2J49A

Crystal structure of yeast taf5 n-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
134
structure length
134
Chain Sequence
PENYIRAYSMLKNWVDSSLEIYKPELSYIMYPIFIYLFLNLVAKNPVYARRFFDRFSPDFKDFHGSEINRLFSVNSIDHIKENEVASAFQSHKYRITMSKTTLNLLLYFLNENESIGGSLIISVINQHLDPNIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 5
publication title Crystal Structure, Biochemical and Genetic Characterization of Yeast and E. Cuniculi Taf(II)5 N-Terminal Domain: Implications for TFIID Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 48
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04494 TFIID_NTD2 WD40 associated region in TFIID subunit, NTD2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j49A00
2NXPA 2J4BA 2J49A
chains in the Genus database with same CATH superfamily
3MKQA 1BLXB 3MKQB 3HHMA 5J08A 3S2AA 2FO7A 4B8CB 2L0TB 1MX2A 3AS4A 1OWLA 1NA0A 3Q49B 1O1SA 5ANRA 3G2UA 4EZJA 3Q5MA 3PUKA 4KZ0A 4H7XA 3NQPA 4IULA 2CG3A 5D0OD 2ETCA 1HX8A 1HS6A 1FVFA 1E8YA 3GZ1A 1H2VC 1ZU2A 3HXCA 1BI8B 4GPMA 1U3CA 2HM8A 5AJLA 4A63B 1OT8A 4B0ZA 3VTYA 1TR4A 4JPSA 4HOSA 4FULA 1PC2A 5A6CA 3ZNGA 3ZHEA 4O60A 3B7RL 3E32A 3ZHEB 1DC2A 1Q2ZA 3EHMA 3QKYA 4G11A 4RSYA 2RKKA 3MCXA 5CRUA 2GRLA 5FQ8A 5ENOD 3CEQA 1LD7A 3PRZA 3QWWA 5LCWJ 3BQOA 3DBSA 1X5BA 2XRYA 3ZXSA 2KZTA 4BTAA 2LAHA 3GZSA 2KZTB 2J4DA 4CDNA 1Z3YA 3FP3A 5BXUA 2XGMA 3ASFA 5EYPF 1EDUA 4I2WA 4WNEA 2AVPA 2GGFA 1OWNA 3CVVA 3MZLB 2V5QC 1D8DA 1ELWA 2L6BA 4I6JA 4DLOA 1LF8A 2QYJA 3LYAA 1OCCE 4LNGA 5LP0A 3IHYA 3JUIA 4GU5A 1OWMA 3T5VA 1P5QA 3IXEA 2IY0C 3DEOA 3HXFA 2C0MA 3LVRE 2ZISA 3RO3A 4F1SA 4YVOA 3APFA 1MYOA 4A55A 4EQFA 2P9SG 2WM9A 4Y6WA 2XGSA 3CSFA 4CYMD 4U0UA 4Q69A 3SNXA 1FT2A 4ILGA 2VSYA 4A1GA 2PZIA 4GMRA 3ONKA 3RK6A 3CHMA 1V55E 3LXUX 4BT8A 2WXOA 3PNTB 1LD8A 5KBAA 4TUMA 4DX5D 3PZ1A 3SY2A 3UKUG 3ESKA 4PH4B 3ZW3A 3D9HA 2WXLA 2BKGA 4JA7A 4YVQC 5D0QD 3Q47B 2RD0A 2OVFA 5M72A 4GA0A 1UJKA 1HO8A 5FJYA 1H19A 2OVBA 1TN8A 3V2XA 3FUFA 4AY6A 3QJZA 3OXFA 2YHEA 4TV3A 4U0SA 5EYLA 4GZ3A 3Q7FA 4BFRA 1A17A 3UIOC 4FC8A 1E8ZA 3Q9UC 2IOLA 3DSSA 4CT0A 4RG9A 1JUQA 1DCQA 3JQ1A 2DWZA 1N4QA 2WXHA 1E8XA 4XX5A 1MHQA 3L13A 3HIZA 4LG6A 1INZA 5KWDA 4BSZB 3DXMG 2YHCA 2V0PA 2QYUA 5ENNA 3RRNB 2EIKE 4OVUA 5C2YA 3HDXA 4BX8A 3B7UX 4KBQA 4ATGA 4YDWA 4K03A 4ABNA 2LAIA 3V31A 1GW6A 4C0EA 3UKRG 3TG4A 3R7RA 1SA4A 3SQVA 4JB8P 5KJNA 4I1OB 4JXTA 4APOA 4OVVA 1TNOA 4QFVA 4PS7A 4FP7A 3IEGA 3UT8A 4DUIA 5CBOA 4B94A 2KM4A 3PS6A 2EILE 3CK7A 2WXJA 3FU5A 3CLJA 3VLEA 2DYRE 1O5MA 2J8SD 1NFIE 3C3QA 4XE0A 2Y0BG 2XHEA 2QY7A 4CRWA 1N4RA 3SFXA 3SHFA 3T9KA 3S7BA 4MBGA 3JYSA 3MYVA 1TN7A 2EINE 4HOQA 5KJLA 3TWRA 4UWGA 1UN8A 2XRZA 4WAFA 4AEZC 2DIWA 5G04C 3KAEA 4NQ0A 1MX6A 1JCQA 2PM6A 4XKBA 3L82A 3BG0B 3UIPC 4E85A 2DZOA 2XZDG 4XIFA 3DSUA 3QWVA 1H6OA 2VGXA 4BETA 2PL2A 2WMOA 4LUNU 3FTVA 3NZSA 2X6FA 2PQNA 2ZGDA 2VGXB 3OXLA 4JZYA 5CEAA 3D9IA 5LOZA 3O4ZA 3ZEFA 4B93B 4AOFA 2GROB 3MKRA 3EHRA 3Q73A 3Q9NC 3LY9A 2L6JA 4GYOA 3Q15A 4UUCA 1UW4B 2WXIA 3LPZA 4KYOB 1HH8A 3JCKC 4N5QA 5BUZA 5BXOA 1DNPA 3DPDA 4NIKA 5EN5D 3FUMA 3G2WA 4DRXE 4BEPA 3AG4E 3T5XA 3CVXA 2VGEA 1SVXA 2WXQA 3ML9A 3LY8A 2X38A 3TJPA 1VDYA 4OAVB 1N94A 4GCNA 3Q78A 5A23A 4Q96A 3NZUA 1XNFA 4AP2A 1TNZA 3TL5A 3R9MA 3PREA 2HO1A 3HVEA 4BWRA 3I3NA 2KBXA 3HVEB 2IF4A 2LXMA 3FY4A 2FEZA 2FULA 3L9TA 4NRHB 3ZGQA 5BV1A 2WMNA 3TWXA 1TJCA 4K5AB 4U95D 3CGHA 3OTNA 1K1AA 4HLEA 3S7JA 4L2LA 4DK5A 3R7QA 3FEYA 5BV0A 2DVWA 1ZBPA 3PEUB 3SD5A 5CHEE 3EHNA 4FU3A 3RRUA 4RG6A 5FZSA 3CR3A 4N2QA 4A3VA 3RKVA 3CVYA 5CEDB 1G3NB 1B89A 3K9IA 4GCOA 2B0OE 3CVWA 1XGWA 3D9MA 1S63A 2JLBA 3AS8A 4NURA 2VTBA 3QC1A 3E4BA 2VTBB 1YCSB 4FADA 4GYWA 4EECA 3CHPA 3FU3A 1KPSB 2NC9A 3RRMB 2X6KA 2DYSE 3PVLA 3B7TA 1QZ2A 5ENRD 4GZ6A 3LS8A 3C5RA 1TN6A 4L23A 4ANXA 1W3BA 2XPIA 4O1PA 1E7VA 3SI5A 4OAUC 3TGOA 4J8SA 2M63A 1ELRA 4FA6A 4K5CA 4QQIA 2V8SE 1HG5A 2X3MA 3U64A 2EQXA 2WVIA 4G2VA 3EIJA 3CVLA 3CK9A 4JHJA 4IRUA 5FQ6A 3B13A 3ZKJA 2QC9A 3SF4A 5JMND 4HXIA 3PZ3A 5BT1A 3FTSA 4HRNA 3D9LA 3MEKA 3L6AA 4NACA 3NBNB 3FDHA 3PZ4A 5FQ7A 2E2EA 2LSVA 4GB9A 1ELKA 4GZDA 2EIME 3ZXPA 2ONDA 2ZXWE 5JA4D 4ZHBA 3CHOA 2R59A 3URZA 1JWGA 4HFGA 2VSNA 2GRNB 5T8IA 4CZ2D 4ZFHA 3FUIA 3ASHA 1OCOE 5FIOA 4I9EA 4UQYA 2WQ6A 2LSUA 4RVBA 5A7DB 3ASGA 3CHSA 4IN3B 3TWQA 4HRLA 4F1PA 3IBEA 2KC7A 5DBKA 4L9PA 1SA5A 1EF1C 2H6IA 1DVPA 2J4BA 1FT1A 4RLYA 3LCAA 4UI9K 3B7BA 3FH8A 2A4ZA 5AENA 2CHWA 5ARFA 2HE0A 3HXEA 3TWWA 1O1RA 3P1UA 1KT0A 4URKA 3FTUA 5KNHD 1BI7B 4J7WA 2VSXE 1E8WA 1OCRE 4WUYA 3PZ2A 2P9IG 3VTXA 4PUCA 5AIJA 4XKCA 2AW6A 2R17C 3TXNA 2GRPB 3TWTA 1HZ4A 4GTRA 4UI9C 2Y4TA 5AQ7A 2FO1E 1E7UA 5CECB 4JEHA 1KT1A 3Q75A 4WWPA 3LJ3A 3S7DA 3UM1A 2Q7FA 2ETBA 3ABKE 1SZAA 1AWCB 1N4SA 5HRYA 4O1OA 4EZLA 3CHRA 5AN8A 