2J49A

Crystal structure of yeast taf5 n-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
134
structure length
134
Chain Sequence
PENYIRAYSMLKNWVDSSLEIYKPELSYIMYPIFIYLFLNLVAKNPVYARRFFDRFSPDFKDFHGSEINRLFSVNSIDHIKENEVASAFQSHKYRITMSKTTLNLLLYFLNENESIGGSLIISVINQHLDPNIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure, Biochemical and Genetic Characterization of Yeast and E. Cuniculi Taf(II)5 N-Terminal Domain: Implications for TFIID Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 5
total genus 48
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04494 TFIID_NTD2 WD40 associated region in TFIID subunit, NTD2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j49A00
2J49A 2NXPA 2J4BA
chains in the Genus database with same CATH superfamily
1PC2A 3ABME 4NIKA 4PS3A 5AQ9A 3JYSA 3QARA 4PUCA 4RSYA 3B7RL 3IV0A 4GZCA 4WWPA 3LCAA 2V5QC 4Y6WA 4CGVA 3CEQA 2PM7A 2VSNA 2Q7FA 4EBAA 4CDRA 2KXPC 1WM5A 4XI0A 4TRQA 3FU0A 4UQXA 3UM3A 1SA4A 4BY6A 2ONDA 2LAHA 2PZIA 2WB2A 3IKOB 2FO1E 3GYZA 4EHMA 3W9GA 2RFMA 3DSWA 4J7WA 4CRWA 3PZ1A 4AY5A 3G2WA 4EQFA 4G8KA 3TJPA 3PEVB 3NOGD 4TUUA 3UKRG 3DEPA 3FU5A 1YA0A 4BX8A 1TJCA 3FU3A 2I6HA 4ATGA 3PZDA 5A6CA 1OCZE 1SVXA 2RG8A 4GA1A 2WMOA 4APFA 1N0QA 4N5QA 2H6FA 3HVEB 4LNBA 3Q49B 3SGHA 3ZEFA 1NZNA 4XZ4A 4I2ZA 3AU5A 5JJTA 3CVNA 2BUGA 4N3BA 2LXMA 2EIME 4BT8A 3NOCD 3MYVA 3JUEA 3LEWA 3APFA 2VGXB 3KS2A 5ENOD 3ABKE 1S70B 4RQIA 2LAIA 2IJGX 5CBNA 3LPZA 1UJJA 4J6IA 1FVHA 3AS8A 2WXGA 3TL5A 3AS5A 2OVFA 2XHEA 4IN3B 4C0EA 2VSOE 3LXUX 3D9NA 3MKQA 2CFUA 2FO7A 2J9QA 4RVBA 1E8WA 3AS4A 3MKRA 4JXTA 1TR4A 4O1PA 5G04J 3KSQA 3TG5A 5CRUA 1JWGA 5AARA 3RRUA 4M7CA 2KATA 4GMLA 1N52A 2RKKA 4JEHA 4JVSA 3RJVA 3QKYA 4HOQA 4MBGA 3L54A 1N4SA 1AP7A 4LCTA 5A7DB 1Y6IA 5BUZA 4UQZA 3CQCB 5AYWD 1K8KG 4AM9A 3P1UA 5FQ6A 3CGHA 4KVOA 2NXPA 2KM4A 3ZFWA 3J5PA 5AQAA 1DVPA 1ELRA 4XIFA 2IEJA 2KC7A 3HXCA 3PRZA 3ZN3A 2IONA 1YYHA 2H6IA 1QQEA 1WAO1 3AG3E 3EDTB 1S64A 3R7RA 1NA3A 4JHJA 2OOEA 3ENEA 4CT0A 1BPOA 3KEAA 3DXKG 5CCLA 5LCWJ 3ULYA 4K5AB 4GTOA 1OUVA 3SO8A 4BESA 1DC2A 2NYJA 3CK9A 4GTVA 1WDYA 4YVOA 3IHYA 1MX4A 5AJLA 3MX3A 3C3RA 4UWKA 4KZCA 4GPKA 3VLFA 4BETA 2YHEA 3DSTA 4GTSA 4GCOA 3CVVA 3BU8A 3BG0B 3UKUG 4F1PA 4GAAA 5ENPD 1N11A 4LNGA 3HXEA 4GMRA 2QYUA 1TN6A 3ZHEA 3IBEA 1D8EA 3D9KA 4BEPA 3L82A 3S7FA 5T8IA 2I1KA 3AG4E 3PH0C 3T5XA 3UXGA 2XGMA 3EU9A 3FY4A 2Y4TA 4E6HA 1BI7B 1HX8A 3FU6A 3OXGA 1HU3A 2XRZA 2V0PA 5G55A 1YCSB 4DRXE 3CVXA 2MRIA 4UUCA 1KLXA 5E76A 4WWOA 3E32A 4DJAA 2GRLA 3L22A 3ZGQA 3UT4A 1YMPA 3TG4A 3T9KA 2GW1A 3RRMB 3FEYA 4G2VA 2UY1B 3CIAA 1E8ZA 4C48B 2HE0A 3BQOA 3QOUA 1P5QA 1FCHA 3GZSA 2J09A 5FZQA 4UWGA 3SI5A 3KD7A 4I1MA 3HXBA 4I9EA 1UOHA 2NC9A 4A3TA 3HYMB 1KZPA 4DLOA 4TUMA 1BD8A 3GZ1A 3W9FA 2ZGDA 2WXHA 4KZ0A 1U3DA 5AAOA 4GU5A 4FLHA 2CHZA 5HQ8A 3P2BA 3CSFA 4JD2G 3LDZA 4YDOA 2VGEA 5BV1A 2OV8A 1JCQA 3E33A 4E85A 2AXUA 4BX9A 4H7YA 4F7AA 4XEIG 2DCPA 3ZU7B 2P9NG 4O6FA 2DYRE 3MJWA 3ULEG 3FUKA 2RD0A 4GPMA 2KCKA 3T8KA 3OXLA 4DUIA 5EKQD 3V79K 3QNKA 4CYMD 1KT0A 3CKCA 3L6AA 5JMND 1HG2A 3PEUB 3D9PA 3AG1E 2VJ8A 1IHBA 1TNZA 1Q2ZA 3PE3A 3TWUA 2Y0BG 4UQYA 3UX4A 3I5PA 1FPPA 2J07A 4GYWA 5M72A 3C3QA 3Q7FA 3UT8A 3JQ0A 3AAAC 2WXIA 5FQ8A 3JQ1A 3FH7A 4ILHB 2A5UA 4KBQA 2ETAA 2P9SG 4KXKB 5KJLA 2L9BA 1NI1A 3Q9NC 1HZ4A 3ABLE 2GGFA 1SW6A 5FWQA 3DWLG 1HXIA 1O5MA 3EIJA 1QBQA 3QWVA 3PUJA 4XI9A 5HRYA 2CHWA 3CK8A 3ASHA 5KNHD 5KCMA 4DPRA 2WQ7A 2IQCA 2XCCA 2VSYA 5AQBA 2XRYA 3C98A 3PZ3A 2J4DA 3MV3B 3G2UA 3PZ4A 4I43A 3S2AA 3Q79A 2YNQA 4IULA 1BU9A 1KT1A 4GTMA 2V4LA 4EZKA 1E7UA 4AVXA 2ETCA 5CCMA 2LNIA 4RLYA 4N2QA 1A5EA 3ESLA 1MX2A 5EX0A 3RU0A 2X6KA 3Q5MA 4MRUA 5KNGA 2KZTB 1ZB1A 2UWJG 3V30A 3FUEA 2WPVA 4ACKA 2PQNA 1E90A 2X38A 4UI9J 2R59A 4I6JA 1MQSA 4GZ3A 4N5CA 5EIDA 4Y6CA 3CVWA 1MYOA 2PNNA 3SF4A 3FH8A 1QYMA 4N2SA 3BG1B 3NQPA 1H2UA 3ZYKA 4ANWA 5ENSD 1H6OA 2A5EA 2YHCA 4A3VA 1EYHA 5BW8C 4I1OB 4Z68A 5AJDA 4HRLA 3TWSA 4J8EA 4JB8P 3Q7AA 1OWLA 1JUQA 3UMVA 4UI9C 5KWDA 1XGWA 4ME2A 2A4ZA 1V54E 3CHQA 3SZ7A 1UN9A 2LO6A 4TXPA 2WXKA 3FTXA 1H6KA 3KAEA 3CHMA 4AP2A 4AEZC 4O1OA 1HFAA 3CHOA 2IOSA 4DX5D 2WXOA 1JCRA 3QWWA 4GTTA 2BEDA 3AG2E 2EQXA 3TAXA 3D9JA 4K5CA 4NURA 5A23A 2IF4A 3FUHA 2DZOA 4FJZA 3Q4AB 2XQ0A 3D9MA 3ZYMA 2XEHA 4FP7A 3RK6A 4DX2A 3GW4A 2ILRA 1JWFA 4B8CB 3HXDA 2E2EA 3TWVA 5EILA 4JEUA 1PAQA 4ABNA 5BXOA 4XKBA 1MJ0A 5CEDB 2OVBA 3DPDA 4G25A 1X5BA 4URKA 2CG3A 1WG0A 2ZIRA 3FDHA 2HR2A 3Q78A 4HBDA 2IO3C 1UJKA 4U96D 1Z6TA 5B1AE 2WXLA 2YQ8A 2J8SD 4KVMA 1NP7A 5C1DA 1N4PA 4IYPA 3TWRA 4FULA 2XGOA 2J49A 2R03A 3APDA 2P9IG 5JJ7A 1L5JA 3S7JA 4EECA 3E34A 3CR3A 3FUFA 3ZIMA 3SFZA 3QDNA 3S7BA 5EN5D 4YDYA 3HXFA 5ARFA 3DSVA 2BF0X 4D10C 4H7XA 3RAUA 4WNEA 3CVQA 3DRAA 2OEWA 1X81A 3VLEA 2WXJA 