4Y6WA

Crystal structure of podosopora anserina putative kinesin light chain nearly identical tpr-like repeats
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
211
structure length
211
Chain Sequence
MEHPSRLRSQHELARRYQQNGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQVQEAVELLEQVVAIQAKTLRSEHPSRLASQHELARAYQANGQRQEAQELLEQVRAIQAKTQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Unknown function
molecule keywords NaB(AB)3ACb - light chain TPR-like repeats
total genus 97
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4y6wA00
2Y4UA 4IN3B 2FO7A 2KC7A 4N39A 2LSVA 5HQ8A 4F3VA 4WNDA 3PE3A 2QFCA 3QWWA 3S7DA 5BNWA 5FJYA 3RKVA 2I6HA 2XCCA 2E2EA 3ZFWA 4GZ3A 5A6CA 2KCKA 2VSNA 5G05J 4AIFA 4U04A 3R9AB 3MV3B 3QDNA 2DBAA 4GYYA 1YA0A 3ASGA 5C1DA 4BTBA 4GZ5A 3AS5A 3S7JA 3U4TA 2PQRA 4A1SA 2UWJG 3CKCA 4KYOB 2NC9A 4UQZA 2C0LA 5FTPA 5G04C 3WXXA 4CGWA 2FI7A 5CCMA 5G04J 3FP3A 2VGXB 4GCNA 3LPZA 2KCLA 3LCAA 2PZIA 2IF4A 2XEVA 4GZ6A 3RO3A 5HI7A 4NRHB 2HYZA 5FT9A 3U3WA 4UI9C 2WPVA 3Q49B 4XI9A 5EKQD 4GA2A 3S7FA 3CK7A 3AS8A 2R5SA 3CK8A 3KS2A 3N71A 4JA9A 4RG6A 4YVQC 4U0SA 1WM5A 5G05C 3SF4A 3ULQA 3OXGA 4AM9A 1NA3A 3QWVA 4H7YA 2VYIA 4RG9A 3UUXA 2XCBA 1A17A 3VTYA 4GCOA 2Q7FA 4I17A 3LY9A 3ZPJA 3BEEA 3ZHEB 2UY1B 3RIBA 1ZBPA 4CDRA 1WAO1 4W9RA 2GW1A 2C2LA 2VQ2A 2XGMA 1IHGA 4J0UA 2XGOA 4KBQA 5D0OD 3CVLA 3UPVA 3CVNA 5EX0A 4J8DA 1QZ2A 4JHRA 1HZ4A 1ELRA 2AVPA 2MHKA 3URZA 1B89A 1OUVA 5D0QD 5JJ6A 5BW8C 3VTXA 4ABNA 2LSUA 4G25A 4APOA 4B94A 3TG4A 3CV0A 2J9QA 1KT1A 4N3BA 5ARGA 2FEZA 2PQNA 3LYAA 3ZGQA 4N3AA 5DBKA 5BT1A 2ONDA 2V5FA 4N3CA 3CVQA 2VGYA 4JL0A 4KXKB 5FZQA 2L6JA 2LNIA 3ASDA 3QWPA 3SZ7A 1HH8A 1P5QA 3CK9A 4HOSA 1KLXA 4AY6A 4YNDA 3Q5MA 3HYMB 3MKRA 3Q4AB 4BT9A 2YHCA 3LY8A 4BWRA 3NF1A 4XIFA 4G24A 3TGOA 3RO2A 3GW4A 5KJKA 1Y8MA 3MEKA 3PDNA 4G23A 5KJLA 3TAXA 4N2SA 4GA0A 4GPKA 2UY1A 4EQFA 1E96B 2KCVA 4Y6WA 4I9EA 4ME2A 4I2ZA 4WUYA 3FFLA 3Q15A 3UQ3A 4BTAA 3K9IA 5LCWC 4N2QA 1FCHA 5A7DB 3KAEA 5LCWJ 2WQHA 3CEQA 1XNFA 2BUGA 5CCLA 5DIZA 4U07A 3LKUA 2FBNA 2XGSA 4I9CA 4LEUA 4JA7A 3MA5A 3ESKA 3FWVA 3PE4A 4J8EA 4I1AA 2YQ8A 3OXLA 5FZSA 3TG5A 5KJMA 1TJCA 5KJNA 4HORA 3JYSA 4BT8A 2OOEA 3MV2B 3GZ2A 3RJVA 4U0ZA 3E4BA 4UQYA 2C0MA 4GA1A 3IEGA 1NA0A 4Y6CA 3EDTB 5FZRA 1IYGA 1PC2A 4AY5A 4WNGA 4GYWA 4UI9K 3RU0A 4N5CA 4WNFA 3QOUA 3Q47B 4UQXA 3S7BA 4YVOA 2JLBA 3ASFA 5ARFA 3LY7A 3OXFA 4WNEA 4I2WA 4HOUA 1ELWA 1W3BA 2VGXA 2PL2A 1QQEA 3CKBA 2FF4A 3QKYA 4H7XA 5EX3A 1NZNA 5M72A 3AS4A 3GYZA 3ZN3A 4G2VA 4CGVA 5CHEE 2VSYA 4O6FA 5JJTA 1HXIA 4U0UA 2KATA 5JJ7A 4NQ0A 4UI9J 4HOTA 3GZ1A 2IFUA 3CVPA 1ZU2A 4G1TA 3ASHA 2HO1A 3ZHEA 2HR2A 3O48A 4HOQA 4J8FA 4GYOA 1KT0A 2XPIA 4G26A 4XI0A 5AYWD 3KD7A 2Y4TA 2P58C
chains in the Genus database with same CATH superfamily
4XX5A 1N0QA 4E6HA 3HVEA 3UX4A 2E2EA 3ZFWA 3MV3B 1AP7A 3LVQE 4UQZA 4M3OA 1E8ZA 3WG7E 1MQSA 1DNPA 3LCAA 3U9WA 2WXIA 1MHQA 3TWRA 1H6PA 2P9LG 5C2YA 2OV8A 4JA9A 3JQ1A 4YVQC 3RRUA 5G05C 2Y0BG 3PRZA 3FUJA 1G3NB 3BEEA 4GB9A 2AXUA 5E75A 3UM0A 4U8HA 2L0IA 4K5AB 4GPMA 4CYMD 3VTXA 1OWOA 1X81A 1QNFA 4Q94A 2BKKB 4LG6A 2ONDA 4DLOA 3CVVA 3FU0A 5J08A 5CBOA 4XE0A 2L6JA 3LS8A 1HH8A 3TGOA 3SBSA 4Q96A 2LAIA 1NI1A 4U63A 1E7VA 5CMWA 2XRYA 4GTSA 5KBAA 3FUKA 1HX8A 4I9CA 4L1BA 2OOEA 5HKPA 4A3VA 2ETCA 3EDTB 1O5MA 4GYWA 2M63A 1E8XA 3Q47B 4KVMA 4XKCA 1IHBA 5ARFA 3FY4A 3T9KA 5EX3A 3CGHA 4U0UA 1ZU2A 1LTXA 2XPIA 4ATGA 2Y4TA 4IRUA 3G2TA 2QYUA 4ATZD 2WXNA 2R2LA 5ANRA 5ENNA 3EIQC 3R9AB 2KXPC 2PQRA 5KCMA 3FTVA 4XI9A 4RG6A 1JWFA 3FU5A 2HM8A 5CEDB 5A23A 2GRPB 3C72A 3EUVA 4W9RA 4K0RA 4LSZE 3UPVA 4NACA 3HXFA 1KT1A 3V31A 5ARGA 5BT1A 2RFAA 2WXRA 1QYMA 3SY2A 3DSSA 4Z68A 3JQ0A 4BX9A 1BI7B 3MGBA 3SQVA 4G11A 4R7LA 3EHQA 4LUNU 4BY6A 1HG5A 3FUEA 3U66A 3ZKJA 5FZSA 4WAFA 4J8EA 5KJMA 2KZTA 5KJNA 2XRZA 1FVHA 1JCQA 3RJVA 4UQYA 3B7TA 2X6JA 1N9AA 1EF1C 4HRMB 5AQBA 4YVOA 2GRLA 3CHQA 1K1BA 4J8SA 2F0YA 2GRMA 3ZVVA 5CMYA 4ACLA 4NQ0A 1S64A 3ZHEA 3O48A 1OCCE 2PM7A 3OTNA 1Z6TA 5AARA 3KD7A 2YINA 3FDHA 4U04A 5LP0A 3RRMB 4U8YD 5ENPD 4GZ5A 3E37A 1D9SA 2UWJG 3CSTA 1TR4A 5LX8A 4GMRA 3PZDA 2QC9A 1S63A 3P2BA 4K5BA 3N71A 1K3ZD 4IULA 3D9HA 4C9BB 1RW2A 3PNLB 3FEYA 3RIBA 4CDRA 2WXGA 2GW1A 4FU3A 1YYHA 3G2VA 2IO3C 3TG4A 1S0PA 2GRRB 2FO1E 3PUJA 4EBAG 3RAUA 3ASDA 4HRNA 1UJJA 3PEVB 1HG2A 3MJWA 3VLDA 1H6KA 5AQ7A 3BQOA 3B13A 3PH0C 4JB8P 1E96B 2P9PG 3K9IA 2WXHA 5LCWJ 4HXIA 1N4SA 1NP7A 3JUIA 4MKTA 5D2MC 5EN5D 5DIZA 2F8XK 3ZYQA 3EU5A 4M7CA 3IV0A 3ONKA 2J09A 3E4BA 1OXJA 2C0MA 2OEWA 4LNGA 5CECB 4AV7A 1JCSA 5AN8A 3LY7A 4WNEA 3ZYKA 2RFMA 2EQXA 3B95A 3NB2A 1SA5A 2IJGX 3QWWA 1O1SA 4WNDA 2XEHA 2XCCA 3APFA 4UWKA 4JXTA 3DPYA 3T5VA 3DXKG 2XPZA 5BXOA 4KYOB 1WG0A 2XPYA 4NURA 3WXXA 3CHRA 2V4HC 2PZIA 4LNBA 3AG3E 1MX6A 3ZUVB 2DWZA 3ZHEB 1ZBPA 3FU3A 5EYLA 4F1SA 2ETAA 2WQ6A 4FC8A 3Q9UC 5EYPF 5JJ6A 1H2TC 4N3BA 3QB2A 2XZDG 4GTTA 4B0ZA 3CK9A 2X6FA 3AU4A 4CT0A 4YNDA 3DBSA 3MKRA 4BT9A 3Q4AB 2YHCA 2X6HA 3RO2A 4FP7A 1SW6A 2DZNA 4G23A 4N2SA 4ANXA 4IYPA 1JWGA 3CR3A 2XGSA 3UKRG 1EDUA 1UN9A 3MA5A 4K03A 4NIKA 2MOWA 2XS8A 2BKGA 4Y6CA 3RK6A 3EJNA 3UT7A 5FINA 3GYZA 3ZN3A 3CHMA 2KATA 4UI9J 1N4QA 4LRZA 3UM1A 3UMVA 5D66A 1HO8A 1VDYA 5BNWA 1JCRA 2V0PA 5AQAA 4I6JA 1E7UA 3AG2E 2ILRA 4FJYA 3AS5A 2ZU6B 4CGWA 3EHMA 3JXIA 4DLQA 4JZYA 3ULQA 4RG9A 2P9IG 1ZB1A 2Q7FA 3LY9A 4ZHBA 4UWLA 4OVUA 2F8YA 2WVIA 4DRXE 1N52A 4J0UA 5EX0A 1QZ2A 4TV3A 4GMLA 4GAAA 