4Y6WA

Crystal structure of podosopora anserina putative kinesin light chain nearly identical tpr-like repeats
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
211
structure length
211
Chain Sequence
MEHPSRLRSQHELARRYQQNGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQRQEAQELLEQVRAIQAKTQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Unknown function
molecule keywords NaB(AB)3ACb - light chain TPR-like repeats
total genus 97
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4y6wA00
3S7FA 3CVLA 1WM5A 1Y8MA 4Y6WA 3U3WA 2FBNA 2PQNA 4G26A 4GZ5A 2FEZA 2VGXA 4G2VA 3MKRA 5EKQD 4ABNA 4HOUA 2QFCA 3AS4A 4WUYA 4EQFA 5A7DB 2P58C 4GA1A 4N2QA 3GZ2A 4WNEA 1HH8A 5BW8C 2WPVA 4Y6CA 4YVQC 4UI9K 3R9AB 4J8FA 3CVQA 4N39A 2XGSA 5G04J 3RU0A 3NF1A 4UQZA 4WNDA 4U0UA 5CCMA 5KJLA 2JLBA 4NQ0A 4CDRA 4YVOA 3WXXA 3O48A 3ULQA 3QWPA 3MA5A 4GPKA 4RG6A 3GZ1A 1KT1A 3QWVA 5AYWD 3ASDA 4BT8A 4U07A 3UPVA 4GYWA 1B89A 5FZSA 3RO3A 3ZPJA 4APOA 3CV0A 1FCHA 2LSVA 5DIZA 4XI9A 2R5SA 1KLXA 4GA2A 3CKCA 3U4TA 3AS5A 2KCLA 4HOTA 4YNDA 4B94A 2KCKA 4WNFA 5G05J 3HYMB 2C0MA 2MHKA 4GZ3A 4F3VA 1XNFA 3EDTB 5KJKA 1OUVA 5EX3A 3RIBA 2C2LA 3SZ7A 2KC7A 2LNIA 5EX0A 2XCBA 1NA0A 1NZNA 2ONDA 3KD7A 4U0SA 4UI9J 5G05C 5KJMA 3KS2A 5FTPA 1HZ4A 2VSNA 3QOUA 5D0QD 2HYZA 5ARGA 4XIFA 5FZRA 4BTBA 2LSUA 2VGYA 1W3BA 3ASGA 3LYAA 4J8EA 2XGMA 2Q7FA 3ZHEA 4I2ZA 3Q47B 2PQRA 4N3BA 4N3AA 3AS8A 3CEQA 2VYIA 3LY8A 3MEKA 2IF4A 3GYZA 2WQHA 4I9CA 3TAXA 2DBAA 4BWRA 2XEVA 5CCLA 3RO2A 5LCWJ 4HORA 1IHGA 3E4BA 3OXFA 4I17A 4AM9A 3VTYA 4HOSA 3S7JA 4AIFA 2XGOA 4N2SA 2HO1A 4I2WA 3MV3B 3QKYA 3ZFWA 4UI9C 1QQEA 3LY9A 1ELRA 3Q4AB 3Q5MA 4G1TA 4HOQA 2XCCA 2NC9A 3FWVA 3IEGA 3CKBA 1ZU2A 4WNGA 4XI0A 1A17A 4GYOA 1P5QA 3OXLA 5ARFA 2KATA 5FZQA 5HQ8A 1E96B 4I9EA 3CVPA 5G04C 4KBQA 2FF4A 3RJVA 3SF4A 4GZ6A 4W9RA 4UQYA 3ZGQA 4J8DA 4H7XA 1ZBPA 3LKUA 2KCVA 4G23A 4G25A 3K9IA 4O6FA 4N5CA 4GCOA 5FJYA 5JJ6A 3QWWA 2UY1A 2L6JA 3LPZA 3TG5A 2GW1A 3ASHA 3CK8A 3MV2B 4JHRA 5D0OD 4ME2A 5C1DA 2FO7A 2UY1B 3KAEA 3OXGA 4RG9A 3PE4A 4A1SA 4JA7A 1NA3A 1TJCA 2YHCA 1KT0A 2FI7A 1QZ2A 4U04A 3S7DA 4CGWA 3JYSA 2PZIA 5DBKA 2IFUA 4J0UA 3RKVA 2OOEA 4H7YA 4GYYA 3BEEA 3LY7A 3Q49B 3VTXA 2VQ2A 3Q15A 5BT1A 4LEUA 5BNWA 2VSYA 3FP3A 5JJTA 5KJNA 5M72A 2HR2A 3S7BA 3CVNA 1YA0A 4G24A 3ZN3A 3PE3A 4KXKB 2J9QA 3UQ3A 3ZHEB 2BUGA 2PL2A 3TG4A 1ELWA 3GW4A 1WAO1 2VGXB 3QDNA 4I1AA 4U0ZA 5CHEE 1IYGA 4N3CA 3ESKA 5HI7A 2Y4UA 3CK7A 2AVPA 2XPIA 4KYOB 4AY5A 2YQ8A 4CGVA 4JL0A 3TGOA 5FT9A 4GCNA 2UWJG 2V5FA 4NRHB 4BTAA 5LCWC 3FFLA 3N71A 4AY6A 3URZA 1HXIA 2C0LA 3LCAA 1PC2A 3UUXA 5JJ7A 2I6HA 5A6CA 3CK9A 4BT9A 3ASFA 4IN3B 2Y4TA 2E2EA 4JA9A 3PDNA 4UQXA 4GA0A
chains in the Genus database with same CATH superfamily
2P9UG 1OY3D 3GZ2A 3MYVA 3ONKA 2WPVA 4YVQC 2LAIA 4NIKA 5CRVA 4KVMA 1HG2A 3ZYLA 3E32A 5T3RA 4HVBA 1FT2A 2GGFA 3F6QA 5LOZA 3SO8A 3HYMB 2BTDA 2WMOA 5EX0A 2WQ7A 3TWUA 2AWIA 2GROB 3DSWA 4URKA 1SVXA 3WG7E 4L23A 1OXJA 2ETBA 3TJPA 2ETCA 3E4BA 2Y3AA 3ONLA 3VTYA 5AIJA 3ENEA 4I1OB 3UM2A 4BSZB 1E90A 3QARA 3R7QA 3ULYA 2V8SE 3QWWA 2AXVA 3E33A 3PE4A 5EDSA 3PUJA 5JJTA 1X81A 3TWVA 1YA0A 2F8XK 2KXPC 3B13A 4DX6D 4I6EA 4Q69A 2VGXB 1HF8A 1K1BA 4C9BB 4EZLA 3ZYQA 3TWRA 1O1SA 5G2NA 4GTQA 2ZXWE 3G2UA 4PH4B 2PQRA 4JA9A 3PNLB 5KNHD 2V0PA 4WUYA 4U8HA 5BW8C 4A55A 3P2BA 1K1AA 5T8IA 3PH0C 5AQ9A 5CCMA 3QC1A 2P9PG 4I6JA 2QYJA 3FHEA 5BXOA 3UPVA 3FUJA 5JHAA 4A1GA 4GA2A 4L1BA 1O1RA 5KJKA 1NFIE 4ANXA 2ONDA 2WXHA 2H6GA 1Q2ZA 2I2OA 1TN7A 4J8EA 1E8YA 3MJWA 3CVVA 3CVYA 2BF0X 3RO2A 3G2SA 3AJIA 1MX4A 3P1UA 1PAQA 2IOLA 2F37A 1A17A 4O1OA 2KATA 3CVPA 4Q96A 4G23A 2CFZA 3C3RA 2A5EA 3J5QB 4IULA 4N5CA 4GZDA 4AEZC 3IV0A 2GW1A 5J90A 1NA3A 2FI7A 4WAFA 3TWXA 1IHBA 3FTYA 2J09A 3TXMA 2XPIA 3BU8A 3Q9UC 3HXDA 3AG3E 5AARA 4U8VD 1HX8A 5JA4D 4GTRA 4GA0A 3B7RL 2J07A 2PQNA 2J4BA 3UINC 4K03A 3G2TA 3CIAA 4OVUA 3PUKA 4RLYA 4APFA 2WXQA 1TJFA 5FIOA 4EBAA 1Y6IA 1O5MA 4TRQA 5BV0A 2KZTA 4B89A 4PDXA 3V30A 3ZPJA 4OAUC 3CV0A 1FCHA 4HOTA 4AXHA 2DYRE 5EX3A 4CCAA 3IXEA 1H2TC 3KS2A 4G8KA 3ZEFA 4PS8A 1H6OA 5CECB 2L9BA 3I4RB 5T4YA 4JB8P 3R9MA 2WXRA 1TEZA 1TYQG 1IHGA 3Q79A 2HO1A 4I2WA 3AG2E 4TV3A 2J4DA 1FT1A 5FZQA 5HQ8A 2P9NG 2FF4A 1HS6A 3LKUA 3FH5A 3DRAA 4L7TA 5BPPA 1NL4A 4ME2A 3S7DA 3FTXA 3FP3A 4DLOA 2PL2A 2QYUA 1ELWA 1WAO1 1LD7A 1H0AA 5IY5E 3KSQA 1HXIA 2I6HA 2J08A 1EYHA 4LRZA 4G26A 3ZIMA 2OEVA 4UWLA 3D9LA 4M3OA 3QNKA 3UTMA 2LXLA 1HU3A 2YINA 3IHYA 3DSUA 4HLEA 3QWPA 3MA5A 1MX6A 3QWVA 4BT8A 2IONA 4APOA 1YCSB 3ABLE 2H6IA 4OYSA 2C0MA 1SZAA 3JXJA 4DI4A 3C3OA 2KC7A 3KD7A 2FO1E 3JUIA 3APDA 4ACLA 2XEEA 3ZHEA 2EIME 4TUUA 2IF4A 3NOCD 4FU3A 2DBAA 4AM9A 4HS2A 4ANWA 4UQXA 3FWVA 4KMOA 4DUIA 3DEOA 5G04C 3CSTA 1Z5SC 3PS6A 4JC8A 5E75A 3KSLA 1QZ2A 3JYSA 5BT1A 2VQ2A 1SZ9A 1DC2A 3ZYKA 1S70B 3PE3A 4KXKB 3D9HA 3TG4A 4E85A 3QDNA 4CGVA 2AVPA 2LO6A 1K3ZD 5EYPF 3MKQA 3CHMA 4CRWA 5JJ7A 2I9CA 3D3MA 3Q78A 4Y6WA 2FBNA 5KCMA 1IQRA 3DXMG 3FUEA 3JQ1A 4Y6CA 3EHNA 3ZYMA 2GRQB 1WDYA 4DPRA 1TNBA 3SFZA 1BD8A 2OVBA 4QFVA 2XQ0A 5HRYA 3L9TA 5DIZA 3TWSA 4CZ2D 4X8QA 1WG0A 3LEWA 4DRXE 1E8ZA 4ILGA 2KCKA 4HB5A 3BQOA 3KEAA 3V79K 4ANVA 3MKQB 4UI9J 2Y69E 3ABME 2R02A 1V54E 1MQSA 3Q9NC 5KWDA 1W3BA 3U66A 4FULA 2CG3A 2HM8A 3MEKA 4ZFHA 4HI9A 2IU1A 4GTVA 2CFUA 2VTBB 5EKQD 3HRAA 3CKBA 3DSTA 1E96B 4I9EA 4FP7A 5ENNA 2ZGDA 2AXZA 4BETA 3QAQA 5LFAA 2WM9A 4U04A 4HQDA 2KZTB 4J0UA 2CHWA 5H7PA 2H6HA 