3BUAA 2LXLA 4WWOA 2XEHA 1O1TA 1QNFA 4G26A 3ESLA 2IO3C 2ZU6B 2I1KA 3FUKA 3J5QB 4GTPA 4B89A 4N3AA 4HOUA 3EUVA 5AQAA 4FLHA 1ZB1A 5JJTA 4J6IA 4U7EB 2CHXA 5IY5E 2P9LG 1D9SA 5H7PA 2I2OA 4UQXA 3NF1A 3GYZA 1QBQA 4HORA 3O48A 4GZ5A 1NP7A 1EPUA 3UM0A 1IHBA 3UINC 4D10C 3CHQA 4CCAA 2OCCE 1IHGA 3TXMA 3ISMC 3OXGA 5C1DA 3FWVA 1YA0A 4JVSA 5KJKA 4TRQA 2ZIRA 1U3DA 5EX0A 4GA1A 5G2NA 1SW6A 2IFUA 3UX4A 3SZ7A 3DPYA 2L9BA 2PM7A 4J8YA 2VSOE 1DCEA 3LKUA 2MYOA 4MRUA 2C2LA 3G2SA 4BY6A 2OV8A 4GTMA 4I6GA 3Q4AB 3ONLA 1H6PA 3HRAA 4HRMB 4AY5A 5J90A 3CIAA 4GAAA 1OY3D 3TWUA 5HS0A 5AYWD 4KXKB 4KT6B 4JW1A 3CK8A 2E0IA 3G2VA 2R5SA 4I17A 3FTZA 2EIJE 4BSXA 2F37A 2XPYA 1MQSA 3UM3A 3T8KA 3SFZA 3APCA 4L2YA 4TUUA 2LUHA 5EIBE 1HG2A 1TJFA 3ZYLA 2BUGA 3PDNA 2WXKA 3FUJA 3ZYKA 2QFCA 4EBAA 5JHBA 2KATA 4U8YD 2HYZA 5CMYA 2IONA 5G05J 3RU0A 5BNWA 2MOWA 3ZU7B 3ULEG 4GMLA 3EIQC 4LSZE 2YQ8A 3FHEA 4Y6CA 5FINA 2F8XK 2OEWA 4BX9A 1OWOA 3KSLA 2P58C 5CRVA 2XENA 3PNLB 4I6EA 5G55A 1HF8A 1TNUA 4DX6D 2PQRA 1WM5A 1MJ0A 3I4RB 2Y4UA 4WNDA 3FUEA 4N3BA 4TXQA 3P2BA 4MKTA 2XZTG 2GRMA 4EZKA 3CVUA 5HKPA 2FBNA 3UT4A 4GTQA 5ENSD 3MV2B 4A1SA 4AM9A 2ZGGA 4U96D 4DI4A 1HU3A 5JJ7A 2H6FA 3QWPA 3U4TA 3CSTA 3FEXA 4JL0A 3FUHA 2HR2A 2J07A 2WXFA 2XS1A 4YDYA 3VLFA 4BTBA 4J8DA 3ASOE 3IKOB 4N3CA 4R7LA 1BU9A 4CEMA 4KVMA 2WXMA 3CQGB 1UG3A 2J9QA 1S0PA 3ULYA 3VLDA 4GTTA 1H2UA 5CCLA 4E6HA 4J0UA 2V4LA 3AG3E 3AG2E 4G23A 5EX3A 4F3VA 3E30A 4W9RA 2RFMA 4MS6A 2BKKB 4C9BB 4BERA 4EHMA 4CDMA 2WQ7A 1AP7A 4LNUD 3IHVA 4RQIA 2YINA 5KJMA 4U63A 2JABA 1E90A 4U8HA 1LTXA 3QARA 4U8VD 3JUEA 2C0LA 3X2QE 3ZIMA 2XEVA 1IQUA 2OEVA 5FQ4A 1U2VG 3DSVA 2AJAA 2WQHA 3QAQA 2H6GA 2MRIA 3L16A 5JHAA 1TNBA 5CMWA 4HI8A 3BU8A 2XPZA 3QDNA 4DPRA 3MV3B 3FULA 2NSZA 5CERB 2VYIA 3F6QA 5T3RA 1FCHA 2XQ0A 5ITZF 2QZAA 4FHKA 3C72A 1JWFA 4EBAG 1V54E 1JPLA 4GA2A 1H6KA 5AAOA 2XGOA 2KCKA 5HI7A 5FZQA 4F7AA 1FPPA 3SFYA 1Z5SC 4GTVA 5LCWC 2CG2A 2NXPA 2F8YA 4PS3A 3RAUA 3ZN3A 4C48B 2UY1A 3ML8A 4F53A 1UOHA 2UY1B 3HYMB 2B6CA 1QQEA 3LJNA 3OAWA 4I1AA 3KS2A 1Z3XA 3ZYQA 4AJWA 5D66A 1NI1A 4C0MA 4P29A 1QYMA 3C98A 4UWLA 3BEEA 1Y6IA 2Y1LE 3DWLG 2J49A 2RG8A 2PNNA 3C3RA 1A5EA 1Y8MA 2YNQA 4JEUA 3W9GA 3NOCD 1JCRA 3L54A 3GZ2A 2GW1A 4G24A 3WG7E 1X81A 1WG0A 3UTMA 3EU9A 3EHQA 3MA5A 3MJWA 3RJVA 1RW2A 1OCZE 4X8QA 2IOSA 3CVNA 3AS5A 4WNGA 4I9CA 3PE4A 3ZVVA 2KCVA 5EIDA 4G1TA 5FWQA 3JQ0A 3ZFWA 3I4GA 3IV0A 1K3ZD 5B1AE 5CBNA 3ULQA 3UXGA 3APDA 1H2TC 4HNAD 2P2CP 3DSXA 5B3SE 4DX7D 1YYHA 2VQ2A 3QNKA 3ZPJA 1TNYA 4AIFA 4JA9A 1OXJA 2BF0X 2J09A 2CFZA 2CHZA 3CKBA 4HBDA 2IO2C 3LEWA 2IQCA 3NOGD 1YMPA 4JHKA 1L5JA 5FTPA 4GTOA 3DRAA 1D8EA 3S7FA 4DX2A 3UT7A 1H0AA 2KXPC 3D9KA 4JC8A 4ANWA 2OOEA 4LEUA 4XZ4A 4M3OA 4J8FA 1IKND 4UWFA 3AJIA 1PY1A 4K5BA 4AVXA 1N9AA 2F0YA 4HVBA 2MHKA 1RZ4A 5DIZA 4LNBA 2I9CA 1HFAA 3D9JA 4HS2A 4BT9A 4JD2G 2XCCA 2IEJA 5AARA 1OWPA 3TG5A 3QB2A 3EDTB 3PH0C 3AAAC 4A3TA 4UWKA 3ZUVB 4GYYA 3PZDA 2DBAA 4K0RA 5KCMA 1Z6TA 3CV0A 2UWJG 4N5CA 1N0RA 4ATZD 2JEKA 3UUXA 4U0ZA 1MZCA 4FLBA 2A5UA 2A5EA 2BTDA 5EKQD 4TXRA 3SGHA 4DI3A 4ANVA 3FFLA 4G25A 1TYQG 3FU0A 4J8EA 4FHJA 3HXBA 3W9FA 2I1JA 3L08A 3SBTB 5FZRA 2V5FA 3LY7A 4I2ZA 3MGBA 1BD8A 4YDEA 4LCTA 4UQZA 2GRRB 3G2TA 5G05C 1FVHA 3DXKG 3PE3A 4HQDA 3LVQE 3QK0A 4DLQA 1UN9A 3DSWA 3B95A 2X6IA 1KZOA 4APFA 2R2LA 4GPKA 4ILIA 2DZNA 1N52A 2WXPA 4GMJA 5LX8A 4MLPA 4JHRA 3RIBA 3MX3A 2CFUA 5KNGA 2Y3AA 3PEVB 5LFAA 3UM2A 4OYSA 3R9AB 3ABME 2P9NG 2DCPA 5E75A 4UI9J 3JXJA 1IYGA 4AXHA 4G8KA 3FTWA 4KZCA 3V2OA 2P9PG 3E37A 4B8AA 4Z68A 3AU5A 2ETAA 2XCBA 4ACKA 3ZYMA 1MX4A 2J08A 2L0IA 5AQBA 2IU1A 4CDRA 3D9OA 1N4PA 2VJ8A 1SZ9A 5EILA 3EJNA 3FU6A 4DJAA 4HLLA 3U66A 5HQ8A 3UQ3A 2Y69E 3AG1E 3DEPA 3KD7A 3EU5A 3V30A 3U3WA 3GW4A 4CT4A 4XI0A 3FH7A 1JCSA 3LDZA 5BPPA 5EDSA 3FTYA 2AWIA 4G8LA 3C3OA 4Q94A 3UMVA 1N0QA 1EYHA 4TXPA 3UI2A 3ABLE 3NAWA 5T4YA 3D9NA 4XEIG 1KLXA 1WY6A 1N54A 3T8MA 2WPVA 4GZCA 2R05A 1E96B 3D9PA 3CKCA 4HB5A 4FJZA 5ARGA 3CVQA 2WXNA 3HXDA 3J5PA 3NB2A 5E76A 3N71A 4CGVA 5ENQD 4FJYA 1NL4A 4HI9A 3RSEG 3KEZA 3KSQA 4LERA 1TEZA 3DSTA 5CCMA 2ILRA 4YDOA 3TWSA 1S64A 5ENPD 3E33A 2XS8A 4KVOA 3I5PA 4U07A 4L1BA 4N39A 2LO6A 3E34A 5AQ9A 1IQRA 5ENTD 1HE8A 1K8KG 5B1BE 1N95A 3ENEA 2H6HA 4HOTA 2KCLA 3ASDA 3FH5A 2P9KG 2FI7A 2AXUA 3PUJA 5G04J 4BESA 1K1BA 2LNIA 3WXXA 4YNDA 2XEEA 5D2MC 3V79K 3FTXA 3JXIA 4WWNA 2WXGA 4GTSA 2WXRA 3FUDA 3QOUA 4DX1A 3Q79A 3TWVA 1HXIA 1OUVA 4H7YA 4O6FA 3Q7AA 3U9WA 2VGYA 5JJ6A 3L17A 4N2SA 2V4HC 2FF4A 3RO2A 3CQCB 4IYPA 2P9UG 3CVPA 3SO8A 1NA3A 4ILHB 2R02A 4LRZA 1S70B 5FT9A 3L22A 2AXZA 2IJGX 3B7SA 4V3IA 1WDYA 3KEAA 4EPZA 3TAXA 3HG0D 4L7TA 3D3MA 5AJDA 2BEDA 4I43A 4WNFA 3SBSA 4AV7A 1UJJA 1SQMA 3ASNE 2NYJA 3UPVA 4ME2A 2RFAA 5BW8C 3ZRHA 4U04A 1PAQA 3BG1B 4I1MA 4KMOA 4M7CA 2AXVA 2I6HA 1BPOA 4PDXA 2GRQB 1NZNA 5ANLA 4PS8A 3AU4A 4ANUA 2WB2A 4CGWA 3FUNA 4XI9A 1WAO1 2R03A 1IXVA 4F6RD 4ACLA 4UWHA 1KZPA 2X6JA 2X6HA 1N11A