3CVQA 4KXKB 1YMPA 5FQ8A 5JHBA 4JHJA 4AY6A 4L23A 3Q5MA 5KNGA 3Q75A 4JEUA 3UXGA 3Q7FA 2IOSA 2UY1A 4ME2A 4WUYA 4BERA 3PVLA 4HS2A 2QZAA 4U07A 3J5QB 3SFXA 2YQ8A 3JYSA 4BT8A 4JD2G 5ENQD 3BG1B 4PDXA 3UIOC 3DXMG 3BG0B 3I5PA 4BESA 4JVSA 4HVBA 3QKYA 2FF4A 3ASOE 1OCOE 2LXLA 2DIWA 1KT0A 2NSZA 4BTAA 5EIBE 2MYOA 2LSVA 5B3SE 1N0RA 3ML9A 4AIFA 3U4TA 2C0LA 2J49A 4GCNA 1FVFA 5FQ4A 1BU9A 4X8QA 3NOCD 3C3OA 3B7UX 1TN6A 3L82A 1DCQA 3D9IA 2XGMA 2XGOA 1UN8A 3KSQA 1TNZA 1HZ4A 1INZA 2EILE 2VGEA 1UOHA 4G8LA 4FJZA 2B0OE 3R7RA 4DX6D 1TNOA 3PDNA 4WWNA 1LF8A 4EQFA 4I2ZA 4F7AA 4XZ4A 4DI3A 4I1AA 3MV2B 4RVBA 3E32A 3MKQB 3IEGA 1NA0A 4I6EA 4ANUA 1E8WA 1N95A 3S7BA 4PUCA 5KNHD 1OWMA 5B1BE 1ELWA 3D9PA 3V2XA 3EHNA 2EINE 4HOTA 3GZ1A 4G1TA 3D9OA 4FLHA 4AP2A 1YA0A 2LO6A 3L9TA 5G04C 3MKQA 5FTPA 1TN8A 3TWWA 2KBXA 2XS1A 3TWQA 4FADA 1BPOA 4O60A 2GRQB 3QWVA 2VQ2A 4KZ0A 1BI8B 4TXPA 2VJ8A 4C48B 4TXQA 4RSYA 4HLLA 3URZA 2LSUA 4G25A 2HE0A 2FEZA 3LYAA 1GW6A 4PS3A 3D9NA 2A5EA 2ZGDA 3QWPA 3CVXA 5FQ6A 3CVYA 4URKA 3Q79A 3PZ2A 5T8IA 4JPSA 4D10C 5KJKA 4GA0A 2NXPA 5FIOA 2R17C 2FBNA 3T8MA 3UT8A 2L0TB 2Y1LE 4B93B 3R9MA 3DPDA 1N11A 4E85A 4PS7A 5G2NA 3TWUA 2WM9A 4YDYA 2EIJE 3AS4A 3DSWA 2WMOA 1SVXA 2XENA 5BXUA 4GZ3A 2VSNA 3QDNA 3HG0D 4YDOA 3G2SA 3FH5A 5CBNA 4L7TA 2IF4A 1OWPA 2YNQA 4UI9C 3LXUX 2WXQA 2DZOA 1FT1A 2CHZA 3ZPJA 5G55A 2UY1B 4JW1A 1IHGA 4ANWA 4UWGA 2MHKA 2X6KA 2EIME 3LVRE 4WWPA 1HF8A 3W9FA 4I6GA 4JL0A 4Q69A 3SHFA 2AWIA 4BWRA 5HS0A 4FLBA 4GTPA 3CHSA 3TAXA 3CVWA 2L9BA 2Y3AA 1FCHA 4U7EB 2XZTG 3L22A 3LKUA 3ONLA 2H6IA 2P9UG 4U0ZA 2JEKA 1IYGA 3LJ3A 4UI9K 2WB2A 4WNFA 3HXEA 2JLBA 3OXFA 1L5JA 2PL2A 2VSOE 1QQEA 3FUDA 2R05A 3FULA 2CG3A 3FU6A 4GTMA 1ELKA 3FTSA 3CVPA 3ASHA 2PM6A 4GYOA 5CEAA 4AXHA 3TG5A 3DRAA 5LOZA 2J4BA 2QFCA 2P9NG 3HXBA 5BV1A 3RKVA 5ENSD 3RRNB 2ETBA 4BTBA 5AJDA 4A1SA 4K5CA 2IY0C 3LPZA 1NL4A 3PZ1A 4LERA 3LEWA 4U95D 5FT9A 3U3WA 5AAOA 2DCPA 1SZAA 1TN7A 2DVWA 3KS2A 3KEZA 3E34A 3ISMC 2H6HA 4AM9A 4H7YA 1A17A 4GCOA 4YDWA 3I3NA 1MYOA 3APDA 2WXFA 3ZXSA 4JC8A 5EIDA 4HRLA 4AY5A 2ZXWE 3DEOA 2GRNB 1UG3A 3UM2A 5J90A 1WDYA 4L2YA 1BLXB 4CDMA 2VSXE 3UI2A 2A5UA 3Q15A 3UQ3A 2AJAA 5FQ7A 1H2UA 3NZUA 2I9CA 2KM4A 1TYQG 3GZ2A 1U3CA 3L6AA 1PAQA 3JXJA 4EECA 2XEEA 4HOUA 4TUUA 4XEIG 1FPPA 4CGVA 4G2VA 4GU5A 3DSVA 3IBEA 2WXOA 3D9MA 3CIAA 3T8KA 4HOQA 4G26A 1DVPA 4N39A 5HQ8A 2Y69E 4FA6A 4N2QA 3EIJA 1SQMA 2DBAA 3ABME 2NC9A 3R7QA 5KWDA 3AAAC 3L54A 1FT2A 2J08A 3IKOB 1X5BA 2FULA 4NRHB 4BSZB 1OWLA 3J5PA 5ENOD 3SF4A 4DX2A 1NA3A 3UUXA 3BU8A 4G8KA 2C2LA 4MBGA 5D0OD 2BTDA 2DYSE 1OUVA 4TUMA 5BW8C 5JHAA 1S70B 4DX7D 4J7WA 2ZGGA 1D8DA 3QARA 3SZ7A 1OT8A 1TNBA 4EHMA 3LY8A 3NF1A 4F1PA 4GPKA 3HHMA 3JUEA 4CEMA 4I9EA 2V8SE 1HFAA 2WQHA 1MZCA 1XNFA 5CCLA 1MJ0A 4LEUA 4HI8A 1TJCA 4KZCA 4RQIA 4P29A 2WXLA 3AG4E 3AJIA 3TWTA 3B7RL 4OYSA 4UUCA 5B1AE 3TJPA 3IHVA 5CHEE 5JJTA 3HDXA 2GROB 3EU9A 1DC2A 4TRQA 3X2QE 2JABA 3CHOA 1EYHA 2DYRE 1OY3D 2J8SD 2LXMA 1U3DA 3AG1E 5G04J 2KCLA 4BEPA 2BEDA 2YHEA 2XQ0A 5LFAA 4A55A 4GA2A 2CHWA 3Q73A 3OXGA 3LDZA 5ENRD 3VTYA 1Z5SC 3BUAA 1O1TA 1TEZA 2R59A 4KBQA 3DSXA 4EBAA 2WXKA 2AXVA 2AVPA 3UTMA 3FUMA 4V3IA 4DUIA 5FZQA 4GTRA 3TWSA 1SA4A 4DI4A 4XIFA 4G24A 3TXMA 2J4DA 1E8YA 1TJFA 2OEVA 3ZRHA 2KCVA 2J07A 2CFUA 3CEQA 1Y6IA 2P2CP 2BUGA 1HE8A 4FHJA 1MX4A 3CQCB 4CZ2D 4BFRA 3ASNE 4KT6B 4AVXA 1NZNA 3MYVA 4O6FA 3ENEA 3T5XA 1N4PA 4J8FA 4EZJA 2FO7A 2MRIA 4LCTA 3ZYLA 3FTXA 3ZIMA 5H7PA 4I1MA 2A4ZA 3HRAA 1KPSB 1SZ9A 4U8VD 3CKCA 1LD7A 3Q9NC 4B8CB 5JA4D 3FTUA 3Q49B 3FH7A 3AS8A 3CK8A 2E0IA 1WM5A 2V4LA 3TWVA 2CHXA 1IQUA 1H19A 3KEAA 4ACKA 2WXJA 2RKKA 3D3MA 3L13A 4GTQA 3V79K 5CERB 2F37A 4B94A 4APOA 2PQNA 3ZGQA 4GTOA 4N3CA 3PZ3A 4HOSA 3E30A 4L9PA 2V5QC 3ABKE 3FTWA 1RZ4A 5BUZA 1Y8MA 3MEKA 3PNTB 3FUNA 2PNNA 3PS6A 2GGFA 4MS6A 3ZEFA 4OAUC 1PY1A 4A63B 4AJWA 2LUHA 4OAVB 1Q2ZA 2IOLA 3QC1A 3HVEB 1W3BA 4F53A 4CCAA 3CQGB 3FTYA 5HRYA 1Z3XA 2KC7A 4O1PA 3PE3A 1TNYA 3S7DA 4JEHA 3IHYA 2VTBB 4GYYA 2I1JA 2I1KA 4B89A 3UINC 3S7JA 2ZIRA 3G2WA 4QQIA 3FP3A 2XEVA 2WMNA 3MZLB 3MX3A 4DK5A 2WPVA 4GZCA 3S7FA 1KZOA 2R5SA 4U0SA 3V2OA 2H6GA 4A1GA 4I17A 5JMND 3SGHA 1EPUA 2OVFA 4AEZC 4J8DA 4HLEA 5D0QD 4ABNA 2X6IA 1UW4B 2QYJA 4N3AA 5DBKA 3FUIA 3FUHA 1AWCB 1HS6A 3L08A 3CVUA 4HFGA 2LNIA 5CRVA 2IU1A 1P5QA 3SBTB 4J6IA 4RLYA 3SFZA 4HNAD 4GTVA 3TWXA 5A7DB 3KAEA 3D9KA 5BV0A 4ILGA 4UWFA 4UWHA 1U2VG 2XHEA 1PC2A 3B7SA 3QOUA 2WQ7A 1V54E 1H2VC 1O1RA 2L6BA 2VSYA 3C3QA 1KZPA 3ESLA 3IXEA 1N54A 1A5EA 3D9LA 2I2OA 5EDSA 1OCZE 4F3VA 3S2AA 5AJLA 3FTZA 5A6CA 4B8AA 4DJAA 3C5RA 5AIJA 3SO8A 1WY6A 4EZKA 4TXRA 5CCMA 4GZ6A 5CRUA 5HI7A 3CHPA 3PZ4A 5EKQD 3CK7A 4DPRA 4KVOA 5IY5E 2VYIA 4PS8A 2XCBA 3G2UA 3V30A 1WAO1 4I43A 4DX1A 3CSFA 3CVNA 3DEPA 4JHRA 3QK0A 1B89A 3U64A 4AOFA 2J9QA 5AQ9A 1QBQA 2V5FA 3VLEA 3MCXA 4CT4A 3F6QA 3SD5A 1KLXA 3B7BA 3L17A 3SFYA 2LAHA 3ULYA 2WXMA 1DCEA 2QY7A 2ZISA 3O4ZA 4J8YA 1K8KG 3QAQA 4WWOA 3VLFA 1MX2A 3APCA 4OVVA 4JA7A 4JHKA 3OXLA 3Q78A 4HORA 4PH4B 3DSTA 4GA1A 3CLJA 5FZRA 4APFA 4KMOA 3RU0A 2AXZA 4N5CA 3PEUB 4UQXA 4MLPA 5ITZF 3ASFA 2VTBA 5T3RA 1Z3YA 3CKBA 5M72A 5T4YA 1H6OA 2BF0X 2KZTB 3PUKA 2HR2A 4C0EA 1D8EA 3SI5A 5AYWD 2Y4UA 4IN3B 5EILA 3UIPC 5AENA 4ILHB 5FJYA 2I6HA 5G05J 3ASGA 3DWLG 4HI9A 1OCRE 3D9JA 3RO3A 2OCCE 1IXVA 3ZYMA 3RSEG 3E33A 3EHRA 4LNUD 4C0MA 4O1OA 3CVLA 3NAWA 4A3TA 1ELRA 3CV0A 2R02A 1H0AA 2P9KG 4GZDA 2OVBA 3I4GA 2X38A 3ULEG 3ZW3A 4XKBA 