A;  5BPP A;  3Q15 A;  4XIF A;  4G24 A;  5T4Y A;  4B89 A;  4J8S A;  1JUQ A;  3FTZ A;  3FTU A;  3OXG A;  4KZ0 A;  2BUG A;  2BF0 X;  4JHR A;  4E6H A;  2WQ7 A;  4I6J A;  1IQR A;  5J90 A;  4B94 A;  3U3W A;  4A1G A;  1Z6T A;  5LCW C;  5KCM A;  3T5V A;  4I1M A;  5AJL A;  1DNP A;  3CVW A;  3L54 A;  3PUK A;  4GA1 A;  4K0R A;  4KVM A;  2J9Q A;  3Q4A B;  2WXM A;  2UY1 B;  1UJK A;  1X5B A;  4FHK A;  3CHS A;  1TJF A;  3MJW A;  3LYA A;  5A7D B;  4B0Z A;  4JA9 A;  4APO A;  3DBS A;  2VQ2 A;  4XX5 A;  2PZI A;  4OVV A;  4ACK A;  5T8I A;  4N5C A;  3LDZ A;  4FJY A;  4GAA A;  4W9R A;  1YA0 A;  3QDN A;  1ELW A;  2KC7 A;  4I9E A;  4AP2 A;  3D9L A;  3D9P A;  3U64 A;  2FUL A;  4JXT A;  4BT9 A;  1INZ A;  1Y8M A;  1HO8 A;  1PC2 A;  4DLO A;  3QWW A;  4Q69 A;  3HVE B;  4GCO A;  4CDM A;  4BX8 A;  4J6I A;  4FU3 A;  4I17 A;  3OXL A;  3ZYL A;  3ZW3 A;  5E76 A;  3IV0 A;  3RO3 A;  3TJP A;  3CV0 A;  4IN3 B;  5FJY A;  4JPS A;  3QB2 A;  2WQH A;  3EIJ A;  2VYI A;  3FUD A;  2X6J A;  2WXQ A;  1EDU A;  3TGO A;  1E8Y A;  4GA2 A;  2FBN A;  3B7R L;  3PDN A;  4U0S A;  3BG1 B;  1WM5 A;  5JJ6 A;  3L08 A;  5FZR A;  1MHQ A;  2Y4U A;  5CMY A;  2KCV A;  1E96 B;  1E8Z A;  2NSZ A;  5FT9 A;  1QQE A;  4BX9 A;  4LUN U;  5FQ7 A;  1TEZ A;  4JZY A;  3FTS A;  1H19 A;  4I2Z A;  5ENN A;  4CCA A;  4WWP A;  4EZL A;  3FUI A;  2KCL A;  2AXZ A;  3P2B A;  4FC8 A;  2LAI A;  3RRM B;  1KT0 A;  4JL0 A;  5BT1 A;  3ESL A;  3FH7 A;  4XZ4 A;  2JLB A;  2JEK A;  2C0M A;  3O4Z A;  3R9A B;  4MS6 A;  3FU0 A;  4FAD A;  3D9J A;  4UWF A;  3CHR A;  4WNG A;  1JWG A;  3VTX A;  3HDX A;  4CDN A;  1OWL A;  4A1S A;  3MA5 A;  2A4Z A;  4HOS A;  2MOW A;  4U63 A;  5JHB A;  5AIJ A;  3URZ A;  2X6F A;  2I6H A;  2CFU A;  2OOE A;  3OTN A;  4UQY A;  3L22 A;  3FHE A;  3PEU B;  4I9C A;  3UT7 A;  4RG6 A;  5ANR A;  4IYP A;  2QFC A;  3TL5 A;  3FUF A;  2J08 A;  2V8S E;  3ZYK A;  2WXI A;  3RU0 A;  2V4L A;  2YHC A;  4GZ3 A;  3UUX A;  4N3C A;  5E75 A;  4DI4 A;  2FF4 A;  1NA0 A;  1UW4 B;  4UI9 J;  3ZEF A;  3CQC B;  4CGW A;  3UPV A;  1HE8 A;  1E8X A;  4GB9 A;  3ZFW A;  3PUJ A;  1N54 A;  3CVY A;  4JEU A;  2OVB A;  4EPZ A;  2L6J A;  2WXR A;  3FUE A;  1H2U A;  1HS6 A;  1OWN A;  2LAH A;  3D9N A;  4J8E A;  1LF8 A;  5C2Y A;  3ML9 A;  3LJ3 A;  1HXI A;  3GZS A;  3PVL A;  4A55 A;  2XGS A;  1HG2 