5BNWA 2R2LA 5HS0A 3U9WA 2XS1A 2VTBB 2WXPA 4R7LA 4AXHA 3QWPA 3FHEA 2PQRA 2EIKE 3PE4A 4U8YD 2B6CA 3APCA 3G2VA 5CMWA 2RFAA 2HO1A 3HVEA 5CHEE 5C2YA 3I4RB 1H6PA 2P9LG 5HKPA 2C0LA 4K0RA 5FZSA 3R7QA 3QB2A 2L0IA 4DX6D 4ILIA 3FEXA 2AVPA 1IHGA 4DLQA 2IY0C 4UWFA 5JHBA 3T5VA 1OWMA 5D2MC 4X8QA 3LY7A 4CEMA 2P58C 3OXFA 1BI8B 3IXEA 3ZRHA 4ANUA 1BLXB 3DPYA 4OYSA 1N4RA 1Z5SC 4DK5A 3MV2B 2IOLA 2MOWA 2WQHA 3CVLA 3Q9UC 3Q75A 2XENA 5CRVA 1NL4A 1H2TC 2XEVA 1E7VA 3FUNA 3FUIA 5ANLA 2IO2C 4BERA 4I6GA 2R5SA 3SFXA 2VTBA 4EZLA 4U8HA 4RG6A 2CG2A 4N39A 3SQVA 2KCVA 4FADA 2WXFA 3D9OA 3IHVA 4HFGA 3SD5A 1N9AA 2DVWA 4GCNA 2PM6A 3LS8A 5EDSA 2KCLA 1IKND 1TEZA 2Y69E 3UUXA 4G8LA 3UTMA 2EILE 4P29A 1N94A 3ZXSA 3SY2A 1NA0A 2AW6A 2XZTG 3HG0D 3U4TA 3CLJA 1E8XA 4NRHB 2X3MA 4GMJA 3ZYLA 4U07A 5KJKA 3FWVA 3D3MA 3ZPJA 3ONKA 2VGXA 1OT8A 4I6EA 4PDXA 4HLEA 4QQIA 4CT4A 3UQ3A 4OAUC 3FH5A 2XPZA 5FQ4A 1H19A 4LUNU 3V31A 4IRUA 3FTZA 2KZTA 1V55E 2VSXE 4APOA 1EPUA 4V3IA 3TWTA 3DSSA 5CBOA 4U0SA 3SNXA 3JXIA 2AJAA 3C3OA 2LSVA 5D0OD 5EIBE 2L6JA 4I17A 2CFZA 1OWNA 3Q47B 4N3AA 2V8SE 4B89A 3DBSA 3QC1A 3FFLA 3LVRE 3C72A 3PS6A 2C0MA 3UIPC 5LP0A 1XNFA 2HYZA 4Q69A 4J0UA 4G23A 5D0QD 3HRAA 4GTPA 2AWIA 1TN7A 2F0YA 2P9UG 4HS2A 5IY5E 5H7PA 2XPIA 1HO8A 4J8YA 1QZ2A 1UN8A 1TN8A 2XCBA 3EU5A 4XKCA 1FVFA 5CMYA 2I1JA 4ANXA 1EF1C 3ASGA 5EX3A 1B89A 1OY3D 1N54A 3D9IA 4M3OA 2LXLA 2Y1LE 3FUDA 1UG3A 3ZHEB 1E8YA 4ANVA 3LY9A 3RSEG 1K1BA 4WNGA 4C9BB 3HIZA 1Z3XA 3L16A 1N95A 4QFVA 3GZ2A 3NB2A 2QY7A 1HF8A 5ENQD 4F53A 4BWRA 2WVIA 2X6IA 5KJMA 2FBNA 4J8DA 2H6GA 2F8YA 1TJFA 3LY8A 4WAFA 4F6RD 1JCSA 3UINC 1OWOA 4UWLA 4U7EB 5KJNA 4O60A 1U2VG 3CVYA 1OWPA 1INZA 3KSLA 5JA4D 3ZNGA 3CVUA 4GTQA 4WNFA 4LERA 5G05J 1SA5A 4UWHA 2CHXA 5AENA 3CVPA 4L1BA 5J08A 4GTRA 4HOSA 4C0MA 2L0TB 3IEGA 3S7DA 2VQ2A 4YDEA 3E37A 3C5RA 4BFRA 5D66A 3EJNA 4GZDA 3UPVA 4GB9A 4KMOA 1HS6A 5BPPA 4G26A 2ZU6B 4EBAG 4JPSA 1D8DA 4WNDA 3R9MA 3B7BA 2QFCA 4OAVB 1NFIE 3U3WA 1K1AA 3MA5A 2HM8A 4ILGA 1KPSB 5JJ6A 4HXIA 2LUHA 2QC9A 4TXQA 3TXMA 2UY1A 3UIOC 3SBSA 4B93B 5EYPF 2J08A 4J8SA 3SFYA 1DNPA 3ZKJA 2LSUA 1KZOA 1O1RA 2Y4UA 3JXJA 4HI8A 3CK7A 4I9CA 2X6FA 5FQ7A 5EYLA 2L6BA 3UM0A 4HB5A 4J8FA 5T3RA 4EPZA 4XX5A 2XPYA 2R05A 4JC8A 4JW1A 4F3VA 1HH8A 1FT1A 3ML8A 2X6JA 3ML9A 4U0UA 4FU3A 4HNAD 2M63A 4G1TA 2DZNA 2V5FA 4A1GA 2WXRA 1PY1A 3ZYQA 4HORA 5AN8A 1E96B 5AQ7A 3HDXA 3HHMA 1OXJA 5G2NA 4LNUD 1LF8A 1VDYA 5ANRA 3B95A 2KBXA 2MYOA 3FP3A 2JEKA 5FTPA 3L13A 4LSZE 4L23A 3B13A 2DYSE 3EUVA 2I9CA 2IFUA 1MX6A 1LTXA 4DX1A 4B94A 4CZ2D 4ATZD 5BT1A 3TWQA 1OCOE 4HQDA 3Q73A 1Z3YA 4L2LA 3AU4A 3OAWA 2VYIA 3CKBA 4I2WA 5HI7A 3PUKA 1HE8A 1MHQA 4JHRA 2GRMA 5LCWC 1MZCA 2P9PG 3ZXPA 1AWCB 3L17A 4U04A 1H2VC 2DBAA 3PVLA 2AXVA 4XE0A 4N3CA 2ZXWE 1RZ4A 5ENTD 1S0PA 3UM2A 1OCRE 2XZDG 3ZUVB 3ASNE 3FULA 2JABA 3RRNB 1U3CA 4L2YA 2DWZA 3PREA 5AIJA 4JZYA 4FHJA 3TWWA 3RKVA 4DI3A 2R17C 3SHFA 4W9RA 2P9KG 5ENRD 5BV0A 3ONLA 3URZA 4ZHBA 3EHMA 3LYAA 5CECB 3NZSA 5ENNA 1LD8A 5FINA 3G2SA 2XGSA 3LJNA 3EHRA 1TNUA 4BSXA 2XEEA 4RG9A 2ZISA 3RIBA 4Q96A 3VLDA 4DI4A 3FTWA 3FTVA 4MKTA 4YVQC 3VTYA 1QNFA 2Y3AA 1IXVA 4BTAA 5BXUA 4BT9A 2AXZA 2FF4A 4G24A 5FT9A 1TNYA 3UT7A 4OVUA 4U63A 2I2OA 5KBAA 4ACLA 4HVBA 2VGYA 5T4YA 5E75A 3N71A 2QYJA 1H0AA 2DIWA 4AV7A 2FULA 5LOZA 1D9SA 1WY6A 5JHAA 3F6QA 3L9TA 1LD7A 1TYQG 1ELKA 3QJZA 5FJYA 1W3BA 4I1AA 3NZUA 4A1SA 3ZVVA 3DSUA 3D9HA 3MCXA 3K9IA 3CHSA 4KYOB 4K03A 2PL2A 2NSZA 5ITZF 4HI9A 1TNOA 5G05C 5FZRA 3FUJA 3NAWA 4GYOA 2JLBA 3FTUA 1RW2A 5J90A 5DIZA 4U0ZA 3V2XA 4ZFHA 3NBNB 4YDWA 3DXMG 3PZ2A 4B0ZA 4HOTA 2OCCE 3AJIA 3B7TA 3VTXA 2EINE 2WQ6A 1N0RA 3ESKA 4GZ6A 2J4BA 4A55A 2IU1A 3DSXA 4JHKA 5G04C 2QZAA 2BTDA 2GRPB 2GRNB 1GW6A 3RO2A 4FLBA 2ZGGA 4CCAA 1Y8MA 4FHKA 3BEEA 3EIQC 3O48A 3LJ3A 1IQUA 3MEKA 2GROB 3FUMA 2WXNA 3TWXA 1A17A 4GA2A 3JUIA 3R9AB 2ETBA 3X2QE 3CHRA 3PNLB 3KEZA 1SZAA 5CERB 3E4BA 3T8MA 1K3ZD 3U64A 4WUYA 1O1TA 2WXQA 4PS8A 5CEAA 3TGOA 3MGBA 4PS7A 3ASOE 3NF1A 3EHNA 4AOFA 4JA9A 4MLPA 4OVVA 1S63A 4A63B 4DX7D 4HRNA 3MKQB 3WXXA 4BTBA 2GRRB 1SQMA 5B3SE 2FEZA 2C2LA 4TXRA 1EDUA 2WXMA 2X6HA 3I3NA 4EZJA 4CDMA 3DEOA 2YINA 3B7UX 4TV3A 4L7TA 3ULQA 4AY6A 3D9LA 3QAQA 1SZ9A 2GRQB 4L9PA 3I4GA 1JPLA 3RO3A 1O1SA 2H6HA 3OTNA 2WM9A 4NACA 3TXNA 2V4HC 2EIJE 1G3NB 3B7SA 3ZW3A 1IYGA 4HOUA 4JL0A 3FTSA 3EHQA 1FT2A 3BUAA 2E0IA 4GA0A 4LEUA 2BKGA 2F37A 4G11A 3CQGB 1ELWA 4YNDA 3FTYA 2F8XK 1DCQA 3ASDA 3CSTA 4WWNA 1ZU2A 5LFAA 4B8AA 3LVQE 1DCEA 5B1BE 4U95D 3SBTB 2P2CP 4BSZB 4PH4B 1ZBPA 3J5QB 4HRMB 4KT6B 3ISMC 4JA7A 4MS6A 3JCKC 4FA6A 4AIFA 3WG7E 3PNTB 4F1SA 4LG6A 3QK0A 3PDNA 4CGWA 1IQRA 2MHKA 4K5BA 3Q15A 1HG5A 3O4ZA 5FIOA 3UI2A 4GZ5A 5ARGA 2XS8A 4FC8A 2B0OE 3CV0A 3MZLB 1OCCE 4FJYA 3UM1A 5LX8A 2WMNA 2FI7A 4CDNA 2BKKB 4AJWA 4U8VD 3LKUA 3ASFA 5DBKA 3CHPA 4Q94A 3V2OA 1UW4B 4LRZA 4HLLA 3E30A 1N4QA 2R02A 3U66A 4UI9K 3L08A 1TNBA 3G2TA 2OEVA 4GYYA 4NQ0A