1N94A 3GW4A 5FWQA 4Y6WA 3FFLA 2IEJA 5LCWC 3FHEA 3C3RA 3UM3A 1N4RA 2RG8A 5E76A 4ILIA 4U96D 3DSUA 3NBNB 3ESKA 3GZSA 1LD8A 2IQCA 2CG2A 4WNGA 4QFVA 4MRUA 4HB5A 3FUFA 3ML8A 1UJKA 3LJNA 3NZSA 3FH8A 3NQPA 2NYJA 2IFUA 2EIKE 1NFIE 2HO1A 3JCKC 3NOGD 3P1UA 2WXPA 1OWNA 3ABLE 3AU5A 5BPPA 1BD8A 2X3MA 4EZLA 2KCKA 4CRWA 5C1DA 2FI7A 2VGXB 1JPLA 2HYZA 4YDEA 4BSXA 4FHKA 4HBDA 4FULA 3Q7AA 3TXNA 2RD0A 4ANVA 2IO2C 3HXCA 1YCSB 5ANLA 4GMJA 4N5QA 4DX5D 3W9GA 2P9SG 1HU3A 4L2LA 3HIZA 3SNXA 3TL5A 3UT4A 2VGYA 1IQRA 1XGWA 1V55E 3L16A 3HYMB 4BETA 3KSLA 2IONA 4ZFHA 5KJLA 2AW6A 3ZU7B 2H6FA 4F6RD 5ENTD 4EPZA 1K1AA 1TNUA 3UKUG 4I1OB 1IKND 3FEXA 2CFZA 3FWVA 3PE4A 3PREA 3QNKA 3OAWA 1JUQA 3I4RB 3QJZA 4CDNA 4BX8A 4HQDA 4I2WA 1E90A 2VGXA 3ZXPA 4H7XA 3HXDA 3ZNGA 1HXIA 2R03A 5JJ7A 2B6CA 3C98A 4XI0A 2P58C
chains in the Genus database with same CATH topology
1Z3XA 3UMVA 2KC7A 5LOZA 3PE3A 1HO8A 1VDYA 2J4BA 2QFCA 4XX5A 3S7DA 4E6HA 5BNWA 5BV1A 3RKVA 4JEHA 3HVEA 3IHYA 3UX4A 2E2EA 3ZFWA 2V0PA 2VTBB 4I6JA 3MV3B 4GYYA 3RRNB 1E7UA 2I1JA 2I1KA 4BTBA 2ILRA 5AJDA 3LVQE 4FJYA 3AS5A 2ZU6B 3S7JA 4B89A 4A1SA 4UQZA 3G2WA 4CGWA 4M3OA 1E8ZA 3EHMA 3FP3A 1MQSA 1DNPA 3LPZA 3LCAA 3U9WA 2WXIA 2XEVA 2WMNA 4DLQA 3MZLB 3LEWA 4LERA 1MHQA 3MX3A 5FT9A 3U3WA 4DK5A 2DCPA 2WPVA 1SZAA 4GZCA 3S7FA 3KS2A 5C2YA 2R5SA 2OV8A 4JA9A 3JQ1A 4JZYA 4YVQC 3KEZA 3PRZA 4U0SA 5G05C 3RRUA 3ULQA 4AM9A 4RG9A 4H7YA 3FUJA 4A1GA 1A17A 4GCOA 2Q7FA 4I17A 3I3NA 3LY9A 3BEEA 4UWLA 4GB9A 2AXUA 3APDA 4OVUA 5E75A 2WXFA 2WVIA 3ZXSA 4U8HA 3SGHA 1EPUA 1N52A 2OVFA 4J0UA 4JC8A 2L0IA 5EX0A 4J8DA 4AEZC 1QZ2A 4HLEA 3VTXA 5D0QD 1OWOA 4ABNA 1QNFA 4TV3A 2X6IA 4AY5A 4Q94A 1UW4B 4GMLA 4GAAA 4N3AA 5DBKA 3FUIA 2ONDA 3FUHA 4DLOA 1HS6A 3CVQA 3L08A 3CVVA 3FU0A 4KXKB 3CVUA 5J08A 4XE0A 4HFGA 5FQ8A 2L6JA 2LNIA 1UG3A 3LS8A 5JHBA 1HH8A 1P5QA 2IU1A 4JHJA 4J6IA 3SBTB 5J90A 4AY6A 4L23A 3Q5MA 4L2YA 3SFZA 3TGOA 3SBSA 4JEUA 4Q96A 2LAIA 4CDMA 2IOSA 2UY1A 2VSXE 4U63A 2A5UA 4ME2A 4WUYA 1E7VA 3Q15A 3UQ3A 5CMWA 3PVLA 5A7DB 3KAEA 2XRYA 4HS2A 3D9KA 5FQ7A 5BV0A 4ILGA 1H2UA 4U07A 3NZUA 3FUKA 1HX8A 4I9CA 4UWFA 2I9CA 2KM4A 4UWHA 2YQ8A 4L1BA 3JYSA 4BT8A 2OOEA 3GZ2A 1U3CA 4A3VA 3EDTB 2XHEA 3L6AA 1PC2A 3BG1B 4GYWA 1PAQA 2M63A 3B7SA 4PDXA 1E8XA 3QOUA 3Q47B 4KVMA 2WQ7A 4XKCA 3BG0B 5ARFA 3I5PA 4EECA 4HOUA 4TUUA 4JVSA 3FY4A 1H2VC 4HVBA 5EX3A 3QKYA 2FF4A 4CGVA 3CGHA 4G2VA 4GU5A 2VSYA 3ESLA 4U0UA 3IBEA 1N54A 2WXOA 3D9LA 1ZU2A 2I2OA 2DIWA 3D9MA 3CIAA 4HOQA 1KT0A 2XPIA 2NSZA 4G26A 4ATGA 2Y4TA 4IRUA 4BTAA 3G2TA 1DVPA 5EDSA 4N39A 2LSVA 5HQ8A 4F3VA 3S2AA 2WXNA 5AJLA 3FTZA 3ML9A 4FA6A 5A6CA 5ANRA 5ENNA 4AIFA 4B8AA 4N2QA 3EIQC 3R9AB 4DJAA 3EIJA 1SQMA 2DBAA 5AIJA 3U4TA 2PQRA 1WY6A 2NC9A 2C0LA 4EZKA 3R7QA 2J49A 3L54A 5KCMA 5CCMA 2J08A 4GCNA 1FVFA 3IKOB 5FQ4A 4GZ6A 1X5BA 2FULA 5HI7A 4NRHB 3CHPA 3FTVA 4XI9A 3B7UX 5EKQD 3CK7A 1OWLA 4DPRA 4RG6A 4KVOA 3SF4A 1NA3A 1JWFA 3UUXA 2VYIA 2HM8A 3FU5A 2XCBA 4PS8A 5A23A 3G2UA 3D9IA 1WAO1 4W9RA 4K0RA 2C2LA 4I43A 2XGMA 2XGOA 2BTDA 3CSFA 5D0OD 1UN8A 3CVNA 4NACA 3UPVA 4JHRA 1HZ4A 1INZA 3QK0A 1B89A 1OUVA 5BW8C 3U64A 5JHAA 4AOFA 2J9QA 1KT1A 5ARGA 5BT1A 2V5FA 3VLEA 3MCXA 2WXRA 4FJZA 4CT4A 3QARA 3SZ7A 3SD5A 1KLXA 3R7RA 3JQ0A 3L17A 2LAHA 3LY8A 3NF1A 4BX9A 2WXMA 3PDNA 4WWNA 1LF8A 2QY7A 3MGBA 3HHMA 4GPKA 4EQFA 4G11A 4CEMA 4I9EA 4I2ZA 4R7LA 2V8SE 1HFAA 4LUNU 3O4ZA 4BY6A 1HG5A 2WQHA 3FUEA 3QAQA 4WWOA 1XNFA 3VLFA 5CCLA 3U66A 3APCA 4OVVA 4F7AA 4LEUA 4JA7A 4JHKA 4XZ4A 5FZSA 4WAFA 4J8EA 4I1AA 4DI3A 3OXLA 5KJMA 1TJCA 2KZTA 4PH4B 5KJNA 1FVHA 3MV2B 4KZCA 4RVBA 2XRZA 4HORA 3RJVA 4UQYA 3B7TA 3MKQB 4GA1A 3IEGA 1NA0A 4I6EA 3CLJA 5FZRA 4ANUA 4APFA 4P29A 2X6JA 1E8WA 4KMOA 3RU0A 2AXZA 4N5CA 1EF1C 2WXLA 3PEUB 3S7BA 4PUCA 4UQXA 4MLPA 4YVOA 1OWMA 3ASFA 2GRLA 3CHQA 3B7RL 2VTBA 4OYSA 1ELWA 5T3RA 4J8SA 1Z3YA 3CKBA 3D9PA 3TJPA 5M72A 3IHVA 5T4YA 5CHEE 5JJTA 2GRMA 3ZVVA 5CMYA 2BF0X 3EHNA 4NQ0A 2KZTB 4ACLA 3PUKA 4HOTA 3HDXA 3GZ1A 4G1TA 3D9OA 3ZHEA 2HR2A 3O48A 4C0EA 2PM7A 3OTNA 1Z6TA 4TRQA 4FLHA 3KD7A 5AYWD 3SI5A 2Y4UA 4IN3B 2YINA 5AENA 4ILHB 3CHOA 5FJYA 1EYHA 2I6HA 4AP2A 3FDHA 5G05J 4U04A 1YA0A 2LO6A 3ASGA 3RRMB 5LP0A 4GZ5A 2UWJG 3CSTA 5G04C 1U3DA 3MKQA 5FTPA 5G04J 3D9JA 5LX8A 2KCLA 3RO3A 3PZDA 2YHEA 3P2BA 2XQ0A 5LFAA 4A55A 4GA2A 2CHWA 1BPOA 3N71A 4FADA 3OXGA 4IULA 3LDZA 3QWVA 3ZYMA 3VTYA 4C9BB 3PNLB 3FEYA 3RIBA 1TEZA 4CDRA 2R59A 2WXGA 2GW1A 2VQ2A 4KZ0A 4FU3A 2VJ8A 4C0MA 4KBQA 3CVLA 3G2VA 4RSYA 4A3TA 4EBAA 2WXKA 2AXVA 1ELRA 2AVPA 3URZA 2LSUA 4G25A 3TG4A 1S0PA 3CV0A 3FUMA 4V3IA 1H0AA 2FEZA 3LYAA 1GW6A 4PS3A 3D9NA 4GZDA 3PUJA 2OVBA 4EBAG 5FZQA 3ASDA 3QWPA 1UJJA 3PEVB 3CVXA 1HG2A 3I4GA 3MJWA 3VLDA 5FQ6A 1H6KA 2X38A 4URKA 3CVYA 3ZW3A 4XKBA 4DI4A 5T8IA 4XIFA 4G24A 4JPSA 3TXMA 4D10C 2J4DA 3B13A 3GW4A 5KJKA 1E8YA 3PH0C 4GA0A 1TJFA 5FWQA 3ZRHA 1E96B 2KCVA 4Y6WA 2J07A 2NXPA 3FFLA 2R17C 3K9IA 2CFUA 2WXHA 3FHEA 5LCWC 5LCWJ 3CEQA 4HXIA 1NP7A 3JUIA 4MKTA 1Y6IA 2BUGA 1HE8A 5DIZA 5E76A 2RG8A 4FHJA 3ZYQA 2FBNA 4ILIA 3T8MA 3CQCB 3ESKA 3GZSA 3UT8A 2L0TB 3IV0A 3ONKA 2J09A 3E4BA 2C0MA 2IQCA 4BFRA 2CG2A 3DPDA 4WNGA 4AV7A 4QFVA 4E85A 4MRUA 4PS7A 5G2NA 3FUFA 2WM9A 3LY7A 1UJKA 3ML8A 4KT6B 4WNEA 3ZYKA 3NZSA 2EQXA 3FH8A 4AVXA 1NZNA 3AS4A 3MYVA 3NQPA 4O6FA 2WMOA 3ENEA 3T5XA 2IFUA 2HO1A 3JCKC 4J8FA 2IJGX 4EZJA 3P1UA 2WXPA 3QWWA 1OWNA 2FO7A 3AU5A 2MRIA 5BPPA 4LCTA 4WNDA 3ZYLA 3FTXA 2XCCA 2X3MA 3APFA 