chains in the Genus database with same CATH topology
3CVXA 3MKQA 5AYWD 4KXKB 4AVXA 3MKQB 4KT6B 2MHKA 2WXQA 3LY8A 2X38A 2E0IA 3CK8A 3G2VA 3HHMA 3ML9A 2R5SA 4I17A 3FTZA 2FO7A 5DIZA 2L0TB 3S2AA 1VDYA 3TJPA 4B8CB 4BSXA 4GCNA 5A23A 3AS4A 1OWLA 2XPYA 1MQSA 1NA0A 3Q49B 4Q96A 3NZUA 5ANRA 1XNFA 2I9CA 3G2UA 3SFZA 4EZJA 3Q5MA 3APCA 1HFAA 3D9JA 3PUKA 4H7XA 4HS2A 4KZ0A 4L2YA 3NQPA 4TUUA 3TL5A 4AP2A 2XCCA 4BT9A 4IULA 2CG3A 5D0OD 1HG2A 1TJFA 3PREA 3ZYLA 1OWPA 2HO1A 3HVEA 2BUGA 1HX8A 4BWRA 3I3NA 1HS6A 3HVEB 3PDNA 1FVFA 2WXKA 2IF4A 3FUJA 3TG5A 2QFCA 3ZYKA 4EBAA 5JHBA 1E8YA 2KATA 3GZ1A 3FY4A 1H2VC 1ZU2A 2FEZA 3EDTB 3PH0C 2HYZA 3QB2A 5CMYA 4A3TA 2FULA 4UWKA 2IONA 4GYYA 1U3CA 2DBAA 3PZDA 4K0RA 4NRHB 2WMNA 5G05J 2HM8A 5KCMA 5AJLA 3RU0A 1Z6TA 1TJCA 5BNWA 3CV0A 2MOWA 2UWJG 4B0ZA 4N5CA 3VTYA 3CGHA 4JPSA 4GMLA 3EIQC 2JEKA 3UUXA 4HOSA 4U0ZA 4FULA 1PC2A 3OTNA 5A6CA 2YQ8A 4HLEA 4FLBA 3FHEA 4Y6CA 2A5UA 3ZHEA 3S7JA 2BTDA 4L2LA 4DK5A 5EKQD 3SGHA 3B7RL 3R7QA 4BX9A 3FEYA 3ZHEB 4DI3A 4ANVA 3FFLA 5BV0A 4G25A 1OWOA 3FU0A 3EHMA 2P58C 3QKYA 1ZBPA 3PEUB 4J8EA 3ZGQA 4HVBA 3PNLB 3SD5A 5CHEE 3EHNA 4G11A 4I6EA 4RSYA 3MCXA 4FHJA 2GRLA 4FU3A 5FQ8A 5G55A 3RRUA 1HF8A 2I1JA 3L08A 3CEQA 3PRZA 3SBTB 2PQRA 1WM5A 3QWWA 5FZRA 2V5FA 3I4RB 3LY7A 4RG6A 3DBSA 1X5BA 3CR3A 5FZSA 5LCWJ 2Y4UA 4I2ZA 4N2QA 3MGBA 4A3VA 4WNDA 2XRYA 3RKVA 3ZXSA 4LCTA 3CVYA 2KZTA 4UQZA 3G2TA 5G05C 1FVHA 3FUEA 2LAHA 4BTAA 3GZSA 2KZTB 5J08A 3PE3A 2J4DA 4CDNA 1Z3YA 3FP3A 1B89A 3K9IA 3LVQE 4N3BA 2XGMA 4GCOA 3CVWA 3ASFA 1XGWA 3D9MA 1EDUA 1UN9A 3P2BA 3QK0A 4MKTA 4I2WA 4WNEA 4DLQA 2AVPA 2GRMA 2GGFA 4EZKA 1OWNA 3CVVA 3CVUA 2JLBA 2X6IA 3AS8A 2FBNA 4APFA 4NURA 4GPKA 2VTBA 3QC1A 3MZLB 4ILIA 3UT4A 3E4BA 2VTBB 1N52A 3MV2B 2WXPA 4GMJA 1ELWA 4A1SA 5LX8A 4I6JA 4DLOA 1LF8A 4AM9A 4MLPA 3LYAA 4FADA 4GYWA 4JHRA 3RIBA 5LP0A 3IHYA 4EECA 3JUIA 4DI4A 1HU3A 3MX3A 5JJ7A 2CFUA 4GU5A 1OWMA 3CHPA 2Y3AA 3PEVB 3QWPA 3U4TA 3CSTA 3FEXA 3T5VA 4JL0A 3FU3A 1P5QA 5LFAA 2NC9A 3FUHA 2HR2A 2C0MA 2J07A 3LVRE 2WXFA 4OYSA 3R9AB 3RRMB 3RO3A 2X6KA 4F1SA 2DCPA 4YVOA 5E75A 3APFA 4UI9J 3VLFA 4BTBA 1IYGA 4J8DA 3PVLA 4AXHA 4A55A 3FTWA 4EQFA 3B7TA 4KZCA 3IKOB 1QZ2A 2WM9A 4N3CA 4Y6WA 4R7LA 4GZ6A 2XGSA 3CSFA 4B8AA 4U0UA 3LS8A 4Q69A 3SNXA 4CEMA 4ILGA 2VSYA 2WXMA 3CQGB 1UG3A 2J9QA 1S0PA 4KVMA 4A1GA 2PZIA 4L23A 3VLDA 3ONKA 3AU5A 1H2UA 5CCLA 3RK6A 3CHMA 4ANXA 4E6HA 1W3BA 4J0UA 2XCBA 4ACKA 3LXUX 3ZYMA 4BT8A 2XPIA 2V4LA 1E7VA 3SI5A 2WXOA 2J08A 4G23A 5EX3A 3PNTB 3TGOA 4J8SA 4F3VA 2M63A 1ELRA 4FA6A 4W9RA 2L0IA 2IU1A 4CDRA 2V8SE 1HG5A 2X3MA 3U64A 2EQXA 3ESKA 4PH4B 3ZW3A 3D9OA 4MS6A 2WVIA 4G2VA 4C9BB 3EIJA 2VJ8A 1SZ9A 2WXLA 3CVLA 4JA7A 3CK9A 3EJNA 4JHJA 4YVQC 5D0QD 3Q47B 4IRUA 3FU6A 2RD0A 4CDMA 2WQ7A 2OVFA 4DJAA 5M72A 4GA0A 1UJKA 1HO8A 3U66A 5FQ6A 3IHVA 5HQ8A 2YINA 3B13A 3UQ3A 5FJYA 5KJMA 4U63A 1H19A 3KD7A 3SF4A 3U3WA 1E90A 4HXIA 4U8HA 5BT1A 3FTSA 3D9LA 3MEKA 3L6AA 3QARA 4NACA 3GW4A 2OVBA 3FDHA 4CT4A 2C0LA 4XI0A 3ZIMA 2XEVA 3FH7A 1IQUA 5FQ7A 5FQ4A 2E2EA 2LSVA 2WQHA 3FUFA 4GB9A 3QAQA 4AY6A 1ELKA 4GZDA 2MRIA 3L16A 3LDZA 5JHAA 5BPPA 3QJZA 5EDSA 3FTYA 2AWIA 2ONDA 3OXFA 5CMWA 4Q94A 3UMVA 3CHOA 2R59A 3URZA 2XPZA 3QDNA 4DPRA 2YHEA 4TV3A 1EYHA 1JWGA 4HFGA 4U0SA 3MV3B 2VSNA 3FULA 2NSZA 4GZ3A 5T4YA 5T8IA 2VYIA 3D9NA 5T3RA 4BFRA 1A17A 1KLXA 1FCHA 1E8ZA 1N54A 1WY6A 2XQ0A 3FUIA 3ASHA 4FC8A 2IOLA 4CT0A 4I9EA 4RG9A 4FHKA 1JUQA 4UQYA 2WQ6A 2LSUA 5BV1A 4RVBA 5A7DB 3JQ1A 3T8MA 1JWFA 4EBAG 2WXHA 3ASGA 1E8XA 4XX5A 1MHQA 2WPVA 3L13A 1JPLA 3CHSA 3HIZA 4GA2A 4IN3B 1INZA 1H6KA 4GZCA 2XGOA 2KCKA 2YHCA 5HI7A 3IBEA 5FZQA 2V0PA 2KC7A 4F7AA 1E96B 3D9PA 3CKCA 5DBKA 5ENNA 3RRNB 1EF1C 4FJZA 4OVUA 5ARGA 1DVPA 3CVQA 5C2YA 2WXNA 3HDXA 2J4BA 4BX8A 5E76A 3B7UX 5LCWC 3N71A 2CG2A 2NXPA 4KBQA 4ATGA 4FJYA 4CGVA 4K03A 4ABNA 4PS3A 2LAIA 3KEZA 3LCAA 4LERA 1TEZA 4UI9K 5CCMA 1GW6A 3ZN3A 4C0EA 2ILRA 2UY1A 3FH8A 3ML8A 2A4ZA 4F53A 5AENA 2CHWA 3TG4A 5ARFA 3R7RA 2UY1B 4JW1A 3HYMB 1QQEA 3OAWA 4I1AA 3P1UA 1KT0A 4URKA 3FTUA 3KS2A 5KJNA 4I1OB 4JXTA 4APOA 1Z3XA 4OVVA 3ZYQA 4AJWA 4QFVA 4KVOA 4C0MA 2VSXE 1E8WA 3C98A 3I5PA 4FP7A 4P29A 4PS7A 4U07A 4UWLA 4L1BA 3BEEA 3IEGA 4N39A 4WUYA 2LO6A 3UT8A 1Y6IA 1IQRA 3VTXA 1HE8A 3ENEA 4PUCA 4B94A 2J49A 2KM4A 2RG8A 4HOTA 5AIJA 2KCLA 4XKCA 3ASDA 2AW6A 1Y8MA 3PS6A 2YNQA 2R17C 4JEUA 3FH5A 3TXNA 3L54A 3GZ2A 3CK7A 2WXJA 3FU5A 2GW1A 2FI7A 3CLJA 3VLEA 2AXUA 3PUJA 5G04J 1HZ4A 4UI9C 4G24A 4XE0A 2Y4TA 2LNIA 3WXXA 1E7UA 4YNDA 4JEHA 2XHEA 2QY7A 1KT1A 4WWPA 3LJ3A 4CRWA 3S7DA 2Q7FA 3SHFA 3FTXA 1SZAA 3MA5A 3MJWA 4WWNA 3RJVA 2WXGA 3S7BA 2WXRA 3FUDA 3JYSA 