2J49A

Crystal structure of yeast taf5 n-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
134
structure length
134
Chain Sequence
PENYIRAYSMLKNWVDSSLEIYKPELSYIMYPIFIYLFLNLVAKNPVYARRFFDRFSPDFKDFHGSEINRLFSVNSIDHIKENEVASAFQSHKYRITMSKTTLNLLLYFLNENESIGGSLIISVINQHLDPNIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 5
publication title Crystal Structure, Biochemical and Genetic Characterization of Yeast and E. Cuniculi Taf(II)5 N-Terminal Domain: Implications for TFIID Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 48
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04494 TFIID_NTD2 WD40 associated region in TFIID subunit, NTD2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j49A00
2J49A 2J4BA 2NXPA
chains in the Genus database with same CATH superfamily
5BXOA 2GRNB 1BU9A 2OOEA 3PUJA 4WWPA 1HU3A 1S63A 3QDNA 1RW2A 1OWNA 3ULEG 1N4RA 4DI3A 4BY6A 4TXQA 3BEEA 3FTXA 4F7AA 5AQ7A 4YDWA 2WXHA 3LPZA 2AJAA 3EHNA 3DBSA 3UI2A 2WXKA 5AQ9A 3SD5A 5CCMA 3J5QB 5JHBA 4HLEA 4AM9A 1NA0A 2BTDA 2KM4A 3LYAA 1OCRE 3JQ1A 2HM8A 3DSXA 4XKCA 1JCQA 4FC8A 1MX4A 5AN8A 5HI7A 2ZXWE 3LKUA 4GYYA 3LJNA 4FLBA 4YNDA 3EUVA 2CG2A 1IYGA 1E8XA 3ZU7B 4GTMA 4LUNU 2C2LA 2MYOA 3EU9A 3SI5A 1OCCE 1TNUA 3FUEA 3ZVVA 4UUCA 1DCQA 2GRPB 2LAIA 1WAO1 4BSXA 3AS4A 1NP7A 3RRMB 4M3OA 3FUDA 2IOSA 3PEVB 2RFAA 1N52A 1TNBA 3JYSA 1K8KG 3CEQA 3TXMA 3GZ1A 1N9AA 4QQIA 4BESA 4KYOB 1IXVA 4KXKB 2YQ8A 5D2MC 2GRLA 4J8YA 4DK5A 4DPRA 1U3DA 3TAXA 2VGXA 4L23A 2UY1A 4K5CA 3TGOA 4G1TA 2CFUA 5KJMA 2WPVA 3RRNB 3DEPA 3UMVA 4U8YD 4XKBA 4JEUA 3CVQA 4WWNA 2GGFA 3CVNA 4ABNA 3CVXA 3TXNA 4BT8A 5B3SE 3ASGA 3QAQA 4N2QA 2I6HA 3G2WA 3C3QA 5LCWC 5T3RA 2WXPA 1S0PA 4U04A 2AWIA 1MZCA 3FTVA 2VSNA 3FTYA 2Y69E 4GA0A 2F8XK 4HOUA 3SFXA 2GRQB 4OVUA 2P9UG 3ZHEA 4TV3A 4UWFA 1H6OA 2DZNA 1OUVA 4TUMA 1DC2A 3Q75A 1K1BA 2HYZA 2UY1B 3Q9NC 4NQ0A 3LCAA 4HI9A 5D0OD 3ABLE 1HXIA 2IY0C 5JMND 4GPMA 2BF0X 2Q7FA 4LERA 2R17C 2ZGDA 1QZ2A 4URKA 4LNGA 4UQXA 4K5BA 1S70B 3EHQA 3DSWA 2LSVA 4N3BA 2J49A 3TG5A 5J90A 5BV1A 2GROB 2C0LA 3FUJA 4KZCA 4UWKA 3ZHEB 4GA2A 4O1PA 4FHKA 4AVXA 3J5PA 4RG6A 3CHQA 3VTXA 5FWQA 4G24A 4MRUA 4NACA 5AARA 3SZ7A 5E76A 2I1KA 1N0RA 1QNFA 3ASFA 1YMPA 1TR4A 4FU3A 2C0MA 2IFUA 3MKQA 1OCZE 3SF4A 3FUMA 2RD0A 4GTQA 2XHEA 3FP3A 1B89A 2LUHA 2PM7A 5HRYA 3FH7A 4HVBA 2XEEA 5FJYA 3IV0A 1FT1A 4FADA 3UM0A 3GYZA 3QKYA 1KLXA 5EN5D 3RO2A 4A1GA 2FO1E 4CGVA 4BTBA 4AY6A 3QNKA 3AU4A 2V8SE 3CLJA 5BT1A 3FTZA 3UM3A 2AXVA 2WXFA 3ZXPA 3SO8A 5ENTD 3CVWA 3MGBA 2VSXE 4I43A 3LJ3A 1E8WA 3APCA 1V55E 1SZAA 3TWWA 3DPYA 1PY1A 3ZYKA 1ELKA 3DPDA 3MKQB 4U95D 4UWGA 3RO3A 3HDXA 3S2AA 3BU8A 3PZ3A 5BNWA 4Y6WA 4HB5A 3ZUVB 1SA5A 3B7BA 4LRZA 4UWLA 5AENA 2WXLA 4U0ZA 4N5CA 3HG0D 3FEYA 4U63A 4LCTA 4BERA 2RG8A 3Q49B 3TWTA 4F1PA 3ZN3A 2VGYA 1LD8A 4DX6D 5EDSA 4GU5A 5T4YA 3FUNA 4GMJA 5IY5E 1O5MA 2HO1A 4GTSA 5JJ7A 1HG5A 3ZFWA 2X6IA 4A3VA 4TRQA 3TL5A 4I9CA 2XRYA 4TXRA 3L08A 5ARGA 1HE8A 3Q9UC 4U8HA 4L9PA 2OEVA 1TNZA 2V5FA 1UJKA 5DIZA 4EBAG 4I6EA 2R03A 4ZFHA 1YA0A 2XPIA 3IEGA 2P9LG 5CHEE 1JWGA 3CSTA 1P5QA 3L17A 5FT9A 4K03A 1E8YA 3NF1A 1XGWA 3WXXA 4APFA 2OVBA 2PQRA 4GCOA 2LXLA 1L5JA 3BQOA 3CKBA 4K0RA 3PVLA 5JHAA 1AWCB 1AP7A 1N4SA 3C3OA 4ILHB 3MV3B 3ZKJA 1OT8A 1NA3A 3KSLA 3EHMA 3CHRA 2A5EA 3UINC 1WM5A 2I1JA 3C72A 4MLPA 1E90A 1QQEA 4GZDA 2OCCE 3PE3A 3TWRA 1HFAA 1E7UA 5CERB 2DIWA 5ENRD 3Q47B 2XGMA 3HXDA 2WXOA 4ATZD 3V30A 5T8IA 3ABKE 4O1OA 3P2BA 1H6PA 3CIAA 3O4ZA 4GMLA 2L0IA 3ML8A 1HG2A 4TUUA 2AW6A 4AXHA 2X3MA 2CG3A 3ONLA 3I4GA 4DRXE 1NL4A 2P9PG 3MEKA 2P2CP 2Y4TA 5A6CA 3D9MA 3U64A 4G8LA 4B0ZA 2J9QA 2KZTA 5EIDA 2VQ2A 3ML9A 3FH8A 3Q5MA 3AG1E 5KCMA 3QK0A 5BXUA 1ELRA 1BI7B 2FULA 2DVWA 5AAOA 3QWPA 1LD7A 2XEVA 2OEWA 3ULQA 3Q4AB 2XGSA 3I5PA 3MV2B 3D9JA 1OWLA 4RQIA 3T5VA 2BEDA 1VDYA 3TWUA 3D9NA 3ZIMA 3APFA 3E37A 3FH5A 3LVRE 2WQ7A 2P58C 3C5RA 4O60A 3ASOE 4KT6B 3S7DA 4ACLA 3CVYA 2BUGA 2FBNA 3E30A 4PDXA 4FP7A 3SQVA 3FDHA 2KZTB 3T8KA 3T5XA 5C2YA 3B7SA 4FJZA 3ESLA 3LY7A 3GZSA 4GYOA 4BX9A 1LF8A 2WVIA 1E8ZA 1MX2A 4C0EA 2EILE 4ME2A 2J4DA 4U0SA 3FU0A 3F6QA 1MYOA 3NOGD 3IBEA 3R9AB 2ZIRA 4OAUC 3U9WA 4N2SA 4JXTA 2VTBA 1UJJA 3S7JA 4UI9K 4ANWA 3TWSA 4PUCA 2OV8A 2IO3C 3T8MA 1GW6A 4G23A 3FUIA 1SW6A 3ISMC 4BT9A 1EYHA 3HRAA 4CT4A 2B6CA 4L2LA 4YVQC 4A55A 1UOHA 3L22A 3FTSA 4AOFA 4C9BB 2FF4A 2LO6A 2YHEA 2WXNA 3B13A 5J08A 4Q96A 3G2TA 3CHMA 4GTTA 2QYUA 3Q78A 2P9KG 4ACKA 1HZ4A 3SFZA 1D9SA 1BD8A 5D66A 4GZ3A 4J8DA 3QARA 3CQCB 4HRMB 5CMYA 5KJKA 3G2VA 2H6GA 3D9OA 3FEXA 4QFVA 4NRHB 3QWVA 1YCSB 4Z68A 1PAQA 4JPSA 3RIBA 4RG9A 5ARFA 2ZU6B 1ELWA 1N0QA 4L2YA 5FZSA 3X2QE 3VLFA 5G04J 4XE0A 4YVOA 2VGXB 4KBQA 4WWOA 3APDA 1HH8A 3FTWA 3AG2E 4I9EA 3JCKC 5BPPA 4N3AA 5A7DB 3FULA 3MCXA 4AJWA 3DXKG 3RRUA 