4UWKA 4GZ3A 3ZIMA 4EZLA 2KCKA 2VSNA 4JXTA 4I1MA 2A4ZA 3QDNA 4CRWA 5C1DA 3T5VA 2XPZA 1SZ9A 3CKCA 4KYOB 2XPYA 4NURA 3WXXA 2FI7A 3CHRA 2VGXB 3G2SA 4B8CB 3FH5A 2PZIA 4L7TA 2IF4A 1JPLA 4CT0A 2HYZA 1OWPA 2YNQA 4UI9C 3LXUX 3FTUA 3Q49B 4BSXA 3FH7A 3AS8A 3CK8A 2E0IA 2WXQA 1WM5A 2V4LA 2CHXA 1IQUA 4FHKA 1H19A 4FULA 2CHZA 4ACKA 3ZPJA 3ZHEB 5G55A 3TXNA 2UY1B 2WXJA 4JW1A 1ZBPA 2RD0A 4ANVA 3D3MA 3L13A 3FU3A 1IHGA 4ANWA 4F1SA 2WQ6A 5ANLA 4UWGA 4FC8A 4GMJA 2MHKA 2X6KA 4B94A 5JJ6A 4APOA 3LVRE 1H2TC 1HU3A 4WWPA 4L2LA 4N3BA 2PQNA 3QB2A 3ZGQA 3HIZA 3SNXA 1HF8A 3TL5A 4I6GA 4N3CA 3UT4A 2VGYA 4JL0A 1IQRA 4Q69A 4B0ZA 3SHFA 4HOSA 1XGWA 3CK9A 3L16A 2X6FA 3AU4A 4YNDA 3DBSA 3HYMB 3MKRA 3Q4AB 4BT9A 3FTWA 2AWIA 2YHCA 4BWRA 2IONA 2X6HA 3RO2A 4FP7A 4FLBA 5BUZA 1Y8MA 3MEKA 4G23A 3CHSA 5KJLA 3TAXA 2AW6A 3PNTB 3CVWA 4N2SA 2L9BA 3FUNA 2Y3AA 1FCHA 4EPZA 4ANXA 4IYPA 3PS6A 1JWGA 3CR3A 2GGFA 3L22A 4I1OB 3LKUA 2XGSA 1EDUA 1UN9A 4MS6A 3ZEFA 3FEXA 2CFZA 1PY1A 3FWVA 3MA5A 3PE4A 3PREA 3QNKA 4K03A 3TG5A 3OAWA 2MOWA 1JUQA 3ONLA 4AJWA 3I4RB 4U0ZA 3QJZA 2JEKA 4Y6CA 1IYGA 3LJ3A 4UI9K 2WB2A 4WNFA 4CDNA 2IOLA 3RK6A 3EJNA 3QC1A 4BX8A 3HVEB 2JLBA 3OXFA 4I2WA 1L5JA 1W3BA 1E90A 2VGXA 2PL2A 2VSOE 3UT7A 1QQEA 4H7XA 3FUDA 3FULA 4F53A 2CG3A 3GYZA 3ZN3A 1HXIA 3CHMA 2KATA 3FU6A 5JJ7A 1ELKA 3FTSA 4UI9J 3CVPA 4CCAA 3ASHA 3C98A 3CQGB 2PM6A 3FTYA 4GYOA 4XI0A 4LRZA 4AXHA 2P58C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  4IN3 B;  2FO7 A;  2KC7 A;  4N39 A;  2LSV A;  5HQ8 A;  4F3V A;  4WND A;  3PE3 A;  2QFC A;  3QWW A;  3S7D A;  5BNW A;  5FJY A;  3RKV A;  2I6H A;  2XCC A;  2E2E A;  3ZFW A;  4GZ3 A;  5A6C A;  2KCK A;  2VSN A;  5G05 J;  4AIF A;  4U04 A;  3R9A B;  3MV3 B;  3QDN A;  2DBA A;  4GYY A;  1YA0 A;  3ASG A;  5C1D A;  4BTB A;  4GZ5 A;  3AS5 A;  3S7J A;  3U4T A;  2PQR A;  4A1S A;  2UWJ G;  3CKC A;  4KYO B;  2NC9 A;  4UQZ A;  2C0L A;  5FTP A;  5G04 C;  3WXX A;  4CGW A;  2FI7 A;  5CCM A;  5G04 J;  3FP3 A;  2VGX B;  4GCN A;  3LPZ A;  2KCL A;  3LCA A;  2PZI A;  2IF4 A;  2XEV A;  4GZ6 A;  3RO3 A;  5HI7 A;  4NRH B;  2HYZ A;  5FT9 A;  3U3W A;  4UI9 C;  2WPV A;  3Q49 B;  4XI9 A;  5EKQ D;  4GA2 A;  3S7F A;  3CK7 A;  3AS8 A;  2R5S A;  3CK8 A;  3KS2 A;  3N71 A;  4JA9 A;  4RG6 A;  4YVQ C;  4U0S A;  1WM5 A;  5G05 C;  3SF4 A;  3ULQ A;  3OXG A;  4AM9 A;  1NA3 A;  3QWV A;  4H7Y A;  2VYI A;  4RG9 A;  3UUX A;  2XCB A;  1A17 A;  3VTY A;  4GCO A;  2Q7F A;  4I17 A;  3LY9 A;  3ZPJ A;  3BEE A;  3ZHE B;  2UY1 B;  3RIB A;  1ZBP A;  4CDR A;  1WAO 1;  4W9R A;  2GW1 A;  2C2L A;  2VQ2 A;  2XGM A;  1IHG A;  4J0U A;  2XGO A;  4KBQ A;  5D0O D;  3CVL A;  3UPV A;  3CVN A;  5EX0 A;  4J8D A;  1QZ2 A;  4JHR A;  1HZ4 A;  1ELR A;  2AVP A;  2MHK A;  3URZ A;  1B89 A;  1OUV A;  5D0Q D;  5JJ6 A;  5BW8 C;  3VTX A;  4ABN A;  2LSU A;  4G25 A;  4APO A;  4B94 A;  3TG4 A;  3CV0 A;  2J9Q A;  1KT1 A;  4N3B A;  5ARG A;  2FEZ A;  2PQN A;  3LYA A;  3ZGQ A;  4N3A A;  5DBK A;  5BT1 A;  2OND A;  2V5F A;  4N3C A;  3CVQ A;  2VGY A;  4JL0 A;  4KXK B;  5FZQ A;  2L6J A;  2LNI A;  3ASD A;  3QWP A;  3SZ7 A;  1HH8 A;  1P5Q A;  3CK9 A;  4HOS A;  1KLX A;  4AY6 A;  4YND A;  3Q5M A;  3HYM B;  3MKR A;  3Q4A B;  4BT9 A;  2YHC A;  3LY8 A;  4BWR A;  3NF1 A;  4XIF A;  4G24 A;  3TGO A;  3RO2 A;  3GW4 A;  5KJK A;  1Y8M A;  3MEK A;  3PDN A;  4G23 A;  5KJL A;  3TAX A;  4N2S A;  4GA0 A;  4GPK A;  2UY1 A;  4EQF A;  1E96 B;  2KCV A;  4Y6W A;  4I9E A;  4ME2 A;  4I2Z A;  4WUY A;  3FFL A;  3Q15 A;  3UQ3 A;  4BTA A;  3K9I A;  5LCW C;  4N2Q A;  1FCH A;  5A7D B;  3KAE A;  5LCW J;  2WQH A;  3CEQ A;  1XNF A;  2BUG A;  5CCL A;  5DIZ A;  4U07 A;  3LKU A;  2FBN A;  2XGS A;  4I9C A;  4LEU A;  4JA7 A;  3MA5 A;  3ESK A;  3FWV A;  3PE4 A;  4J8E A;  4I1A A;  2YQ8 A;  3OXL A;  5FZS A;  3TG5 A;  5KJM A;  1TJC A;  5KJN A;  4HOR A;  3JYS A;  4BT8 A;  2OOE A;  3MV2 B;  3GZ2 A;  3RJV A;  4U0Z A;  3E4B A;  4UQY A;  2C0M A;  4GA1 A;  3IEG A;  1NA0 A;  4Y6C A;  3EDT B;  5FZR A;  1IYG A;  1PC2 A;  4AY5 A;  4WNG A;  4GYW A;  4UI9 K;  3RU0 A;  4N5C A;  4WNF A;  3QOU A;  3Q47 B;  4UQX A;  3S7B A;  4YVO A;  2JLB A;  3ASF A;  5ARF A;  3LY7 A;  3OXF A;  4WNE A;  4I2W A;  4HOU A;  1ELW A;  1W3B A;  2VGX A;  2PL2 A;  1QQE A;  3CKB A;  2FF4 A;  3QKY A;  4H7X A;  5EX3 A;  1NZN A;  5M72 A;  3AS4 A;  3GYZ A;  3ZN3 A;  4G2V A;  4CGV A;  5CHE E;  2VSY A;  4O6F A;  5JJT A;  1HXI A;  4U0U A;  2KAT A;  5JJ7 A;  4NQ0 A;  4UI9 J;  4HOT A;  3GZ1 A;  2IFU A;  3CVP A;  1ZU2 A;  4G1T A;  3ASH A;  2HO1 A;  3ZHE A;  2HR2 A;  3O48 A;  4HOQ A;  4J8F A;  4GYO A;  1KT0 A;  2XPI A;  4G26 A;  4XI0 A;  5AYW D;  3KD7 A;  2Y4T A;  2P58 C; 
#chains in the Genus database with same CATH topology