3FUMA 3B7SA 3SFYA 3ZHEB 4BY6A 5CHEE 1Z3YA 3NZUA 4CEMA 4DX2A 2V5FA 2P9LG 2GRRB 3EU5A 2Y0BG 1JCQA 4KZ0A 2DIWA 4F53A 5AENA 2XPYA 4HOUA 2MOWA 3VLDA 3HVEB 5A7DB 3UT8A 3CVXA 2YNQA 4UI9K 2XGSA 1V55E 1N94A 3O48A 4Q94A 3GZ1A 1KT1A 3IHVA 1B89A 2B0OE 1EPUA 3ABKE 3B7BA 3KEZA 4FJZA 2L0IA 4GZ3A 4F3VA 1XNFA 1OUVA 4K5CA 4GB9A 2WXLA 3EUVA 2XCBA 1UW4B 4ILIA 3IKOB 5CBOA 2Y1LE 4MS6A 3UM3A 2AJAA 1UJJA 5CMYA 3I4GA 4FADA 3Q4AB 3ZFWA 4L2LA 3NB2A 3CHRA 4H7XA 1ZBPA 4I1MA 3QK0A 5AJDA 1SW6A 4O6FA 3V2OA 3AU5A 1TN8A 4K5AB 2GRNB 3IBEA 2YHCA 4UWKA 2WMNA 3UIPC 5M72A 3S7BA 2BUGA 4F6RD 2RFAA 4NQ0A 3UIOC 1BPOA 3MKRA 1SA5A 4XEIG 4P29A 3FU5A 3CVQA 2L0TB 3DBSA 5KJLA 2GRMA 4GTPA 1U3CA 2OCCE 2HE0A 4JHJA 4GYWA 3RO3A 4PUCA 4DLQA 3L22A 2PM7A 3ML8A 3EHRA 3CGHA 4YNDA 4WNFA 3SHFA 4GAAA 3ISMC 4PS7A 2DWZA 1JCSA 3I3NA 4XIFA 4BTBA 1N54A 1Z6TA 3LY8A 4XX5A 3W9FA 3OXFA 4N2SA 3S7JA 2VSOE 3MV3B 3QKYA 1DCQA 4KZCA 2IQCA 4C0EA 3SF4A 4KBQA 1OCZE 3ZGQA 3FEXA 3ZUVB 5KBAA 3MV2B 3FDHA 4JHRA 4A3TA 2JABA 2FO7A 3RRUA 3FUKA 3LY7A 3Q75A 2RFMA 2P9KG 4EZKA 4YDWA 2AW6A 3ESKA 4KYOB 2UWJG 4NRHB 4TXQA 3BUAA 5LP0A 1BI8B 5A6CA 2E2EA 3ZVVA 4ACKA 3CVLA 1WM5A 3I5PA 2QFCA 3AS4A 1KZPA 1UJKA 2IJGX 2CHXA 1A5EA 2MRIA 4B0ZA 3C5RA 4GPKA 3ASDA 4WWPA 3JUEA 2LSVA 4GTMA 3CKCA 2OEWA 3AS5A 5G05J 3MGBA 3MX3A 4LCTA 3FTZA 2P9SG 1E8WA 1WY6A 3FUNA 2F8YA 2ZIRA 1JWGA 4MBGA 3ASGA 1BU9A 2Q7FA 2XRYA 3AS8A 2A4ZA 4I9CA 2XS8A 3L54A 3EIQC 3DEPA 1XGWA 1QQEA 3ZRHA 2NC9A 4WNGA 3SI5A 4JW1A 1QYMA 4GCOA 4KVOA 2L6BA 3LVRE 3FEYA 1KZOA 1RW2A 3AG1E 4G24A 3UQ3A 3CQCB 4D10C 3D9IA 3QJZA 3QB2A 4BFRA 3AG4E 4IYPA 1OWMA 4AP2A 2NXPA 4EQFA 4GA1A 4N2QA 4CDNA 5EIBE 2WXNA 4UQZA 3FU0A 3HIZA 2LAHA 3PZ1A 5AN8A 1KLXA 3UMVA 2H6FA 3FTUA 3DSVA 5A23A 3CLJA 1H2VC 4JPSA 5D66A 3R7RA 4ANUA 3FY4A 3CR3A 4I6GA 3TWQA 2X38A 2AXUA 3PZ4A 5B1BE 4BX9A 5CBNA 3ZXSA 2EQXA 4AOFA 5FINA 4BWRA 4LG6A 4NACA 4AIFA 5CERB 4UI9C 3VLEA 4G1TA 4DK5A 2XPZA 1P5QA 5ENSD 3OAWA 2WXJA 4UWFA 4XZ4A 3UI2A 4J7WA 3TG5A 5D0OD 1TNZA 4FC8A 4RG9A 5AQ7A 3UKUG 1YYHA 1OWNA 3RKVA 4LNBA 5EIDA 1SA4A 1BI7B 2EILE 4HRMB 4J8YA 3TWTA 2DCPA 3D9PA 1IYGA 4N3CA 4F7AA 1BLXB 3LS8A 3EU9A 5LCWC 4BTAA 3FFLA 4A3VA 2C0LA 4JEUA 1LD8A 3DWLG 1UN8A 5DBKA 4ABNA 1JPLA 3D9KA 4HXIA 1HH8A 5KNGA 3ULEG 4J8FA 3NF1A 4L9PA 2WQ6A 2VGEA 4CDRA 3WXXA 4KT6B 4AVXA 2R05A 1FPPA 3EJNA 3D9NA 4HLLA 4JVSA 1QNFA 3RK6A 2R17C 1MYOA 4LUNU 3RIBA 3DXKG 2C2LA 3VLFA 3BG0B 3HG0D 3O4ZA 2FULA 3J5PA 4K5BA 3LDZA 3HXBA 2HYZA 4O60A 2XZTG 4B8CB 3E34A 4I2ZA 4N3AA 5FWQA 3GYZA 1IQUA 4RSYA 4L2YA 3CHPA 1AWCB 1ELRA 1NI1A 1QBQA 5HKPA 2LUHA 4GZ6A 4UQYA 4G11A 2NSZA 5HS0A 2EINE 3LJ3A 2VTBA 4HRLA 4CDMA 2ETAA 3D9MA 2BKGA 3ZN3A 2XHEA 3C98A 4C0MA 3BG1B 5HI7A 2Y4UA 3B7UX 3D9JA 3N71A 2X6IA 3CK9A 4JD2G 1KT0A 3V31A 4OAVB 3EHQA 2VGXA 2OVFA 3PRZA 4F1PA 3NBNB 3MCXA 4JHKA 3L82A 1PY1A 4GMJA 1OWLA 4U0UA 3LJNA 3X2QE 5AYWD 2ZU6B 4U07A 1TR4A 1HFAA 5FZSA 2IO2C 1O1TA 3U4TA 5AQBA 4LNUD 3SZ7A 4GTOA 2QY7A 1N0RA 5ENRD 4HOSA 1NZNA 2A5UA 2V4LA 1OT8A 1EDUA 1HZ4A 3APFA 3UXGA 2WXFA 4V3IA 3CQGB 2I1KA 5B3SE 4U7EB 2VYIA 2ILRA 3HXFA 4CYMD 1E8XA 3T5VA 5ENOD 4HOQA 2XCCA 3IEGA 3CVWA 3JQ0A 4GYOA 4XE0A 4ATZD 4GTTA 2XEHA 5E76A 2WVIA 4EZJA 2GRPB 5JJ6A 4C48B 2RG8A 3ZU7B 3JXIA 3ASHA 4UWGA 2QC9A 1KPSB 5EYLA 4GYYA 3BEEA 5KJNA 1Z3XA 4LEUA 1FVHA 1FVFA 2VSXE 3CK7A 1S0PA 3E37A 4CT0A 1OCCE 4JEHA 5FQ4A 4TUMA 3APCA 2X6FA 4DI3A 3RAUA 3PZDA 3PEVB 3R9AB 4JZYA 4N39A 5G04J 4LERA 3RSEG 1EF1C 4F1SA 2VJ8A 5D2MC 4G8LA 1K8KG 4GMLA 1D8DA 4YDOA 5EILA 1TN6A 5ENQD 1TNYA 4GZCA 3NQPA 4BESA 4M7CA 1H6KA 4E6HA 2EIKE 5KJMA 2I1JA 3QOUA 4U95D 3ESLA 1LF8A 3LYAA 4DX5D 2XGMA 4FA6A 3RRMB 1N9AA 1AP7A 3ZW3A 5CCLA 4HORA 2X6JA 3CHOA 3T8MA 4XI0A 3UT7A 4GPMA 3HXCA 3DPYA 4BSXA 4J8DA 4EECA 4ZHBA 3DPDA 3LPZA 4HI8A 2V5QC 3AU4A 1LTXA 4JA7A 3UM1A 3SBTB 3FU3A 1N95A 3Q49B 2M63A 5BNWA 2PM6A 4N5QA 5CMWA 2HR2A 3T8KA 1UG3A 2J9QA 1N52A 3MZLB 3NAWA 3HVEA 4GCNA 5B1AE 3UUXA 2F0YA 4ATGA 3PNTB 3ASFA 2Y4TA 4MRUA 2P58C 4YDYA 1UN9A 1SQMA 3Q7FA 1IXVA 4WNDA 4HFGA 4MLPA 3FUDA 2P2CP 3SQVA 4BERA 4DX7D 4YDEA 4HBDA 4WWNA 4TXRA 2R5SA 1TNOA 4K0RA 3U64A 2R59A 4B94A 2MHKA 3C3QA 1H2UA 2YHEA 3EHMA 5BXUA 3TL5A 2LNIA 4J8SA 1NA0A 4U0SA 4U8YD 3UT4A 4DJAA 2VSNA 5D0QD 5ARGA 2LSUA 4U63A 3SFXA 2BKKB 3GZSA 3ML9A 3V2XA 2XZDG 4EBAG 2BEDA 3CEQA 4OVVA 3PREA 4RQIA 2J8SD 3HHMA 3FULA 3LY9A 1DNPA 1ZU2A 4FHKA 3E30A 5ENPD 4G25A 4GMRA 3FH8A 1D8EA 2XS1A 3PVLA 5LX8A 5ANRA 3UM0A 3CVNA 3CHQA 4I1AA 5FT9A 4FLHA 3ZXPA 1H6PA 5AJLA 4IRUA 3PDNA 1N4RA 3S7FA 1YMPA 2OV8A 4GZ5A 3AAAC 2CG2A 5ENTD 1OWPA 2MYOA 3TWWA 3L08A 2X6HA 2JLBA 4YVOA 5BUZA 4HRNA 1ZB1A 1HE8A 1DVPA 2WXIA 2KCLA 2B6CA 2EIJE 3FTVA 3S2AA 3EDTB 2WXGA 1ELKA 3SY2A 5FTPA 3HXEA 4J6IA 4QQIA 2PNNA 4NURA 3L6AA 2WQHA 3B95A 3TAXA 1OWOA 3FTWA 2IOSA 1MHQA 2JEKA 3L16A 3G2VA 4BEPA 5ARFA 5ANLA 3T9KA 4AJWA 3DSSA 4W9RA 2KCVA 3CVUA 3K9IA 5C2YA 4XKCA 5AQAA 4BX8A 5C1DA 3C72A 3CK8A 3OXGA 2NYJA 1HO8A 4FHJA 2CHZA 2PZIA 2IFUA 4UWHA 1S63A 3PEUB 2WXPA 3GW4A 1N11A 4AY5A 3TGOA 3OTNA 3TXNA 3G2WA 3URZA 5FQ8A 3SGHA 3U3WA 3HDXA 2FEZA 4PS3A 4WNEA 3CSFA 1JWFA 3B7TA 3RU0A 4DX1A 5JHBA 1JCRA 4RG6A 2KBXA 1VDYA 1MX2A 2R2LA 2DYSE 4XI9A 3NOGD 2LXMA 2E0IA 1OCOE 4MKTA 1JUQA 3FU6A 3LVQE 1X5BA 5FQ6A 5CRUA 1OCRE 4U96D 4B8AA 3SNXA 4CT4A 3ZNGA 1H19A 4GTSA 4ILHB 1N4PA 2X3MA 2XEVA 3CHSA 4LNGA 4WWOA 4I17A 2IY0C 3FUFA 2ZISA 3Q73A 2XRZA 5EN5D 3L17A 1S64A 3RJVA 3UX4A 4FLBA 2RD0A 1U2VG 5FJYA 2RKKA 2UY1A 2DZOA 1E7UA 4EHMA 4EPZA 1TJCA 5CEAA 2OOEA 1UOHA 2VSYA 3FTSA 2QZAA 3T5XA 2WXMA 4U0ZA 3L13A 4JL0A 4RVBA 4XKBA 1TNUA 4FJYA 3U9WA 4BT9A 2DZNA 2KM4A 3Q7AA 3ASNE 3SD5A 1Y8MA 4G2VA 4AV7A 3LXUX 4GU5A 3ULQA 1IKND 4HNAD 3ASOE 3JCKC 3ZKJA 2WXOA 1D9SA 1DCEA 2ZGGA 3EIJA 5FQ7A 5AAOA 1NP7A 4R7LA 2GRLA 5CEDB 1L5JA 3UKRG 2J49A 2R03A 1N4QA 3SBSA 5G05C 3RRNB 4A63B 5J08A 5FZRA 4B93B 2VGYA 3FUIA 5BV1A 4TXPA 3W9GA 2DVWA 2P9IG 1MJ0A 3Q47B 5LCWJ 1GW6A 3PZ2A 2XGOA 1RZ4A 3FH7A 1HG5A 4JXTA 3Q5MA 3PZ3A 3OXLA 2V4HC 2IO3C 5JMND 1N4SA 2L6JA 2WXKA 5G55A 1MZCA 2UY1B 3KAEA 4A1SA 2WB2A 4CGWA 1INZA 4O1PA 4H7YA 3VTXA 1G3NB 3Q15A 2XENA 3D9OA 2X6KA 4I43A 4UUCA 3FUHA 1E7VA 2YQ8A 5ITZF 1N0QA 4AY6A 3LCAA 1PC2A 3DSXA 3NZSA 4Z68A 2IEJA 4IN3B 1U3DA 4LSZE 4N3BA