2HE0A 4HRLA 3BUAA 1H2UA 4ANXA 3UUXA 2VSYA 2X6JA 1MJ0A 1FVFA 4KVMA 2V4LA 5EYLA 4U0UA 4EBAA 5FQ8A 2PZIA 3OXFA 4A63B 3ZXSA 5E75A 1N95A 3K9IA 4ATGA 1E96B 2BKGA 4DLOA 4G11A 3E32A 3DEOA 4XX5A 4DX5D 3UQ3A 4R7LA 2P9IG 5EX0A 4RVBA 1ZB1A 1UG3A 3CVLA 3EJNA 3P1UA 2H6FA 3EDTB 3CKCA 2PM6A 4F53A 4HI8A 3T9KA 3Q7AA 3FWVA 2WMOA 4I2ZA 3D9KA 3VLDA 3EIJA 4DJAA 4GYWA 4GTPA 2PQNA 4HFGA 3B7UX 3IHYA 4WNDA 4YDYA 4LG6A 4NIKA 4FA6A 3QB2A 3G2UA 1HF8A 3HVEA 3CV0A 4IULA 3E33A 3HIZA 4H7YA 5EILA 2IF4A 5M72A 1X5BA 3UPVA 4JVSA 5BUZA 3QC1A 1TEZA 4DX7D 5DBKA 4UI9J 4JZYA 1EDUA 4G25A 4I1OB 2J07A 4KVOA 4DI4A 2YHCA 2ONDA 2XZDG 2Y4UA 5BV0A 4HXIA 2J4BA 3LDZA 2A5UA 4UQYA 1DCEA 4CDNA 4OYSA 5LP0A 3ZYLA 2WXIA 4JHRA 1JUQA 4KMOA 3DSTA 2ETBA 3EIQC 3HVEB 4F3VA 4CGWA 2P9SG 4CCAA 4UQZA 3CHOA 2XPYA 5KNHD 2MRIA 4ZHBA 4HOSA 1O1TA 2GRMA 4E85A 3ULYA 5KBAA 5G2NA 1Z3YA 4FULA 2XPZA 2EIJE 3KS2A 2I2OA 3DSSA 1RZ4A 3R7QA 3GW4A 5AJDA 4GTRA 3B95A 3UT4A 2IO2C 2NC9A 3AJIA 4AP2A 4ANUA 1S64A 1D8DA 3RK6A 3GZ2A 2WMNA 2MOWA 4LSZE 4L7TA 2XGOA 3SBSA 1W3BA 2KC7A 4X8QA 3W9GA 3CK9A 1KPSB 2L6BA 3W9FA 1UN8A 3PZ1A 3V79K 4ILIA 4O6FA 2J08A 4IRUA 3FUHA 2AXZA 3C3RA 4JEHA 3UKUG 3UX4A 1N4PA 2RKKA 2VYIA 3I3NA 5FZRA 1A17A 3UXGA 2LSUA 3DWLG 3C98A 4F6RD 1OY3D 5ENQD 3AS5A 3HXFA 1BPOA 4WUYA 2IOLA 2R2LA 3CVPA 1FT2A 1Z5SC 5KNGA 3FU5A 5A23A 3NZSA 1A5EA 1FCHA 3NZUA 5HKPA 5G05J 4B8AA 5CRUA 5B1AE 4BWRA 2QY7A 4C0MA 2R02A 3CHSA 3ZGQA 4HNAD 3CVVA 3Q73A 5JA4D 3WG7E 2QFCA 2DYRE 4E6HA 2P9NG 2XCCA 2HR2A 3ZNGA 2Y1LE 4BFRA 5FINA 3SGHA 2YINA 4XEIG 2IONA 3L13A 2LAHA 3RAUA 5CEDB 2X38A 2DCPA 1JCRA 4HQDA 2KCKA 3E34A 4A1SA 1K1AA 3PH0C 4DX2A 3UT7A 2IEJA 2XENA 2KCLA 5HS0A 3B7RL 4N5QA 2V5QC 3PNTB 2PL2A 3U4TA 4OAVB 5CBNA 4IYPA 1YYHA 2CHZA 3CSFA 4ANVA 2UWJG 5ENNA 4JHKA 1N54A 1KT1A 4HBDA 4XI9A 4TXPA 3UTMA 3JXJA 4HRNA 2NYJA 2F0YA 3IKOB 3PE4A 4CEMA 4J7WA 4J8SA 5AIJA 5AQBA 2XQ0A 1O1SA 2DWZA 1IQRA 4GPKA 4DUIA 1UW4B 3O48A 4FJYA 3TWXA 4EZKA 1OWPA 5ANRA 4MKTA 1N11A 2CFZA 5LOZA 1OWMA 5FIOA 2WB2A 3EHRA 1FVHA 3G2SA 4I17A 4GZ5A 2QC9A 4GMRA 3RSEG 1TN8A 2X6HA 2VSOE 2V4HC 3D9IA 5G04C 5FTPA 4JD2G 1N4QA 2IU1A 5FQ7A 3MJWA 4U96D 3CK8A 2KATA 2F8YA 4EQFA 3UIPC 3PDNA 3CVUA 4YDEA 3MA5A 3D9PA 1INZA 1ZBPA 4PS3A 4LEUA 3NB2A 4BEPA 4V3IA 3SHFA 3AG4E 3L54A 4JA9A 3ESKA 3PUKA 1NFIE 4CDRA 3ABME 2JABA 2B0OE 2Y3AA 4BETA 2ILRA 1IKND 2WXMA 2ZGGA 2WXQA 3CR3A 1SZ9A 1HO8A 3NAWA 2WXGA 3MKRA 4PH4B 4WNFA 2A4ZA 3Q7FA 1KZOA 3ZPJA 1EPUA 4NURA 3HXCA 4P29A 2BKKB 4MBGA 3ZYMA 2GRRB 3FU3A 4AIFA 3FUFA 3PREA 2VTBB 2LNIA 4Q69A 3D3MA 3QWWA 4APOA 3PZDA 3I4RB 3CGHA 4HOTA 3LXUX 2XS8A 1H0AA 2F37A 3OAWA 3U66A 3FHEA 5HQ8A 4FHJA 4HORA 2KBXA 3IHVA 2NXPA 4C48B 5B1BE 2L6JA 3ONKA 1QYMA 2IQCA 3UT8A 4A3TA 3V31A 5JJ6A 1TJCA 3DSUA 3ENEA 1V54E 2OVFA 4OVVA 2JLBA 1BLXB 3TJPA 1X81A 5KJLA 1G3NB 4RLYA 3BG0B 5D0QD 2EIME 5AQAA 3FTUA 3QOUA 1WDYA 2XEHA 5C1DA 2KXPC 4JA7A 1Q2ZA 4GB9A 1O1RA 2EIKE 4UI9C 3D9HA 4G8KA 2R05A 2ETCA 4HLLA 2CHWA 4EZLA 1Z6TA 3KD7A 1QBQA 4B93B 3HYMB 4J8EA 2AVPA 4Q94A 1SA4A 3AS8A 3OXLA 1JWFA 4BTAA 4PS7A 1WG0A 3DSVA 4FLHA 3DXMG 5ANLA 3OTNA 2CHXA 4J8FA 3QJZA 3TWQA 3JUIA 3Q15A 3SFYA 2LXMA 4Y6CA 4I2WA 1JPLA 3AAAC 4HOQA 4GAAA 2WXJA 3EU5A 2J8SD 1SVXA 2X6FA 4RSYA 4XIFA 1MHQA 3JXIA 5ENPD 2FI7A 3KEZA 2IJGX 4I1MA 4BSZB 5CCLA 5CRVA 5AYWD 2L9BA 3JUEA 4I1AA 4J0UA 1MX6A 5H7PA 4CRWA 3URZA 4B89A 1TN6A 2QYJA 5CECB 5FQ6A 3D9LA 3LY8A 1XNFA 1K3ZD 5CBOA 1H2TC 5EX3A 1TNYA 2R5SA 4G26A 3LS8A 4I6JA 1JCSA 4I6GA 3NOCD 5LCWJ 4WNEA 3PZ4A 4GCNA 3ZYQA 3PRZA 4B8CB 2Y0BG 2WXRA 3CQGB 1NZNA 3SNXA 4N39A 1FPPA 4GZ6A 3FUKA 2XZTG 2VJ8A 2XS1A 3FY4A 1D8EA 2E0IA 1SQMA 3CK7A 1TYQG 2J09A 3L82A 5EYPF 3RKVA 3Q79A 4EZJA 4B94A 5G05C 3VTYA 1TJFA 1HS6A 3R9MA 4IN3B 4AV7A 2AXUA 2YNQA 3BG1B 3B7TA 5FQ4A 4ILGA 4AY5A 3S7FA 1NI1A 4GTOA 3TWVA 2M63A 4EPZA 2RFMA 2EQXA 5KJNA 3PZ2A 4DLQA 1Y6IA 3UIOC 2H6HA 2QZAA 1U3CA 1LTXA 2DZOA 3LEWA 5LX8A 1IQUA 4LNUD 1N94A 3LVQE 2H6IA 3HXEA 3LY9A 3V2OA 4D10C 1IHGA 5G55A 2R59A 3KAEA 3RJVA 1U2VG 1MQSA 2FO7A 3NQPA 4KZ0A 1KT0A 3L6AA 3MYVA 3UKRG 4F1SA 3U3WA 3KEAA 4U07A 3FU6A 4XZ4A 2ZISA 4UWHA 4W9RA 4G2VA 2WQHA 4EHMA 5EIBE 3N71A 4XI0A 3SBTB 5CMWA 3R7RA 4BX8A 1OWOA 3PNLB 1UN9A 5EKQD 5ITZF 3NBNB 3OXGA 5FZQA 1WY6A 3PEUB 3AG3E 1ZU2A 2NSZA 4MS6A 2PNNA 1H2VC 3TG4A 1OXJA 3KSQA 4M7CA 2V0PA 4H7XA 3UM1A 5CEAA 1PC2A 1H6KA 2JEKA 3V2XA 4CZ2D 4LNBA 5LFAA 4EECA 3RU0A 4HS2A 4DX1A 5KWDA 3ZEFA 5ENOD 4GTVA 4N3CA 4JL0A 3ASDA 4CYMD 2L0TB 1TNOA 2KCVA 1Z3XA 3SY2A 4AEZC 4U7EB 4YDOA 1DNPA 3ZRHA 3AU5A 3ASNE 4WNGA 3MX3A 3IXEA 2XCBA 5JJTA 4CT0A 3PS6A 3HHMA 3CHPA 4PS8A 1KZPA 5ENSD 1DVPA 3L9TA 2DBAA 3FFLA 4J6IA 2ETAA 3ASHA 2XRZA 1IHBA 2WM9A 4JHJA 1BI8B 1H19A 2E2EA 4CDMA 2GW1A 1E7VA 4JC8A 1Y8MA 4WAFA 5BW8C 3E4BA 5AJLA 3UM2A 1HX8A 2MHKA 2I9CA 3HXBA 4GZCA 2EINE 3ZW3A 2WQ6A 3VLEA 2X6KA 4JW1A 4U8VD 3S7BA 2DYSE 1OCOE 3DRAA 3MZLB 3JQ0A 1EF1C 4L1BA 1TN7A 3L16A 4GA1A 4K5AB 2FEZA 2VGEA 4JB8P