 4XX5 A;  1N0Q A;  4E6H A;  3HVE A;  3UX4 A;  2E2E A;  3ZFW A;  3MV3 B;  1AP7 A;  3LVQ E;  4UQZ A;  4M3O A;  1E8Z A;  3WG7 E;  1MQS A;  1DNP A;  3LCA A;  3U9W A;  2WXI A;  1MHQ A;  3TWR A;  1H6P A;  2P9L G;  5C2Y A;  2OV8 A;  4JA9 A;  3JQ1 A;  4YVQ C;  3RRU A;  5G05 C;  2Y0B G;  3PRZ A;  3FUJ A;  1G3N B;  3BEE A;  4GB9 A;  2AXU A;  5E75 A;  3UM0 A;  4U8H A;  2L0I A;  4K5A B;  4GPM A;  4CYM D;  3VTX A;  1OWO A;  1X81 A;  1QNF A;  4Q94 A;  2BKK B;  4LG6 A;  2OND A;  4DLO A;  3CVV A;  3FU0 A;  5J08 A;  5CBO A;  4XE0 A;  2L6J A;  3LS8 A;  1HH8 A;  3TGO A;  3SBS A;  4Q96 A;  2LAI A;  1NI1 A;  4U63 A;  1E7V A;  5CMW A;  2XRY A;  4GTS A;  5KBA A;  3FUK A;  1HX8 A;  4I9C A;  4L1B A;  2OOE A;  5HKP A;  4A3V A;  2ETC A;  3EDT B;  1O5M A;  4GYW A;  2M63 A;  1E8X A;  3Q47 B;  4KVM A;  4XKC A;  1IHB A;  5ARF A;  3FY4 A;  3T9K A;  5EX3 A;  3CGH A;  4U0U A;  1ZU2 A;  1LTX A;  2XPI A;  4ATG A;  2Y4T A;  4IRU A;  3G2T A;  2QYU A;  4ATZ D;  2WXN A;  2R2L A;  5ANR A;  5ENN A;  3EIQ C;  3R9A B;  2KXP C;  2PQR A;  5KCM A;  3FTV A;  4XI9 A;  4RG6 A;  1JWF A;  3FU5 A;  2HM8 A;  5CED B;  5A23 A;  2GRP B;  3C72 A;  3EUV A;  4W9R A;  4K0R A;  4LSZ E;  3UPV A;  4NAC A;  3HXF A;  1KT1 A;  3V31 A;  5ARG A;  5BT1 A;  2RFA A;  2WXR A;  1QYM A;  3SY2 A;  3DSS A;  4Z68 A;  3JQ0 A;  4BX9 A;  1BI7 B;  3MGB A;  3SQV A;  4G11 A;  4R7L A;  3EHQ A;  4LUN U;  4BY6 A;  1HG5 A;  3FUE A;  3U66 A;  3ZKJ A;  5FZS A;  4WAF A;  4J8E A;  5KJM A;  2KZT A;  5KJN A;  2XRZ A;  1FVH A;  1JCQ A;  3RJV A;  4UQY A;  3B7T A;  2X6J A;  1N9A A;  1EF1 C;  4HRM B;  5AQB A;  4YVO A;  2GRL A;  3CHQ A;  1K1B A;  4J8S A;  2F0Y A;  2GRM A;  3ZVV A;  5CMY A;  4ACL A;  4NQ0 A;  1S64 A;  3ZHE A;  3O48 A;  1OCC E;  2PM7 A;  3OTN A;  1Z6T A;  5AAR A;  3KD7 A;  2YIN A;  3FDH A;  4U04 A;  5LP0 A;  3RRM B;  4U8Y D;  5ENP D;  4GZ5 A;  3E37 A;  1D9S A;  2UWJ G;  3CST A;  1TR4 A;  5LX8 A;  4GMR A;  3PZD A;  2QC9 A;  1S63 A;  3P2B A;  4K5B A;  3N71 A;  1K3Z D;  4IUL A;  3D9H A;  4C9B B;  1RW2 A;  3PNL B;  3FEY A;  3RIB A;  4CDR A;  2WXG A;  2GW1 A;  4FU3 A;  1YYH A;  3G2V A;  2IO3 C;  3TG4 A;  1S0P A;  2GRR B;  2FO1 E;  3PUJ A;  4EBA G;  3RAU A;  3ASD A;  4HRN A;  1UJJ A;  3PEV B;  1HG2 A;  3MJW A;  3VLD A;  1H6K A;  5AQ7 A;  3BQO A;  3B13 A;  3PH0 C;  4JB8 P;  1E96 B;  2P9P G;  3K9I A;  2WXH A;  5LCW J;  4HXI A;  1N4S A;  1NP7 A;  3JUI A;  4MKT A;  5D2M C;  5EN5 D;  5DIZ A;  2F8X K;  3ZYQ A;  3EU5 A;  4M7C A;  3IV0 A;  3ONK A;  2J09 A;  3E4B A;  1OXJ A;  2C0M A;  2OEW A;  4LNG A;  5CEC B;  4AV7 A;  1JCS A;  5AN8 A;  3LY7 A;  4WNE A;  3ZYK A;  2RFM A;  2EQX A;  3B95 A;  3NB2 A;  1SA5 A;  2IJG X;  3QWW A;  1O1S A;  4WND A;  2XEH A;  2XCC A;  3APF A;  4UWK A;  4JXT A;  3DPY A;  3T5V A;  3DXK G;  2XPZ A;  5BXO A;  4KYO B;  1WG0 A;  2XPY A;  4NUR A;  3WXX A;  3CHR A;  2V4H C;  2PZI A;  4LNB A;  3AG3 E;  1MX6 A;  3ZUV B;  2DWZ A;  3ZHE B;  1ZBP A;  3FU3 A;  5EYL A;  4F1S A;  2ETA A;  2WQ6 A;  4FC8 A;  3Q9U C;  5EYP F;  5JJ6 A;  1H2T C;  4N3B A;  3QB2 A;  2XZD G;  4GTT A;  4B0Z A;  3CK9 A;  2X6F A;  3AU4 A;  4CT0 A;  4YND A;  3DBS A;  3MKR A;  4BT9 A;  3Q4A B;  2YHC A;  2X6H A;  3RO2 A;  4FP7 A;  1SW6 A;  2DZN A;  4G23 A;  4N2S A;  4ANX A;  4IYP A;  1JWG A;  3CR3 A;  2XGS A;  3UKR G;  1EDU A;  1UN9 A;  3MA5 A;  4K03 A;  4NIK A;  2MOW A;  2XS8 A;  2BKG A;  4Y6C A;  3RK6 A;  3EJN A;  3UT7 A;  5FIN A;  3GYZ A;  3ZN3 A;  3CHM A;  2KAT A;  4UI9 J;  1N4Q A;  4LRZ A;  3UM1 A;  3UMV A;  5D66 A;  1HO8 A;  1VDY A;  5BNW A;  1JCR A;  2V0P A;  5AQA A;  4I6J A;  1E7U A;  3AG2 E;  2ILR A;  4FJY A;  3AS5 A;  2ZU6 B;  4CGW A;  3EHM A;  3JXI A;  4DLQ A;  4JZY A;  3ULQ A;  4RG9 A;  2P9I G;  1ZB1 A;  2Q7F A;  3LY9 A;  4ZHB A;  4UWL A;  4OVU A;  2F8Y A;  2WVI A;  4DRX E;  1N52 A;  4J0U A;  5EX0 A;  1QZ2 A;  4TV3 A;  4GML A;  4GAA A;  3CVQ A;  4KXK B;  1YMP A;  5FQ8 A;  5JHB A;  4JHJ A;  4AY6 A;  4L23 A;  3Q5M A;  5KNG A;  3Q75 A;  4JEU A;  3UXG A;  3Q7F A;  2IOS A;  2UY1 A;  4ME2 A;  4WUY A;  4BER A;  3PVL A;  4HS2 A;  2QZA A;  4U07 A;  3J5Q B;  3SFX A;  2YQ8 A;  3JYS A;  4BT8 A;  4JD2 G;  5ENQ D;  3BG1 B;  4PDX A;  3UIO C;  3DXM G;  3BG0 B;  3I5P A;  4BES A;  4JVS A;  4HVB A;  3QKY A;  2FF4 A;  3ASO E;  1OCO E;  2LXL A;  2DIW A;  1KT0 A;  2NSZ A;  4BTA A;  5EIB E;  2MYO A;  2LSV A;  5B3S E;  1N0R A;  3ML9 A;  4AIF A;  3U4T A;  2C0L A;  2J49 A;  4GCN A;  1FVF A;  5FQ4 A;  1BU9 A;  4X8Q A;  3NOC D;  3C3O A;  3B7U X;  1TN6 A;  3L82 A;  1DCQ A;  3D9I A;  2XGM A;  2XGO A;  1UN8 A;  3KSQ A;  1TNZ A;  1HZ4 A;  1INZ A;  2EIL E;  2VGE A;  1UOH A;  4G8L A;  4FJZ A;  2B0O E;  3R7R A;  4DX6 D;  1TNO A;  3PDN A;  4WWN A;  1LF8 A;  4EQF A;  4I2Z A;  4F7A A;  4XZ4 A;  4DI3 A;  4I1A A;  3MV2 B;  4RVB A;  3E32 A;  3MKQ B;  3IEG A;  1NA0 A;  4I6E A;  4ANU A;  1E8W A;  1N95 A;  3S7B A;  4PUC A;  5KNH D;  1OWM A;  5B1B E;  1ELW A;  3D9P A;  3V2X A;  3EHN A;  2EIN E;  4HOT A;  3GZ1 A;  4G1T A;  3D9O A;  4FLH A;  4AP2 A;  1YA0 A;  2LO6 A;  3L9T A;  5G04 C;  3MKQ A;  5FTP A;  1TN8 A;  3TWW A;  2KBX A;  2XS1 A;  3TWQ A;  4FAD A;  1BPO A;  4O60 A;  2GRQ B;  3QWV A;  2VQ2 A;  4KZ0 A;  1BI8 B;  4TXP A;  2VJ8 A;  4C48 B;  4TXQ A;  4RSY A;  4HLL A;  3URZ A;  2LSU A;  4G25 A;  2HE0 A;  2FEZ A;  3LYA A;  1GW6 A;  4PS3 A;  3D9N A;  2A5E A;  2ZGD A;  3QWP A;  3CVX A;  5FQ6 A;  3CVY A;  4URK A;  3Q79 A;  3PZ2 A;  5T8I A;  4JPS A;  4D10 C;  5KJK A;  4GA0 A;  2NXP A;  5FIO A;  2R17 C;  2FBN A;  3T8M A;  3UT8 A;  2L0T B;  2Y1L E;  4B93 B;  3R9M A;  3DPD A;  1N11 A;  4E85 A;  4PS7 A;  5G2N A;  3TWU A;  2WM9 A;  4YDY A;  2EIJ E;  3AS4 A;  3DSW A;  2WMO A;  1SVX A;  2XEN A;  5BXU A;  4GZ3 A;  2VSN A;  3QDN A;  3HG0 D;  4YDO A;  3G2S A;  3FH5 A;  5CBN A;  4L7T A;  2IF4 A;  1OWP A;  2YNQ A;  4UI9 C;  3LXU X;  2WXQ A;  2DZO A;  1FT1 A;  2CHZ A;  3ZPJ A;  5G55 A;  2UY1 B;  4JW1 A;  1IHG A;  4ANW A;  4UWG A;  2MHK A;  2X6K A;  2EIM E;  3LVR E;  4WWP A;  1HF8 A;  