chains in the Genus database with same CATH topology
4Y6WA 4AP2A 2FBNA 2NXPA 5KCMA 1IQRA 4MRUA 4EQFA 2P58C 4GA1A 4N2QA 3GZ2A 3FUEA 3MYVA 3ONKA 3JQ1A 2WPVA 4Y6CA 4YVQC 3EHNA 4CDNA 3ZYMA 1UN9A 1SQMA 2LAIA 2WXNA 4UQZA 4KVMA 4WNDA 4DPRA 1HG2A 3ZYLA 3SFZA 4HFGA 3FU0A 4MLPA 3FUDA 2OVBA 5T3RA 3HIZA 2LAHA 4QFVA 4WWNA 2XQ0A 5DIZA 4HVBA 2R5SA 1KLXA 2GGFA 3LEWA 1E8ZA 4K0RA 4ILGA 5LOZA 2R59A 2KCKA 3U64A 3UMVA 4B94A 3HYMB 2MHKA 1H2UA 2YHEA 3FTUA 2BTDA 5A23A 3CLJA 1H2VC 3EHMA 2WMOA 4JPSA 3R7RA 4ANUA 3TL5A 5EX0A 2LNIA 4J8SA 1NA0A 4ANVA 4U0SA 3MKQB 2AWIA 4UI9J 3UT4A 4DJAA 4URKA 2WQ7A 3FY4A 3CR3A 2VSNA 5D0QD 4I6GA 1MQSA 5ARGA 2X38A 2LSUA 2AXUA 4U63A 1W3BA 4L23A 4BX9A 3U66A 3TJPA 3ZXSA 2EQXA 4FULA 3GZSA 3ML9A 2CG3A 2HM8A 4EBAG 3CEQA 3MEKA 4AOFA 4OVVA 4BWRA 2IU1A 3PREA 3E4BA 2Y3AA 3ONLA 3VTYA 4NACA 4AIFA 2CFUA 3HHMA 4UI9C 3VLEA 2VTBB 3FULA 3LY9A 4G1TA 5EKQD 4DK5A 5AIJA 3ENEA 2XPZA 3CKBA 1DNPA 1ZU2A 4I1OB 4FHKA 1P5QA 1E96B 4I9EA 4FP7A 3OAWA 5ENNA 1E90A 2WXJA 3QARA 4G25A 4UWFA 3R7QA 4XZ4A 2AXZA 2V8SE 3QWWA 3TG5A 2AXVA 3QAQA 3FH8A 5D0OD 5LFAA 4FC8A 4RG9A 2WM9A 3PE4A 3PVLA 4U04A 5LX8A 1OWNA 2KZTB 4J0UA 3RKVA 5EDSA 2CHWA 3PUJA 5ANRA 5JJTA 3FUMA 3CVNA 1YA0A 3B7SA 2DCPA 3D9PA 3B13A 3ZHEB 4I6EA 3CHQA 4BY6A 4Q69A 2VGXB 1HF8A 4I1AA 5CHEE 1IYGA 1Z3YA 3NZUA 4CEMA 4N3CA 4F7AA 3LS8A 4C9BB 4EZLA 5FT9A 3ZYQA 2V5FA 4FLHA 5G2NA 4BTAA 3FFLA 5LCWC 4A3VA 3G2UA 2C0LA 4JEUA 5AJLA 4PH4B 2PQRA 4IRUA 1UN8A 3PDNA 4JA9A 5DBKA 4KZ0A 2DIWA 3PNLB 2OV8A 3S7FA 4F53A 5AENA 4GZ5A 2V0PA 2XPYA 4ABNA 1JPLA 4HOUA 2MOWA 4WUYA 3VLDA 3HVEB 5A7DB 3D9KA 4U8HA 4HXIA 1HH8A 5BW8C 3UT8A 2CG2A 3CVXA 1OWPA 2YNQA 4UI9K 4J8FA 4A55A 3P2BA 2XGSA 3L08A 3NF1A 5T8IA 2X6HA 3PH0C 2WQ6A 5CCMA 3QC1A 2JLBA 4CDRA 4I6JA 4YVOA 3WXXA 3O48A 4Q94A 5BUZA 3FHEA 3GZ1A 1KT1A 4KT6B 3UPVA 4AVXA 3IHVA 3FUJA 5JHAA 1B89A 4A1GA 3EJNA 1HE8A 1DVPA 2WXIA 3D9NA 4JVSA 1QNFA 3RK6A 4GA2A 1EPUA 4L1BA 2KCLA 2R17C 3FTVA 3KEZA 3S2AA 4FJZA 2L0IA 4GZ3A 5KJKA 4F3VA 1XNFA 3EDTB 1OUVA 2WXGA 4GB9A 4LUNU 3RIBA 2C2LA 2WXLA 3VLFA 4ANXA 3BG0B 1ELKA 2XCBA 2ONDA 3O4ZA 2FULA 1UW4B 2WXHA 5FTPA 4ILIA 3IKOB 4J6IA 3LDZA 2HYZA 2I2OA 4MS6A 4B8CB 4J8EA 1E8YA 3MJWA 4NURA 3CVVA 3CVYA 4I2ZA 4N3AA 1UJJA 5CMYA 5FWQA 2BF0X 3L6AA 3GYZA 2WQHA 3TAXA 1OWOA 3FTWA 3RO2A 3I4GA 1IQUA 2IOSA 3G2SA 4FADA 4RSYA 4L2YA 1MHQA 3CHPA 2JEKA 3L16A 3P1UA 1ELRA 3Q4AB 3ZFWA 3G2VA 1PAQA 5ARFA 5ANLA 2IOLA 1A17A 2KATA 4AJWA 4L2LA 3CVPA 4GZ6A 4W9RA 4UQYA 3CHRA 4Q96A 4H7XA 1ZBPA 4G23A 2KCVA 2CFZA 4G11A 4I1MA 3CVUA 2NSZA 3K9IA 3QK0A 4IULA 4O6FA 4N5CA 5AJDA 5C2YA 4GZDA 4XKCA 4AEZC 4BX8A 3IV0A 3AU5A 2GW1A 3CK8A 5C1DA 5J90A 3LJ3A 3OXGA 2VTBA 1NA3A 3IBEA 2YHCA 2FI7A 1HO8A 4FHJA 2CHZA 2PZIA 4UWKA 2IFUA 2WMNA 4CDMA 3D9MA 4UWHA 4WAFA 3PEUB 5M72A 3S7BA 3ZN3A 2XHEA 2WXPA 3C98A 2BUGA 3FTYA 3GW4A 4C0MA 3BG1B 2J09A 5HI7A 3TXMA 2Y4UA 4AY5A 2XPIA 3TGOA 3B7UX 3OTNA 3TXNA 4IN3B 3G2WA 3D9JA 3N71A 3URZA 2X6IA 3CK9A 1HX8A 5FQ8A 1KT0A 4NQ0A 4GA0A 3B7RL 3SGHA 3U3WA 2J07A 2PQNA 3HDXA 2FEZA 2VGXA 1BPOA 3MKRA 2J4BA 2OVFA 3PRZA 4K03A 4PS3A 4WNEA 3G2TA 3CIAA 4OVUA 4P29A 3PUKA 3CSFA 3FU5A 3CVQA 4APFA 2WXQA 3MCXA 1JWFA 3B7TA 1PY1A 4JHKA 3RU0A 4GMJA 1OWLA 2L0TB 1TJFA 3DBSA 4U0UA 4EBAA 5JHBA 5KJLA 1Y6IA 2GRMA 4RG6A 4TRQA 5AYWD 5BV0A 2KZTA 2ZU6B 1U3CA 4U07A 1HFAA 4PDXA 4B89A 4JHJA 1VDYA 4GYWA 5FZSA 3RO3A 3ZPJA 4PUCA 3CV0A 4DLQA 1FCHA 4XI9A 3L22A 2PM7A 3ML8A 3U4TA 3CGHA 4HOTA 4YNDA 4WNFA 4AXHA 2E0IA 4MKTA 3SHFA 1JUQA 5EX3A 4GAAA 4CCAA 4PS7A 3FU6A 3SZ7A 2QY7A 1H2TC 3LVQE 4HOSA 1NZNA 2A5UA 2V4LA 1X5BA 3KS2A 5FQ6A 1EDUA 3ZEFA 4PS8A 1HZ4A 3I3NA 3APFA 4XIFA 4BTBA 4B8AA 1N54A 3SNXA 4CT4A 2WXFA 4V3IA 2L9BA 3CQGB 1H19A 3I4RB 2I1KA 5T4YA 4ILHB 1Z6TA 3LY8A 2VYIA 2WXRA 4XX5A 1TEZA 2ILRA 2X3MA 2XEVA 3CHSA 4WWOA 1IHGA 3OXFA 4I17A 4N2SA 3S7JA 2VSOE 1E8XA 2HO1A 4I2WA 3MV3B 3QKYA 3FUFA 4KZCA 3T5VA 4TV3A 4HOQA 2IQCA 4C0EA 2XRZA 2XCCA 3IEGA 2J4DA 3L17A 3JQ0A 4GYOA 3CVWA 5FZQA 5HQ8A 4XE0A 3SF4A 3RJVA 4KBQA 2FF4A 3UX4A 1HS6A 3FEXA 4FLBA 3ZGQA 3LKUA 3FH5A 2RD0A 5E76A 2WVIA 4EZJA 5FJYA 4L7TA 5JJ6A 2UY1A 5BPPA 2RG8A 3ASHA 3MV2B 3FDHA 4JHRA 1E7UA 4ME2A 4UWGA 2FO7A 4A3TA 4EPZA 1TJCA 3S7DA 3FTXA 3RRUA 2OOEA 4GYYA 3FUKA 3BEEA 3LY7A 5KJNA 1Z3XA 4LEUA 2VSYA 3FP3A 1FVHA 1FVFA 3FTSA 4EZKA 4DLOA 2PL2A 1ELWA 1WAO1 2VSXE 3T5XA 2WXMA 4U0ZA 2AW6A 3ESKA 3CK7A 4KYOB 3L13A 1H0AA 1S0PA 4JL0A 2UWJG 4NRHB 4RVBA 4XKBA 4CT0A 5LP0A 1HXIA 4FJYA 3U9WA 2I6HA 2J08A 4JEHA 5FQ4A 4BT9A 5A6CA 2KM4A 2E2EA 3ZVVA 4ACKA 3CVLA 1EYHA 1WM5A 1Y8MA 3APCA 4LRZA 4G26A 3SD5A 3ZIMA 2X6FA 4G2VA 3I5PA 4DI3A 4UWLA 2QFCA 3AS4A 3D9LA 