3MYVA 2IOSA 3CVNA 3AS5A 4WNGA 3QOUA 4HOQA 4I9CA 3PE4A 5KJLA 1HXIA 1OUVA 4H7YA 3CHRA 4UWGA 4EZLA 4O6FA 3U9WA 3ZVVA 2KCVA 2VGYA 1UN8A 2XRZA 5JJ6A 3L17A 4N2SA 4WWOA 2FF4A 3RO2A 1QNFA 4G1TA 4G26A 3ESLA 4WAFA 4AEZC 5FWQA 2ZU6B 2I1KA 3FUKA 4B89A 3JQ0A 3CQCB 4IYPA 4N3AA 3ZFWA 3CVPA 1NA3A 2DIWA 3I4GA 4HOUA 4ILHB 5G04C 3IV0A 4LRZA 4FLHA 3KAEA 4NQ0A 5JJTA 4J6IA 3ULQA 3APDA 1H2TC 5FT9A 3L22A 2CHXA 2PM6A 2AXZA 4XKBA 2I2OA 2IJGX 4UQXA 3B7SA 3NF1A 3BG0B 3GYZA 4V3IA 4E85A 4EPZA 4HORA 3O48A 4XIFA 4GZ5A 1NP7A 1EPUA 2VQ2A 3TAXA 3QNKA 3ZPJA 4D10C 3CHQA 3QWVA 4AIFA 4CCAA 2VGXA 4JA9A 2PL2A 2WMOA 4L7TA 4LUNU 3FTVA 3NZSA 1IHGA 2PQNA 2X6FA 2VGXB 3TXMA 3OXLA 2BF0X 2J09A 2CFZA 2CHZA 3CKBA 3D3MA 5AJDA 3OXGA 4I43A 4JZYA 4WNFA 3LEWA 5C1DA 2IQCA 3FWVA 3SBSA 4AV7A 1UJJA 1YA0A 4JVSA 5KJKA 1SQMA 3D9IA 4TRQA 5LOZA 3O4ZA 3ZEFA 1U3DA 4AOFA 5EX0A 3UPVA 4ME2A 3MKRA 4GA1A 5BW8C 3ZRHA 4JHKA 1L5JA 4U04A 3LY9A 5G2NA 2IFUA 2L6JA 1PAQA 3BG1B 5FTPA 3UX4A 4GYOA 3Q15A 4I1MA 4KMOA 3SZ7A 2AXVA 2I6HA 1UW4B 1BPOA 2WXIA 3LPZA 2L9BA 4PDXA 3S7FA 2PM7A 1NZNA 5ANLA 3UT7A 1H0AA 4KYOB 4PS8A 3AU4A 2VSOE 3D9KA 1HH8A 4JC8A 4ANWA 2OOEA 4LEUA 4ANUA 4CGWA 2WB2A 3JCKC 3FUNA 3LKUA 4XI9A 5BUZA 4XZ4A 4MRUA 4M3OA 2C2LA 1WAO1 3G2SA 4BY6A 2OV8A 1DNPA 3DPDA 4I6GA 4J8FA 3Q4AB 3FUMA 3ONLA 4ACLA 4UWHA 2X6JA 4UWFA 3G2WA 4AY5A 5J90A 3CIAA 1PY1A 2X6HA 4GAAA 3T5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXP A;  2J4B A;  2J49 A; 
#chains in the Genus database with same CATH topology
 3MKQ A;  1BLX B;  3MKQ B;  3HHM A;  5J08 A;  3S2A A;  2FO7 A;  4B8C B;  2L0T B;  1MX2 A;  3AS4 A;  1OWL A;  1NA0 A;  3Q49 B;  1O1S A;  5ANR A;  3G2U A;  4EZJ A;  3Q5M A;  3PUK A;  4KZ0 A;  4H7X A;  3NQP A;  4IUL A;  2CG3 A;  5D0O D;  2ETC A;  1HX8 A;  1HS6 A;  1FVF A;  1E8Y A;  3GZ1 A;  1H2V C;  1ZU2 A;  3HXC A;  1BI8 B;  4GPM A;  1U3C A;  2HM8 A;  5AJL A;  4A63 B;  1OT8 A;  4B0Z A;  3VTY A;  1TR4 A;  4JPS A;  4HOS A;  4FUL A;  1PC2 A;  5A6C A;  3ZNG A;  3ZHE A;  4O60 A;  3B7R L;  3E32 A;  3ZHE B;  1DC2 A;  1Q2Z A;  3EHM A;  3QKY A;  4G11 A;  4RSY A;  2RKK A;  3MCX A;  5CRU A;  2GRL A;  5FQ8 A;  5ENO D;  3CEQ A;  1LD7 A;  3PRZ A;  3QWW A;  5LCW J;  3BQO A;  3DBS A;  1X5B A;  2XRY A;  3ZXS A;  2KZT A;  4BTA A;  2LAH A;  3GZS A;  2KZT B;  2J4D A;  4CDN A;  1Z3Y A;  3FP3 A;  5BXU A;  2XGM A;  3ASF A;  5EYP F;  1EDU A;  4I2W A;  4WNE A;  2AVP A;  2GGF A;  1OWN A;  3CVV A;  3MZL B;  2V5Q C;  1D8D A;  1ELW A;  2L6B A;  4I6J A;  4DLO A;  1LF8 A;  2QYJ A;  3LYA A;  1OCC E;  4LNG A;  5LP0 A;  3IHY A;  3JUI A;  4GU5 A;  1OWM A;  3T5V A;  1P5Q A;  3IXE A;  2IY0 C;  3DEO A;  3HXF A;  2C0M A;  3LVR E;  2ZIS A;  3RO3 A;  4F1S A;  4YVO A;  3APF A;  1MYO A;  4A55 A;  4EQF A;  2P9S G;  2WM9 A;  4Y6W A;  2XGS A;  3CSF A;  4CYM D;  4U0U A;  4Q69 A;  3SNX A;  1FT2 A;  4ILG A;  2VSY A;  4A1G A;  2PZI A;  4GMR A;  3ONK A;  3RK6 A;  3CHM A;  1V55 E;  3LXU X;  4BT8 A;  2WXO A;  3PNT B;  1LD8 A;  5KBA A;  4TUM A;  4DX5 D;  3PZ1 A;  3SY2 A;  3UKU G;  3ESK A;  4PH4 B;  3ZW3 A;  3D9H A;  2WXL A;  2BKG A;  4JA7 A;  4YVQ C;  5D0Q D;  3Q47 B;  2RD0 A;  2OVF A;  5M72 A;  4GA0 A;  1UJK A;  1HO8 A;  5FJY A;  1H19 A;  2OVB A;  1TN8 A;  3V2X A;  3FUF A;  4AY6 A;  3QJZ A;  3OXF A;  2YHE A;  4TV3 A;  4U0S A;  5EYL A;  4GZ3 A;  3Q7F A;  4BFR A;  1A17 A;  3UIO C;  4FC8 A;  1E8Z A;  3Q9U C;  2IOL A;  3DSS A;  4CT0 A;  4RG9 A;  1JUQ A;  1DCQ A;  3JQ1 A;  2DWZ A;  1N4Q A;  2WXH A;  1E8X A;  4XX5 A;  1MHQ A;  3L13 A;  3HIZ A;  4LG6 A;  1INZ A;  5KWD A;  4BSZ B;  3DXM G;  2YHC A;  2V0P A;  2QYU A;  5ENN A;  3RRN B;  2EIK E;  4OVU A;  5C2Y A;  3HDX A;  4BX8 A;  3B7U X;  4KBQ A;  4ATG A;  4YDW A;  4K03 A;  4ABN A;  2LAI A;  3V31 A;  1GW6 A;  4C0E A;  3UKR G;  3TG4 A;  3R7R A;  1SA4 A;  3SQV A;  4JB8 P;  5KJN A;  4I1O B;  4JXT A;  4APO A;  4OVV A;  1TNO A;  4QFV A;  4PS7 A;  4FP7 A;  3IEG A;  3UT8 A;  4DUI A;  5CBO A;  4B94 A;  2KM4 A;  3PS6 A;  2EIL E;  3CK7 A;  2WXJ A;  3FU5 A;  3CLJ A;  3VLE A;  2DYR E;  1O5M A;  2J8S D;  1NFI E;  3C3Q A;  4XE0 A;  2Y0B G;  2XHE A;  2QY7 A;  4CRW A;  1N4R A;  3SFX A;  3SHF A;  3T9K A;  3S7B A;  4MBG A;  3JYS A;  3MYV A;  1TN7 A;  2EIN E;  4HOQ A;  5KJL A;  3TWR A;  4UWG A;  1UN8 A;  2XRZ A;  4WAF A;  4AEZ C;  2DIW A;  5G04 C;  3KAE A;  4NQ0 A;  1MX6 A;  1JCQ A;  2PM6 A;  4XKB A;  3L82 A;  3BG0 B;  3UIP C;  4E85 A;  2DZO A;  2XZD G;  4XIF A;  3DSU A;  3QWV A;  1H6O A;  2VGX A;  4BET A;  2PL2 A;  2WMO A;  4LUN U;  3FTV A;  3NZS A;  2X6F A;  2PQN A;  2ZGD A;  2VGX B;  3OXL A;  4JZY A;  5CEA A;  3D9I A;  5LOZ A;  3O4Z A;  3ZEF A;  4B93 B;  4AOF A;  2GRO B;  3MKR A;  3EHR A;  3Q73 A;  3Q9N C;  3LY9 A;  2L6J A;  4GYO