3W9F A;  4I6G A;  4JL0 A;  4Q69 A;  3SHF A;  2AWI A;  4BWR A;  5HS0 A;  4FLB A;  4GTP A;  3CHS A;  3TAX A;  3CVW A;  2L9B A;  2Y3A A;  1FCH A;  4U7E B;  2XZT G;  3L22 A;  3LKU A;  3ONL A;  2H6I A;  2P9U G;  4U0Z A;  2JEK A;  1IYG A;  3LJ3 A;  4UI9 K;  2WB2 A;  4WNF A;  3HXE A;  2JLB A;  3OXF A;  1L5J A;  2PL2 A;  2VSO E;  1QQE A;  3FUD A;  2R05 A;  3FUL A;  2CG3 A;  3FU6 A;  4GTM A;  1ELK A;  3FTS A;  3CVP A;  3ASH A;  2PM6 A;  4GYO A;  5CEA A;  4AXH A;  3TG5 A;  3DRA A;  5LOZ A;  2J4B A;  2QFC A;  2P9N G;  3HXB A;  5BV1 A;  3RKV A;  5ENS D;  3RRN B;  2ETB A;  4BTB A;  5AJD A;  4A1S A;  4K5C A;  2IY0 C;  3LPZ A;  1NL4 A;  3PZ1 A;  4LER A;  3LEW A;  4U95 D;  5FT9 A;  3U3W A;  5AAO A;  2DCP A;  1SZA A;  1TN7 A;  2DVW A;  3KS2 A;  3KEZ A;  3E34 A;  3ISM C;  2H6H A;  4AM9 A;  4H7Y A;  1A17 A;  4GCO A;  4YDW A;  3I3N A;  1MYO A;  3APD A;  2WXF A;  3ZXS A;  4JC8 A;  5EID A;  4HRL A;  4AY5 A;  2ZXW E;  3DEO A;  2GRN B;  1UG3 A;  3UM2 A;  5J90 A;  1WDY A;  4L2Y A;  1BLX B;  4CDM A;  2VSX E;  3UI2 A;  2A5U A;  3Q15 A;  3UQ3 A;  2AJA A;  5FQ7 A;  1H2U A;  3NZU A;  2I9C A;  2KM4 A;  1TYQ G;  3GZ2 A;  1U3C A;  3L6A A;  1PAQ A;  3JXJ A;  4EEC A;  2XEE A;  4HOU A;  4TUU A;  4XEI G;  1FPP A;  4CGV A;  4G2V A;  4GU5 A;  3DSV A;  3IBE A;  2WXO A;  3D9M A;  3CIA A;  3T8K A;  4HOQ A;  4G26 A;  1DVP A;  4N39 A;  5HQ8 A;  2Y69 E;  4FA6 A;  4N2Q A;  3EIJ A;  1SQM A;  2DBA A;  3ABM E;  2NC9 A;  3R7Q A;  5KWD A;  3AAA C;  3L54 A;  1FT2 A;  2J08 A;  3IKO B;  1X5B A;  2FUL A;  4NRH B;  4BSZ B;  1OWL A;  3J5P A;  5ENO D;  3SF4 A;  4DX2 A;  1NA3 A;  3UUX A;  3BU8 A;  4G8K A;  2C2L A;  4MBG A;  5D0O D;  2BTD A;  2DYS E;  1OUV A;  4TUM A;  5BW8 C;  5JHA A;  1S70 B;  4DX7 D;  4J7W A;  2ZGG A;  1D8D A;  3QAR A;  3SZ7 A;  1OT8 A;  1TNB A;  4EHM A;  3LY8 A;  3NF1 A;  4F1P A;  4GPK A;  3HHM A;  3JUE A;  4CEM A;  4I9E A;  2V8S E;  1HFA A;  2WQH A;  1MZC A;  1XNF A;  5CCL A;  1MJ0 A;  4LEU A;  4HI8 A;  1TJC A;  4KZC A;  4RQI A;  4P29 A;  2WXL A;  3AG4 E;  3AJI A;  3TWT A;  3B7R L;  4OYS A;  4UUC A;  5B1A E;  3TJP A;  3IHV A;  5CHE E;  5JJT A;  3HDX A;  2GRO B;  3EU9 A;  1DC2 A;  4TRQ A;  3X2Q E;  2JAB A;  3CHO A;  1EYH A;  2DYR E;  1OY3 D;  2J8S D;  2LXM A;  1U3D A;  3AG1 E;  5G04 J;  2KCL A;  4BEP A;  2BED A;  2YHE A;  2XQ0 A;  5LFA A;  4A55 A;  4GA2 A;  2CHW A;  3Q73 A;  3OXG A;  3LDZ A;  5ENR D;  3VTY A;  1Z5S C;  3BUA A;  1O1T A;  1TEZ A;  2R59 A;  4KBQ A;  3DSX A;  4EBA A;  2WXK A;  2AXV A;  2AVP A;  3UTM A;  3FUM A;  4V3I A;  4DUI A;  5FZQ A;  4GTR A;  3TWS A;  1SA4 A;  4DI4 A;  4XIF A;  4G24 A;  3TXM A;  2J4D A;  1E8Y A;  1TJF A;  2OEV A;  3ZRH A;  2KCV A;  2J07 A;  2CFU A;  3CEQ A;  1Y6I A;  2P2C P;  2BUG A;  1HE8 A;  4FHJ A;  1MX4 A;  3CQC B;  4CZ2 D;  4BFR A;  3ASN E;  4KT6 B;  4AVX A;  1NZN A;  3MYV A;  4O6F A;  3ENE A;  3T5X A;  1N4P A;  4J8F A;  4EZJ A;  2FO7 A;  2MRI A;  4LCT A;  3ZYL A;  3FTX A;  3ZIM A;  5H7P A;  4I1M A;  2A4Z A;  3HRA A;  1KPS B;  1SZ9 A;  4U8V D;  3CKC A;  1LD7 A;  3Q9N C;  4B8C B;  5JA4 D;  3FTU A;  3Q49 B;  3FH7 A;  3AS8 A;  3CK8 A;  2E0I A;  1WM5 A;  2V4L A;  3TWV A;  2CHX A;  1IQU A;  1H19 A;  3KEA A;  4ACK A;  2WXJ A;  2RKK A;  3D3M A;  3L13 A;  4GTQ A;  3V79 K;  5CER B;  2F37 A;  4B94 A;  4APO A;  2PQN A;  3ZGQ A;  4GTO A;  4N3C A;  3PZ3 A;  4HOS A;  3E30 A;  4L9P A;  2V5Q C;  3ABK E;  3FTW A;  1RZ4 A;  5BUZ A;  1Y8M A;  3MEK A;  3PNT B;  3FUN A;  2PNN A;  3PS6 A;  2GGF A;  4MS6 A;  3ZEF A;  4OAU C;  1PY1 A;  4A63 B;  4AJW A;  2LUH A;  4OAV B;  1Q2Z A;  2IOL A;  3QC1 A;  3HVE B;  1W3B A;  4F53 A;  4CCA A;  3CQG B;  3FTY A;  5HRY A;  1Z3X A;  2KC7 A;  4O1P A;  3PE3 A;  1TNY A;  3S7D A;  4JEH A;  3IHY A;  2VTB B;  4GYY A;  2I1J A;  2I1K A;  4B89 A;  3UIN C;  3S7J A;  2ZIR A;  3G2W A;  4QQI A;  3FP3 A;  2XEV A;  2WMN A;  3MZL B;  3MX3 A;  4DK5 A;  2WPV A;  4GZC A;  3S7F A;  1KZO A;  2R5S A;  4U0S A;  3V2O A;  2H6G A;  4A1G A;  4I17 A;  5JMN D;  3SGH A;  1EPU A;  2OVF A;  4AEZ C;  4J8D A;  4HLE A;  5D0Q D;  4ABN A;  2X6I A;  1UW4 B;  2QYJ A;  4N3A A;  5DBK A;  3FUI A;  3FUH A;  1AWC B;  1HS6 A;  3L08 A;  3CVU A;  4HFG A;  2LNI A;  5CRV A;  2IU1 A;  1P5Q A;  3SBT B;  4J6I A;  4RLY A;  3SFZ A;  4HNA D;  4GTV A;  3TWX A;  5A7D B;  3KAE A;  3D9K A;  5BV0 A;  4ILG A;  4UWF A;  4UWH A;  1U2V G;  2XHE A;  1PC2 A;  3B7S A;  3QOU A;  2WQ7 A;  1V54 E;  1H2V C;  1O1R A;  2L6B A;  2VSY A;  3C3Q A;  1KZP A;  3ESL A;  3IXE A;  1N54 A;  1A5E A;  3D9L A;  2I2O A;  5EDS A;  1OCZ E;  4F3V A;  3S2A A;  5AJL A;  3FTZ A;  5A6C A;  4B8A A;  4DJA A;  3C5R A;  5AIJ A;  3SO8 A;  1WY6 A;  4EZK A;  4TXR A;  5CCM A;  4GZ6 A;  5CRU A;  5HI7 A;  3CHP A;  3PZ4 A;  5EKQ D;  3CK7 A;  4DPR A;  4KVO A;  5IY5 E;  2VYI A;  4PS8 A;  2XCB A;  3G2U A;  3V30 A;  1WAO 1;  4I43 A;  4DX1 A;  3CSF A;  3CVN A;  3DEP A;  4JHR A;  3QK0 A;  1B89 A;  3U64 A;  4AOF A;  2J9Q A;  5AQ9 A;  1QBQ A;  2V5F A;  3VLE A;  3MCX A;  4CT4 A;  3F6Q A;  3SD5 A;  1KLX A;  3B7B A;  3L17 A;  3SFY A;  2LAH A;  3ULY A;  2WXM A;  1DCE A;  2QY7 A;  2ZIS A;  3O4Z A;  4J8Y A;  1K8K G;  3QAQ A;  4WWO A;  3VLF A;  1MX2 A;  3APC A;  4OVV A;  4JA7 A;  4JHK A;  3OXL A;  3Q78 A;  4HOR A;  4PH4 B;  3DST A;  4GA1 A;  3CLJ A;  5FZR A;  4APF A;  4KMO A;  3RU0 A;  2AXZ A;  4N5C A;  3PEU B;  