4M3OA 4AV7A 3LXUX 3PZDA 3QNKA 3PEVB 3R9AB 1UJKA 4GU5A 2IJGX 4JZYA 4N39A 5G04J 1HU3A 2YINA 4LERA 2CHXA 3IHYA 4HLEA 2MRIA 3ULQA 1EF1C 3QWPA 3MA5A 4B0ZA 4F1SA 4GPKA 3QWVA 2VJ8A 4BT8A 3ASDA 2IONA 3JCKC 4WWPA 4GMLA 2WXOA 4APOA 3EIJA 5FQ7A 2LSVA 1NP7A 4R7LA 3CKCA 3AS5A 5G05J 4OYSA 2GRLA 2C0MA 1SZAA 3MGBA 1L5JA 3MX3A 3NQPA 4GZCA 4DI4A 2J49A 4LCTA 1H6KA 3FTZA 3SBSA 2KC7A 4E6HA 1E8WA 3KD7A 5KJMA 5G05C 1WY6A 3FUNA 2I1JA 3RRNB 5J08A 3JUIA 1JWGA 3QOUA 3ESLA 5FZRA 1LF8A 3APDA 4ACLA 2VGYA 3ASGA 3LYAA 2XGMA 4FA6A 3FUIA 5BV1A 2Q7FA 3ZHEA 2XRYA 4TUUA 3RRMB 3Q47B 3AS8A 2A4ZA 2IF4A 3ZW3A 4FU3A 4I9CA 2DBAA 5CCLA 5LCWJ 4HORA 4AM9A 1GW6A 3L54A 3EIQC 4HS2A 2XGOA 2X6JA 3FH7A 1HG5A 1XGWA 4ANWA 4JXTA 3CHOA 3T8MA 1QQEA 3Q5MA 4UQXA 3ZRHA 4XI0A 3FWVA 2NC9A 4KMOA 4WNGA 3UT7A 3OXLA 5G04C 3SI5A 4BSXA 3CSTA 4JW1A 4J8DA 4EECA 3DPDA 4GCOA 4KVOA 3PS6A 2L6JA 2WXKA 3LPZA 3LVRE 4JC8A 5G55A 2UY1B 3AU4A 3KAEA 5E75A 4A1SA 4JA7A 3FEYA 2WB2A 4CGWA 1QZ2A 3SBTB 1INZA 3JYSA 3FU3A 4H7YA 3VTXA 3Q49B 2M63A 2VQ2A 1SZ9A 3Q15A 5BT1A 5BNWA 2PM6A 3ZYKA 5CMWA 3D9OA 2HR2A 2X6KA 4G24A 3PE3A 4KXKB 1UG3A 2J9QA 3UQ3A 1N52A 3MZLB 4I43A 3CQCB 3TG4A 4E85A 3QDNA 4CGVA 3FUHA 3HVEA 2AVPA 4D10C 1E7VA 2LO6A 2YQ8A 3D9IA 4GCNA 4AY6A 3QJZA 3QB2A 3MKQA 3CHMA 3LCAA 4BFRA 1PC2A 3NZSA 3UUXA 4IYPA 4ATGA 2I9CA 3PNTB 4CRWA 5JJ7A 3ASFA 1OWMA 2Y4TA 1U3DA 3D3MA 4N3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7F A;  3CVL A;  1WM5 A;  1Y8M A;  4Y6W A;  3U3W A;  2FBN A;  2PQN A;  4G26 A;  4GZ5 A;  2FEZ A;  2VGX A;  4G2V A;  3MKR A;  5EKQ D;  4ABN A;  4HOU A;  2QFC A;  3AS4 A;  4WUY A;  4EQF A;  5A7D B;  2P58 C;  4GA1 A;  4N2Q A;  3GZ2 A;  4WNE A;  1HH8 A;  5BW8 C;  2WPV A;  4Y6C A;  4YVQ C;  4UI9 K;  3R9A B;  4J8F A;  3CVQ A;  4N39 A;  2XGS A;  5G04 J;  3RU0 A;  3NF1 A;  4UQZ A;  4WND A;  4U0U A;  5CCM A;  5KJL A;  2JLB A;  4NQ0 A;  4CDR A;  4YVO A;  3WXX A;  3O48 A;  3ULQ A;  3QWP A;  3MA5 A;  4GPK A;  4RG6 A;  3GZ1 A;  1KT1 A;  3QWV A;  5AYW D;  3ASD A;  4BT8 A;  4U07 A;  3UPV A;  4GYW A;  1B89 A;  5FZS A;  3RO3 A;  3ZPJ A;  4APO A;  3CV0 A;  1FCH A;  2LSV A;  5DIZ A;  4XI9 A;  2R5S A;  1KLX A;  4GA2 A;  3CKC A;  3U4T A;  3AS5 A;  2KCL A;  4HOT A;  4YND A;  4B94 A;  2KCK A;  4WNF A;  5G05 J;  3HYM B;  2C0M A;  2MHK A;  4GZ3 A;  4F3V A;  1XNF A;  3EDT B;  5KJK A;  1OUV A;  5EX3 A;  3RIB A;  2C2L A;  3SZ7 A;  2KC7 A;  2LNI A;  5EX0 A;  2XCB A;  1NA0 A;  1NZN A;  2OND A;  3KD7 A;  4U0S A;  4UI9 J;  5G05 C;  5KJM A;  3KS2 A;  5FTP A;  1HZ4 A;  2VSN A;  3QOU A;  5D0Q D;  2HYZ A;  5ARG A;  4XIF A;  5FZR A;  4BTB A;  2LSU A;  2VGY A;  1W3B A;  3ASG A;  3LYA A;  4J8E A;  2XGM A;  2Q7F A;  3ZHE A;  4I2Z A;  3Q47 B;  2PQR A;  4N3B A;  4N3A A;  3AS8 A;  3CEQ A;  2VYI A;  3LY8 A;  3MEK A;  2IF4 A;  3GYZ A;  2WQH A;  4I9C A;  3TAX A;  2DBA A;  4BWR A;  2XEV A;  5CCL A;  3RO2 A;  5LCW J;  4HOR A;  1IHG A;  3E4B A;  3OXF A;  4I17 A;  4AM9 A;  3VTY A;  4HOS A;  3S7J A;  4AIF A;  2XGO A;  4N2S A;  2HO1 A;  4I2W A;  3MV3 B;  3QKY A;  3ZFW A;  4UI9 C;  1QQE A;  3LY9 A;  1ELR A;  3Q4A B;  3Q5M A;  4G1T A;  4HOQ A;  2XCC A;  2NC9 A;  3FWV A;  3IEG A;  3CKB A;  1ZU2 A;  4WNG A;  4XI0 A;  1A17 A;  4GYO A;  1P5Q A;  3OXL A;  5ARF A;  2KAT A;  5FZQ A;  5HQ8 A;  1E96 B;  4I9E A;  3CVP A;  5G04 C;  4KBQ A;  2FF4 A;  3RJV A;  3SF4 A;  4GZ6 A;  4W9R A;  4UQY A;  3ZGQ A;  4J8D A;  4H7X A;  1ZBP A;  3LKU A;  2KCV A;  4G23 A;  4G25 A;  3K9I A;  4O6F A;  4N5C A;  4GCO A;  5FJY A;  5JJ6 A;  3QWW A;  2UY1 A;  2L6J A;  3LPZ A;  3TG5 A;  2GW1 A;  3ASH A;  3CK8 A;  3MV2 B;  4JHR A;  5D0O D;  4ME2 A;  5C1D A;  2FO7 A;  2UY1 B;  3KAE A;  3OXG A;  4RG9 A;  3PE4 A;  4A1S A;  4JA7 A;  1NA3 A;  1TJC A;  2YHC A;  1KT0 A;  2FI7 A;  1QZ2 A;  4U04 A;  3S7D A;  4CGW A;  3JYS A;  2PZI A;  5DBK A;  2IFU A;  4J0U A;  3RKV A;  2OOE A;  4H7Y A;  4GYY A;  3BEE A;  3LY7 A;  3Q49 B;  3VTX A;  2VQ2 A;  3Q15 A;  5BT1 A;  4LEU A;  5BNW A;  2VSY A;  3FP3 A;  5JJT A;  5KJN A;  5M72 A;  2HR2 A;  3S7B A;  3CVN A;  1YA0 A;  4G24 A;  3ZN3 A;  3PE3 A;  4KXK B;  2J9Q A;  3UQ3 A;  3ZHE B;  2BUG A;  2PL2 A;  3TG4 A;  1ELW A;  3GW4 A;  1WAO 1;  2VGX B;  3QDN A;  4I1A A;  4U0Z A;  5CHE E;  1IYG A;  4N3C A;  3ESK A;  5HI7 A;  2Y4U A;  3CK7 A;  2AVP A;  2XPI A;  4KYO B;  4AY5 A;  2YQ8 A;  4CGV A;  4JL0 A;  3TGO A;  5FT9 A;  4GCN A;  2UWJ G;  2V5F A;  4NRH B;  4BTA A;  5LCW C;  3FFL A;  3N71 A;  4AY6 A;  3URZ A;  1HXI A;  2C0L A;  3LCA A;  1PC2 A;  3UUX A;  5JJ7 A;  2I6H A;  5A6C A;  3CK9 A;  4BT9 A;  3ASF A;  4IN3 B;  2Y4T A;  2E2E A;  4JA9 A;  3PDN A;  4UQX A;  4GA0 A; 
#chains in the Genus database with same CATH topology