chains in the Genus database with same CATH topology
1PC2A 4L2YA 4PS3A 3PREA 4P29A 4UQYA 3ZXSA 3UX4A 5AIJA 4JZYA 3JYSA 3QARA 3I5PA 4FHJA 2J07A 1NA0A 2AW6A 4GYWA 4PUCA 4RSYA 3RKVA 3U4TA 5M72A 3CLJA 4DI3A 3B7RL 3IV0A 2R17C 1E8XA 4GZCA 3SHFA 3UT8A 4W9RA 4NRHB 2X3MA 3JQ0A 4GMJA 2WXIA 5FQ8A 3JQ1A 5BV0A 4WWPA 3ZYLA 3LCAA 4U07A 4Y6WA 5KJKA 3ONLA 3FH7A 4CGVA 3CEQA 3FWVA 3URZA 4ILHB 2A5UA 4KBQA 2PM7A 3D3MA 3ZPJA 3EHMA 2VSNA 2Q7FA 3ONKA 2VGXA 4I6EA 3LYAA 4PDXA 4HLEA 4EBAA 4CDRA 4CT4A 4KXKB 5KJLA 3UQ3A 3NZSA 2L9BA 5ENNA 1WM5A 3FH5A 4XI0A 4TRQA 3FU0A 3G2SA 4UQXA 1HZ4A 4BY6A 2XGSA 2GGFA 2XPZA 5FQ4A 1H19A 2ONDA 4LUNU 2LAHA 2PZIA 2WB2A 4IRUA 3FTZA 3IKOB 4BSXA 2KZTA 5FWQA 2VSXE 3GYZA 4APOA 1HXIA 4RG9A 1EPUA 4V3IA 3EIJA 3QWVA 4Q96A 3RIBA 3PUJA 4U0SA 3VLDA 4DI4A 4XI9A 3SNXA 3FTWA 2CHWA 3CK8A 3FTVA 3ASHA 4CRWA 4MKTA 4YVQC 5KCMA 3VTYA 4DPRA 2WQ7A 2IQCA 2LSVA 5D0OD 1QNFA 2XCCA 2VSYA 2Y3AA 2XRYA 3C98A 2L6JA 4AY5A 3G2WA 4BTAA 3TJPA 4EQFA 4I17A 4BT9A 2CFZA 1OWNA 2J4DA 3PEVB 3MV3B 2AXZA 3Q47B 4N3AA 2FF4A 3G2UA 4G24A 2V8SE 5FT9A 4B89A 3DBSA 4I43A 3UT7A 4OVUA 4U63A 2I2OA 3QC1A 4TUUA 3S2AA 2YNQA 3FFLA 4IULA 3LVRE 3FU5A 1KT1A 1YA0A 4ACLA 4HVBA 2VGYA 3PS6A 5T4YA 2V4LA 4BX8A 2C0MA 5E75A 4EZKA 3N71A 1E7UA 1TJCA 3FU3A 4AVXA 5CCMA 5LP0A 2I6HA 2LNIA 1XNFA 4ATGA 3PZDA 2HYZA 4Q69A 1H0AA 2DIWA 4N2QA 4AV7A 4J0UA 4G23A 2FULA 5LOZA 5A6CA 5D0QD 3ESLA 2RG8A 4GA1A 2WMOA 1WY6A 4APFA 5JHAA 5EX0A 3RU0A 2AWIA 2X6KA 3Q5MA 4MRUA 3HVEB 1ELKA 2KZTB 4HS2A 3QJZA 2UWJG 5FJYA 1W3BA 3FUEA 2WPVA 4I1AA 3Q49B 2XPIA 3NZUA 3SGHA 2PQNA 3ZEFA 4ACKA 1E90A 2X38A 4A1SA 3ZVVA 1HO8A 4UI9J 1NZNA 2R59A 4I6JA 1MQSA 1QZ2A 1UN8A 3AU5A 4GZ3A 2XCBA 4I2ZA 4N5CA 4XZ4A 5JJTA 3MCXA 3CVNA 4Y6CA 3K9IA 4XKCA 1FVFA 2BUGA 3CHSA 4KYOB 4K03A 5CMYA 2I1JA 4ANXA 1EF1C 3CVWA 2PL2A 4N3BA 2NSZA 3ASGA 4BT8A 5EX3A 1B89A 3MYVA 5G05C 3SF4A 3LEWA 3FH8A 5FZRA 4N2SA 3BG1B 3APFA 3FUJA 3NQPA 1H2UA 1N54A 2VGXB 3D9IA 3ZYKA 4ANWA 4GYOA 3KS2A 2JLBA 3FTUA 4M3OA 2LAIA 5DIZA 2IJGX 2YHCA 4U0ZA 5J90A 3FUDA 1UG3A 3LPZA 3ZHEB 4A3VA 1UJJA 1E8YA 1EYHA 1FVHA 4J6IA 5BW8C 3AS8A 4I1OB 4ANVA 2WXGA 3LY9A 3TL5A 3AS5A 2OVFA 5AJDA 2XHEA 4IN3B 4C0EA 4WNGA 4C9BB 3HIZA 2VSOE 1Z3XA 4J8EA 4B0ZA 3L16A 4HOTA 3LXUX 4QFVA 3GZ2A 3D9NA 2QY7A 1HF8A 3B7TA 1OWLA 3MKQA 4F53A 1JUQA 3UMVA 3VTXA 2CFUA 2WVIA 4UI9C 4BWRA 2FO7A 2X6IA 2J9QA 4RVBA 1E8WA 5KJMA 2FBNA 4J8DA 3AS4A 1XGWA 3MKRA 4ME2A 2WQ6A 4JXTA 2A4ZA 3ESKA 4GZ6A 2J4BA 5G04J 3CHQA 4A55A 1TJFA 3LY8A 3SZ7A 2IU1A 3TG5A 4WAFA 1UN9A 2LO6A 1JWGA 2WXKA 4JHKA 5G04C 1OWOA 3RRUA 3FTXA 2KATA 1H6KA 4GMLA 1N52A 4JEHA 2BTDA 4JVSA 3RJVA 3KAEA 3CHMA 4UWLA 4AEZC 1GW6A 4AP2A 1HFAA 3RO2A 3CHOA 2IOSA 4FLBA 2WXOA 3QKYA 5KJNA 3QWWA 4HOQA 3CVYA 1OWPA 4CCAA 1Y8MA 4FHKA 1INZA 3BEEA 3L54A 2EQXA 3TAXA 3D9JA 3EIQC 3O48A 3CVUA 3LJ3A 4LCTA 5A7DB 4WNFA 1Y6IA 5BUZA 1IQUA 3MEKA 4NURA 3FUMA 2IF4A 3FUHA 4FJZA 4UQZA 3CQCB 4LERA 5AYWD 5A23A 2WXNA 3Q4AB 5G05J 4UWHA 1A17A 4GA2A 3JUIA 4AM9A 2XQ0A 3D9MA 3P1UA 3R9AB 5FQ6A 3CGHA 3CHRA 2CHXA 3PNLB 4KVOA 3ZYMA 3CVPA 3KEZA 4FP7A 5AENA 4L1BA 2NXPA 5J08A 1SZAA 3RK6A 4HOSA 4C0MA 2KM4A 2L0TB 3E4BA 3GW4A 2ILRA 3T8MA 3ZFWA 3IEGA 3U64A 3S7DA 1JWFA 4WUYA 4B8CB 2VQ2A 2E2EA 1DVPA 1ELRA 2WXQA 4XIFA 4PS8A 4JEUA 3MGBA 3TGOA 1PAQA 2KC7A 4ABNA 4PS7A 3PRZA 4BFRA 3ZN3A 2IONA 3NF1A 3EHNA 4AOFA 4JA9A 3EJNA 4GZDA 4MLPA 4XKBA 2OVBA 3DPDA 1QQEA 1WAO1 3EDTB 4OVVA 4G25A 1X5BA 4URKA 3R7RA 3UPVA 2CG3A 4GB9A 4KMOA 1HS6A 5BPPA 4G26A 2ZU6B 3MKQB 1NA3A 4JHJA 3WXXA 4BTBA 2OOEA 3FDHA 2HR2A 4EBAG 3ENEA 1SQMA 4CT0A 1UJKA 4JPSA 4WNDA 1BPOA 1Z6TA 2FEZA 5CCLA 2C2LA 2WXLA 1EDUA 2WXMA 2YQ8A 2X6HA 5LCWJ 2QFCA 3I3NA 4EZJA 4KVMA 3U3WA 1NP7A 4CDMA 5C1DA 4IYPA 2YINA 2HM8A 3MA5A 1OUVA 3B7UX 4FULA 4ILGA 2XGOA 2J49A 3APDA 5JJ6A 4TV3A 4L7TA 3ULQA 4HXIA 5JJ7A 1L5JA 3D9LA 4AY6A 3S7JA 3CK9A 3QAQA 4EECA 3CR3A 4YVOA 1SZ9A 3TXMA 3IHYA 2UY1A 3SBSA 5AJLA 3MX3A 3FUFA 4UWKA 3I4GA 3ZIMA 1JPLA 3RO3A 4KZCA 3SFZA 2J08A 3QDNA 4J8SA 3VLFA 4GPKA 2YHEA 3S7BA 4GCOA 1DNPA 3CVVA 3OTNA 2WM9A 3BG0B 2LSUA 4NACA 5ARFA 4GAAA 3TXNA 2BF0X 2Y4UA 4D10C 3B7SA 3ZHEA 3IBEA 4H7XA 3CK7A 4I9CA 3ZW3A 4WNEA 3CVQA 4HOUA 3D9KA 1IYGA 2X6FA 3S7FA 5T8IA 4JL0A 5FQ7A 3FTSA 2I1KA 3PH0C 3VLEA 3T5XA 4J8FA 2WXJA 5T3RA 2XGMA 5BNWA 2E0IA 4EPZA 4XX5A 4GA0A 4LEUA 2XPYA 3FY4A 2Y4TA 4E6HA 1HX8A 3U9WA 3FU6A 3OXGA 1HU3A 4G11A 2VTBB 4JC8A 2WXPA 4JW1A 2XRZA 3CQGB 1ELWA 2V0PA 4F3VA 4YNDA 3FTYA 5G55A 1HH8A 4R7LA 3ML8A 2X6JA 3ASDA 3ML9A 3CSTA 3CVXA 4AXHA 4WWNA 2MRIA 4U0UA 4FU3A 1KLXA 5E76A 4WWOA 1ZU2A 3QWPA 2M63A 3FHEA 4G1TA 4B8AA 4DJAA 5LFAA 2GRLA 2PQRA 2V5FA 3L22A 3LVQE 3PE4A 