4UQX A;  4MLP A;  5ITZ F;  3ASF A;  2VTB A;  5T3R A;  1Z3Y A;  3CKB A;  5M72 A;  5T4Y A;  1H6O A;  2BF0 X;  2KZT B;  3PUK A;  2HR2 A;  4C0E A;  1D8E A;  3SI5 A;  5AYW D;  2Y4U A;  4IN3 B;  5EIL A;  3UIP C;  5AEN A;  4ILH B;  5FJY A;  2I6H A;  5G05 J;  3ASG A;  3DWL G;  4HI9 A;  1OCR E;  3D9J A;  3RO3 A;  2OCC E;  1IXV A;  3ZYM A;  3RSE G;  3E33 A;  3EHR A;  4LNU D;  4C0M A;  4O1O A;  3CVL A;  3NAW A;  4A3T A;  1ELR A;  3CV0 A;  2R02 A;  1H0A A;  2P9K G;  4GZD A;  2OVB A;  3I4G A;  2X38 A;  3ULE G;  3ZW3 A;  4XKB A;  1N94 A;  3GW4 A;  5FWQ A;  4Y6W A;  3FFL A;  2IEJ A;  5LCW C;  3FHE A;  3C3R A;  3UM3 A;  1N4R A;  2RG8 A;  5E76 A;  4ILI A;  4U96 D;  3DSU A;  3NBN B;  3ESK A;  3GZS A;  1LD8 A;  2IQC A;  2CG2 A;  4WNG A;  4QFV A;  4MRU A;  4HB5 A;  3FUF A;  3ML8 A;  1UJK A;  3LJN A;  3NZS A;  3FH8 A;  3NQP A;  2NYJ A;  2IFU A;  2EIK E;  1NFI E;  2HO1 A;  3JCK C;  3NOG D;  3P1U A;  2WXP A;  1OWN A;  3ABL E;  3AU5 A;  5BPP A;  1BD8 A;  2X3M A;  4EZL A;  2KCK A;  4CRW A;  5C1D A;  2FI7 A;  2VGX B;  1JPL A;  2HYZ A;  4YDE A;  4BSX A;  4FHK A;  4HBD A;  4FUL A;  3Q7A A;  3TXN A;  2RD0 A;  4ANV A;  2IO2 C;  3HXC A;  1YCS B;  5ANL A;  4GMJ A;  4N5Q A;  4DX5 D;  3W9G A;  2P9S G;  1HU3 A;  4L2L A;  3HIZ A;  3SNX A;  3TL5 A;  3UT4 A;  2VGY A;  1IQR A;  1XGW A;  1V55 E;  3L16 A;  3HYM B;  4BET A;  3KSL A;  2ION A;  4ZFH A;  5KJL A;  2AW6 A;  3ZU7 B;  2H6F A;  4F6R D;  5ENT D;  4EPZ A;  1K1A A;  1TNU A;  3UKU G;  4I1O B;  1IKN D;  3FEX A;  2CFZ A;  3FWV A;  3PE4 A;  3PRE A;  3QNK A;  3OAW A;  1JUQ A;  3I4R B;  3QJZ A;  4CDN A;  4BX8 A;  4HQD A;  4I2W A;  1E90 A;  2VGX A;  3ZXP A;  4H7X A;  3HXD A;  3ZNG A;  1HXI A;  2R03 A;  5JJ7 A;  2B6C A;  3C98 A;  4XI0 A;  2P58 C; 
#chains in the Genus database with same CATH homology
 1Z3X A;  3UMV A;  2KC7 A;  5LOZ A;  3PE3 A;  1HO8 A;  1VDY A;  2J4B A;  2QFC A;  4XX5 A;  3S7D A;  4E6H A;  5BNW A;  5BV1 A;  3RKV A;  4JEH A;  3HVE A;  3IHY A;  3UX4 A;  2E2E A;  3ZFW A;  2V0P A;  2VTB B;  4I6J A;  3MV3 B;  4GYY A;  3RRN B;  1E7U A;  2I1J A;  2I1K A;  4BTB A;  2ILR A;  5AJD A;  3LVQ E;  4FJY A;  3AS5 A;  2ZU6 B;  3S7J A;  4B89 A;  4A1S A;  4UQZ A;  3G2W A;  4CGW A;  4M3O A;  1E8Z A;  3EHM A;  3FP3 A;  1MQS A;  1DNP A;  3LPZ A;  3LCA A;  3U9W A;  2WXI A;  2XEV A;  2WMN A;  4DLQ A;  3MZL B;  3LEW A;  4LER A;  1MHQ A;  3MX3 A;  5FT9 A;  3U3W A;  4DK5 A;  2DCP A;  2WPV A;  1SZA A;  4GZC A;  3S7F A;  3KS2 A;  5C2Y A;  2R5S A;  2OV8 A;  4JA9 A;  3JQ1 A;  4JZY A;  4YVQ C;  3KEZ A;  3PRZ A;  4U0S A;  5G05 C;  3RRU A;  3ULQ A;  4AM9 A;  4RG9 A;  4H7Y A;  3FUJ A;  4A1G A;  1A17 A;  4GCO A;  2Q7F A;  4I17 A;  3I3N A;  3LY9 A;  3BEE A;  4UWL A;  4GB9 A;  2AXU A;  3APD A;  4OVU A;  5E75 A;  2WXF A;  2WVI A;  3ZXS A;  4U8H A;  3SGH A;  1EPU A;  1N52 A;  2OVF A;  4J0U A;  4JC8 A;  2L0I A;  5EX0 A;  4J8D A;  4AEZ C;  1QZ2 A;  4HLE A;  3VTX A;  5D0Q D;  1OWO A;  4ABN A;  1QNF A;  4TV3 A;  2X6I A;  4AY5 A;  4Q94 A;  1UW4 B;  4GML A;  4GAA A;  4N3A A;  5DBK A;  3FUI A;  2OND A;  3FUH A;  4DLO A;  1HS6 A;  3CVQ A;  3L08 A;  3CVV A;  3FU0 A;  4KXK B;  3CVU A;  5J08 A;  4XE0 A;  4HFG A;  5FQ8 A;  2L6J A;  2LNI A;  1UG3 A;  3LS8 A;  5JHB A;  1HH8 A;  1P5Q A;  2IU1 A;  4JHJ A;  4J6I A;  3SBT B;  5J90 A;  4AY6 A;  4L23 A;  3Q5M A;  4L2Y A;  3SFZ A;  3TGO A;  3SBS A;  4JEU A;  4Q96 A;  2LAI A;  4CDM A;  2IOS A;  2UY1 A;  2VSX E;  4U63 A;  2A5U A;  4ME2 A;  4WUY A;  1E7V A;  3Q15 A;  3UQ3 A;  5CMW A;  3PVL A;  5A7D B;  3KAE A;  2XRY A;  4HS2 A;  3D9K A;  5FQ7 A;  5BV0 A;  4ILG A;  1H2U A;  4U07 A;  3NZU A;  3FUK A;  1HX8 A;  4I9C A;  4UWF A;  2I9C A;  2KM4 A;  4UWH A;  2YQ8 A;  4L1B A;  3JYS A;  4BT8 A;  2OOE A;  3GZ2 A;  1U3C A;  4A3V A;  3EDT B;  2XHE A;  3L6A A;  1PC2 A;  3BG1 B;  4GYW A;  1PAQ A;  2M63 A;  3B7S A;  4PDX A;  1E8X A;  3QOU A;  3Q47 B;  4KVM A;  2WQ7 A;  4XKC A;  3BG0 B;  5ARF A;  3I5P A;  4EEC A;  4HOU A;  4TUU A;  4JVS A;  3FY4 A;  1H2V C;  4HVB A;  5EX3 A;  3QKY A;  2FF4 A;  4CGV A;  3CGH A;  4G2V A;  4GU5 A;  2VSY A;  3ESL A;  4U0U A;  3IBE A;  1N54 A;  2WXO A;  3D9L A;  1ZU2 A;  2I2O A;  2DIW A;  3D9M A;  3CIA A;  4HOQ A;  1KT0 A;  2XPI A;  2NSZ A;  4G26 A;  4ATG A;  2Y4T A;  4IRU A;  4BTA A;  3G2T A;  1DVP A;  5EDS A;  4N39 A;  2LSV A;  5HQ8 A;  4F3V A;  3S2A A;  2WXN A;  5AJL A;  3FTZ A;  3ML9 A;  4FA6 A;  5A6C A;  5ANR A;  5ENN A;  4AIF A;  4B8A A;  4N2Q A;  3EIQ C;  3R9A B;  4DJA A;  3EIJ A;  1SQM A;  2DBA A;  5AIJ A;  3U4T A;  2PQR A;  1WY6 A;  2NC9 A;  2C0L A;  4EZK A;  3R7Q A;  2J49 A;  3L54 A;  5KCM A;  5CCM A;  2J08 A;  4GCN A;  1FVF A;  3IKO B;  5FQ4 A;  4GZ6 A;  1X5B A;  2FUL A;  5HI7 A;  4NRH B;  3CHP A;  3FTV A;  4XI9 A;  3B7U X;  5EKQ D;  3CK7 A;  1OWL A;  4DPR A;  4RG6 A;  4KVO A;  3SF4 A;  1NA3 A;  1JWF A;  3UUX A;  2VYI A;  2HM8 A;  3FU5 A;  2XCB A;  4PS8 A;  5A23 A;  3G2U A;  3D9I A;  1WAO 1;  4W9R A;  4K0R A;  2C2L A;  4I43 A;  2XGM A;  2XGO A;  2BTD A;  3CSF A;  5D0O D;  1UN8 A;  3CVN A;  4NAC A;  3UPV A;  4JHR A;  1HZ4 A;  1INZ A;  3QK0 A;  1B89 A;  1OUV A;  5BW8 C;  3U64 A;  5JHA A;  4AOF A;  2J9Q A;  1KT1 A;  5ARG A;  5BT1 A;  2V5F A;  3VLE A;  3MCX A;  2WXR A;  4FJZ A;  4CT4 A;  3QAR A;  3SZ7 A;  3SD5 A;  1KLX A;  3R7R A;  3JQ0 A;  3L17 A;  2LAH A;  3LY8 A;  3NF1 