 2P9U G;  1OY3 D;  3GZ2 A;  3MYV A;  3ONK A;  2WPV A;  4YVQ C;  2LAI A;  4NIK A;  5CRV A;  4KVM A;  1HG2 A;  3ZYL A;  3E32 A;  5T3R A;  4HVB A;  1FT2 A;  2GGF A;  3F6Q A;  5LOZ A;  3SO8 A;  3HYM B;  2BTD A;  2WMO A;  5EX0 A;  2WQ7 A;  3TWU A;  2AWI A;  2GRO B;  3DSW A;  4URK A;  1SVX A;  3WG7 E;  4L23 A;  1OXJ A;  2ETB A;  3TJP A;  2ETC A;  3E4B A;  2Y3A A;  3ONL A;  3VTY A;  5AIJ A;  3ENE A;  4I1O B;  3UM2 A;  4BSZ B;  1E90 A;  3QAR A;  3R7Q A;  3ULY A;  2V8S E;  3QWW A;  2AXV A;  3E33 A;  3PE4 A;  5EDS A;  3PUJ A;  5JJT A;  1X81 A;  3TWV A;  1YA0 A;  2F8X K;  2KXP C;  3B13 A;  4DX6 D;  4I6E A;  4Q69 A;  2VGX B;  1HF8 A;  1K1B A;  4C9B B;  4EZL A;  3ZYQ A;  3TWR A;  1O1S A;  5G2N A;  4GTQ A;  2ZXW E;  3G2U A;  4PH4 B;  2PQR A;  4JA9 A;  3PNL B;  5KNH D;  2V0P A;  4WUY A;  4U8H A;  5BW8 C;  4A55 A;  3P2B A;  1K1A A;  5T8I A;  3PH0 C;  5AQ9 A;  5CCM A;  3QC1 A;  2P9P G;  4I6J A;  2QYJ A;  3FHE A;  5BXO A;  3UPV A;  3FUJ A;  5JHA A;  4A1G A;  4GA2 A;  4L1B A;  1O1R A;  5KJK A;  1NFI E;  4ANX A;  2OND A;  2WXH A;  2H6G A;  1Q2Z A;  2I2O A;  1TN7 A;  4J8E A;  1E8Y A;  3MJW A;  3CVV A;  3CVY A;  2BF0 X;  3RO2 A;  3G2S A;  3AJI A;  1MX4 A;  3P1U A;  1PAQ A;  2IOL A;  2F37 A;  1A17 A;  4O1O A;  2KAT A;  3CVP A;  4Q96 A;  4G23 A;  2CFZ A;  3C3R A;  2A5E A;  3J5Q B;  4IUL A;  4N5C A;  4GZD A;  4AEZ C;  3IV0 A;  2GW1 A;  5J90 A;  1NA3 A;  2FI7 A;  4WAF A;  3TWX A;  1IHB A;  3FTY A;  2J09 A;  3TXM A;  2XPI A;  3BU8 A;  3Q9U C;  3HXD A;  3AG3 E;  5AAR A;  4U8V D;  1HX8 A;  5JA4 D;  4GTR A;  4GA0 A;  3B7R L;  2J07 A;  2PQN A;  2J4B A;  3UIN C;  4K03 A;  3G2T A;  3CIA A;  4OVU A;  3PUK A;  4RLY A;  4APF A;  2WXQ A;  1TJF A;  5FIO A;  4EBA A;  1Y6I A;  1O5M A;  4TRQ A;  5BV0 A;  2KZT A;  4B89 A;  4PDX A;  3V30 A;  3ZPJ A;  4OAU C;  3CV0 A;  1FCH A;  4HOT A;  4AXH A;  2DYR E;  5EX3 A;  4CCA A;  3IXE A;  1H2T C;  3KS2 A;  4G8K A;  3ZEF A;  4PS8 A;  1H6O A;  5CEC B;  2L9B A;  3I4R B;  5T4Y A;  4JB8 P;  3R9M A;  2WXR A;  1TEZ A;  1TYQ G;  1IHG A;  3Q79 A;  2HO1 A;  4I2W A;  3AG2 E;  4TV3 A;  2J4D A;  1FT1 A;  5FZQ A;  5HQ8 A;  2P9N G;  2FF4 A;  1HS6 A;  3LKU A;  3FH5 A;  3DRA A;  4L7T A;  5BPP A;  1NL4 A;  4ME2 A;  3S7D A;  3FTX A;  3FP3 A;  4DLO A;  2PL2 A;  2QYU A;  1ELW A;  1WAO 1;  1LD7 A;  1H0A A;  5IY5 E;  3KSQ A;  1HXI A;  2I6H A;  2J08 A;  1EYH A;  4LRZ A;  4G26 A;  3ZIM A;  2OEV A;  4UWL A;  3D9L A;  4M3O A;  3QNK A;  3UTM A;  2LXL A;  1HU3 A;  2YIN A;  3IHY A;  3DSU A;  4HLE A;  3QWP A;  3MA5 A;  1MX6 A;  3QWV A;  4BT8 A;  2ION A;  4APO A;  1YCS B;  3ABL E;  2H6I A;  4OYS A;  2C0M A;  1SZA A;  3JXJ A;  4DI4 A;  3C3O A;  2KC7 A;  3KD7 A;  2FO1 E;  3JUI A;  3APD A;  4ACL A;  2XEE A;  3ZHE A;  2EIM E;  4TUU A;  2IF4 A;  3NOC D;  4FU3 A;  2DBA A;  4AM9 A;  4HS2 A;  4ANW A;  4UQX A;  3FWV A;  4KMO A;  4DUI A;  3DEO A;  5G04 C;  3CST A;  1Z5S C;  3PS6 A;  4JC8 A;  5E75 A;  3KSL A;  1QZ2 A;  3JYS A;  5BT1 A;  2VQ2 A;  1SZ9 A;  1DC2 A;  3ZYK A;  1S70 B;  3PE3 A;  4KXK B;  3D9H A;  3TG4 A;  4E85 A;  3QDN A;  4CGV A;  2AVP A;  2LO6 A;  1K3Z D;  5EYP F;  3MKQ A;  3CHM A;  4CRW A;  5JJ7 A;  2I9C A;  3D3M A;  3Q78 A;  4Y6W A;  2FBN A;  5KCM A;  1IQR A;  3DXM G;  3FUE A;  3JQ1 A;  4Y6C A;  3EHN A;  3ZYM A;  2GRQ B;  1WDY A;  4DPR A;  1TNB A;  3SFZ A;  1BD8 A;  2OVB A;  4QFV A;  2XQ0 A;  5HRY A;  3L9T A;  5DIZ A;  3TWS A;  4CZ2 D;  4X8Q A;  1WG0 A;  3LEW A;  4DRX E;  1E8Z A;  4ILG A;  2KCK A;  4HB5 A;  3BQO A;  3KEA A;  3V79 K;  4ANV A;  3MKQ B;  4UI9 J;  2Y69 E;  3ABM E;  2R02 A;  1V54 E;  1MQS A;  3Q9N C;  5KWD A;  1W3B A;  3U66 A;  4FUL A;  2CG3 A;  2HM8 A;  3MEK A;  4ZFH A;  4HI9 A;  2IU1 A;  4GTV A;  2CFU A;  2VTB B;  5EKQ D;  3HRA A;  3CKB A;  3DST A;  1E96 B;  4I9E A;  4FP7 A;  5ENN A;  2ZGD A;  2AXZ A;  4BET A;  3QAQ A;  5LFA A;  2WM9 A;  4U04 A;  4HQD A;  2KZT B;  4J0U A;  2CHW A;  5H7P A;  2H6H A;  3FUM A;  3B7S A;  3SFY A;  3ZHE B;  4BY6 A;  5CHE E;  1Z3Y A;  3NZU A;  4CEM A;  4DX2 A;  2V5F A;  2P9L G;  2GRR B;  3EU5 A;  2Y0B G;  1JCQ A;  4KZ0 A;  2DIW A;  4F53 A;  5AEN A;  2XPY A;  4HOU A;  2MOW A;  3VLD A;  3HVE B;  5A7D B;  3UT8 A;  3CVX A;  2YNQ A;  4UI9 K;  2XGS A;  1V55 E;  1N94 A;  3O48 A;  4Q94 A;  3GZ1 A;  1KT1 A;  3IHV A;  1B89 A;  2B0O E;  1EPU A;  3ABK E;  3B7B A;  3KEZ A;  4FJZ A;  2L0I A;  4GZ3 A;  4F3V A;  1XNF A;  1OUV A;  4K5C A;  4GB9 A;  2WXL A;  3EUV A;  2XCB A;  1UW4 B;  4ILI A;  3IKO B;  5CBO A;  2Y1L E;  4MS6 A;  3UM3 A;  2AJA A;  1UJJ A;  5CMY A;  3I4G A;  4FAD A;  3Q4A B;  3ZFW A;  4L2L A;  3NB2 A;  3CHR A;  4H7X A;  1ZBP A;  4I1M A;  3QK0 A;  5AJD A;  1SW6 A;  4O6F A;  3V2O A;  3AU5 A;  1TN8 A;  4K5A B;  2GRN B;  3IBE A;  2YHC A;  4UWK A;  2WMN A;  3UIP C;  5M72 A;  3S7B A;  2BUG A;  4F6R D;  2RFA A;  4NQ0 A;  3UIO C;  1BPO A;  3MKR A;  1SA5 A;  4XEI G;  4P29 A;  3FU5 A;  3CVQ A;  2L0T B;  3DBS A;  5KJL A;  2GRM A;  4GTP A;  1U3C A;  2OCC E;  2HE0 A;  4JHJ A;  4GYW A;  3RO3 A;  4PUC A;  4DLQ A;  3L22 A;  2PM7 A;  3ML8 A;  3EHR A;  3CGH A;  4YND A;  4WNF A;  3SHF A;  4GAA A;  3ISM C;  4PS7 A;  2DWZ A;  1JCS A;  3I3N A;  4XIF A;  4BTB A;  1N54 A;  1Z6T A;  3LY8 A;  4XX5 A;  3W9F A;  3OXF A;  4N2S A;  3S7J A;  2VSO E;  3MV3 B;  3QKY A;  1DCQ A;  4KZC A;  2IQC A;  4C0E A;  3SF4 A;  4KBQ A;  1OCZ E;  3ZGQ A;  3FEX A;  3ZUV B;  5KBA A;  3MV2 B;  3FDH A;  4JHR A;  4A3T A;  2JAB A;  2FO7 A;  3RRU A;  3FUK A;  3LY7 A;  3Q75 A;  2RFM A;  2P9K G;  4EZK A;  4YDW A;  2AW6 A;  3ESK A;  4KYO B;  2UWJ G;  4NRH B;  4TXQ A;  3BUA A;  5LP0 A;  1BI8 B;  5A6C A;  2E2E A;  3ZVV A;  4ACK A;  3CVL A;  1WM5 A;  3I5P A;  2QFC A;  3AS4 A;  1KZP A;  1UJK A;  2IJG X;  2CHX A;  1A5E A;  2MRI A;  4B0Z A;  3C5R A;  4GPK A;  3ASD A;  4WWP A;  3JUE A;  2LSV A;  4GTM A;  3CKC A;  2OEW A;  3AS5 A;  5G05 J;  3MGB A;  3MX3 A;  4LCT A;  3FTZ A;  2P9S G;  1E8W A;  1WY6 A;  3FUN A;  2F8Y A;  2ZIR A;  1JWG A;  4MBG A;  3ASG A;  1BU9 A;  2Q7F A;  2XRY A;  3AS8 