A;  3Q15 A;  4UUC A;  1UW4 B;  2WXI A;  3LPZ A;  4KYO B;  1HH8 A;  3JCK C;  4N5Q A;  5BUZ A;  5BXO A;  1DNP A;  3DPD A;  4NIK A;  5EN5 D;  3FUM A;  3G2W A;  4DRX E;  4BEP A;  3AG4 E;  3T5X A;  3CVX A;  2VGE A;  1SVX A;  2WXQ A;  3ML9 A;  3LY8 A;  2X38 A;  3TJP A;  1VDY A;  4OAV B;  1N94 A;  4GCN A;  3Q78 A;  5A23 A;  4Q96 A;  3NZU A;  1XNF A;  4AP2 A;  1TNZ A;  3TL5 A;  3R9M A;  3PRE A;  2HO1 A;  3HVE A;  4BWR A;  3I3N A;  2KBX A;  3HVE B;  2IF4 A;  2LXM A;  3FY4 A;  2FEZ A;  2FUL A;  3L9T A;  4NRH B;  3ZGQ A;  5BV1 A;  2WMN A;  3TWX A;  1TJC A;  4K5A B;  4U95 D;  3CGH A;  3OTN A;  1K1A A;  4HLE A;  3S7J A;  4L2L A;  4DK5 A;  3R7Q A;  3FEY A;  5BV0 A;  2DVW A;  1ZBP A;  3PEU B;  3SD5 A;  5CHE E;  3EHN A;  4FU3 A;  3RRU A;  4RG6 A;  5FZS A;  3CR3 A;  4N2Q A;  4A3V A;  3RKV A;  3CVY A;  5CED B;  1G3N B;  1B89 A;  3K9I A;  4GCO A;  2B0O E;  3CVW A;  1XGW A;  3D9M A;  1S63 A;  2JLB A;  3AS8 A;  4NUR A;  2VTB A;  3QC1 A;  3E4B A;  2VTB B;  1YCS B;  4FAD A;  4GYW A;  4EEC A;  3CHP A;  3FU3 A;  1KPS B;  2NC9 A;  3RRM B;  2X6K A;  2DYS E;  3PVL A;  3B7T A;  1QZ2 A;  5ENR D;  4GZ6 A;  3LS8 A;  3C5R A;  1TN6 A;  4L23 A;  4ANX A;  1W3B A;  2XPI A;  4O1P A;  1E7V A;  3SI5 A;  4OAU C;  3TGO A;  4J8S A;  2M63 A;  1ELR A;  4FA6 A;  4K5C A;  4QQI A;  2V8S E;  1HG5 A;  2X3M A;  3U64 A;  2EQX A;  2WVI A;  4G2V A;  3EIJ A;  3CVL A;  3CK9 A;  4JHJ A;  4IRU A;  5FQ6 A;  3B13 A;  3ZKJ A;  2QC9 A;  3SF4 A;  5JMN D;  4HXI A;  3PZ3 A;  5BT1 A;  3FTS A;  4HRN A;  3D9L A;  3MEK A;  3L6A A;  4NAC A;  3NBN B;  3FDH A;  3PZ4 A;  5FQ7 A;  2E2E A;  2LSV A;  4GB9 A;  1ELK A;  4GZD A;  2EIM E;  3ZXP A;  2OND A;  2ZXW E;  5JA4 D;  4ZHB A;  3CHO A;  2R59 A;  3URZ A;  1JWG A;  4HFG A;  2VSN A;  2GRN B;  5T8I A;  4CZ2 D;  4ZFH A;  3FUI A;  3ASH A;  1OCO E;  5FIO A;  4I9E A;  4UQY A;  2WQ6 A;  2LSU A;  4RVB A;  5A7D B;  3ASG A;  3CHS A;  4IN3 B;  3TWQ A;  4HRL A;  4F1P A;  3IBE A;  2KC7 A;  5DBK A;  4L9P A;  1SA5 A;  1EF1 C;  2H6I A;  1DVP A;  2J4B A;  1FT1 A;  4RLY A;  3LCA A;  4UI9 K;  3B7B A;  3FH8 A;  2A4Z A;  5AEN A;  2CHW A;  5ARF A;  2HE0 A;  3HXE A;  3TWW A;  1O1R A;  3P1U A;  1KT0 A;  4URK A;  3FTU A;  5KNH D;  1BI7 B;  4J7W A;  2VSX E;  1E8W A;  1OCR E;  4WUY A;  3PZ2 A;  2P9I G;  3VTX A;  4PUC A;  5AIJ A;  4XKC A;  2AW6 A;  2R17 C;  3TXN A;  2GRP B;  3TWT A;  1HZ4 A;  4GTR A;  4UI9 C;  2Y4T A;  5AQ7 A;  2FO1 E;  1E7U A;  5CEC B;  4JEH A;  1KT1 A;  3Q75 A;  4WWP A;  3LJ3 A;  3S7D A;  3UM1 A;  2Q7F A;  2ETB A;  3ABK E;  1SZA A;  1AWC B;  1N4S A;  5HRY A;  4O1O A;  4EZL A;  3CHR A;  5AN8 A;  3BUA A;  2LXL A;  4WWO A;  2XEH A;  1O1T A;  1QNF A;  4G26 A;  3ESL A;  2IO3 C;  2ZU6 B;  2I1K A;  3FUK A;  3J5Q B;  4GTP A;  4B89 A;  4N3A A;  4HOU A;  3EUV A;  5AQA A;  4FLH A;  1ZB1 A;  5JJT A;  4J6I A;  4U7E B;  2CHX A;  5IY5 E;  2P9L G;  1D9S A;  5H7P A;  2I2O A;  4UQX A;  3NF1 A;  3GYZ A;  1QBQ A;  4HOR A;  3O48 A;  4GZ5 A;  1NP7 A;  1EPU A;  3UM0 A;  1IHB A;  3UIN C;  4D10 C;  3CHQ A;  4CCA A;  2OCC E;  1IHG A;  3TXM A;  3ISM C;  3OXG A;  5C1D A;  3FWV A;  1YA0 A;  4JVS A;  5KJK A;  4TRQ A;  2ZIR A;  1U3D A;  5EX0 A;  4GA1 A;  5G2N A;  1SW6 A;  2IFU A;  3UX4 A;  3SZ7 A;  3DPY A;  2L9B A;  2PM7 A;  4J8Y A;  2VSO E;  1DCE A;  3LKU A;  2MYO A;  4MRU A;  2C2L A;  3G2S A;  4BY6 A;  2OV8 A;  4GTM A;  4I6G A;  3Q4A B;  3ONL A;  1H6P A;  3HRA A;  4HRM B;  4AY5 A;  5J90 A;  3CIA A;  4GAA A;  1OY3 D;  3TWU A;  5HS0 A;  5AYW D;  4KXK B;  4KT6 B;  4JW1 A;  3CK8 A;  2E0I A;  3G2V A;  2R5S A;  4I17 A;  3FTZ A;  2EIJ E;  4BSX A;  2F37 A;  2XPY A;  1MQS A;  3UM3 A;  3T8K A;  3SFZ A;  3APC A;  4L2Y A;  4TUU A;  2LUH A;  5EIB E;  1HG2 A;  1TJF A;  3ZYL A;  2BUG A;  3PDN A;  2WXK A;  3FUJ A;  3ZYK A;  2QFC A;  4EBA A;  5JHB A;  2KAT A;  4U8Y D;  2HYZ A;  5CMY A;  2ION A;  5G05 J;  3RU0 A;  5BNW A;  2MOW A;  3ZU7 B;  3ULE G;  4GML A;  3EIQ C;  4LSZ E;  2YQ8 A;  3FHE A;  4Y6C A;  5FIN A;  2F8X K;  2OEW A;  4BX9 A;  1OWO A;  3KSL A;  2P58 C;  5CRV A;  2XEN A;  3PNL B;  4I6E A;  5G55 A;  1HF8 A;  1TNU A;  4DX6 D;  2PQR A;  1WM5 A;  1MJ0 A;  3I4R B;  2Y4U A;  4WND A;  3FUE A;  4N3B A;  4TXQ A;  3P2B A;  4MKT A;  2XZT G;  2GRM A;  4EZK A;  3CVU A;  5HKP A;  2FBN A;  3UT4 A;  4GTQ A;  5ENS D;  3MV2 B;  4A1S A;  4AM9 A;  2ZGG A;  4U96 D;  4DI4 A;  1HU3 A;  5JJ7 A;  2H6F A;  3QWP A;  3U4T A;  3CST A;  3FEX A;  4JL0 A;  3FUH A;  2HR2 A;  2J07 A;  2WXF A;  2XS1 A;  4YDY A;  3VLF A;  4BTB A;  4J8D A;  3ASO E;  3IKO B;  4N3C A;  4R7L A;  1BU9 A;  4CEM A;  4KVM A;  2WXM A;  3CQG B;  1UG3 A;  2J9Q A;  1S0P A;  3ULY A;  3VLD A;  4GTT A;  1H2U A;  5CCL A;  4E6H A;  4J0U A;  2V4L A;  