4A1GA 3ZGQA 3UT4A 3APCA 2WXRA 1PY1A 3G2VA 3TG4A 2GW1A 3RRMB 3ZYQA 5CMWA 4HORA 3FEYA 4G2VA 1E96B 2UY1B 3CIAA 1E8ZA 2HO1A 3HVEA 5CHEE 3HDXA 3SBTB 5C2YA 3HHMA 3QOUA 4PH4B 3I4RB 1P5QA 5G2NA 1ZBPA 1LF8A 1VDYA 2C0LA 1FCHA 5ANRA 4KT6B 3GZSA 4K0RA 4JA7A 5FZSA 3R7QA 2J09A 4MS6A 3QB2A 5FZQA 3JCKC 4UWGA 4FA6A 2L0IA 4AIFA 3SI5A 4ILIA 3KD7A 3FEXA 3PNTB 4I1MA 2AVPA 1IHGA 4DLQA 3FP3A 2JEKA 5FTPA 4F1SA 4UWFA 3L13A 4I9EA 5JHBA 3T5VA 3QK0A 1OWMA 4L23A 3PDNA 3B13A 2NC9A 4A3TA 3HYMB 2I9CA 2IFUA 4DLOA 4CGWA 1IQRA 3GZ1A 2MHKA 3Q15A 1HG5A 4B94A 2WXHA 4KZ0A 3O4ZA 1U3DA 3LY7A 4CEMA 4GU5A 4FLHA 5BT1A 2P58C 3OXFA 2CHZA 3ZRHA 5HQ8A 4ANUA 3P2BA 3CSFA 4GZ5A 3LDZA 5ARGA 4OYSA 4FC8A 1Z3YA 5BV1A 4L2LA 2OV8A 3CV0A 3AU4A 3MZLB 3OAWA 4E85A 2AXUA 2VYIA 4BX9A 4DK5A 3MV2B 3CKBA 4FJYA 4H7YA 3CVLA 2IOLA 2MOWA 2WQHA 4I2WA 5HI7A 3PUKA 5LX8A 4F7AA 1HE8A 1MHQA 2DCPA 4O6FA 2WMNA 2FI7A 4CDNA 4JHRA 1H2TC 2XEVA 2GRMA 5LCWC 4AJWA 3MJWA 1E7VA 3LKUA 3ASFA 3FUNA 5DBKA 3FUIA 3L17A 3CHPA 4Q94A 4U04A 3FUKA 5ANLA 1UW4B 2RD0A 4I6GA 2KCKA 1H2VC 2DBAA 2R5SA 3PVLA 2VTBA 3OXLA 4LRZA 2AXVA 5EKQD 4EZLA 4U8HA 3QNKA 1KT0A 4RG6A 4XE0A 2CG2A 3CKCA 3L6AA 4N3CA 2KCVA 4N39A 4FADA 3U66A 2WXFA 4UI9K 3D9OA 3IHVA 1HG2A 4HFGA 3PEUB 3L08A 3G2TA 3SD5A 3D9PA 1S0PA 4GCNA 2VJ8A 2PM6A 3LS8A 5EDSA 2KCLA 3FULA 1TEZA 4GYYA 4NQ0A 3UUXA 3RRNB 3PE3A 1U3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J49 A;  2NXP A;  2J4B A; 
#chains in the Genus database with same CATH topology
 1PC2 A;  3ABM E;  4NIK A;  4PS3 A;  5AQ9 A;  3JYS A;  3QAR A;  4PUC A;  4RSY A;  3B7R L;  3IV0 A;  4GZC A;  4WWP A;  3LCA A;  2V5Q C;  4Y6W A;  4CGV A;  3CEQ A;  2PM7 A;  2VSN A;  2Q7F A;  4EBA A;  4CDR A;  2KXP C;  1WM5 A;  4XI0 A;  4TRQ A;  3FU0 A;  4UQX A;  3UM3 A;  1SA4 A;  4BY6 A;  2OND A;  2LAH A;  2PZI A;  2WB2 A;  3IKO B;  2FO1 E;  3GYZ A;  4EHM A;  3W9G A;  2RFM A;  3DSW A;  4J7W A;  4CRW A;  3PZ1 A;  4AY5 A;  3G2W A;  4EQF A;  4G8K A;  3TJP A;  3PEV B;  3NOG D;  4TUU A;  3UKR G;  3DEP A;  3FU5 A;  1YA0 A;  4BX8 A;  1TJC A;  3FU3 A;  2I6H A;  4ATG A;  3PZD A;  5A6C A;  1OCZ E;  1SVX A;  2RG8 A;  4GA1 A;  2WMO A;  4APF A;  1N0Q A;  4N5Q A;  2H6F A;  3HVE B;  4LNB A;  3Q49 B;  3SGH A;  3ZEF A;  1NZN A;  4XZ4 A;  4I2Z A;  3AU5 A;  5JJT A;  3CVN A;  2BUG A;  4N3B A;  2LXM A;  2EIM E;  4BT8 A;  3NOC D;  3MYV A;  3JUE A;  3LEW A;  3APF A;  2VGX B;  3KS2 A;  5ENO D;  3ABK E;  1S70 B;  4RQI A;  2LAI A;  2IJG X;  5CBN A;  3LPZ A;  1UJJ A;  4J6I A;  1FVH A;  3AS8 A;  2WXG A;  3TL5 A;  3AS5 A;  2OVF A;  2XHE A;  4IN3 B;  4C0E A;  2VSO E;  3LXU X;  3D9N A;  3MKQ A;  2CFU A;  2FO7 A;  2J9Q A;  4RVB A;  1E8W A;  3AS4 A;  3MKR A;  4JXT A;  1TR4 A;  4O1P A;  5G04 J;  3KSQ A;  3TG5 A;  5CRU A;  1JWG A;  5AAR A;  3RRU A;  4M7C A;  2KAT A;  4GML A;  1N52 A;  2RKK A;  4JEH A;  4JVS A;  3RJV A;  3QKY A;  4HOQ A;  4MBG A;  3L54 A;  1N4S A;  1AP7 A;  4LCT A;  5A7D B;  1Y6I A;  5BUZ A;  4UQZ A;  3CQC B;  5AYW D;  1K8K G;  4AM9 A;  3P1U A;  5FQ6 A;  3CGH A;  4KVO A;  2NXP A;  2KM4 A;  3ZFW A;  3J5P A;  5AQA A;  1DVP A;  1ELR A;  4XIF A;  2IEJ A;  2KC7 A;  3HXC A;  3PRZ A;  3ZN3 A;  2ION A;  1YYH A;  2H6I A;  1QQE A;  1WAO 1;  3AG3 E;  3EDT B;  1S64 A;  3R7R A;  1NA3 A;  4JHJ A;  2OOE A;  3ENE A;  4CT0 A;  1BPO A;  3KEA A;  3DXK G;  5CCL A;  5LCW J;  3ULY A;  4K5A B;  4GTO A;  1OUV A;  3SO8 A;  4BES A;  1DC2 A;  2NYJ A;  3CK9 A;  4GTV A;  1WDY A;  4YVO A;  3IHY A;  1MX4 A;  5AJL A;  3MX3 A;  3C3R A;  4UWK A;  4KZC A;  4GPK A;  3VLF A;  4BET A;  2YHE A;  3DST A;  4GTS A;  4GCO A;  3CVV A;  3BU8 A;  3BG0 B;  3UKU G;  4F1P A;  4GAA A;  5ENP D;  1N11 A;  4LNG A;  3HXE A;  4GMR A;  2QYU A;  1TN6 A;  3ZHE A;  3IBE A;  1D8E A;  3D9K A;  4BEP A;  3L82 A;  3S7F A;  5T8I A;  2I1K A;  3AG4 E;  3PH0 C;  3T5X A;  3UXG A;  2XGM A;  3EU9 A;  3FY4 A;  2Y4T A;  4E6H A;  1BI7 B;  1HX8 A;  3FU6 A;  3OXG A;  1HU3 A;  2XRZ A;  2V0P A;  5G55 A;  1YCS B;  4DRX E;  3CVX A;  2MRI A;  4UUC A;  1KLX A;  5E76 A;  4WWO A;  3E32 A;  4DJA A;  2GRL A;  3L22 A;  3ZGQ A;  3UT4 A;  1YMP A;  3TG4 A;  3T9K A;  2GW1 A;  3RRM B;  3FEY A;  4G2V A;  2UY1 B;  3CIA A;  1E8Z A;  4C48 B;  2HE0 A;  3BQO A;  3QOU A;  1P5Q A;  1FCH A;  3GZS A;  2J09 A;  5FZQ A;  4UWG A;  3SI5 A;  3KD7 A;  4I1M A;  3HXB A;  4I9E A;  1UOH A;  2NC9 A;  4A3T A;  3HYM B;  1KZP A;  4DLO A;  4TUM A;  1BD8 A;  3GZ1 A;  3W9F A;  2ZGD A;  2WXH A;  4KZ0 A;  1U3D A;  5AAO A;  4GU5 A;  4FLH A;  2CHZ A;  5HQ8 A;  3P2B A;  3CSF A;  4JD2 G;  3LDZ A;  4YDO A;  2VGE A;  5BV1 A;  2OV8 A;  1JCQ A;  3E33 A;  4E85 A;  2AXU A;  4BX9 A;  4H7Y A;  4F7A A;  4XEI G;  2DCP A;  3ZU7 B;  2P9N G;  4O6F A;  2DYR E;  3MJW