chains in the Genus database with same CATH topology
3IHVA 4FA6A 2NXPA 2OOEA 3QB2A 1L5JA 2L6JA 3CKBA 3G2UA 3ONKA 3PUJA 1HF8A 1HU3A 2IQCA 3HVEA 4WWPA 3CV0A 4K0RA 3UT8A 4IULA 4A3TA 5JJ6A 1TJCA 3HIZA 3PVLA 4H7YA 5JHAA 3ENEA 2OVFA 3QDNA 1OWNA 4OVVA 2JLBA 4DI3A 3TJPA 4BY6A 5KJLA 3BEEA 2IF4A 3FTXA 4F7AA 4ILHB 3BG0B 3MV3B 5D0QD 5M72A 1X5BA 2WXHA 3FTUA 3UPVA 3LPZA 4JVSA 1NA3A 3EHNA 3QOUA 3DBSA 5BUZA 2WXKA 5CCMA 3SD5A 3QC1A 3EHMA 5C1DA 3CHRA 4JA7A 5JHBA 1TEZA 5DBKA 4UI9J 4JZYA 1EDUA 4HLEA 1WM5A 4GB9A 4AM9A 1NA0A 2BTDA 2I1JA 2KM4A 3LYAA 4G25A 3JQ1A 2HM8A 4I1OB 2J07A 1E90A 1QQEA 4GZDA 4KVOA 4MLPA 4UI9C 4DI4A 3PE3A 4XKCA 1HFAA 4FC8A 1E7UA 2YHCA 2ONDA 5HI7A 2DIWA 2Y4UA 3LKUA 3Q47B 4GYYA 2CHWA 2XGMA 5BV0A 4HXIA 2J4BA 4EZLA 3LDZA 4FLBA 2A5UA 4UQYA 2WXOA 4YNDA 1Z6TA 4CDNA 3KD7A 5T8IA 2CG2A 4OYSA 5LP0A 1IYGA 3HYMB 3ZYLA 2WXIA 4JHRA 4J8EA 1JUQA 3P2BA 1E8XA 3CIAA 4KMOA 2AVPA 4Q94A 4LUNU 3O4ZA 2C2LA 3EIQC 3AS8A 3HVEB 3OXLA 4GMLA 2L0IA 1JWFA 3ML8A 1HG2A 3SI5A 4TUUA 3FUEA 2AW6A 4AXHA 3ZVVA 4BTAA 4F3VA 4CGWA 2X3MA 4CCAA 4PS7A 2CG3A 3ONLA 3CHOA 2XPYA 2LAIA 2MRIA 3I4GA 1WAO1 3MEKA 4UQZA 4HOSA 2Y4TA 4FLHA 5ANLA 3AS4A 4BSXA 1NP7A 3RRMB 5A6CA 3D9MA 2GRMA 4M3OA 3OTNA 4E85A 2CHXA 2IOSA 3FUDA 4J8FA 3U64A 5G2NA 3QJZA 1Z3YA 4FULA 2XPZA 3PEVB 3KS2A 2I2OA 3R7QA 4B0ZA 1N52A 3JYSA 2J9QA 2KZTA 3JUIA 2VQ2A 3CEQA 3GW4A 3ML9A 3Q15A 5AJDA 3FH8A 3TXMA 3Q5MA 4Y6CA 3GZ1A 4I2WA 1JPLA 5KCMA 3UT4A 2NC9A 3QK0A 4HOQA 4GAAA 2WXJA 4AP2A 1ELRA 4KYOB 4ANUA 3RK6A 2X6FA 3GZ2A 2WMNA 2FULA 2MOWA 4KXKB 3QWPA 2YQ8A 4L7TA 4RSYA 2XGOA 4XIFA 3SBSA 1MHQA 2GRLA 2XEVA 3ULQA 3Q4AB 4DK5A 4DPRA 2FI7A 3KEZA 1W3BA 2IJGX 4I1MA 2KC7A 1U3DA 2XGSA 3TAXA 2VGXA 5CCLA 3I5PA 3MV2B 2L9BA 5AYWD 4L23A 4I1AA 4J0UA 3D9JA 1OWLA 4CRWA 3CK9A 3URZA 2UY1A 4B89A 1UN8A 3T5VA 1VDYA 3TGOA 4G1TA 5FQ6A 3D9LA 3D9NA 3ZIMA 2CFUA 3APFA 5KJMA 3LY8A 1XNFA 3FH5A 4ILIA 4O6FA 2WPVA 3LVRE 2J08A 3RRNB 4IRUA 3UMVA 3FUHA 2AXZA 2WQ7A 4JEHA 4XKBA 3UX4A 1H2TC 4JEUA 2P58C 3CVQA 4WWNA 5EX3A 2R5SA 2GGFA 3CVNA 4G26A 4ABNA 3LS8A 4I6JA 4I6GA 2VYIA 3I3NA 3CVXA 4KT6B 3S7DA 5FZRA 1A17A 4ACLA 2LSUA 3TXNA 4BT8A 5LCWJ 3CVYA 2BUGA 2FBNA 3ASGA 3C98A 4GCNA 3QAQA 4FP7A 4PDXA 4WNEA 3FDHA 2KZTB 3ZYQA 4N2QA 2I6HA 3PRZA 4B8CB 3G2WA 3AS5A 5LCWC 5T3RA 2WXPA 3T5XA 2WXRA 1S0PA 3CQGB 2AWIA 4U04A 5C2YA 1NZNA 3B7SA 3SNXA 1BPOA 3FTVA 4WUYA 2IOLA 2VSNA 4FJZA 4N39A 3CVPA 4GZ6A 3FTYA 4GA0A 3ESLA 3FUKA 4HOUA 3LY7A 3FU5A 3GZSA 2VJ8A 5A23A 4OVUA 3FY4A 2E0IA 3ZHEA 4GYOA 1SQMA 4TV3A 3NZSA 3CK7A 1LF8A 2WVIA 1FCHA 4UWFA 4BX9A 3NZUA 1E8ZA 2J09A 5G05J 1OUVA 4B8AA 3RKVA 4C0EA 4BWRA 4EZJA 2QY7A 4ME2A 2J4DA 4C0MA 2HYZA 3CHSA 2UY1B 4U0SA 4B94A 5G05C 3FU0A 3IBEA 3R9AB 3VTYA 1TJFA 3ZGQA 3CVVA 4NQ0A 1HS6A 3LCAA 5D0OD 4IN3B 2QFCA 3U9WA 4AV7A 4E6HA 2AXUA 4N2SA 2XCCA 2YNQA 4JXTA 2HR2A 1HXIA 4BFRA 3BG1B 3SGHA 2YINA 3B7TA 5FQ4A 4ILGA 2VTBA 2BF0X 1UJJA 2Q7FA 2IONA 4LERA 4AY5A 2R17C 3L13A 2LAHA 3S7JA 1QZ2A 3S7FA 4UI9K 2X38A 4ANWA 2DCPA 4URKA 4UQXA 4PUCA 2OV8A 2KCKA 2LSVA 2M63A 4N3BA 4A1SA 2J49A 3TG5A 5J90A 4EPZA 3T8MA 3PH0C 5BV1A 1GW6A 3UT7A 4G23A 2C0LA 3FUJA 2KCLA 2EQXA 3FUIA 4KZCA 5KJNA 4BT9A 3B7RL 1EYHA 4DLQA 4CT4A 1Y6IA 4UWKA 3ZHEB 4L2LA 4GA2A 4YVQC 4A55A 4FHKA 1U3CA 4AVXA 3PNTB 2PL2A 3L22A 3FTSA 4RG6A 4AOFA 3CHQA 3U4TA 4C9BB 3VTXA 3LEWA 5LX8A 1IQUA 2FF4A 5FWQA 2LO6A 2YHEA 4G24A 4MRUA 4NACA 4IYPA 3SZ7A 2WXNA 3LVQE 5E76A 2CHZA 2I1KA 3CSFA 4ANVA 2UWJG 3LY9A 3B13A 5ENNA 5J08A 4D10C 1IHGA 4JHKA 4Q96A 1N54A 2R59A 3KAEA 5G55A 3RJVA 1QNFA 1KT1A 3ASFA 1MQSA 4FU3A 2C0MA 2IFUA 3G2TA 3CHMA 4XI9A 3MKQA 3SF4A 2FO7A 3FUMA 3NQPA 4ACKA 1HZ4A 2RD0A 4KZ0A 3SFZA 2XHEA 1KT0A 3FP3A 1B89A 3L6AA 3MYVA 4GZ3A 4F1SA 3U3WA 4J8DA 3QARA 4U07A 2PM7A 3CQCB 3FU6A 3IKOB 3PE4A 4XZ4A 5CMYA 4CEMA 4UWHA 4J8SA 3FH7A 5AIJA 4W9RA 4HVBA 4G2VA 5KJKA 2WQHA 3G2VA 2XQ0A 3N71A 4XI0A 3SBTB 5CMWA 1IQRA 5FJYA 3R7RA 3IV0A 3D9OA 1OWOA 4BX8A 3PNLB 4FADA 1UN9A 4GPKA 3FEXA 4QFVA 3GYZA 3QKYA 4NRHB 1KLXA 1UW4B 3O48A 4A1GA 4FJYA 5EKQD 3RO2A 3QWVA 4EZKA 1OWPA 3OXGA 4CGVA 5ANRA 1PAQA 4MKTA 5FZQA 4BTBA 1WY6A 4JPSA 3RIBA 2CFZA 3PEUB 4AY6A 3QNKA 3AU4A 1ZU2A 5LOZA 2V8SE 3CLJA 5BT1A 3FTZA 1OWMA 2NSZA 2AXVA 4MS6A 4RG9A 2WB2A 1H2VC 2WXFA 5ARFA 3TG4A 1FVHA 2ZU6B 3CVWA 3G2SA 1ELWA 3MGBA 2VSXE 4L2YA 4I17A 4I43A 3LJ3A 5FZSA 4GZ5A 1E8WA 3APCA 5G04J 3VLFA 4XE0A 4YVOA 1SZAA 2VGXB 4KBQA 2X6HA 4WWOA 2V0PA 1PY1A 4H7XA 2VSOE 3ZYKA 3APDA 1ELKA 3DPDA 1PC2A 3MKQB 1HH8A 1H6KA 3D9IA 5G04C 2JEKA 3FTWA 5FTPA 4I9EA 5LFAA 4EECA 4UWGA 3RO3A 3RU0A 4HS2A 3HDXA 3JCKC 3S2AA 5BPPA 3ZEFA 4N3AA 2IU1A 5FQ7A 5A7DB 3FULA 3MJWA 