3AG3 E;  3AG2 E;  4G23 A;  5EX3 A;  4F3V A;  3E30 A;  4W9R A;  2RFM A;  4MS6 A;  2BKK B;  4C9B B;  4BER A;  4EHM A;  4CDM A;  2WQ7 A;  1AP7 A;  4LNU D;  3IHV A;  4RQI A;  2YIN A;  5KJM A;  4U63 A;  2JAB A;  1E90 A;  4U8H A;  1LTX A;  3QAR A;  4U8V D;  3JUE A;  2C0L A;  3X2Q E;  3ZIM A;  2XEV A;  1IQU A;  2OEV A;  5FQ4 A;  1U2V G;  3DSV A;  2AJA A;  2WQH A;  3QAQ A;  2H6G A;  2MRI A;  3L16 A;  5JHA A;  1TNB A;  5CMW A;  4HI8 A;  3BU8 A;  2XPZ A;  3QDN A;  4DPR A;  3MV3 B;  3FUL A;  2NSZ A;  5CER B;  2VYI A;  3F6Q A;  5T3R A;  1FCH A;  2XQ0 A;  5ITZ F;  2QZA A;  4FHK A;  3C72 A;  1JWF A;  4EBA G;  1V54 E;  1JPL A;  4GA2 A;  1H6K A;  5AAO A;  2XGO A;  2KCK A;  5HI7 A;  5FZQ A;  4F7A A;  1FPP A;  3SFY A;  1Z5S C;  4GTV A;  5LCW C;  2CG2 A;  2NXP A;  2F8Y A;  4PS3 A;  3RAU A;  3ZN3 A;  4C48 B;  2UY1 A;  3ML8 A;  4F53 A;  1UOH A;  2UY1 B;  3HYM B;  2B6C A;  1QQE A;  3LJN A;  3OAW A;  4I1A A;  3KS2 A;  1Z3X A;  3ZYQ A;  4AJW A;  5D66 A;  1NI1 A;  4C0M A;  4P29 A;  1QYM A;  3C98 A;  4UWL A;  3BEE A;  1Y6I A;  2Y1L E;  3DWL G;  2J49 A;  2RG8 A;  2PNN A;  3C3R A;  1A5E A;  1Y8M A;  2YNQ A;  4JEU A;  3W9G A;  3NOC D;  1JCR A;  3L54 A;  3GZ2 A;  2GW1 A;  4G24 A;  3WG7 E;  1X81 A;  1WG0 A;  3UTM A;  3EU9 A;  3EHQ A;  3MA5 A;  3MJW A;  3RJV A;  1RW2 A;  1OCZ E;  4X8Q A;  2IOS A;  3CVN A;  3AS5 A;  4WNG A;  4I9C A;  3PE4 A;  3ZVV A;  2KCV A;  5EID A;  4G1T A;  5FWQ A;  3JQ0 A;  3ZFW A;  3I4G A;  3IV0 A;  1K3Z D;  5B1A E;  5CBN A;  3ULQ A;  3UXG A;  3APD A;  1H2T C;  4HNA D;  2P2C P;  3DSX A;  5B3S E;  4DX7 D;  1YYH A;  2VQ2 A;  3QNK A;  3ZPJ A;  1TNY A;  4AIF A;  4JA9 A;  1OXJ A;  2BF0 X;  2J09 A;  2CFZ A;  2CHZ A;  3CKB A;  4HBD A;  2IO2 C;  3LEW A;  2IQC A;  3NOG D;  1YMP A;  4JHK A;  1L5J A;  5FTP A;  4GTO A;  3DRA A;  1D8E A;  3S7F A;  4DX2 A;  3UT7 A;  1H0A A;  2KXP C;  3D9K A;  4JC8 A;  4ANW A;  2OOE A;  4LEU A;  4XZ4 A;  4M3O A;  4J8F A;  1IKN D;  4UWF A;  3AJI A;  1PY1 A;  4K5B A;  4AVX A;  1N9A A;  2F0Y A;  4HVB A;  2MHK A;  1RZ4 A;  5DIZ A;  4LNB A;  2I9C A;  1HFA A;  3D9J A;  4HS2 A;  4BT9 A;  4JD2 G;  2XCC A;  2IEJ A;  5AAR A;  1OWP A;  3TG5 A;  3QB2 A;  3EDT B;  3PH0 C;  3AAA C;  4A3T A;  4UWK A;  3ZUV B;  4GYY A;  3PZD A;  2DBA A;  4K0R A;  5KCM A;  1Z6T A;  3CV0 A;  2UWJ G;  4N5C A;  1N0R A;  4ATZ D;  2JEK A;  3UUX A;  4U0Z A;  1MZC A;  4FLB A;  2A5U A;  2A5E A;  2BTD A;  5EKQ D;  4TXR A;  3SGH A;  4DI3 A;  4ANV A;  3FFL A;  4G25 A;  1TYQ G;  3FU0 A;  4J8E A;  4FHJ A;  3HXB A;  3W9F A;  2I1J A;  3L08 A;  3SBT B;  5FZR A;  2V5F A;  3LY7 A;  4I2Z A;  3MGB A;  1BD8 A;  4YDE A;  4LCT A;  4UQZ A;  2GRR B;  3G2T A;  5G05 C;  1FVH A;  3DXK G;  3PE3 A;  4HQD A;  3LVQ E;  3QK0 A;  4DLQ A;  1UN9 A;  3DSW A;  3B95 A;  2X6I A;  1KZO A;  4APF A;  2R2L A;  4GPK A;  4ILI A;  2DZN A;  1N52 A;  2WXP A;  4GMJ A;  5LX8 A;  4MLP A;  4JHR A;  3RIB A;  3MX3 A;  2CFU A;  5KNG A;  2Y3A A;  3PEV B;  5LFA A;  3UM2 A;  4OYS A;  3R9A B;  3ABM E;  2P9N G;  2DCP A;  5E75 A;  4UI9 J;  3JXJ A;  1IYG A;  4AXH A;  4G8K A;  3FTW A;  4KZC A;  3V2O A;  2P9P G;  3E37 A;  4B8A A;  4Z68 A;  3AU5 A;  2ETA A;  2XCB A;  4ACK A;  3ZYM A;  1MX4 A;  2J08 A;  2L0I A;  5AQB A;  2IU1 A;  4CDR A;  3D9O A;  1N4P A;  2VJ8 A;  1SZ9 A;  5EIL A;  3EJN A;  3FU6 A;  4DJA A;  4HLL A;  3U66 A;  5HQ8 A;  3UQ3 A;  2Y69 E;  3AG1 E;  3DEP A;  3KD7 A;  3EU5 A;  3V30 A;  3U3W A;  3GW4 A;  4CT4 A;  4XI0 A;  3FH7 A;  1JCS A;  3LDZ A;  5BPP A;  5EDS A;  3FTY A;  2AWI A;  4G8L A;  3C3O A;  4Q94 A;  3UMV A;  1N0Q A;  1EYH A;  4TXP A;  3UI2 A;  3ABL E;  3NAW A;  5T4Y A;  3D9N A;  4XEI G;  1KLX A;  1WY6 A;  1N54 A;  3T8M A;  2WPV A;  4GZC A;  2R05 A;  1E96 B;  3D9P A;  3CKC A;  4HB5 A;  4FJZ A;  5ARG A;  3CVQ A;  2WXN A;  3HXD A;  3J5P A;  3NB2 A;  5E76 A;  3N71 A;  4CGV A;  5ENQ D;  4FJY A;  1NL4 A;  4HI9 A;  3RSE G;  3KEZ A;  3KSQ A;  4LER A;  1TEZ A;  3DST A;  5CCM A;  2ILR A;  4YDO A;  3TWS A;  1S64 A;  5ENP D;  3E33 A;  2XS8 A;  4KVO A;  3I5P A;  4U07 A;  4L1B A;  4N39 A;  2LO6 A;  3E34 A;  5AQ9 A;  1IQR A;  5ENT D;  1HE8 A;  1K8K G;  5B1B E;  1N95 A;  3ENE A;  2H6H A;  4HOT A;  2KCL A;  3ASD A;  3FH5 A;  2P9K G;  2FI7 A;  2AXU A;  3PUJ A;  5G04 J;  4BES A;  1K1B A;  2LNI A;  3WXX A;  4YND A;  2XEE A;  5D2M C;  3V79 K;  3FTX A;  3JXI A;  4WWN A;  2WXG A;  4GTS A;  2WXR A;  3FUD A;  3QOU A;  4DX1 A;  3Q79 A;  3TWV A;  1HXI A;  1OUV A;  4H7Y A;  4O6F A;  3Q7A A;  3U9W A;  2VGY A;  5JJ6 A;  3L17 A;  4N2S A;  2V4H C;  2FF4 A;  3RO2 A;  3CQC B;  4IYP A;  2P9U G;  3CVP A;  3SO8 A;  1NA3 A;  4ILH B;  2R02 A;  4LRZ A;  1S70 B;  5FT9 A;  3L22 A;  2AXZ A;  2IJG X;  3B7S A;  4V3I A;  1WDY A;  3KEA A;  4EPZ A;  3TAX A;  3HG0 D;  4L7T A;  3D3M A;  5AJD A;  2BED A;  4I43 A;  4WNF A;  3SBS A;  4AV7 A;  1UJJ A;  1SQM A;  3ASN E;  2NYJ A;  3UPV A;  4ME2 A;  2RFA A;  5BW8 C;  3ZRH A;  4U04 A;  1PAQ A;  3BG1 B;  4I1M A;  4KMO A;  4M7C A;  2AXV A;  2I6H A;  1BPO A;  4PDX A;  2GRQ B;  1NZN A;  5ANL A;  4PS8 A;  3AU4 A;  4ANU A;  2WB2 A;  4CGW A;  3FUN A;  4XI9 A;  1WAO 1;  2R03 A;  1IXV A;  4F6R D;  4ACL A;  4UWH A;  1KZP A;  2X6J A;  2X6H A;  1N11 A; 