A;  3ULE G;  3FUK A;  2RD0 A;  4GPM A;  2KCK A;  3T8K A;  3OXL A;  4DUI A;  5EKQ D;  3V79 K;  3QNK A;  4CYM D;  1KT0 A;  3CKC A;  3L6A A;  5JMN D;  1HG2 A;  3PEU B;  3D9P A;  3AG1 E;  2VJ8 A;  1IHB A;  1TNZ A;  1Q2Z A;  3PE3 A;  3TWU A;  2Y0B G;  4UQY A;  3UX4 A;  3I5P A;  1FPP A;  2J07 A;  4GYW A;  5M72 A;  3C3Q A;  3Q7F A;  3UT8 A;  3JQ0 A;  3AAA C;  2WXI A;  5FQ8 A;  3JQ1 A;  3FH7 A;  4ILH B;  2A5U A;  4KBQ A;  2ETA A;  2P9S G;  4KXK B;  5KJL A;  2L9B A;  1NI1 A;  3Q9N C;  1HZ4 A;  3ABL E;  2GGF A;  1SW6 A;  5FWQ A;  3DWL G;  1HXI A;  1O5M A;  3EIJ A;  1QBQ A;  3QWV A;  3PUJ A;  4XI9 A;  5HRY A;  2CHW A;  3CK8 A;  3ASH A;  5KNH D;  5KCM A;  4DPR A;  2WQ7 A;  2IQC A;  2XCC A;  2VSY A;  5AQB A;  2XRY A;  3C98 A;  3PZ3 A;  2J4D A;  3MV3 B;  3G2U A;  3PZ4 A;  4I43 A;  3S2A A;  3Q79 A;  2YNQ A;  4IUL A;  1BU9 A;  1KT1 A;  4GTM A;  2V4L A;  4EZK A;  1E7U A;  4AVX A;  2ETC A;  5CCM A;  2LNI A;  4RLY A;  4N2Q A;  1A5E A;  3ESL A;  1MX2 A;  5EX0 A;  3RU0 A;  2X6K A;  3Q5M A;  4MRU A;  5KNG A;  2KZT B;  1ZB1 A;  2UWJ G;  3V30 A;  3FUE A;  2WPV A;  4ACK A;  2PQN A;  1E90 A;  2X38 A;  4UI9 J;  2R59 A;  4I6J A;  1MQS A;  4GZ3 A;  4N5C A;  5EID A;  4Y6C A;  3CVW A;  1MYO A;  2PNN A;  3SF4 A;  3FH8 A;  1QYM A;  4N2S A;  3BG1 B;  3NQP A;  1H2U A;  3ZYK A;  4ANW A;  5ENS D;  1H6O A;  2A5E A;  2YHC A;  4A3V A;  1EYH A;  5BW8 C;  4I1O B;  4Z68 A;  5AJD A;  4HRL A;  3TWS A;  4J8E A;  4JB8 P;  3Q7A A;  1OWL A;  1JUQ A;  3UMV A;  4UI9 C;  5KWD A;  1XGW A;  4ME2 A;  2A4Z A;  1V54 E;  3CHQ A;  3SZ7 A;  1UN9 A;  2LO6 A;  4TXP A;  2WXK A;  3FTX A;  1H6K A;  3KAE A;  3CHM A;  4AP2 A;  4AEZ C;  4O1O A;  1HFA A;  3CHO A;  2IOS A;  4DX5 D;  2WXO A;  1JCR A;  3QWW A;  4GTT A;  2BED A;  3AG2 E;  2EQX A;  3TAX A;  3D9J A;  4K5C A;  4NUR A;  5A23 A;  2IF4 A;  3FUH A;  2DZO A;  4FJZ A;  3Q4A B;  2XQ0 A;  3D9M A;  3ZYM A;  2XEH A;  4FP7 A;  3RK6 A;  4DX2 A;  3GW4 A;  2ILR A;  1JWF A;  4B8C B;  3HXD A;  2E2E A;  3TWV A;  5EIL A;  4JEU A;  1PAQ A;  4ABN A;  5BXO A;  4XKB A;  1MJ0 A;  5CED B;  2OVB A;  3DPD A;  4G25 A;  1X5B A;  4URK A;  2CG3 A;  1WG0 A;  2ZIR A;  3FDH A;  2HR2 A;  3Q78 A;  4HBD A;  2IO3 C;  1UJK A;  4U96 D;  1Z6T A;  5B1A E;  2WXL A;  2YQ8 A;  2J8S D;  4KVM A;  1NP7 A;  5C1D A;  1N4P A;  4IYP A;  3TWR A;  4FUL A;  2XGO A;  2J49 A;  2R03 A;  3APD A;  2P9I G;  5JJ7 A;  1L5J A;  3S7J A;  4EEC A;  3E34 A;  3CR3 A;  3FUF A;  3ZIM A;  3SFZ A;  3QDN A;  3S7B A;  5EN5 D;  4YDY A;  3HXF A;  5ARF A;  3DSV A;  2BF0 X;  4D10 C;  4H7X A;  3RAU A;  4WNE A;  3CVQ A;  3DRA A;  2OEW A;  1X81 A;  3VLE A;  2WXJ A;  5BNW A;  2R2L A;  5HS0 A;  3U9W A;  2XS1 A;  2VTB B;  2WXP A;  4R7L A;  4AXH A;  3QWP A;  3FHE A;  2PQR A;  2EIK E;  3PE4 A;  4U8Y D;  2B6C A;  3APC A;  3G2V A;  5CMW A;  2RFA A;  2HO1 A;  3HVE A;  5CHE E;  5C2Y A;  3I4R B;  1H6P A;  2P9L G;  5HKP A;  2C0L A;  4K0R A;  5FZS A;  3R7Q A;  3QB2 A;  2L0I A;  4DX6 D;  4ILI A;  3FEX A;  2AVP A;  1IHG A;  4DLQ A;  2IY0 C;  4UWF A;  5JHB A;  3T5V A;  1OWM A;  5D2M C;  4X8Q A;  3LY7 A;  4CEM A;  2P58 C;  3OXF A;  1BI8 B;  3IXE A;  3ZRH A;  4ANU A;  1BLX B;  3DPY A;  4OYS A;  1N4R A;  1Z5S C;  4DK5 A;  3MV2 B;  2IOL A;  2MOW A;  2WQH A;  3CVL A;  3Q9U C;  3Q75 A;  2XEN A;  5CRV A;  1NL4 A;  1H2T C;  2XEV A;  1E7V A;  3FUN A;  3FUI A;  5ANL A;  2IO2 C;  4BER A;  4I6G A;  2R5S A;  3SFX A;  2VTB A;  4EZL A;  4U8H A;  4RG6 A;  2CG2 A;  4N39 A;  3SQV A;  2KCV A;  4FAD A;  2WXF A;  3D9O A;  3IHV A;  4HFG A;  3SD5 A;  1N9A A;  2DVW A;  4GCN A;  2PM6 A;  3LS8 A;  5EDS A;  2KCL A;  1IKN D;  1TEZ A;  2Y69 E;  3UUX A;  4G8L A;  3UTM A;  2EIL E;  4P29 A;  1N94 A;  3ZXS A;  3SY2 A;  1NA0 A;  2AW6 A;  2XZT G;  3HG0 D;  3U4T A;  3CLJ A;  1E8X A;  4NRH B;  2X3M A;  4GMJ A;  3ZYL A;  4U07 A;  5KJK A;  3FWV A;  3D3M A;  3ZPJ A;  3ONK A;  2VGX A;  1OT8 A;  4I6E A;  4PDX A;  4HLE A;  4QQI A;  4CT4 A;  3UQ3 A;  4OAU C;  3FH5 A;  2XPZ A;  5FQ4 A;  1H19 A;  4LUN U;  3V31 A;  4IRU A;  3FTZ A;  2KZT A;  1V55 E;  2VSX E;  4APO A;  1EPU A;  4V3I A;  3TWT A;  3DSS A;  5CBO A;  4U0S A;  3SNX A;  3JXI A;  2AJA A;  3C3O A;  2LSV A;  5D0O D;  5EIB E;  2L6J A;  4I17 A;  2CFZ A;  1OWN A;  3Q47 B;  4N3A A;  2V8S E;  4B89 A;  3DBS A;  3QC1 A;  3FFL A;  3LVR E;  3C72 A;  3PS6 A;  2C0M A;  3UIP C;  5LP0 A;  1XNF A;  2HYZ A;  4Q69 A;  4J0U A;  4G23 A;  5D0Q D;  3HRA A;  4GTP A;  2AWI A;  1TN7 A;  2F0Y A;  2P9U G;  4HS2 A;  5IY5 E;  5H7P A;  2XPI A;  1HO8 A;  4J8Y A;  1QZ2 A;  1UN8 A;  1TN8 A;  2XCB A;  3EU5 A;  4XKC A;  1FVF A;  5CMY A;  2I1J A;  4ANX A;  1EF1 C;  3ASG A;  5EX3 A;  1B89 A;  1OY3 D;  1N54 A;  3D9I A;  4M3O A;  2LXL