5BNWA 3MCXA 4Y6WA 4N3CA 3CK8A 4JL0A 4AJWA 3ASDA 2KATA 4EQFA 2L0TB 4LRZA 4UWLA 2KCVA 3RRUA 5AENA 3PDNA 3CVUA 2WXLA 4U0ZA 1Z3XA 4AEZC 3MA5A 3D9PA 1INZA 4N5CA 1ZBPA 4PS3A 4LEUA 3FEYA 4U63A 4LCTA 1DNPA 3ZRHA 2RG8A 3AU5A 1H2UA 3Q49B 4WNGA 4V3IA 3MX3A 3SHFA 3ZN3A 4ANXA 2XCBA 5JJTA 2VGYA 3L54A 3UUXA 4CT0A 4JA9A 3ESKA 2VSYA 3PUKA 3PS6A 2X6JA 3HHMA 3CHPA 4PS8A 1FVFA 4CDRA 4KVMA 2V4LA 5EDSA 4U0UA 4EBAA 4GU5A 2Y3AA 2ILRA 1DVPA 5FQ8A 2PZIA 5T4YA 3FUNA 3OXFA 4GMJA 3ZXSA 2WXMA 5E75A 2DBAA 2HO1A 2WXQA 3CR3A 3FFLA 3K9IA 1SZ9A 1HO8A 5JJ7A 2WXGA 4J6IA 3ASHA 1HG5A 3ZFWA 2XRZA 2X6IA 4ATGA 2WM9A 4JHJA 3MKRA 4PH4B 1E96B 4WNFA 2A4ZA 4A3VA 4TRQA 1H19A 1EPUA 2E2EA 3ZPJA 4G11A 4CDMA 4DLOA 2GW1A 1E7VA 3TL5A 4I9CA 4XX5A 4JC8A 4NURA 1Y8MA 4P29A 2XRYA 4WAFA 3L08A 5ARGA 1HE8A 5BW8C 3E4BA 4U8HA 5AJLA 3UQ3A 3ZYMA 1HX8A 2MHKA 4R7LA 3FU3A 2I9CA 4GZCA 5EX0A 4AIFA 3FUFA 4RVBA 3PREA 3ZW3A 1UG3A 2WQ6A 2LNIA 3CVLA 3EJNA 2V5FA 3P1UA 3VLEA 2VTBB 1UJKA 5DIZA 3EDTB 3CKCA 2X6KA 4JW1A 4EBAG 4Q69A 2PM6A 3D3MA 4I6EA 4F53A 3QWWA 3S7BA 4APOA 1YA0A 2XPIA 3IEGA 3PZDA 3MZLB 3FWVA 3I4RB 3CGHA 5CHEE 2WMOA 3JQ0A 4I2ZA 1EF1C 1JWGA 3CSTA 4HOTA 3LXUX 3D9KA 3VLDA 1P5QA 3L17A 4L1BA 4K03A 1H0AA 5FT9A 3EIJA 1E8YA 4DJAA 4GYWA 3OAWA 3U66A 3L16A 2PQNA 3NF1A 4HFGA 4GA1A 1XGWA 2FEZA 3B7UX 3IHYA 4WNDA 3FHEA 2OVBA 3WXXA 4APFA 5HQ8A 2PQRA 4FHJA 4HORA 4GCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J49 A;  2J4B A;  2NXP A; 
#chains in the Genus database with same CATH topology
 5BXO A;  2GRN B;  1BU9 A;  2OOE A;  3PUJ A;  4WWP A;  1HU3 A;  1S63 A;  3QDN A;  1RW2 A;  1OWN A;  3ULE G;  1N4R A;  4DI3 A;  4BY6 A;  4TXQ A;  3BEE A;  3FTX A;  4F7A A;  5AQ7 A;  4YDW A;  2WXH A;  3LPZ A;  2AJA A;  3EHN A;  3DBS A;  3UI2 A;  2WXK A;  5AQ9 A;  3SD5 A;  5CCM A;  3J5Q B;  5JHB A;  4HLE A;  4AM9 A;  1NA0 A;  2BTD A;  2KM4 A;  3LYA A;  1OCR E;  3JQ1 A;  2HM8 A;  3DSX A;  4XKC A;  1JCQ A;  4FC8 A;  1MX4 A;  5AN8 A;  5HI7 A;  2ZXW E;  3LKU A;  4GYY A;  3LJN A;  4FLB A;  4YND A;  3EUV A;  2CG2 A;  1IYG A;  1E8X A;  3ZU7 B;  4GTM A;  4LUN U;  2C2L A;  2MYO A;  3EU9 A;  3SI5 A;  1OCC E;  1TNU A;  3FUE A;  3ZVV A;  4UUC A;  1DCQ A;  2GRP B;  2LAI A;  1WAO 1;  4BSX A;  3AS4 A;  1NP7 A;  3RRM B;  4M3O A;  3FUD A;  2IOS A;  3PEV B;  2RFA A;  1N52 A;  1TNB A;  3JYS A;  1K8K G;  3CEQ A;  3TXM A;  3GZ1 A;  1N9A A;  4QQI A;  4BES A;  4KYO B;  1IXV A;  4KXK B;  2YQ8 A;  5D2M C;  2GRL A;  4J8Y A;  4DK5 A;  4DPR A;  1U3D A;  3TAX A;  2VGX A;  4L23 A;  2UY1 A;  4K5C A;  3TGO A;  4G1T A;  2CFU A;  5KJM A;  2WPV A;  3RRN B;  3DEP A;  3UMV A;  4U8Y D;  4XKB A;  4JEU A;  3CVQ A;  4WWN A;  2GGF A;  3CVN A;  4ABN A;  3CVX A;  3TXN A;  4BT8 A;  5B3S E;  3ASG A;  3QAQ A;  4N2Q A;  2I6H A;  3G2W A;  3C3Q A;  5LCW C;  5T3R A;  2WXP A;  1S0P A;  4U04 A;  2AWI A;  1MZC A;  3FTV A;  2VSN A;  3FTY A;  2Y69 E;  4GA0 A;  2F8X K;  4HOU A;  3SFX A;  2GRQ B;  4OVU A;  2P9U G;  3ZHE A;  4TV3 A;  4UWF A;  1H6O A;  2DZN A;  1OUV A;  4TUM A;  1DC2 A;  3Q75 A;  1K1B A;  2HYZ A;  2UY1 B;  3Q9N C;  4NQ0 A;  3LCA A;  4HI9 A;  5D0O D;  3ABL E;  1HXI A;  2IY0 C;  5JMN D;  4GPM A;  2BF0 X;  2Q7F A;  4LER A;  2R17 C;  2ZGD A;  1QZ2 A;  4URK A;  4LNG A;  4UQX A;  4K5B A;  1S70 B;  3EHQ A;  3DSW A;  2LSV A;  4N3B A;  2J49 A;  3TG5 A;  5J90 A;  5BV1 A;  2GRO B;  2C0L A;  3FUJ A;  4KZC A;  4UWK A;  3ZHE B;  4GA2 A;  4O1P A;  4FHK A;  4AVX A;  3J5P A;  4RG6 A;  3CHQ A;  3VTX A;  5FWQ A;  4G24 A;  4MRU A;  4NAC A;  5AAR A;  3SZ7 A;  5E76 A;  2I1K A;  1N0R A;  1QNF A;  3ASF A;  1YMP A;  1TR4 A;  4FU3 A;  2C0M A;  2IFU A;  3MKQ A;  1OCZ E;  3SF4 A;  3FUM A;  2RD0 A;  4GTQ A;  2XHE A;  3FP3 A;  1B89 A;  2LUH A;  2PM7 A;  5HRY A;  3FH7 A;  4HVB A;  2XEE A;  5FJY A;  3IV0 A;  1FT1 A;  4FAD A;  3UM0 A;  3GYZ A;  3QKY A;  1KLX A;  5EN5 D;  3RO2 A;  4A1G A;  2FO1 E;  4CGV A;  4BTB A;  4AY6 A;  3QNK A;  3AU4 A;  2V8S E;  3CLJ A;  5BT1 A;  3FTZ A;  3UM3 A;  2AXV A;  2WXF A;  3ZXP A;  3SO8 A;  5ENT D;  3CVW A;  3MGB A;  2VSX E;  4I43 A;  3LJ3 A;  1E8W A;  3APC A;  1V55 E;  1SZA A;  3TWW A;  3DPY A;  1PY1 A;  3ZYK A;  1ELK A;  3DPD A;  3MKQ B;  4U95 D;  4UWG A;  3RO3 A;  3HDX A;  3S2A A;  3BU8 A;  3PZ3 A;  5BNW A;  4Y6W A;  4HB5 A;  3ZUV B;  1SA5 A;  3B7B A;  4LRZ A;  4UWL A;  5AEN A;  2WXL A;  4U0Z A;  4N5C A;  3HG0 D;  3FEY A;  4U63 A;  4LCT A;  4BER A;  2RG8 A;  3Q49 B;  3TWT A;  4F1P A;  3ZN3 A;  2VGY A;  1LD8 A;  4DX6 D;  5EDS A;  4GU5 A;  5T4Y A;  3FUN A;  4GMJ A;  5IY5 E;  1O5M A;  2HO1 A;  4GTS A;  5JJ7 A;  1HG5 A;  3ZFW A;  2X6I A;  4A3V A;  4TRQ A;  3TL5 A;  4I9C A;  2XRY A;  4TXR A;  3L08 A;  5ARG A;  1HE8 A;  3Q9U C;  4U8H A;  4L9P A;  2OEV