#chains in the Genus database with same CATH homology
 3CVX A;  3MKQ A;  5AYW D;  4KXK B;  4AVX A;  3MKQ B;  4KT6 B;  2MHK A;  2WXQ A;  3LY8 A;  2X38 A;  2E0I A;  3CK8 A;  3G2V A;  3HHM A;  3ML9 A;  2R5S A;  4I17 A;  3FTZ A;  2FO7 A;  5DIZ A;  2L0T B;  3S2A A;  1VDY A;  3TJP A;  4B8C B;  4BSX A;  4GCN A;  5A23 A;  3AS4 A;  1OWL A;  2XPY A;  1MQS A;  1NA0 A;  3Q49 B;  4Q96 A;  3NZU A;  5ANR A;  1XNF A;  2I9C A;  3G2U A;  3SFZ A;  4EZJ A;  3Q5M A;  3APC A;  1HFA A;  3D9J A;  3PUK A;  4H7X A;  4HS2 A;  4KZ0 A;  4L2Y A;  3NQP A;  4TUU A;  3TL5 A;  4AP2 A;  2XCC A;  4BT9 A;  4IUL A;  2CG3 A;  5D0O D;  1HG2 A;  1TJF A;  3PRE A;  3ZYL A;  1OWP A;  2HO1 A;  3HVE A;  2BUG A;  1HX8 A;  4BWR A;  3I3N A;  1HS6 A;  3HVE B;  3PDN A;  1FVF A;  2WXK A;  2IF4 A;  3FUJ A;  3TG5 A;  2QFC A;  3ZYK A;  4EBA A;  5JHB A;  1E8Y A;  2KAT A;  3GZ1 A;  3FY4 A;  1H2V C;  1ZU2 A;  2FEZ A;  3EDT B;  3PH0 C;  2HYZ A;  3QB2 A;  5CMY A;  4A3T A;  2FUL A;  4UWK A;  2ION A;  4GYY A;  1U3C A;  2DBA A;  3PZD A;  4K0R A;  4NRH B;  2WMN A;  5G05 J;  2HM8 A;  5KCM A;  5AJL A;  3RU0 A;  1Z6T A;  1TJC A;  5BNW A;  3CV0 A;  2MOW A;  2UWJ G;  4B0Z A;  4N5C A;  3VTY A;  3CGH A;  4JPS A;  4GML A;  3EIQ C;  2JEK A;  3UUX A;  4HOS A;  4U0Z A;  4FUL A;  1PC2 A;  3OTN A;  5A6C A;  2YQ8 A;  4HLE A;  4FLB A;  3FHE A;  4Y6C A;  2A5U A;  3ZHE A;  3S7J A;  2BTD A;  4L2L A;  4DK5 A;  5EKQ D;  3SGH A;  3B7R L;  3R7Q A;  4BX9 A;  3FEY A;  3ZHE B;  4DI3 A;  4ANV A;  3FFL A;  5BV0 A;  4G25 A;  1OWO A;  3FU0 A;  3EHM A;  2P58 C;  3QKY A;  1ZBP A;  3PEU B;  4J8E A;  3ZGQ A;  4HVB A;  3PNL B;  3SD5 A;  5CHE E;  3EHN A;  4G11 A;  4I6E A;  4RSY A;  3MCX A;  4FHJ A;  2GRL A;  4FU3 A;  5FQ8 A;  5G55 A;  3RRU A;  1HF8 A;  2I1J A;  3L08 A;  3CEQ A;  3PRZ A;  3SBT B;  2PQR A;  1WM5 A;  3QWW A;  5FZR A;  2V5F A;  3I4R B;  3LY7 A;  4RG6 A;  3DBS A;  1X5B A;  3CR3 A;  5FZS A;  5LCW J;  2Y4U A;  4I2Z A;  4N2Q A;  3MGB A;  4A3V A;  4WND A;  2XRY A;  3RKV A;  3ZXS A;  4LCT A;  3CVY A;  2KZT A;  4UQZ A;  3G2T A;  5G05 C;  1FVH A;  3FUE A;  2LAH A;  4BTA A;  3GZS A;  2KZT B;  5J08 A;  3PE3 A;  2J4D A;  4CDN A;  1Z3Y A;  3FP3 A;  1B89 A;  3K9I A;  3LVQ E;  4N3B A;  2XGM A;  4GCO A;  3CVW A;  3ASF A;  1XGW A;  3D9M A;  1EDU A;  1UN9 A;  3P2B A;  3QK0 A;  4MKT A;  4I2W A;  4WNE A;  4DLQ A;  2AVP A;  2GRM A;  2GGF A;  4EZK A;  1OWN A;  3CVV A;  3CVU A;  2JLB A;  2X6I A;  3AS8 A;  2FBN A;  4APF A;  4NUR A;  4GPK A;  2VTB A;  3QC1 A;  3MZL B;  4ILI A;  3UT4 A;  3E4B A;  2VTB B;  1N52 A;  3MV2 B;  2WXP A;  4GMJ A;  1ELW A;  4A1S A;  5LX8 A;  4I6J A;  4DLO A;  1LF8 A;  4AM9 A;  4MLP A;  3LYA A;  4FAD A;  4GYW A;  4JHR A;  3RIB A;  5LP0 A;  3IHY A;  4EEC A;  3JUI A;  4DI4 A;  1HU3 A;  3MX3 A;  5JJ7 A;  2CFU A;  4GU5 A;  1OWM A;  3CHP A;  2Y3A A;  3PEV B;  3QWP A;  3U4T A;  3CST A;  3FEX A;  3T5V A;  4JL0 A;  3FU3 A;  1P5Q A;  5LFA A;  2NC9 A;  3FUH A;  2HR2 A;  2C0M A;  2J07 A;  3LVR E;  2WXF A;  4OYS A;  3R9A B;  3RRM B;  3RO3 A;  2X6K A;  4F1S A;  2DCP A;  4YVO A;  5E75 A;  3APF A;  4UI9 J;  3VLF A;  4BTB A;  1IYG A;  4J8D A;  3PVL A;  4AXH A;  4A55 A;  3FTW A;  4EQF A;  3B7T A;  4KZC A;  3IKO B;  1QZ2 A;  2WM9 A;  4N3C A;  4Y6W A;  4R7L A;  4GZ6 A;  2XGS A;  3CSF A;  4B8A A;  4U0U A;  3LS8 A;  4Q69 A;  3SNX A;  4CEM A;  4ILG A;  2VSY A;  2WXM A;  3CQG B;  1UG3 A;  2J9Q A;  1S0P A;  4KVM A;  4A1G A;  2PZI A;  4L23 A;  3VLD A;  3ONK A;  3AU5 A;  1H2U A;  5CCL A;  3RK6 A;  3CHM A;  4ANX A;  4E6H A;  1W3B A;  4J0U A;  2XCB A;  4ACK A;  3LXU X;  3ZYM A;  4BT8 A;  2XPI A;  2V4L A;  1E7V A;  3SI5 A;  2WXO A;  2J08 A;  4G23 A;  5EX3 A;  3PNT B;  3TGO A;  4J8S A;  4F3V A;  2M63 A;  1ELR A;  4FA6 A;  4W9R A;  2L0I A;  2IU1 A;  4CDR A;  2V8S E;  1HG5 A;  2X3M A;  3U64 A;  2EQX A;  3ESK A;  4PH4 B;  3ZW3 A;  3D9O A;  4MS6 A;  2WVI A;  4G2V A;  4C9B B;  3EIJ A;  2VJ8 A;  1SZ9 A;  2WXL A;  3CVL A;  4JA7 A;  3CK9 A;  3EJN A;  4JHJ A;  4YVQ C;  5D0Q D;  3Q47 B;  4IRU A;  3FU6 A;  2RD0 A;  4CDM A;  2WQ7 A;  2OVF A;  4DJA A;  5M72 A;  4GA0 A;  1UJK A;  1HO8 A;  3U66 A;  5FQ6 A;  3IHV A;  5HQ8 A;  2YIN A;  3B13 A;  3UQ3 A;  5FJY A;  5KJM A;  4U63 A;  1H19 