A;  2Y1L E;  3FUD A;  1UG3 A;  3ZHE B;  1E8Y A;  4ANV A;  3LY9 A;  3RSE G;  1K1B A;  4WNG A;  4C9B B;  3HIZ A;  1Z3X A;  3L16 A;  1N95 A;  4QFV A;  3GZ2 A;  3NB2 A;  2QY7 A;  1HF8 A;  5ENQ D;  4F53 A;  4BWR A;  2WVI A;  2X6I A;  5KJM A;  2FBN A;  4J8D A;  2H6G A;  2F8Y A;  1TJF A;  3LY8 A;  4WAF A;  4F6R D;  1JCS A;  3UIN C;  1OWO A;  4UWL A;  4U7E B;  5KJN A;  4O60 A;  1U2V G;  3CVY A;  1OWP A;  1INZ A;  3KSL A;  5JA4 D;  3ZNG A;  3CVU A;  4GTQ A;  4WNF A;  4LER A;  5G05 J;  1SA5 A;  4UWH A;  2CHX A;  5AEN A;  3CVP A;  4L1B A;  5J08 A;  4GTR A;  4HOS A;  4C0M A;  2L0T B;  3IEG A;  3S7D A;  2VQ2 A;  4YDE A;  3E37 A;  3C5R A;  4BFR A;  5D66 A;  3EJN A;  4GZD A;  3UPV A;  4GB9 A;  4KMO A;  1HS6 A;  5BPP A;  4G26 A;  2ZU6 B;  4EBA G;  4JPS A;  1D8D A;  4WND A;  3R9M A;  3B7B A;  2QFC A;  4OAV B;  1NFI E;  3U3W A;  1K1A A;  3MA5 A;  2HM8 A;  4ILG A;  1KPS B;  5JJ6 A;  4HXI A;  2LUH A;  2QC9 A;  4TXQ A;  3TXM A;  2UY1 A;  3UIO C;  3SBS A;  4B93 B;  5EYP F;  2J08 A;  4J8S A;  3SFY A;  1DNP A;  3ZKJ A;  2LSU A;  1KZO A;  1O1R A;  2Y4U A;  3JXJ A;  4HI8 A;  3CK7 A;  4I9C A;  2X6F A;  5FQ7 A;  5EYL A;  2L6B A;  3UM0 A;  4HB5 A;  4J8F A;  5T3R A;  4EPZ A;  4XX5 A;  2XPY A;  2R05 A;  4JC8 A;  4JW1 A;  4F3V A;  1HH8 A;  1FT1 A;  3ML8 A;  2X6J A;  3ML9 A;  4U0U A;  4FU3 A;  4HNA D;  2M63 A;  4G1T A;  2DZN A;  2V5F A;  4A1G A;  2WXR A;  1PY1 A;  3ZYQ A;  4HOR A;  5AN8 A;  1E96 B;  5AQ7 A;  3HDX A;  3HHM A;  1OXJ A;  5G2N A;  4LNU D;  1LF8 A;  1VDY A;  5ANR A;  3B95 A;  2KBX A;  2MYO A;  3FP3 A;  2JEK A;  5FTP A;  3L13 A;  4LSZ E;  4L23 A;  3B13 A;  2DYS E;  3EUV A;  2I9C A;  2IFU A;  1MX6 A;  1LTX A;  4DX1 A;  4B94 A;  4CZ2 D;  4ATZ D;  5BT1 A;  3TWQ A;  1OCO E;  4HQD A;  3Q73 A;  1Z3Y A;  4L2L A;  3AU4 A;  3OAW A;  2VYI A;  3CKB A;  4I2W A;  5HI7 A;  3PUK A;  1HE8 A;  1MHQ A;  4JHR A;  2GRM A;  5LCW C;  1MZC A;  2P9P G;  3ZXP A;  1AWC B;  3L17 A;  4U04 A;  1H2V C;  2DBA A;  3PVL A;  2AXV A;  4XE0 A;  4N3C A;  2ZXW E;  1RZ4 A;  5ENT D;  1S0P A;  3UM2 A;  1OCR E;  2XZD G;  3ZUV B;  3ASN E;  3FUL A;  2JAB A;  3RRN B;  1U3C A;  4L2Y A;  2DWZ A;  3PRE A;  5AIJ A;  4JZY A;  4FHJ A;  3TWW A;  3RKV A;  4DI3 A;  2R17 C;  3SHF A;  4W9R A;  2P9K G;  5ENR D;  5BV0 A;  3ONL A;  3URZ A;  4ZHB A;  3EHM A;  3LYA A;  5CEC B;  3NZS A;  5ENN A;  1LD8 A;  5FIN A;  3G2S A;  2XGS A;  3LJN A;  3EHR A;  1TNU A;  4BSX A;  2XEE A;  4RG9 A;  2ZIS A;  3RIB A;  4Q96 A;  3VLD A;  4DI4 A;  3FTW A;  3FTV A;  4MKT A;  4YVQ C;  3VTY A;  1QNF A;  2Y3A A;  1IXV A;  4BTA A;  5BXU A;  4BT9 A;  2AXZ A;  2FF4 A;  4G24 A;  5FT9 A;  1TNY A;  3UT7 A;  4OVU A;  4U63 A;  2I2O A;  5KBA A;  4ACL A;  4HVB A;  2VGY A;  5T4Y A;  5E75 A;  3N71 A;  2QYJ A;  1H0A A;  2DIW A;  4AV7 A;  2FUL A;  5LOZ A;  1D9S A;  1WY6 A;  5JHA A;  3F6Q A;  3L9T A;  1LD7 A;  1TYQ G;  1ELK A;  3QJZ A;  5FJY A;  1W3B A;  4I1A A;  3NZU A;  4A1S A;  3ZVV A;  3DSU A;  3D9H A;  3MCX A;  3K9I A;  3CHS A;  4KYO B;  4K03 A;  2PL2 A;  2NSZ A;  5ITZ F;  4HI9 A;  1TNO A;  5G05 C;  5FZR A;  3FUJ A;  3NAW A;  4GYO A;  2JLB A;  3FTU A;  1RW2 A;  5J90 A;  5DIZ A;  4U0Z A;  3V2X A;  4ZFH A;  3NBN B;  4YDW A;  3DXM G;  3PZ2 A;  4B0Z A;  4HOT A;  2OCC E;  3AJI A;  3B7T A;  3VTX A;  2EIN E;  2WQ6 A;  1N0R A;  3ESK A;  4GZ6 A;  2J4B A;  4A55 A;  2IU1 A;  3DSX A;  4JHK A;  5G04 C;  2QZA A;  2BTD A;  2GRP B;  2GRN B;  1GW6 A;  3RO2 A;  4FLB A;  2ZGG A;  4CCA A;  1Y8M A;  4FHK A;  3BEE A;  3EIQ C;  3O48 A;  3LJ3 A;  1IQU A;  3MEK A;  2GRO B;  3FUM A;  2WXN A;  3TWX A;  1A17 A;  4GA2 A;  3JUI A;  3R9A B;  2ETB A;  3X2Q E;  3CHR A;  3PNL B;  3KEZ A;  1SZA A;  5CER B;  3E4B A;  3T8M A;  1K3Z D;  3U64 A;  4WUY A;  1O1T A;  2WXQ A;  4PS8 A;  5CEA A;  3TGO A;  3MGB A;  4PS7 A;  3ASO E;  3NF1 A;  3EHN A;  4AOF A;  4JA9 A;  4MLP A;  4OVV A;  1S63 A;  4A63 B;  4DX7 D;  4HRN A;  3MKQ B;  3WXX A;  4BTB A;  2GRR B;  1SQM A;  5B3S E;  2FEZ A;  2C2L A;  4TXR A;  1EDU A;  2WXM A;  2X6H A;  3I3N A;  4EZJ A;  4CDM A;  3DEO A;  2YIN A;  3B7U X;  4TV3 A;  4L7T A;  3ULQ A;  4AY6 A;  3D9L A;  3QAQ A;  1SZ9 A;  2GRQ B;  4L9P A;  3I4G A;  1JPL A;  3RO3 A;  1O1S A;  2H6H A;  3OTN A;  2WM9 A;  4NAC A;  3TXN A;  2V4H C;  2EIJ E;  1G3N B;  3B7S A;  3ZW3 A;  1IYG A;  4HOU A;  4JL0 A;  3FTS A;  3EHQ A;  1FT2 A;  3BUA A;  2E0I A;  4GA0 A;  4LEU A;  2BKG A;  2F37 A;  4G11 A;  3CQG B;  1ELW A;  4YND A;  3FTY A;  2F8X K;  1DCQ A;  3ASD A;  3CST A;  4WWN A;  1ZU2 A;  5LFA A;  4B8A A;  3LVQ E;  1DCE A;  5B1B E;  4U95 D;  3SBT B;  2P2C P;  4BSZ B;  4PH4 B;  1ZBP A;  3J5Q B;  4HRM B;  4KT6 B;  3ISM C;  4JA7 A;  4MS6 A;  3JCK C;  4FA6 A;  4AIF A;  3WG7 E;  3PNT B;  4F1S A;  4LG6 A;  3QK0 A;  3PDN A;  4CGW A;  1IQR A;  2MHK A;  4K5B A;  3Q15 A;  1HG5 A;  3O4Z A;  5FIO A;  3UI2 A;  4GZ5 A;  5ARG A;  2XS8 A;  4FC8 A;  2B0O E;  3CV0 A;  3MZL B;  1OCC E;  4FJY A;  3UM1 A;  5LX8 A;  2WMN A;  2FI7 A;  4CDN A;  2BKK B;  4AJW A;  4U8V D;  3LKU A;  3ASF A;  5DBK A;  3CHP A;  4Q94 A;  3V2O A;  1UW4 B;  4LRZ A;  4HLL A;  3E30 A;  1N4Q A;  2R02 A;  3U66 A;  4UI9 K;  3L08 A;  1TNB A;  3G2T A;  2OEV A;  4GYY A;  4NQ0 A; 