A;  2A4Z A;  4I9C A;  2XS8 A;  3L54 A;  3EIQ C;  3DEP A;  1XGW A;  1QQE A;  3ZRH A;  2NC9 A;  4WNG A;  3SI5 A;  4JW1 A;  1QYM A;  4GCO A;  4KVO A;  2L6B A;  3LVR E;  3FEY A;  1KZO A;  1RW2 A;  3AG1 E;  4G24 A;  3UQ3 A;  3CQC B;  4D10 C;  3D9I A;  3QJZ A;  3QB2 A;  4BFR A;  3AG4 E;  4IYP A;  1OWM A;  4AP2 A;  2NXP A;  4EQF A;  4GA1 A;  4N2Q A;  4CDN A;  5EIB E;  2WXN A;  4UQZ A;  3FU0 A;  3HIZ A;  2LAH A;  3PZ1 A;  5AN8 A;  1KLX A;  3UMV A;  2H6F A;  3FTU A;  3DSV A;  5A23 A;  3CLJ A;  1H2V C;  4JPS A;  5D66 A;  3R7R A;  4ANU A;  3FY4 A;  3CR3 A;  4I6G A;  3TWQ A;  2X38 A;  2AXU A;  3PZ4 A;  5B1B E;  4BX9 A;  5CBN A;  3ZXS A;  2EQX A;  4AOF A;  5FIN A;  4BWR A;  4LG6 A;  4NAC A;  4AIF A;  5CER B;  4UI9 C;  3VLE A;  4G1T A;  4DK5 A;  2XPZ A;  1P5Q A;  5ENS D;  3OAW A;  2WXJ A;  4UWF A;  4XZ4 A;  3UI2 A;  4J7W A;  3TG5 A;  5D0O D;  1TNZ A;  4FC8 A;  4RG9 A;  5AQ7 A;  3UKU G;  1YYH A;  1OWN A;  3RKV A;  4LNB A;  5EID A;  1SA4 A;  1BI7 B;  2EIL E;  4HRM B;  4J8Y A;  3TWT A;  2DCP A;  3D9P A;  1IYG A;  4N3C A;  4F7A A;  1BLX B;  3LS8 A;  3EU9 A;  5LCW C;  4BTA A;  3FFL A;  4A3V A;  2C0L A;  4JEU A;  1LD8 A;  3DWL G;  1UN8 A;  5DBK A;  4ABN A;  1JPL A;  3D9K A;  4HXI A;  1HH8 A;  5KNG A;  3ULE G;  4J8F A;  3NF1 A;  4L9P A;  2WQ6 A;  2VGE A;  4CDR A;  3WXX A;  4KT6 B;  4AVX A;  2R05 A;  1FPP A;  3EJN A;  3D9N A;  4HLL A;  4JVS A;  1QNF A;  3RK6 A;  2R17 C;  1MYO A;  4LUN U;  3RIB A;  3DXK G;  2C2L A;  3VLF A;  3BG0 B;  3HG0 D;  3O4Z A;  2FUL A;  3J5P A;  4K5B A;  3LDZ A;  3HXB A;  2HYZ A;  4O60 A;  2XZT G;  4B8C B;  3E34 A;  4I2Z A;  4N3A A;  5FWQ A;  3GYZ A;  1IQU A;  4RSY A;  4L2Y A;  3CHP A;  1AWC B;  1ELR A;  1NI1 A;  1QBQ A;  5HKP A;  2LUH A;  4GZ6 A;  4UQY A;  4G11 A;  2NSZ A;  5HS0 A;  2EIN E;  3LJ3 A;  2VTB A;  4HRL A;  4CDM A;  2ETA A;  3D9M A;  2BKG A;  3ZN3 A;  2XHE A;  3C98 A;  4C0M A;  3BG1 B;  5HI7 A;  2Y4U A;  3B7U X;  3D9J A;  3N71 A;  2X6I A;  3CK9 A;  4JD2 G;  1KT0 A;  3V31 A;  4OAV B;  3EHQ A;  2VGX A;  2OVF A;  3PRZ A;  4F1P A;  3NBN B;  3MCX A;  4JHK A;  3L82 A;  1PY1 A;  4GMJ A;  1OWL A;  4U0U A;  3LJN A;  3X2Q E;  5AYW D;  2ZU6 B;  4U07 A;  1TR4 A;  1HFA A;  5FZS A;  2IO2 C;  1O1T A;  3U4T A;  5AQB A;  4LNU D;  3SZ7 A;  4GTO A;  2QY7 A;  1N0R A;  5ENR D;  4HOS A;  1NZN A;  2A5U A;  2V4L A;  1OT8 A;  1EDU A;  1HZ4 A;  3APF A;  3UXG A;  2WXF A;  4V3I A;  3CQG B;  2I1K A;  5B3S E;  4U7E B;  2VYI A;  2ILR A;  3HXF A;  4CYM D;  1E8X A;  3T5V A;  5ENO D;  4HOQ A;  2XCC A;  3IEG A;  3CVW A;  3JQ0 A;  4GYO A;  4XE0 A;  4ATZ D;  4GTT A;  2XEH A;  5E76 A;  2WVI A;  4EZJ A;  2GRP B;  5JJ6 A;  4C48 B;  2RG8 A;  3ZU7 B;  3JXI A;  3ASH A;  4UWG A;  2QC9 A;  1KPS B;  5EYL A;  4GYY A;  3BEE A;  5KJN A;  1Z3X A;  4LEU A;  1FVH A;  1FVF A;  2VSX E;  3CK7 A;  1S0P A;  3E37 A;  4CT0 A;  1OCC E;  4JEH A;  5FQ4 A;  4TUM A;  3APC A;  2X6F A;  4DI3 A;  3RAU A;  3PZD A;  3PEV B;  3R9A B;  4JZY A;  4N39 A;  5G04 J;  4LER A;  3RSE G;  1EF1 C;  4F1S A;  2VJ8 A;  5D2M C;  4G8L A;  1K8K G;  4GML A;  1D8D A;  4YDO A;  5EIL A;  1TN6 A;  5ENQ D;  1TNY A;  4GZC A;  3NQP A;  4BES A;  4M7C A;  1H6K A;  4E6H A;  2EIK E;  5KJM A;  2I1J A;  3QOU A;  4U95 D;  3ESL A;  1LF8 A;  3LYA A;  4DX5 D;  2XGM A;  4FA6 A;  3RRM B;  1N9A A;  1AP7 A;  3ZW3 A;  5CCL A;  4HOR A;  2X6J A;  3CHO A;  3T8M A;  4XI0 A;  3UT7 A;  4GPM A;  3HXC A;  3DPY A;  4BSX A;  4J8D A;  4EEC A;  4ZHB A;  3DPD A;  3LPZ A;  4HI8 A;  2V5Q C;  3AU4 A;  1LTX A;  4JA7 A;  3UM1 A;  3SBT B;  3FU3 A;  1N95 A;  3Q49 B;  2M63 A;  5BNW A;  2PM6 A;  4N5Q A;  5CMW A;  2HR2 A;  3T8K A;  1UG3 A;  2J9Q A;  1N52 A;  3MZL B;  3NAW A;  3HVE A;  4GCN A;  5B1A E;  3UUX A;  2F0Y A;  4ATG A;  3PNT B;  3ASF A;  2Y4T A;  4MRU A;  2P58 C;  4YDY A;  1UN9 A;  1SQM A;  3Q7F A;  1IXV A;  4WND A;  4HFG A;  4MLP A;  3FUD A;  2P2C P;  3SQV A;  4BER A;  4DX7 D;  4YDE A;  4HBD A;  4WWN A;  4TXR A;  2R5S A;  1TNO A;  4K0R A;  3U64 A;  2R59 A;  4B94 A;  2MHK A;  3C3Q A;  1H2U A;  2YHE A;  3EHM A;  5BXU A;  3TL5 A;  2LNI A;  4J8S A;  1NA0 A;  4U0S A;  4U8Y D;  3UT4 A;  4DJA A;  2VSN A;  5D0Q D;  5ARG A;  2LSU A;  4U63 A;  3SFX A;  2BKK B;  3GZS A;  3ML9 A;  3V2X A;  2XZD G;  4EBA G;  2BED A;  3CEQ A;  4OVV A;  3PRE A;  4RQI A;  2J8S D;  3HHM A;  3FUL A;  3LY9 A;  1DNP A;  1ZU2 A;  4FHK A;  3E30 A;  5ENP D;  4G25 A;  4GMR A;  3FH8 A;  1D8E A;  2XS1 A;  3PVL A;  5LX8 A;  5ANR A;  3UM0 A;  3CVN A;  3CHQ A;  4I1A A;  5FT9 A;  4FLH A;  3ZXP A;  1H6P A;  5AJL A;  4IRU A;  3PDN A;  1N4R A;  3S7F A;  1YMP A;  2OV8 A;  4GZ5 A;  3AAA C;  2CG2 A;  5ENT D;  1OWP A;  2MYO A;  3TWW A;  3L08 A;  2X6H A;  2JLB A;  4YVO A;  5BUZ A;  4HRN A;  1ZB1 A;  1HE8 A;  1DVP A;  2WXI A;  2KCL A;  2B6C A;  2EIJ E;  3FTV A;  3S2A A;  3EDT B;  2WXG A;  1ELK A;  3SY2 A;  5FTP A;  3HXE A;  4J6I A;  4QQI A;  2PNN A;  4NUR A;  3L6A A;  2WQH A;  3B95 A;  3TAX A;  1OWO A;  3FTW A;  2IOS A;  1MHQ A;  2JEK A;  3L16 A;  3G2V A;  4BEP A;  5ARF A;  5ANL A;  3T9K A;  4AJW A;  3DSS A;  4W9R A;  2KCV A;  3CVU A;  3K9I A;  5C2Y A;  4XKC A;  5AQA A;  4BX8 A;  5C1D A;  3C72 A;  3CK8 A;  3OXG A;  2NYJ A;  1HO8 A;  4FHJ A;  2CHZ A;  2PZI A;  2IFU A;  4UWH A;  1S63 A;  3PEU B;  2WXP A;  3GW4 A;  1N11 A;  4AY5 A;  3TGO A;  3OTN A;  3TXN A;  3G2W A;  