A;  1TNZ A;  2V5F A;  1UJK A;  5DIZ A;  4EBA G;  4I6E A;  2R03 A;  4ZFH A;  1YA0 A;  2XPI A;  3IEG A;  2P9L G;  5CHE E;  1JWG A;  3CST A;  1P5Q A;  3L17 A;  5FT9 A;  4K03 A;  1E8Y A;  3NF1 A;  1XGW A;  3WXX A;  4APF A;  2OVB A;  2PQR A;  4GCO A;  2LXL A;  1L5J A;  3BQO A;  3CKB A;  4K0R A;  3PVL A;  5JHA A;  1AWC B;  1AP7 A;  1N4S A;  3C3O A;  4ILH B;  3MV3 B;  3ZKJ A;  1OT8 A;  1NA3 A;  3KSL A;  3EHM A;  3CHR A;  2A5E A;  3UIN C;  1WM5 A;  2I1J A;  3C72 A;  4MLP A;  1E90 A;  1QQE A;  4GZD A;  2OCC E;  3PE3 A;  3TWR A;  1HFA A;  1E7U A;  5CER B;  2DIW A;  5ENR D;  3Q47 B;  2XGM A;  3HXD A;  2WXO A;  4ATZ D;  3V30 A;  5T8I A;  3ABK E;  4O1O A;  3P2B A;  1H6P A;  3CIA A;  3O4Z A;  4GML A;  2L0I A;  3ML8 A;  1HG2 A;  4TUU A;  2AW6 A;  4AXH A;  2X3M A;  2CG3 A;  3ONL A;  3I4G A;  4DRX E;  1NL4 A;  2P9P G;  3MEK A;  2P2C P;  2Y4T A;  5A6C A;  3D9M A;  3U64 A;  4G8L A;  4B0Z A;  2J9Q A;  2KZT A;  5EID A;  2VQ2 A;  3ML9 A;  3FH8 A;  3Q5M A;  3AG1 E;  5KCM A;  3QK0 A;  5BXU A;  1ELR A;  1BI7 B;  2FUL A;  2DVW A;  5AAO A;  3QWP A;  1LD7 A;  2XEV A;  2OEW A;  3ULQ A;  3Q4A B;  2XGS A;  3I5P A;  3MV2 B;  3D9J A;  1OWL A;  4RQI A;  3T5V A;  2BED A;  1VDY A;  3TWU A;  3D9N A;  3ZIM A;  3APF A;  3E37 A;  3FH5 A;  3LVR E;  2WQ7 A;  2P58 C;  3C5R A;  4O60 A;  3ASO E;  4KT6 B;  3S7D A;  4ACL A;  3CVY A;  2BUG A;  2FBN A;  3E30 A;  4PDX A;  4FP7 A;  3SQV A;  3FDH A;  2KZT B;  3T8K A;  3T5X A;  5C2Y A;  3B7S A;  4FJZ A;  3ESL A;  3LY7 A;  3GZS A;  4GYO A;  4BX9 A;  1LF8 A;  2WVI A;  1E8Z A;  1MX2 A;  4C0E A;  2EIL E;  4ME2 A;  2J4D A;  4U0S A;  3FU0 A;  3F6Q A;  1MYO A;  3NOG D;  3IBE A;  3R9A B;  2ZIR A;  4OAU C;  3U9W A;  4N2S A;  4JXT A;  2VTB A;  1UJJ A;  3S7J A;  4UI9 K;  4ANW A;  3TWS A;  4PUC A;  2OV8 A;  2IO3 C;  3T8M A;  1GW6 A;  4G23 A;  3FUI A;  1SW6 A;  3ISM C;  4BT9 A;  1EYH A;  3HRA A;  4CT4 A;  2B6C A;  4L2L A;  4YVQ C;  4A55 A;  1UOH A;  3L22 A;  3FTS A;  4AOF A;  4C9B B;  2FF4 A;  2LO6 A;  2YHE A;  2WXN A;  3B13 A;  5J08 A;  4Q96 A;  3G2T A;  3CHM A;  4GTT A;  2QYU A;  3Q78 A;  2P9K G;  4ACK A;  1HZ4 A;  3SFZ A;  1D9S A;  1BD8 A;  5D66 A;  4GZ3 A;  4J8D A;  3QAR A;  3CQC B;  4HRM B;  5CMY A;  5KJK A;  3G2V A;  2H6G A;  3D9O A;  3FEX A;  4QFV A;  4NRH B;  3QWV A;  1YCS B;  4Z68 A;  1PAQ A;  4JPS A;  3RIB A;  4RG9 A;  5ARF A;  2ZU6 B;  1ELW A;  1N0Q A;  4L2Y A;  5FZS A;  3X2Q E;  3VLF A;  5G04 J;  4XE0 A;  4YVO A;  2VGX B;  4KBQ A;  4WWO A;  3APD A;  1HH8 A;  3FTW A;  3AG2 E;  4I9E A;  3JCK C;  5BPP A;  4N3A A;  5A7D B;  3FUL A;  3MCX A;  4AJW A;  3DXK G;  3RRU A;  2HE0 A;  4HRL A;  3BUA A;  1H2U A;  4ANX A;  3UUX A;  2VSY A;  2X6J A;  1MJ0 A;  1FVF A;  4KVM A;  2V4L A;  5EYL A;  4U0U A;  4EBA A;  5FQ8 A;  2PZI A;  3OXF A;  4A63 B;  3ZXS A;  5E75 A;  1N95 A;  3K9I A;  4ATG A;  1E96 B;  2BKG A;  4DLO A;  4G11 A;  3E32 A;  3DEO A;  4XX5 A;  4DX5 D;  3UQ3 A;  4R7L A;  2P9I G;  5EX0 A;  4RVB A;  1ZB1 A;  1UG3 A;  3CVL A;  3EJN A;  3P1U A;  2H6F A;  3EDT B;  3CKC A;  2PM6 A;  4F53 A;  4HI8 A;  3T9K A;  3Q7A A;  3FWV A;  2WMO A;  4I2Z A;  3D9K A;  3VLD A;  3EIJ A;  4DJA A;  4GYW A;  4GTP A;  2PQN A;  4HFG A;  3B7U X;  3IHY A;  4WND A;  4YDY A;  4LG6 A;  4NIK A;  4FA6 A;  3QB2 A;  3G2U A;  1HF8 A;  3HVE A;  3CV0 A;  4IUL A;  3E33 A;  3HIZ A;  4H7Y A;  5EIL A;  2IF4 A;  5M72 A;  1X5B A;  3UPV A;  4JVS A;  5BUZ A;  3QC1 A;  1TEZ A;  4DX7 D;  5DBK A;  4UI9 J;  4JZY A;  1EDU A;  4G25 A;  4I1O B;  2J07 A;  4KVO A;  4DI4 A;  2YHC A;  2OND A;  2XZD G;  2Y4U A;  5BV0 A;  4HXI A;  2J4B A;  3LDZ A;  2A5U A;  4UQY A;  1DCE A;  4CDN A;  4OYS A;  5LP0 A;  3ZYL A;  2WXI A;  4JHR A;  1JUQ A;  4KMO A;  3DST A;  2ETB A;  3EIQ C;  3HVE B;  4F3V A;  4CGW A;  2P9S G;  4CCA A;  4UQZ A;  3CHO A;  2XPY A;  5KNH D;  2MRI A;  4ZHB A;  4HOS A;  1O1T A;  2GRM A;  4E85 A;  3ULY A;  5KBA A;  5G2N A;  1Z3Y A;  4FUL A;  2XPZ A;  2EIJ E;  3KS2 A;  2I2O A;  3DSS A;  1RZ4 A;  3R7Q A;  3GW4 A;  5AJD A;  4GTR A;  3B95 A;  3UT4 A;  2IO2 C;  2NC9 A;  3AJI A;  4AP2 A;  4ANU A;  1S64 A;  1D8D A;  3RK6 A;  3GZ2 A;  2WMN A;  2MOW A;  4LSZ E;  4L7T A;  2XGO A;  3SBS A;  1W3B A;  2KC7 A;  4X8Q A;  3W9G A;  3CK9 A;  1KPS B;  2L6B A;  3W9F A;  1UN8 A;  3PZ1 A;  3V79 K;  4ILI A;  4O6F A;  2J08 A;  4IRU A;  3FUH A;  2AXZ A;  3C3R A;  4JEH A;  3UKU G;  3UX4 A;  1N4P A;  2RKK A;  2VYI A;  3I3N A;  5FZR A;  1A17 A;  3UXG A;  2LSU A;  3DWL G;  3C98 A;  4F6R D;  1OY3 D;  5ENQ D;  3AS5 A;  3HXF A;  1BPO A;  4WUY A;  2IOL A;  2R2L A;  3CVP A;  1FT2 A;  1Z5S C;  5KNG A;  3FU5 A;  5A23 A;  3NZS A;  1A5E A;  1FCH A;  3NZU A;  5HKP A;  5G05 J;  4B8A A;  5CRU A;  5B1A E;  4BWR A;  