#chains in the Genus database with same CATH homology
 1PC2 A;  4L2Y A;  4PS3 A;  3PRE A;  4P29 A;  4UQY A;  3ZXS A;  3UX4 A;  5AIJ A;  4JZY A;  3JYS A;  3QAR A;  3I5P A;  4FHJ A;  2J07 A;  1NA0 A;  2AW6 A;  4GYW A;  4PUC A;  4RSY A;  3RKV A;  3U4T A;  5M72 A;  3CLJ A;  4DI3 A;  3B7R L;  3IV0 A;  2R17 C;  1E8X A;  4GZC A;  3SHF A;  3UT8 A;  4W9R A;  4NRH B;  2X3M A;  3JQ0 A;  4GMJ A;  2WXI A;  5FQ8 A;  3JQ1 A;  5BV0 A;  4WWP A;  3ZYL A;  3LCA A;  4U07 A;  4Y6W A;  5KJK A;  3ONL A;  3FH7 A;  4CGV A;  3CEQ A;  3FWV A;  3URZ A;  4ILH B;  2A5U A;  4KBQ A;  2PM7 A;  3D3M A;  3ZPJ A;  3EHM A;  2VSN A;  2Q7F A;  3ONK A;  2VGX A;  4I6E A;  3LYA A;  4PDX A;  4HLE A;  4EBA A;  4CDR A;  4CT4 A;  4KXK B;  5KJL A;  3UQ3 A;  3NZS A;  2L9B A;  5ENN A;  1WM5 A;  3FH5 A;  4XI0 A;  4TRQ A;  3FU0 A;  3G2S A;  4UQX A;  1HZ4 A;  4BY6 A;  2XGS A;  2GGF A;  2XPZ A;  5FQ4 A;  1H19 A;  2OND A;  4LUN U;  2LAH A;  2PZI A;  2WB2 A;  4IRU A;  3FTZ A;  3IKO B;  4BSX A;  2KZT A;  5FWQ A;  2VSX E;  3GYZ A;  4APO A;  1HXI A;  4RG9 A;  1EPU A;  4V3I A;  3EIJ A;  3QWV A;  4Q96 A;  3RIB A;  3PUJ A;  4U0S A;  3VLD A;  4DI4 A;  4XI9 A;  3SNX A;  3FTW A;  2CHW A;  3CK8 A;  3FTV A;  3ASH A;  4CRW A;  4MKT A;  4YVQ C;  5KCM A;  3VTY A;  4DPR A;  2WQ7 A;  2IQC A;  2LSV A;  5D0O D;  1QNF A;  2XCC A;  2VSY A;  2Y3A A;  2XRY A;  3C98 A;  2L6J A;  4AY5 A;  3G2W A;  4BTA A;  3TJP A;  4EQF A;  4I17 A;  4BT9 A;  2CFZ A;  1OWN A;  2J4D A;  3PEV B;  3MV3 B;  2AXZ A;  3Q47 B;  4N3A A;  2FF4 A;  3G2U A;  4G24 A;  2V8S E;  5FT9 A;  4B89 A;  3DBS A;  4I43 A;  3UT7 A;  4OVU A;  4U63 A;  2I2O A;  3QC1 A;  4TUU A;  3S2A A;  2YNQ A;  3FFL A;  4IUL A;  3LVR E;  3FU5 A;  1KT1 A;  1YA0 A;  4ACL A;  4HVB A;  2VGY A;  3PS6 A;  5T4Y A;  2V4L A;  4BX8 A;  2C0M A;  5E75 A;  4EZK A;  3N71 A;  1E7U A;  1TJC A;  3FU3 A;  4AVX A;  5CCM A;  5LP0 A;  2I6H A;  2LNI A;  1XNF A;  4ATG A;  3PZD A;  2HYZ A;  4Q69 A;  1H0A A;  2DIW A;  4N2Q A;  4AV7 A;  4J0U A;  4G23 A;  2FUL A;  5LOZ A;  5A6C A;  5D0Q D;  3ESL A;  2RG8 A;  4GA1 A;  2WMO A;  1WY6 A;  4APF A;  5JHA A;  5EX0 A;  3RU0 A;  2AWI A;  2X6K A;  3Q5M A;  4MRU A;  3HVE B;  1ELK A;  2KZT B;  4HS2 A;  3QJZ A;  2UWJ G;  5FJY A;  1W3B A;  3FUE A;  2WPV A;  4I1A A;  3Q49 B;  2XPI A;  3NZU A;  3SGH A;  2PQN A;  3ZEF A;  4ACK A;  1E90 A;  2X38 A;  4A1S A;  3ZVV A;  1HO8 A;  4UI9 J;  1NZN A;  2R59 A;  4I6J A;  1MQS A;  1QZ2 A;  1UN8 A;  3AU5 A;  4GZ3 A;  2XCB A;  4I2Z A;  4N5C A;  4XZ4 A;  5JJT A;  3MCX A;  3CVN A;  4Y6C A;  3K9I A;  4XKC A;  1FVF A;  2BUG A;  3CHS A;  4KYO B;  4K03 A;  5CMY A;  2I1J A;  4ANX A;  1EF1 C;  3CVW A;  2PL2 A;  4N3B A;  2NSZ A;  3ASG A;  4BT8 A;  5EX3 A;  1B89 A;  3MYV A;  5G05 C;  3SF4 A;  3LEW A;  3FH8 A;  5FZR A;  4N2S A;  3BG1 B;  3APF A;  3FUJ A;  3NQP A;  1H2U A;  1N54 A;  2VGX B;  3D9I A;  3ZYK A;  4ANW A;  4GYO A;  3KS2 A;  2JLB A;  3FTU A;  4M3O A;  2LAI A;  5DIZ A;  2IJG X;  2YHC A;  4U0Z A;  5J90 A;  3FUD A;  1UG3 A;  3LPZ A;  3ZHE B;  4A3V A;  1UJJ A;  1E8Y A;  1EYH A;  1FVH A;  4J6I A;  5BW8 C;  3AS8 A;  4I1O B;  4ANV A;  2WXG A;  3LY9 A;  3TL5 A;  3AS5 A;  2OVF A;  5AJD A;  2XHE A;  4IN3 B;  4C0E A;  4WNG A;  4C9B B;  3HIZ A;  2VSO E;  1Z3X A;  4J8E A;  4B0Z A;  3L16 A;  4HOT A;  3LXU X;  4QFV A;  3GZ2 A;  3D9N A;  2QY7 A;  1HF8 A;  3B7T A;  1OWL A;  3MKQ A;  4F53 A;  1JUQ A;  3UMV A;  3VTX A;  2CFU A;  2WVI A;  4UI9 C;  4BWR A;  2FO7 A;  2X6I A;  2J9Q A;  4RVB A;  1E8W A;  5KJM A;  2FBN A;  4J8D A;  3AS4 A;  1XGW A;  3MKR A;  4ME2 A;  2WQ6 A;  4JXT A;  2A4Z A;  3ESK A;  4GZ6 A;  2J4B A;  5G04 J;  3CHQ A;  4A55 A;  1TJF A;  3LY8 A;  3SZ7 A;  2IU1 A;  3TG5 A;  4WAF A;  1UN9 A;  2LO6 A;  1JWG A;  2WXK A;  4JHK A;  5G04 C;  1OWO A;  3RRU A;  3FTX A;  2KAT A;  1H6K A;  4GML A;  1N52 A;  4JEH A;  2BTD A;  4JVS A;  3RJV A;  3KAE A;  3CHM A;  4UWL A;  4AEZ C;  1GW6 A;  4AP2 A;  1HFA A;  3RO2 A;  3CHO A;  2IOS A;  4FLB A;  2WXO A;  3QKY A;  5KJN A;  3QWW A;  4HOQ A;  3CVY A;  1OWP A;  4CCA A;  1Y8M A;  4FHK A;  1INZ A;  3BEE A;  3L54 A;  2EQX A;  3TAX A;  3D9J A;  3EIQ C;  3O48 A;  3CVU A;  3LJ3 A;  4LCT A;  5A7D B;  4WNF A;  1Y6I A;  5BUZ A;  1IQU