3URZ A;  5FQ8 A;  3SGH A;  3U3W A;  3HDX A;  2FEZ A;  4PS3 A;  4WNE A;  3CSF A;  1JWF A;  3B7T A;  3RU0 A;  4DX1 A;  5JHB A;  1JCR A;  4RG6 A;  2KBX A;  1VDY A;  1MX2 A;  2R2L A;  2DYS E;  4XI9 A;  3NOG D;  2LXM A;  2E0I A;  1OCO E;  4MKT A;  1JUQ A;  3FU6 A;  3LVQ E;  1X5B A;  5FQ6 A;  5CRU A;  1OCR E;  4U96 D;  4B8A A;  3SNX A;  4CT4 A;  3ZNG A;  1H19 A;  4GTS A;  4ILH B;  1N4P A;  2X3M A;  2XEV A;  3CHS A;  4LNG A;  4WWO A;  4I17 A;  2IY0 C;  3FUF A;  2ZIS A;  3Q73 A;  2XRZ A;  5EN5 D;  3L17 A;  1S64 A;  3RJV A;  3UX4 A;  4FLB A;  2RD0 A;  1U2V G;  5FJY A;  2RKK A;  2UY1 A;  2DZO A;  1E7U A;  4EHM A;  4EPZ A;  1TJC A;  5CEA A;  2OOE A;  1UOH A;  2VSY A;  3FTS A;  2QZA A;  3T5X A;  2WXM A;  4U0Z A;  3L13 A;  4JL0 A;  4RVB A;  4XKB A;  1TNU A;  4FJY A;  3U9W A;  4BT9 A;  2DZN A;  2KM4 A;  3Q7A A;  3ASN E;  3SD5 A;  1Y8M A;  4G2V A;  4AV7 A;  3LXU X;  4GU5 A;  3ULQ A;  1IKN D;  4HNA D;  3ASO E;  3JCK C;  3ZKJ A;  2WXO A;  1D9S A;  1DCE A;  2ZGG A;  3EIJ A;  5FQ7 A;  5AAO A;  1NP7 A;  4R7L A;  2GRL A;  5CED B;  1L5J A;  3UKR G;  2J49 A;  2R03 A;  1N4Q A;  3SBS A;  5G05 C;  3RRN B;  4A63 B;  5J08 A;  5FZR A;  4B93 B;  2VGY A;  3FUI A;  5BV1 A;  4TXP A;  3W9G A;  2DVW A;  2P9I G;  1MJ0 A;  3Q47 B;  5LCW J;  1GW6 A;  3PZ2 A;  2XGO A;  1RZ4 A;  3FH7 A;  1HG5 A;  4JXT A;  3Q5M A;  3PZ3 A;  3OXL A;  2V4H C;  2IO3 C;  5JMN D;  1N4S A;  2L6J A;  2WXK A;  5G55 A;  1MZC A;  2UY1 B;  3KAE A;  4A1S A;  2WB2 A;  4CGW A;  1INZ A;  4O1P A;  4H7Y A;  3VTX A;  1G3N B;  3Q15 A;  2XEN A;  3D9O A;  2X6K A;  4I43 A;  4UUC A;  3FUH A;  1E7V A;  2YQ8 A;  5ITZ F;  1N0Q A;  4AY6 A;  3LCA A;  1PC2 A;  3DSX A;  3NZS A;  4Z68 A;  2IEJ A;  4IN3 B;  1U3D A;  4LSZ E;  4N3B A; 
#chains in the Genus database with same CATH homology
 4Y6W A;  4AP2 A;  2FBN A;  2NXP A;  5KCM A;  1IQR A;  4MRU A;  4EQF A;  2P58 C;  4GA1 A;  4N2Q A;  3GZ2 A;  3FUE A;  3MYV A;  3ONK A;  3JQ1 A;  2WPV A;  4Y6C A;  4YVQ C;  3EHN A;  4CDN A;  3ZYM A;  1UN9 A;  1SQM A;  2LAI A;  2WXN A;  4UQZ A;  4KVM A;  4WND A;  4DPR A;  1HG2 A;  3ZYL A;  3SFZ A;  4HFG A;  3FU0 A;  4MLP A;  3FUD A;  2OVB A;  5T3R A;  3HIZ A;  2LAH A;  4QFV A;  4WWN A;  2XQ0 A;  5DIZ A;  4HVB A;  2R5S A;  1KLX A;  2GGF A;  3LEW A;  1E8Z A;  4K0R A;  4ILG A;  5LOZ A;  2R59 A;  2KCK A;  3U64 A;  3UMV A;  4B94 A;  3HYM B;  2MHK A;  1H2U A;  2YHE A;  3FTU A;  2BTD A;  5A23 A;  3CLJ A;  1H2V C;  3EHM A;  2WMO A;  4JPS A;  3R7R A;  4ANU A;  3TL5 A;  5EX0 A;  2LNI A;  4J8S A;  1NA0 A;  4ANV A;  4U0S A;  3MKQ B;  2AWI A;  4UI9 J;  3UT4 A;  4DJA A;  4URK A;  2WQ7 A;  3FY4 A;  3CR3 A;  2VSN A;  5D0Q D;  4I6G A;  1MQS A;  5ARG A;  2X38 A;  2LSU A;  2AXU A;  4U63 A;  1W3B A;  4L23 A;  4BX9 A;  3U66 A;  3TJP A;  3ZXS A;  2EQX A;  4FUL A;  3GZS A;  3ML9 A;  2CG3 A;  2HM8 A;  4EBA G;  3CEQ A;  3MEK A;  4AOF A;  4OVV A;  4BWR A;  2IU1 A;  3PRE A;  3E4B A;  2Y3A A;  3ONL A;  3VTY A;  4NAC A;  4AIF A;  2CFU A;  3HHM A;  4UI9 C;  3VLE A;  2VTB B;  3FUL A;  3LY9 A;  4G1T A;  5EKQ D;  4DK5 A;  5AIJ A;  3ENE A;  2XPZ A;  3CKB A;  1DNP A;  1ZU2 A;  4I1O B;  4FHK A;  1P5Q A;  1E96 B;  4I9E A;  4FP7 A;  3OAW A;  5ENN A;  1E90 A;  2WXJ A;  3QAR A;  4G25 A;  4UWF A;  3R7Q A;  4XZ4 A;  2AXZ A;  2V8S E;  3QWW A;  3TG5 A;  2AXV A;  3QAQ A;  3FH8 A;  5D0O D;  5LFA A;  4FC8 A;  4RG9 A;  2WM9 A;  3PE4 A;  3PVL A;  4U04 A;  5LX8 A;  1OWN A;  2KZT B;  4J0U A;  3RKV A;  5EDS A;  2CHW A;  3PUJ A;  5ANR A;  5JJT A;  3FUM A;  3CVN A;  1YA0 A;  3B7S A;  2DCP A;  3D9P A;  3B13 A;  3ZHE B;  4I6E A;  3CHQ A;  4BY6 A;  4Q69 A;  2VGX B;  1HF8 A;  4I1A A;  5CHE E;  1IYG A;  1Z3Y A;  3NZU A;  4CEM A;  4N3C A;  4F7A A;  3LS8 A;  4C9B B;  4EZL A;  5FT9 A;  3ZYQ A;  2V5F A;  4FLH A;  5G2N A;  4BTA A;  3FFL A;  5LCW C;  4A3V A;  3G2U A;  2C0L A;  4JEU A;  5AJL A;  4PH4 B;  2PQR A;  4IRU A;  1UN8 A;  3PDN A;  4JA9 A;  5DBK A;  4KZ0 A;  2DIW A;  3PNL B;  2OV8 A;  3S7F A;  4F53 A;  5AEN A;  4GZ5 A;  2V0P A;  2XPY A;  4ABN A;  1JPL A;  4HOU A;  2MOW A;  4WUY A;  3VLD A;  3HVE B;  5A7D B;  3D9K A;  4U8H A;  4HXI A;  1HH8 A;  5BW8 C;  3UT8 A;  2CG2 A;  3CVX A;  1OWP A;  2YNQ A;  4UI9 K;  4J8F A;  4A55 A;  3P2B A;  2XGS A;  3L08 A;  3NF1 A;  5T8I A;  2X6H A;  3PH0 C;  2WQ6 A;  5CCM A;  3QC1 A;  2JLB A;  4CDR A;  4I6J A;  4YVO A;  3WXX A;  3O48 A;  4Q94 A;  5BUZ A;  3FHE A;  3GZ1 A;  1KT1 A;  4KT6 B;  3UPV A;  4AVX A;  3IHV A;  3FUJ A;  5JHA A;  1B89 A;  4A1G A;  3EJN A;  1HE8 A;  1DVP A;  2WXI A;  3D9N A;  4JVS A;  1QNF A;  3RK6 A;  4GA2 A;  1EPU A;  4L1B A;  2KCL A;  2R17 C;  3FTV A;  3KEZ A;  3S2A A;  4FJZ A;  2L0I A;  4GZ3 A;  5KJK A;  4F3V A;  1XNF A;  3EDT B;  1OUV A;  2WXG A;  4GB9 A;  4LUN U;  3RIB A;  2C2L A;  2WXL A;  3VLF A;  4ANX A;  3BG0 B;  1ELK A;  2XCB A;  2OND A;  3O4Z A;  2FUL A;  1UW4 B;  2WXH A;  5FTP A;  4ILI A;  3IKO B;  4J6I A;  3LDZ A;  2HYZ A;  2I2O A;  4MS6 A;  4B8C B;  4J8E A;  1E8Y A;  3MJW A;  4NUR A;  3CVV A;  3CVY A;  4I2Z A;  4N3A A;  1UJJ A;  5CMY A;  5FWQ A;  2BF0 X;  3L6A A;  3GYZ A;  2WQH A;  3TAX A;  1OWO A;  3FTW A;  3RO2 A;  3I4G A;  1IQU A;  2IOS A;  3G2S A;  4FAD A;  4RSY A;  4L2Y A;  1MHQ A;  3CHP A;  2JEK A;  3L16 A;  3P1U A;  1ELR A;  3Q4A B;  3ZFW A;  3G2V A;  1PAQ A;  5ARF A;  5ANL A;  2IOL A;  1A17 A;  