2QY7 A;  4C0M A;  2R02 A;  3CHS A;  3ZGQ A;  4HNA D;  3CVV A;  3Q73 A;  5JA4 D;  3WG7 E;  2QFC A;  2DYR E;  4E6H A;  2P9N G;  2XCC A;  2HR2 A;  3ZNG A;  2Y1L E;  4BFR A;  5FIN A;  3SGH A;  2YIN A;  4XEI G;  2ION A;  3L13 A;  2LAH A;  3RAU A;  5CED B;  2X38 A;  2DCP A;  1JCR A;  4HQD A;  2KCK A;  3E34 A;  4A1S A;  1K1A A;  3PH0 C;  4DX2 A;  3UT7 A;  2IEJ A;  2XEN A;  2KCL A;  5HS0 A;  3B7R L;  4N5Q A;  2V5Q C;  3PNT B;  2PL2 A;  3U4T A;  4OAV B;  5CBN A;  4IYP A;  1YYH A;  2CHZ A;  3CSF A;  4ANV A;  2UWJ G;  5ENN A;  4JHK A;  1N54 A;  1KT1 A;  4HBD A;  4XI9 A;  4TXP A;  3UTM A;  3JXJ A;  4HRN A;  2NYJ A;  2F0Y A;  3IKO B;  3PE4 A;  4CEM A;  4J7W A;  4J8S A;  5AIJ A;  5AQB A;  2XQ0 A;  1O1S A;  2DWZ A;  1IQR A;  4GPK A;  4DUI A;  1UW4 B;  3O48 A;  4FJY A;  3TWX A;  4EZK A;  1OWP A;  5ANR A;  4MKT A;  1N11 A;  2CFZ A;  5LOZ A;  1OWM A;  5FIO A;  2WB2 A;  3EHR A;  1FVH A;  3G2S A;  4I17 A;  4GZ5 A;  2QC9 A;  4GMR A;  3RSE G;  1TN8 A;  2X6H A;  2VSO E;  2V4H C;  3D9I A;  5G04 C;  5FTP A;  4JD2 G;  1N4Q A;  2IU1 A;  5FQ7 A;  3MJW A;  4U96 D;  3CK8 A;  2KAT A;  2F8Y A;  4EQF A;  3UIP C;  3PDN A;  3CVU A;  4YDE A;  3MA5 A;  3D9P A;  1INZ A;  1ZBP A;  4PS3 A;  4LEU A;  3NB2 A;  4BEP A;  4V3I A;  3SHF A;  3AG4 E;  3L54 A;  4JA9 A;  3ESK A;  3PUK A;  1NFI E;  4CDR A;  3ABM E;  2JAB A;  2B0O E;  2Y3A A;  4BET A;  2ILR A;  1IKN D;  2WXM A;  2ZGG A;  2WXQ A;  3CR3 A;  1SZ9 A;  1HO8 A;  3NAW A;  2WXG A;  3MKR A;  4PH4 B;  4WNF A;  2A4Z A;  3Q7F A;  1KZO A;  3ZPJ A;  1EPU A;  4NUR A;  3HXC A;  4P29 A;  2BKK B;  4MBG A;  3ZYM A;  2GRR B;  3FU3 A;  4AIF A;  3FUF A;  3PRE A;  2VTB B;  2LNI A;  4Q69 A;  3D3M A;  3QWW A;  4APO A;  3PZD A;  3I4R B;  3CGH A;  4HOT A;  3LXU X;  2XS8 A;  1H0A A;  2F37 A;  3OAW A;  3U66 A;  3FHE A;  5HQ8 A;  4FHJ A;  4HOR A;  2KBX A;  3IHV A;  2NXP A;  4C48 B;  5B1B E;  2L6J A;  3ONK A;  1QYM A;  2IQC A;  3UT8 A;  4A3T A;  3V31 A;  5JJ6 A;  1TJC A;  3DSU A;  3ENE A;  1V54 E;  2OVF A;  4OVV A;  2JLB A;  1BLX B;  3TJP A;  1X81 A;  5KJL A;  1G3N B;  4RLY A;  3BG0 B;  5D0Q D;  2EIM E;  5AQA A;  3FTU A;  3QOU A;  1WDY A;  2XEH A;  5C1D A;  2KXP C;  4JA7 A;  1Q2Z A;  4GB9 A;  1O1R A;  2EIK E;  4UI9 C;  3D9H A;  4G8K A;  2R05 A;  2ETC A;  4HLL A;  2CHW A;  4EZL A;  1Z6T A;  3KD7 A;  1QBQ A;  4B93 B;  3HYM B;  4J8E A;  2AVP A;  4Q94 A;  1SA4 A;  3AS8 A;  3OXL A;  1JWF A;  4BTA A;  4PS7 A;  1WG0 A;  3DSV A;  4FLH A;  3DXM G;  5ANL A;  3OTN A;  2CHX A;  4J8F A;  3QJZ A;  3TWQ A;  3JUI A;  3Q15 A;  3SFY A;  2LXM A;  4Y6C A;  4I2W A;  1JPL A;  3AAA C;  4HOQ A;  4GAA A;  2WXJ A;  3EU5 A;  2J8S D;  1SVX A;  2X6F A;  4RSY A;  4XIF A;  1MHQ A;  3JXI A;  5ENP D;  2FI7 A;  3KEZ A;  2IJG X;  4I1M A;  4BSZ B;  5CCL A;  5CRV A;  5AYW D;  2L9B A;  3JUE A;  4I1A A;  4J0U A;  1MX6 A;  5H7P A;  4CRW A;  3URZ A;  4B89 A;  1TN6 A;  2QYJ A;  5CEC B;  5FQ6 A;  3D9L A;  3LY8 A;  1XNF A;  1K3Z D;  5CBO A;  1H2T C;  5EX3 A;  1TNY A;  2R5S A;  4G26 A;  3LS8 A;  4I6J A;  1JCS A;  4I6G A;  3NOC D;  5LCW J;  4WNE A;  3PZ4 A;  4GCN A;  3ZYQ A;  3PRZ A;  4B8C B;  2Y0B G;  2WXR A;  3CQG B;  1NZN A;  3SNX A;  4N39 A;  1FPP A;  4GZ6 A;  3FUK A;  2XZT G;  2VJ8 A;  2XS1 A;  3FY4 A;  1D8E A;  2E0I A;  1SQM A;  3CK7 A;  1TYQ G;  2J09 A;  3L82 A;  5EYP F;  3RKV A;  3Q79 A;  4EZJ A;  4B94 A;  5G05 C;  3VTY A;  1TJF A;  1HS6 A;  3R9M A;  4IN3 B;  4AV7 A;  2AXU A;  2YNQ A;  3BG1 B;  3B7T A;  5FQ4 A;  4ILG A;  4AY5 A;  3S7F A;  1NI1 A;  4GTO A;  3TWV A;  2M63 A;  4EPZ A;  2RFM A;  2EQX A;  5KJN A;  3PZ2 A;  4DLQ A;  1Y6I A;  3UIO C;  2H6H A;  2QZA A;  1U3C A;  1LTX A;  2DZO A;  3LEW A;  5LX8 A;  1IQU A;  4LNU D;  1N94 A;  3LVQ E;  2H6I A;  3HXE A;  3LY9 A;  3V2O A;  4D10 C;  1IHG A;  5G55 A;  2R59 A;  3KAE A;  3RJV A;  1U2V G;  1MQS A;  2FO7 A;  3NQP A;  4KZ0 A;  1KT0 A;  3L6A A;  3MYV A;  3UKR G;  4F1S A;  3U3W A;  3KEA A;  4U07 A;  3FU6 A;  4XZ4 A;  2ZIS A;  4UWH A;  4W9R A;  4G2V A;  2WQH A;  4EHM A;  5EIB E;  3N71 A;  4XI0 A;  3SBT B;  5CMW A;  3R7R A;  4BX8 A;  1OWO A;  3PNL B;  1UN9 A;  5EKQ D;  5ITZ F;  3NBN B;  3OXG A;  5FZQ A;  1WY6 A;  3PEU B;  3AG3 E;  1ZU2 A;  2NSZ A;  4MS6 A;  2PNN A;  1H2V C;  3TG4 A;  1OXJ A;  3KSQ A;  4M7C A;  2V0P A;  4H7X A;  3UM1 A;  5CEA A;  1PC2 A;  1H6K A;  2JEK A;  3V2X A;  4CZ2 D;  4LNB A;  5LFA A;  4EEC A;  3RU0 A;  4HS2 A;  4DX1 A;  5KWD A;  3ZEF A;  5ENO D;  4GTV A;  4N3C A;  4JL0 A;  3ASD A;  4CYM D;  2L0T B;  1TNO A;  2KCV A;  1Z3X A;  3SY2 A;  4AEZ C;  4U7E B;  4YDO A;  1DNP A;  3ZRH A;  3AU5 A;  3ASN E;  4WNG A;  3MX3 A;  3IXE A;  2XCB A;  5JJT A;  4CT0 A;  3PS6 A;  3HHM A;  3CHP A;  4PS8 A;  1KZP A;  5ENS D;  1DVP A;  3L9T A;  2DBA A;  3FFL A;  4J6I A;  2ETA A;  3ASH A;  2XRZ A;  1IHB A;  2WM9 A;  4JHJ A;  1BI8 B;  1H19 A;  2E2E A;  4CDM A;  2GW1 A;  1E7V A;  4JC8 A;  1Y8M A;  4WAF A;  5BW8 C;  3E4B A;  5AJL A;  3UM2 A;  1HX8 A;  2MHK A;  2I9C A;  3HXB A;  4GZC A;  2EIN E;  3ZW3 A;  2WQ6 A;  3VLE A;  2X6K A;  4JW1 A;  4U8V D;  3S7B A;  2DYS E;  1OCO E;  3DRA A;  3MZL B;  3JQ0 A;  1EF1 C;  4L1B A;  1TN7 A;  3L16 A;  4GA1 A;  4K5A B;  2FEZ A;  2VGE A;  4JB8 P; 