A;  3MEK A;  4NUR A;  3FUM A;  2IF4 A;  3FUH A;  4FJZ A;  4UQZ A;  3CQC B;  4LER A;  5AYW D;  5A23 A;  2WXN A;  3Q4A B;  5G05 J;  4UWH A;  1A17 A;  4GA2 A;  3JUI A;  4AM9 A;  2XQ0 A;  3D9M A;  3P1U A;  3R9A B;  5FQ6 A;  3CGH A;  3CHR A;  2CHX A;  3PNL B;  4KVO A;  3ZYM A;  3CVP A;  3KEZ A;  4FP7 A;  5AEN A;  4L1B A;  2NXP A;  5J08 A;  1SZA A;  3RK6 A;  4HOS A;  4C0M A;  2KM4 A;  2L0T B;  3E4B A;  3GW4 A;  2ILR A;  3T8M A;  3ZFW A;  3IEG A;  3U64 A;  3S7D A;  1JWF A;  4WUY A;  4B8C B;  2VQ2 A;  2E2E A;  1DVP A;  1ELR A;  2WXQ A;  4XIF A;  4PS8 A;  4JEU A;  3MGB A;  3TGO A;  1PAQ A;  2KC7 A;  4ABN A;  4PS7 A;  3PRZ A;  4BFR A;  3ZN3 A;  2ION A;  3NF1 A;  3EHN A;  4AOF A;  4JA9 A;  3EJN A;  4GZD A;  4MLP A;  4XKB A;  2OVB A;  3DPD A;  1QQE A;  1WAO 1;  3EDT B;  4OVV A;  4G25 A;  1X5B A;  4URK A;  3R7R A;  3UPV A;  2CG3 A;  4GB9 A;  4KMO A;  1HS6 A;  5BPP A;  4G26 A;  2ZU6 B;  3MKQ B;  1NA3 A;  4JHJ A;  3WXX A;  4BTB A;  2OOE A;  3FDH A;  2HR2 A;  4EBA G;  3ENE A;  1SQM A;  4CT0 A;  1UJK A;  4JPS A;  4WND A;  1BPO A;  1Z6T A;  2FEZ A;  5CCL A;  2C2L A;  2WXL A;  1EDU A;  2WXM A;  2YQ8 A;  2X6H A;  5LCW J;  2QFC A;  3I3N A;  4EZJ A;  4KVM A;  3U3W A;  1NP7 A;  4CDM A;  5C1D A;  4IYP A;  2YIN A;  2HM8 A;  3MA5 A;  1OUV A;  3B7U X;  4FUL A;  4ILG A;  2XGO A;  2J49 A;  3APD A;  5JJ6 A;  4TV3 A;  4L7T A;  3ULQ A;  4HXI A;  5JJ7 A;  1L5J A;  3D9L A;  4AY6 A;  3S7J A;  3CK9 A;  3QAQ A;  4EEC A;  3CR3 A;  4YVO A;  1SZ9 A;  3TXM A;  3IHY A;  2UY1 A;  3SBS A;  5AJL A;  3MX3 A;  3FUF A;  4UWK A;  3I4G A;  3ZIM A;  1JPL A;  3RO3 A;  4KZC A;  3SFZ A;  2J08 A;  3QDN A;  4J8S A;  3VLF A;  4GPK A;  2YHE A;  3S7B A;  4GCO A;  1DNP A;  3CVV A;  3OTN A;  2WM9 A;  3BG0 B;  2LSU A;  4NAC A;  5ARF A;  4GAA A;  3TXN A;  2BF0 X;  2Y4U A;  4D10 C;  3B7S A;  3ZHE A;  3IBE A;  4H7X A;  3CK7 A;  4I9C A;  3ZW3 A;  4WNE A;  3CVQ A;  4HOU A;  3D9K A;  1IYG A;  2X6F A;  3S7F A;  5T8I A;  4JL0 A;  5FQ7 A;  3FTS A;  2I1K A;  3PH0 C;  3VLE A;  3T5X A;  4J8F A;  2WXJ A;  5T3R A;  2XGM A;  5BNW A;  2E0I A;  4EPZ A;  4XX5 A;  4GA0 A;  4LEU A;  2XPY A;  3FY4 A;  2Y4T A;  4E6H A;  1HX8 A;  3U9W A;  3FU6 A;  3OXG A;  1HU3 A;  4G11 A;  2VTB B;  4JC8 A;  2WXP A;  4JW1 A;  2XRZ A;  3CQG B;  1ELW A;  2V0P A;  4F3V A;  4YND A;  3FTY A;  5G55 A;  1HH8 A;  4R7L A;  3ML8 A;  2X6J A;  3ASD A;  3ML9 A;  3CST A;  3CVX A;  4AXH A;  4WWN A;  2MRI A;  4U0U A;  4FU3 A;  1KLX A;  5E76 A;  4WWO A;  1ZU2 A;  3QWP A;  2M63 A;  3FHE A;  4G1T A;  4B8A A;  4DJA A;  5LFA A;  2GRL A;  2PQR A;  2V5F A;  3L22 A;  3LVQ E;  3PE4 A;  4A1G A;  3ZGQ A;  3UT4 A;  3APC A;  2WXR A;  1PY1 A;  3G2V A;  3TG4 A;  2GW1 A;  3RRM B;  3ZYQ A;  5CMW A;  4HOR A;  3FEY A;  4G2V A;  1E96 B;  2UY1 B;  3CIA A;  1E8Z A;  2HO1 A;  3HVE A;  5CHE E;  3HDX A;  3SBT B;  5C2Y A;  3HHM A;  3QOU A;  4PH4 B;  3I4R B;  1P5Q A;  5G2N A;  1ZBP A;  1LF8 A;  1VDY A;  2C0L A;  1FCH A;  5ANR A;  4KT6 B;  3GZS A;  4K0R A;  4JA7 A;  5FZS A;  3R7Q A;  2J09 A;  4MS6 A;  3QB2 A;  5FZQ A;  3JCK C;  4UWG A;  4FA6 A;  2L0I A;  4AIF A;  3SI5 A;  4ILI A;  3KD7 A;  3FEX A;  3PNT B;  4I1M A;  2AVP A;  1IHG A;  4DLQ A;  3FP3 A;  2JEK A;  5FTP A;  4F1S A;  4UWF A;  3L13 A;  4I9E A;  5JHB A;  3T5V A;  3QK0 A;  1OWM A;  4L23 A;  3PDN A;  3B13 A;  2NC9 A;  4A3T A;  3HYM B;  2I9C A;  2IFU A;  4DLO A;  4CGW A;  1IQR A;  3GZ1 A;  2MHK A;  3Q15 A;  1HG5 A;  4B94 A;  2WXH A;  4KZ0 A;  3O4Z A;  1U3D A;  3LY7 A;  4CEM A;  4GU5 A;  4FLH A;  5BT1 A;  2P58 C;  3OXF A;  2CHZ A;  3ZRH A;  5HQ8 A;  4ANU A;  3P2B A;  3CSF A;  4GZ5 A;  3LDZ A;  5ARG A;  4OYS A;  4FC8 A;  1Z3Y A;  5BV1 A;  4L2L A;  2OV8 A;  3CV0 A;  3AU4 A;  3MZL B;  3OAW A;  4E85 A;  2AXU A;  2VYI A;  4BX9 A;  4DK5 A;  3MV2 B;  3CKB A;  4FJY A;  4H7Y A;  3CVL A;  2IOL A;  2MOW A;  2WQH A;  4I2W A;  5HI7 A;  3PUK A;  5LX8 A;  4F7A A;  1HE8 A;  1MHQ A;  2DCP A;  4O6F A;  2WMN A;  2FI7 A;  4CDN A;  4JHR A;  1H2T C;  2XEV A;  2GRM A;  5LCW C;  4AJW A;  3MJW A;  1E7V A;  3LKU A;  3ASF A;  3FUN A;  5DBK A;  3FUI A;  3L17 A;  3CHP A;  4Q94 A;  4U04 A;  3FUK A;  5ANL A;  1UW4 B;  2RD0 A;  4I6G A;  2KCK A;  1H2V C;  2DBA A;  2R5S A;  3PVL A;  2VTB A;  3OXL A;  4LRZ A;  2AXV A;  5EKQ D;  4EZL A;  4U8H A;  3QNK A;  1KT0 A;  4RG6 A;  4XE0 A;  2CG2 A;  3CKC A;  3L6A A;  4N3C A;  2KCV A;  4N39 A;  4FAD A;  3U66 A;  2WXF A;  4UI9 K;  3D9O A;  3IHV A;  1HG2 A;  4HFG A;  3PEU B;  3L08 A;  3G2T A;  3SD5 A;  3D9P A;  1S0P A;  4GCN A;  2VJ8 A;  2PM6 A;  3LS8 A;  5EDS A;  2KCL A;  3FUL A;  1TEZ A;  4GYY A;  4NQ0 A;  3UUX A;  3RRN B;  3PE3 A;  1U3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...