A;  1FVF A;  2YIN A;  4JHK A;  4WWN A;  3OXF A;  5ARF A;  4I43 A;  3CR3 A;  3APD A;  5D0Q D;  5ANL A;  3CVU A;  2RG8 A;  3MX3 A;  4JA7 A;  4ATG A;  3FTY A;  2C0L A;  2RD0 A;  4M3O A;  1VDY A;  2PQN A;  3BG0 B;  3ZRH A;  3B7U X;  3FEY A;  1OWP A;  4NRH B;  4KYO B;  3NQP A;  4HOR A;  3JQ0 A;  1W3B A;  5M72 A;  2KCK A;  2WXF A;  3FUH A;  4GMJ A;  4HOT A;  3QOU A;  1E90 A;  3QK0 A;  1HX8 A;  4UWK A;  4C0E A;  3EHM A;  4TRQ A;  1WAO 1;  2XPY A;  4O6F A;  1H2T C;  5JHA A;  3N71 A;  1XNF A;  2VSN A;  2HYZ A;  3WXX A;  3PRZ A;  4XE0 A;  2AXV A;  2J49 A;  4FA6 A;  3HYM B;  3Q47 B;  2WVI A;  4L2L A;  2XHE A;  4AVX A;  4EZK A;  3PE3 A;  2IFU A;  4APF A;  4G26 A;  3B7S A;  4F53 A;  3KEZ A;  3G2W A;  4UI9 K;  4LER A;  3FP3 A;  3EDT B;  4ACL A;  3CST A;  3HIZ A;  3CKC A;  2AWI A;  4KBQ A;  2E2E A;  2PM6 A;  3L17 A;  3VLE A;  4U07 A;  2CFZ A;  2P58 C;  5KJN A;  2YHE A;  3I5P A;  3SGH A;  5FQ4 A;  1U3C A;  4E85 A;  1ELK A;  1A17 A;  4J0U A;  3GZ1 A;  4NAC A;  4UWL A;  5FZS A;  1EYH A;  3TXM A;  4GML A;  3CVN A;  2IQC A;  3RJV A;  2OVF A;  4FUL A;  3RK6 A;  4ILH B;  4Q94 A;  4N2Q A;  2CG2 A;  3L13 A;  5HQ8 A;  3EJN A;  3JYS A;  4EBA G;  3LPZ A;  5BV0 A;  4WNE A;  4ILI A;  5G05 J;  3ZVV A;  5CHE E;  2J4B A;  4PDX A;  4G1T A;  3APF A;  5G55 A;  1Z3Y A;  3SHF A;  3ZIM A;  3LKU A;  2NXP A;  3MGB A;  2X6H A;  5HI7 A;  2WXH A;  1H2V C;  1E7V A;  3S7B A;  1BPO A;  4CT4 A;  3FTV A;  2L9B A;  3AS4 A;  2AW6 A;  4FP7 A;  4PS7 A;  4U8H A;  4URK A;  2Y3A A;  3LS8 A;  1UN8 A;  2WXN A;  3ASF A;  3CVL A;  4GPK A;  3D9K A;  1OWO A;  2XQ0 A;  3QAR A;  4WND A;  4CGV A;  4I1O B;  2HR2 A;  3D9O A;  1IQU A;  3QAQ A;  3SNX A;  3FU3 A;  3P1U A;  4DPR A;  2MRI A;  4C9B B;  3PRE A;  4YVQ C;  4F1S A;  3E4B A;  5CMW A;  5T3R A;  3UX4 A;  3CVQ A;  3UMV A;  5C1D A;  3S2A A;  5BUZ A;  1ZBP A;  1QZ2 A;  3MV3 B;  2KZT A;  3EIQ C;  1SZA A;  2L0I A;  3ENE A;  3FDH A;  3L6A A;  3CK8 A;  3ZGQ A;  1GW6 A;  3BEE A;  3PEV B;  4J8D A;  3EHN A;  2XEV A;  3JQ1 A;  4ANV A;  3CLJ A;  3IEG A;  1EF1 C;  3ONL A;  3ZYM A;  2BTD A;  3ASD A;  3PZD A;  4H7X A;  5FWQ A;  3MYV A;  1NA3 A;  4KT6 B;  4AY6 A;  4N3B A;  4ILG A;  2IU1 A;  2WXG A;  4IUL A;  4XI0 A;  3S7J A;  3VLD A;  4RSY A;  4ANW A;  4N2S A;  4QFV A;  5G04 J;  4MKT A;  3FH5 A;  4PUC