#chains in the Genus database with same CATH homology
 3IHV A;  4FA6 A;  2NXP A;  2OOE A;  3QB2 A;  1L5J A;  2L6J A;  3CKB A;  3G2U A;  3ONK A;  3PUJ A;  1HF8 A;  1HU3 A;  2IQC A;  3HVE A;  4WWP A;  3CV0 A;  4K0R A;  3UT8 A;  4IUL A;  4A3T A;  5JJ6 A;  1TJC A;  3HIZ A;  3PVL A;  4H7Y A;  5JHA A;  3ENE A;  2OVF A;  3QDN A;  1OWN A;  4OVV A;  2JLB A;  4DI3 A;  3TJP A;  4BY6 A;  5KJL A;  3BEE A;  2IF4 A;  3FTX A;  4F7A A;  4ILH B;  3BG0 B;  3MV3 B;  5D0Q D;  5M72 A;  1X5B A;  2WXH A;  3FTU A;  3UPV A;  3LPZ A;  4JVS A;  1NA3 A;  3EHN A;  3QOU A;  3DBS A;  5BUZ A;  2WXK A;  5CCM A;  3SD5 A;  3QC1 A;  3EHM A;  5C1D A;  3CHR A;  4JA7 A;  5JHB A;  1TEZ A;  5DBK A;  4UI9 J;  4JZY A;  1EDU A;  4HLE A;  1WM5 A;  4GB9 A;  4AM9 A;  1NA0 A;  2BTD A;  2I1J A;  2KM4 A;  3LYA A;  4G25 A;  3JQ1 A;  2HM8 A;  4I1O B;  2J07 A;  1E90 A;  1QQE A;  4GZD A;  4KVO A;  4MLP A;  4UI9 C;  4DI4 A;  3PE3 A;  4XKC A;  1HFA A;  4FC8 A;  1E7U A;  2YHC A;  2OND A;  5HI7 A;  2DIW A;  2Y4U A;  3LKU A;  3Q47 B;  4GYY A;  2CHW A;  2XGM A;  5BV0 A;  4HXI A;  2J4B A;  4EZL A;  3LDZ A;  4FLB A;  2A5U A;  4UQY A;  2WXO A;  4YND A;  1Z6T A;  4CDN A;  3KD7 A;  5T8I A;  2CG2 A;  4OYS A;  5LP0 A;  1IYG A;  3HYM B;  3ZYL A;  2WXI A;  4JHR A;  4J8E A;  1JUQ A;  3P2B A;  1E8X A;  3CIA A;  4KMO A;  2AVP A;  4Q94 A;  4LUN U;  3O4Z A;  2C2L A;  3EIQ C;  3AS8 A;  3HVE B;  3OXL A;  4GML A;  2L0I A;  1JWF A;  3ML8 A;  1HG2 A;  3SI5 A;  4TUU A;  3FUE A;  2AW6 A;  4AXH A;  3ZVV A;  4BTA A;  4F3V A;  4CGW A;  2X3M A;  4CCA A;  4PS7 A;  2CG3 A;  3ONL A;  3CHO A;  2XPY A;  2LAI A;  2MRI A;  3I4G A;  1WAO 1;  3MEK A;  4UQZ A;  4HOS A;  2Y4T A;  4FLH A;  5ANL A;  3AS4 A;  4BSX A;  1NP7 A;  3RRM B;  5A6C A;  3D9M A;  2GRM A;  4M3O A;  3OTN A;  4E85 A;  2CHX A;  2IOS A;  3FUD A;  4J8F A;  3U64 A;  5G2N A;  3QJZ A;  1Z3Y A;  4FUL A;  2XPZ A;  3PEV B;  3KS2 A;  2I2O A;  3R7Q A;  4B0Z A;  1N52 A;  3JYS A;  2J9Q A;  2KZT A;  3JUI A;  2VQ2 A;  3CEQ A;  3GW4 A;  3ML9 A;  3Q15 A;  5AJD A;  3FH8 A;  3TXM A;  3Q5M A;  4Y6C A;  3GZ1 A;  4I2W A;  1JPL A;  5KCM A;  3UT4 A;  2NC9 A;  3QK0 A;  4HOQ A;  4GAA A;  2WXJ A;  4AP2 A;  1ELR A;  4KYO B;  4ANU A;  3RK6 A;  2X6F A;  3GZ2 A;  2WMN A;  2FUL A;  2MOW A;  4KXK B;  3QWP A;  2YQ8 A;  4L7T A;  4RSY A;  2XGO A;  4XIF A;  3SBS A;  1MHQ A;  2GRL A;  2XEV A;  3ULQ A;  3Q4A B;  4DK5 A;  4DPR A;  2FI7 A;  3KEZ A;  1W3B A;  2IJG X;  4I1M A;  2KC7 A;  1U3D A;  2XGS A;  3TAX A;  2VGX A;  5CCL A;  3I5P A;  3MV2 B;  2L9B A;  5AYW D;  4L23 A;  4I1A A;  4J0U A;  3D9J A;  1OWL A;  4CRW A;  3CK9 A;  3URZ A;  2UY1 A;  4B89 A;  1UN8 A;  3T5V A;  1VDY A;  3TGO A;  4G1T A;  5FQ6 A;  3D9L A;  3D9N A;  3ZIM A;  2CFU A;  3APF A;  5KJM A;  3LY8 A;  1XNF A;  3FH5 A;  4ILI A;  4O6F A;  2WPV A;  3LVR E;  2J08 A;  3RRN B;  4IRU A;  3UMV A;  3FUH A;  2AXZ A;  2WQ7 A;  4JEH A;  4XKB A;  3UX4 A;  1H2T C;  4JEU A;  2P58 C;  3CVQ A;  4WWN A;  5EX3 A;  2R5S A;  2GGF A;  3CVN A;  4G26 A;  4ABN A;  3LS8 A;  4I6J A;  4I6G A;  2VYI A;  3I3N A;  3CVX A;  4KT6 B;  3S7D A;  5FZR A;  1A17 A;  4ACL A;  2LSU A;  3TXN A;  4BT8 A;  5LCW J;  3CVY A;  2BUG A;  2FBN A;  3ASG A;  3C98 A;  4GCN A;  3QAQ A;  4FP7 A;  4PDX A;  4WNE A;  3FDH A;  2KZT B;  3ZYQ A;  4N2Q A;  2I6H A;  3PRZ A;  4B8C B;  3G2W A;  3AS5 A;  5LCW C;  5T3R A;  2WXP A;  3T5X A;  2WXR A;  1S0P A;  3CQG B;  2AWI A;  4U04 A;  5C2Y A;  1NZN A;  3B7S A;  3SNX A;  1BPO A;  3FTV A;  4WUY A;  2IOL A;  2VSN A;  4FJZ A;  4N39 A;  3CVP A;  4GZ6 A;  3FTY A;  4GA0 A;  3ESL A;  3FUK A;  4HOU A;  3LY7 A;  3FU5 A;  3GZS A;  2VJ8 A;  5A23 A;  4OVU A;  3FY4 A;  2E0I A;  3ZHE A;  4GYO A;  1SQM A;  4TV3 A;  3NZS A;  3CK7 A;  1LF8 A;  2WVI A;  1FCH A;  4UWF A;  4BX9 A;  3NZU A;  1E8Z A;  2J09 A;  5G05 J;  1OUV A;  4B8A A;  3RKV A;  4C0E A;  4BWR A;  4EZJ A;  2QY7 A;  4ME2 A;  2J4D A;  4C0M A;  2HYZ A;  3CHS A;  2UY1 B;  4U0S A;  4B94 A;  5G05 C;  3FU0 A;  3IBE A;  3R9A B;  3VTY A;  1TJF A;  3ZGQ A;  3CVV A;  4NQ0 A;  1HS6 A;  3LCA A;  5D0O D;  4IN3 B;  2QFC A;  3U9W A;  4AV7 A;  4E6H A;  2AXU A;  4N2S A;  2XCC A;  2YNQ A;  4JXT A;  2HR2 A;  1HXI A;  4BFR A;  3BG1 B;  3SGH A;  2YIN