2KAT A;  4AJW A;  4L2L A;  3CVP A;  4GZ6 A;  4W9R A;  4UQY A;  3CHR A;  4Q96 A;  4H7X A;  1ZBP A;  4G23 A;  2KCV A;  2CFZ A;  4G11 A;  4I1M A;  3CVU A;  2NSZ A;  3K9I A;  3QK0 A;  4IUL A;  4O6F A;  4N5C A;  5AJD A;  5C2Y A;  4GZD A;  4XKC A;  4AEZ C;  4BX8 A;  3IV0 A;  3AU5 A;  2GW1 A;  3CK8 A;  5C1D A;  5J90 A;  3LJ3 A;  3OXG A;  2VTB A;  1NA3 A;  3IBE A;  2YHC A;  2FI7 A;  1HO8 A;  4FHJ A;  2CHZ A;  2PZI A;  4UWK A;  2IFU A;  2WMN A;  4CDM A;  3D9M A;  4UWH A;  4WAF A;  3PEU B;  5M72 A;  3S7B A;  3ZN3 A;  2XHE A;  2WXP A;  3C98 A;  2BUG A;  3FTY A;  3GW4 A;  4C0M A;  3BG1 B;  2J09 A;  5HI7 A;  3TXM A;  2Y4U A;  4AY5 A;  2XPI A;  3TGO A;  3B7U X;  3OTN A;  3TXN A;  4IN3 B;  3G2W A;  3D9J A;  3N71 A;  3URZ A;  2X6I A;  3CK9 A;  1HX8 A;  5FQ8 A;  1KT0 A;  4NQ0 A;  4GA0 A;  3B7R L;  3SGH A;  3U3W A;  2J07 A;  2PQN A;  3HDX A;  2FEZ A;  2VGX A;  1BPO A;  3MKR A;  2J4B A;  2OVF A;  3PRZ A;  4K03 A;  4PS3 A;  4WNE A;  3G2T A;  3CIA A;  4OVU A;  4P29 A;  3PUK A;  3CSF A;  3FU5 A;  3CVQ A;  4APF A;  2WXQ A;  3MCX A;  1JWF A;  3B7T A;  1PY1 A;  4JHK A;  3RU0 A;  4GMJ A;  1OWL A;  2L0T B;  1TJF A;  3DBS A;  4U0U A;  4EBA A;  5JHB A;  5KJL A;  1Y6I A;  2GRM A;  4RG6 A;  4TRQ A;  5AYW D;  5BV0 A;  2KZT A;  2ZU6 B;  1U3C A;  4U07 A;  1HFA A;  4PDX A;  4B89 A;  4JHJ A;  1VDY A;  4GYW A;  5FZS A;  3RO3 A;  3ZPJ A;  4PUC A;  3CV0 A;  4DLQ A;  1FCH A;  4XI9 A;  3L22 A;  2PM7 A;  3ML8 A;  3U4T A;  3CGH A;  4HOT A;  4YND A;  4WNF A;  4AXH A;  2E0I A;  4MKT A;  3SHF A;  1JUQ A;  5EX3 A;  4GAA A;  4CCA A;  4PS7 A;  3FU6 A;  3SZ7 A;  2QY7 A;  1H2T C;  3LVQ E;  4HOS A;  1NZN A;  2A5U A;  2V4L A;  1X5B A;  3KS2 A;  5FQ6 A;  1EDU A;  3ZEF A;  4PS8 A;  1HZ4 A;  3I3N A;  3APF A;  4XIF A;  4BTB A;  4B8A A;  1N54 A;  3SNX A;  4CT4 A;  2WXF A;  4V3I A;  2L9B A;  3CQG B;  1H19 A;  3I4R B;  2I1K A;  5T4Y A;  4ILH B;  1Z6T A;  3LY8 A;  2VYI A;  2WXR A;  4XX5 A;  1TEZ A;  2ILR A;  2X3M A;  2XEV A;  3CHS A;  4WWO A;  1IHG A;  3OXF A;  4I17 A;  4N2S A;  3S7J A;  2VSO E;  1E8X A;  2HO1 A;  4I2W A;  3MV3 B;  3QKY A;  3FUF A;  4KZC A;  3T5V A;  4TV3 A;  4HOQ A;  2IQC A;  4C0E A;  2XRZ A;  2XCC A;  3IEG A;  2J4D A;  3L17 A;  3JQ0 A;  4GYO A;  3CVW A;  5FZQ A;  5HQ8 A;  4XE0 A;  3SF4 A;  3RJV A;  4KBQ A;  2FF4 A;  3UX4 A;  1HS6 A;  3FEX A;  4FLB A;  3ZGQ A;  3LKU A;  3FH5 A;  2RD0 A;  5E76 A;  2WVI A;  4EZJ A;  5FJY A;  4L7T A;  5JJ6 A;  2UY1 A;  5BPP A;  2RG8 A;  3ASH A;  3MV2 B;  3FDH A;  4JHR A;  1E7U A;  4ME2 A;  4UWG A;  2FO7 A;  4A3T A;  4EPZ A;  1TJC A;  3S7D A;  3FTX A;  3RRU A;  2OOE A;  4GYY A;  3FUK A;  3BEE A;  3LY7 A;  5KJN A;  1Z3X A;  4LEU A;  2VSY A;  3FP3 A;  1FVH A;  1FVF A;  3FTS A;  4EZK A;  4DLO A;  2PL2 A;  1ELW A;  1WAO 1;  2VSX E;  3T5X A;  2WXM A;  4U0Z A;  2AW6 A;  3ESK A;  3CK7 A;  4KYO B;  3L13 A;  1H0A A;  1S0P A;  4JL0 A;  2UWJ G;  4NRH B;  4RVB A;  4XKB A;  4CT0 A;  5LP0 A;  1HXI A;  4FJY A;  3U9W A;  2I6H A;  2J08 A;  4JEH A;  5FQ4 A;  4BT9 A;  5A6C A;  2KM4 A;  2E2E A;  3ZVV A;  4ACK A;  3CVL A;  1EYH A;  1WM5 A;  1Y8M A;  3APC A;  4LRZ A;  4G26 A;  3SD5 A;  3ZIM A;  2X6F A;  4G2V A;  3I5P A;  4DI3 A;  4UWL A;  2QFC A;  3AS4 A;  3D9L A;  4M3O A;  4AV7 A;  3LXU X;  3PZD A;  3QNK A;  3PEV B;  3R9A B;  1UJK A;  4GU5 A;  2IJG X;  4JZY A;  4N39 A;  5G04 J;  1HU3 A;  2YIN A;  4LER A;  2CHX A;  3IHY A;  4HLE A;  2MRI A;  3ULQ A;  1EF1 C;  3QWP A;  3MA5 A;  4B0Z A;  4F1S A;  4GPK A;  3QWV A;  2VJ8 A;  4BT8 A;  3ASD A;  2ION A;  3JCK C;  4WWP A;  4GML A;  2WXO A;  4APO A;  3EIJ A;  5FQ7 A;  2LSV A;  1NP7 A;  4R7L A;  3CKC A;  3AS5 A;  5G05 J;  4OYS A;  2GRL A;  2C0M A;  1SZA A;  3MGB A;  1L5J A;  3MX3 A;  3NQP A;  4GZC A;  4DI4 A;  2J49 A;  4LCT A;  1H6K A;  3FTZ A;  3SBS A;  2KC7 A;  4E6H A;  1E8W A;  3KD7 A;  5KJM A;  5G05 C;  1WY6 A;  3FUN A;  2I1J A;  3RRN B;  5J08 A;  3JUI A;  1JWG A;  3QOU A;  3ESL A;  5FZR A;  1LF8 A;  3APD A;  4ACL A;  2VGY A;  3ASG A;  3LYA A;  2XGM A;  4FA6 A;  3FUI A;  5BV1 A;  2Q7F A;  3ZHE A;  2XRY A;  4TUU A;  3RRM B;  3Q47 B;  3AS8 A;  2A4Z A;  2IF4 A;  3ZW3 A;  4FU3 A;  4I9C A;  2DBA A;  5CCL A;  5LCW J;  4HOR A;  4AM9 A;  1GW6 A;  3L54 A;  3EIQ C;  4HS2 A;  2XGO A;  2X6J A;  3FH7 A;  1HG5 A;  1XGW A;  4ANW A;  4JXT A;  3CHO A;  3T8M A;  1QQE A;  3Q5M A;  4UQX A;  3ZRH A;  4XI0 A;  3FWV A;  2NC9 A;  4KMO A;  4WNG A;  3UT7 A;  3OXL A;  5G04 C;  3SI5 A;  4BSX A;  3CST A;  4JW1 A;  4J8D A;  4EEC A;  3DPD A;  4GCO A;  4KVO A;  3PS6 A;  2L6J A;  2WXK A;  3LPZ A;  3LVR E;  4JC8 A;  5G55 A;  2UY1 B;  3AU4 A;  3KAE A;  5E75 A;  4A1S A;  4JA7 A;  3FEY A;  2WB2 A;  4CGW A;  1QZ2 A;  3SBT B;  1INZ A;  3JYS A;  3FU3 A;  4H7Y A;  3VTX A;  3Q49 B;  2M63 A;  2VQ2 A;  1SZ9 A;  3Q15 A;  5BT1 A;  5BNW A;  2PM6 A;  3ZYK A;  5CMW A;  3D9O A;  2HR2 A;  2X6K A;  4G24 A;  3PE3 A;  4KXK B;  1UG3 A;  2J9Q A;  3UQ3 A;  1N52 A;  3MZL B;  4I43 A;  3CQC B;  3TG4 A;  4E85 A;  3QDN A;  4CGV A;  3FUH A;  3HVE A;  2AVP A;  4D10 C;  1E7V A;  2LO6 A;  2YQ8 A;  3D9I A;  4GCN A;  4AY6 A;  3QJZ A;  3QB2 A;  3MKQ A;  3CHM A;  3LCA A;  4BFR A;  1PC2 A;  3NZS A;  3UUX A;  4IYP A;  4ATG A;  2I9C A;  3PNT B;  4CRW A;  5JJ7 A;  3ASF A;  1OWM A;  2Y4T A;  1U3D A;  3D3M A;  4N3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...