A;  3KD7 A;  3SF4 A;  3U3W A;  1E90 A;  4HXI A;  4U8H A;  5BT1 A;  3FTS A;  3D9L A;  3MEK A;  3L6A A;  3QAR A;  4NAC A;  3GW4 A;  2OVB A;  3FDH A;  4CT4 A;  2C0L A;  4XI0 A;  3ZIM A;  2XEV A;  3FH7 A;  1IQU A;  5FQ7 A;  5FQ4 A;  2E2E A;  2LSV A;  2WQH A;  3FUF A;  4GB9 A;  3QAQ A;  4AY6 A;  1ELK A;  4GZD A;  2MRI A;  3L16 A;  3LDZ A;  5JHA A;  5BPP A;  3QJZ A;  5EDS A;  3FTY A;  2AWI A;  2OND A;  3OXF A;  5CMW A;  4Q94 A;  3UMV A;  3CHO A;  2R59 A;  3URZ A;  2XPZ A;  3QDN A;  4DPR A;  2YHE A;  4TV3 A;  1EYH A;  1JWG A;  4HFG A;  4U0S A;  3MV3 B;  2VSN A;  3FUL A;  2NSZ A;  4GZ3 A;  5T4Y A;  5T8I A;  2VYI A;  3D9N A;  5T3R A;  4BFR A;  1A17 A;  1KLX A;  1FCH A;  1E8Z A;  1N54 A;  1WY6 A;  2XQ0 A;  3FUI A;  3ASH A;  4FC8 A;  2IOL A;  4CT0 A;  4I9E A;  4RG9 A;  4FHK A;  1JUQ A;  4UQY A;  2WQ6 A;  2LSU A;  5BV1 A;  4RVB A;  5A7D B;  3JQ1 A;  3T8M A;  1JWF A;  4EBA G;  2WXH A;  3ASG A;  1E8X A;  4XX5 A;  1MHQ A;  2WPV A;  3L13 A;  1JPL A;  3CHS A;  3HIZ A;  4GA2 A;  4IN3 B;  1INZ A;  1H6K A;  4GZC A;  2XGO A;  2KCK A;  2YHC A;  5HI7 A;  3IBE A;  5FZQ A;  2V0P A;  2KC7 A;  4F7A A;  1E96 B;  3D9P A;  3CKC A;  5DBK A;  5ENN A;  3RRN B;  1EF1 C;  4FJZ A;  4OVU A;  5ARG A;  1DVP A;  3CVQ A;  5C2Y A;  2WXN A;  3HDX A;  2J4B A;  4BX8 A;  5E76 A;  3B7U X;  5LCW C;  3N71 A;  2CG2 A;  2NXP A;  4KBQ A;  4ATG A;  4FJY A;  4CGV A;  4K03 A;  4ABN A;  4PS3 A;  2LAI A;  3KEZ A;  3LCA A;  4LER A;  1TEZ A;  4UI9 K;  5CCM A;  1GW6 A;  3ZN3 A;  4C0E A;  2ILR A;  2UY1 A;  3FH8 A;  3ML8 A;  2A4Z A;  4F53 A;  5AEN A;  2CHW A;  3TG4 A;  5ARF A;  3R7R A;  2UY1 B;  4JW1 A;  3HYM B;  1QQE A;  3OAW A;  4I1A A;  3P1U A;  1KT0 A;  4URK A;  3FTU A;  3KS2 A;  5KJN A;  4I1O B;  4JXT A;  4APO A;  1Z3X A;  4OVV A;  3ZYQ A;  4AJW A;  4QFV A;  4KVO A;  4C0M A;  2VSX E;  1E8W A;  3C98 A;  3I5P A;  4FP7 A;  4P29 A;  4PS7 A;  4U07 A;  4UWL A;  4L1B A;  3BEE A;  3IEG A;  4N39 A;  4WUY A;  2LO6 A;  3UT8 A;  1Y6I A;  1IQR A;  3VTX A;  1HE8 A;  3ENE A;  4PUC A;  4B94 A;  2J49 A;  2KM4 A;  2RG8 A;  4HOT A;  5AIJ A;  2KCL A;  4XKC A;  3ASD A;  2AW6 A;  1Y8M A;  3PS6 A;  2YNQ A;  2R17 C;  4JEU A;  3FH5 A;  3TXN A;  3L54 A;  3GZ2 A;  3CK7 A;  2WXJ A;  3FU5 A;  2GW1 A;  2FI7 A;  3CLJ A;  3VLE A;  2AXU A;  3PUJ A;  5G04 J;  1HZ4 A;  4UI9 C;  4G24 A;  4XE0 A;  2Y4T A;  2LNI A;  3WXX A;  1E7U A;  4YND A;  4JEH A;  2XHE A;  2QY7 A;  1KT1 A;  4WWP A;  3LJ3 A;  4CRW A;  3S7D A;  2Q7F A;  3SHF A;  3FTX A;  1SZA A;  3MA5 A;  3MJW A;  4WWN A;  3RJV A;  2WXG A;  3S7B A;  2WXR A;  3FUD A;  3JYS A;  3MYV A;  2IOS A;  3CVN A;  3AS5 A;  4WNG A;  3QOU A;  4HOQ A;  4I9C A;  3PE4 A;  5KJL A;  1HXI A;  1OUV A;  4H7Y A;  3CHR A;  4UWG A;  4EZL A;  4O6F A;  3U9W A;  3ZVV A;  2KCV A;  2VGY A;  1UN8 A;  2XRZ A;  5JJ6 A;  3L17 A;  4N2S A;  4WWO A;  2FF4 A;  3RO2 A;  1QNF A;  4G1T A;  4G26 A;  3ESL A;  4WAF A;  4AEZ C;  5FWQ A;  2ZU6 B;  2I1K A;  3FUK A;  4B89 A;  3JQ0 A;  3CQC B;  4IYP A;  4N3A A;  3ZFW A;  3CVP A;  1NA3 A;  2DIW A;  3I4G A;  4HOU A;  4ILH B;  5G04 C;  3IV0 A;  4LRZ A;  4FLH A;  3KAE A;  4NQ0 A;  5JJT A;  4J6I A;  3ULQ A;  3APD A;  1H2T C;  5FT9 A;  3L22 A;  2CHX A;  2PM6 A;  2AXZ A;  4XKB A;  2I2O A;  2IJG X;  4UQX A;  3B7S A;  3NF1 A;  3BG0 B;  3GYZ A;  4V3I A;  4E85 A;  4EPZ A;  4HOR A;  3O48 A;  4XIF A;  4GZ5 A;  1NP7 A;  1EPU A;  2VQ2 A;  3TAX A;  3QNK A;  3ZPJ A;  4D10 C;  3CHQ A;  3QWV A;  4AIF A;  4CCA A;  2VGX A;  4JA9 A;  2PL2 A;  2WMO A;  4L7T A;  4LUN U;  3FTV A;  3NZS A;  1IHG A;  2PQN A;  2X6F A;  2VGX B;  3TXM A;  3OXL A;  2BF0 X;  2J09 A;  2CFZ A;  2CHZ A;  3CKB A;  3D3M A;  5AJD A;  3OXG A;  4I43 A;  4JZY A;  4WNF A;  3LEW A;  5C1D A;  2IQC A;  3FWV A;  3SBS A;  4AV7 A;  1UJJ A;  1YA0 A;  4JVS A;  5KJK A;  1SQM A;  3D9I A;  4TRQ A;  5LOZ A;  3O4Z A;  3ZEF A;  1U3D A;  4AOF A;  5EX0 A;  3UPV A;  4ME2 A;  3MKR A;  4GA1 A;  5BW8 C;  3ZRH A;  4JHK A;  1L5J A;  4U04 A;  3LY9 A;  5G2N A;  2IFU A;  2L6J A;  1PAQ A;  3BG1 B;  5FTP A;  3UX4 A;  4GYO A;  3Q15 A;  4I1M A;  4KMO A;  3SZ7 A;  2AXV A;  2I6H A;  1UW4 B;  1BPO A;  2WXI A;  3LPZ A;  2L9B A;  4PDX A;  3S7F A;  2PM7 A;  1NZN A;  5ANL A;  3UT7 A;  1H0A A;  4KYO B;  4PS8 A;  3AU4 A;  2VSO E;  3D9K A;  1HH8 A;  4JC8 A;  4ANW A;  2OOE A;  4LEU A;  4ANU A;  4CGW A;  2WB2 A;  3JCK C;  3FUN A;  3LKU A;  4XI9 A;  5BUZ A;  4XZ4 A;  4MRU A;  4M3O A;  2C2L A;  1WAO 1;  3G2S A;  4BY6 A;  2OV8 A;  1DNP A;  3DPD A;  4I6G A;  4J8F A;  3Q4A B;  3FUM A;  3ONL A;  4ACL A;  4UWH A;  2X6J A;  4UWF A;  3G2W A;  4AY5 A;  5J90 A;  3CIA A;  1PY1 A;  2X6H A;  4GAA A;  3T5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...