A;  3B7T A;  5FQ4 A;  4ILG A;  2VTB A;  2BF0 X;  1UJJ A;  2Q7F A;  2ION A;  4LER A;  4AY5 A;  2R17 C;  3L13 A;  2LAH A;  3S7J A;  1QZ2 A;  3S7F A;  4UI9 K;  2X38 A;  4ANW A;  2DCP A;  4URK A;  4UQX A;  4PUC A;  2OV8 A;  2KCK A;  2LSV A;  2M63 A;  4N3B A;  4A1S A;  2J49 A;  3TG5 A;  5J90 A;  4EPZ A;  3T8M A;  3PH0 C;  5BV1 A;  1GW6 A;  3UT7 A;  4G23 A;  2C0L A;  3FUJ A;  2KCL A;  2EQX A;  3FUI A;  4KZC A;  5KJN A;  4BT9 A;  3B7R L;  1EYH A;  4DLQ A;  4CT4 A;  1Y6I A;  4UWK A;  3ZHE B;  4L2L A;  4GA2 A;  4YVQ C;  4A55 A;  4FHK A;  1U3C A;  4AVX A;  3PNT B;  2PL2 A;  3L22 A;  3FTS A;  4RG6 A;  4AOF A;  3CHQ A;  3U4T A;  4C9B B;  3VTX A;  3LEW A;  5LX8 A;  1IQU A;  2FF4 A;  5FWQ A;  2LO6 A;  2YHE A;  4G24 A;  4MRU A;  4NAC A;  4IYP A;  3SZ7 A;  2WXN A;  3LVQ E;  5E76 A;  2CHZ A;  2I1K A;  3CSF A;  4ANV A;  2UWJ G;  3LY9 A;  3B13 A;  5ENN A;  5J08 A;  4D10 C;  1IHG A;  4JHK A;  4Q96 A;  1N54 A;  2R59 A;  3KAE A;  5G55 A;  3RJV A;  1QNF A;  1KT1 A;  3ASF A;  1MQS A;  4FU3 A;  2C0M A;  2IFU A;  3G2T A;  3CHM A;  4XI9 A;  3MKQ A;  3SF4 A;  2FO7 A;  3FUM A;  3NQP A;  4ACK A;  1HZ4 A;  2RD0 A;  4KZ0 A;  3SFZ A;  2XHE A;  1KT0 A;  3FP3 A;  1B89 A;  3L6A A;  3MYV A;  4GZ3 A;  4F1S A;  3U3W A;  4J8D A;  3QAR A;  4U07 A;  2PM7 A;  3CQC B;  3FU6 A;  3IKO B;  3PE4 A;  4XZ4 A;  5CMY A;  4CEM A;  4UWH A;  4J8S A;  3FH7 A;  5AIJ A;  4W9R A;  4HVB A;  4G2V A;  5KJK A;  2WQH A;  3G2V A;  2XQ0 A;  3N71 A;  4XI0 A;  3SBT B;  5CMW A;  1IQR A;  5FJY A;  3R7R A;  3IV0 A;  3D9O A;  1OWO A;  4BX8 A;  3PNL B;  4FAD A;  1UN9 A;  4GPK A;  3FEX A;  4QFV A;  3GYZ A;  3QKY A;  4NRH B;  1KLX A;  1UW4 B;  3O48 A;  4A1G A;  4FJY A;  5EKQ D;  3RO2 A;  3QWV A;  4EZK A;  1OWP A;  3OXG A;  4CGV A;  5ANR A;  1PAQ A;  4MKT A;  5FZQ A;  4BTB A;  1WY6 A;  4JPS A;  3RIB A;  2CFZ A;  3PEU B;  4AY6 A;  3QNK A;  3AU4 A;  1ZU2 A;  5LOZ A;  2V8S E;  3CLJ A;  5BT1 A;  3FTZ A;  1OWM A;  2NSZ A;  2AXV A;  4MS6 A;  4RG9 A;  2WB2 A;  1H2V C;  2WXF A;  5ARF A;  3TG4 A;  1FVH A;  2ZU6 B;  3CVW A;  3G2S A;  1ELW A;  3MGB A;  2VSX E;  4L2Y A;  4I17 A;  4I43 A;  3LJ3 A;  5FZS A;  4GZ5 A;  1E8W A;  3APC A;  5G04 J;  3VLF A;  4XE0 A;  4YVO A;  1SZA A;  2VGX B;  4KBQ A;  2X6H A;  4WWO A;  2V0P A;  1PY1 A;  4H7X A;  2VSO E;  3ZYK A;  3APD A;  1ELK A;  3DPD A;  1PC2 A;  3MKQ B;  1HH8 A;  1H6K A;  3D9I A;  5G04 C;  2JEK A;  3FTW A;  5FTP A;  4I9E A;  5LFA A;  4EEC A;  4UWG A;  3RO3 A;  3RU0 A;  4HS2 A;  3HDX A;  3JCK C;  3S2A A;  5BPP A;  3ZEF A;  4N3A A;  2IU1 A;  5FQ7 A;  5A7D B;  3FUL A;  3MJW A;  5BNW A;  3MCX A;  4Y6W A;  4N3C A;  3CK8 A;  4JL0 A;  4AJW A;  3ASD A;  2KAT A;  4EQF A;  2L0T B;  4LRZ A;  4UWL A;  2KCV A;  3RRU A;  5AEN A;  3PDN A;  3CVU A;  2WXL A;  4U0Z A;  1Z3X A;  4AEZ C;  3MA5 A;  3D9P A;  1INZ A;  4N5C A;  1ZBP A;  4PS3 A;  4LEU A;  3FEY A;  4U63 A;  4LCT A;  1DNP A;  3ZRH A;  2RG8 A;  3AU5 A;  1H2U A;  3Q49 B;  4WNG A;  4V3I A;  3MX3 A;  3SHF A;  3ZN3 A;  4ANX A;  2XCB A;  5JJT A;  2VGY A;  3L54 A;  3UUX A;  4CT0 A;  4JA9 A;  3ESK A;  2VSY A;  3PUK A;  3PS6 A;  2X6J A;  3HHM A;  3CHP A;  4PS8 A;  1FVF A;  4CDR A;  4KVM A;  2V4L A;  5EDS A;  4U0U A;  4EBA A;  4GU5 A;  2Y3A A;  2ILR A;  1DVP A;  5FQ8 A;  2PZI A;  5T4Y A;  3FUN A;  3OXF A;  4GMJ A;  3ZXS A;  2WXM A;  5E75 A;  2DBA A;  2HO1 A;  2WXQ A;  3CR3 A;  3FFL A;  3K9I A;  1SZ9 A;  1HO8 A;  5JJ7 A;  2WXG A;  4J6I A;  3ASH A;  1HG5 A;  3ZFW A;  2XRZ A;  2X6I A;  4ATG A;  2WM9 A;  4JHJ A;  3MKR A;  4PH4 B;  1E96 B;  4WNF A;  2A4Z A;  4A3V A;  4TRQ A;  1H19 A;  1EPU A;  2E2E A;  3ZPJ A;  4G11 A;  4CDM A;  4DLO A;  2GW1 A;  1E7V A;  3TL5 A;  4I9C A;  4XX5 A;  4JC8 A;  4NUR A;  1Y8M A;  4P29 A;  2XRY A;  4WAF A;  3L08 A;  5ARG A;  1HE8 A;  5BW8 C;  3E4B A;  4U8H A;  5AJL A;  3UQ3 A;  3ZYM A;  1HX8 A;  2MHK A;  4R7L A;  3FU3 A;  2I9C A;  4GZC A;  5EX0 A;  4AIF A;  3FUF A;  4RVB A;  3PRE A;  3ZW3 A;  1UG3 A;  2WQ6 A;  2LNI A;  3CVL A;  3EJN A;  2V5F A;  3P1U A;  3VLE A;  2VTB B;  1UJK A;  5DIZ A;  3EDT B;  3CKC A;  2X6K A;  4JW1 A;  4EBA G;  4Q69 A;  2PM6 A;  3D3M A;  4I6E A;  4F53 A;  3QWW A;  3S7B A;  4APO A;  1YA0 A;  2XPI A;  3IEG A;  3PZD A;  3MZL B;  3FWV A;  3I4R B;  3CGH A;  5CHE E;  2WMO A;  3JQ0 A;  4I2Z A;  1EF1 C;  1JWG A;  3CST A;  4HOT A;  3LXU X;  3D9K A;  3VLD A;  1P5Q A;  3L17 A;  4L1B A;  4K03 A;  1H0A A;  5FT9 A;  3EIJ A;  1E8Y A;  4DJA A;  4GYW A;  3OAW A;  3U66 A;  3L16 A;  2PQN A;  3NF1 A;  4HFG A;  4GA1 A;  1XGW A;  2FEZ A;  3B7U X;  3IHY A;  4WND A;  3FHE A;  2OVB A;  3WXX A;  4APF A;  5HQ8 A;  2PQR A;  4FHJ A;  4HOR A;  4GCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...