A;  4BX9 A;  2WXM A;  3PDN A;  4WWN A;  1LF8 A;  2QY7 A;  3MGB A;  3HHM A;  4GPK A;  4EQF A;  4G11 A;  4CEM A;  4I9E A;  4I2Z A;  4R7L A;  2V8S E;  1HFA A;  4LUN U;  3O4Z A;  4BY6 A;  1HG5 A;  2WQH A;  3FUE A;  3QAQ A;  4WWO A;  1XNF A;  3VLF A;  5CCL A;  3U66 A;  3APC A;  4OVV A;  4F7A A;  4LEU A;  4JA7 A;  4JHK A;  4XZ4 A;  5FZS A;  4WAF A;  4J8E A;  4I1A A;  4DI3 A;  3OXL A;  5KJM A;  1TJC A;  2KZT A;  4PH4 B;  5KJN A;  1FVH A;  3MV2 B;  4KZC A;  4RVB A;  2XRZ A;  4HOR A;  3RJV A;  4UQY A;  3B7T A;  3MKQ B;  4GA1 A;  3IEG A;  1NA0 A;  4I6E A;  3CLJ A;  5FZR A;  4ANU A;  4APF A;  4P29 A;  2X6J A;  1E8W A;  4KMO A;  3RU0 A;  2AXZ A;  4N5C A;  1EF1 C;  2WXL A;  3PEU B;  3S7B A;  4PUC A;  4UQX A;  4MLP A;  4YVO A;  1OWM A;  3ASF A;  2GRL A;  3CHQ A;  3B7R L;  2VTB A;  4OYS A;  1ELW A;  5T3R A;  4J8S A;  1Z3Y A;  3CKB A;  3D9P A;  3TJP A;  5M72 A;  3IHV A;  5T4Y A;  5CHE E;  5JJT A;  2GRM A;  3ZVV A;  5CMY A;  2BF0 X;  3EHN A;  4NQ0 A;  2KZT B;  4ACL A;  3PUK A;  4HOT A;  3HDX A;  3GZ1 A;  4G1T A;  3D9O A;  3ZHE A;  2HR2 A;  3O48 A;  4C0E A;  2PM7 A;  3OTN A;  1Z6T A;  4TRQ A;  4FLH A;  3KD7 A;  5AYW D;  3SI5 A;  2Y4U A;  4IN3 B;  2YIN A;  5AEN A;  4ILH B;  3CHO A;  5FJY A;  1EYH A;  2I6H A;  4AP2 A;  3FDH A;  5G05 J;  4U04 A;  1YA0 A;  2LO6 A;  3ASG A;  3RRM B;  5LP0 A;  4GZ5 A;  2UWJ G;  3CST A;  5G04 C;  1U3D A;  3MKQ A;  5FTP A;  5G04 J;  3D9J A;  5LX8 A;  2KCL A;  3RO3 A;  3PZD A;  2YHE A;  3P2B A;  2XQ0 A;  5LFA A;  4A55 A;  4GA2 A;  2CHW A;  1BPO A;  3N71 A;  4FAD A;  3OXG A;  4IUL A;  3LDZ A;  3QWV A;  3ZYM A;  3VTY A;  4C9B B;  3PNL B;  3FEY A;  3RIB A;  1TEZ A;  4CDR A;  2R59 A;  2WXG A;  2GW1 A;  2VQ2 A;  4KZ0 A;  4FU3 A;  2VJ8 A;  4C0M A;  4KBQ A;  3CVL A;  3G2V A;  4RSY A;  4A3T A;  4EBA A;  2WXK A;  2AXV A;  1ELR A;  2AVP A;  3URZ A;  2LSU A;  4G25 A;  3TG4 A;  1S0P A;  3CV0 A;  3FUM A;  4V3I A;  1H0A A;  2FEZ A;  3LYA A;  1GW6 A;  4PS3 A;  3D9N A;  4GZD A;  3PUJ A;  2OVB A;  4EBA G;  5FZQ A;  3ASD A;  3QWP A;  1UJJ A;  3PEV B;  3CVX A;  1HG2 A;  3I4G A;  3MJW A;  3VLD A;  5FQ6 A;  1H6K A;  2X38 A;  4URK A;  3CVY A;  3ZW3 A;  4XKB A;  4DI4 A;  5T8I A;  4XIF A;  4G24 A;  4JPS A;  3TXM A;  4D10 C;  2J4D A;  3B13 A;  3GW4 A;  5KJK A;  1E8Y A;  3PH0 C;  4GA0 A;  1TJF A;  5FWQ A;  3ZRH A;  1E96 B;  2KCV A;  4Y6W A;  2J07 A;  2NXP A;  3FFL A;  2R17 C;  3K9I A;  2CFU A;  2WXH A;  3FHE A;  5LCW C;  5LCW J;  3CEQ A;  4HXI A;  1NP7 A;  3JUI A;  4MKT A;  1Y6I A;  2BUG A;  1HE8 A;  5DIZ A;  5E76 A;  2RG8 A;  4FHJ A;  3ZYQ A;  2FBN A;  4ILI A;  3T8M A;  3CQC B;  3ESK A;  3GZS A;  3UT8 A;  2L0T B;  3IV0 A;  3ONK A;  2J09 A;  3E4B A;  2C0M A;  2IQC A;  4BFR A;  2CG2 A;  3DPD A;  4WNG A;  4AV7 A;  4QFV A;  4E85 A;  4MRU A;  4PS7 A;  5G2N A;  3FUF A;  2WM9 A;  3LY7 A;  1UJK A;  3ML8 A;  4KT6 B;  4WNE A;  3ZYK A;  3NZS A;  2EQX A;  3FH8 A;  4AVX A;  1NZN A;  3AS4 A;  3MYV A;  3NQP A;  4O6F A;  2WMO A;  3ENE A;  3T5X A;  2IFU A;  2HO1 A;  3JCK C;  4J8F A;  2IJG X;  4EZJ A;  3P1U A;  2WXP A;  3QWW A;  1OWN A;  2FO7 A;  3AU5 A;  2MRI A;  5BPP A;  4LCT A;  4WND A;  3ZYL A;  3FTX A;  2XCC A;  2X3M A;  3APF A;  4UWK A;  4GZ3 A;  3ZIM A;  4EZL A;  2KCK A;  2VSN A;  4JXT A;  4I1M A;  2A4Z A;  3QDN A;  4CRW A;  5C1D A;  3T5V A;  2XPZ A;  1SZ9 A;  3CKC A;  4KYO B;  2XPY A;  4NUR A;  3WXX A;  2FI7 A;  3CHR A;  2VGX B;  3G2S A;  4B8C B;  3FH5 A;  2PZI A;  4L7T A;  2IF4 A;  1JPL A;  4CT0 A;  2HYZ A;  1OWP A;  2YNQ A;  4UI9 C;  3LXU X;  3FTU A;  3Q49 B;  4BSX A;  3FH7 A;  3AS8 A;  3CK8 A;  2E0I A;  2WXQ A;  1WM5 A;  2V4L A;  2CHX A;  1IQU A;  4FHK A;  1H19 A;  4FUL A;  2CHZ A;  4ACK A;  3ZPJ A;  3ZHE B;  5G55 A;  3TXN A;  2UY1 B;  2WXJ A;  4JW1 A;  1ZBP A;  2RD0 A;  4ANV A;  3D3M A;  3L13 A;  3FU3 A;  1IHG A;  4ANW A;  4F1S A;  2WQ6 A;  5ANL A;  4UWG A;  4FC8 A;  4GMJ A;  2MHK A;  2X6K A;  4B94 A;  5JJ6 A;  4APO A;  3LVR E;  1H2T C;  1HU3 A;  4WWP A;  4L2L A;  4N3B A;  2PQN A;  3QB2 A;  3ZGQ A;  3HIZ A;  3SNX A;  1HF8 A;  3TL5 A;  4I6G A;  4N3C A;  3UT4 A;  2VGY A;  4JL0 A;  1IQR A;  4Q69 A;  4B0Z A;  3SHF A;  4HOS A;  1XGW A;  3CK9 A;  3L16 A;  2X6F A;  3AU4 A;  4YND A;  3DBS A;  3HYM B;  3MKR A;  3Q4A B;  4BT9 A;  3FTW A;  2AWI A;  2YHC A;  4BWR A;  2ION A;  2X6H A;  3RO2 A;  4FP7 A;  4FLB A;  5BUZ A;  1Y8M A;  3MEK A;  4G23 A;  3CHS A;  5KJL A;  3TAX A;  2AW6 A;  3PNT B;  3CVW A;  4N2S A;  2L9B A;  3FUN A;  2Y3A A;  1FCH A;  4EPZ A;  4ANX A;  4IYP A;  3PS6 A;  1JWG A;  3CR3 A;  2GGF A;  3L22 A;  4I1O B;  3LKU A;  2XGS A;  1EDU A;  1UN9 A;  4MS6 A;  3ZEF A;  3FEX A;  2CFZ A;  1PY1 A;  3FWV A;  3MA5 A;  3PE4 A;  3PRE A;  3QNK A;  4K03 A;  3TG5 A;  3OAW A;  2MOW A;  1JUQ A;  3ONL A;  4AJW A;  3I4R B;  4U0Z A;  3QJZ A;  2JEK A;  4Y6C A;  1IYG A;  3LJ3 A;  4UI9 K;  2WB2 A;  4WNF A;  4CDN A;  2IOL A;  3RK6 A;  3EJN A;  3QC1 A;  4BX8 A;  3HVE B;  2JLB A;  3OXF A;  4I2W A;  1L5J A;  1W3B A;  1E90 A;  2VGX A;  2PL2 A;  2VSO E;  3UT7 A;  1QQE A;  4H7X A;  3FUD A;  3FUL A;  4F53 A;  2CG3 A;  3GYZ A;  3ZN3 A;  1HXI A;  3CHM A;  2KAT A;  3FU6 A;  5JJ7 A;  1ELK A;  3FTS A;  4UI9 J;  3CVP A;  4CCA A;  3ASH A;  3C98 A;  3CQG B;  2PM6 A;  3FTY A;  4GYO A;  4XI0 A;  4LRZ A;  4AXH A;  2P58 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...