A;  4GA0 A;  3MKR A;  1UJJ A;  3LXU X;  2XPZ A;  4L1B A;  3CK9 A;  4WAF A;  2ILR A;  1NP7 A;  3C98 A;  2XCB A;  4I6G A;  4U04 A;  4XKC A;  1EPU A;  2R17 C;  3RRU A;  4F7A A;  2KM4 A;  1L5J A;  2CHX A;  2XGM A;  2X6K A;  1E8W A;  5G2N A;  3ZXS A;  1HFA A;  4N39 A;  3Q5M A;  2I1J A;  3QWV A;  2J07 A;  4UWG A;  3ULQ A;  4ANX A;  4AJW A;  3TG4 A;  2VGX A;  3IBE A;  3B13 A;  3LVQ E;  5FQ6 A;  1IHG A;  4R7L A;  3ML8 A;  3IKO B;  3CVP A;  3QKY A;  4U0Z A;  3AS8 A;  4BT8 A;  2LNI A;  4ANU A;  5EX0 A;  3AS5 A;  3LY9 A;  2XGO A;  3PS6 A;  1NZN A;  4BSX A;  1N52 A;  1ZU2 A;  3R7R A;  4UI9 C;  3VTY A;  2IF4 A;  3RIB A;  4PS3 A;  5CCL A;  4TUU A;  3LEW A;  2X3M A;  3B7T A;  4G25 A;  4KXK B;  2XPI A;  4EZJ A;  1XGW A;  4FLB A;  2VSY A;  4EEC A;  5EDS A;  2LSU A;  2WXO A;  2IOS A;  3ONK A;  4GZD A;  4Y6C A;  5LCW J;  4ABN A;  2E0I A;  3G2S A;  1SZ9 A;  4ME2 A;  3NF1 A;  1S0P A;  3NZU A;  4I1A A;  2NC9 A;  3LCA A;  3SBS A;  2XRY A;  1QNF A;  3GZ2 A;  3T5X A;  1H0A A;  1HH8 A;  1HG5 A;  2AVP A;  2QY7 A;  3FH8 A;  2Y4T A;  3RKV A;  4HVB A;  2WMN A;  4JEH A;  4TV3 A;  5CCM A;  3KAE A;  3QNK A;  4OVU A;  4H7Y A;  1WY6 A;  3D9M A;  3SD5 A;  1JWF A;  1H6K A;  1Y6I A;  2I2O A;  2EQX A;  4HOU A;  2R59 A;  3ASH A;  2FO7 A;  4KVO A;  3TAX A;  4G11 A;  3FUL A;  3I4G A;  3CEQ A;  2J4D A;  5D0O D;  2YNQ A;  4BWR A;  4EQF A;  3U66 A;  4BTB A;  3AU4 A;  3G2T A;  3ZPJ A;  4HOQ A;  3MKQ A;  4BY6 A;  4LEU A;  1MQS A;  2MHK A;  4YND A;  3D9I A;  3D3M A;  3HHM A;  2ION A;  2PL2 A;  2OV8 A;  3SZ7 A;  4A3V A;  4AXH A;  4CT0 A;  5A23 A;  3FFL A;  1HU3 A;  4FLH A;  2VJ8 A;  4L23 A;  2V0P A;  2WPV A;  4FHJ A;  4N3A A;  4DJA A;  5LX8 A;  4JHJ A;  2AXU A;  3IHY A;  4F3V A;  3ESK A;  2A5U A;  4DI3 A;  4GZ6 A;  3L16 A;  4NUR A;  4J8F A;  4RVB A;  2M63 A;  2VSO E;  4C0M A;  2WXJ A;  3PNL B;  3UT4 A;  3PE4 A;  5BNW A;  1OUV A;  4GYY A;  4UWH A;  3MV2 B;  3MZL B;  4L7T A;  3CK7 A;  5AJD A;  5AEN A;  2WM9 A;  1JPL A;  2UY1 A;  3AU5 A;  4JW1 A;  2GRM A;  3KD7 A;  4UQX A;  2DIW A;  4HS2 A;  1DVP A;  4NQ0 A;  4OYS A;  5DBK A;  4DLQ A;  4BFR A;  2WQ6 A;  2LO6 A;  3LY8 A;  3FTW A;  3MCX A;  3T8M A;  4MLP A;  3PNT B;  4Y6W A;  3SI5 A;  3LY7 A;  1B89 A;  4K03 A;  4A3T A;  3OAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...